1ZLYA

The structure of human glycinamide ribonucleotide transformylase in complex with alpha,beta-n-(hydroxyacetyl)-d-ribofuranosylamine and 10-formyl-5,8,dideazafolate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylglycinamide formyltransferase
publication title The apo and ternary complex structures of a chemotherapeutic target: human glycinamide ribonucleotide transformylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zlyA00
1MEOA 1RBMA 4ZZ2A 4NV1A 1S3IA 2FMTA 2YWRA 1RBQA 2BLNA 3AV3A 1FMTA 1YRWA 4S1NA 4ZYXA 1RC0A 1MENA 1MEJA 2BW0A 4EW2A 4TS4A 1RBYA 3Q0IA 4YFVA 4TTSA 1NJSA 3NRBA 2GARA 3W7BA 3DA8A 3DCJA 4EW1A 1RBZA 3TQRA 4ZYUA 1C3EA 1GARA 5CJJA 4ZYWA 4IQFA 3O1LA 4ZYTA 1ZGHA 4ZYZA 3R8XA 4PZUA 4TT8A 4EW3A 3AUFA 1CDDA 5J63A 3GARA 1ZLXA 1GRCA 3KCQA 4YFYA 4DS3A 1JKXA 4Q12A 4QPDA 3TQQA 3N0VA 4R8VA 1CDEA 4ZYVA 3P9XA 3LOUA 4ZZ3A 4ZYYA 4QPCA 1RC1A 3OBIA 4ZZ1A 2CFIA 1C2TA 4ZZ0A 5J9FA 1ZLYA
chains in the Genus database with same CATH superfamily
3NHFA 1VB3A 2C88A 3CWCA 1V16A 3VC3A 1R6AA 2Q5JA 3ZU2A 3G49A 3ZX4A 2V55B 3K0AB 3ORSA 2HRDA 2A88A 1Z13A 3LPMA 2LCQA 3GLIE 1G8HA 1CJSA 1P2SA 2ZYRA 1YQTA 2ZTSA 4MW7A 3ZU6A 2AXEA 1QDLB 5HF6A 4CR6A 5K4GA 4DEXA 3T1YB 1V9LA 4QGSA 1CU1A 1QTQA 4OD0A 1P18A 3WYGA 2BP7A 1PFVA 1AKQA 1UBHS 2V7QA 3A6GA 4P5EA 4RQTA 1FCJA 2J45A 1TK3A 2PGLA 1AB6A 1E94E 3LCVB 3HRHA 1XRNA 1RC0A 3I9JA 4IIJB 1FYEA 5AVZA 3E9MA 3AR8A 4WXYB 3ML1A 5JMOA 4MQUA 2F55A 1VPVA 4DLPA 2I2CA 1L7AA 5KQRA 1H2AS 2PL9A 4OSPA 2A35A 4U7TB 2QSZA 4YV0A 3R0XA 3L8MA 2P77A 5H81A 4DBVO 2XI4A 4E70A 1YT5A 2WM3A 2YWGA 3ZDRA 3AVTA 1UMDA 4CLHA 2AFHA 5JISA 2ZE6A 3H5NA 3QA3E 5A7GA 1GA4A 1KXZA 2A30A 5F7XA 3X1DA 4EK9A 4IV5A 1OT3A 3HSKA 1NY5A 4IJMA 1TAUA 4PC7A 1TKAA 2B69A 4YJ2B 2CXPA 3F47A 9ABPA 1KDRA 4IUBS 2XQIA 3UB4A 2NV0A 2ZVDA 5I4IA 3L41A 3REOA 1V7ZA 1AVTA 3A36A 1DO2A 3MEQA 4OB6A 5P21A 4E5YA 3AF2A 2CXQA 5CB4A 1TYAE 3OTWA 4CGYA 3ILHA 2CFCA 5C8YA 4CQJA 4J0CA 5L7WA 4FBMA 4KQJA 1ISHA 4N03A 4YH1A 2A84A 2ZJ6A 3DVRX 2D1SA 3DQZA 5J5AA 1IWOA 1BNCA 1LS6A 2BBSA 2QQFA 4V0RA 2BTQA 2Y4OA 3CPSA 1XWWA 3TKAA 3ER9A 1SM4A 1W0JA 2YZGA 5K4HA 5LM3A 5LQKA 4YECA 4CEIB 4F4IA 2R47A 3UFXB 1ZVVA 3BK2A 4UNPA 4J16C 1QVRA 1V3TA 2VHWA 3WWZA 1W46A 2X23A 1DTEA 1NC3A 1FDWA 1ZPDA 2VJMA 2X0NA 3DDOA 4WASA 3DT9A 4XIJA 3V7UA 1F38A 1SPXA 4DNXA 3DV2A 2C5LA 3P5BA 3KZNA 3PP8A 3VU8A 2DQSA 4HAXA 4BFTA 4CLOB 5J4YA 1E4OA 1CQIB 1YRAA 4GOMD 1PYDA 3GWGA 1XDBA 1OXXK 2GN0A 4NCNA 4PFSA 1KYTA 4QGFA 3UW3A 1S0UA 6PFKA 3WYBA 4R1MA 1OAOA 3FWZA 2XXAB 2HMTA 3DXFA 3VQTA 3M33A 4ER5A 1SEPA 2ZSHA 3DKRA 3WRYA 4DQVA 2X1LA 1VXRA 2JAXA 2JF0A 1ZAKA 5EQDA 4JI4B 4D44A 1YBMA 1ILEA 3DVQX 5DSZA 2OHJA 1I2BA 2VQDA 3VI3B 2JHAA 4M76B 3D02A 2FSPA 2WJZB 4H15A 1SC4A 4OGWA 1YDGA 3RADC 1W5SA 1A9YA 1E69A 1PNTA 3DMRA 2WD7B 3HBLA 2VXOA 4Q1BA 5LUBA 4KAXA 3S2FA 1E20A 1V7QA 2JFOA 2PWYA 2Y1LA 1BXKA 3EZ2A 4II2A 2PN1A 5E3JA 5GAJA 1E1QD 1IY8A 1GFIA 1V5EA 2BMWA 3ANYB 1QCDA 2ZBVA 3AZQA 2PWBA 1QE5A 5EMHA 4ALJA 4IDQA 2QUBA 1FX0B 4RY8A 1QRUA 1FDVA 4BLQA 4DWJA 4L4SA 1JR2A 4GPTA 2QXTA 3P4YA 1E6UA 3OFSA 1A0OA 4JLWA 4UPVA 2WWGA 2GAFA 3HPRA 4A92A 3V9AA 1ZN9A 1W48A 2IXFA 1N2SA 1EZZA 1PZNA 2EAUA 1FLAA 1HE2A 2LRHA 4NJMB 5EMKA 5GJBA 5DXAA 1ESZA 2PHZA 2VG8A 3DNMA 4B0OA 1JHRA 3TLYA 2JD2A 2ARKA 2R6CA 5A05A 3EC7A 4QUEA 1NKSA 2ODBA 4BN4A 3MTEA 1J2RA 4PRKA 4HNHA 5EP1A 4AJLA 4A8HA 4MS1B 4G65A 4Q6BA 3GA7A 4QNRA 1XOIA 1BN7A 3ITKA 1WVGA 3PXCX 4I9HA 2BMVA 4K0RA 2YINC 1KE1A 2XGJA 4TRNA 1WZCA 1Z0ZA 2AR9A 3R0QA 4OMDA 1MOSA 1YCFA 3QWAA 2IK8A 2HBYA 3PUKA 4NVRA 3RT1A 2OAEA 3NDIA 2A0FA 4CDMA 1NYRA 1PK9A 1EVJA 2WKWA 4I1VA 3Q3CA 4TL6A 3AUSA 5F7JA 1G8KA 1YVEI 4X24A 1A72A 1BW9A 1EWTA 2WJWA 2ZSEA 1RLTA 4RHEA 2O3TA 4OJYA 5LVAA 1PJTA 1E2FA 1PNVA 1R6VA 3QK7A 5E3HA 4LJRA 5IJ0B 1CJCA 4NE9A 2OB1A 3DGEC 3AIOA 1ATIA 3HKCA 4LJ4A 1Y5LA 1O95C 4G5YA 1VJRA 3EF0A 1NQAO 4L5CA 3UOAB 3M6IA 1T8YA 2EQ5A 3GFBA 5TQ2A 2EX4A 3QE9Y 2ZXEA 4CTJA 4ESEA 2R8RA 3VJRA 1FUEA 2R85A 3RBAA 2B3DA 4URWR 3VYWA 1M0WA 5I7RA 1ULUA 2OSBA 2C7GA 2EWVA 1A4XA 1AUXA 1T8TA 1Q7EA 2WW8A 2V7VA 3REGA 3PB3A 2C58A 2CYAA 4Q7JB 5C0OE 2R00C 2HEGA 3TW8A 1HX7A 4EHDA 4B44A 3OZAA 1U3GA 2EVWX 3OY7A 1JFVA 2D5BA 4E3ZA 3BT7A 1BE8A 2ID7A 3FD8A 3F5FA 1M73E 1VPTA 3EASA 1GPBA 2YRWA 3IQZA 4ZVQA 4G1FA 4DSOA 1TJYA 1HDEA 3M2TA 2XOKA 1DXYA 3O4JA 2HPAA 2EFGA 3P0JA 4QUIA 3RS2A 4AC9A 1JG3A 1IWBB 2OE2A 3TW6A 2V7TA 2IZ7A 4MUXA 1BQEA 4DBLE 1FW8A 1MGPA 2NU6B 3DDZX 5FI3A 5HIMA 2IV7A 4D41A 3OFNA 2PXAA 2V59A 3NHUA 1XAGA 1ZNYA 4MS3B 4W9NA 4P4SA 5AVVA 1QHFA 2VI5A 4MW9A 5C8XA 4CKZA 1A98A 2Y1KA 5HS4A 3KLMX 2EZ9A 4GZ3A 1KSJA 4S3MA 4AFNA 1FPQA 4ZK2A 4DR4B 5KTPA 3G7UA 5JS2A 3G79A 3IJPA 3D3WB 1UCFA 5CK5A 3SYRA 3KWLA 1G5PA 1B2LA 4KGZA 4ZDJA 4OK3A 1YACA 3TVTA 5JBNA 4A3SA 3ZDQA 2DT8A 3TZEA 4PQYA 1NR5A 3AFGA 3IURA 1IY1A 2IYUA 1QV9A 1CZLA 1XJ5A 2GAAA 4HF7A 2Z95A 4E46A 3O2JA 5BOVA 4LC9A 4NCHA 3VKHA 3ZQ6A 3D6MA 1WSDA 1J70A 4I14A 1TAHA 4L51A 2XMDA 2YY5A 2UUOA 3F1KA 1KP2A 4AS2A 3EN0A 4DIDA 4Z4FA 4WGGA 2AGVA 3WJAA 2CXRA 2ZTUA 5ECGC 1UDXA 2P6NA 3ET5A 3O95A 3M1IA 2C9DA 1EFRA 1YRWA 3GRUA 2FW7A 3OJOA 3GDGA 1CEXA 3PC2A 4FQ7A 2O5EA 2CLEB 3F8TA 3KO8A 4FHFA 1GNVA 4LJ6A 3ZHRA 5IBCA 2ZATA 2HCFA 1JFSA 4IKPA 3PUXA 2QMHA 3IP9A 4AO7A 2OV4A 4ZOLF 2SKCA 3VR6H 2HQSA 4RKRA 5CNMA 2O50A 2VPIA 1A27A 4GLFA 1ZUIA 4YP5A 4PVCA 2ZCUA 1LI5A 2VT2A 5AQ1A 2OAQ1 2EJUA 1MNAA 1DHTA 2PRSA 4QBIA 3LT2A 3VV3A 4AMZA 1O6GA 1JF8A 2HSWA 3U3ZA 4DOMA 2XW6A 2V3WA 4KXVA 4E2XA 3DMGA 3KBOA 4R40A 3FHOA 3QPAA 3P2EA 3ELBA 1KEVA 4NBRA 1LLDA 3HR7A 1EDDA 3KKPA 3PC6A 4HVAA 1FBNA 4QLOA 4CF3A 1E79D 2H4WA 2BMEA 2XDWA 4I1OA 4LSZA 1PYGA 3TH5A 4XW2A 2QAIA 3EZLA 1T4CA 1IXRC 3OX1A 1P7VA 3EUAA 4UHBA 2IXTA 3GIWA 1QANA 5EKDA 5LDHA 3LQ1A 1JEQB 3IJEB 4WFIA 4X20A 3SXJA 3GT0A 3HDVA 1MDFA 4L0MA 2FPIB 4BKQA 4X85A 1VBMA 1ZD5A 2OXCA 4F2GA 2VQSA 4P3PA 5D01A 3BJZA 1M8PA 4I7EA 5MF6A 4RZ2A 1UM9A 4P82A 3E1KA 1DKOA 3TVDA 3OQBA 1GPUA 4YIKA 5T8KC 2J6CA 2P79A 2H06A 3E5NA 3MBOA 3P9SA 4QASA 5D7BA 4RGQA 3S1SA 2A86A 5JAOA 1UXHA 5CB0A 3CLUD 1EUCB 4UAGA 5TF0A 5CA1B 1KAEA 4U6NA 4XUDA 2H0AA 1NSYA 1RAFA 4PLTA 4F97A 4MJXA 3RSOA 2B8NA 2JG3A 1WBJB 3GAAA 4GR4A 2I4MA 3BCSA 2R6GA 4MITA 1N77A 1FYFA 2YXPX 4OIMA 1PDOA 3LW7A 3AF3A 5B3AA 1H65A 1XAJA 3RDPA 3BE6A 5HIAA 3AW8A 3OCCA 4O4IF 2C7BA 4B9AA 3LTNC 3BHMA 2O1EA 3MELA 1WETA 4G0WA 4GYYA 5ALQA 4LSGA 5BV8A 4F38A 3G3EA 4HQKA 2PSJA 2AOUB 4XWGA 4IOKA 3A2LA 3LUHA 4HTFB 1CR2A 2X8JA 4IOJA 3MBKA 3PFBA 3R5JA 4M0PA 4OP1A 3ZY5A 1MW9X 3WLJA 3EPKA 1IWPB 1XRJA 4IH9A 1LQUA 1ZDMA 5DTRA 1D0VA 3UK6A 2CVFA 1DAGA 3RT7A 3WV5A 3S8EA 5EZSA 3ZKWA 1QRTA 1OC2A 1REQB 1TQDA 2QVZX 1JLRA 2ZCJA 1KEEA 3PSAA 4I1UA 2ZTLA 3GEEA 1N5LA 4YR9A 1NF9A 5LCXA 3AI3A 2O8CB 2BEVB 1NJFA 3DL4A 3ZBQA 5CDTA 2ZOSA 1IIRA 4AO8A 1BFKA 2VP9A 4PX5A 1NWCA 3NP7A 1F12A 2XWBF 4G24A 4IRXA 2J48A 1C1XA 4K9QA 5IUNC 2FEKA 3C8MA 5DPMA 1XRSB 3JQGB 3BQMB 5TRTA 4JV5B 2JEZA 3QPWA 4L8YA 4YUXA 5HXAA 5GGYA 1ZC3A 3U80A 3JASB 2FSHA 4BBPA 4IHAA 2HT1A 4X62B 1FUIA 1MIOB 2WHPB 4BZXA 1D5WA 1TE2A 2JJQA 3DLCA 2XYQA 4ARUA 1ISMA 4B74A 4I99A 1GEEA 1YOBA 3LT4A 3OAAD 4ESOA 4GZLA 1L4MA 4XJXA 3HR8A 3WYDA 3K16A 1BGWA 3WNDA 2RG7A 4WFKA 4ZVSA 2FMXA 4ILKA 5AXAA 1VKJA 1SOVA 2AN5A 1C9JA 2J46A 2PR2A 2FFQA 3GD7A 3NS7A 5DF1A 5DV9A 4G8CA 4CN9A 1QMGA 2VF4X 3LK7A 3PC8C 4C20A 1Z7YA 3BH0A 4EJSC 3QE3A 3EGVA 1Q83A 1QH0A 1DEKA 1NXOA 1RXCA 2GMWA 2M6SA 2PWAA 1AQLA 2CXTA 2FN4A 5KVCA 1YH3A 1ONNA 3EZ6A 3I6BA 4MVJD 1C0EA 2AI2A 1DG3A 4K2AA 1R0RE 3E7XA 1DJNA 4GSYA 4U9HS 5IANA 4Z54A 5AT1A 3T5GA 1NLUA 1DKPA 3VOTA 4CW7A 3N59A 4CIWA 2CE7A 1KVTA 3WYAA 4EWLA 1O9BA 4NBLA 1SZJG 3C4QA 4RF4A 3CRMA 4X9XA 2Q5FA 2IS2A 1OI3A 2IOHA 2Q0SA 2HOQA 4NYIR 4KHZA 4M6WB 4II7A 4JBIA 4WACA 1V11A 3H9CA 1R0CA 5KTTA 4IHJA 1BVHA 2JBAA 4YONB 4FGUA 4CLEA 3B48A 1AQYA 1E2DA 4U8HA 3IMFA 3ZXXA 3D2CA 2VWQA 4ZI7F 1RQRA 2ZJZA 2GA9A 4K9MA 3G9ZA 4MAAA 5M29A 3GLGE 5T6BA 4HADA 3L7NA 3VVLA 1HZZA 2P2YA 2QVXX 4G5RA 1KH1A 2AVNA 4FYIA 4JASB 4XVQA 5LOVA 2PKXA 2RGNC 5A9RA 1VJ1A 4EO7A 5KJCA 3CONA 1WV0A 3T7JA 4ER6A 1DIRA 4ZICA 2V7QD 2HU7A 4AZ0A 5BW4A 5EXTA 4AN4A 5JRJA 1RPAA 1ZX1A 3LS2A 1LTQA 2VR1A 1FW6A 5AVQA 4L9WA 1OA1A 1BN6A 1R0LA 2ALJA 3V00A 5C8ZA 1I01A 5HF8A 1PDWA 1ZD4A 4PGMA 3SYTA 4HDKB 1XRRA 2AR7A 1TOAA 4KE9A 1TVKA 4NNPA 2Q62A 3T5DA 3BRCA 4RD1A 3TNLA 3LKVA 3UQYS 5IJ9B 1IOVA 2XMZA 3AOEC 4TTIA 1S2DA 1GL6A 1IG3A 1MXFA 5FP0A 3N2ZB 4D92A 4EI8A 4Q4CA 3CVOA 3IT0A 4YT5A 4QPCA 4Y6PA 4CF6A 1GYQA 4ZCQA 4UTNA 4BGUA 2W2NA 2ZW9A 1FTWA 1L0BA 4RZQA 1POWA 1DIGA 2JLZA 4K6HA 2QUKA 4NAVA 5DCLA 3TWOA 2P7HA 4E2ZA 2C7RA 2C2XA 1VCHA 2HIHA 4OQFA 1HM5A 1Z8NA 4WDQA 1MXHA 3PWZA 2OD7A 2H4HA 4FK8A 1XYYA 3OQOA 2C4NA 2F48A 1R6TA 4TYMA 3C7CB 1ZW6A 3UK2A 1W59A 2AYZA 2OFXA 3E9NA 1BDMA 4G5OA 4GMFA 1HEIA 3VO8A 5FAXA 3D6JA 2VYNA 4JWKA 1MRSA 4JBXA 1D1SA 4J49A 1WAMA 4LF6B 1T8WA 2WV7A 4LBZA 1DZ3A 3K5IA 1QHXA 3BTVA 3L6EA 3R6GA 3EGWA 2BM1A 3AEQB 4MPPA 1KSGA 3R7DA 3N7TA 3HCRA 3KZOA 4L0QA 4RCVA 3BH6A 4X1YA 3RKUA 4JEUA 4KN6A 1KYQA 4BMCA 5TQJA 1VJGA 2F1RA 1K75A 2JK1A 4RD4A 4I8XA 4QOGA 3CUKA 2BHRA 4MTLA 4KFSA 1P73A 1L7BA 4HQ6A 2IEGA 4RO0A 5DMHA 4TV8A 2W6PA 1W0JD 4ABTA 3KOUA 2O2JA 3MT9A 3QVMA 3U81A 3J81k 2HA7A 3K1AA 3MUNA 4OU4A 3OD1A 3EVZA 4JEHA 1OIVA 3LZCA 2A58A 1FFEA 3AKCA 1ULZA 5A5VA 2QYOA 5AW4A 4Y2TA 3F90A 2IOYA 2I66A 2LDBA 2YJ3A 1ZR2A 3ZXYA 1L5LA 2W2OA 1F3LA 2GD0A 3RU7A 1XA0A 2Y92A 4A8JB 2O0HA 3RFXA 2W4QA 3DV0B 4WK2B 3MCZA 1Z6YA 4BNUA 5JAUA 4F56A 1Y8RB 4RV5A 5L51A 3CIFA 3OF2A 4G5XA 4MW1A 1EK1A 2OG2A 5JS7A 1IZ0A 2AFRA 3I37X 4MAMA 4JI6B 1UWKA 4WECA 3LBAA 1N2XA 3AFOA 3U16A 3W5CA 3KLPX 4OXRA 2J3HA 5JD6A 4QJBA 3RKSA 1E9AA 3ERCA 4KR2A 4GI7A 2P65A 3RR2A 4NP6A 1XZKA 1YASA 2IHTA 1ODJA 3B1XA 4IIFA 4MRMB 1UBKS 1U1EA 2IXEA 2PD6A 2UAGA 2J0VA 1F7UA 3II6X 4WOPA 3AVYA 2XY4A 2Q5HA 1BGXT 4KPEC 3LBNA 1WW3A 2VH5R 2B4AA 1M75A 2X7JA 4FYHA 4KK4A 4AY4A 3B3GA 1KQOA 4QECA 3PQEA 5I01A 3JTMA 4TSRA 3ZI7A 1CUGA 3V8EA 4RELA 4AO6A 2WZDA 3NNNA 3QMPA 2JI8A 2GF0A 3L5OA 4GQAA 3RIHA 5I7WA 5L8VA 2RGBA 3Q4GA 4OLHA 1XTIA 5DSTA 1YZTA 2OHXA 4KLAA 3EA0A 3L84A 2BHTA 3GB9A 1MC8A 1UPTA 4WA8A 3PITA 5DLPA 2PJDA 4N54A 5BQOA 2MU1A 3UMSA 4XB1A 3NGMA 1LFDB 3JX9A 5KC9A 1MN6A 3CH4B 4Q3OA 4B4OA 5BORA 2YIJA 3U1VA 1V7CA 3WK8A 4M9UA 5B5SA 2G88A 3KT6A 3N2GB 2X3YA 2CFRA 4I3HA 5FTLA 4KXYA 3JQEA 1HE1C 4Q7QA 1R0BA 4J1TA 2QRMA 3KEGA 4NYIQ 2C1EA 4AJEA 2P78A 2QLLA 1I4LD 3NTRA 4KVFA 3SEQA 3SEFA 5KYYA 3EIXA 1RWXA 4K3UA 1A7AA 3WNZA 5LDDC 1A8IA 3VC7A 3LJKA 4Z6KA 2PZKA 2RAPA 1OLXB 2CWDA 1NURA 5IC5A 3PE6A 3X3HA 4FKZA 4R2LA 1T5DX 5AYVA 1SVMA 2WF8A 3CUEF 4FFNA 4K1LA 1L4KA 1QKJA 4P9NA 3N05A 1U28C 3K1TA 4OQYA 1ZJWA 3U4GA 1XZDA 4QC2A 2BRUA 5LN1A 1RJWA 1VHTA 4RXTA 4RQBA 5CM8B 5F3RA 2W8BB 5AD1A 4FGZA 1AIPA 4U7HA 4M1ZA 5D3ZA 1S3IA 5F76A 3RM3A 4RNDB 1PZGA 3OKPA 5FPHA 1OUMA 5LC1A 2G0AA 1NVUQ 3WIVA 4D3YA 5B4UA 1I4OA 2QY6A 2M1XA 3DP9A 4DCCA 4EDFA 2GASA 4G8DA 1U8ZA 4MROA 2FMFA 2PGAA 4JVSB 1CP2A 4QBTA 4UFNA 3IUQA 3PD0A 3QVTA 4P4LA 4AICA 2JAWA 2EJBA 3RIXA 4GX1A 5KWSA 3PQ4A 3ZGLA 1QWOA 3JD0A 2XE8A 4Y2JA 2VHTA 3PXDA 1AGXA 2I8AA 2MSDB 3EARA 5HKBA 1ESCA 1NN1A 2I2FA 4MUHA 2FSIA 4R9VA 3ROGA 3O8RA 1RD4A 2BW0A 4PAOA 1MB0A 1F20A 1IEQA 4Z4EA 1RZ3A 3DO5A 1QGUB 2IOFA 3GFFA 2BFDB 2HFKA 1YGYA 1ECJA 2H2IA 4KMSA 4MYDA 2ERXA 2J0UB 1PJ4A 2XOKD 4KTVE 3MUFA 1MOPA 5SYMA 1FSPA 4A10A 2G06A 1N6PA 1PZEA 1SVIA 2DPGA 2FZ4A 4G63A 3RJ9A 1G4HA 5K0BA 4R98A 4JWTA 2AMFA 1W5AA 1K68A 2AFVA 2NWQA 3NHJA 1C8KA 4URZR 3OFND 3VR1A 3OIUA 4DXDA 5E1DA 2UZ1B 5DASA 1OE0A 2KX7A 2VUHB 3M1LA 1Y3AA 4KO3S 3G2QA 3O2QB 4YNBA 1AKEA 4CT5A 3IV6A 1PEYA 2AOWA 3O3CA 3R0VA 4PHGA 3F5QA 3ND7A 3SCZA 3W5IA 4ZAXA 1TMKA 1GCUA 1MQ9A 1Y34E 2JK0A 3OPNA 4CKYA 4QUJA 1ML4A 4DEVA 1ZVQA 1KJJA 1LLFA 2Q1YA 3H18A 3PR3A 2BGKA 3HXKA 2IZZA 3A6PC 2WVGA 2P8JA 4LY9A 3OUZA 1IFXA 4KG7A 5GMOA 3W5UA 4GL2A 1HRDA 4MJLA 4LDPA 3CUSA 2CSUA 2XVZA 4LNUA 4NV0A 1AN9A 2D0OB 4IWNA 4GLBA 2PBRA 3ORYA 2C2WA 4NULA 2B6NA 1PKEA 3H5LA 3IMEA 3UCFA 2YZNA 2VKTA 4O2AF 1D2GA 1YZQA 2Q4TA 4UU8A 2J08A 1Z4NA 1F8FA 2BM0A 4C78A 3AHCA 2MSWA 1CF9A 1WR8A 2Z1MA 3T1NA 2ZSBA 3VV2A 1OA0A 2C8LA 3KKMA 3PL1A 3D0KA 5JW6A 4OJTA 2CLSA 1EFRD 4XGKA 2CNLA 3BHIA 5GM2A 2R8YA 3LBFA 4QWMA 1YQEA 5F78A 1XXHE 1QRRA 3K0AA 2ISCA 4WRRA 1V6SA 2WT4A 1Q57A 5EEGA 4II3A 2I4NA 3PT5A 3IVCA 2TSYB 4J7UA 4LRYA 3GU3A 3CBQA 5DNYB 1LUAA 5A6VA 2C7PA 3K8YA 3AL3A 3GRPA 1I36A 1NVWQ 4MUIA 3OPQA 4WXRA 2WWVD 2QYHA 3ZCXA 3EXAA 4PWYA 3S0JA 4B6RA 3CGWA 4PG5A 4C4AA 1K6MA 4BECA 3RUEA 1P80A 4DQKA 4G07A 5EE9A 1P3JA 5FBWB 4YUZA 5LLDA 1ZHFA 1HYHA 1N25A 1QOPB 1P7ZA 1TJ5A 2DTDA 2IDKA 2OO5A 3HUTA 4IIJA 4WK6A 2J9XB 5EHGA 4FCTA 3EQ2A 3UXHA 3BSSA 3GFSA 1EMDA 3N2NA 4IZIA 3WISA 5A4MS 1F1JA 6NULA 3ZC3A 2A0KA 1ZP6A 2VIIA 4ZU1X 3WGJA 1SC6A 2VC2B 4Z0NA 3LC2O 4HDQB 4IQ8A 2XZTA 1N6HA 3QU9A 4ZCTA 1MAHA 2XUPA 5AVRA 4JC4A 4HQ0A 5B1HA 1M2GA 5IZCC 4D8TA 3HM9A 3TBKA 4EG7A 2OV6A 3UJ3X 5I7FA 2OFOA 3EHEA 3L8FA 4JUIA 1V1MB 5KU7A 4WNAB 1D4FA 2B4YA 2XNKA 2HUPA 4AJ2A 4YJ2A 1WXQA 1L4NA 4TV9F 3KQQA 5IKMA 3UK0A 2NMVA 3MSXA 1T6BY 2B4KA 3M82A 3UAZA 4W7HA 3JVEA 3ZE8A 5JS8A 1K7EB 1PR0A 3PNQA 2JIPA 2PD3A 4H1TA 3RSHA 5C81A 2J4CA 2XB4A 2VDRB 3W5VA 3Q8KA 1X0XA 3ADCA 2RHDA 2DWQA 4J94A 1F6DA 3KHKA 3K4PA 2WA1A 2CV0A 3GCGA 3P97A 3OPMA 4ID9A 1SXJC 1SVKA 3T06B 3N28A 1N9KA 1VDMA 3UJPA 4EKYA 5JY6A 3Q9LA 1TCAA 3TQHA 1AV7A 2QRNA 1ESDA 4D82A 1LGYA 3CZ5A 4H6XA 4CEIA 3UFXA 3OMLA 3LHDA 4KI0A 2RH9B 3A11A 4R0NA 1VECA 3RVDA 1N34B 4FHEA 4YLEA 3WVNA 1UJ2A 3O0DA 4MVCA 5HQJA 1DELA 2C20A 4BL5A 4C4SA 1WF3A 2ZRPA 3KV1A 2ABWA 2Y9PB 4FCWA 2TMYA 4MMZB 4R05A 3RK4A 4UBJA 2HRBA 4LFBB 4CLOA 5IYZF 4Y7DA 3AHJA 5HHTA 1CQIA 2IVZA 1PBNA 4PZAA 1MQ8B 3GFRA 4YRPA 2GRAA 3COZA 3PXUA 2XXAA 1UOOA 1K5HA 2D59A 3OBBA 3J80A 1FRZA 3BERA 1YCGA 4KR9A 1INLA 2QTLA 2WIBA 1PIWA 2Z2IA 1RRPA 4LYYA 4D3FA 1IHPA 2XWSA 5E9WA 3FJOA 2A7XA 2YS7A 4GOXA 1JKIA 1VMEA 1D6NA 2KE5A 4RFVA 4BKOA 4ZTBA 4MKFA 4R2KA 5LKAA 2EP5A 5J4LA 4MQBA 2W6OA 3DAPA 4OQMA 5ALRA 3K8QA 3N2YA 4DHWA 3OE5A 1QB8A 2R65A 5LDGA 2BI7A 3LWNA 2IYSA 4DNOA 2WD7A 2JNWA 3GVCA 4O1MA 5KSPA 5JMTA 5CGQB 4BE7B 3GNSA 4RJLA 1P5JA 5F77A 3ZE7A 1W4CA 4BYGA 1C3XA 4CODB 5CCEA 4DILA 5JXIA 3IT3A 1DV2A 3L18A 3NOVA 3PEUA 2ONJA 1USVA 1F5NA 2WD8A 1SKMA 1A9SA 1W6UA 2XUHA 4R9SA 1X6VA 2C00A 1FX0A 3N0XA 5GJVC 4XWKA 1P0PA 4OVKA 3S2UA 3T7DA 1BHSA 3NDRA 4XFDA 4DVJA 2VPTA 4Z0PA 3OZ7A 1RC1A 5H70A 4F7DA 3VR3A 3O3OB 2NVWA 4PGGA 3DWIA 4NJMA 3JQ9A 1A2OA 2O52A 3VYSB 3ES9A 2IYYA 4H7PA 5LP1A 1E2BA 3EEQA 3PFWO 3OUTA 3QMWA 3PQDA 5CNJA 2GZHA 2WYOA 4BO9A 1CUEA 4MS1A 4O33A 5B3JC 1EVIA 1U8UA 1Q2XA 3L07A 3OCWA 1SQ6A 4ZJPA 1JFRA 2UZ4A 3AY7A 1KI7A 1RQ2A 3TGLA 2DFDA 1W9HA 1AOXA 2HXGA 2XDAA 2XITA 3H5OA 4Q9LA 1KMHB 2PUFA 4L4RA 4A4DA 5L45A 1TTQB 2CEKA 4G0XA 3E1SA 1H8ED 4W6QA 2FRDA 1EI9A 1T5OA 4FE3A 2CXUA 1KC1A 3PYLA 5SZKB 2BFCB 5YASA 3R3VA 3VPDA 1QK4A 1NP6A 3DMYA 1N2ZA 1WZ2A 3CLHA 3SZRA 4AP5A 4DCPA 3B6KA 4DPLA 3KVNA 2A5JA 5IJ0A 2OBNA 2ZTVA 4O3MA 3HP1A 3OA2A 2NXJA 4UVIA 4YAJA 5KNDA 3PFIA 4RVNA 5FEMA 2A57A 1G38A 1Y9DA 1WY7A 4PNHA 3NXKA 4R84A 4YPVA 2Z4TA 2BC9A 4J0JA 4R1LA 1BYUA 4IIEA 2QD5A 3FMPB 3B9PA 5UKDA 1F6BA 3DXXA 4NMWA 2AZDA 4DDVA 4D9JA 1I33A 1N2JA 5E0KB 3M5WA 2AQ8A 3M89A 3RJMA 1ORHA 3Q1KA 3QTLA 4GE0A 4Z9YA 3RAEC 4YDQA 4I4LA 1EK5A 3FWHA 4ZO7A 2APJA 4YA6A 3RSGA 4RJJA 1D9XA 1M6NA 1QIIA 3P4XA 3F9IA 3RB8A 5L3QB 3GZJA 4IYJA 5EIXA 3F5MA 3T9BA 3QXGA 3PJGA 1YQQA 5BR7A 3K8ZA 4UNSA 4ABYA 1SKUA 5D1HA 1Q1GA 4DXAA 2F17A 3FTCA 1GPAA 4HFNA 2I78A 3LP6A 2NU6A 4JBGA 5A3RA 2Y8EA 3E84A 4WTOA 4GP9A 4YBZA 5DP2A 1S1MA 2VYND 4MS3A 2AMYA 3W8RA 3QVWA 2EFHB 4QUHA 1NNUA 5AOCA 3CKLA 3QXSA 3KPUA 2NADA 1W5TA 2FWMX 2PANA 3C45A 1L5MA 4EKIA 1USWA 2Z6QA 1N2IA 3S1AB 3D3WA 3ZCQA 1O08A 1U2TA 2EHJA 3DKVA 3JARB 3L9XA 2AN4A 1ARZA 4J1QA 4BZPA 5CBKA 1UFQA 1TUGA 3W6ZA 4NWIA 4MQEB 3F5SA 4WX2B 5AUQA 2I33A 8LDHA 1WW8A 3GUUA 1UDCA 5HFNA 3EDOA 4HRXA 3AVQA 5TVKA 3ZYCA 4ZJYA 4P31A 4E4YA 2B98A 2ZM6B 4XFJA 2IKQA 1F4VA 2PCLA 3CPEA 4Y7CA 5IBQA 3SI7A 1O54A 3T3OA 1XPOA 2AMLA 5TB5A 1JGTA 4HQLA 4BZZA 2XUZA 2V0NA 4BVJA 3AVOA 5CB4F 2JI6A 5C8YF 1VGVA 4ARVA 1RTTA 3SSNA 2GZSA 4DJEC 2YHSA 2ZJ5A 1XFDA 3JWIA 4L5JA 3NBUA 1I7NA 1A88A 2BCEA 1NXQA 1OYWA 1P1HA 3PDWA 4JR1A 4BQOA 3ZDBA 4QYIB 1CD5A 1KO4A 2CZCA 2BJHA 1HFJA 1U80A 3EXG1 4LMAA 5FADA 2HHLA 2O2DA 4P6VF 3R7SA 3SS8A 5C5CA 3WTCA 1DTSA 3HJTA 3ZD6A 4HT3B 2B83A 3TRKA 3PUJA 4QLAA 3P2MA 1AZLA 4FW8A 2DC1A 2HI0A 1ZL2A 1C9KA 2A9QA 3CRRA 3KT3A 3NUGA 4F5YA 2WU0A 4LRTB 1C7JA 1U90A 2P9ZA 1N0HA 4H0NA 1P9LA 1Y7TA 2VHUA 1PWHA 4PZ0A 3HEBA 2R62A 5FKJA 2V9ZA 2ASEA 5LUAA 4LGMA 1P72A 3WIOA 1FVXA 1J23A 2RJOA 1MT3A 5A2GA 3IAS1 2AZXA 4N5HX 3IIEA 5AM4A 1N1EA 5KTOA 1CJKC 2JGMA 1RWNA 2YC2C 2Z2XA 2V9PA 3L1KA 2GZDA 2POQX 2R44A 1JEQA 1HFEL 4HYEA 3ZQUA 3OOYA 4OATA 2D2XA 3OOWA 5CNIA 1Z68A 1IDN1 2YWCA 1YA4A 3FTPA 2OGZA 2P1DA 2J5BA 3NBZC 4U6SA 2FPIA 4FBGA 4UAVA 5CTAA 3UMGA 3OC6A 1JAHA 4YV7A 1YKGA 2DHQA 3OT4A 4IDFA 3OOHA 2IBTA 5C5EA 1UWLA 4G2NA 2ZWMA 3KTDA 1KKLA 4LOHA 2BUCA 3TKYA 1NP3A 3IERA 2Q1XA 3BORA 4J0EA 4HPXB 4KQGA 4G0VA 1LVGA 2O0MA 1TAGA 3KYDB 2RI6A 4BMXA 1EUCA 4I6GA 4WZBE 3WL8A 2WAYA 5CA1A 4NHOA 1U9ZA 2D2FA 5BP7A 1E0DA 2I9PA 5BUQA 4I66A 3OY2A 4RK0A 3BD8A 5D5HA 4G25A 4I5EA 5FWNA 1H4QA 3PNSA 2OBYA 3NJ4A 3MTGA 1OHHA 2PZEA 3WYNA 1H3EA 1E2UA 3EGOA 3GR6A 1CDOA 4HPWA 2AG0A 4ZZ2A 3NBYC 2UDPA 2BV3A 4XX0B 4RPIA 1VI2A 5L3RA 3WAGA 1ZGHA 1XEFA 4R71A 1QRAA 3SVTA 1ZUD1 2WHEA 2WIGA 3SSAA 3VKFA 5AW8A 2AOUA 3P0IA 1VCIA 3HGQA 1JA0A 4HTFA 4FFRA 4CU5A 3B70A 2CDNA 2EHDA 1UUFA 4HB0A 4WKOA 1A8QA 2MYTA 2DM6A 1KQPA 1MH1A 2VRBA 3MQ4A 1DWUA 4PG6A 5CXQA 3H6GA 5ICFA 5BQ3A 4LOAA 5ALPA 1SGWA 3QXXA 4Q18A 4DS3A 5PGMA 5F35A 1KMNA 1E9FA 1S6YA 1REQA 1Y7IA 2AA3A 3ABZA 3D2AA 4Q3KA 4WEQA 5HKLA 3DOFA 4QU8A 1WWKA 3CW8X 3EZNA 2CMFA 2Z4SA 4F3KA 1I8TA 1XQ6A 1CG6A 1Y6ZA 4QEKA 2BEVA 3LBYA 4GBJA 4HXFB 4RKQA 2VDWB 4UAUA 1RXEA 3WX0A 4A6DA 4LFAB 1EFVB 3NTUA 5TV2A 4A6PA 2NU7B 5AHXA 2B8TA 3ONFA 5DX1A 3JQGA 4EB0A 2GA8A 3AGPA 4RPKA 1M10A 3QVVA 4KIWA 3PQ5A 4LGVA 2ILTA 3JASA 1U9YA 4KN8A 4BP3A 2DB3A 5KDOA 3QIAA 4IINA 3C3BA 4BKPA 2VXYA 1AGPA 1MIOA 2M98A 1T1IA 4LZLA 2WHPA 4HDMB 5ENVA 1WVIA 2XKKA 1KRXA 4DV2B 2E3JA 3O82A 3DBOB 1YRLA 3GAMA 4P3KA 3F3KA 3C85A 3EB9A 2YQ4A 4EFDA 2MCFA 3VC2A 4EPWA 3NRCA 5HGJA 4JROA 4I5GA 1B3RA 4EPVA 1JH9A 3A1NA 5AOVA 2V7XA 5KHLB 3NM4A 3P0RA 5BXYA 2XNHA 3KQUA 5TQVA 3BQ9A 4D8YA 2IZ6A 2W2TA 3OJ0A 3S1LA 4FFOA 3JV7A 4UFOA 3A05A 2W93A 3AHFA 2I65A 3ER6A 4K5QA 3VBCA 5CG1A 4U7FA 3D31A 1E77A 2H18A 2GXUA 4GDMA 1Y9JA 3IA7A 4GQIA 1CEEA 3H1TA 4UUMA 5I6DA 2G1JA 1TCVA 3EAGA 3HLTA 4OXQA 3N2IA 3WZ2A 1YQDA 4AROA 1K0UA 1Y5IA 3PQ2A 4LCJA 3U3JA 1RI4A 4NX2A 3FVWA 3OM1A 4D3DA 2PL3A 1T9KA 5FFNA 4NRDA 4KXMA 4YCJA 4IQGA 1OTXA 4HNRA 4M6WA 5G1OA 1P4AA 3E5HA 5CB6A 1U7TA 1MENA 4AVYA 4OK6A 3WICA 1PVOA 4LE2A 3CEAA 4LAFA 2GHRA 3OQ1A 1FA9A 1PG0A 3LPAA 4CUJA 3ROXA 4NNOA 1PGJA 1PTJA 4F45A 3HUFA 3ZVKA 5LJLA 2BAGA 2JLBA 4IIUA 1COWA 2NUTA 4QOIA 4EFLA 5KJFA 2ECPA 3K32A 3IEIA 2AE1A 4QGAA 2Q2QA 3ND8A 4UUBA 1I0LA 1QONA 4UPDA 4X6LA 4IL5A 1FSGA 3X0DA 2A0UA 2DFTA 2BD0A 2DHRA 2IE0A 2YUTA 1P1JA 3DBRB 3QKWA 2VP5A 2RH4A 3UJ6A 4B7UA 1XJ0A 3FROA 4LXXA 1BO6A 3W5DA 2YJTD 4YP7A 1OBVA 1N4AA 4HDKA 1SOUA 3ABIA 5IH3A 2Y93A 3IE2A 3L7CA 4IF6A 3ACCA 5IKOA 5HMMA 5A2QA 5IJ9A 5I9NA 2P0YA 4HNVA 4I36A 4DMHA 2ANCA 2WUVA 5AR1A 1FRVA 1H5QA 3AVVA 2EZ4A 2WE8A 4L5AA 1LK5A 5L3ZA 4XVUA 4KBGA 4M36A 3DQPA 3JATB 2B1GA 5J63A 4ZQBA 1G20B 2BEJA 2HQ1A 2JFNA 3K31A 3PKIA 4BUJA 1GKLA 1J49A 4N39A 2ZUFA 4ARAA 4KCGA 3LLCA 3G2OA 4I2VA 5JROA 3CZ9A 1KKUA 1EKXA 1NKTA 1P1IA 3KJGA 5EJFA 1LA2A 1EWQA 1MIHA 1P0IA 4TM8A 2V96A 4XLZA 1DBPA 3K0KA 1L8XA 2QL9A 5LIRA 1F0YA 1CY4A 4KO1S 4D8XA 4Q9DA 1ETUA 1DG1G 2RGGA 1F17A 1PT6A 3AEQA 4WK4B 1PWZA 5EJAA 5B1DA 4C6TB 3RTGA 2F1HA 4B45A 1K8QA 1GTZA 3BGVA 2VDKB 3X43A 1CVLA 2D1QA 4PCVA 2Z4RA 5DXJA 3D1LA 3O47A 3KKZA 4KRGA 1XTJA 3ZNPA 2OGTA 3K5HA 3FMOB 2ZAYA 3F2VA 3IIJA 2QQ5A 1AY0A 2VPYA 3QNUA 2B78A 2VLIA 4UARA 2AX3A 3AQ4A 3DLAA 4FOOA 1PWXA 3BXFA 1E1YA 2GT1A 1JQDA 3H2BA 3HH8A 3GFOA 3JSXA 1QYVA 1XMIA 1MPXA 2JGNA 2ZI9A 3C7DB 3K0CA 3LPLA 3NGLA 5AESA 2FSVA 3MW8A 4UM7A 3EIWA 5EIWA 2C5AA 5GZ3A 2PMKA 2VQ3A 1WD7A 3F6SA 4QG7A 3RRMA 4JLBA 2PV0A 4M9SA 4EG0A 5B64A 2I7XA 1NNI1 1JHQA 3EZ9A 4G3XA 3NATA 4C29A 1PV4A 3MTDA 4A8JA 3DAHA 5BW6B 3DV0A 4YWJA 3VMMA 1OMOA 2CLHB 1Y8RA 3EZFA 1YU6A 3CV3A 1A50B 2KHZA 2K2WA 3I30X 2G4LA 2M6KA 1GNRA 4DLAA 4JB2A 3LO8A 1QFZA 4QBHA 1TYZA 1P8AA 2V7GA 4B73A 5JXGA 5JCJD 1DAFA 3ZV3A 4E08A 1XQWA 3KZXA 2B4RO 2BUBA 2IXDA 2IP4A 3M3DA 3KZMA 4MRMA 4ED9A 4R8SA 3ED5A 4PCLA 4ZALA 5IEJA 1O5TA 1F8YA 3A1TA 4JHLA 3PVZA 4EGCB 4ZGBA 2ATEA 1YZUA 1PN3A 3D3KA 1JVNA 3BZBA 4JBYA 5JEDA 1EJ6A 1ZD3A 2VAPA 2G9NA 1TM7E 4TWJA 1OLOA 3VX4A 3CR7A 3Q0IA 4CJXA 2WWRA 5C18A 1GKIA 2OV8A 1SU7A 1XE3A 1RXIA 2D5AA 2H4ZA 1N75A 3LOQA 4OI0A 2IS6A 4YFVA 5AKKA 1ESEA 1HNXB 1WUHS 2BZ0A 2VYFA 3URKA 1S2GA 4UD6A 5IP5A 1WXWA 1L1EA 1GFZA 1VPDA 2QW8A 5L4SA 3DR3A 5KHAA 1NOKA 2GCIA 2NVUB 4YDHB 3SF8B 3QW4B 1GRQA 1QWSA 4FHGA 3B6ZA 4X7PA 4YALA 2FHPA 2NOAA 4Y1FA 3VR3D 4NKRA 5K9ZA 5EWMB 2BSQA 1RI1A 2YH2A 1TF7A 3CMMA 3LWBA 2H2HA 1PGQA 1DX6A 3TIIA 1EVLA 1MF7A 3GGCA 2XGOA 3QSYA 2WJ4A 3N2GA 3OJCA 1CX9B 4ZCIA 2ZXFA 3TIVA 1PL6A 2GM3A 4I1RA 4MVJI 2C95A 4RTOA 1TTTA 2NTVA 4YK7A 3OOJA 3JZIA 2FFHA 2WABA 2QX6A 3NKFA 4FI3F 3KWFA 1OFGA 1NI5A 1IIBA 2KI5A 3W79A 1FDOA 1OLXA 2CXHA 3CJRA 3WY9A 3QEAZ 4WLUA 5F33A 7YASA 4TSKA 4TMFA 1ZNXA 3HRIA 1MKYA 3GJ7A 1K98A 2CYBA 2FDXA 4IWYA 4ROSA 4S24A 4US2R 4RDHA 3GJTA 3UA4A 3EXEB 3PI6A 3L40A 3GF4A 4JAVC 1B3BA 4KFTA 2W8BA 3BX1A 2C54A 1YB5A 3K0BA 1CJVC 3L0DA 1B76A 5M04A 3OZRA 1IXSB 3ZE2B 2GPWA 1U8TA 4KAAA 1QAOA 4WZAE 5ULLA 1R74A 3MJVA 1FJHA 3I42A 2HRCA 1ZGJA 4GNKA 5KNDD 4BNFA 4AI6A 5DBFA 3L7KA 4ECEA 2DP4E 2Q4OA 5IVPA 4ZU6X 3DDNA 2H4JA 4IHJF 1QHHB 4HI0E 2IX9A 3AX6A 3DEYX 3RYCB 2JJMA 2H1CA 1NVKA 1LPBB 2PSSA 1W85B 4Z8XA 2GZMA 5L7YA 1AV6A 4I1SA 3V7WA 2CFIA 2CD7A 2O3SA 2PL5A 3GI1A 3HP4A 1ISRA 1RRKA 4I55B 2FZCA 1DEHA 2VT7A 1E6CA 3RUFA 2HTFA 3MTBA 1RCFA 3O8NA 5LOVF 1IUOA 4QSMA 5HK8A 1PX2A 1QGUA 2BFDA 4X7MA 5KEIA 2NO5A 3BDAA 1KIAA 2J0UA 3AW9A 2IPNA 4XLTA 4P2BA 2ZJAA 3QNMA 1YJAA 2ZSJA 4LTNA 3EYAA 1NRJB 4UUAA 3HFRA 2BLNA 4RF3A 3SNKA 1MCZA 3VH1A 3QWBA 2QUHA 1HA3A 3WGYA 3U1BA 2D3TA 2UZ1A 3F96A 4UVHA 1LPOA 1FL9A 2IDZA 2PG3A 4Q19A 5HIIA 5BMVB 5TPWB 2QVBA 3TSZA 1CYDA 3H84A 3G2HA 1CLUA 4XWYA 2OXEA 3HVKA 4FFMA 2G6BA 2JLAA 4LI0A 4PIPA 5IARA 1YBHA 3PXEA 1XL1A 2G70A 1HNNA 1R1DA 2P9HA 3QLVA 4TQAA 3ECCA 4G5SA 1XUOA 3QKTA 2ISQA 2X5XA 1G16A 3EDMA 4HUTA 2XVXA 3CRZA 2ZYAA 4GI5A 4BBAA 2PO5A 4P22A 4XIIA 1H5UA 3OPXA 2OXRA 2Z43A 3DE0X 3NHSA 3X1KA 2QZJA 5G0UA 3THWB 3CRW1 3TD9A 2GJAA 4QQFA 5HS6A 1B41A 3DKIA 3SY8A 3B8EA 3C6MA 3DF9A 4M0CA 4WCDA 1MG0A 1V45E 2WHRA 3OE1A 4MYSA 3RU2A 3Q8LA 3ZJTA 3DZDA 1HR0B 4ZYUA 5IAGA 3RPEA 2OBMA 6Q21A 1OAAA 1P8JA 1SWVA 2TMDA 1C50A 3M4NA 2VP3A 4MEAA 4QARA 2D62A 3A70A 4DJAA 2HBRA 2XQGA 2WJ3A 1D2MA 5DYNA 5ICMA 1LSSA 4NEQA 4PAMA 2AG1A 2WU3A 2II6A 4XIYA 3FJ1A 4KE6A 4TLEA 5DP1A 3H2SA 1RYDA 1XR3A 4RSMA 1XC7A 4LJSA 1PGNA 4MSUA 1MRNA 1T9HA 4JLUA 1GTMA 5EESA 5EIAA 2INGX 4BE4A 4K2HA 1DL5A 1QU2A 4ZTZB 1DNPA 1KI8A 1MU0A 5DJ5A 1SG6A 5EXDA 4A15A 4HSGA 4C7KA 3I64A 2YRXA 4Q34A 2DJIA 3FLMA 1R00A 3BMCB 1Q1ZA 3L43A 2J4DA 4RW0A 2ZE7A 3B51X 2X7XA 1ZRHA 2A33A 5D86A 4AJNA 4N5MA 1YZGA 4IIGA 3EK2A 4E07A 1MB9A 2BELA 1NN5A 3EVAA 3QVJA 3NEPX 5JSZB 1NUQA 3UPDA 3DNPA 2CFOA 4GRIA 3W6NA 7ABPA 2VTBB 2YVUA 1QAMA 4DDUA 1E7MA 3NASA 2YRFA 2ZETA 3AKYA 4H3VA 4QLBA 2P4EA 2CHVA 3G2NA 1AX9A 1QVVA 2QPLA 4FZ3A 1VL5A 4N5IX 2X2FA 3LM8A 3A6HA 4F06A 1TC1A 1V1MA 4WY2A 4WNAA 4TL8A 2CKDA 4OGKA 5D51S 2JVJA 4LYHA 2BY4A 2PEYA 3QWHA 1AO0A 4LEIA 4CIYA 1Z16A 2V7BA 4ITVA 4D9NA 4U7PB 2ZSUA 4X5OA 2RK6A 3ZIUA 4EP1A 2W0SA 5DN6A 2V58A 3QOYA 3TIFA 2QN3A 3NVKI 3EFEA 2AX4A 3BXGA 1XN1A 4CLDA 2RGDA 1N8KA 1CJMA 2WIFA 2CCKA 4TOIA 2QRVB 3HA2A 2HF8A 3MJTA 4NENB 1Z2EA 1I7LA 4NV1A 4G01B 4PEVA 1OHHD 2ZJ1A 4AQ7A 3M6MD 1JJ7A 4HH3C 4P98A 4A6XA 4DL9A 1S4QA 4HNSA 2AFIE 4XDHA 3EEBA 4A0RA 3KE8A 2YN2A 1DQNA 4X64B 4B79A 1GUAA 3DH0A 1EVEA 1AUPA 3QV2A 3URMA 3WRWA 2IUUA 4DHEA 4KE8A 4UHDA 3IUYA 1JMYA 2BCJQ 3CRVA 3RTEA 5KMGB 3LX8A 3EPJA 4DPMA 3RWBA 2AQKA 4N3CA 2FMKA 4JJZA 4L4XA 3OHSX 4TWBA 4RZHA 1V4VA 4WY8A 1XD8A 3T1OA 2J6IA 4PLHA 4DIFA 5C31A 1R9GA 2AUMA 2F3UA 4PFJA 3TXAA 1XT6A 2G28A 2HA4A 1TZBA 3BZWA 2X2OA 4YYZA 1KEPA 4KPUB 5IHPA 2Q46A 1C9YA 2WYHA 2JAOA 1ZBQA 5BRJA 2G6TA 3CA8A 1X39A 1XPUA 4WI1A 1YL7A 3EXFB 2QAJA 1ZAYA 3C6KA 3KLBA 2VL7A 3R5XA 4U6QA 5FOVA 1I2MA 1DKMA 1GT6A 5H3LA 2XTAA 4MK4A 5A3SA 5KDLA 1OTHA 3BICA 2IF0A 2YIDA 3EEFA 5ECYA 2FQYA 4BFYA 4ETWA 1QU3A 4UHHA 3F8SA 3JAMA 1LU9A 1J8VA 4DA4A 1S2NA 2D1RA 2IY8A 5DWVA 3SWWA 4XTCS 3RV4A 1FFSA 4XASA 1JJFA 5TE9A 2I9KA 5JXWA 1ECBA 2EL9A 1YE5A 4KDCA 2QWXA 3OE4A 5BSVA 4TQGA 1KIMA 2QTFA 4O0LA 4BO8A 1MC1A 5CIWA 2G9QA 1C41A 2C97A 3E82A 3KVVA 4RH1A 4W8HA 1SBTA 4L4UA 3I1FA 3S40A 4BFSA 3LUCA 5GTDA 4LHWA 1ECGA 1PZHA 3TCNA 1F2TB 3RREA 2BBTA 4E21A 1UWVA 2ZDGA 2IBSA 1E9BA 1D6MA 4TLMB 4OYHA 5ADWA 1N8SA 4HZUB 4M0DA 4Z4IA 1OGIA 2MR5A 1U0GA 3E4DA 5LR6A 1WXHA 2VRNA 3BBLA 3ORFA 5EJGA 2FZLA 1E9VA 2O7QA 3OLQA 4HN4B 3UWMA 4YX9A 3JYNA 3LI2A 1ECFA 2ZPUA 1UT6A 3NDBB 3ZLJA 1IG0A 2E48A 3CXRA 3L7BA 4MAFA 1CDEA 1NP7A 2X2EA 4NS1A 2YZMA 4RXMA 2OA0A 1R9NA 4D81A 5KVVA 5FPTA 2OM6A 3CUVA 1Z7BA 1EFKA 3HM2A 2ODAA 4Y3UA 3ZWMA 3VVBA 4YV2A 1JLHA 2VTEA 3QMVA 1WXFA 2I7VA 3R7WB 3K6RA 4J0FA 1PEKE 3EGEA 1KMHA 1SQGA 3Q41A 4M86A 3GPIA 3SJBA 5A4IS 4JC5A 2V6BA 2NQ8A 4L8VA 3JYOA 3E9CA 2HF7A 5KX5B 5CW1A 1FLVA 2PT9A 1ZRMA 1G18A 2BFCA 2JZNA 3SZMA 2CJWB 1JSXA 3ZE9A 4Z49A 1H1DA 1SVWA 4ETIA 2VOEA 3D3EA 5FH9A 1B0ZA 1FVOA 3EODA 1DSSG 2CDRA 1HBJA 1K6XA 3BXHA 4PLVA 3IKLA 4LW8A 3A6FA 4C01A 4YMLA 4EGJA 1JLLB 3F74A 2VNKA 3DYBA 4IDHA 4TMZA 3KUCA 2QM8A 3FUCA 4A9AA 1CULC 3WB9A 1XDGA 3AJ9A 1IDOA 2ZAOA 3D0RA 2PUTA 3RHSA 2C61A 4JKYA 4M0UA 4IAOA 3R9IA 4IJQA 1J07A 3IPXA 2ONKA 1RZVA 3HZOA 1AHNA 5KJEA 4B3BA 5DM70 2VDVE 1RYNA 5HYVA 5FOXA 3GRYA 1Y7PA 2Y4NA 4Y2QA 3ZHBA 3V97A 2QEQA 3QELB 1GQQA 1EK2A 4JBLA 4OSEA 1LPMA 1AB5A 1Y9EA 1BHO1 2CLLB 1M9NA 2XYRA 4UU1A 4GVPA 3TL2A 1LVUA 2QUIA 5MN4A 1GAJA 5L3QA 2A8YA 1EGHA 4LYAA 3VPSA 4RABA 5KNCA 1YGPA 2YWDA 4OSOA 5LWHA 1FYWA 2GPJA 3PFGA 3KPYA 4IIJF 5DHPA 4H1WA 3QBJA 1G41A 3KJXA 4HZGA 3USES 3EE6A 1Q3TA 4CMBA 1Z6QA 3NVAA 2PUWA 1YMVA 3UZUA 2YN0A 4WESB 4R16A 4CCSA 4DDTA 2IS1A 3WLQA 5AJTA 3NDJA 4FN4A 4OBBA 2IDMA 4OHKA 3GC6A 4LC1A 4ZFNA 1Q1EA 2MJLA 4FE7A 3HDJA 3DLHA 1JSLA 4AD8A 3ESRA 4F7WA 2I6TA 1YK0A 1KO8A 3LZ6A 5F1OA 2F1IA 3JARA 2IT1A 3G0OA 4P93A 3S1AA 1WU8A 1ZJ6A 3DCJA 3ZXIA 1D0SA 3C6QA 3FF1A 3KRTA 521PA 3TUJC 4MQEA 4ZDWA 1S2OA 5IH7A 4NJEB 5TF4A 1O0CA 2AB0A 2ODTX 3K20A 4YJ2F 3V8BA 3ADDA 2PBFA 3SBXA 4IXWA 4RHUA 4WWHA 3FGZA 2EKZA 2Q3DA 4OYRA 3H99A 1CT9A 3OECA 1YC5A 2VYVA 1VIDA 1H2WA 5CXXA 1FIUA 2YJGA 2ZIVB 3LDFA 3PKZA 5M3BA 1NG9A 3QX9A 3RFVA 5D87A 3UT0A 4N7JA 3HVRA 4AKIA 3HXLA 3K9FC 1RI5A 3GT4A 3OTQA 3R8XA 3LU1A 3J7TA 4IS3A 4OMFG 3CT6A 2R86A 3IEUA 3UM9A 3ZH2A 3ZDDA 4NDNE 4QYIA 3VFDA 2XJ9A 3I5XA 1W19A 2IHBA 2J0QA 1M33A 1H6DA 3LRPA 3IE1A 2Q9CA 4Y8VA 1BDIA 1NA5A 3REFA 4OXXA 4DLWA 2K2QB 1HLDA 4R1NA 4Y9UA 2EKLA 2IYWA 4NZ9A 1PJLA 3SMVA 3DZGA 3E70C 2JI4A 5HE9A 1DT5A 5FR1A 4C76A 3GHYA 3OX2A 4EG6A 4EW6A 5AJYA 5IHXA 1TM5E 2QTTA 2M9MA 4W5QA 2IFTA 3H13A 2VRCA 1GTJ1 3HEAA 2AG6A 2FUNB 1U04A 1ZUWA 1T2AA 2L17A 4JBNA 3WK5A 3BRWA 1PCXA 2HK6A 4AXXA 5C7IO 4QT4A 5JV5A 5I7AA 2Y1GA 3NHAA 4Z9FA 5ESDA 4BVAA 1WMEA 1P77A 4X7RA 5F1YA 2ZE5A 1LJ8A 1E1MA 4CKXA 4KHPB 3CX6A 3A10A 3R8CA 2X0JA 4M9ZA 4K86A 1JMKC 2CV2A 1U6IA 1YHNA 1TTHA 1RKQA 1ZWKA 4P7BA 2Z0MA 4O2BB 4RLSA 1KAQA 5CPFA 4FWBA 5KQMA 4PLGA 4Z7JA 2ZWAA 1TLLA 4NBWA 5GIOE 1ZNWA 1E3TA 1I1HA 2O23A 2P27A 1GQYA 1V26A 3K8OE 4TKUB 4UEJA 4JIGA 4Y67A 5CP8A 1DLIA 1SC3A 4Q47A 5LBIA 4XQEA 2NTYC 3AHGA 5B37A 3RC7A 1KMIY 5ADUS 1Y6RA 2JIOA 3KYDA 3OQVA 2NZYA 1ZSVA 5D3QA 3UJAA 4BVEA 3R8FA 1DO0A 1E1KA 1N5OX 4WN9B 2HHHB 3U40A 4CKCB 2EBHX 2WJ6A 3X44A 1A9RA 4KLRA 4URXR 2VXBA 3A4MA 3IP6A 1E63A 2FLKA 3IRVA 3FPAA 3NORA 2YV2A 4LWPA 2DQZA 2PZGA 5ALMA 1SCAA 3VNSA 4RNCA 2WMOB 4EB6B 2W83A 3S44A 3SJZA 2H4XA 4B3FX 4BZQA 3FB1A 2Y99A 4IFBA 4KBYA 1GG2A 2WOOA 2HXYA 2PS0A 3JPYA 4RZXA 4XX0A 2VUIB 3ILSA 4G0OA 4EY8A 3TSWA 3RIMA 5GWXA 3WOHA 1X1TA 2C1ZA 3HVUA 1P5FA 3NCTA 3OTIA 4HLUA 2BGJA 3E7DA 4YB8A 2UYQA 2EW8A 3JYQA 5EUCA 2ZJ4A 3PFCA 1BXZA 1CZOA 2OZKA 5FUYA 2R8PA 2XF2A 3QIVA 4MYTA 2B82A 2YVKA 1N3YA 2YFYA 2G72A 3IAXA 2UVDA 1ZESA 1SHUX 2HD4A 1C5KA 1UBEA 5EIBC 4MWTA 2WOJA 2HN9A 4NG5A 3C5EA 1PV1A 4C7OA 4NMMA 5CRIA 3TRJA 2VDWA 3DMTC 3HUDA 1EX9A 4EVIA 2W2PA 2FSUA 5ESRA 5FXMA 1EFVA 2W37A 3OE7D 4PF1A 4DCGA 2NU7A 3OFJA 4L8FA 3VDXA 5K03A 2Q8NA 4FEEA 4BKUA 1T3HA 1XCLA 5LPNA 3NJRA 4Y6QA 4HZIA 4MR9B 1HLPA 3MIZA 3HCWA 3QVLA 3V9PA 3OZTA 5I5EA 1TMOA 1OXBB 4HDMA 3DOEA 4XQGA 3UXYA 4BV2A 1EVZA 2WA2A 4WOKA 3I04A 4ASUA 5JZVA 3PWSA 4UC0A 3P7MA 2WYWA 5J2UB 3RT9A 5HUJA 5JMWA 3KQNA 4P8RA 1CNMA 3T7EA 4CL2A 5JCOC 1ZH2A 4AG5A 3GJ3A 1MBZA 1IHOA 3PQ6A 1DAPA 1M1YB 2B6HA 4OHWA 4RMIA 4EHHA 3OJXA 4ZVUA 4F8EA 3B20A 5DLQC 2HQBA 5I9SA 5G0VA 3WHIA 4F91B 2B25A 3N2KB 4PX2A 4KNYA 2ZSKA 5GV8A 1M6EX 5A71A 3V1LA 4MR7B 2IEZA 5EWLB 3RODA 4BLPA 4DNQA 4OP3A 3JALB 2UXDB 3DOOA 2P9GA 1KVSA 3WKBA 3ZDAA 1C7ZA 3L0PA 2DUWA 3AP2A 3HNOA 1TM2A 1Z0FA 2PRZA 1PG5A 4RGYA 2VDJA 1GV0A 3M5CA 3ZCTA 5EERA 1RQ7A 1TB4A 1TXGA 2ZUUA 4QYSA 5I9IA 2VP0A 5IWAB 2ZQYA 5JADA 1TJNA 4YRSA 1NXWA 5JNSA 2LIPA 3T9CA 4YT4A 2HJVA 1XCBA 1DAMA 1P81A 4Q4JB 3AUJB 1ZVJA 5LB2A 3BA1A 3THXB 2R87A 4BB9A 3SC4A 1A76A 1PF7E 4L8WB 1XTKA 2FMIA 5NLLA 1FMLA 3GJ8A 4WOCA 3JWGA 4H08A 3TVYA 4ENTA 4YCNA 4Z86A 1VG9B 5H0IA 1EA5A 4QICA 2ZRLA 4EUFA 2CVPA 3WS7A 1N2HA 5KCZA 2TMKA 4G37A 3GLFE 5C2JB 2AIRA 1FSSA 2QOEA 5A4JA 2V9CA 3TOSA 4J7AA 3WKAA 3WGZA 4V0OA 4I8IA 1JDJA 4A0SA 4K40A 4IMIB 1G19A 4DQUA 1AE1A 2B8WA 2OPHA 3JQDA 2G07A 2NXCA 3DBRA 3E0XA 2CFTA 3OM9A 4FMCB 3J7AC 1AKRA 4S1WA 1YQGA 4PYJA 3UBMA 4DFDA 4Q3LA 1RFLA 1F8GA 1TM4E 4X6UA 3KPWA 2V6MA 3QY0A 4KFCA 1N78A 1FYDA 3GRCA 2H8GA 2RFLA 3EOZA 1VL1A 4TVBA 4UTRA 1Q0RA 4TLBA 3BGWA 1MHTA 4O4HB 1WNTA 5EE3A 1G8FA 1FRNA 1WMAA 2G83A 3H0EA 4JLMA 2ECKA 1KP3A 3IXLA 2G9RA 5IAAA 4I19A 3JATA 4Q24A 4CHGA 1Y3DE 4Y9SA 3ULKA 4H0FA 1G20A 3VISA 3AF5A 2BR4A 3A58B 3GLVA 3KTOA 2CHFA 4ROTA 3L5KA 4O8ZA 3QE2A 3T3MB 5E8RA 5A1JA 3C3KA 2B92A 1Z38A 1YUMA 1TW2A 1GARA 1L5YA 3I45A 1K2WA 5IFKA 3DWGA 2OHVA 2XCTB 5DOVA 3QE4A 3RRXA 5LYYA 1UL1X 3CPHA 3OICA 4A5SA 2Q1TA 3A7DA 2YFHA 1CUJA 4GPEA 1L8LA 4C6TA 2RAVA 5C1DA 4K9DA 2C4MA 3VZCA 3GJ4A 3RNOA 5AXCA 3UATA 4DR3B 3PTLA 3L8CA 3C7KA 3HWRA 1ENOA 4JL8A 3C7AA 3HCEA 2PRKA 3A6LA 4TT8A 3IHLA 5AI6A 3P9CA 2C9OA 1GPH1 4UUPA 4JEMA 2PXXA 4CKEB 2HU8A 5B7NA 3HB4X 2UZIR 1WXEA 2JH9A 3FSEA 3VJMA 2IRWA 1E7RA 1TM3E 4KDEA 4L74A 3TTSA 2XUAA 3N8HA 4LRQA 2W70A 4PLPA 3M2PA 2E4VA 2OO3A 4TZ6A 1ZXBA 4P0PB 4YDRA 3O4FA 1SKAA 2FLVA 2HA6A 3M6AA 3O5AA 4OBEA 5CA1F 2BHLA 1DKUA 3WFIA 1EUYA 4WLEA 4XXHA 4WT7A 4XDYA 3RRFA 3V8NA 1E3QA 4EYOA 4YJDA 4UTPA 3OHPA 4N8SA 8ABPA 2Q4EA 3GYGA 3HV2A 1YS1X 3NUQA 4ZEWA 1SXPA 3D6NB 4Z4GA 3GLRA 2J33A 4BB5A 4U7WA 4ZVMA 1SC9A 4HGYA 3DDUA 4CFYA 3AKEA 1GCAA 1PNRA 3GJ0A 2QPTA 3C98A 3IB3A 3STWA 2LW7A 2QYSA 4XJTA 1DC3A 1PFWA 2PX2A 1YAHA 3ZE0B 1E66A 2J5RA 3FVRA 1DIOB 1SXJB 1C8BA 2NM0A 3LX5A 4P81A 2FQWA 5J5CA 5BN4B 2G5GX 1JQAA 3V8PA 4D5EA 4RU1A 2E4AA 3MT8A 3PD7A 4B5LA 3ER8A 1QCCA 2I2XB 1QR6A 3EMVA 3GT7A 4OKSA 2YV3A 1F51E 2WP0A 5CUQA 3TRFA 3VPBA 5I8WA 2VHJA 1X9GA 5FULA 1H2RS 1Y1LA 4Y2HA 1Z6AA 2YVQA 4J16A 3NRJA 2RGAA 1L5FA 4GYJA 1DO8A 2REXB 3NIWA 4KBFA 4NI5A 1EWYA 5B12A 1B42A 4DC9A 5CX1B 3OIVA 1BVYF 3G88A 3S27A 1FU8A 3PDUA 1UAGA 4PYMA 2QTBA 1Y1KE 2OHIA 4FB4A 2Z30A 2P4HX 3EGXB 2TMGA 1QZXA 4L07A 2NVUA 1B8VA 4UXIA 5CHYA 1KVQA 3SF8A 2ZT7A 3TMKA 1IXZA 1T9GS 4QD3A 5EWMA 1NF3A 1J2YA 4DADA 1XTQA 4E5DA 5CDGA 1VHJA 3LD9A 3IDSA 2CDAA 2AC2A 1SBIA 2W11A 4LZOA 3RS9A 3QUSA 1P0FA 3UWDA 3HJFA 4FKBA 1X7DA 1Q84A 1YC2A 5IABA 3Q7SA 2DH6A 3PLRA 1ZRNA 4F0JA 1DVRA 1NT2A 4YIHA 3OA0A 3NYWA 1CIJA 4RKWA 1ZOIA 2Y27A 3AG6A 4QAQA 5BMOA 1NJSA 4NOLA 1NV8A 5KZMB 5EJEA 2BFAA 2UZ0A 1JHDA 3GG9A 3HDQA 3JQ8B 2LDXA 3AZOA 4TTPA 4F6CA 2O8FB 5T3YA 4YRAA 1KJWA 2PRJA 3EXEA 4UTVA 4BU1A 2O6HA 3S99A 3ZHQA 4JI7B 5EIOA 4G0NA 4QVKA 5TC4A 4ZYWA 2JRLA 5J40A 3L8DA 2IGBA 4EY5A 4OHVA 4AWAA 1L7VC 2PXCA 4MWCA 4U1RA 4B6SA 3B1FA 1XQYA 1YFKA 4AP9A 1E0SA 3KXLA 3RVQA 1Q12A 4CMGA 3IPRA 2EJTA 1BOFA 1ODKA 3FWPA 4JCOA 4MTCA 1AXGA 1RQGA 5CYPA 2DFPA 1BRTA 4AX8A 1ORVA 3MWYW 4JLNA 4EYKA 3T7IA 4AY5A 5BNTA 2FP4B 5IVHA 1QHHA 4QOEA 4N8DA 1X1BA 3RYCA 2Z2YA 1K6IA 3FUWA 3ZZTA 2VZ8A 1PFKA 2IYQA 1HDOA 1W85A 2IY7A 5T7BA 5EXPA 2IEYA 3NEAA 3PA8A 1Q6YA 3SSMA 1P1KA 3U37A 1PW5A 3GXBA 4Q3DA 4I55A 2YY6A 2X15A 3O8BA 1RRCA 1GLNA 3MBIA 5FUMA 4JP3A 1L7DA 4C0BA 4LWQA 4LS3A 1LSJA 3AF4A 3MB8A 3UG6A 1W30A 4BNTA 3IVXA 1RU3A 3P2YA 5B1YA 1CJUC 5JPDA 3A27A 1ZNQO 1MO2A 1G60A 2E5WA 3FJYA 3TEJA 4E11A 3HU2A 3C5VA 2WIKA 3PD1A 3IKTA 1DKRA 1JZSA 4NLLA 2C78A 1CY8A 1Z5UA 2W22A 4JLVA 4OEHA 4ZYYA 5BMVA 1R12A 1O95A 2GH1A 3GFGA 5TPWA 2GEVA 1HG1A 1SCQA 1Y37A 3U13A 3DDWA 4Z4CA 5C9ZA 4OXKA 1UEJA 1JLSA 3BGIA 3OF5A 3U3OA 5EJIA 2N1MA 1M2WA 4LYJA 1WPQA 3ZNNA 3HUUA 2O59A 3ZKAA 2QTRA 1NV9A 4HMOA 4E09A 2ZLBA 2G4CA 5SV2A 2HBQA 3C8HA 4PG4A 3IUBA 4GPIB 2QRUA 3EWSA 2QQ0A 3U48A 2NSJA 2O4UX 2BR5A 5H7XA 1X80B 2OCKA 1SHJA 4PN3A 1ZMRA 2HYDA 2J87A 3THWA 4Z3KA 1U3WA 1TEXA 2H4FA 5FBZA 1UJ6A 3LV8A 4XPZA 2ZAIA 4N7MA 2MMGA 1G21E 2VYVD 4LOIA 5B6PA 3NHMA 3BE5A 1QQTA 2O2IA 2FX2A 3N76A 3OZSA 3TXXA 3G2MA 5A5DA 2HPZA 3OP4A 1IEXA 3WQSB 2IHVA 1SUPA 3KDAA 4C08A 3L0ZA 1B23P 1QPBA 4MIKA 3AU9A 2X9VA 3GP8A 3Q5GA 4HG2A 1P2UA 1M6YA 1XDWA 2ZJBA 4FPXA 4O2RA 1FZQA 5ALZA 3HLYA 4DDWA 1A7JA 1XZLA 2W6IA 4Q3CA 4QELA 1RLUA 1CXZA 2YVLA 5BSRA 1RHKA 1Q7BA 1P0QA 1L3CA 2F1JA 2VWHA 2Z2KA 3ETNA 5E4TA 5SYNA 1MEJA 3U5TA 3MRSA 3A31A 4C03A 2UUBB 5DEOA 2XQKA 3E5RA 1TQ6A 3TDKA 1Z2CA 2SCUB 1RRFA 2I54A 3W77A 2VRCD 5A4FS 4HDSB 3BMCA 2BDUA 3ZNOA 4Q7KA 4XEUA 3GEBA 2IIQA 3AHEA 1UJCA 5LBTA 4EVSA 4I5FA 4ITRC 3BRWD 3L49A 1YS2X 3LUGA 5DM2A 3KJQA 4L3VA 1G55A 3PUWA 3QFCA 3UNXA 1P75A 3HHPA 5JSZA 2OK7A 4D9HA 3UMMA 4IQ4A 3OKFA 1PU2A 2PFSA 2VTBA 1H8HA 5KYUB 2BEWB 3OMWA 3QYAA 3WGHA 5FTKA 1ZICA 3H9UA 4YRRA 3GZNB 4UVEA 5LD2C 2P0AA 1ZUNB 1CQWA 2R6HA 5E7JA 3EQZA 4LHVA 3OCXA 1OOEA 5K0JA 1KFBB 3QE0A 3W9BA 4B3IA 5FL7A 4AUKA 1JDVA 1F3OA 1AG9A 1ZGAA 2XODA 3ASYA 4R2JA 1NJ8A 2J3MA 2HJSA 4UDOA 4Q01A 3R9XB 1QHNA 4IJ5A 2Y1WA 1E8NA 1ACJA 1DHRA 5GP1A 1JG1A 3QSGA 4WJKB 1IN4A 1G63A 3W3AA 4OFWA 4TZ0A 4N5NA 3F7TA 5JSYA 3AEYA 3I09A 2OXTA 2O4CA 3RUHA 1DMRA 2IXBA 3IP1A 1K0FA 221PA 1VIAA 4UEWA 1FXWA 4JBHA 1TJPB 2XTZA 4G9BA 2RB5A 1V47A 4I46A 3CINA 2QRVA 4BGIA 4NENA 4IFTA 1C29B 5HDBB 1UKAA 5TPZA 2WUDA 1T8SA 4YAKA 4DCUA 1QHGA 5K3CA 8MHTA 5CA0B 3BTOA 1RKBA 1U2QA 3ZHTA 2RC6A 4W7IA 2I29A 1UIMA 3ZGVA 4ZPJA 2KBEA 1Q20A 4MW6A 3ZUGA 4B43A 1XALA 1DKLA 1T1JA 3X1MA 1UKBA 1TZJA 4Z0HO 1D4ZA 1HE4A 1JPVA 2NZ8A 1OLUB 2R97A 2Q07A 1HL7A 2HAEA 4NYMQ 4N41A 1PWEA 3CVXA 1U0OC 5KMGA 4CL0A 4KUEA 3WLKX 4KQ2A 4BKRA 1N0VC 4CEHB 1IVNA 1RAGA 2PS9A 2Q5QA 1UC8A 3R5HA 4R2HA 4EKDA 1MABB 2Q3JA 3QWIA 5GY7A 5EJ5A 4FKMA 1CTQA 4QDJA 5B7GA 5DGDA 1OWNA 1F0PA 3E7WA 4LXHA 4BGVA 1XX6A 4ZRDA 5BWOA 4C6HA 4ZAWA 2DECA 5IPFA 4AYTA 1PRYA 1UOQA 4KPUA 4LNAA 2NUAB 2YDXA 3M70A 2B2XA 4EKEA 4N48A 3H75A 4C3OB 1YO6A 2I8CA 4GX5A 5TS3A 2JGDB 5BOSB 1R4ZA 3VZPA 3JY6A 2EWWA 3PWKA 4LF4B 4A2QA 1DJPA 3EXFA 3G2PA 3PI7A 5I7VA 3WDKA 4KQHA 1JWAB 1SBHA 3EH1A 4GRAA 5EXEA 3MRVA 5AXBA 2Q2VA 2VK2A 1PHRA 3GXOA 4PZPA 3M4YA 5EMNA 4CFSA 4ECAA 1WSWA 4CEJB 5REQB 4KH1A 3CVVA 5DN9A 1E3WB 4ZKEA 2PH7A 4LMRA 2OOKA 3UJCA 5IXJA 5DI9A 3T8YA 3ZOZA 4ASUD 5FA5A 4IIXA 4QXMA 4F2DA 1ODTC 4M7WA 2MSNA 4RTSA 2YNMA 3L01A 4LWOA 2BM9A 4ID3A 1K7YA 1FP2A 3FG9A 1TIPA 4UCWA 3PRJA 4M83A 1EE9A 1ZY2A 2BISA 4DE5A 3EFHA 1Q0LA 4MB0A 5C4MA 4QQ8A 4IYRA 3OQMA 3FPCA 1KFCB 3EVFA 3Q98A 2O3RA 1F2TA 2HU2A 1FE8A 4KX5A 2XE4A 1YJXA 3G0DA 3IVGA 2I0FA 5BNZA 2CLIB 1VPLA 3OKCA 4CWAA 4HZUA 4JNKA 1EP1B 3K2QA 1U2ZA 1GFSA 2I1QA 2OWEA 3MJRA 3GBSA 5KKNB 2GX6A 2QRJA 2KPOA 2W6ZA 4PLZA 2F8MA 4RK4A 1N6OA 2WNSA 2I1VB 4ZHSA 1RDFA 3BHNA 3T1TA 1QGOA 2WUWE 5JJ5A 4ZMSA 2PT5A 2J32A 3FSGD 4N7RA 1DRVA 3R7WA 5IVIA 3CT4A 2DKNA 4LJ9A 2CZQA 1DIAA 3R40A 2WZQA 4GECA 4Q1VA 5FOTA 5KX5A 1KWGA 1K8XB 4J76A 1RS0A 1OAKA 4DSNA 2PEZA 3PC8A 5DCWA 2CJWA 2KMLA 2UV8A 1ZW1A 3LSTA 3RG8A 4EJSA 1FQJA 4M0FA 3MWLA 3WR5A 4L0DA 4BO7A 3UN1A 1TYBE 1N1GA 4JB8A 4R41A 2LR0A 3V4ZA 1IATA 1JLLA 5ETJA 1JDTA 1N3IA 3E2PA 5T4HA 1ONBA 3I9LA 3IBFA 2XDYA 3OQ6A 2VF8A 5DGTA 1N9ZA 2B99A 4MGHA 4X44A 4JITA 3SPXA 3I2YX 2WLTA 3GAZA 3C14C 3BA6A 3BSFA 4D0LB 1MO4A 5JTUA 1MMFB 4UBMA 3COVA 3DOIA 5F2NA 4AY6A 4PYOA 2ZR9A 4PC6A 3PEWA 2CY0A 2IV3A 1BIFA 1PUJA 4AMVA 2WKQA 3TL3A 1JU9A 4EABA 4YCLA 5AK3A 4IO0A 3QELA 4XGRA 3NBMA 4L85A 3CFYA 4F86A 1BQ3A 2ZRAA 2HA2A 4NF2A 3ZZ1A 4CMEC 5BR4A 3JR3A 3U4QB 1KHHA 3ZV4A 3A6JA 4QGBA 4YCCA 4ARBA 4BEBA 2C5HA 3C3JA 3IP5A 5EN4A 1G8YA 3GL9A 2NW6A 3K9NA 5T64A 1XKQA 2H0RA 1M34E 4K9RA 2GLXA 3DZFA 3OJFA 3KV3O 1QR2A 3P2IA 5DSXA 4H3HB 3GH3A 5BSKA 4RY0A 5F7OA 4WESA 1PQPA 2AS0A 2Q6TA 2GTIA 2ONZA 3FYUB 3RVSA 2PZMA 3IE0A 3DKKA 1SXGA 2J3JA 2ZBDA 5DBOA 3M6VA 5JMPA 2SICE 4GZ6A 2BKVA 3F6CA 1QYXA 2HPVA 3W5HA 1KS2A 4LTMA 4CMCA 2R8EA 2PZJA 3OJWA 5AW2A 1OXUA 3NGXA 3H3FA 1R8QA 1KETA 1UZAA 2P5SA 2YY7A 3HACA 4NJEA 2DR2A 2R3SA 4WV3A 2OUIA 3BIXA 1EQUA 4FR0A 3LXRA 3THOA 1C9DB 3CLSC 1HC7A 2N1BA 4ZEOA 4PYQA 5TY0A 4JU9A 4WN3A 2Q6KA 4MO9A 1KP9A 1P2DA 4XR4A 2C9MA 3K35A 4LZPA 4NQRA 4TVOA 3FNBA 3UJHA 4NCKA 3P9QA 2WTNA 2PLFA 5FPPA 1EVKA 2WUEA 3FOWA 3K72B 5CBPB 5TGTA 3CVUA 1SY7A 1JEEA 1JQEA 1XCOA 2HMAA 4MDHA 4B3TB 3Q7QA 1W9MA 3QLUA 2CF6A 1DQRA 3EHDA 3IDQA 3N8DA 4FLEA 3FOFC 1WRBA 3IPLA 1A96A 3NP9A 1IULA 2RKWA 2F00A 1C9NA 3HVIA 2ZAMA 3HDGA 3LHFA 3WP0A 2Z08A 4RA9B 4DAOA 1U7WA 2ZIUB 1PL7A 1TGYA 3LUAA 4B8WA 1TIBA 2QJWA 5ELXA 3OZCA 1XMXA 1C3EA 2XYHA 4CM8B 1MDBA 3WSVA 5JNUA 1AO3A 1U9JA 3VZRA 5EP3A 2YWHA 1U65A 3H7AA 4YAGA 3ABQB 4CCAA 3PLNA 2EEPA 2OP0A 3FOBA 3N07A 4EZIA 5E95A 2POCA 5JSFA 3JYPA 4OLBA 1EAMA 3TL6A 1C4OA 1YDWA 3QFHA 2ZG6A 1OZFA 1U7ZA 1DGQA 3OMXA 5E1MA 1E5VA 1UKYA 1V8OA 5FIUA 3ZW7A 1UBMS 1PX0A 2R6FA 4FNOA 2DQ4A 3KP1A 3QXHA 1PQYA 1SQ5A 2J7PA 1IM8A 3A4NA 1WXXA 3F98A 1VSTA 4JC8A 3RBVA 3ZNQA 3WL7A 3R7NA 2DPHA 3EWAA 3EZGA 2VPXA 3AP3A 1A8PA 2WJAA 4YY3B 1Y1SA 1WVMA 5AKYA 1N2EA 2XZOA 1BFUA 4KXQA 5T4EA 4O2BA 5JJLA 1GV1A 3BE4A 2IUTA 4F8JA 1XA3A 1OX4B 2LE0A 2XMCA 1VOTA 3AG5A 4TKUA 1V95A 4K7JA 1CUCA 5FDFA 1GA1A 5AI8A 1GGNA 4KR6A 3VUEA 3IODA 3C3DA 5ARBA 3JSAA 1FBTA 3LDUA 1NMSA 2NPOA 3ODPA 4MULA 1XRPA 3IEXA 5DT2A 3FY4A 3DUFB 3HA3A 1D4AA 2PPVA 1T3ZA 2FFJA 3A9RA 5J58A 1DRKA 1OKKD 2WHXA 3VHRA 5FI0B 3SAJA 4CKCA 4F6RB 1X19A 1T25A 2HMYB 1UDRA 3ON5A 4TXLA 4E5PA 4PTLA 2HM7A 2J07A 3QGMA 4EB6A 2DT5A 4JLKA 2I55A 4JYCA 4L02A 5CH5A 3QU5A 3ZDEA 1Y6FA 2ZAGA 1EM8B 2XAAA 4WH0A 4DR6B 4N0DA 5T67A 3HN6A 2VP2A 1KOJA 1YS7A 4CETA 1RYBA 1T0JB 2OV1A 1NNSA 5K3FB 5B58C 3OZGA 1HG0A 2OFWA 1P5HA 4B40A 3U44B 4JP8A 3QUAA 4P08A 4ZOBA 4XUEA 1GGEA 4MUFA 3CCBA 3KKOA 3GRKA 1KKMA 3H0CA 4PPNA 3T6KA 2BWJA 1D8AA 1JHXA 4EKGA 4I4TB 4W5TA 3IEMA 2FPKA 3I5AA 4X92A 3CW2A 3FTQA 3VH4A 2JFHA 3H9JA 3ROFA 5H68A 2BKEA 1G7RA 1YS9A 2VYCA 3GJRA 3SF0A 4BLWA 1T43A 1I6LA 3CUYA 3P26A 4QODA 2FXIA 1GQOA 5KNCH 2A9VA 2A0XA 1KDTA 3ADPA 3DVAB 4FOTA 1N2CB 4DLUA 3EC2A 4N8EA 5IBRA 1ZOLA 3I6IA 4MV9A 1EFHA 4RBNA 4MR9A 3W4KA 3TB4A 5KNBD 2FA9A 1P1BA 1PD1A 1X8KA 4ERNA 3DEJA 1IUKA 1U28A 4Q39A 3HXPA 3VPCA 3MRTA 1FZTA 2AXNA 1NULA 3C43A 3V4PB 3Q2KA 3FMFA 3LT5A 5EIFA 4UM9B 2NIPA 2PAAA 3H2JA 5E2IA 5BSFA 5J2UA 3O9VA 4X66B 4M55A 5KYTA 1AN0A 1LBHA 4J4BA 4PX9A 2IYXA 1MQSA 3L4BC 1U2DC 3GP3A 3BF7A 1T4DA 4B6GA 3V4SA 3MA0A 3W7BA 1DJMA 1M1YA 1T2NA 2F43B 1O95D 2JGKA 4HDRB 1I5OA 1VE5A 4JA2A 4H60A 5ANRB 4C14A 4Q7MB 2V6FA 3EAFA 3KR9A 4Q0MA 1PS8A 3N2KA 5K8IA 4R5HA 4MR7A 1GTRA 3DDSA 1WKCA 2PMCA 3VNBA 1KI4A 3JALA 1K86A 3ZIAD 4B6PA 3FNQA 3HSSA 5DDIP 3D6UA 1HT2E 1NBHA 1NMYA 2YBDA 2A9PA 1CUFA 4FGWA 5ITWA 4BJHB 4EKNB 1NBOA 1U1CA 1EGQA 4UJ5A 1K3FA 1Z0DA 4L28A 4BNYA 2QLMA 2Z09A 4U8GA 1W1WA 1JW9B 3VKVA 3P4UA 2WDZA 3GDFA 3ZWNA 5CYGA 4JVMA 1I10A 2YCLA 4HNTA 3FZGA 4YQEA 2DYKA 5IBPA 3FLBA 4UXJA 4H4EA 1TQ4A 4YO7A 2WKRA 4Q4JA 2PMEA 1FNBA 4E5NA 2HR1A 5HFAA 4O5OA 3THXA 1Y9AA 3IAFA 4KO2S 1YRQA 5IVKA 3CQ9A 4BOYA 2XKAA 1TK2A 3AJAA 4FXPA 3BCUA 3IQHX 2AF4C 1ZH0A 2MYPA 1UZLA 4UD2A 1HYEA 2CXOA 3KHUA 4X84A 4A03A 2QG9A 1UXIA 2A9JA 3BKXA 2W6ID 1FFCA 2EBFX 1P6UA 1TAQA 1ZN2A 4FYVA 4EMTA 5CDFE 3Q8MA 5TMEA 4NH0A 1O57A 2IHUA 1SIWA 3TQOA 2L69A 2V6IA 3L8ZA 4IP0A 1GUZA 5J43A 1TU0A 1JHOA 1USIA 4GKKB 3T1QA 1IHUA 1CB0A 1SWWA 1SXIA 5IDWA 2FXVA 1EU1A 3LDAA 4RVFA 5AKEA 4N3BA 4EF6A 3KSUA 4B7XA 1GGHA 2JLRA 2C9BA 1Z63A 1WLSA 2GRUA