1ZLYA

The structure of human glycinamide ribonucleotide transformylase in complex with alpha,beta-n-(hydroxyacetyl)-d-ribofuranosylamine and 10-formyl-5,8,dideazafolate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoribosylglycinamide formyltransferase
publication title The apo and ternary complex structures of a chemotherapeutic target: human glycinamide ribonucleotide transformylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2005-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1zlyA00
3Q0IA 4YFVA 4ZYYA 2BW0A 2FMTA 4TT8A 4ZZ0A 1ZGHA 4DS3A 4YFYA 1RC1A 1MEJA 5J9FA 3W7BA 3OBIA 4ZYUA 1CDEA 2GARA 4IQFA 5CJJA 3DA8A 4ZYZA 2YWRA 3P9XA 4S1NA 1RBZA 1C3EA 3GARA 1RBMA 1YRWA 1ZLYA 4R8VA 1NJSA 3AUFA 4EW1A 3NRBA 4EW3A 3LOUA 1GARA 4TTSA 3R8XA 3TQRA 4ZZ2A 1GRCA 4ZYVA 4ZYTA 2CFIA 4ZZ1A 4QPDA 3DCJA 3TQQA 4TS4A 1MEOA 3N0VA 4EW2A 4ZYWA 2BLNA 4NV1A 1CDDA 1MENA 3AV3A 1RC0A 1FMTA 1ZLXA 1RBYA 5J63A 4ZZ3A 1S3IA 4Q12A 4QPCA 4ZYXA 4PZUA 1JKXA 1C2TA 1RBQA 3O1LA 3KCQA
chains in the Genus database with same CATH superfamily
3ZYZA 1TK9A 3Q8KA 2DKOA 1C0LA 2C4KA 2GPJA 5SV2A 2R68A 2P4EA 5EEGA 4QAJA 1PHRA 3W4KA 4BZXA 5M3BA 4DV7B 2BEUA 4I9UA 5KOHB 2ZYUX 2HKIA 2ZRDA 3IVCA 1V7CA 1Z37A 2B94A 3DH0A 3CNLA 2HJHA 2C0QA 6YASA 1O95C 3NJRA 1P0MA 4LXYA 1MG0A 3SQWA 4A82A 4P4SA 1CYDA 2GYVA 2IPXA 1Z4MA 3L7IA 3HY4A 2J3DA 4XDGA 5GJCA 2WICA 4MWDA 4N7JA 1CWUA 1QH1A 1LXCA 1O6ZA 4N7RA 5D3QA 4EB0A 2AOTA 5JJ5A 4RGQA 2VKQA 2XA1A 1U3WA 3JWIA 4BZPA 5COBA 3ZBTA 3RSFA 1DXHA 4JEMA 1UBSB 3NVDA 5HCIA 1G5FA 3OZAA 1OX4B 2AFHE 2I7VA 1U81A 3HNRA 4RYDA 5H80A 4D8TA 2DJ5A 5LR6A 3BXHA 3IHKA 1VJ1A 2FXVA 3QEMB 3NHMA 3LUKA 3UAWA 1I7NA 4WLFA 4YPVA 4Q9JA 3U81A 1QHYA 2EFDB 1J8QA 3OIWA 4P7BA 2AQ8A 3B53X 2PJRA 1C4OA 1GFWA 3GAFA 1W4LA 4W6ZA 1RBZA 3NX4A 5AUQA 4EG5A 4C04A 3HDVA 2O7QA 2VPQA 3BT7A 3HKEB 2K87A 1ATZA 2VT3A 1HTWA 3FOWA 1SBCA 2BGMA 4L73A 2CCGA 4MIOA 4NK5A 3A3OA 4MI1A 3H8JA 4RTMA 1JB1A 2VP6A 3DBRB 4DIDA 4AY4A 2JS7A 3WLPA 5DNYB 3CHYA 3ND6A 1O96A 3CF0A 1QHIA 4EUHA 2FLKA 4O2AF 3TIVA 4TRMA 3OESA 2OD9A 5E9WA 1CR2A 1XTRA 3NEPX 2V5VA 4NBVA 2XBLA 5LIPA 5C1PA 1DC5A 3LUPA 4Q7MB 1JWBB 4HNVA 3UM9A 4MPJA 3EW7A 3C2QA 2JJ1D 3PHBE 1SCNE 1L7AA 3D7LA 4G4IA 3T4XA 4EGAA 4N76A 2GCNA 2GPWA 4RA6A 4EY3A 4PZCA 3S0JA 1XDGA 5DXAA 3CE6A 4DNQA 1ZM2A 1PT6A 2ETVA 1FMCA 3IOBA 3NNNA 4G8CA 4DPMA 3GLIB 1E3WB 2PUJA 5SY6A 5TQ0A 5KCMA 1RM0A 1HR0B 2X8BA 4DSZA 2NN3C 1F7UA 1Y6ZA 2J0QA 1ZL0A 2BAGA 3CBGA 4X85A 4EHKA 2PH5A 4B71A 3P2IA 4OO3A 3PGVA 4QICA 4XVCA 3UQZA 1DHTA 5AOVA 4FGJA 1F5SA 3AUSA 3JRXA 4KTTE 3TCKA 2PVPA 3D7KA 3V1MA 3IT3A 1ZU5A 3OJWA 3N2NA 1U0GA 5DLPA 1QWSA 4MV7A 2B6HA 4B6FA 3OKPA 4BRSA 4QBIA 1C8BA 1QYVA 3FTDA 4EPWA 1OJ7A 3OLQA 3AEQB 3D8BA 4NESA 4UD2A 2X7XA 1GILA 4LWZA 2VT7A 4PQRA 4CU5A 2VQEB 1LX6A 3TAXA 2QM3A 3DHVA 1KYWA 1Q84A 3QKTA 3M49A 3MRXA 3FFTA 4N3CA 1QO0A 3TIIA 3I1YA 1GNLA 1KYVA 2B98A 3MJRA 1GPNA 1HMYA 2C2BA 3NWBA 2N47A 4Y7DA 2FWRA 5FHRA 3WIDA 4EG4A 4IMPA 5EJGA 1TDJA 2IHUA 4XRRA 5EMMA 3FKJA 3SS9X 1PNTA 2SKDA 2VYQA 4GXRA 3RFFA 4CMIA 5DGIA 4ESEA 821PA 3LF2A 3LMKA 4XX0A 4EVQA 4L76A 4OJMX 4WVLA 16PKA 3ZZNA 3ZTYA 1LS1A 3A6LA 3BE6A 3JRWA 4G85A 3SLKA 1E9FA 1M1NA 2C97A 3H2SA 2IL1A 4RHYA 4B3JA 4Z4IA 2BZ0A 3IXQA 5TX7A 1X7YB 2E48A 1BS1A 1D9XA 4GKVA 4WNCA 2PCJA 4E5MA 4ZICA 1I01A 3ANYB 2IUTA 5DSZA 1GPYA 2ONJA 3JQFA 4R4JA 1R4AA 4FB4A 1SZJG 4K3VA 2G9UA 1Z26A 5AUNB 4HVTA 1MBZA 2HY7A 4JOQA 2Q5CA 2YHSA 3EDOA 3OLXA 4YFYA 2E6KA 4NFHA 3QF7A 5KPJA 1KERA 5FUVA 3UG7A 4KE9A 2DBVO 4DQDA 4C7OA 2K7FA 1HDCA 5LP6C 1KI4A 2JGJA 3VAYA 4DWOA 4IZOA 5TGZA 5L6MB 2AYYA 3K4PA 1M34E 1AJEA 2ZVQX 1BWSA 1UJCA 1J00A 1ZOIA 2ZB7A 2MHCA 3UHJA 3EXHA 1KMIY 4B3HA 2I33A 4HQOA 4OHUA 1EYZA 3HEMA 2AKAB 4C6TB 1KO5A 1SWVA 5CXSA 1K3FA 2VFAA 1TADA 5DEIA 1V43A 3GRKA 3FRJA 2XCTB 2PK3A 5BRJA 1E59A 4Q1EA 1L5RA 2ZBPA 3BGIA 4XFJA 3TECE 1U2GA 2VF4X 1P3DA 4JLWA 1WVIA 2OCDA 1N5MA 4KLAA 3B82A 1MFZA 1FVFA 3PD0A 1O9GA 3RUPA 3CVYA 1WXGA 2H54A 4MW2A 3C39A 1BMQA 1TEVA 2W2QA 3C3JA 2IVZA 3BDVA 4KV7A 1KQOA 3JASA 4OD0A 2PMEA 4RCYA 2ZR8A 3OZWA 4ENVA 3HJTA 2O0LA 1Y8RB 4MWEA 3LKZA 3RSCA 3AM4A 2WWXA 1FY2A 2NO4A 3KL2A 3R7WA 3UZUA 1CX9B 2HJRA 1FMFA 1F1JA 1MAWA 2FY8A 2P3SA 5IMBA 2DSTA 1MMFB 1L0BA 3OTQA 4HDQB 4U2CA 2D13A 1IEQA 3NBYC 3F6PA 4GMHA 4J4BA 4QD3A 4D45A 2P2ZA 3HFSA 2X1MA 4EFLA 3QI2A 2FKAA 1JG1A 3LC2O 3GPIA 4QQRA 3EZLA 5ELXA 1EQAA 2D74A 1NA5A 3GMTA 2C7BA 1XDZA 1SCQA 3SKVA 5AI4A 2WKRA 3W3AA 5K3FA 4Y2PA 5K0NA 3T1QA 4AY3A 3TLCA 3S70A 3QU4A 1AGNA 1BS9A 4HQRA 5J2TF 1E2DA 3RIGA 1C3LA 3GGOA 3H0CA 5E3JA 1TZ2A 1XCBA 2KPOA 1UKVY 2EATA 2MJLA 3AY6A 3DZGA 4UBLA 4V3BA 1C9DB 3ASVA 4Y2TA 4YJ3A 3W8DA 4FR5A 1C5KA 2O20A 4BQQA 3I2HA 1M1YB 2ZUEA 1KI9A 4ZVQA 1YKGA 3E9DA 1CUAA 4A6XA 4BNZA 5KWEA 3BWMA 4C01A 3PQ5A 4N1AA 3MMZA 5TQJA 1QIKA 2PXCA 3HE3A 2HV9A 4EUEA 4B6GA 2JDID 3AM3A 1DBPA 2HA5A 1F2TB 1T4CB 2A9JA 1JEQB 2IOFK 3G7UA 4M8NE 3RADC 3K8YA 3PCTA 4DWVA 5KOJB 3FSGD 3C70A 1DQYA 2B2NA 2WV9A 4NZMA 4BFVA 4BVFA 1XRRA 1XMOB 4LQLA 2PIDA 2H52A 4CM1A 1NQXA 4UHCA 2H11A 1ULUA 4XGIA 2IDJA 2QTZA 1HDGO 3RWBA 5JAUA 5HBRA 5LUAA 4CLXA 1WPQA 4JYAB 3ZD7A 4GBJA 1JQEA 5IJWA 4OA5A 1LQUA 3K6RA 4K9MA 3F8TA 4KQ1A 4GPZA 4N5IX 4ERNA 3KPYA 1MN6A 1QIEA 3EC7A 1YR2A 1OTYA 4Y1EA 4UNRA 4YT8A 2D0OB 1PWYE 1V6SA 3DE4X 4LNAA 2GNAA 5DTIA 4IVQA 4BMVA 4CF3A 1OBOA 1MGPA 3E9CA 2BKAA 2EP8A 4D9JA 3QUCA 2FN7A 2ZWIA 3B6KA 2BGKA 2WOOA 4FW9A 1GCAA 3GQBA 5E3IA 5JLAA 3WLJA 5C7YA 2NSJA 5EIHA 2FPPB 1ISFA 2R6DA 2XTZA 1I7PA 4UHDA 4IUDS 3ROXA 3WKEA 4PSDA 2TMGA 4LE2A 3WO1A 2R97A 4S2EA 4BN0A 3QU2A 5B30A 5BN5A 2HPZA 2HCJB 4Y67A 3U7HB 4DA4A 2Q4DA 3NTOA 3PHCA 4BU0A 5ICEA 2YN4A 1I4WA 2ZLBA 1ULHA 2Z2JA 1C7IA 3GGCA 4N6GA 3WRYC 4CQLB 5KINB 5LP6F 2O8BA 3IBCA 3MOSA 2C1EA 1QF6A 4NBLA 2J0VA 4FKMA 1ZIOA 3JYPA 1W6RA 1DAEA 3GUYA 1KMHB 3IX7A 3R2JA 3MLEA 4IHAA 4Q4LA 3ENZA 3S2ZA 2JF0A 5FTJA 2W2XA 4B35A 2WW8A 4LJKA 1QDUA 2FQXA 4X66B 3DFFA 4ZJUA 2VTEA 5REQB 3CZ4A 1CERA 5L3QA 1LTQA 2XWBF 4HYTA 1FBTA 2WZDA 3BEDA 3O2SB 4KVAA 5F1OA 3F9IA 1CFZA 3PNLA 2J32A 5DCUA 1ZD4A 3K92A 1E9RA 3GQVA 3SFTA 4BQSA 2W00A 1OF1A 2OORA 2WABA 1SQ5A 3KSUA 2YFQA 1EA7A 4YMSA 1NM5A 1UAGA 2O7VA 1ZIXA 2OCKA 2RBKA 5I3ZA 3IUSA 2VZ8A 1JEOA 3LKDA 2HT6A 5JAOA 3AHGA 2NUTA 2MDTA 5GIPE 4XWWA 1E4OA 2HLDA 2UXCB 3A4MA 1T4DA 2H5LA 4UJ3A 3DFKA 4RVNA 1CEYA 4GXTA 3RAGA 1A50B 1NBME 3TEFA 3UFXA 1SXJE 2ZJYA 4MKFA 5DT2A 4KAJA 5K99A 9MHTA 2FMUA 4OKNA 1AGYA 5EFOA 4MSUA 3EUEA 3GEMA 2PXAA 3K31A 3L0YA 3SBXA 1KYZA 1STOA 3TCNA 4F6RA 4YMHA 1RU3A 3DR5A 3RRYA 4CCYA 3ZJVA 3JQ8B 2HIGA 4QBHA 3RI3A 3TKAA 1E0AA 1TEXA 2Y67A 3N8HA 2W58A 4AZ0A 2DLNA 2WT9A 4ZYXA 1UCFA 3IQGX 4CBVA 4WTOA 5JCOC 1YRQA 4Q4CA 1P6UA 3IESA 4A03A 3GDWA 5JY1A 4R8SA 1V3QE 4KXWA 3U4IA 4TRNA 3SJAA 1JHMA 5IU6A 1CUWA 3VKHA 1QLHA 1V2GA 2R3SA 4PYOA 3BPSA 5F7XA 1OWNA 4CL3A 1P29A 4GXQA 5D8DA 4UOEA 2YJ3A 1OWLA 5CA1F 4RA9A 2O8EB 2YYZA 2PUTA 1EWRA 3ER9A 1P9OA 2C8KA 2OO5A 5AJHA 4QRDA 2NVWA 4ZAXA 3RF7A 4EY4A 1SY7A 2Z2XA 3JWHA 4ITVA 1XHFA 3VGJA 1NMZA 5FNVF 3H1BA 4ZVVA 4DM3A 4K6OA 2PXXA 4AKIA 2Z1MA 3W9UA 4HAZA 3VZSA 2AOWA 4C08A 1D2GA 4LI3X 2BFBA 3BJIC 4C0WA 2BJHA 2P0EA 2GTPA 1N5DA 5GV7A 5KUTA 3KTOA 1Q77A 5EAIA 1D03A 2XHZA 2BM0A 3I3OA 3IEXA 2HCTA 5FI0B 3WGNA 1SQSA 2JGRA 3LF1A 3Q3EA 1J49A 1XD2A 4M6WA 4ZCSA 1RJ9B 2JVJA 4FLFA 4RY0A 1WLYA 2CEKA 1FEZA 1NDUA 4JWTA 3PGXA 2G1UA 4TPKA 5HZMA 5SZJA 3P2YA 2GBLA 3KB1A 3AQ4A 2XNSA 1F12A 4X93A 4L27A 1X1RA 2QQFA 3TLYA 5A4DA 3NTLA 1T9AA 2G71A 3CN9A 4C5AA 4ZCPA 2ZSJA 5FI1B 3GLSA 4YBZA 4G89A 5JAIA 4CIYA 5AVJA 1N33B 2HSWA 2XHEA 2HM7A 3G2MA 2WTEA 3ROEA 3T7JA 1XPRA 1RXVA 5TEWA 1G55A 2J4FA 1WMFA 3HB0A 4FD3A 2ZBUA 1PQPA 2QDKA 4J0JA 4J7UA 1MC1A 1FPQA 2ZM5A 1RRCA 1BDMA 1UKZA 1QBKC 3LVRE 1HV8A 1UJMA 2DFTA 2YHIA 5ALIA 5CVJA 2ZQ5A 2IVFA 5B3KA 5GIOE 3IERA 4QQNA 1GCUA 5TGDA 4PGMA 5ADWA 1ST2A 5DNWA 3K2EA 3DKKA 2UU9B 4DIMA 1KS9A 4AO8A 2XXAA 3GJ5A 3QLVC 4N40A 2RC5A 5T64A 4LOLA 2ODBA 4NOMA 4EHBA 3R3VA 1U1FA 5CXXA 1TVCA 1NYLA 3OHMA 1S3GA 5J40A 2IELA 4NARA 1XLWA 1XE3A 3D1JA 4RV5A 5MFZA 3WWEA 1MCZA 1T4MA 2QGZA 4REMA 3R3SA 4DFDA 1UZUA 2JAOA 4EYQA 4GAEA 3ISVA 3PGKA 3ZGNA 2WA1A 1VJ0A 4HKTA 2DWQA 3ASYA 1TIPA 3QBVA 1KDZA 1C7JA 2EX0A 1HKUA 1XMPA 1JE0A 3HVJA 3L4SO 4TV9B 1Y9EA 3P0RA 2NU7A 4HSGA 4JLSA 4JEHA 4R9UC 3FUTA 4U0KA 3T9AA 3KTAB 1JPNA 3CRW1 3MWJA 1YL5A 1XKLA 2V1UA 1WHSB 1HG1A 4LY9A 4U7JA 1AZLA 1Z82A 1Z0AA 4J8PA 5IJZA 5BWCA 3QX7A 4TSFA 1VECA 1U5BA 1N1DA 2ZWOA 4JEIA 1E3QA 1K8YB 3DAYA 4ZA2A 3FYUB 2AFIA 3QXGA 4LX0A 7AT1A 1S4QA 2DBRA 3BMXA 3RM3A 1J5XA 2PSFA 1SKQA 4RD6A 1ZVJA 1OB2A 1W29A 4HEA1 1GTSA 1YZYA 1DVRA 1YZVA 4TXMA 5HF6A 4CEJA 4F1WA 1T4BA 2IUFA 4C4ZA 2C5AA 2ZRBA 3LT2A 3G5AA 3PC4A 2FW9A 3ZY4A 2A30A 2OA0A 3ROKA 5JXWA 4NPHA 1YVPA 5KHOC 4IQGA 2C7OA 5E6RA 3D6MA 4I1PA 4XE5A 5K0SA 1M10A 4RY2A 1YBHA 2G07A 2VNHA 3G0CA 4EGSA 4XDHA 2WPDA 3UAOA 2ZANA 4MJ7A 2ENWA 2PU5A 4CIDA 1JG3A 1EXVA 2ZRHA 1F4VA 5ALVA 1N9GA 3RS2A 2H4XA 2DPMA 1A9XA 2MT9A 4MTLA 1V8PA 4WY8A 2CHQA 2INGX 5K03A 4WCFB 2OAGA 3RJTA 1B16A 1C7QA 2WHQA 2OV8A 3JATA 1F60A 1KQNA 4UQOA 5H3HA 4E15A 3GP5A 3U5ZB 3OPVA 2E18A 3AB7A 4K7JA 1OWPA 2D06A 2ASEA 2DWOA 2EBFX 1Z0KA 2R6FA 3KOWA 4KQ2A 1KVSA 1TJ5A 2HQRA 4ZDWA 3O1HB 2IWHA 3TL3A 3OQOA 1GGEA 3ROFA 3BYZA 3UWMA 1CUDA 1UL1X 1QANA 2IKQA 4G6ZA 2DR0A 3WWZA 2V4ZA 1XZMA 1V96A 1Z0DA 3K9LA 3WTCA 3EVCA 421PA 3RYCB 1JR3E 4QBFA 3WIOA 3TB4A 1TYBE 2IYOA 2PBFA 3HKCB 3KLBA 4YP7A 5GADl 5JXJA 2FDCA 3DVAB 1EVQA 4D3YA 2QRVA 3PQFA 2OV2A 4NG5A 3VFDA 4MMXB 2NUAB 4RZ3A 2C31A 1RYZA 2PSJA 3OZEA 2YJ4A 2ZI7A 3EAFA 3R74A 4MZDA 3O21A 2YZKA 1LZKA 1YDFA 3ICOA 4KBFA 4OY3A 3T5GA 5JWRA 5H81A 1DIGA 4Q3CA 4DLPA 3UMCA 2H57A 4AKEA 4S1WA 3EVGA 1V39A 3RRFA 4UEWA 2CVZA 4L78A 3CNQS 3BIFA 1IIBA 1O8CA 2P68A 2WUFA 4LRTB 3KJGA 2WWVD 3JVDA 3TGWA 2R66A 3ZI0A 2OPBA 4DMHA 2H07A 1YA4A 3C3PA 1P2UA 1U4NA 3KELA 4O4IA 2G17A 1OUMA 2Y4OA 2E4UA 3C8MA 2PHZA 1XF1A 3ORSA 2LBPA 4KOAA 1A9TA 4PZ9A 2ZJ1A 4M86A 1S7GA 1XELA 2VUIB 3EQZA 4JA0A 2E3JA 2Q1WA 3M6XA 3TSZA 4YAOA 3QWBA 4ZP1A 4Y0VA 3IKMB 1JDBB 4N6NA 4EY8A 2G3YA 4N5LA 3EDCA 3ZDAA 1X87A 1ZMBA 3GGGA 5T8KA 2I3BA 4E2FA 3QHQA 3KT0A 4QT4A 5FIUA 1J8FA 3OZCA 4QLBA 1TEZA 5TVGA 3I0NA 4HVLA 4NP6A 4OQ4A 2FW7A 3FYSA 3GNSA 3OFND 4IMRA 4X9XA 7REQB 1K8XB 3I4CA 3CZQA 3K9GA 3ETNA 2ZUBA 1CC1S 4IKPA 1RKVA 4GQBA 1MVLA 1H9CA 1TNDA 1XWWA 2XBUA 3FOBA 1Z6GA 5DWDA 4POOA 3MOIA 5ULLA 1U8TA 3K8ZA 3LY5A 3LUAA 5AJUA 5IULC 4RZHA 3CRQA 1NNUA 3A1CA 1OSNA 4S1PA 3V4RA 4A8JA 2Q46A 4LZOA 3WL5A 5IHPA 2ZTLA 1UBCA 1NI4A 4HGQA 4F5EA 1E9EA 4JBIA 2GZMA 4MV4A 4MKGA 2HL6A 3AU9A 2JATA 4DUZB 9LDBA 1WY7A 2XYPA 3NXSA 1AO3A 1H3FA 3HR8A 4B3XA 3PHJA 2BJVA 1GA4A 4M8KA 1G18A 3IPYA 1QZUA 4OFZA 4GD3Q 1CB0A 1UWLA 3RSZA 3TLKA 4DA7A 5FA8A 1ULBA 5A7HA 3F98A 1G41A 4COOA 3ENVA 3VM6A 1MO4A 1AKNA 4E51A 1KEEA 1H2YA 4IG9A 2LE0A 4XQGA 3T1HB 4Y7CA 1GGVA 1QHNA 4JBHA 4BFLA 1NIJA 2QNBA 1VSTA 4CEIA 3ZDZB 2QD5A 4ZCTA 3E5MA 1DQNA 3JD2A 2FMTA 1Z08A 5BNZA 3LUHA 4BNYA 5HJEA 1YJCA 4I3FA 4EMUA 1EB8A 2OCPA 2QY6A 3HXPA 2FMFA 2GF0A 5FP0A 3SICE 2XZOA 4L0CA 2O8FB 3I32A 2EF1A 1FW8A 1SD5A 2C4UA 4WL0A 3SR3A 1LPMA 1UJ5A 4BDSA 4MS3A 2A58A 4LC9A 1I9CA 3U3OA 3D4NA 9LDTA 2E4VA 4NJMA 1MHPA 2FTKE 2H29A 2ZI5A 3H3XA 2IH2A 3WG9A 1VPWA 1IZYA 4H6PA 3PHGA 4NL4H 5FRDA 4MUKA 1R5BA 2NQ2C 2XUIA 4HWRA 1PEDA 2GASA 1B6SA 2GCGA 2NAPA 4LCEA 2HZBA 3MAJA 1R9JA 4QUBA 4W1SA 3RSOA 2GMWA 4S1NA 4EYSA 2D0IA 4XIJA 1S3SA 3WBFA 2IIVA 1J23A 4G67A 3WOHA 4B2LA 5AVUA 1TT5A 1WZCA 5K5EA 5AO9A 2JLBA 4PG5A 1GCGA 2IYAA 2EFJA 1C1YA 1QFMA 1QAOA 3W6OA 3QVOA 3OOSA 4UUOA 6PFKA 1PJCA 1XQXA 1PL0A 1V8OA 1LBIA 3A26A 1TCBA 1GTRA 1L7PA 3PDIA 3PZRA 2P65A 2PRKA 1ADYA 3TUZC 1ELOA 2E4YA 3PNVA 4LVUA 1CJSA 3TZQA 1Q7BA 1JGTA 2Y0DA 4DMLA 1QX3A 5AK4A 3KETA 5KYYA 1KDOA 3QEJA 3TKLA 3P0IA 3LC0A 3H2ZA 5C7OO 2BGNA 3IV9A 5J23A 1ACLA 1P17A 2AN1A 2XUFA 3AEKA 5HUQA 3W9BA 1Q2XA 4ZZ2A 1LSSA 4E21A 5JXIA 3KQUA 1V9LA 2G9QA 4E3WA 4L22A 1I3MA 1O5IA 3D0RA 2JK1A 3I3SR 3A4LA 4TWRA 4IS2A 1KFCB 4BWVA 1MX9A 3F2VA 1FNCA 3HVIA 3F96A 3VO8A 1A8QA 2IE8A 3TD2A 5FL7A 1M8JA 1YZUA 4HG2A 3U1VA 1U3TA 1BVYF 4IXTA 5LMUB 3QEAZ 4ZVUA 4JR1A 3QBDA 3MTGA 1NVVQ 4FFPA 3MQ4A 2FE1A 3FPGA 2FSHA 3T52A 4DLLA 4L8WB 2G1AA 4MVWA 5TF4A 5KQRA 3PLAE 3C1TA 5LZ4A 4I1OA 1IHDA 1FW6A 5ED4A 2L69A 5IYZA 3C41J 3I1JA 3OETA 4WKPA 2YVKA 3CZ9A 2ZEJA 4CWAA 1GJRA 3PFKA 3CR3C 4U3JA 5C9ZA 4M0CA 4ZO8A 2EDCA 1MA3A 2IYXA 5CLHA 1P7CA 3PDUA 3D6FA 4DLYA 2G9NA 1UBLS 1LA2A 4DJAA 1KRXA 3KOZA 2V5UA 2IZ1A 3FDXA 3NH9A 3A32A 3OD1A 2HAEA 3SEAA 4ZI3A 1FFSA 5EJ8A 4H77A 3GXBA 1MJGM 5EMKA 4F4IA 2IFTA 2PV0A 3VR2D 1NPYA 4RPHA 1BWRA 4Q9LA 2NO7A 4QNMA 4EHDA 3NIGB 3VVMA 4AQDA 1IN4A 1XC7A 1GN9A 3QPDA 1IWOA 3U3ZA 2V7QA 5DB4A 4COKA 3ZNNA 1EP9A 1GPWB 1IJBA 1TU4A 3O8DA 4N5HX 3RUAA 2OO5C 2AFHA 4YJ3F 4W7IA 1VLQA 2P9QA 5JRDS 2FR8C 4DA9A 4EI2A 1W30A 1ZJ4A 1ZHFA 2JCVA 2FU5C 2IW3A 3OSUA 3OAAA 4M0LA 4WCVA 3VJLA 3SF8A 3ZLTA 1EX6A 1H3NA 1TKRA 3EIXA 3UANA 1NYQA 2ZVDA 5L6LB 4ICIA 2G83A 5EJ7A 3ZQJA 2A4MA 2XQVA 1INLA 1UADA 4WCDA 5JATA 2CFOA 2Q8QA 4AIIA 2XGSA 2WJHA 3ZXXA 1QPGA 4AP5A 1N2HA 1YCGA 4Q1BA 4W99A 2BR5A 2EZUA 4RV4A 1MUUA 2CXUA 2V58A 2XITA 4L4UA 2Q5IA 4Q7QA 5F35A 2OV6A 5F73A 1NKVA 1PGNA 4IDPA 1TLLA 1V1MB 2W2OA 4XW2A 3MCWA 1T8TA 5SZKB 2C7GA 3V1TC 4ZAFA 3QLJA 1VYUA 5MGBA 1E63A 3LC1O 3KOMA 4PX3A 3Q8LA 2X5NA 4M55A 2C8JA 1REQA 5C80A 3UG6A 2G09A 3AP2A 2JD0A 3AF0A 1LQ2A 3F4LA 3MAGA 5EMHA 3WE7A 3P0FA 4JYCA 4ILEA 1KBOA 1X92A 1W5AA 2QTMA 4DKXA 1BXZA 1GPAA 3B3GA 1Z4KA 1OX6A 3K1ZA 3NRBA 4QRIA 4ZOQI 3L1UA 5KYGA 4B3SB 3EEIA 5K3CA 2VBCA 2RH9B 2FWJA 3A11A 4WI1A 3FWHA 2NVOA 4EH1A 1KVQA 1Y7PA 2J67A 4Z2YA 1C0IA 1LI4A 4GLFA 1Q91A 4S12A 4WACA 4X20B 4PCLA 4DIEA 5JECA 3AEYA 1ZN8A 3SNHA 2C9BA 1SC3A 3AW8A 3AL2A 4OQLA 2CJWA 1Z0FA 2VT6A 2GBIA 5K8VA 1VI5A 1IJEA 3EQ7A 2AEMA 4QPJC 3U6KA 2BDUA 3T3IA 3IP7A 1HE3A 1MC8A 5BWNA 1HLDA 4DGSA 4NFLA 2PH1A 5JJBA 4ND8A 1QFXA 4CL2A 1JI0A 3ZZUA 2V97A 1VLHA 1EK5A 1Y8CA 4TKMA 1B74A 4PC3A 4P1ZA 5JS2A 3FR7A 4QSMA 3EWAA 3BL8A 4W8HA 5CA0B 1XEAA 3B8HA 4K9OA 1J70A 1NATA 4LF5B 2C03A 1JBEA 2SCUA 1QG2A 3HXTA 3K20A 1TFUA 4HPWA 4P4UA 1YRBA 4RESA 3DBHB 3IO5A 3MMNA 4JQYA 4D25A 4FWIB 1P39A 2H3HA 1SIUA 5I48A 3FIJA 1NXQA 4AJNA 4D74A 4KO2S 2WYIA 5IBCA 1B76A 3LCVB 1GZ5A 2ZSFA 2DHCA 3PGMA 4D1YA 4CQNA 2IHNA 3VAAA 3BKWA 5LNK6 2QMUA 3QF4B 1SCUA 4NPCA 1OFGA 4FGZA 1X3LA 3UWOA 2BGIA 4TVKA 2BZ1A 3E35A 4YAWA 1AV6A 1DGQA 4WUVA 4JC4A 1PZGA 3T5BA 4Q3BA 1I3KA 3KRTA 4X00A 4F93B 4MROA 3VTFA 5EWJB 3QVVA 4AD8A 2C77A 2V96A 3GYBA 2Q5OA 4X97A 5K01A 1H0SA 1E2LA 4IQ0A 1KNXA 3OCUA 1PT8A 3N2YA 4KPUA 3UC5A 5ARBA 2I1WA 2QJOA 4AJIA 3CCBA 4UUPA 1M34A 5AM4A 3Q9SA 2RD2A 3CS3A 2ZIAA 3FPLA 3ORQA 2AKYA 2OAEA 3MCAA 3LLCA 4QJ4A 4B3GA 2OZLA 4BJ1A 1V5EA 1T0PA 2AEEA 2GS9A 3G02A 3NBMA 3FSRA 2YHBA 3ROZA 4FJ1A 4QU8A 1CS4C 3STUA 3EEYA 1FRFS 1R0BA 4C2TA 3SHTA 1CY2A 4UUMA 4O3MA 4EPYA 4DG5A 2JH9A 4B40A 4HTFB 3C6YA 3WV4A 2FZ4A 1WCV1 1VJTA 3EMDA 1FQJA 3OM8A 5E6SB 5B12A 4RHEA 2QN1A 4EUKA 3W34A 3KQMA 3PUHA 4GBED 2O5RA 2VATA 3BXPA 2JCSA 4YNBA 4BKQA 2ZPTX 3DGEC 1T43A 3NEAA 2D1FA 2EQAA 1U3UA 3A25A 4K9KA 2VNJA 3CJRA 4YDQA 3O3CA 1PFWA 5EPOA 1FYDA 5BV7A 1DJMA 3QSYA 2B35A 4LJ4A 8ATCA 1E79A 1PT9A 4DZRA 1WVMA 3E7DA 3GA0A 2ZXFA 1LI5A 3H1EA 4E5KA 2J5QA 4GYJA 1RXSA 4S1TA 4U7HA 5KQPA 3UWPA 2BEJA 1FCJA 3FF4A 4HFMA 4HPJB 5JD6A 1TM2A 5GWXA 2GEFA 3B3AA 4IZHA 1VA5A 3EPJA 4YUZA 2PZMA 1HZJA 4B1FA 2VDKB 1M33A 3V42A 3W6UA 3ZGOA 1IUKA 5EKDA 4PYJA 5A0FA 3R8CA 5EFZA 3M0EA 1KP3A 3NBFA 4DV0B 5AUOB 3P4UA 1NJ8A 5GJBA 1T5SA 2A1IA 4D4HA 3SJCA 1TQDA 5LA6B 4PPNA 2XOKA 4IM7A 1NW5A 4CM4B 3GLHB 3RYIB 1JLRA 4OHKA 3X3HA 3T1YB 4B3MB 1B42A 2AF4C 2RGWA 4QHSA 3KJFA 3DUFB 2VUUA 2Q07A 2G9ZA 3VYUB 3RVOA 1E0SA 2CHGA 1E9BA 1KC1A 2E82A 1JAYA 2GZ3A 2NXWA 4YACA 5I9LA 2KSQA 3QPBA 1B8VA 3G79A 4RXMA 1OR8A 5DNEA 1PU2A 1HZZC 1Z2EA 3H99A 3SBEA 1V6CA 3FHJA 1H6BA 1YVRA 2IGTA 4KGVA 4AZ3A 1PKXA 2I4LA 5B4TA 4YCDA 2SBTA 2B20A 3R3XA 4H4CA 4MWCA 2AR0A 3H6KA 4HQNA 5ESRA 4YMIA 5ELLA 1BHQ1 3CIOA 3WAKA 3PWTA 3RG8A 1ORDA 4QTXA 1GFZA 5I01A 1YV9A 1C8LA 2CNBA 2FCRA 4TKVB 5H5JA 3RQIA 3JYNA 1TGVA 1HY3A 5DCYA 4AXXA 2FH5B 2ADFA 4ID3A 4Q9AA 4D8XA 2GEBA 4PYQA 1H69A 1SK9A 5IDWA 1SUWA 2XB4A 1RAHA 3DAHA 2J5BA 3U6BA 1O57A 1VJCA 3NS7A 3QLEA 2AOUA 1IUPA 4BO2A 5I4IA 4R5MA 3SU8A 3JWPA 4KL8S 2JVKA 1DE0A 2H1HA 2R60A 4BNDA 3L93A 2EOAA 4FDLA 3WK7A 1RWBA 4LSWA 1BX3A 1XVVA 2YVQA 5NULA 1D2HA 4BQIA 1NMEA 2I1QA 1YDEA 5C8DA 4S1VA 3U3MA 3H65A 1FSPA 2BCGY 3PRKE 4DSTA 3IIIA 2AH5A 3NYQA 3HCOA 4LAFA 3OA2A 4UHHA 1GKUB 2XZTA 4CCWA 4BASA 4L51A 4URXR 2IIQA 4BB9A 4U7GA 1NNLA 2QUAA 2FRVA 3H2KA 4QO7A 2PYIA 5F98A 1PTJC 2YVUA 2W2VA 5DGTA 5IRCD 2NU9A 2GN8A 3B5IA 3P0HA 3V55A 1OX5A 2O2ZA 2RKBA 2V55B 2H31A 3LT1A 4P82A 5HA5A 3T54A 1XRNA 3SEQA 3STHA 1C14A 1ZNQO 5ERXA 4CE6A 4XYLA 1XZBA 4RF2A 4O2BB 4CG1A 5JH7B 2RHTA 2R4UA 2B30A 3BIOA 3KR2A 1IJFA 2Z83A 3Q2KA 1EGAA 1UC9A 2WE7A 4WOPA 2P2LA 5IHXA 3TQTA 2IXDA 3P27A 1WMDA 2BFEB 3NBUA 4MJLA 4ZT3A 2O2IA 1NXTA 3O4GA 3IB6A 1GTVA 1JAZA 3NHJA 3KAKA 4ARZB 5HK9A 5KTOA 4IJ5A 3VV3A 1HQYE 4XM2A 2XLCA 1R64A 1QLWA 1J0CA 3FVTA 1BRMA 1JP7A 1KZYC 3C3WA 5I8ZA 1TJNA 5C46F 2EHJA 1KRHA 2G77B 3BJRA 3TJZA 4W5RA 1FLDA 1M5RA 2F3QA 2WJZB 3ZDRA 3DT6A 4OU5A 1DTSA 3P9YA 3NHYA 4LNUB 1RQNA 2OBNA 5DI9A 3TLGB 3EZFA 1DMSA 2GF2A 3CVJA 2FSIA 4E5SA 2QHXA 3BB4A 4M7OA 2POQX 3ZWBA 1BW9B 3RDPA 2RGDA 2YL2A 3ADCA 4DEVA 4PLFA 5IM5A 1QONA 1MVNA 1VB3A 2ZRJA 4QOEA 5TR9A 4CT4B 1CRQA 5L3SA 4AULA 1NKTA 2VXCA 2DBYA 1J7KA 1SH7A 1K8QA 2OCXA 2Q7OE 3WBJA 4R8MA 5GZ3A 1YRAA 2D2VA 2XYQA 1NBOA 1D7OA 4IJVA 1NBMA 1DIAA 3RWOA 1SXJA 4JLVA 2BF4A 4MYCA 3TW8A 4LYDA 3HN7A 5F5XA 4URHA 2PJUA 1R6UA 3WADA 3ZCSA 1ZJJA 2RGGA 3PEFA 3WNQA 5HJ7A 3W5BA 1RHUA 1D6NA 5H02A 2WIAA 4AECA 3PJEA 5F7OA 1CZNA 3IOMA 4EM6A 2HD4A 2O5EA 1P6QA 3TINA 3ZQ6A 2PMFA 3OEHA 1IFXA 3CZRA 5KWSA 1WW2A 2A4KA 2F1KA 3DBLA 4OGWA 1ZRNA 2GXUA 4XB6B 5K2MA 3UUWA 4KWIA 2HWYA 3I5XA 1C1DA 3QU7A 1JFFB 3GUHA 3A14A 3PJFA 4F56A 2PZFA 5BQPA 3HRHA 4L74A 4M0PA 2FHSA 4CQMB 1XMVA 1H5UA 3OIYA 4L28A 4Z9FA 5J63A 1FP6A 4GH5A 1P5ZB 1FSSA 1G5QA 2W8BA 3QE3A 2FEOA 4MP6A 4WDQA 3N7AA 1N8SA 1DNPA 4PRZA 4F97A 1K7YA 2YS6A 1UEIA 3PR1A 3R6LA 1I3CA 4LXTA 3GRUA 1YKSA 1C81A 2ZUTA 3U09A 3DTNA 1KC3A 1ODKA 3BWCA 4KE6A 4MV0A 3FF1A 2Q6LA 4QC2A 3OCJA 1WU7A 1DB3A 1X13A 1WXXA 5HOQA 5HFNA 4DV4B 4EG6A 2Z8YA 2W71A 1R6BX 1TB4A 1UPBA 4B2PA 4OGGA 4RC9A 3P4XA 4JP3A 3ZCPA 1QO0D 2BGGA 3H4VA 4RNDB 2YUTA 4J0DA 1PSWA 3UB2A 1LRJA 2WMYA 2ZIFA 3LW7A 1WSAA 4B0OA 4PQGA 4YAEA 4YJ2F 4WK4B 3NJ4A 4XIIA 1Z2OX 2IPMA 2BMFA 1JLKA 2FE4A 5JD5A 4XYEA 4QOHA 4AAYA 5BQXA 3G9XA 3AR9A 4UZSA 4NCBA 1KJYA 4JU9A 2EX1A 4YXWD 1DADA 2J30A 2HV8A 3H6GA 1AZSC 3LX4A 5BW6B 2GA9A 4BLSA 1RNLA 1EWKA 4WZBB 2GHTA 4AP6A 3PNQA 1Z8NA 3OURA 4K86A 4O4JB 4OXIA 1RQPA 3HCEA 3T3DA 4EECA 4EHAA 3KUCA 2J3EA 2TMDA 3CJQA 3MWGA 5DRTA 3SG0A 1GQQA 4UAVA 2PX0A 4AN1A 1WL8A 3JQ9A 4BNNA 4C0JA 2F43A 2AXPA 2AXNA 3HUUA 4X63A 3K4HA 3RS4A 2G4LA 1IU9A 1PZEA 1IDOA 1MW8X 4ZHQB 3W5CA 2XTNA 4NATA 2GPTA 2JLSA 2R6GA 3DOIA 4GGMX 1BXRB 3DXFA 5JMWA 3MTAA 2GETA 2PSDA 3B12A 3FRHA 4CKCA 1DC4A 2CXNA 2OLKA 3R3ZA 3IBTA 5TXGA 4CL0A 1USWA 2H00A 3LQ1A 4RIGA 1C4XA 2UUPA 4A6EA 4D80A 4K1XA 1JLHA 3ME5A 1ZN9A 3AY0A 1F3OA 1QF7A 4LK3A 2WNSA 2J9FB 4L72A 3FNGA 1MRNA 2HDWA 5F2EA 5FLYA 4D41A 3EVEA 3FSEA 7ADHA 2GH1A 1JR2A 2QTRA 3RCBA 2NT4A 4JGIA 2QL5A 4CG2A 4HZGA 4MS1A 4R2WA 4JN6B 3DT8A 4XYBA 5TQVA 4J1TA 3T7TA 4D4IA 1GLNA 1AXEA 3QZUA 3HLKA 3F74A 3GCZA 3IGFA 4HXFB 4RNCA 3VR0A 1GFSA 3T5DA 4YRZA 1JIJA 2CFSA 4BKMA 2EKLA 2VDVE 5E4TA 2RG7A 3AUTA 4BVLA 4LHYA 1CEEA 3FI9A 3TVYA 4ZOLF 4IWYA 3NAGA 4TXJA 1LDGA 3IAUA 1IXZA 4UNNA 4MW1A 4PIVA 4HDAA 1CIJA 3GGSA 4Q4DA 1XZJA 2FUNB 2Y66A 4QDOA 4YCAA 4CRWB 3D8RA 3GNLA 5LSAA 3N2EA 4E5NA 3ZOKA 4YMTA 1YQUA 1J24A 1U28C 4MKHA 4MGEA 1TU3A 3BQMB 4YECA 3VC7A 1SC1A 3ELWA 2HBZA 3TTTA 2GO1A 5F9MA 2AX4A 3KJIA 3O26A 3W0LB 3R4CA 2JIQA 4RX1A 2CVPA 1KKMA 4G09A 4QJIA 1TPYA 1J97A 3HGQA 4PU0A 3WJ2A 5F2NA 2Q5HA 3G23A 3O8OA 1Y9DA 1ISIA 1ZH0A 2H0AA 3AM5A 3PYLA 1U90A 4I5FA 2OGWA 4YV7A 4UEKA 3PVZA 3HWRA 4WDRA 5CT5A 4ES6A 3PC2A 4LIPD 1RBQA 2OQRA 2AR9A 3P20A 4JROA 1KYXA 5G0SA 1JQBA 5J1TB 2JLYA 1CR1A 1SOAA 4YRDA 1NUQA 1W4CA 3HU1A 2R4TA 5B6PA 1G19A 3M6IA 1K6EA 3IEUA 3IQWA 4JQOA 1CXZA 4Y9UA 5IX8A 4BBPA 1R8YA 4J3FA 1LV7A 5LYYA 3NBKA 5M5BA 1Y48E 4GT1A 1BMFD 2OBBA 5BVGB 4P6VF 3I6MA 1W4RA 3GA5A 3P45A 3ROPA 1WXEA 2NW6A 4RH0A 1ODCA 4ZAVA 3T61A 4UBMA 4B7XA 2COKA 3UVEA 1JR3A 1KBQA 2BE9A 1Y1TA 4G4JA 4YMVA 2R00C 1WKCA 5FTNA 2CLOB 5HPYB 1C1XB 1F5NA 1UPFA 1TF7A 2XAAA 4B4OA 1DL5A 4HMPA 2JJ8A 4A6PA 4MHTA 2QUHA 1XB2A 3P19A 2I03A 2QW1A 2PBRA 2VKTA 1N32B 4MUIA 2JFBA 1UBHS 4Q4AB 1CZRA 4TTAA 3CKMA 2CY0A 3K7EA 4ML3A 5DCWA 2VCHA 4IIUA 1UP6A 1IPHA 2PLWA 5EGNA 3ZX4A 1JJAA 1G5TA 2ORVA 4GSLA 4MQFA 2VBGA 2F1RA 1PNRA 1XK6A 5EE9A 1ZD1A 4HNQA 1T9ZA 4ZKEA 3RVNA 5CDYA 1F2VA 4ND4A 4P83A 4YDRA 5KTYA 3ZWOA 1ECBA 3RTDA 1IZ0A 2J5RA 4MOWA 3V1KA 1OD6A 2X19A 4OQYA 1ISJA 1ESEA 1AZWA 1SBYA 5F78A 5KU7A 4A36A 2GVNA 2Z4RA 3AFGA 2ZYHA 2BC9A 3A27A 3K53A 3I8XA 1XCOA 3FCOA 4IIEA 2PUEA 1KY4A 1VMIA 1ZSVA 4CMGA 3CX3A 5EXEA 1C8VB 3RBVA 3HCNA 2R11A 1LZLA 1JL3A 3NHBA 3SYLA 3T35A 2CCKA 1JHYA 3BSSA 3HY3A 1UT6A 2W2KB 4M8SA 1FTWA 2OK8A 3T34A 2DEUA 4BAUA 1DO0A 1TPZA 1Z5NA 2RKOA 1M6NA 2Y1LA 2Q1SA 3DOEA 1HDIA 4IV8A 3ZY2A 4BATA 2HHCA 1X80B 5AHOA 2FQWA 3VR5H 3DDZX 121PA 3K0CA 4UHFA 4H7IA 1B41A 1MQ8B 1P19A 2BGRA 2DH6A 3DO5A 4XB1A 3VPAA 2HNAA 3C6ZA 1L7NA 3IHTA 3GX1A 3LO8A 2GK4A 4H35A 2D2XA 4HF7A 2QSYA 1T2AA 4AG5A 4TQ9A 2PA3A 2O2XA 3FCCA 3VO2A 5DWVA 2QD2A 1TA0A 3DO8A 4ZVRA 2JLAA 2ZDHA 3P9QA 3O82A 4TLAA 3E9MA 2IYEA 4Y2SA 2HFJA 1GXSB 4H7DA 3RVSA 4M76B 4D56A 1NVAA 3PIRA 5JCJA 1U3CA 2GSDA 3A2NA 5A7FA 5TQ2A 1H66A 2QAGC 3GJ4A 3WFJA 4OSEA 1M0SA 1L8QA 4TLLB 4UNPA 4UTOA 3P5BA 4B45A 5JBNA 2O07A 4L1KA 1QH1B 1J8VA 1T25A 1SU8A 2ZR0A 4PTYA 2AOTB 1XA0A 3DDOA 4YCJA 1ICEA 2H8KA 4A5SA 3I5UA 1TECE 1Z5UA 2FAXA 3D7MA 4V1CA 3OUUA 1CRLA 3ND7A 4NECA 4A8HA 1RZRA 3Q72A 1BQEA 4WNAB 3GLIE 2OUKA 4ZPJA 4LC1A 2DP4E 4Q19A 2XMDA 1NNEA 3H83A 4EYEA 3ZIAA 1RYYA 2A0XA 3E0QA 4BYGA 2DE0X 4Y6PA 4J6EA 5IDVA 2ZJ2A 1X6VA 1IB0A 1S1CA 3K0AB 2FPGA 5JSQA 1UWCA 1A9SA 2EBHX 3LDAA 4QEZA 3U3RA 4RSRA 3ZHUA 3DO6A 3OKAA 1YQGA 1HDXA 2J3MA 2RK6A 3D6VA 4LYFA 3DEIA 5ES4B 2I2BA 3I73A 2WHEA 4K81B 2JI6A 1HURA 3KYIB 4FEYA 4R6XA 1XRQA 3WP1B 1FTSA 2WIFA 2IF2A 3Q1KA 1KH1A 1JZSA 5DU2A 1SOWA 1U3VA 4LISA 1JWLA 2CJPA 4KKXB 4Y2QA 1PDOA 3CGGA 4IBOA 1Z8HA 2OKGA 1D1PA 4HDKA 3Q5DA 2CFCA 3PYMA 3R24A 4UTNA 4XGRA 4XGQA 3U0BA 3E3LA 5DHRA 4DLXA 5J9FA 1WX1A 2V3WA 2H59A 4XA8A 1BGXT 1R0CA 3GJ3A 3CNHA 1HNNA 5EXXA 4NU8X 1Q0SA 4QUGA 3FZQA 3KPVA 3MGKA 3NHPA 1L4FA 4AJHA 4AMVA 1K89A 4EZBA 2X4DA 3KXPA 1J22A 3A06A 3ICEA 4F7DA 1R4MB 2ZZMA 5HF9A 1XTKA 4K26A 3VR6A 3LTNC 1KFKB 1LNSA 4CV0A 5KOJA 5JE8A 3KPWA 4FGKA 4F92B 1DEKA 1ACJA 4OP3A 1CP3A 1WB5A 2J5KA 4F84A 1B26A 1P5RA 2D0PB 2R96A 3GGDA 3UV6A 3UHFA 1TTHA 3TNFA 1H2XA 3ZWPA 2BVNA 1W34A 3X1JA 5JXGA 4RLHA 5ECDA 5AFSA 1E2IA 5EIBC 3EE6A 1X7ZA 1VPLA 2QMYA 1PS9A 2V0NA 3GF4A 4KNWA 5CT9A 4Q7LA 1CS0A 5LZ5A 1RP7A 1HRKA 4A73A 3BFKA 3NASA 3X2FA 3LBAA 3SX2A 4F6LA 1NW9B 3LT4A 1T9DA 2YJTD 3G85A 3S2IA 4C5CA 2HHHB 2DX7A 3PUWA 1NONA 1HGXA 4TKUB 3DQPA 4U2DA 3HCWA 5KDDA 2ZRNA 3TX6A 2AN3A 4UM9B 4OSOA 4TTSA 4HGOA 2EWWA 3BICA 4YAIA 1YE3A 2LCIA 2OBXA 1SXJC 5I5GA 2V03A 2CVFA 2VDWA 3C3MA 3C14C 3IDQA 3TQFA 1XPUA 3LBHA 3PEUA 5HM8A 2QRKA 5MF6A 1NFFA 4YYEA 1JU9A 1T1GA 3BMNA 5KCZA 1FS6A 1TJPB 2HPAA 5ALOA 1U98A 1TVMA 2O6HA 1W36B 2UZ4A 1DFGA 5AMXA 1KPGA 4LEIA 4AN0A 4HXGA 2DQZA 2X9NA 1JVSA 1X0VA 2QVXX 2AJCA 2WM8A 2HCRA 2XQFA 4R1LA 3B51X 5DRYA 2GUWA 3Q7EA 5T5QA 3AZQA 2DQYA 3OQNA 2QLFA 3F73A 4Q02A 4JYZA 4G8JA 4GBGA 2FMIA 1VIVA 2NO6A 1F9EA 4MW4A 1TMOA 3PDWA 1ZMOA 1PV4A 4D3XA 4LHXA 3FKQA 2GWRA 1DRJA 4YUAA 4HNRA 4UOZA 2QRNA 3PG5A 1O7JA 5CDHA 1LPSA 2EWMA 2IZ7A 2VXBA 4KWEA 3GAZA 5JNWA 1IZ9A 3E53A 4ZZIA 1K0FA 1RXYA 1DJOA 3GEBA 2J3KA 3EXHB 5CK4A 4E2WA 2NP7A 2EBWA 1DQSA 2PL9A 3STXA 3A6EA 3AX6A 1AGPA 3TQSA 1JXOA 4CFYA 2F90A 5CVUA 2IYYA 2DYKA 1XCGB 3TB6A 4KBGA 1GNVA 2NZJA 5CB8A 2H9IA 4TSFD 1DC3A 4MVJM 5EHQA 3Q0IA 4A0HA 1SBZA 3WA7A 2CSUA 4BJHB 1Z2AA 5JC8A 3U60B 4H6VA 4INOA 1M1UA 2AZTA 2I3GA 2MYPA 3ZLUA 2VTBB 3F3MA 2NACA 4IZIA 1U9JA 4P53A 3TPFA 3OIGA 3IUNA 4JHXA 4DLKA 1IY8A 5TARA 1PQYA 2O8CA 2YQ5A 4RPIA 1M1YE 4BNXA 1U9ZA 2G80A 3B3JA 3PQ3A 5CM9C 3B1FA 1KJJA 5KTSA 3H1GA 4RDCA 3IHLA 2XVYA 4RD2A 2BTQB 4MKRA 1D7AA 1H22A 2VA9A 2DBQA 3HJUA 3LQ2A 3K30A 3BZUA 3IDAA 1P1JA 2CLDX 4AKSA 4M8LA 2AKEA 1P4HA 2YIMA 4UC0A 1T2VA 3K1AA 4P5DA 2V7PA 3JALA 3NALA 2AG8A 4JYPA 4PWZA 1ZH8A 3T0IA 2WG2A 1UF9A 3PT5A 3VR5D 4DNPA 5TY0A 1S2NA 3HCAA 1R6VA 1LWOA 3PQ7A 1WCIB 2XE6A 4YCSA 3BN3A 1EP3B 5CIWA 2QL9A 2NU6A 4TLDA 4XQ9A 4KWHA 1NVBA 3L0IB 2CVHA 4HPXB 1HUQA 2D4AA 1O1YA 2GBCA 1N2ZA 3OCXA 1RQXA 5JS8A 2V7BA 4HHEA 1I10A 2VZLA 3DAFA 4L9SA 5P8WA 2GB4A 3W9YA 5GM1A 5AVSA 4BO0A 1Y6FA 3VNQA 1F48A 1U2DA 4LZAA 3OE7A 5G0TA 4DSAA 2Q6KA 1G6OA 1UXJA 4BEJA 4XJXA 3W77A 4DJ5X 5IKMA 4GEKA 2DXIA 3CX7A 4EKNB 3AKYA 3HG7A 3IIMA 2C07A 4I4IA 1GADO 1L4UA 4LN1A 3QJGA 2O23A 4JL6A 4ZVSA 3FUWA 3L02A 4AB1A 1W73A 4LQDA 1TM3E 5JS1A 1IRXA 2X3YA 1V1JA 4ZDIA 4I4TA 2BH2A 2WYOA 1U7OA 1VLLA 4S35A 2UZ1A 4KLNA 1XMQB 1N57A 2F62A 2OD2A 1YS7A 2FSUA 1RP1A 1E1NA 4FEEA 4G5FA 2QLLA 1JA1A 4MUJA 5EESA 2MSCB 3NUQA 1IBKB 4B4DA 2VT2A 2PT9A 4CM5A 1EFRA 3AF1A 4XPIB 2R1UA 5LQMA 3LYLA 2DKNA 2H08A 3AOGA 3M2TA 4QQFA 2R87A 2G4CA 3CRNA 3UK2A 1YFJA 5E2IA 4DDVA 2PX4A 1WXQA 1GV0A 3TBFA 4V0OA 1YQQA 2PUHA 1VE1A 3OZ7A 2PL1A 3KSZO 2PSSA 1AQLA 2RCNA 3EFBA 4BFSA 1JG4A 3GT3A 1E5TA 2OXTA 3S7TA 2BEVA 4EPVA 4ZZ3A 4J0CA 1VXOA 3IILA 4Z9YA 2A9VA 3RIEA 4WKCA 3T15A 4V38A 4XJTA 5DZSA 3OF5A 1L5MA 5D01A 1LK5A 2MINB 5MN5A 3BG5A 2DMRA 5K6AA 3TAHA 1BDIA 1ZS9A 4JASB 3VX3A 3ADDA 3QXXA 4G63A 3EYAA 5CRIA 3PA8A 4IHJA 4P4LA 4ZCLA 2HZ7A 3I6YA 2QUKA 3MTBA 2A88A 4HZUB 1N2BA 4DA8A 3U4QA 3GFFA 3A6ZA 4ZRNA 4PTLA 4H1UA 4UEOA 3DE3X 4I55F 3ID6C 4LOAA 4MRVA 3QW4B 2LR0A 2DETA 2YZMA 2ZSKA 4TS3A 4ZJPA 4BP8A 2JFPA 4NMMA 3VC1A 1NJ6A 4J0IA 3WIEA 5E7JA 4ASUA 4WNYA 3EHEA 3N39C 2OBLA 5EQTA 4KSYA 1IVSA 3C6XA 1Y9AA 1MV5A 1T3SA 2H6EA 4CT5A 3CLSC 2FOXA 2FPXA 1T2EA 4BFTA 2OQ2A 1KJWA 3MJHA 4LXXA 3AUXA 3QFRA 1OLUB 5L3QB 2GF9A 2JIOA 5FUYA 1KMNA 4J7CA 3AXSA 5KI6A 3E84A 3FVRA 3HKBA 1A5AB 3STWA 2Q2NA 4NK4A 4M1YA 3ZLJA 1SHUX 1IWPB 5H0IA 1DQZA 1S0UA 2IT1A 2W9XA 3HUEA 1X8LA 3N6XA 4QUKA 2MR5A 4RK4A 5JRJA 2AN9A 3GGPA 3I01A 3VR3A 3ZEAA 3QXCA 5IW8A 2ORYA 4C3UA 2O2YA 5U1PA 3A1FA 4X90A 3OIVA 3Q9UA 1G8YA 2EV9A 2DRIA 3OQBA 5K6TA 1FDSA 4E0BA 1KI6A 1Z35A 2ANCA 2QX4A 4HAWA 4ZQGA 2X2FA 1A5BB 1E32A 1N0UA 2ESRA 1ZEMA 2WE8A 3LPNA 4FIDA 4I9HA 4FMDB 1IZ7A 1A95A 3A6KA 4Q34A 4QOJA 3E03A 5IH3A 3NTQA 4HAOA 3RC9A 3ZWWA 5HRCA 1RIFA 4EFKA 4F12A 2EFEB 2VH1A 3GB9A 5HNKA 5FBQB 3L2OB 1QTQA 1T2UA 3K0CC 3MERA 3L04A 3CG4A 4HJRA 4I7EA 3TO5A 2P4SA 1BAPA 1L5OA 1PX2A 4AUKA 2R2AA 4JT8A 1YVDA 2Z8ZA 4P5EA 3CPHA 3K70C 4ER3A 3LLVA 4AO6A 5DLDA 1RKXA 5AW7A 4JBWA 4QPDA 3WYAA 5JSKA 4MQ5A 4JB0A 3UGTA 2OQIA 3MBIA 5J2UA 3HABA 1JEEA 1DAKA 3BK1A 1F14A 2QRUA 3WLSA 1H05A 1GPUA 1UMCA 2ODEA 3A4TA 2XAUA 2J08A 2ZJ5A 3DAOA 1WY5A 4JCOA 4DLZA 4DTIA 1WBBA 1EK6A 3HKDB 2ZG6A 3NGLA 5DTJA 3ROQA 5KQLA 2IPOA 4YUWA 1NZFA 2EL7A 2P6UA 2D5LA 5BN4B 1O4VA 2X6TA 2DTDA 1H2BA 2A94A 3DVQX 1AD2A 1N6LA 3MG9A 2FK7A 2DTEA 2VNAA 4BWGA 4EZEA 5FL7D 5JNRA 4Z99A 3UMJA 5A0VA 1MIOB 3H5LA 3B1KA 3N76A 4H16A 4YHBA 3MCUA 2AD5A 3AFHA 1JF8A 1QHHB 1SO8A 2CLSA 2HJ9A 3GVIA 5ALQA 2FFQA 3RWMB 2F1HA 4JBLA 2UVPB 4D99A 2GJ8A 3VU8A 3R09A 3ZPXA 1T36B 1YHYA 5D3MA 1JYSA 3IT2A 5IBPA 3EISA 2RSLA 5KWVA 2RJ3A 4L5IA 4A0GA 3L8HA 2I65A 2ZJAA 4ON9A 4HTAA 4BVGA 3C1AA 3AIMA 1XYYA 2GZ1A 2OAQ1 2QT1A 3DMHA 1THMA 5DHQA 4AZWA 2R8RA 3AHJA 1J0BA 2QUBA 4H9GA 6REQB 5LYJB 1NMYA 2WD9A 2ZYGA 4O6VA 2ECFA 2ZCJA 2EJBA 2FPKA 4IV0A 4N8EA 3MFQA 3EXFA 4ODIA 2FSVC 1BA3A 1QPBA 3KQQA 4QGFA 4E5UA 4WZ6A 3VKGA 3SY8A 1HF3A 4TT3A 4YC7A 4I46A 4R8KA 2RHBA 5CEEA 1GGNA 2XXJA 4PC2A 1ZI6A 4B5LA 2Q4EA 3HGMA 2PV7A 5CDUA 4FR0A 4QDTA 4DEXA 1WZEA 4IMIB 3Q5EA 3QYFA 4Q48A 1OWMA 2GJ9A 2YHIB 2DY0A 3C98A 4PZDA 4WLNA 1OLXB 2GBPA 3VHLB 3LWDA 1Z4PX 4R16A 5G1NA 2V7QD 5A6SB 2DSNA 5I8WA 3FXAA 3QE4A 1C3XA 3X1ZA 3V8MA 3O9MA 2XSZA 4H15A 1OV6A 3EXIB 3HSSA 4XTRA 1U8XX 4RTLA 3PX7A 1T3ZA 1GRVA 2QX6A 3OAAD 4PAGA 1MZPA 3I2FA 1IM2A 1E7SA 3GDHA 4HEHA 3ZWMA 2HWWA 1UFKA 2O4UX 4W9NA 1L9KA 1OCEA 4PAOA 2R8EA 3EVNA 1KJ9A 2QVBA 3RVRA 4B0PA 3HJFA 3BS4A 4NBSA 4RMJA 3RHZA 3WNBA 5KJCA 3KZKA 3VVBA 1PZNA 4DMUB 3A37A 4M38A 5D6NA 1G2QA 1KQPA 3QX3A 1A5ZA 3OKCA 5K8LA 5TJHA 2PGAA 3O92A 4FYXA 4NZPA 1B8UA 4ARSA 4L08A 3I04M 1DWPA 3DL4A 4M99A 1RMQA 2OHOA 1XOIA 2ZVJA 4JKIA 3QVXA 1R5JA 1KOJA 2GERA 4OHMA 5CLGA 5BYBA 4TTTS 4DCOA 2ODQA 1FUKA 1V2HE 4H3HB 4RPJA 1EHCA 4X91A 4FDVA 2EG9A 4QOFA 4QVKA 5CG2A 4ZT6A 1IHUA 5KTKA 5AM0A 4WBNA 5JZMA 4Z6KA 5KYTA 1EUZA 1IH8A 1MX3A 3OPXA 1OVMA 3VZQA 5INTA 1NI3A 1VIDA 1WV1A 4HQ6A 1Z6XA 3QRWA 4K9NA 4BPRA 4OI2A 3FPKA 5A9TA 1TEHA 2C4MA 4JC5A 4ZZ1A 3NUGA 4TUYF 5AVYA 4N7BA 2FJPA 1JFLA 1OFIA 1ZKMA 2DPXA 4MARA 2YJNA 4BYMA 2GN9A 1DWOA 2E7ZA 5AKIA 4BNIA 4CKWB 2AZ4A 1LTKA 4IIJA 3ZCUA 3KSMA 4WOBA 3RBXA 3CX8A 3ZVMA 1L7VC 1UOEA 1NZJA 2JLRA 4BZWA 4QTYA 4ZGBA 1GDTA 3AR7A 3OZXA 3DTVA 3ZCVA 1VLVA 2VPXA 4IXMA 3VHXB 5IAOA 2RCYA 1M2OB 2B82A 2JARA 2CT8A 4DILA 1KOLA 4RPKA 3JATB 1L9XA 1CB7A 1T15A 1PWXA 3L0PA 3TZ6A 3Q8MA 1GTG1 2G04A 2HLPA 1O54A 5ALRA 2P91A 1N6PA 3QVKA 3VX4A 5BUCA 4YMUA 4ZT4A 2EX4A 3AV3A 2O50A 1L3BA 2CFRA 3PFNA 1QQTA 3K16A 1EBBA 3KL4A 1Q92A 1RRVA 1W8IA 1MH9A 4RD0A 1BXKA 4NNPA 2Q41A 3SZGA 2OYSA 1L3IA 1VL2A 3L1KA 3O1IC 1EDEA 4W1RA 4BTLA 4NE9A 1CW2B 4CN8A 2XCRB 1HM5A 2Q7DA 1QV9A 3EQ2A 5BR4A 3OFKA 4B4VA 3OZVA 2WF5A 1E2PA 3IPAA 5E4YA 1M8GA 3DL0A 3PPIA 1KDPA 3HHEA 3W06A 2VF5X 2GFQA 4Z8XA 5ENDA 5BO5A 1IVYA 4UNIA 2VP0A 3RT7A 4W5NA 2P7IA 1CYEA 1SCBA 4L8VA 5IJ0B 4U2BA 5TT0A 3V8RA 1X7XA 4KJXA 2WQ6A 4AJKA 2HU2A 3F1LA 4K6GA 1P45A 2YJGA 3HBAA 1E3EA 4E5VA 1A4IA 3CRMA 1YIOA 6AT1A 4Q3EA 1YD7A 5LDGA 3P2EA 1EFKA 1P2BA 2ECPA 3JARB 4HEA6 3UPTA 4BLPA 2W6QA 1HKHA 3MPOA 4KRXA 5G4KA 3QW2A 1H8EA 3WYCA 4QYTA 3NDRA 1GQSA 1OAAA 4HRXA 5EQFA 1U8UA 2CWDA 4LXHA 4A6DA 5JQGF 1Y4DE 1J90A 2YN2A 2YZGA 4G86A 1VQ1A 4HNGA 4WN3A 2BGWA 5BVHA 5ITWA 4CJXA 4RDXA 1GZSA 5T7BA 2PRSA 4C4SA 2IYSA 4RQBA 1BFUA 4JVNA 2C83A 1FMLA 221PA 1MAVA 4L7QA 2AZMA 1BHJA 4FUTA 3RG2A 1Q7TA 5BUZA 8ADHA 4DB4A 1KRWA 3BTSA 1TAHA 1R0KA 4M1EA 3DOUA 3GT0A 4EJSA 5LU8A 1A71A 3EMBA 3U26A 2ZSAA 1U2DC 2AN4A 3FB1A 4HOYA 1JT9A 1V16B 2HF7A 1E3DA 2V7XA 4RZIA 3EOAI 4Q7JB 1NXPA 3EEQA 5A2QA 4ZQHA 2FEKA 5DHFA 1FFHA 1JJIA 2EIXA 3GRRA 4QDUA 1L1RA 3R5JA 1YFZA 2XUZA 5C81A 3U17A 2Z1DA 4A3SA 2ZRGA 4A8JB 1XMIA 1E79D 1WLSA 3O8QA 1NG1A 4HGZA 1RWPA 1DUIA 4C0QC 3GT4A 3OTOB 1Q6ZA 4E4RA 3TR0A 3FNEA 1EIZA 2R8ZA 1SD1A 2A67A 4JLUA 4Z0PA 3UKJA 2FQQA 3QQPA 4WA7A 2CJXA 3E9YA 4LWQA 5IDYA 1S2MA 4ZVTA 2BWJA 2PPLA 4DMMA 2CXXA 3BOSA 4LJLA 2I6XA 2VRNA 3RSGA 2HMYB 4ZCMA 4DRXA 5AKZA 5CH8A 1HNXB 1SA0A 1HC7A 3TCXB 3DC2A 1SVIA 4K87A 3R7FA 4CKBA 4D8UA 3AFMA 4MDEA 3EFOB 4ALLA 3V1UA 3KAJA 1Q7EA 4E6PA 2Z2KA 4BLTA 1UOOA 1ZOOA 1F8YA 4HX9A 2NVUA 3U7EB 2E89A 4ARVA 5SYAA 2JHFA 3T94A 1TQ8A 1HMPA 5EZQA 4RXUA 1TCAA 3HU2A 2ZYSA 3Q2OA 1JHZA 4IF4A 3UJAA 3VA7A 1IMJA 2AOXA 2P9EA 3RU2A 5IMSA 1Z7YA 1J07A 1FLVA 1BTOA 1R3UA 4MQ4A 3HFGA 2J1LA 1TOAA 4X3CA 4C30A 1SZCA 3OLCX 1IWBB 3ZU5A 4IQ4A 3TW4A 2HI0A 1J2TA 1H0KA 3NBZC 4MUXA 1JH9A 2ODAA 4PVCA 1RXWA 4FDMA 3THWA 4PNEA 1P33A 3QVMA 2FOIA 2WYUA 4QU5A 3U3XA 1V47A 3RRBA 2P41A 1AB5A 3O74A 5DM1A 4C4TA 3FZNA 4K28A 1QVWA 3CLTC 3X1XA 4F2GA 2EFHB 1Y1QA 5EZYF 1W96A 3ZD6A 3ZGZA 3G1UA 1IXYA 1AOXA 1XDDA 1SUEA 3L1VA 1NOIA 1W5FA 2PY6A 1IBRA 2W2LA 1GZDA 2ZUVA 3JAKB 4R6WA 5KDLA 4OA8A 5F1PA 1L4MA 1VG0B 2JAHA 4IIYA 1NVDA 3HA7A 1B43A 1F0KA 2GDZA 3LGSA 4BQFA 1EFLA 5LP1A 3VH4A 3OCZA 2IA5A 2IW1A 5KHLB 4ATNA 1VI2A 2ZIEA 3KQNA 3G1TA 2Z6UA 1QP8A 1TUGA 3H4IA 4M7PA 3B1JA 3U3KA 1ZO8A 4DIFA 1ZY2A 3N0XA 1HX7A 1JQDA 8AT1A 5KOHA 2Y1OA 4DQXA 1GKYA 2QI9F 3H8WA 2IZ5A 4EL5A 1W7AA 3LA8A 5COAA 1TU0A 1L4NA 1WXIA 5E0KB 3F8WA 3TAUA 3IA7A 3HV0A 4IIXA 2FX5A 3OQJA 4CN9A 4EAQA 2CXTA 3WWCA 4EF4A 2GM9A 5CLIA 1XNRB 3AEKB 5EPEA 5K4HA 4Q1VA 1Y3DE 4M0KA 5GTDA 2KBEA 2BI7A 2R8YA 4F6CA 4XXHA 3MW8A 2EZ8A 2B21A 1SELA 1PCXA 5F51A 2E9SA 1RFGE 4HFRA 1Q44A 1WSBA 3R6WA 2C1XA 3I09A 1OYYA 1SU7A 1OX4A 1US8B 2DPHA 1YONA 1TA4A 3GFPA 3H9GA 1VBNA 3K5WA 1JHUA 3WMGA 2P6OA 4A1FA 3QEMA 3DULA 2I91A 1IRIA 3H5RA 3EGVA 3NC4A 1SBQA 1T1SA 1AN0A 3OC0A 4WBXC 4BUZA 2PXHA 4OX9Y 2Q27A 2XXBA 1Z74A 1WABA 2H63A 1A8HA 3N05A 1G2PA 3ZK8A 4G4GA 2RARA 4IIGA 1J9GA 3HKEA 3OT4A 3WHIA 4IICA 1AS2A 2PMBA 2AQHA 2Z08A 3KKOA 1ANKA 4NAVA 4U3JB 3VYSB 4E2ZA 1HFWA 3O4FA 1E3LA 2JCBA 4JUDX 4XSVA 2Z8XA 3CMMA 1AQNA 2QTFA 3DBRA 3K0SA 2Y1WA 5JY6A 3HJAA 1PQUA 1QFYA 5C34B 4B74A 2I3ZA 2ID8A 4M1OA 1D2MA 1FQKA 1L4LA 1GQOA 2CB0A 3N2GB 3ORRA 3KOUA 2QN2A 4M7WA 4OEHA 5FOWA 5B57C 3TW8B 1KQ3A 1NW6A 2AMJA 4B44A 3QENA 1ESDA 4TMYA 1K4KA 4EL0A 3W1EA 2NWQA 5DBGA 1FX0A 1COWD 2IZ0A 1Y33E 1SVKA 3HBLA 1TYZA 4XJVA 5TGTA 1KR2A 1NBWB 1VRCA 2PMCA 3RFXA 4IJUA 4DQLA 4J4TA 4JLPA 3GLIA 1CQXA 1XVLA 1ZJWA 1WKVA 2H2DA 3TTVA 1I6MA 1HSOA 1CVLA 3EPKA 1E3WA 3BIXA 4QUHA 4QYIB 4R3WA 4XQEA 4X8OA 4NTZA 3EULA 5AHXA 2GLTA 4ZJYA 1N25A 3EEBA 5PGMA 2AD1A 1NBMD 1B8PA 4G1BA 1SXJD 2PGXA 3DB2A 3RTAA 2HH9A 1BMDA 3FCYA 3K1JA 3GGJA 2ZWPA 3AUAA 1SULA 1G98A 3ED5A 3V4OA 2IU4A 1BHO1 1CJMA 2HF2A 3O83A 4NYMR 4CMEA 1PVVA 2NU8B 1Z29A 1H65A 3I76A 2AOVA 5EMJA 1U1DA 3OQPA 1ZESA 4CR6A 1ONOA 2RHHA 4XR9A 3AEQA 3V6MA 5CBPB 4BLUA 1LBQA 2FSSA 3ZGLA 4CFZA 4I5DA 4LRSB 5DP2A 3NIFB 2EEZA 3ZDYB 4YPOA 3FNQA 5ICSA 3E3OA 2IYRA 4O33A 5CFZA 4JI2B 2IBSA 4B17A 2WDZA 1U9CA 1RJDA 2VRBA 4OAQA 5DULA 3W2FA 4PO3X 2GESA 1CPYA 2XNDA 2HYIC 3FDJA 3NNSA 1CG6A 1R0RE 1V26A 2G9VA 3PENA 1QCYA 1NMXA 2JNWA 3HXLA 3JQPA 4EABA 2FZGA 1QQAA 2BTEA 5H3CA 5EIFA 1NUSA 2GK6A 3HBMA 2YXPX 4HVCA 1NR7A 5DEOA 1O58A 4GNKA 3FYTA 4EBBA 2G7ZA 4IVNA 1X7YA 3ZKWA 3GRCA 1QZ3A 3HYCA 4TQUS 1U0FA 5EPUA 1SN7A 4LYJA 4B6SA 5JCXA 2PUAA 3SI7A 2IHYA 3RJZA 3UK1A 4BMPB 3JCZA 5FPTA 3S1SA 3UC9A 1QO9A 1VMDA 3EIEA 1PYOA 4MGKR 1P5FA 2FZLA 2PS0A 1TK2A 3KQWA 2XI4A 3L49A 2FEAA 3MJ4A 4IHJF 4PE5B 3A2LA 5A05A 1EH5A 1HNZB 2Q1YA 1D4ZA 4KMMA 3EMVA 4M1SA 3FLEA 2CNDA 4RZ2A 2JBHA 2Y1KA 4WH0A 4G5YA 1GRNA 3USES 2GGSA 4W9NC 4C0SA 5K0FA 1ZBDA 4II7A 3G88A 2BFFA 1SVOA 1KEVA 3D2AA 3EHDA 2QLJA 4KX5A 3GBSA 5DKFA 4TN5A 3RUDA 2WU1A 1L5KA 3JV7A 4JI3B 3O8RA 1GL9B 2BHRA 3A1TA 2JH3A 4KQWA 1PD1A 1J42A 5SICE 3V8BA 1V95A 3LKVA 3RD5A 5BMVA 3Q0TA 4OQQA 4XH9B 2M6LA 4HX2A 3RAJA 1W581 1D8AA 3VPGA 3E4DA 1ZQ1A 3OECA 5LBTA 2ZJ4A 5ALFA 4C6TA 3DLBA 1Q15A 2FPOA 1KVTA 1P4SA 1WIWA 4O2AB 4JYBA 1NJSA 2BFOA 1H23A 2CXHA 5GVSA 4MWGA 3KQHA 3OU6A 4BGDA 5I9BA 3R7DA 3B20A 1ADBA 2YVAA 4MRRA 3ZZ0A 3IJRA 3ZH9B 4FOSA 3PHLA 1M0EA 2ZJOA 3H3FA 5JISA 2VNKA 4H1TA 4PYLA 3NBXX 3LG2A 5FPHA 5IK2A 4LQ4A 5CPFA 5KHAA 4H0FA 3FGOA 3AONB 1QGAA 1D04A 3V2GA 4M4SA 1G4AE 3W1VA 3F3KA 4DCJA 1K6XA 3LUJA 3OVMA 2ZJ7A 3KLPX 3NTRA 1J56A 4IEEA 1J9EA 3H16A 1Y8RA 4ZRMA 2PX2A 5BUSA 1QRSA 3ZW8A 2P75A 4M9RA 1P77A 4X84A 2WVGA 3VDXA 4AG6A 1ZCJA 4ZDKA 1SCIA 3AERB 5HQTA 3K32A 5FR2A 2ZYDA 1ZH6A 3Q3JB 2FSFA 4K6KA 1D6JA 1GT91 1UFOA 1ICIA 2WVHA 3G49A 4YMWA 5K3EA 1XZFA 2WR8A 1AHHA 3OOWA 5LFAA 1RFLA 1AV7A 1USGA 1IBSA 2AV6A 2OZLB 3C1OA 4IL5A 1USIA 1R37A 5AICA 3KKKA 1EBUA 1L8XA 2QRLA 3GLHE 4RWZA 2QN6A 4B73A 2FLVA 3UJ3X 2L18A 2WVJA 3ZVKA 1BYIA 1XZDA 4Q47A 3V34A 1QGZA 4E09A 4WAUA 2PJDA 4IX1A 1F17A 3USCS 2C7PA 2OHVA 3WQSB 4Y9SA 2GKSA 2NUPB 4MDYA 2UYYA 1XZPA 1Z6ZA 2XGJA 5EA2A 3GDOA 1JXQA 2BKUA 2F59A 3F6SA 4WKGA 1W76A 1Z6YA 4RF3A 3OM0A 3UK7A 4YX9A 5JAPA 1Z0UA 4XUDA 4FVTA 4DHWA 3OOJA 4BO8A 2XVMA 4FFNA 1M1YA 3IODA 4ARAA 5KC8A 3PEVA 2Q49A 4NI5A 1JLLB 1XCMA 2Q99A 3HBFA 4AFNA 3PNKA 2YRFA 3B6IA 1P4RA 1F2TA 1IB6A 1T4CA 1JEQA 3KHSA 4FFRA 3UW3A 3KSDO 5DM0A 2CFTA 2P40A 3UCXA 3KZ1E 3LQQA 5HX7A 3Q12A 4ZAZA 4D6XA 1ZA2A 1LVUA 2Y8EA 1V5GA 5H82A 1H9AA 1KO4A 4OHPA 2W43A 4DN6A 2X2EA 3CYFA 4K1LA 4GEGA 2F3PA 4G3XA 2P6PA 2CYBA 1O77A 4JJ6A 1GO2A 4ZANA 4RZQA 5CLQA 2IV3A 2IS4A 4ZTZB 2FF7A 4X94A 1TCVA 4FDTA 3EMKA 1Z5ZA 2ZTMA 3NM6B 3S8MA 4Z49A 4ENQA 3FZEA 3R5HA 2B5OA 2RIPA 4YP1A 4AVYA 2X2PA 1U1GA 3ELUA 4GWKA 5TB5A 4L15A 3QVSA 4DC0A 3U56A 3OZIA 5IAKA 3LWBA 2G5GX 4X1KB 3SZLA 4BS9A 1MT3A 3UICA 1DKUA 2FYTA 4MIEA 4U6SA 1ZH2A 4QQ8A 4L85A 2I4RA 2DR2A 3ORHA 3O4JA 1P7YA 2FPPA 1H6DA 3CLSD 2JKYA 2ZTSA 4W1PA 1O6GA 1ZMTA 2JGEA 1WM1A 1ZG3A 5JAZA 4JX8A 4J7XA 4L16A 4K46A 1DBQA 3KJZA 4LDNA 5DTRA 1T3LA 2WP8J 1OHHD 2POCA 3L0DA 5G3ZA 2H1OA 5JROA 4DNXA 3Q0EA 2J9RA 4GQIA 4RJLA 2ZIWB 3N70A 4FYHA 1U0OC 1Y5MA 1T5OA 3LOUA 1Z63A 4HDSB 3PSAA 4N3AA 4MZXA 3ZD9A 4CQLA 4H3VA 4Y2GA 2AOUB 1Y81A 4F1JA 4KGDA 3TXYA 1B2LA 2D59A 1KMHA 3IH5A 1QK3A 4IDQA 1MU0A 4PIMA 2YBDA 3K1YA 3OTIA 4BO3A 1ILWA 2P11A 3OZSA 3SYRA 1VLMA 4D0RA 4IUBS 4KR6A 4Y0AA 1F3LA 5DYWA 5E8RA 2JA1A 2R7KA 3IS3A 3RVQA 5REQA 3WKCA 4LVCA 4J1QA 1ISSA 2B6NA 1DC6A 1E5QA 1SKBA 2OAP1 3GMSA 5BSEA 4FZVA 2JB9A 4IDBA 4RKRA 2ATIA 2P5SA 2AXQA 4P3KA 2VSOA 2F3SA 1K2WA 3S44A 1BG6A 1USKA 1MF7A 2ZR7A 3RO7A 3HCCA 2IY9A 2ABWA 4DA6A 4ZI7B 5B3AA 2ET6A 4WBNF 2W93A 3M3HA 1E1CB 4CYMA 4HB4A 3L06A 4JOSA 3A1VA 4WJZA 4M1MA 4FW8A 3ZWVA 2Z6VA 3K70D 5F4ZA 2DUNA 4GUDA 1UXOA 1QHEA 1QK4A 4IOMA 4R2HA 5CLLA 4DYHA 5K3DA 4YH1A 1BCSB 3AP1A 1IAQA 3KOXA 5JBIA 3LFUA 2HMUA 2JAWA 3JWJA 1MP0A 2B7BA 4IIJF 1OBVA 4YRTA 4C6RA 2BKLA 3N59A 2WM2A 4ZI7A 5JCJD 1I1OA 3E9NA 3KBOA 2X0NA 1N6IA 5A02A 3G2KA 2NOAA 1ZUWA 4BNUA 1F6BA 1R18A 1T1IA 1MZVA 1C8KA 2YNMA 2Z3ZA 3HO8A 5AP9A 3JQ8A 5FA5A 2WKWA 5B1HA 2RB4A 2Y27A 3AUKA 1YS4A 1Z4OA 3KKZA 3G2IA 4H08A 1QS0A 3VNSA 2QW0X 5C3MA 3M6LA 5EJ4A 1CUEA 1RZRD 3SQNA 1KMMA 3GEHA 4RY8A 2OHXA 1BGWA 2NXCA 5DX1A 2C88A 3FFAA 4YRFA 4KLZA 2GT1A 3ZIAD 1BN6A 4H3KB 5BORA 4RTKA 3D6TB 1F0YA 4LHVA 4NENA 5CM2Z 4CHGA 3GRFA 4Z8YA 1YS6A 4EEKA 1L8OA 2XUAA 1DXYA 5EQDA 2Q2VA 4RVDA 1R7RA 2XUOA 3C0KA 4F60A 5LXTA 1K7FB 4V3CA 4GDMA 2O8EA 4EKDA 4LRUA 1S89A 1MABB 1KJIA 2A0WA 1E6MA 2Q4RA 4TMKA 3OJXA 5DGCA 1RHRA 4J0HA 4XLLA 1IPFA 1O9BA 4G0WA 2BMDA 3G2QA 2VRWA 4HRVA 2AEFA 1JU4A 1WA5A 4FNAA 3OHPA 1AN9A 1LDEA 1VLZA 1Z6PA 2JAXA 1TMGE 4U2KA 3TXXA 4YRRA 1VKNA 5JZOA 3V3KA 5KMGB 1N5JA 5G1PA 3TVTA 3ABRB 3HM2A 3IPCA 4REQB 4DUYB 1G8KA 1GRRA 5DDIP 5FUWA 3KQVA 2BEKA 3FGPA 5TV2A 1JYFA 1UQTA 3FGNA 5ITSA 2JEZA 2PDAA 4PZYA 2C0CA 2FPUA 3AG6A 3QWAA 1U6KA 1KEPA 2TMKA 1DV2A 4E08A 1NT4A 1RJ9A 3CINA 3P2JA 1ABFA 1G21B 3Q4GA 1MRSA 3QXHA 4MI6A 3CY6A 3DBLB 5LP6B 2ZUFA 3T5TA 3NAZA 1KJQA 3CRVA 1JE1A 3GH1A 1NXVA 1YBAA 2A9QA 1IE3A 2DHEA 3M6AA 3JYQA 4FBGA 4IXWA 3GZJA 4BP9A 3AYXB 4WZBE 1G9XA 3CUTA 1C41A 4KIFA 3BK7A 4L4ZA 1M6VB 5DGXA 2JJYA 4NEQA 1UJBA 2C3YA 3MD9A 3I5YA 1N0VC 1V9CA 1X14A 3NHZA 1GGMA 2XADA 4RBNA 4S0XA 1XAHA 1GY8A 4B47A 1XP8A 4GPTA 4FWTA 3C6KA 4I5GA 3DLTA 4YV2A 1BA2A 1UANA 4IHKA 1T13A 1GRCA 2W6ID 1CETA 2BGLA 2OGZA 4F4FA 4DV3B 1C2YA 3QG5A 1OIXA 1T5DX 4D02A 2V54A 5LJIA 4Z53A 1NGSA 3TTWA 3BE5A 5BXQC 3L07A 1ML3A 2XDYA 3TPZA 2I4OA 4Y2UA 2G5CA 1LK0A 4OV6B 4MDHA 1ZCBA 5L4NA 2OY0A 4YAGA 1JJBA 5IAEA 4BE9A 4U8GA 2R1ZA 4DXAA 3KT6A 4JQZA 4BNMA 4CKYA 3TX2A 3O8NA 3VU0A 1W2HA 3ND9A 1MNQA 3MINB 1ZITA 2XWPA 3P94A 4DLWA 1XZCA 1OH6A 4M1TA 2V6GA 1NKSA 1T8YA 3E4CA 2N75A 4P36A 1E1MA 3TZCA 3V4ZA 3VISA 1CJVC 2BZSA 2DUJA 3IIEA 3QI7A 4QNNA 3KS9A 3DM5A 4CMEC 3W6NA 1PR3A 3RAPR 1EFAA 1I14A 3H75A 2Q21A 3IDSA 2IY7A 1JHPA 4TV9A 2QV7A 1B73A 2JKVA 5I47A 1UBRS 3ZJYA 1UBNA 3KTAA 3EIQA 4RJKA 1W9MA 2BZGA 3ZR4B 4Q6WA 2IBMA 4QPCA 1OYOA 4P58A 2JLXA 2A9OA 1VPVA 1W1IA 3WIVA 3HXOA 3FYUA 1TVKA 5DHUA 5CIYA 2ORWA 4G8BA 2JFQA 2PS1A 1R1DA 3UHAA 1C80A 2XTJA 2VSQA 5JRZA 1YR1A 2B0CA 1II8B 3ESZA 3K9CA 3PLNA 3ZHZA 5CA1B 2UXBB 4AWBA 4I8DA 4TV8B 1P7VA 4JI5B 1AA6A 5BSVA 3PJGA 5CW1A 3ABOB 4L3WA 1ZBQA 2UVQA 4NE7A 3WGHA 3EVFA 5CU7A 4BQOA 4II3A 4HQKA 4BV9A 3WQBA 3OZGA 2EERA 5KVSA 4IOJA 4NBTA 1Z45A 1IOVA 4G24A 2RMKA 3SJBA 3S6JA 2B4TO 1NAHA 4LV8B 1IQRA 1VCHA 5U4XA 3T41A 3NM5A 5I7OA 3OIUA 3OU2A 4M89A 3F4KA 4OQFA 3H86A 4WKOA 3CURA 3ONDA 5CD9A 3MT8A 1C9JA 1G42A 4JP5A 4I3GA 3WB9A 2VYND 2H4JA 1SG0A 2QG6A 4YJKA 5HW0A 4QGGA 1R27A 4WCFA 3ZXUB 1I33A 1G6Q1 5GVRA 3AB3A 2ERYA 5GONB 5BSMA 3TOCA 3ZU2A 4HBGA 1QB8A 4KIJA 3NT2A 5DCLA 2I6GA 3EK2A 1PEYA 3TR5A 1GG2A 3ZH2A 2OOKA 2VDQB 1XTTA 2RGNA 1NVTA 2WTBA 4QYWA 3RS7A 3PI6A 2YXLA 5LQJA 4DMFA 3ONEA 1JHAA 4CKZA 4FGUA 4ARCA 3AVPA 3RYCA 4I6GA 3V4PB 4FZRA 3OTWA 4F8YA 1TW3A 5JT1A 3F5DA 1CF2O 3H04A 3DBVO 2IE0A 4BV8A 2DOKA 2NUAA 5CHYA 5G0UA 1ZP6A 3FOEC 3QK7A 3RVMA 2BY4A 1LPPA 5THKA 2E55A 3CH4B 3KV3O 3SVLA 1RLTA 2PZKA 3NR2A 4B2YA 2QM0A 4KN9S 2I3AA 5FFNA 4AI6A 3OWHA 2BFAA 3LNTA 2WTAA 1KE1A 4BNJA 1RRMA 2GYYA 3ENWA 4IIDA 3U4HA 1W75A 4H3SA 3QUSA 4ZEOA 5K0CA 2DBZA 4Q37A 4WLVA 5CFLA 1GU0A 2ZB3A 2FB9A 1CQWA 3VR1A 1G9TA 2CMGA 3Q11A 3WICA 3LHDA 5EHXA 4G81A 4PG6A 1RLIA 3TNLA 4EI9A 3IUJA 4ZARA 3GZTB