1ZLYA

The structure of human glycinamide ribonucleotide transformylase in complex with alpha,beta-n-(hydroxyacetyl)-d-ribofuranosylamine and 10-formyl-5,8,dideazafolate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide formyltransferase
publication title The apo and ternary complex structures of a chemotherapeutic target: human glycinamide ribonucleotide transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zlyA00
1RC1A 3TQRA 1ZGHA 1S3IA 1C2TA 4TTSA 4ZYUA 4QPCA 4EW2A 4ZYYA 2BW0A 1MENA 3GARA 3R8XA 4EW1A 4TS4A 3KCQA 3P9XA 1JKXA 1FMTA 3AUFA 4ZYZA 1ZLYA 4Q12A 1RC0A 3DCJA 3N0VA 1RBZA 4YFYA 5J63A 1GRCA 1C3EA 3W7BA 1RBQA 2GARA 2YWRA 4ZZ2A 4ZYXA 1YRWA 3LOUA 5J9FA 4TT8A 3AV3A 4YFVA 4PZUA 4DS3A 1MEJA 1MEOA 2FMTA 1GARA 4QPDA 4ZZ3A 3OBIA 1ZLXA 3O1LA 2BLNA 5CJJA 4ZYTA 4NV1A 4EW3A 4ZYWA 1RBYA 1NJSA 4ZZ0A 4S1NA 2CFIA 3TQQA 4ZZ1A 4ZYVA 3Q0IA 4R8VA 4IQFA 3DA8A 1CDDA 1CDEA 1RBMA 3NRBA
chains in the Genus database with same CATH superfamily
4WI1A 2AN1A 3MLAA 3MOIA 3EGDA 3AEYA 1M1YE 4NX2A 5IKOA 5C46F 3HXOA 4EGCB 1EFTA 3BWXA 3W8DA 4MQFB 2W2OA 4NYMR 5BN5A 2GBFA 3Q85A 1XTKA 5EMNA 1J9EA 3VMMA 1M0EA 4IDCA 2GPAA 3GCZA 2G5CA 2Q4DA 2Y0EA 3I9NA 3RF7A 2XMBA 1PW5A 2EVWX 2HSDA 2NQ2C 4QWWA 2CUKA 4AU1A 2NACA 3R7DA 1JKMA 2GYUA 5ITVA 1DEAA 1G6HA 3M49A 1V1MB 2C4VA 4H17A 4RS4A 4JB3A 4S05A 4A15A 4ND8B 4DCSA 1F12A 1T1SA 3O4JA 3WRVA 5L3RA 3FZQA 1Q83A 2X2OA 1Q74A 4WADA 1QTIA 1E3DA 1R0SA 4NQZA 1T3SA 1C9NA 1E9BA 3K1YA 5EE9A 3T52A 3NGLA 3CLTC 5LC1A 1JVSA 3QXHA 3KB6A 4QGBA 5BSFA 1T9ZA 1E20A 4NZZA 3PE3A 2XYGA 1PYOA 4EZBA 1RWPA 5FLEX 1IEXA 1B1AA 4JJ8A 2OCLA 3BWBA 1TO6A 1XMOB 3KWMA 4R6XA 5TJHA 4JOSA 1HL3A 3GFSA 5JY6A 1QTRA 3FMFA 4CMIB 4EF5A 5J4LA 2HREA 2VPYA 2BMAA 3HB4X 4QLAA 5LWQA 2VTBA 3WA6A 1LRJA 3CUEF 4UNPA 3WL7A 4MV9A 4N65A 3I9KA 3TZ6A 3QMWA 2HMTA 1WHSB 3OF3A 3LHDA 4G86A 4IV8A 3ZHZA 1TMOA 3A6PC 5FORA 4MPTA 2J0EA 4CM9A 4P86A 1ORRA 2QIOA 2ZJ5A 1MEOA 1SURA 1MW9X 5HFAA 3K70C 3N5CA 1ZGBA 3R0JA 3ZQ6A 4Q3CA 1AKYA 5FWYA 1LRLA 4NOJA 3DMNA 4H7FA 2GSDA 3JVEA 4XM1A 3TTYA 4DMLA 4DL9A 5AUOB 3ZYZA 2CBZA 4ZI3A 2H51A 3H19A 3I2YX 1J4AA 4OK6A 4G8DA 4K88A 4ZAVA 1O57A 2QIPA 1KDZA 2NVOA 2Z6VA 1WXXA 5B2FA 4WX2B 4DJEC 4PX9A 3WHLA 2FN4A 2NXJA 3EIFA 1Z28A 5DSTA 4ZICA 2X41A 4WNYA 5TEWA 1VKRA 1HE2A 3ROGA 2ZG6A 4FILA 2XNHA 3AYXB 3MM4A 3W5JA 2FW6A 1YFKA 1ZU4A 1X13A 5AM5A 1HXHA 4JVNA 1YHZA 3WP0A 3ZJTA 2YX1A 2XA1A 3K72B 3JASA 5LMUB 3VHLB 1BJTA 4EQ6A 3TCXB 3AU8A 2ON6A 4O2AF 1BA2A 1T35A 1Y3AA 2QRPA 3NRJA 4DUZB 3BDAA 4F4DA 4MWBA 5COQA 3F73A 5JDCC 1MD9A 4RK4A 3UT0A 3X1MA 1I10A 1VIMA 1KIMA 1S89A 3RFFA 1S1MA 2YN4A 3WE7A 5KJ1A 1SEPA 5IK2A 3AJRA 5A02A 2V5UA 1EK6A 1MAAA 1W4BA 4NPAA 5ALUA 5E6RA 2Z2YA 1X9IA 1JMYA 1J90A 3MWLA 3RRZA 1CDEA 4LWPA 2PU7A 4D4JA 4PZPA 1U2ZA 3KL4A 2QAIA 1WE2A 2ANBA 1GU7A 2NAPA 4HLCA 2ZVJA 3SS7X 2WWFA 3KIPA 4HAIA 5JMWA 4WXEA 1SXJD 4DXHA 4BATA 1RP7A 4KPEC 4QUHA 1P0PA 3SHVA 2VO1A 5EL0A 9MHTA 2JCYA 3KPWA 2GN1A 2B9VA 4QFCA 4US1R 3WLEA 4IIFA 1C1HA 4B5KA 1VL0A 2EWVA 3V1KA 5AVXA 3DE1X 3F8WA 3WGHA 1SG9A 3V7UA 3IULA 5EMKA 1G42A 1VE1A 4QPCA 3ITNA 2YIMA 5DRTA 1C1DB 1YL5A 5JFOA 2CFCA 2WDPA 1LB1B 2F17A 3BVPA 3CLRD 1R9JA 2GGSA 4EW1A 4ZYYA 2IPXA 2V5VA 3FPJA 1E69A 3VPSA 1ELOA 3ZHQA 1JIQA 1ZK1A 3S1LA 4HYTA 5A1TA 3E6AA 3MF4A 2BGJA 1HC7A 3WLJA 2PBZA 3WLQA 3ZV3A 1P2UA 5I8PA 5ISMA 1H2EA 4NCHA 1NX9A 1W2WB 2NYRA 2IPNA 2XPCA 2WZDA 3V8QA 5F9FA 2JGAA 1K6XA 4YJGA 2F8TA 2JIMA 5C0OE 2QORA 3UFXB 4D8TA 4PQEA 3OETA 4IHQA 3Q0EA 2HFJA 5CTJA 1O4WA 2P6MA 3MCZA 3TIXB 1AIPA 1LWNA 4ZZ2A 1D1QA 1UWKA 3RV4A 1LRKA 6CHYA 4UBOA 1S2GA 2IZOA 3VC3A 4C43A 3Q7EA 3JATB 3ZX5A 2QRHA 2P68A 4PWZA 1T4CA 2PKRA 3QKRA 3RQIA 3SG0A 2I29A 4B79A 1YJCA 4HAVA 4OUKX 3U3JA 3DVSX 5EMHA 1OXTA 3R3JA 3KQLA 1ZBQA 1ZKDA 2B21A 3P4XA 3SXUB 3VOAA 4B43A 1ICIA 1HZZC 2R7NA 3I53A 3U7FB 1HYHA 1DV1A 1NXSA 3MCWA 2C31A 1L7BA 1YDFA 3M5WA 1CETA 2IP2A 3QKWA 4LSMA 2WU3A 4PLHA 5A3QA 5F2EA 3P9SA 4P32A 3CTPA 1KBOA 4I2VA 3T5TA 4FFRA 4H7KA 3GLRA 3PFGA 3T7CA 1DGQA 3KSDO 1JNXX 1Z3IX 4CHGA 4KP7A 4LKOA 2WC1A 2IU4A 4O2BF 4ZJPA 5HHTA 1J22A 1H3EA 1GTVA 3BB3A 1XVLA 4MYRA 3LKZA 3VYWA 3OC0A 1F4VA 1PWXA 2E9SA 4FUQA 4DC9A 1TMYA 3OX4A 3DNMA 3HEMA 3J7TA 1ZJWA 2EZ8A 2AR9A 3NBKA 3NIFB 4RMJA 4RLSA 4XIGS 5ALVA 5I7FA 4HEA1 1NBMD 5AM1A 4E1AA 4AG5A 1QH1A 4C05A 4FWTA 2Q6LA 2GEJA 2G82A 3G9ZA 5C4GB 4NBUA 2Q6VA 3S2EA 4DR1B 3O0TA 3FUVA 4Y2VA 4U9UA 4M3NA 5JC1A 1D2NA 2QAJA 4XR4A 3E35A 3G0CA 1CG6A 3QOWA 3LLSA 4Q0MA 5E1BA 4LGMA 5K0FA 4TL7A 1RWOA 4AKTA 4DIBA 1YMQA 3Q1LA 1SUEA 1P2DA 1U4NA 3Q0IA 4MHOA 3A04A 1P72A 4GRAA 1BTOA 1E9DA 5LZ9A 1DC3A 1HT3A 2NLOA 3DYIA 4KO3S 3RJMA 1GCOA 4N03A 4UBIA 3AIMA 3ZGVA 3CMCO 4HX9A 2AOTA 4BWYA 2XOKA 4D5GA 4EB8A 3D6VA 2FEMA 4O2BA 4I1PA 3NBMA 4CT5A 3THWA 2HTFA 3L84A 1TZJA 4K9SA 2YOHA 2UZ3A 3CJQA 4K6GA 5KZMB 4HDCA 4CKEA 3LCUA 1SUIA 2CSUA 4UXIA 5DTIA 1PR5A 2AFHA 1QJCA 3HBNA 3JQ7B 1CNFA 5BQ5A 2G9QA 3WLOA 1J1IA 1Q95A 4OL9A 3OP4A 3P4UA 1OZAA 5ALLA 5AVUA 1E1DA 3SS8A 4NS4A 2I6QA 3T3EA 3V8RA 2IOFA 2ZSEA 5EQDA 3UWOA 1EUCA 1DS6A 1IHOA 4YAFA 3RVOA 4CLOA 1P61B 1UBGA 3BUSA 4XEHA 4ARZB 4YUVA 4MW0A 4B6JA 4HDAA 5AK4A 3HKBB 3LE8A 1V1JA 1K8RA 3LHSA 1XPJA 3X0DA 2OWDA 3PUWA 4RKYA 2WNSA 1YQWA 5DMHA 3ZOKA 3N76A 5A6VA 2FQQA 4WY8A 1YK1A 4Q1CA 3DQPA 1KK2A 3VU9B 1FLDA 1QWOA 3AH8A 4YREA 1O96A 3DBLB 2PUBA 2BRUC 1HDEA 1TF2A 1XTQA 2EX4A 2VL7A 221PA 3GFGA 3ORYA 4LDRA 3DL4A 2HK8A 4OBEA 3SQDA 3BILA 3KV3O 5IJWA 2JVJA 4H1WA 2DQSA 4U6NA 5M04A 1H8EA 1W0JA 3NBZC 3TZQA 4BO7A 4B33A 4C4PA 3N74A 4C7BA 4YQFA 3OJXA 4B2PA 621PA 1B0ZA 3BE6A 4FFWA 4JVMA 4MGHA 1MEEA 2VCYA 3RVJA 7REQA 1JHUA 4JR1A 1D2HA 3FFTA 4UM9D 5TVGA 5T8KA 5FF9A 2XBLA 4PO8A 2JK0A 3FH0A 4UE3S 2JCXA 1B3RA 3S4YA 3HLYA 3TR6A 4EA9A 5AVTA 1I4DD 2CMFA 3NDJA 2I4RA 2PG3A 3DTYA 1HY3A 1DWPA 3OWOA 4FN5A 4N39A 4OYYA 4WRRA 3FAZA 2JIBA 3IGFA 2BYTA 4NXNB 2ADMA 1G7TA 3KU1A 4CGYA 3Q3IA 5GTDA 1ADBA 5B57C 2QLNA 3MS4A 1XWIA 1LGYA 2BHTA 1LBSA 1W6RA 2P9JA 5EJ2A 4R8RA 5EJAA 3KUDA 2G25A 4IHJA 1U7ZA 2WICA 2G36A 2IOYA 1ZQ1A 3RCBA 4CN9A 2P3OA 1P7YA 1KMHB 2A8YA 4HHEA 4OQPA 4R1QA 4DY4A 1ONSA 3VKUA 1AF7A 4W9NA 4CKZA 1JAXA 1RR6A 1TOAA 1EZ1A 3ROXA 1NXXA 4XX0B 4BGIA 1NNI1 3E7PA 3BYZA 3EFEA 1ENZA 2DHDA 2JGEA 2VQ6A 4BIMA 5F1KA 5EMLA 2CXHA 1U5AA 3R3VA 5E6SA 3U61B 1DIOB 2FB9A 2O8CA 2W37A 3OG9A 3LLUA 2H2DA 3TQFA 1WNTA 2GHIA 2OBBA 1MB3A 3F3SA 2OKCA 4HVTA 3F6SA 4GHWA 4LG1A 1U2DA 1QNFA 1D2EA 1DWUA 3A0UA 4JJAA 1NT2A 1GUAA 5GGXA 3ZY6A 4BQOA 3K4PA 4DCUA 1NZFA 2DBYA 2IZ5A 5JBIA 1TAUA 5GV8A 1RHRA 2Q5LA 2EKQA 2XEDA 4IVPA 4QJBA 2Y6VA 5D8DA 1P73A 3RAPR 4O2LA 4Q4AB 3SZGA 4BMDA 1SBTA 4MAAA 3M1LA 2YVLA 5G40A 4HQOA 3CSSA 2ZIVB 4EATA 4UBLA 3AB3A 4MWGA 5TB5A 2R85A 2I2BA 2H4FA 3ETJA 3JPYA 4BQRA 4PAGA 2LCQA 1NPTO 4TMXA 2CB9A 1KY4A 2A2ZA 2I54A 1S3IA 1ZNQO 3QWHA 4XCVA 5FNVF 5AW8A 3EY4A 4DQLA 3NKLA 1A88A 2FPGB 1UFOA 1NKVA 1NULA 3I9V1 3BMQB 2QM7A 4FEYA 3NAGA 4YRBA 3I2IA 3BJMA 5LU9A 3ZD7A 3DMPA 5CDSA 5A4MS 2GKSA 4IMJB 4YV7A 1G55A 2HCJB 3TM5A 3EZLA 5AOVA 4CKXA 3OEED 4YAIA 721PA 1P9RA 1OGJA 2BW0A 3II6X 4QELA 2WPNA 1Y33E 1F5NA 4UHHA 2NUBA 5IJ9A 4NABA 4F1KA 4LYGA 4YLYA 1V6AA 4MO2A 1A9YA 3ZHUA 2VPIA 2W8BB 3A1TA 3V8BA 1M2VA 4EH1A 1E3JA 1KO7A 2HYIC 1RWXA 3UW3A 3UA4A 3A2LA 3E82A 5CK5A 1Y6GA 2UV8A 1VQ1A 3LU1A 4RK1A 1TRHA 5CLIA 1EWTA 1Y4ZA 2G04A 2FEXA 1IUKA 3I4FA 3IB6A 3BORA 3KUKA 3L77A 1QRAA 1BW9A 4HH4A 4WZBE 3BIWA 3FSEA 2HPAA 3B2QA 3TZHA 4XX1A 4DT1A 2Y1XA 1NF8A 1ZS9A 1RADA 3AJ8A 1NW5A 1FMCA 1O8BA 5FNVA 3RS2A 5KDOA 4IV0A 4PHCA 1TF7A 1ZUNB 3TCNA 5IT0A 3TM4A 2V54A 4AJLA 4OFWA 1YZNA 1BX1A 2TSYB 4NEGA 1UPAA 5CNIA 3UPUA 3GOHA 4RZXA 2VWHA 1FNCA 2XW6A 5HCUA 3CF4A 3WLRA 4LVUA 4J49A 1ZM7A 3QKIA 1XLUA 4O63O 5HE9A 2Y4OA 4YUAA 4MQMA 1AMUA 3PCRB 1Q22A 3E5HA 3S1AA 5D84A 1LEHA 2CXUA 3MMNA 4HJRA 4H6WA 2GFQA 2JFWA 4ZV7A 2Z6UA 1VLLA 4TV8B 2QG9A 4JSYA 2FPIA 3SIPA 5ECYA 4ZN6A 3KR0A 1QWSA 1XB2A 4DMUB 1GXSA 2ZI5A 4LQLA 4M7RA 1I4EB 3WMXA 5LQRA 2ZZMA 3FDIA 2IBMA 3UAXA 3C4QA 3GNSA 4KE9A 4O08A 5CIQA 2VNJA 3B48A 3OLVA 1ZLXA 5K3FA 2D74A 2DFDA 3HP4A 4NRDA 4QUEA 4D3FA 4ZU3A 2CGEA 4ZQCB 5AKGA 3BDIA 3ROPA 1U2QA 5IDQA 1NW3A 2E21A 3HR7A 5E1DA 2NU8B 3SZRA 3UB4A 1IMJA 2WAMA 5BWMA 4P3XA 1PVDA 2HA2A 4L5BA 2IDMA 4K9QA 5FOXA 4A8JC 1XEXB 3L7MA 5EIBC 4EG6A 4ZV4A 4BASA 3PD1A 4YAKA 4HLUC 4U7PB 1AQNA 3SF8A 1CZKA 1CLUA 1ZINA 3KJEA 1FDRA 4MICA 5AK6A 1UJMA 1K4KA 4OGFA 5JS8A 2VSOA 4GI1A 3GLHE 1GILA 1KMNA 5B36A 2ECKA 3MWFA 4DR2B 2WF5A 2AW3A 1BOOA 2J48A 3L7CA 4F6RA 2A33A 3LF2A 5CB8A 1I32A 2AMYA 1G41A 2YJTD 3I5MA 4HEA6 4JT2A 5D87A 2XRYA 3IJ5A 1EFUA 4EG7A 2BEUA 3K0SA 5J40A 2W11A 1NU8A 1QJ4A 2FTKE 1YL7A 1WW3A 2R751 2M1XA 3K8YA 2PSDA 2HCTA 3MCAA 4S1PA 3EG9B 5DBHX 4EFDA 4G0PA 3UTCA 3PX7A 3HBJA 1XXLA 4AWXA 5A4IS 2AJ8A 3JAKA 5HKKA 4MRSA 1OASA 5TS3A 1W19A 4WXRA 4EKIA 5DNYB 1PD0A 2J41A 2TMYA 4PAWA 5ED4A 2NO0A 1RMYA 3AETA 3FKSD 1EQAA 1FP4B 2LDXA 4O5AA 5J4YA 2JLXA 4AWBA 1ZZEA 3DUWA 2YASA 1B15A 4G67A 3PC7A 4S1WA 5F98A 1L7EA 3WLKX 2G9ZA 2XUGA 4AY6A 2IK8A 1OF1A 3T5DA 1VG1A 3NHPA 1NXPA 2H08A 3NETA 2C9BA 1Q0LA 3PR2B 4KB5A 4WKBA 2OV3A 4LYYA 1EE1A 5ALEA 4JDPA 4GZ3A 3UKDA 8AT1A 1MOPA 2PXAA 2XQJA 3ICVA 4FFDA 4DR6B 3OZSA 1DKQA 1RWNA 3QVGB 1ZA1A 5LQUA 3KKPA 1F1JA 1FRVA 1P77A 3AVYA 3AF5A 4RH3A 4IGFA 4BB6A 4EJ6A 3VA7A 2G5GX 4DLRA 3L8DA 3E48A 1ABEA 1P17A 1BCRB 2QUBA 5F12A 1DTWB 3ACDA 3JARB 3TLAA 2C7QA 4QXPA 1WULS 3KVVA 3OKCA 1RBZA 3I72A 3PQCA 4I4LA 4XM2A 1NR1A 3NASA 4AJIA 3LBHA 4RHFA 2JGDA 3P0IA 5KJCA 1MH1A 3IPAA 2F1KA 2P79A 1YVEI 5H80A 2X4GA 4BUZA 2DR3A 1RT9A 1NI4B 4F6LA 2NZJA 5BNIA 4RADA 3DNFA 3C3XA 2QAGC 4WLFA 3VPCA 4BZQA 5ALZA 5BN1A 5AKYA 1E60A 2RSLA 3WTBA 4GBMA 4PLFA 4CG3A 4OLBA 2D8AA 1PL6A 3ZYCA 1Y9JA 5CDUA 5KVCA 4RPCA 5KC9A 2CNKA 3K09C 5LQKA 3O74A 1NI3A 2GYWA 3HB7A 2R6AA 2AJCA 3LFTA 5FPSA 3V7NA 1P4RA 2W6OA 4BJ1A 1IXYA 2IQIA 2Q7OE 3KKZA 3MAGA 5CHYA 5IT9A 1MDFA 5SY9A 3U7GA 1Z33A 5T5QA 4EG0A 4Y9UA 1MAUA 1NLUA 3NB0A 4GF5A 4NAHA 3WKDA 4LJYA 4UATA 3ZE7A 5CW1A 4B45A 5AW0A 1UAAA 1D6JA 1EPUA 3CO5A 4PGAA 2VXYA 2ZYHA 4TKLA 1TAGA 3B6EA 4X6UA 3VX3A 5I5EA 2WQ7A 4CV0A 4Z4FA 4ZMRA 2YCBA 4HXYA 2F9LA 1NVAA 1T3LA 4WN9A 5B1YA 3FVWA 4TYMA 4HUTA 3MWGA 1FYWA 2D5CA 2K7ZA 4ZOLA 1X7ZB 1WQ1R 1VYUA 5FOTA 5KYTA 1U1CA 2BWJA 5CX1B 5HS4A 4ESEA 4XM0A 1OLSA 2WTBA 4LJ7A 2WU4A 2X8BA 2CHFA 3FHOA 2NVWA 3AINA 1LDNA 2FLKA 1PD1A 3HZOA 4FK8A 4MWZA 3VZSA 4E09A 3ON5A 3D6MA 2YXBA 4RXMA 4WFKA 2I2XB 1OV4A 3KXDA 2OP0A 3L1KA 4RUKA 4V1CI 3CUVA 1UMDB 2AYXA 1PEDA 1X7WB 2A7XA 1H4TA 2HA0A 1SCUA 3EVFA 1DXOA 2R8PA 4LWOA 1IUNA 3C3CA 4F3CA 4LJAA 4F6CA 2IHVA 3CX7A 2AE2A 2FSUA 5IYZB 1MP0A 3HSSA 4IGKA 3W3ZB 2L82A 3GAMA 2XITA 2WKRA 2E18A 1O77A 1BKSB 1I2AA 5BR4A 3OFSA 4JGBA 1UQUA 2ZZNA 2VF5X 1G3MA 4AJ4A 4W9RA 4CKWB 5EIFA 2JJ2D 2VK8A 3DXYA 1JQEA 4YDSA 4AP9A 4KPUA 3VAAA 4DB2A 2JFYA 1SXIA 2TYSB 4QUJA 2OBNA 4JLAA 1WPRA 4WCFA 5DHAA 4B74A 3QLUC 4WFJA 4D9FA 3OZUA 4KW7A 3TPCA 2C2KA 4YRNA 1ZOIA 5FBLB 1FSSA 3D8NA 5KYYB 1F8YA 4M53A 1KJJA 5ELMA 1S8OA 3OEHA 1X7XB 4O8ZA 2DR2A 1R6AA 1RYEA 1WXIA 2G4CA 4MO9A 1Q0QA 4QSHA 3FNEA 5K3OA 2GX6A 4C6SA 2B98A 4LJ9A 2IKSA 5JAPA 1KEPA 2HBRA 4YV2A 4IHAA 1ZIOA 3QVVA 3D54D 1FFBA 1T6BY 3FLAA 5EIXA 3C70A 2H4ZA 4JBLA 3G1UA 4MVXA 1GZDA 3QY0A 2O5CA 2HJHA 4M99A 2YFKA 4B8WA 4YMGA 4FFMA 2JGMA 4P9NA 1V8DA 2ACEA 3CLTD 4CEHA 4FZJA 2ARKA 4IIBA 3RRMA 3U3OA 4EZIA 3TLJA 5LZ5A 1K3UB 1RQLA 4GL2A 2HHLA 1TK2A 1ODCA 2A9VA 1UZUA 4NYJQ 2ZRDA 4QARA 5AK5A 1GCUA 3DCJA 5KU7A 5FLXA 2J4FA 2R1UA 3RYHA 4ARUA 1IHUA 3C3DA 3C5HA 4TKVB 3ZXUB 2GHTA 5T64A 1RU3A 5EA2A 4WN3A 3AF3A 3WGGA 2I78A 2J7KA 3GEIA 2B82A 1BDMA 5LZ8A 1OLUA 4B84A 3K71B 2I6SA 3AO0B 4TM7A 1N6HA 1KGDA 4S2UA 4TKMA 2G7ZA 5FUQA 2FR8A 4UEWA 1JXMA 2QS9A 5AIAA 3SNKA 3U3RA 4BCDA 1G2PA 5EHZA 2VQEB 4M9CA 2HBQA 3S99A 5FUBA 3GW8A 1TYCA 3U1VA 1H4QA 4GPD1 5DHFA 2V7QD 2XRFA 4ZQFA 5CR9A 1YKFA 4ECEA 1W5TA 2FZKA 5JWHA 3K70D 1PKEA 2WIKA 3CZ4A 3HNPA 3B5JA 2G76A 5BVHB 3SDBA 1BEUB 3QEKA 1U7UA 1ECBA 3TE7A 1EK2A 2GHQA 4H6XA 1KZ9A 4R0VA 3KSMA 3LUHA 3WZLA 3PXDA 5J2UA 2O8EA 3FGPA 3MZ0A 4P4SB 4LNUA 4X1YB 1KU0A 4PAMA 1KBZA 5TMBA 1NUPA 3FDFA 1O94C 3WS7A 3OZVA 5I4BA 1S3SA 3IQEA 4LRTB 2DUJA 4X20A 2RGGA 2WJ3A 1AZTA 4U5XA 1U31A 4AKHA 2ZSAA 2YOGA 4LV8B 3ODGA 4QBTA 1AKTA 3PK0A 3TRIA 2CNOA 2FEKA 4K6OA 4MRMA 1RI3A 4EPVA 3M7IA 3R41A 3PIIA 3EC2A 3C0KA 4E5PA 1EB8A 1EVJA 1JR3A 3MYYA 2JKVA 4M1KA 4QUIA 5FLYA 1JEYB 2XKKA 2VDWB 2RH4A 2AIRA 2B8EA 3K4QA 5C7LO 1ZMTA 3KYDB 3RIYA 2CJYA 2BR4A 1J8QA 5JQGF 5CAEA 2CJFA 3QPAA 1OB2A 1RVV1 3KELA 4ZOQI 4KREA 3OCVA 3UHFA 4CFZA 4FFBA 5TV2A 4YCSA 5AXCA 3NFYA 10MHA 1LBHA 2EKPA 4ZQEA 2PRJA 4O33A 2POQX 2CDCA 1WA5A 5DYTA 1N6PA 2D5AA 2CHVA 3GC6A 4X62B 4L4SA 1NUAA 4JELA 4NARA 4IJMA 3RWMB 1N7GA 1X42A 4U6QA 3TPZA 3TQSA 4PC1A 1JSRA 1DAKA 1Z12A 3SSMA 3O8OA 3K5IA 4I6EA 2LP4Y 1EHYA 5AM2A 2PX3A 3VR4D 3A1NA 2RK3A 3R3WA 2CDNA 5JRZA 4E2XA 2NW6A 1Z73A 4PO3X 2QQFA 3WP1B 6Q21A 1DC7A 2OXFA 4ZJUA 3LP6A 5I9MA 2GH1A 3OLQA 4PE5B 1G5RA 2HV8A 1V11B 4NMWA 2HHHB 2Y1LA 3I73A 1N4AA 3H5NA 4RSHA 4KNWA 4P4NA 1KEUA 4X3CA 4C4OA 5JQGA 3QLEA 1JE1A 2NTJA 1KEEA 4HKTA 3IDAA 2NXNA 3N0TA 1GA1A 3F71A 1XCPA 4L22A 2JEOA 4DQKA 5J47A 4L9AA 4MI3A 4GAEA 2FOLA 4YGXB 3VBCA 4EHDA 3FNQA 5DE3A 5BW6B 4RMNA 1XROA 3ROQA 2PT9A 4BX8A 2A9OA 1P4AA 3NDBB 3M2PA 4GKVA 3W9SA 3EDQA 5L3QA 3EFOB 3FYUC 2NU7A 2NM0A 2OFWA 3IDOA 2GKOA 3OOYA 4HAXA 5GMOA 1NHWA 1TD9A 5A05A 3U9SA 4AG6A 3K0CC 2G06A 5EHNA 5LP6C 5BUZA 4MKRA 4RACA 1XHLA 4DDMA 2XZPA 1JILA 3RSLA 2Q8PA 3FWZA 5CU7A 1FBTA 1ZNYA 3O82A 1DKPA 4Q3NA 1YKSA 2RE8A 2Z98A 3RRXA 4QYIA 3IESA 1WUJS 5IXYA 1ZM2A 4RZHA 1L4LA 1MDBA 3A10A 3SJAA 2XYVA 4GM0A 4K03A 1OYYA 1U2GA 4C1BA 1VJDA 1WSAA 1Y6FA 4R81A 4ZOBA 4PN3A 1L7QA 1THMA 4H4CA 4RK7A 3S6JA 4LRWA 1CW2B 5KU1A 2GJAA 5FQOA 3JZAA 4EYOA 3AF1A 1K8ZB 5KVVA 1EGHA 1DKLA 4WXMA 3F8SA 2Z3VA 2OLJA 5JO0A 1XD8A 3C1TA 1E2UA 1MIOB 4OB6A 4TLEA 4YA6A 3FTCA 5K0NA 3AYZB 1ARZA 1EAMA 4OGGA 4WEQA 4C7JA 1TEXA 2IYNA 2W90A 1ZWLA 1VDMA 2QRGA 4B47A 4D3XA 3PJFA 3QF4A 4RU1A 2OWEA 1LZKA 3KP1A 1Z34A 2QGNA 3CWZA 1A3CA 2Z08A 3JQQA 4NULA 3Q5EA 3MLBA 1BCSA 1L1FA 5D1NA 3S5UA 2I2DA 1L5RA 5ILGA 1LTKA 3VSAA 5KTNA 3BZBA 1WXFA 1E6KA 1RPNA 1YONA 1Q1EA 1H8HA 1YCFA 2JIZA 2Q0XA 2A59A 2XTJA 2IYWA 4B3JA 1B1CA 5E0KB 2JLVA 4DNPA 4YP6A 5KQRA 3TO5A 2N9UA 1MR3F 1N78A 4L5IA 4BP8A 4Z0TA 5JS7A 4J0CA 4ZCQA 2G6TA 1NMZA 1RKXA 3ZUPA 1K3TA 4HVCA 5I4IA 2JAQA 5EWJB 2PZFA 5INTA 1YB2A 2D7DA 1TK9A 1EDOA 3DV0B 1ZKMA 1GSHA 3I52A 4J16C 3TZKA 4W7IA 2J3HA 2X3UA 5D1HA 5L40A 1XGKA 5LQSA 2G1JA 1EFAA 4KOAA 1N8NA 1MTZA 1D8TA 2PIAA 2B94A 4IIUA 5TR9A 2AEJA 2GK3A 1R0RE 4RANA 1NPDA 4ZD6A 4FBGA 3IE0A 1DARA 3Q98A 2YWFA 3AIKA 3QVSA 1YS6A 1XL1A 3K6RA 4LHWA 4KG7A 4D7AA 6NULA 1VMEA 3PA8A 5JBNA 3ZWCA 4A5OA 1ZI6A 3ER8A 4UHJA 2F64A 3L41A 2C3OA 1GKKA 3A36A 3LZDA 3QUCA 1WZEA 4WY5A 5CJPA 2ZT6A 3KXPA 1LZLA 4FGJA 4RLQA 1IAQA 1U11A 3I6BA 4WIAA 3QMPA 2PUEA 4BUJA 1UMBA 3H2YA 4PLPA 2B1QA 3OTHA 3VOTA 2IXGA 2OHHA 1BGVA 3DLCA 4PX2A 4ZXFA 5FOWA 3LSTA 3RVBA 4Z4IA 3EBOA 1RJGA 1I33A 1UXKA 3NW9A 1DFGA 2C4UA 2O3JA 2XVXA 1YFLA 3V1LA 1X1CA 1E5VA 5AJXA 1BMQA 3CEPB 4K86A 5G0UA 3AM4A 4RFVA 1FXWF 4F2GA 3GZNA 1NVEA 3VTZA 2GCEA 1JHVA 2JLBA 2RGRA 1GQRA 4G3XA 1RWBA 4UHEA 3OZIA 2HQ1A 4GR4A 4MKHA 3FMOB 1BX3A 1DI0A 3PQ5A 4LC1A 1AY0A 5E2AA 1YS9A 1OMOA 5ULLA 3O21A 2H3HA 3TX6A 2HHJA 3WWPA 4OTZA 3T15A 4JLMA 1AKUA 4DMRA 4KDFA 3R44A 1JDTA 1OFIA 1VPWA 1K2VN 1Z4PX 4UVHA 4AYXA 2VHXA 3U16A 5FTJA 3B6KA 2GXQA 2WV7A 2GS9A 2ID7A 4FOTA 1TM2A 2I6FA 1ZGCA 2IPOA 4WXYB 2OZEA 4FR0A 3MJSA 5BW8A 4X6LA 4DCPA 2EW2A 3HFSA 4MTLA 3D4OA 3VU8A 4WT7A 4BMZA 1M1NA 3OKFA 3ORHA 5KWEA 3GO4A 3ROKA 1Y7HA 1CR6A 1R66A 1YUNA 2I34A 2JD2A 2PJDA 1UEJA 3O3NB 4OHZA 3TZEA 1KH2A 2WE7A 3ZV5A 3I76A 1FCJA 1KAEA 4PV7A 5YASA 4OLAA 1ZUIA 1GVHA 3L4JA 2G71A 1L7MA 2Q62A 4PNEA 1PO7A 2FE1A 3DFIA 1O6ZA 3PVCA 1CT9A 3RVSA 2HGSA 2VLIA 4WTOA 4BRSA 4KIGA 3IT3A 2OESA 2W2LD 1Y1LA 2WUDA 4I3HA 5EN4A 3DEAA 2VF2A 1NQUA 1SHLA 3HPRA 2W5UA 3GD7A 2J07A 2A6PA 2ZTUA 4D8XA 2YQZA 3OE7A 4F4UA 4W5QA 4WNCA 5KWJA 4J07A 2IX3A 1B8OA 1L5MA 4RD6A 1SGWA 1PLLA 1ZMXA 2NO1A 2X0NA 2JJMA 4HS4A 3UQZA 1UBSB 3PFHA 4E2FA 5L53A 3WFJA 5DEIA 2QJRA 1GPWB 5BOSB 5I8WA 4B8ZA 4KBYA 4ZCMA 5FI1B 5TARA 1NJ1A 1U02A 1U5CA 3E0XA 4GQBA 4ZCPA 3MTDA 4OHFA 5ABPA 3U7RA 4HLNA 1KK0A 3WZ2A 4HVLA 2I4MA 4LZOA 3EWSA 3IQZA 4PCVA 5KNBH 2HYDA 4TSFA 3H5OA 4XW2A 3NDPA 4GRDA 2PGLA 4GUAA 1MJHA 2OV8A 4QTUB 3WZMA 1BS9A 1P1RA 3KYCB 3PYLA 4JLUA 4EEKA 5JAUA 4BXOB 4KNVA 3O8BA 4BWVA 1XVTA 2HMWA 3WNDA 1K68A 4LMPA 3A3OA 3QKTA 4ALLA 2EG9A 1XDDA 3CEAA 1C9DB 2O57A 3BERA 1NW8A 4DEVA 5BSHA 1LLQA 4G0OA 3M82A 4HNRA 1F60A 1PUIA 3SXJA 5JZMA 1TKBA 1YRLA 2D5LA 1JHAA 4UPVA 1FNSA 2AFRA 1DJLA 1RQGA 2IF0A 4AZ3B 4AMGA 3T3OA 1LJUA 5EKTA 4WUTA 2B4QA 1A9XB 1MJGM 1HOTA 1QK4A 3TTWA 1MENA 4NBTA 4P7JA 1D1TA 1T29A 4MGZR 3VPDA 1YDWA 1FC0A 4GG1A 3ZE2B 1O5TA 1QCCA 1R18A 2FFRA 2OHFA 2QLJA 3GBPA 4IV5A 4JP5A 2BBSA 3HHPA 4FLMA 4GP9A 4PQGA 4B3SB 2W2MA 3AUFA 3PDCA 1D3AA 4NMMA 4BN4A 4CG2A 5F9HA 4ZU1X 2J08A 1GT6A 1QO0A 4M7PA 2W48A 4YJ2F 3RK1A 3AMVA 2ODQA 3ONEA 3HCNA 3OZBA 5JE8A 1NFFA 5GINE 2WKPA 4WJKB 2JCVA 4NCXA 1XZCA 2IZZA 1QVAA 1JRLA 5CPBA 3RNOA 2C99A 4GVXA 1SUFA 3TFOA 3EOAI 1UC4B 3WWOA 1YA6A 2GJKA 2BFDA 3AI1A 1H6DA 2DZDA 4OGKA 3R09A 1PGQA 3ANSA 1P33A 1PQWA 3IXMA 4OUDB 3U7QB 2AYYA 2CF5A 1IVYA 2OFOA 2Y0PA 3CVYA 3L0SA 4CDRA 2XZDA 4F1WA 4FP9A 5IASA 1S96A 3EW7A 1YRWA 1H6BA 3OESA 4X84A 3DBIA 1IM5A 2V4MA 4PSAA 1N5OX 4Q15A 5KOHB 2G80A 4K9NA 3Q1KA 4CIXA 2VDRB 3AIOA 5BN4A 4KAFA 4RTNA 4XRRA 5KNDH 4BMSA 1QFJA 5JS6A 3LWNA 4IF4A 3EXHB 4YJKA 1QDUA 2AI1A 1CF2O 1QB8A 4RO0A 3K94A 1AV6A 4OMDA 5CVTA 1E1MA 1JPUA 1V5EA 4XQ9A 3H83A 13PKA 4HQFA 2DBRA 2GZ1A 1N5KA 1UMCA 8ATCA 5K8TA 3BH0A 2YKGA 3SLKA 4BKQA 1SVMA 5EIBD 4QAQA 4H18A 4FHDA 3UAOA 2X6TA 4OCZA 4HNAA 4KMMA 4Q3DA 1HUQA 4MIKA 4BZXA 2VJMA 3BD7A 1Z6TA 4A10A 2ZVQX 2OC9A 1KVRA 1VSTA 2YWCA 1RBYA 5CIWA 2A4MA 5EFZA 1AKNA 1NYLA 2WJIA 1PS0A 1SKYB 2V9CA 3L1JA 4JGGA 4WZAA 1LBQA 3OQ1A 3T54A 3EUWA 2FG6C 1NRWA 4PZAA 5HF5A 2X58A 4QBKA 4MVJI 4ARSA 5ICEA 1IZYA 3KQMA 5I51A 5CLHA 4N01A 4ZVVA 3VSEA 3LX8A 4LXTA 2UVPA 2J7PA 1EXVA 3A28A 3DE7X 4X24A 3W3AD 2QMQA 1M34B 5DW0A 5KAMA 4FYKA 1BDBA 3B2EA 5EHIA 2WHEA 3LVRE 4GP6A 2OD9A 3HGTA 4BN0A 1CQIA 3B20A 2CVQA 4YO7A 2VP2A 4Y9TA 3C45A 1OBFO 3MTAA 4JJGA 4CTOA 3FBGA 4G23A 4L4ZA 2B5OA 5BWBA 3OPYB 2OUIA 3FNIA 4O02B 4XD2A 3E9MA 2BEJA 4XTRA 3HU5A 4G0QA 1PR4A 5AHWA 3VNRA 4IQ8A 5A2GA 3ZHVA 1RTKA 1L4GA 1M2EA 2HCBA 2I1QA 2P7IA 2QTVA 1EFRA 4LDAA 4MYHA 3ZLBA 1Y9ZA 2X9GA 4DWWA 1MW8X 3H1PA 5C8ZA 1YVUA 1UZNA 2MYPA 2YJ4A 3GDGA 3IUBA 5KYXB 1A9OA 4BZPA 4UREA 3BTVA 4ZT4A 1E6LA 3FHTA 2D13A 2F1OA 5J58A 1GG5A 2PTHA 3SFZA 1I51A 1DUSA 1SC9A 3NNSA 4EGFA 1LC0A 5KVAA 1CPYA 1LVGA 3KUCA 4U63A 5JVDB 5TX7A 2YRFA 1MLDA 1H2RS 1PV2A 1G60A 2YIVX 2PUVA 4JI6B 1WAMA 1TC2A 1II8B 4IIYA 4D96A 2XXBA 5LP6F 2FW9A 3OUZA 5A6SB 3RYIA 2H8KA 4M0KA 3I30X 2QN9A 4C3OB 4EJSA 3VXKA 1C8LA 1G8KA 2CXQA 2HQRA 2Q2WA 2Z8XA 3C14C 4MS3B 3UWMA 4E70A 2PUCA 1ZLYA 4CV3A 3HXQA 1FJGB 1PG5A 2QGZA 3DFKA 3SEFA 1ZAKA 5J1SB 2NO5A 4ZT5A 4BO0A 4Q1FA 4XZ3A 4BLVA 4AO8A 3R7SA 4K46A 3KKEA 1P2FA 4ENQA 3R3HA 2VUIB 2H57A 5JH7F 4FMCF 3D8RA 4XUDA 1U8FO 1ESZA 2ZITA 2HK6A 3P5SA 3E03A 2CZQA 3KKQA 3SNHA 3B9RA 1CVLA 1V0JA 2HSZA 1LD3A 1TE2A 3FKQA 4IM7A 4LMRA 4PBRA 4DRYA 2ZRQA 3MIIA 4BVHA 2OQIA 3AXTA 4JUCA 4ZDIA 4EG1A 4YAEA 2A1TR 2PH5A 2AI3A 4RW0A 5H3LA 2FFAA 5KKNB 3VU0A 4G24A 1W4RA 4QJIA 1DIHA 3I2KA 3ASYA 1YQDA 4EECA 2Y2UA 3RBVA 1QE0A 1FTYA 2I8CA 2ISQA 4KL8S 1E59A 3TIGA 4E5DA 3IA2A 5FCDA 3UMYA 4KWTA 3I39X 1O8CA 2GAOA 4MA4A 4N5MA 2DLNA 3KLBA 4UVEA 3TZBA 3WSWA 2E5LB 4PGGA 4TLAA 4D02A 1BMTA 2CBXA 3DXFA 121PA 1T1IA 1QGED 4NNPA 3AFOA 4UDNA 1F4LA 3W2FA 2PUTA 5DIZA 3UT5A 3ZDAA 5AI8A 1XIVA 4F3RA 4H4DA 2PZ8A 3WIUA 2ZK7A 4X65B 5JXWA 1EJ2A 1J06A 2BKEA 2Q0HA 3T1NA 1JR2A 3A4VA 1DEOA 2OENG 3BE8A 3Q2IA 4QNMA 5JSHA 1PT5A 2CEKA 1YAHA 2WVGA 4IEEA 4DC0A 2KJQA 3DG9A 2DHCA 3KPVA 4JIGA 3N8KA 4R4JA 2I7TA 1CUIA 3DHYA 5C52B 4HNUA 2HLNA 4BRZA 5CVJA 5AXAA 4YRJA 1HMPA 2BR5A 4BMYA 1ORVA 2X42A 2JFBA 3HVHA 1C4WA 2G8NA 4C4YA 1NJSA 3LT5A 2AZDA 4JVOA 4KGZA 1I4WA 3U60B 3DKPA 4M7WA 1HURA 1KH3A 1LNSA 4HX2A 2WJPA 2Z30A 2XAUA 3TSCA 1SVNA 1G0NA 2H2WA 2MDTA 2Y9PB 2JFXA 3JU3A 4ILEA 1NVXQ 4RSGA 1XTPA 3K1ZA 2WY2D 4EFKA 5LSAA 3DAGA 2B69A 2AFHE 4OBWA 2CJWB 4GFDA 2FLWA 2NT4A 1OFHA 4M87A 4URHA 4OO3A 1J2RA 1EUDB 4QHYA 3EZFA 1H5UA 1Y5RA 3AQIA 3PXUA 2Z43A 4R8VA 3SYLA 1JYSA 2WMYA 5JISA 3GGSA 5CD1A 1GWNA 1VBNA 1JLHA 1U80A 1JEDA 3NHUA 4FMDB 3VJMA 3FSGD 1VPEA 1DQSA 1GZUA 1WOYA 2HRCA 1G18A 3NUGA 4NU6A 4R7TA 1S6YA 2HUNA 3BCHA 4UNIA 4C04A 3ANXA 3NRBA 4OFXA 2JC3A 1QYIA 2FMXA 4NMXB 1SIBE 3BGIA 5KWVA 4HNHA 4RKQA 1NPYA 3GPIA 4LZNA 4U0KA 5ALFA 1MC5A 5KJ6A 3AY0A 3DOIA 1DBIA 5SZHB 4DA4A 3JVVA 1S02A 4JEHA 3C3PA 4HP8A 3FDZA 1ISSA 2CK3D 5ERXA 4DJ5X 1P81A 2WP8J 3CGWA 4II2A 4KE6A 4UTXA 3GH3A 3EMBA 3HY6A 4WOBA 5ARCA 5FUWA 5LPNA 3HMQA 5F23A 1ANKA 1G8JA 1SR8A 1Y8RB 3P4YA 3PIDA 1UOOA 3PNMA 2P5YA 4J0FA 4JODA 4LGCA 4EPRA 5JS1A 3X1YA 1NDHA 2EWMA 3OU2A 3U7IA 3ZY2A 1OHHA 4BO8A 4L76A 3R8XA 3PEVA 3DB1A 2WUGA 1N2CB 2OHVA 2GM4A 3KCQA 3S55A 1U2DC 4RHCA 3P9XA 4YLGA 1NRIA 3F4KA 3IKLA 4HXGA 2WEKA 1VJCA 1XCMA 1UXJA 4I8DA 5EJFA 3ANTA 4H3SA 2GK4A 3I61A 1QZ3A 4PZ0A 5IMBA 4CM6A 4BFZA 3D4IA 1Z63A 1U9IA 2J30A 3GUZA 1H42A 3DONA 4NG5A 2R7AA 1C3EA 3F6CA 3K15A 3L6EA 3MAAC 1KMIY 1DSSG 4X94A 3RT1A 4AY3A 4BKPA 5I9LA 1CJCA 1Q16A 2GBGA 3ENQA 1ZNWA 5C7YA 4QL3A 1L9KA 4QLOA 4OB8A 1ESDA 2YOFA 4Y7CA 3PLRA 3FIUA 4ZK6A 5K2OA 3WGMA 2PS3A 1V1RB 4RCVA 3WGLA 3QBDA 3Q8LA 4Y1RA 4DV4B 2ZUVA 3JQGA 5F9MA 1LSUA 3B85A 3I23A 4KMRA 1O5IA 3S40A 4ZP1A 5HS6A 2V7XA 2X6QA 2GCOB 5G4KB 4QU5A 5I3ZA 3V5NA 3VR5D 2IYFA 1L4NA 4ZZIA 5JSQA 3Q11A 4BPRA 5KOIA 1CEEA 2NN3C 2OHIA 3D59A 3GB9A 2WR8A 3D1VA 3KBBA 1YAJA 3H3XA 4JBHA 4YALA 5DM4A 5EIOA 4KK4A 3TLEA 2PZJA 3X1ZA 5JJ5A 4UEOA 2CWDA 1II0A 4HGYA 4L6IA 1KKLA 2IOHA 4A36A 1WCIB 1BQ3A 1E61A 3TDKA 4CMGA 1JQAA 1ZN7A 1LS1A 1M6VA 2DH6A 3AZOA 1GZHB 2O2IA 1TT5A 3IAM6 3KT8A 5A4JA 1HKUA 5P21A 4OI1A 1EQUA 2XJ9A 4BMCA 5HJ5A 5TC4A 1T3ZA 1VB5A 2OECA 3KKKA 2OYRA 2KW5A 1R10A 4E21A 1M6WA 1IFXA 1UPTA 2H2AA 3OHPA 5CX4A 2EC5A 4Q5IA 4EI7A 4QXQA 4YR7A 1IHPA 2MR6A 4HDNA 3B5EA 4L3VA 4IIGA 4YMHA 4CHTA 5FDFA 5EHXA 2VQFB 4D25A 3F4BA 3C4VA 1VPTA 5IVIA 3ADPA 1DNPA 1NFRA 4HB3A 1R8QA 3SD7A 3ELBA 1UKVY 2WDZA 3IMKA 4ENWA 1GUDA 1Q7CA 4WLEA 1QGDA 2QMZA 3H5VA 3B6IA 3KM0A 3PJRA 2O0MA 1DAOA 1KYXA 3N86A 3SSOA 4ZYVA 5KHLB 4NY1A 1YL6A 4JUDX 3L43A 4KR6A 4HOYA 4KC0A 5A06A 4IQFA 2JG3A 2WF6A 1FFHA 3RVQA 3QK7A 1Q3TA 4DUGD 1SZJG 2KM1A 4JU8A 3LUPA 1T9HA 3NATA 2VAWA 3S5JA 3UUGA 1RXCA 4OK3A 4PPQA 5T3UA 4RKWA 3HUTA 2OD7A 5JZSA 1JKJA 3CYFA 4KV7A 4PBTA 2IRWA 3GLIA 4C1NA 3DXXA 4UUNA 2H18A 1L1EA 4G01B 3FWHA 4BV9A 2I67A 1KK3A 3L6CA 4DEYA 3QOFA 5BOVA 4YRGA 1R3DA 1ODFA 1NAIA 1DIGA 1JG6A 1U90A 2J67A 2GNOA 4HB0A 4IS2A 4W5WA 3WLLA 3P27A 3GRAA 5EJMA 4KEAA 3RC1A 2PS0A 3CH6A 3IDQA 3NC0C 3D7SA 4Q9HA 4BFCA 4DXDA 3T1TA 4ND7A 5LMZA 1Z6ZA 1MO5A 3R23A 5EE3A 3AESA 3BFPA 3EGDB 1C41A 5JZVA 2C00A 2LRHA 3E8XA 1H0SA 2HRZA 1BU5A 3GCXA 1U0TA 1V8OA 3FHCB 5G1NA 3ZU3A 3MJTA 3OWXA 3Q3VA 1UDRA 1AKVA 3KT3A 4MRPA 5AESA 5HSGA 1C7FA 1KFBB 3Q3CA 1XKXA 4NYMQ 1ZGGA 5EKUA 1ULBA 2V3VA 2XNDD 4C07A 3V7FA 2PJRA 4RF4A 5A4KA 1Q0SA 4FYYA 4BBZA 5F4ZA 2OO7A 1AU9A 2GARA 2QRVB 3BRQA 3RAEC 1R37A 1YASA 1IM2A 2A9QA 3CBGA 1VBFA 3NEJA 3WYDA 4QD3A 3WL8A 3MQFA 4PYJA 9LDBA 1PJAA 4GYYA 4L73A 5B4VA 3OIVA 3HZRA 5HBGA 2WHPA 3AEUA 5ELLA 3GLFA 2P2YA 4YFVA 1A7AA 1U0EA 1KEVA 4LEIA 4Z0NA 4ITRC 3VZQA 2GD2A 4IF6A 1DAGA 4BLRA 5B1EA 5C1BA 5H8WA 2GN6A 4DR5B 3ZDRA 1K8XB 2N3ZA 3DMFA 2HKIA 4EJMA 4ZAFA 1SOWA 4I9HA 2R1TA 2KSQA 1XZBA 3N2KA 3QLTA 3KQQA 2PUGA 4IGAA 1AKRA 2VTBB 2INGX 1Z45A 4PO1A 5EKDA 2FCRA 3BD6A 3NM4A 4P7GA 2GLTA 5JMOA 5HF6A 1G9SA 5C37A 1ODJA 3AERA 3LO5A 1GNPA 4NXMB 2I7CA 1TJ5A 2PRZA 1IY0A 2ZBEA 3C6BA 3D8UA 2Z5GA 4V1CA 1GKLA 4DQVA 1GO2A 5E7MA 5A71A 4CEJB 1P1HA 2DRIA 2R8BA 2ZE6A 3STWA 1VI2A 4H77A 1X8KA 2ZWVA 5FWYB 3RLIA 4OP2A 4MUBA 4REQA 4HDQB 3G8AA 3GJTA 2BCGY 1OC2A 2MHCA 3Q72A 1IWBB 4GZLA 1NV9A 1XCLA 4TTPA 1OLXB 1X0XA 1LK7A 2WILA 3SKYA 4EI9A 4UM9B 1QE5A 1Y1PA 4JR2A 1HDCA 1E1KA 1ORTA 3P0RA 5C8YA 3TH5A 1NASA 4NV3A 1E5LA 1RRFA 1YGYA 4HL6A 1Z37A 1FFXA 1ZNZA 4RA9B 3BJRA 2QK4A 4EG5A 2PMFA 1SBNE 3N8NA 2NZ2A 4UFNA 1VJ1A 2W2TA 1QHHA 2DPYA 1FQOA 4ITVA 3MS7A 1PNVA 1DRVA 3PC8A 4MVJH 3QGMA 4KX5A 1RRMA 3PUZA 1FRFS 4JYPA 4N3CA 2AX3A 4COKA 3D0OA 1WUTA 2CXTA 2WSYB 1D7AA 1N5DA 3UJPA 2X14A 1BHJA 1ZIPA 3IURA 1JR6A 3D1JA 1RAGA 2F43B 5DGCA 4ARCA 5I7VA 2C5AA 2DC1A 4P2GA 2H1FA 2VSFA 2XOEA 4FM9A 3LYAA 2PK3A 2Z0MA 4H1UA 3V8PA 1LQUA 1C7IA 4IKEA 1R6VA 3ST7A 1DEKA 2WSSD 3OEYA 3LQFA 4YBZA 4YRKA 2JIRA 3COJA 3C8MA 2B7BA 2B1JA 3RARA 2JJQA 2P2LA 4U2CA 3LLCA 4RABA 1T9GS 3BN3A 4WBXC 2VOEA 1L8QA 3D2CA 4KQMA 5TT0A 3V4OA 5ITZB 5JXJA 2F8MA 3U56A 1FFYA 1TZBA 3REQA 2FMKA 5TRTA 1I5EA 1H94A 3D4BA 3OA2A 1ZMRA 2AC7A 3RTGA 2P9YA 3O9VA 1H2BA 1KOFA 2VYVA 3PC6A 2F3PA 1I7SB 5BYJA 5EHGA 1ZK4A 1E6WA 2IDJA 3I6IA 2ZJBA 4O2AB 1GFSA 1FMFA 2D0OB 2CUZA 2Q2VA 2Z58A 3QV1A 1DC4A 5JSZB 3ELDA 1L8OA 1XFAA 3EVNA 4RPLA 2WJZB 4WCFC 5JW6A 3BK2A 4N4AA 3ZX4A 2WTEA 1QO7A 3CZQA 5AM3A 4N5NA 2HH9A 2OXRA 2PZAA 3PGMA 5KNDA 2ORWA 2ZAOA 5IC5A 1Q19A 3OURA 2JATA 4K6FA 2EBWA 3GT3A 1AXRA 1DCFA 2HXGA 2Q6KA 2ZIXA 3IQGX 5B1DA 4B35A 4D74A 4Z6KA 3KR1A 5FPHA 3FG9A 5TQ2A 2P9TA 4JL8A 1PQUA 1CJUC 4G5OA 2EW1A 4ZVUA 3VR0A 5BQXA 2BY4A 4MVJG 2GNAA 3WDLA 4RD3A 2B4RO 2J9YB 1FDIA 4MV6A 4Y2PA 5LDGA 4I4IA 1L0BA 3WRYC 1ISGA 1IPHA 4FI3F 3IO3A 3IKVA 3KEMA 1L1RA 2PL3A 1D8AA 1OAAA 4E4YA 1E9RA 2RHLA 1P4SA 2Y6UA 3RADC 4PYQA 1JG2A 2J59A 5JROA 3HJFA 4TUYA 3WFZA 1L4YA 2O4UX 1DJQA 2P40A 1LK0A 1TIPA 1WD5A 3LA8A 3ZQUA 5BYAA 2O50A 3CZCA 1CRQA 2QY9A 1Q7RA 2Q3DA 3SOPA 4OHBA 3L9WA 3HCWA 2PGXA 2WAXA 4YP9A 1RWVA 4BFVA 1YULA 4MV5A 3CVJA 3DGFC 1ULSA 1CUDA 1M33A 1XYGA 2OPBA 3LXXA 4W6ZA 5K8VA 1DADA 5HK8A 5TDHA 1H65A 1LDGA 2FW7A 2QRJA 1Q0PA 2HUPA 1XKLA 2TS1A 3HKEB 1OJ7A 2JFVA 3FTDA 1E2LA 1GP2A 3PXBA 4HDMA 4UUMA 4XA8A 3FRJA 5AVVA 3NXKA 3U6KA 4LYJA 3FUWA 3ZHOA 1ZGJA 2FR8C 2A84A 2CFIA 4XYMA 1KRWA 5EIAA 5KI6A 3HJGA 2VHCA 3LRPA 2QZSA 3K8ZA 1L5KA 3RC2A 1Z5GA 1WLSA 1E2NA 2LPMA 4YXWA 1ECCA 2ENWA 4R54A 4AJ1A 5J43A 2FEOA 5IPFA 4MW1A 3UY4A 2GBLC 4PQRA 4MGIR 3H5WA 1QYCA 3T1VA 4QYMA 4ZFNA 4DLUA 2OO5A 3V2GA 1QU3A 4WESB 1Y3BE 1E2PA 3COZA 3FNBA 4M88A 2ZWAA 2YHUA 1HLGA 3IP9A 2MTBA 5IULC 2PR2A 1YZGA 1AQ6A 4KAXA 5F21A 4RF5A 2NNWB 2XTAA 2ZUBA 2P0YA 5DYWA 4QDKA 3ZW7A 1VE5A 2E7ZA 3J7AC 4RAQA 4ZCLA 3EXAA 1N7JA 4HDKB 1VKOA 4BS9A 3UHJA 4Z4GA 4G0MA 5LA6A 4OHMA 3C5CA 5LD2C 2F8SA 1J5XA 3ESDA 1UKZA 4A2CA 4D42A 4U2FA 3VTKA 1EFDN 2WQZA 1UBMS 2FUCA 4F9EA 1H85A 2O1SA 2FSIA 3H87A 4P33A 1QE3A 3FOZA 3MPOA 1E94E 2C8JA 2CWWA 2WFLA 3RJ5A 1OB5A 4GKBA 4DLAA 2PR7A 4DEXA 5IG2A 2CC2A 2ZYGA 4LSZA 3A6DA 4MDYA 4KSYA 1I1HA 1YB4A 2I7VA 3R6TA 2C7VA 5C9ZA 3FTEA 5A62A 3L0PA 3VVCA 4XSVA 1EA7A 3N2IA 4UUAA 2YNMC 4IOJA 1H1TA 2O8NA 1JTFA 3RG2A 1X15A 1QK3A 1V95A 3NTOA 4V0RA 2LTAA 5WRFA 1CLEA 1JDVA 1N5MA 1S2OA 2KWIA 4ZVOA 3EDYA 2RK6A 3DVLA 4UUOA 2VWGA 4MI9A 5HG0A 3OZTA 1H0KA 2B35A 2V4UA 3KZNA 4MOWA 2PSJA 4ZAWA 3RBAA 5D2CA 5A5DA 3CY6A 5JV5A 3W9YA 3TD9A 3AX6A 1JQKA 1M9NA 3OTWA 4RENA 5DX1A 5LCXA 2FG7C 1GOTA 2C78A 5B2ZA 5FPKA 1MQAA 1NF2A 1JPVA 1KVUA 2PBLA 3QBEA 2C94A 1M2HA 2RI6A 1TKRA 1CIPA 4PHTA 4XB6B 1X77A 2MSKA 3WO0A 3FR7A 1OIXA 4PC3A 3PEEA 3UENA 1ZW6A 3UJ3X 2OC4A 1V8BA 4RDIA 3IVAA 5F76A 3RU2A 2AMLA 3GFTA 3BMOA 3C8ZA 3KALA 3ZLUA 1IJFA 1V16A 4AJKA 5CA0F 3DV9A 3IPXA 4LQDA 1WB5A 4GOKA 4QDTA 2XT0A 4FEAA 1KKUA 3FMGA 4ILKA 3RS3A 4R1SA 3OCWA 2QTAA 4F5YA 4DSUA 4QRHA 5FT9A 2Z9DA 1Y3DE 4IIJA 1AKQA 2EHDA 1QG6A 4JP1A 5KYVA 1GAXA 2P7HA 5BQFA 1VIVA 2VJAA 3QFRA 4QWMA 5GONA 3AL2A 4X91A 4F97A 1UJ5A 3DEHA 2X1LA 3VZDA 3SC3A 3GJQA 1GTZA 5A3SA 4XAQA 2B4YA 3AR3A 1JVNA 1ISFA 1SN7A 2BHLA 3F2VA 3PXGA 2ZUEA 3VZBA 1CWUA 3SR4A 3ZHCA 1SUWA 1M1YB 1U2GC 2EFHB 1GADO 3D6NB 3F6PA 3OOEA 6AT1A 4DR7B 1U7HA 1D03A 4JBYA 4LSWA 5AKEA 4CR6A 5EZQA 5GJBA 2XA9A 4Y2XA 1T9DA 3BGDA 3ME5A 1EVZA 1A98A 1R6BX 2AX4A 3KEOA 3PZBA 5GJWC 4ZCSA 4CQMA 4Q3OA 1E3TA 1L4BA 4IEIA 3GRRA 3A4YA 4RYLA 3Q10A 4UHKA 4AJOA 3H2JA 3FCXA 3ZE6A 5DOZA 1CZUA 1XA4A 4N3BA 1GUBA 4HATA 1T6ZA 4ZWNA 4ZGGA 4PG7A 4P5PA 4BX0A 1IY9A 4LCEA 4D8UA 1LVHA 1QORA 3BE5A 4QA9A 1CJMA 1BZYA 4TYPA 1HR0B 2I2WA 2L18A 1FMLA 2PDAA 3KLMX 3NTRA 4WBSA 3ULKA 3GLGB 2QP4A 3W2IA 1T24A 1P4GA 4DVGA 2VJDA 1T1EA 3H7IA 3JXEA 1ZUHA 4LHSA 3UBTA 1DZ3A 5HUJA 5AVJA 1EGVB 1QGOA 4K9DA 1M7BA 1KR2A 3IIJA 1L7XA 1JJVA 4NPHA 1FOEB 5CUQA 3T4EA 1J49A 3OSZA 3IT0A 3LHKA 2YYYA 3HCRA 4PLVA 5FV7A 3UAGA 2PD3A 1O3YA 3MJDA 2WA2A 3OOSA 4MKIA 2NXEA 3LKDA 2DM6A 3OZEA 2QLMA 3PDIA 4PSCA 2HD4A 3PJDA 3QXXA 4TSKA 3OFNA 5DN6A 2XNCA 3MWDA 3ZWBA 2IKQA 3NLLA 4P3YA 5BSMA 3UAWA 4F3TA 1UP4A 5IFKA 1P2VA 3BOSA 3ZLTA 4CL0A 5TLSA 1XLTA 1U8AA 3ZD6A 1XMQB 1R5OA 2ZRIA 1K86A 4RIFA 1E6CA 4Q9IA 3NJRA 2DG2A 1ZJYA 5JNTA 3V55A 1C7EA 2WMOB 3I0ZA 4KLCA 5CDHA 4UC0A 2ZBDA 3CURA 4UQPA 4ED9A 3B6MA 2HSJA 3INTA 4J7UA 2FN3A 5A5VA 1ADFA 4ASUA 3Q8KA 1IQRA 4RELA 4YRCA 4B6FA 4NONA 2QU7A 3PICA 4UU1A 3PLNA 1GDHA 2J0SA 1QRDA 4HRYA 3EH2A 5CXQA 3N2GA 2WK1A 3RB8A 4Y9DA 4O25A 3O4FA 4DT1B 4NICA 2C2YA 4E1VA 1DRKA 2R96A 1U99A 4GKKB 1OYOA 4N5LA 2JLRA 4QIHA 3O4HA 4EG4A 2G1UA 1RI4A 3V1NA 2D2XA 3RTAA 1SKBA 2XAAA 3W8FA 4RJ2A 1UC9A 1OXUA 4O1MA 1SBCA 1M76A 1YQXA 3BHMA 4HWGA 4MR7A 4KBGA 3UO8B 1RABA 2B1GA 4AAYA 4C2UA 3DUFB 2PANA 3H86A 3L1IA 4LXGA 4BEWA 1YB6A 4JUIA 3KYJB 5JHGB 1JQBA 4AI6A 4UHBA 1WKBA 5CXSA 3IAS6 3FCAA 1Z5OA 4X5OA 1NUHA 2QP3A 2VHZA 2WWIA 5ALWA 1YRYE 1CEXA 1MXFA 3ONNA 1Z0AA 3HA2A 2VC2B 4RY8A 1H8ED 2ZVDA 1W0JD 2H4XA 5KPDA 1JEQA 1GKUB 1HZJA 3AR6A 3DC2A 4FIZA 1UBLS 5ANRB 4D4MA 3HN7A 1ZU5A 4KXMA 4K6CA 1NM5C 2AQKA 2YW2A 4C0SA 3U81A 1MQSA 4B6EA 1C30A 1JJAA 4HDRA 2NZVG 3IBGA 5DRYA 2JCBA 3VJKA 1T2CA 1IY1A 4Q18A 5ER6A 2QRLA 3E22A 2QE6A 2K6GA 4IRXA 4X61A 4G4SO 5IP5A 3DYVA 3JYPA 4GOMD 4DPKA 1RLUA 4XCXA 4HNQA 4M22A 4YRPA 4RZIA 4ZZ1A 3FXAA 3QPCA 4JB2A 4RNCA 3WLFA 5A9SA 5LXTA 2FMUA 2ZSIA 4MULA 3SF8B 3ILXA 4Y2JA 2IEGA 3AJEA 2DJ5A 3GGPA 1XV5A 2EARA 1DJOA 2YS6A 4BOYA 3H4TA 1JFTA 3DM9B 3FYSA 3NXSA 3RYFA 5IUJC 2AA3A 3QEMB 4TXHA 1DXHA 3E3LA 2AOVA 3F1LA 4M0UA 1CS0B 3RAJA 1J8MF 4A8HA 4TVSA 2AJTA 2QM3A 4MUXA 1SVLA 1RAHA 1IZ7A 3HBAA 5EXEA 1KQOA 3CW8X 3VHXB 3WY9A 1V25A 5G0VA 3EPHA 2XBMA 4IW3B 1UQTA 1EA5A 2GPNA 3E5RA 3GYBA 1T0IA 1C2TA 1GSIA 1RHJA 4HLDA 2ADFA 1QX3A 4LY0A 3HO1A 1WCYA 1M54A 2CYBA 4PYOA 2W42A 3U80A 2QVXX 3NZEA 4PC2A 1SUBA 3H8JA 2LKCA 1BE8A 1UKBA 1ZH0A 3OMXA 3OT1A 1FDTA 4KACA 3H7AA 4Q9LA 5EERA 3TD6A 2RC6A 4FDAA 1U7DA 1GNVA 1NLYA 2BEWB 4EEXA 5JRJA 2I80A 3IEVA 4TXJA 4ME6A 3V6MA 2IV2X 1E2QA 1ZCAA 5L4NA 1JECA 4L5CA 5E7JA 3WQHA 1XZFA 1AGPA 1RAFA 3BBLA 2B9EA 2Y1DA 4O4IA 4D81A 1UT8A 1Y1SA 2CF6A 3KB8A 3L8ZA 3M4ZA 3MYRA 3KAPA 4WNIA 5I7AA 4J4BA 2CNNA 3F97A 4L2IB 3NEAA 2J3QA 3JZFA 3V4PB 2GN2A 3DH0A 1L8LA 5FULA 4EO4A 9ATCA 4CXMA 3LBAA 5M34A 2AN4A 3WXMA 1SELA 2XSZA 3AJ9A 5JYEA 3PWSA 4Y1GA 2F3TA 3VGJA 4Z7OB 2BL4A 2JDID 1PT8A 3D8BA 5LQAA 1MOSA 1XF1A 2UYQA 2V8BA 3DLIA 2HBZA 2CVFA 4L72A 3SC6A 2WFAA 2RBGA 4MKFA 2J6BA 4ND5A 5I7SA 5JTUA 3OJWA 4B3GA 3RUIA 3HM9A 1YT5A 1E2MA 2GYVA 4WPGA 2ZRCA 4CG1A 1PSZA 1F8UA 3ZNPA 5LL6P 3A6EA 5A7FA 1K8QA 4RMGA 4KLNA 2X9QA 3GGCA 3SMVA 3PWTA 4HNTA 4TV9F 1XLVA 3K1TA 3DFMA 3MT7A 1V5GA 4Y2TA 2REQB 4CCYA 2CXOA 9ABPA 3ILHA 3U6BA 1Z6PA 1YIAA 2P2DA 3CCCA 3IRVA 3GNLA 3PE6A 1KERA 5DCYA 3KHSA 4G8BA 5JANA 1W30A 3JD1A 4O3MA 4ER0A 3ESAA 1MIHA 1H93A 4MQFA 4YMSA 4KXVA 3WYAA 5C5IA 1XNQB 3H5AA 4FPXA 2H6EA 3ND7A 5AFSA 2LNDA 2VPQA 5E1OA 1YE8A 2WD7B 3FVQA 5DGIA 1Q91A 4XOUA 1AO0A 4MWCA 1SG0A 4MVJA 2X9LA 1CUBA 1J0CA 1GZVA 1UXGA 1E3LA 3GJZA 2FEWB 4MW4A 4BX2A 3G23A 1ECGA 1V1MA 1LLDA 4ND8A 4I36A 3NAQA 2FR1A 5EUMA 5BYKA 4JP8A 2ZI9A 4R2IA 3URMA 1B93A 3M9WA 1PSWA 2PKQO 1A72A 4K1LA 4KXNA 5F7OA 1HV8A 3DOFA 2GEUA 3HUUA 3R2JA 2EDCA 1G21B 1NN1A 1OVGA 3BC1A 1FVXA 1YQUA 2X7HA 4WINA 1UEXC 3GDWA 2BM9A 2PZMA 3F5DA 2BFBA 2D1RA 2PKXA 3GCGA 3ITDA 3M6AA 1HF3A 4R71A 3DMRA 5LQJA 1DE0A 1GSAA 4FU0A 4INZA 3H4VA 4RK0A 1KOGA 1YI8A 2C1XA 1S01A 3PEUA 2VJOA 4FC6A 4N0PA 3SFVA 4KVFA 2NQTA 4NDNE 5K4GA 1G16A 1Q77A 4KX3A 3UGQA 3IBTA 2HMVA 2PCJA 2ZYVX 3ESBA 4M0DA 3B7PA 5IDYA 5L6MB 2NSJA 3ETCA 3AFHA 3H2SA 1RHQA 2YJZA 3OA0A 1FTWA 3OBBA 4QXOA 4TKUB 3TQOA 2YL2A 1ADJA 4CMIA 1ZRSA 2PVCA 2YBEA 2CLHB 2BISA 3MC1A 4OQQA 1WP4A 1DIAA 4QPPA 5DHTA 3EHEA 1E2IA 2QQEA 3T41A 4B3HA 2VUHB 1YF3A 2QKYA 1J33A 1SHKA 5B7QA 2ZRAA 1WHSA 1EWYA 4R7ZA 3H2BA 1DELA 1W34A 5FWAA 1I3MA 3CW2A 4YT2A 4UU7A 5EJ4A 1M7GA 3E7WA 3BS4A 3SGLA 1PGOA 3OLXA 5JSYA 2ATEA 3WLTA 1QH8B 5EJ9A 4QECA 2A1UB 4C29A 2H0RA 4AX4A 4KK3A 2FV8A 4KHPB 1SHZA 2A9RA 1JAYA 3DE4X 2BJVA 1E5QA 5L3ZA 3RRNA 4OI0A 2WU0A 3QU9A 4MVWA 3ZDBA 4YB8A 5IWCA 4B48A 1THGA 1XQVA 1HK7A 3BZUA 4GPTA 5HKKD 2RGBA 2CE2X 2WTXA 1OZHA 3TW0A 4YFYA 4YJFB 1X80B 4UEQA 5IAKA 3VR6H 3CA8A 4OREX 4QU0A 5CCXA 1EGAA 5CYOA 2XNJA 5IW8A 5KTRA 4V2UA 2AYZA 1ADCA 1SZDA 2VDVE 4P31A 3QSGA 1N5LA 3AF0A 3F46A 4K9PA 3VV3A 3SJUA 1KQPA 2QTFA 4J6FA 5EIEA 2GUGA 2B7LA 4OAPA 4NSNA 3UMRA 1QPZA 4IDNA 1CYEA 1RHUA 2JJYA 2QVCA 4HBGA 1GPLA 1WVMA 2A9FA 4M0LA 4P6VF 4Y67A 4BMXA 1K7CA 1XT6A 4QFMA 4TT8A 1E4YA 2IFTA 2QJTA 5CPFA 3LPNA 5GVRA 1E0DA 5EP3A 3RSSA 4IJWA 2H59A 4R9RA 2PUHA 3KQHA 4EGQA 2BI4A 3BZWA 1XTIA 2G0TA 2ZB2A 3HJNA 3NTLA 5AI4A 2VS1A 4WZAE 1P45A 3DHEA 3G17A 1L9XA 4Z8XA 4OAOA 3GT0A 1LLFA 1DQYA 3ND9A 3E5MA 2BM0A 4RJJA 1UWCA 1NQVA 4ZO9A 1L5NA 2ZRLA 4O4JF 3H84A 3T0IA 4FYHA 3WDMA 1JAIA 1KIFA 1PJTA 1R0ZA 1U2RA 3EZYA 2AVNA 5TF4A 1VPDA 5DH9A 1BAPA 4G1FA 4EFLA 5JCZA 3INGA 2ISSD 2QN2A 1B73A 3E0QA 4FLFA 4LXUA 1C1DA 3SI7A 3IAFA 4LNUB 3RUCA 3EZ9A 8MHTA 1U3TA 3T6KA 3LPDA 3ASZA 3LS2A 5BRAA 2SKDA 4B3MB 1LLCA 2DQ4A 1I2DA 2J5XA 2JFZA 5HIKA 2P77A 3H8SA 4ZAXA 3BRWD 4Z1MD 4C3ZA 1B2LA 1SVSA 4AN0A 4D0LB 1JH9A 5IARA 5K6TA 2MT9A 1H0RA 1AZSC 5LOVB 2AS0A 2R7KA 3R3XA 3E3NA 3SM9A 1SVOA 2ZT8A 3DMTC 1VL8A 3AUXA 4JOCA 4QBGB 5E4YA 2Z9CA 2DLCX 2GLXA 3GPLA 1YC5A 1MZPA 4FB4A 2AFIB 4XPZA 4WKPA 5DYYA 5BV2P 2B8JA 1X9GA 2JI4A 4KQXA 5KDLA 3UFXA 3ZZ1A 4CF4A 1LUAA 3WTCA 5J4VA 2XI4A 3AB7A 3C3JA 4P81A 2A0KA 1KEKA 1I5OA 2XZOA 1KZYC 3ORSA 1O87A 5GVSA 2H1LA 1A50B 3SKXA 3JATA 4HTAA 1BMFD 3Q6NA 3KAKA 3F49S 3IC5A 4H7HA 2ZB4A 1XVUA 1EAYA 4IOMA 2ZI7A 5KEIA 2CMGA 2IH4A 4NFSA 1C8BA 1Y3FE 1YDGA 3RVNA 2P9QA 3GROA 4J1TC 3AKZA 1PP4A 1P6XA 1SCDA 1G291 2H2GA 1V9LA 1W94A 4I0WB 4IMRA 4B6GA 3UXHA 3AI3A 4D4LA 2V0CA 4NV0A 1NXWA 1SCKA 3IPLA 3GARA 3KB1A 5JTTA 4IUDS 2GZMA 3QLJA 4HYQA 1N2ZA 4EBFA 2QNRA 1BFDA 4IWNA 4XGIA 3F7TA 1YZUA 1JHXA 2FOXA 3QUAA 1D07A 1K6EA 2UYHA 4YRRA 1VYTA 3VPAA 3CRMA 1GPDG 1T1GA 1PI3A 1H2XA 1E1QA 1TUEA 1X70A 2M2IA 3KU4A 2P2NA 4KO8A 4RVNA 2BC9A 2ZP1A 3ZBTA 3EGVA 1O95A 3R1IA 1PW7A 1SOMA 4D1YA 5DV9A 4OJQA 4U7WA 1XAHA 4INPA 5KUTA 1MGPA 3HYTA 4MUMA 4HYYA 2AWOA 1EM8B 3K9QO 5D3ZA 1K89A 3KXLA 2CNBA 2G5PA 1UDCA 2WW8A 1A8HA 3C7CB 3GEPA 1KJNA 4HAOA 2F00A 2BKAA 5DLDA 4KWEA 2J3EA 1Z56C 1IY8A 3CLVA 3PF9A 3NV9A 4GOXA 3U4MA 4PFQA 4K7JA 4RHEA 1H6AA 1HFKA 1R5NA 4OOFA 1STOA 2NU7B 4ZQGA 1GPJA 2ZCVA 4E5VA 3AFIA 2ZYSA 1F14A 2PS1A 1SH7A 3BTOA 3AVPA 3GBSA 1DIRA 4JK3A 3UUWA 4EYKA 3FSRA 2HJVA 3WMRA 1WSWA 5L95A 2IZ1A 4RX1A 4Q02A 5ARBA 1AQYA 3OX1A 2GQ0A 2G9UA 1I7LA 1PL7A 4X6YA 2M6KA 5CDTA 1JSZA 2RG1A 2DTXA 2ZSFA 2PWYA 4EI2A 3J80A 1XJ5A 3JQ7A 1OXXK 1T5SA 3T12A 2HF8A 3BQNB 2PBRA 3OPYI 3AR2A 3CR3C 1X1TA 1ZJ5A 1XDZA 2G40A 2ZDGA 3HBMA 3PF8A 4QDUA 5IZCA 5JAMA 4O3FA 2XBUA 4GLOA 3ET5A 1U9IC 3D43A 5D3MB 4DA6A 1IN4A 3LX4A 3TNFA 3ZC3A 1CUFA 2E4ZA 4FKZA 1N0WA 2OB1A 4W8HA 2QG4A 2JLWA 3W77A 4ARZA 3W5HA 3N70A 3WL3A 4FGSA 5K3BA 1EP2B 2JVKA 3HKBA 3K0EA 3V34A 4AJPA 3TL6A 5DHSA 1CU1A 1V8FA 1DKMA 1FYDA 1JEJA 5BPFA 3I6ZA 5HW0A 1UBUS 4RJKA 5FX2A 3UTDA 1ZOOA 3H2KA 3VU9A 1XXHA 1LBIA 5J23A 2P75A 2WTUA 3CIOA 1TTQB 1W7AA 2HDOA 2UUPA 4E31A 3C6YA 2J6CA 2QJFA 4S12A 3PQ8A 3X2EA 1IPFA 1HDIA 3G2OA 3BJEA 3AT1A 4GS5A 4I6GA 4KZKA 4XYGA 3WQBA 2IHNA 4PWYA 3TOSA 1TJ3A 2BJWA 2DTDA 2DFNA 2WIGA 3B1FA 1DWOA 2GAFA 4Y1EA 2Q2OA 3VYRB 3ZW9A 1KI7A 4KU4A 5FYDA 2O3QA 4FT4A 4A8JB 3TXXA 4Z3DA 5CCBA 2ESRA 4V0QA 2JCGA 4RKFA 4U5QA 4YGYA 1SHTX 2QUHA 2HQSA 4R7GA 3OM9A 3SC2B 3WYFA 3CRNA 4L7QA 3ABRB 4GGMX 4Q03A 5AJTA 2C7BA 2QE7A 3T7EA 1KARA 1UBFA 4KAAA 3AR7A 4F5EA 1SBZA 2J8ZA 1IH8A 3BF7A 3PUJA 2WUEA 2BGRA 1X74A 1O9GA 4P3NA 3RRBA 3LKBA 1H9CA 4CKCB 6GPBA 3VPHA 3ZS8A 5KTTA 2C0CA 1X14A 3H0EA 4G0XA 1VHJA 1W581 1DO8A 3A25A 2QRNA 1GCIA 1GQYA 2C3PA 3EUFA 3I2GA 3U4HA 3V42A 1EBUA 1A7KA 4KXYA 4BO2A 4ENTA 3FX2A 5E9QA 2TRSB 4NH4A 3BJIC 1KMHA 2C8LA 3QA9A 4HFMA 1X1SA 1U8EA 4L0DA 1NW6A 3ENKA 1G3IA 3GVCA 1VSQA 1F0KA 1GRRA 1RYMA 1W9MA 2YNMD 5FTKA 1GPH1 1WHTB 2YR0A 4Q3LA 4XX0A 2N1MA 2R47A 3FB4A 4IH1A 4JY7A 3HJAA 1XJ0A 4RKEA 1KO1A 4Y2HA 4DA7A 2HRQA 1F2UB 3W7BA 5A1JA 2RH8A 1KJQA 3NORA 3USZA 4EAAA 1FSZA 4FX2A 1U04A 3IVRA 3PKIA 4QOGA 4QQRA 4QX6A 1GNLA 2JBAB 4XVRA 3SEZA 2F9FA 4Z2AA 1EG2A 3RKRA 1WVIA 3UK6A 1D0VA 2CSXA 2OK7A 3A11A 4GVPA 4KYIB 5E2IA 2R4TA 3ZE0B 2AHRA 3HBLA 4FE4A 2VBIA 3V48A 4R9NA 3B7WA 3FFBA 2Y1KA 1WWKA 3UMFA 1HMYA 1U0GA 2IXTA 2R65A 3Q8WA 4PZLA 4B3FX 5CB4F 2FMFA 4R8MA 3M5DA 2Y67A 3FPGA 3G49A 1QCZA 4Q4AA 1U3VA 3GT4A 4PYKA 1MEJA 1E5TA 4B81A 2ZJ6A 3QVJA 4AN4A 1NKTA 3UWPA 1UAYA 4RJLA 4HLQB 1Z6GA 3U39A 2PKYX 4MYUA 5IBRA 2RHGB 1PRYA 5IT5A 3MERA 4JBXA 4U2KA 4F06A 4YPOA 2BKUA 5GP1A 3CLHA 3JPWA 4K8OA 2WIAA 2ODWA 4XWGA 4E03A 2FF5A 3ZGXA 1XNGA 1Z08A 3CLKA 2FPGA 4MV4A 2PX2A 3BMQA 1CY7A 1U8CB 4PGFA 4MV1A 3TLGB 4V0ME 5AKKA 4I4TF 3VNSA 1Y5LA 4DDVA 5DK4A 4CL2A 1XTRA 3NIDB 3ZVLA 3EN0A 2AZMA 3NUZA 3RLFA 3WKBA 4TV8F 1FYEA 3EISA 4CIDA 1ZSYA 4BEBA 3SVLA 2N0SA 3GLIE 1Q3HA 2E5FA 2RHTA 1U1FA 2EYQA 2W8BA 5AJYA 3UK2A 2DECA 3WGZA 4ZO8A 5JAHA 1T0UA 4K9OA 1F7UA 5AI5A 3EF0A 2BV3A 1Y42X 2XRZA 3KOWA 2IIPA 1GD1O 4XVQA 1XN1A 5KO2A 4F60A 3OY2A 4JWTA 5DB4A 2WHQA 3TMKA 1DMRA 3LW7A 2EF1A 2C2HA 2IUFA 1IM8A 2WNHA 1NG1A 2CMHA 4RH1A 4RM3A 2GN4A 3AFNA 1ZUNA 1OXBB 2H5JA 5CFQA 2VXCA 2V6BA 2IELA 4RGQA 4EKDA 1ZQ9A 3LX6A 4RGVA 1D5WA 3MK31 3CN9A 3ES9A 2WJAA 3QRWA 1QH9A 3C43A 1LDEA 5AKJA 4R1NA 1V7QA 1H8HD 2JIZD 2X2FA 2ZSUA 3NBUA 3WMFA 4EFNA 4PR3A 2YWEA 1TVCA 3PRJA 3QSYA 1K5HA 4FFPA 4MI6A 1IULA 2Z57A 4RJTA 5B5SA 2C82A 3JALB 4TV8A 3AVOA 1C0EA 3H0CA 1SIWA 4BTLA 4JXJA 1MORA 3UV7A 3DHWC 2F3SA 1UF9A 1XSEA 1IVNA 3IRUA 2BDUA 1SQ0A 4GI2A 2JHFA 1G6Q1 5E2BA 1JHYA 4IWXA 2KYRA 4CUZA 1CUJA 1HFJA 2YHAA 5L3SA 3Q88A 2NU8A 3A3YA 3EWIA 3SZMA 4DSAA 3GLFE 3PC8C 5AICA 1XEXA 1KOLA 1ORHA 1AT1A 1YO6A 2EQBA 4MW2A 1NYQA 4YRIA 4HXEB 1OT5A 2GSWA 2Z2KA 2A78A 3JWIA 3LUFA 2BKXA 1C50A 1JLKA 1QVWA 1ZVMA 1ZD4A 2VP0A 2WHXA 4YJHB 4J3NA 4EX7A 3PPXA 1P2TA 4R0NA 4UCQA 2RH9B 3O8LA 4FXOA 4HN9A 4KGVA 4TMTA 3WJAA 1EI9A 5KTMA 2PCLA 5M5BA 3ETEA 3KVOA 3NHSA 3DJYA 4QUAA 4NAVA 3SEQA 3FNGA 5I4KA 1HT2E 5KYNA 1QR2A 3EBPA 1O7JA 3SHOA 3ZNQA 3QNMA 4LDPA 3P26A 1HFEL 2A5LA 1VJTA 3M9LA 3BL5A 2VRCD 3EG9A 3LUAA 4YCJA 3K0AB 2CHEA 3CV3A 1WMBA 3LVFO 5IVHA 5IM5A 4RSRA 1EU1A 3WFIA 4LTDA 4UUPA 4X41A 1JPJA 3K1JA 1X8XA 2YV5A 5HZGA 1SMKA 5T67A 2V6JA 4EHAA 4MMYB 1FP4A 1BD3A 1V45E 3KV1A 3L7YA 4Q3BA 3FLBA 1LVUA 4TLDA 4UU8A 2XYHA 3T3NA 2AXNA 2BLNA 1Q1NA 4GMXA 2CLKB 4KN9S 3U62A 1YRAA 3QX8A 4R1LA 4BE7B 2MCFA 3F4LA 4UBKA 1RS0A 4CI9A 5H4GA 3IHKA 4WE3A 1TQHA 2BGMA 2X3YA 3KG2A 4TWIA 3CVVA 1L4EA 5EXSA 4K1XA 1AS2A 1RCTE 1A5BB 1W5EA 3NQ41 1QH0A 1P1KA 1WW2A 5T57A 4BLWA 4ZHSA 5HM8A 1Z39A 3FPSA 3BFXA 4JEMA 3ZDQA 4JLKA 1A8UA 3IT1A 4YJ2B 4ZGWA 3PHBE 1G20E 4AL4A 3O8CA 2YN2A 1AXEA 3DYBA 3CZMA 4P53A 2CEAA 2VG8A 4PVDA 1I6WA 1SUPA 2FH5B 3IODA 4TRRA 3MW8A 3R9XB 2ACKA 1AMNA 4L9WA 2ZU0C 4L8WB 5DHPA 1FYXA 1BCRA 1DTWA 5KHAA 3JARA 4CDMA 4J4TA 2RGCA 1C0LA 2SECE 4DMMA 4RTPA 3I8OA 4KGXA 2R8RA 3PJEA 3ZTTA 4CU5A 3RS9A 2DOKA 1GN9A 2WG1A 4BY9E 3UMGA 4IXDA 5K0GA 1YB5A 5HCIA 1J1UA 1NI4A 4UARA 4HMOA 3E8MA 3C3AA 3NHJA 4R2XA 3CBQA 4E11A 1R9MA 4C4SA 5BQPA 3NU1A 3WK6A 2Y66A 1W93A 1T2UA 1XU7A 3DTTA 3RFXA 4EKNB 5C4IA 5IBCA 2R84A 4KHZA 3G9QA 2AQHA 4CF6A 1U0FA 1V8PA 2QT9A 4Q3AA 3UAYA 3CH7A 2OCGA 3MNFA 3HO6A 1Z62A 1E9EA 1OXKB 3EZ2A 5EHQA 3BSSA 5D85A 2AFVA 5K0LA 3ZZTA 4TS1A 3IIMA 4BFXA 3VR6A 3GBVA 4BUCA 8LDHA 5KTYA 4FGUA 1WLYA 3U4AA 3V4RA 1EG7A 1JQLB 2A94A 4MA0A 4OFZA 5EP1A 3LW8A 5DHUA 5GJVC 2OVFA 1NJ6A 1MOZA 4IS3A 1BXRA 2K4MA 3DC7A 3MUFA 3P9CA 4P83A 2A0UA 4CM8B 2BFCB 3TKLA 1QIFA 1W85B 1R2QA 1YB1A 1Z47A 2KMLA 2QSZA 2DY0A 1JZTA 3ADKA 3PHGA 1OY1A 4RF2A 1X7ZA 3VZCA 1AS3A 5ADHA 5CX1A 4N0QA 5DWQA 3EWAA 4QXAA 3N58A 4D8WA 2D0DA 1CTQA 2GXUA 2X0KA 1Z5ZA 4KR0A 4TSFD 1RZRD 3A9SA 3IQHX 1GRCA 2VZLA 3ZQ4A 1UBKS 2DHEA 1F5SA 1ADYA 2C8VA 1ZH2A 3WK4A 1UMDA 1ZUD1 2PY6A 3KQPA 3EA4A 4FC7A 4GXRA 1EINA 3TL2A 2PZGA 1VL1A 2CL7X 2F48A 5IYZA 3NMUF 2BBWA 5A4DA 4N6GA 5DT9A 3WB0A 4FCVA 3E2IA 3K3PA 1NNSA 1PT6A 1NUSA 3E4CA 4CEIB 4P22A 4Q4JB 4TTRA