5IKEA

Crystal structure of mutant-d97n of peptidyl-trna hydrolase from vibrio cholerae
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
194
Chain Sequence
SQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHNELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unraveling the stereochemical and dynamic aspects of the catalytic site of bacterial peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
total genus 63
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ikeA00
3TCKA 4DHWA 4HOYA 4OLJA 2PTHA 2NAFA 4JX9A 2MJLA 3V2IA 1RYNA 3OFVA 5IMBA 4FOTA 4LWQA 4QBKA 4FNOA 5IVPA 2Z2IA 3NEAA 3TD2A 4QD3A 3P2JA 4QAJA 1RYBA 5B6JA 4ERXA 4IKOA 4JC4A 2Z2KA 3TD6A 4ZXPA 4Z86A 3TCNA 5IKEA 3KK0A 5EKTA 3KJZA 2LGJA 2Z2JA 1RYMA 4FYJA 4JWKA 4QT4A 2JRCA 4P7BA 4JY7A 3VJRA 4FOPA 4DJJA 4YLYA
chains in the Genus database with same CATH superfamily
4ZFNA 4O4HF 1ABFA 1P91A 2ZBPA 3QYJA 4HGRA 2BGTA 2YDXA 5BSRA 3S81A 1PS8A 4B6OA 4OQNA 4U8HA 3G7NA 4FDLA 9ATCA 1YIAA 4JJEA 3HJNA 3DZGA 2VP9A 4ZCIA 4OGLA 4P86A 1U04A 3R6WA 4Q7LA 2GZRA 3QKIA 1OASA 2G77B 4HBZA 5DGHA 5AUPB 5JECA 1NVTA 4YI5A 5LOVA 4KWHA 1PZGA 3VBCA 2MCFA 4AJKA 1VRWA 2JGAA 4ER5A 1ZQ1A 4L27A 3GZTB 4JWKA 4WXHA 5K0NA 1YR6A 3NASA 2X1HA 3HCNA 4Y2QA 3SQMA 7MDHA 1H0SA 4LZNA 5KS2A 4MVCA 3KR0A 4HNRA 4LC1A 1E3QA 1UKCA 3KQQA 5DBEX 3ESAA 5FL7D 1THGA 5T8KC 4ENVA 4Q3NA 1GDHA 2BUAA 4KX3A 3NHBA 4HGOA 3H5WA 2VA8A 1TC1A 5E4JA 4QE3A 2FPPA 2YWFA 2GD0A 3CZ5A 3NBZC 1NQOA 4C6TB 1EGHA 4R98A 5AIAA 3QKRB 5ITZB 2Q6OA 2VNJA 1A3CA 1XYVA 4NZNA 3AF3A 4HDSB 2EXXA 5KJ1A 1YMQA 2HO4A 3W5HA 5A4JA 2QV7A 5SV2A 4Z2YA 3URMA 3M4YA 4MICA 1QTRA 1FX1A 1FCJA 5AXDA 4PR3A 1CQZA 3BH0A 1Q7TA 4Y6PA 1JZQA 1DLIA 2K2QB 4YJFB 1NE2A 1NW8A 4AUNA 1F5SA 1NIPA 4LOLA 3BF8A 3GEHA 3M6MD 1VB5A 4IIUA 1NVAA 1GQYA 1L5ZA 1P7CA 4JC0A 4K28A 3W8NA 4DIOA 5HS4A 1DKOA 4GC5A 3GLHE 2Z6QA 1KY4A 2BGNA 2FJ0A 1C3LA 4ON9A 1W0KA 4BMVA 3ZI7A 4C4AA 4H3KB 2PLNA 1W0JD 3T06B 3VPSA 1I14A 5CH3A 1HT2E 2ZITA 2YRFA 1AUXA 3KCNA 3TXYA 2YOFA 2Q3LA 1J5XA 4JJGA 4BNNA 1A2BA 5L3QB 5JDIC 3ND8A 3LQ1A 1KEVA 4L5YA 2PZMA 1JPVA 2AK2A 1EWRA 2XODA 4Y0VA 3PCRB 5EE9A 1SNYA 5ADUS 1PJAA 2NV0A 3O6VA 3ZJYA 3KZOA 1H1TA 4KGVA 5JANA 3SQDA 2FWAA 1H42A 2BDTA 2O06A 1O4VA 4ZYZA 4F3RA 2FPIB 3U4GA 2VQSA 2QR2A 1LF0A 2XX3A 3R3UA 4BRZA 1TO1E 3I37X 3IYLW 2XUJA 5FA8A 4BVJA 5A5EA 3QA9A 3R3ZA 4CMAA 3WNQA 1QK3A 3VTAA 1BYIA 3RTBA 1AUVA 2JZCA 4CYMA 5JAQA 3OO1A 1ZFNA 3TAHA 4JLWA 4BZQA 5G4KB 2XNCA 1CD5A 1WBDA 3AI3A 4P4NA 4XH9B 4QTTB 2FZ4A 4Y1EA 1EFHA 1F12A 3OJEA 4ZA2A 4P32A 1PTJA 1M2FA 3MAGA 4OJNA 4RJJA 3W5IA 1QZ3A 5IEBA 1M8FA 4UM8B 2EKLA 2P3QA 1DAMA 4A1OA 1VQ1A 1KBZA 3O74A 4GYKA 3RLIA 3VVMA 1QGED 1O4WA 1FFCA 4LVOA 4Z54A 4UAJA 5FPTA 1W94A 1AMOA 4B3RB 3GLFE 3KWFA 4DNFA 3FVTA 3JQQA 5BNZA 2QX6A 2ABWA 4BV8A 1JR3A 1WVMA 4KNYA 2XQGA 4CHTA 5JAZA 1WS6A 2HPHA 1XTKA 1PT9A 2L69A 4R8MA 5B64A 3RBVA 5CB4B 1WD5A 2CCGA 2LBPA 2FSHA 1XWFA 4ZEXA 1L9XA 4CTNA 2BI4A 4E5YA 4C0BA 2C4UA 3PX3A 1UFVA 3R0QA 1W4ZA 3DFIA 3K3PA 4I1VA 4NJMB 2FQ1A 1G9TA 4OATA 4P3NA 1AD2A 1HNXB 4GNKA 4L6IA 2V7WA 1KK0A 3M6FA 5DM70 2VNIA 3WDMA 4TWZA 1NL3A 3BG5A 2UZAA 3IHKA 1EXNA 1U0GA 2VDWB 3D8RA 3OJFA 5CLJA 1XRPA 2Z3WA 4FQ7A 5H81A 2W98A 1Z5ZA 2VPWA 3YASA 4A91A 2WQ6A 1TKAA 3WGHA 2VTBA 1X3SA 3ZIAA 1EQ2A 2BMFA 2ZYRA 2IEZA 4BKRA 2XF8A 2RJ3A 3OCVA 5SYNA 5DOZA 5THXA 1K8QA 2PLRA 2PWBA 4AD8A 3H8SA 3PGLA 3HCCA 3W9SA 5CDUA 1H66A 4RTKA 3HGQA 3I64A 4E12A 3KG2A 1RQ7A 1P45A 5FTMA 3TEFA 1RM0A 4GH5A 4J1SA 4PQRA 1ADFA 2I62A 1UWKA 2I9PA 4NWIA 4L15A 2AB0A 2GZ2A 3TQIA 4M7RA 3KEOA 1EX9A 2P67A 3PT9A 4E15A 1TTTA 4E7OA 2VSYA 4BNLA 5JJIA 4MDYA 3WK5A 3ZHZA 3R6LA 5IWCA 3CR8A 1NVKA 3WNDA 2CMHA 5EWJB 1GGJA 4HEJA 1ARZA 3R5JA 5JH7A 1XRLA 3LUAA 1PL0A 3W7AA 4MQEB 5EJAA 1TPYA 4A6DA 5A4AA 1THTA 2H54A 3RF6A 4N6OA 5FR2A 8LDHA 1WUHS 2BUBA 1P2TA 3FYUB 1PNTA 1UK8A 4QQ8A 1H6CA 4ZZ2A 1JHOA 5JPIA 2BMEA 1A8SA 1JA9A 1G3UA 1PO7A 2G88A 4N9QA 1BQ4A 4ZTZB 4HKTA 4FFNA 1TJ3A 4H7EA 4OPMA 4FU0A 2NU8B 3C45A 4HV4A 4OMDA 4TV8A 2VHXA 1NWCA 3WBBA 3O8OA 4FGWA 3E15A 3VRHA 3P1JA 4OSPA 3QEBZ 1VKRA 1Y1TA 3PQ4A 4GOND 1ZS9A 3TFQA 1K3TA 2VSNA 3MGBA 1O7JA 4TWJA 3M49A 1G8AA 4QL3A 4YRQA 4FDUA 2XQFA 1JDPA 2ZRCA 4XASA 4RTLA 3PJRA 3WA6A 1JE1A 4NDNE 3W9BA 3W5JA 5ELXA 5EXPA 1MXHA 2IE8A 3ZPXA 1WDTA 2E55A 1UMDB 4BASA 3B5JA 5JXWA 1GQQA 1TTHA 1UT6A 2PANA 2I03A 4Q9NA 2RGDA 3S1AB 3WADA 5I9MA 2F1IA 3RUCA 1VHWA 3RB8A 2MSEB 1EUZA 1SEVA 4Y2XA 1R4MB 2X23A 1OVGA 5K3SA 4CLEA 3L7AA 1II8B 3FYSA 1C8BA 1SHUX 4OAPA 3CRNA 4OHWA 1A2KC 3RVSA 4GOLD 3TTSA 3U19A 1XV5A 1SKAA 5LBTA 2EWWA 5TJHA 3BAZA 4KAXA 4CMIB 5K99A 2AJBA 2WIKA 4TTIA 1TEVA 4WJLA 1SCIA 4CFYA 4RY0A 3AUXA 3DOUA 4MW5A 4X1OA 5B6PA 1H2YA 3PP8A 5DM60 2IHNA 5EI5A 1D2HA 4PG6A 1QP0A 3ICEA 1KETA 1U0BB 3TCXB 3WQBA 1TE2A 4XGIA 4NJMA 2JBAA 1O54A 1FFAA 3IBCA 4BYMA 5KQGA 2D0PB 1YAJA 1XRMA 3JWIA 3BL8A 1XZ8A 2QSJA 1LQ2A 1PF7E 2Q8PA 1Q92A 2YHIA 4HXYA 1PZFA 1XTBA 3UOAB 3ZUGA 4WERA 4LCJA 2BFNA 1SRRA 1AS2A 1VE5A 5FF9A 3DYBA 1G8JA 4QPDA 2PX3A 4BMPB 5FA5A 1MO5A 2F64A 2V7QA 3ETNA 1Z4JA 3BRWA 3DS8A 3I83A 4I5FA 5F3DA 3SK0A 2D4AA 3ESQA 3K5IA 4UDYX 5JS1A 2EZ9A 1PWEA 3TDKA 3FSRA 4ZHQF 4JXKA 3M9LA 4MWGA 2MR5A 1W36C 4IO0A 1FFXA 1K7XB 3OPMA 4YT8A 1L7BA 2GZSA 4GQBA 1T24A 1ZOSA 4MA5A 5TVKA 4EG1A 4LG1A 5AVXA 1K06A 2JI6A 3HU2A 3KIPA 5G4KA 3DMRA 3O5AA 1G1MA 1PX2A 2BF4A 4M1SA 4NJOA 4TKVB 4LQ4A 5H3CA 2OZVA 3ZU5A 2WP0A 5JYCA 2GD6A 4POOA 4JB3A 1EFVB 4HY3A 1EGVB 1ABBA 2DBZA 1W34A 4FCWA 1Q77A 1TF2A 2Q5QA 4D9CA 4X3OA 5AKIA 5TPWA 2X1VA 1G2IA 5EZYB 1CF2O 2EZUA 1YQTA 2QN2A 3ZV4A 3QU5A 2WVJA 5K3FA 4M89A 1GADO 3EUAA 3RVQA 2QT0A 1QVVA 1PR9A 1COWD 4HNTA 1YC5A 1ILWA 1KFKB 2CDAA 2WKSA 2W4MA 4IJMA 3AIMA 3NOVA 1YVPA 3FUUA 4TGLA 1QHHA 3KZNA 4QATA 2D2EA 4PGAA 1MJ5A 5JZBA 1TXGA 3EULA 4OO3A 4AZTA 5BURA 1LC3A 2RDMA 2ZCUA 3A14A 1NN0A 2OHVA 1DE0A 2REQA 4G0QA 4PLHA 2P30A 2R84A 3EDCA 2XGSA 3FHOA 3M6VA 4IJ5A 1CY2A 2C04A 2RG7A 3KTOA 2M9MA 3CVXA 1WNFA 2WIGA 2CLIB 3EIOA 3PEEA 3RVPA 3W90A 2FFRA 1JDBB 2RGEA 2JDID 2NSDA 2OWDA 1EESA 3IR5A 1DWOA 5BV7A 5CIQA 1H23A 3RYIB 4L4UA 1KEZA 5G1PA 4FDAA 3ZQ4A 4Q6BA 3D6JA 3ZLUA 2YWBA 1T43A 3AKEA 4OQQA 1DRUA 1IN7A 1IG0A 5AKXA 1WSDA 2X13A 1M2EA 5A1TA 4BX2A 4EABA 4D97A 4Z7QB 5CA0A 3UAZA 2F3RA 1FDWA 4HCJA 2E1PA 1XTVA 3H5RA 5GZ1A 1ZU4A 2H6EA 3BA6A 1BEUB 1G8YA 4UCXA 3VV2A 4CTMA 4BVHA 1CUFA 1M6WA 2TYSB 3MCUA 4EJSB 3B9RA 3CZCA 4PX5A 4Z7NB 1B8NA 3FDFA 4F7WA 2EF0A 3LD9A 4CQMA 1S6YA 2VR1A 3CG4A 3O1LA 3MB5A 4EZBA 1EWYA 3BTUA 5JUWA 1V71A 4PYKA 1H5NA 2FPPB 4II3A 5HM8A 3PX7A 2VHUA 3INYA 5COQA 4EKDA 4OHXA 2CL6X 5JV5A 1VGQA 4W5JA 1TK9A 4KRXA 2WJGA 3BFKA 3OF3A 1CRWG 2IEYA 2RHMA 4AJIA 3HBAA 3ZCQA 1NUTA 2C4TA 1KQPA 3VXKA 2N0SA 3JS5A 2RI1A 4NF2A 3TG8A 3FTEA 1QG4A 5FORA 1KORA 3GJYA 1U7UA 2PYDA 4P8RA 2F3TA 5E1OA 3PRKE 4DXDA 5KQMA 4H4EA 4ZAZA 2Z2JA 3BWEA 4Q7MB 4ND1A 5H0IA 5F5LA 4DILA 1YQDA 3VU1A 3E3LA 3IIJA 4XJXA 2PJZA 2QZ9A 2Z8XA 5FI0B 2WY2D 1NZJA 3DXFA 3EXFB 1WZEA 1FRVA 2XA1A 1IZYA 4MMXB 1CQJB 4X7MA 2UYCA 1Z74A 4MPJA 5K0BA 3GRUA 3EGVA 2H2DA 1KSGA 1GQSA 1AGNA 2PVPA 1N34B 4PC7A 1EU1A 1GUAA 2NXWA 4D1YA 1UBTS 1NVWQ 3OQOA 4YLEA 4FWBA 3FNFA 3LCMA 5E8JA 2CLOB 2IUEA 3O21A 4XUEA 1XVIA 4TMFA 4RZUA 1SXHA 3CXUA 3CWQA 4U5QA 3BM5A 3SF8B 4B9EA 1TM4E 2XWQA 4FZVA 5KKCA 1ML3A 4LOHA 1NUUA 1EUQA 4YACA 4IGIA 3EF0A 2ZT5A 1AHHA 3C7TA 1LD3A 4QXAA 4F4DA 4Z4CA 2EP7A 1A4RA 4ALNA 3FOBA 1KZ4A 1L7DA 4PE5B 3R8XA 3I61A 4NCXA 2D1QA 5CXQA 4ZO4A 3IEIA 1FS4A 3LNTA 1XD8A 4NU6A 4TT3D 4UVIA 1LSOA 3K0CA 2I2AA 1Q0HA 4ZI3A 4DBLC 4WVFA 4Q9DA 3TSZA 1X7XA 2P7HA 3J7TA 2FYTA 4HVAA 1Z6TA 1QWSA 3GLIE 3RSGA 1H4VB 1EHIA 2RCYA 4EG7A 1YFKA 1B8VA 3RH0A 1USVA 4AULA 2FVYA 2P65A 3VO8A 1PEAA 2FPGB 1YDGA 4AC9A 5ED4A 5LCXA 5LQRA 4GO1A 2IOFA 2NO5A 4J4BA 5AHKA 1ZNYA 3UAYA 3DWFA 2F62A 3WWOA 1E18A 1LRJA 1OZGA 3I2GA 4J75A 4L7VA 5PNTA 2G9NA 2OYRA 4C4SA 5HXAA 5LP1A 1TF5A 4WIAA 2GO7A 3RHFA 1P9LA 4K88A 3LT1A 1LTKA 1JFRA 5AUNB 3R7WA 1G9SA 1A71A 2W2PA 5BSVA 1U8YA 3KYBA 2GFIA 1RLTA 3DHYA 3HNRA 1MEJA 1YHNA 3TPZA 4WWHA 2JCVA 1BS9A 4Z2AA 5HIIA 2EP8A 5CVEA 3SMQA 4ARIA 1BKDR 3PK0A 3AB7A 1QGUB 3QM1A 1EINA 2X2EA 3VNUA 2Y1LA 1MVNA 3RD5A 2I5PO 4A7PA 1OC2A 4ALLA 3I9V6 5DYGA 1E61A 3C8ZA 3AF0A 4TMXA 3K8OE 3UKOA 1ZO8A 4AJNA 2RGAA 4HDMA 5KSWB 2QSZA 5JARA 1SXJC 1BVRA 1UC8A 1Z2AA 4UREA 4U2KA 4DHWA 3ICQB 4LFBB 2Q4DA 4EEKA 5G0WA 2W6JD 4P08A 4D4GA 3QPUA 2XYHA 3TSCA 5ICSA 4Y2VA 5IVPA 4B8ZA 3ZJVA 2ZRLA 4NQZA 1E6UA 1C7IA 3C87A 4IVQA 3PYLA 3B36A 3G82C 2H1LA 3KQOA 3B5IA 3G5LA 4J0QA 1O0BA 3CRRA 5EAIA 1EUCB 2FF7A 3K9QO 4EG0A 3BK7A 3PS9A 1TIKA 3HCPA 4HWGA 2WU3A 3NEPX 1HLPA 3W9UA 5F98A 1EVJA 2JAQA 1UK9A 2J07A 4D7AA 4HG2A 1JQDA 4Z49A 2FN8A 5LYJB 2JZNA 2HU8A 1J8MF 2WMNB 1BOOA 3KOOA 2VBIA 4FGKA 4QG7A 2FDCA 2KB0A 3HH8A 4K8RB 1DBVO 2DHRA 3O3CA 5ESDA 3HVKA 2O1XA 3ZWOA 2B5WA 2I55A 3PFBA 1U8AA 3CUUA 4OM7A 2ANCA 3K94A 5DYWA 1UIRA 2ATCA 3M7IA 2VK1A 4XQ0A 2Y9MB 3BQNB 4M86A 3CLUD 1V16A 4GXQA 3IVMA 4JP5A 2F8LA 4JP3A 3UXEA 3DF9A 4CIAA 3BIXA 3IQDB 3KYIB 5IVDA 1A2OA 4P4SB 1Z6XA 2GYYA 1C3XA 3C3YA 5AM0A 5LB4A 2X9NA 2D1SA 5EYPB 4D2IA 3J7AC 1RVDA 2OCKA 1GQFA 4XYGA 5CFPA 4PAQA 4FSHA 2CJYA 1XD2B 1U0EA 4N5LA 2PK3A 1IN4A 4NCKA 2GKOA 5TNXA 3A3KA 1V96A 5EHNA 5JS8A 3ZV5A 2PVSA 4KPUA 4YAJA 5IU6A 2HJHA 1Q14A 4RIHA 2D0IA 1EK6A 1HTTA 3CU5A 3MINA 4RELA 1ESMA 1GAJA 121PA 4L8VA 5CA0F 2ZIWB 2J3JA 5K8TA 1YZUA 4V0OA 1XWWA 3R40A 5C7LO 2ZBGA 1Z56C 4G09A 2Q50A 1FP1D 3LE8A 4LHYA 4MIOA 1GZSA 4FYWA 3LG2A 4FFMA 2PL3A 4GM0A 3HL0A 3A2NA 4J0HA 4GI1A 2FE1A 4O3FA 1YE5A 3AR7A 2PZAA 5DIFA 5IW8A 3ZHBA 3DW3X 1QC5B 1SU8A 2D06A 3CO0S 2J5XA 4X6UA 3EK2A 4F4JA 1RXYA 2OESA 4WXRA 5BN4B 3V4PB 4L2IB 1J9GA 1RW4A 4EFNA 2H1WA 1BE0A 2PRIA 3TVYA 3LDUA 3MMXA 1LNQA 2JVIA 2JVJA 3DZBA 1KY5A 1CRLA 1KBQA 5CW1A 3HZHA 2WAXA 2CJXA 3PRYA 3P9YA 3AHFA 4KYVA 3WIUA 4XI9A 4CUKA 4C7VA 4JJZA 5BWLA 5CEJA 5JH7B 4C20A 4G1UC 1ZKMA 4G0NA 2ECQA 4MLDA 5AP9A 5MN6A 4YA6A 2MSKA 4NCIA 2FV8A 4BNDA 4CT0A 1G5HA 2VK2A 1FQOA 5JJKA 2YYYA 2XPCA 1KIAA 1L5OA 2GDJA 5EIEA 2NUTB 3DHEA 4DG8A 2VIIA 2PT6A 2CF6A 1SHTX 2LV8A 3WYEA 1Y5RA 1CZHA 4FDVA 4MITA 4F1KA 1UH5A 2E1RA 1LQTA 2ODQA 3KKEA 3QEOA 4KLZA 1UWLA 5B1YA 4EKGA 4KXWA 3C43A 1J9EA 4FGLA 1BGVA 1G41A 3AHJA 3FOWA 4D0RA 4ZQGA 4ESEA 3ZWQA 4MUEA 4EEZA 1EVQA 3BL6A 1NSFA 3HDTA 2Q3CA 3MS2A 5T57A 3VOBA 3VKWA 5AW8A 5TXGA 1AURA 3JY6A 2QRJA 3JD0A 1RAGA 3N8NA 1G3IA 1ZXBA 2J6BA 2Y1OA 3GLSA 3Q6IA 5DYTA 3RC7A 4YCAA 4C22A 1RAAA 1NV8A 1GCUA 1K7FB 2W11A 5LUAA 2WYOA 4FN4A 4MV3A 4QAJA 1H2HA 4NP6A 2YN0A 1H8HA 5HVNA 3RW9A 3IA2A 5A7GA 3X1JA 4JA2A 5B6IA 5JMOA 2PYZA 1VOTA 3CF6R 1MZPA 4BCDA 1P18A 4PXYA 2QAGC 2VK4A 1I3LA 3THWB 1PE0A 2XRFA 4IG9A 1XMJA 1MN6A 1QAQA 4UBIA 1NTOA 1QKJA 1X80A 3S2GA 1BU8A 3NV9A 2AVDA 4CEHB 1F17A 1ODFA 1OSNA 1CKEA 3CPSA 4BU1A 2CXPA 3WYBA 1Z6GA 3PNKA 3WVNA 2NADA 3UAGA 1T2EA 5LC1A 1F8YA 4OL9A 1G21A 1YOVA 5FPSA 1TZCA 2ZI6A 2P68A 2XUZA 3CGGA 2H4XA 3LHSA 4HQNA 4UDOA 1RHMA 1Q3TA 3HU1A 5GM1A 3RCBA 1DZ3A 4TVSA 1DJQA 4EYOA 4B84A 4JBNA 1BDBA 2KLHA 2Z5GA 1ODCA 2FLWA 1Z3CA 5IZ4A 3WIBA 3WGZA 1GNQA 2QZ4A 2RHGB 3C6KA 4HWSA 4UE3S 3PIRA 3MIZA 4RPKA 1L5KA 2PMDA 1G66A 4CUZA 1UBUS 1UZAA 3HA3A 1RT9A 3JQDA 4IXWA 4CBVA 2W6CX 2D0OB 1PG5A 2D5AA 3OKCA 1NW4A 1X7WB 1KP3A 1Y4DE 4TTSA 4AUKA 2I1LA 4D43A 4BXOB 1UBJS 1VCMA 4IHJB 5C3MA 2ZM6B 4L28A 3GP8A 4F91B 4IAOA 4NFYA 1E1LA 2H5IA 1L5RA 3G2JA 3HYCA 4RVOA 4RVCA 2VJLA 5HBGA 1FFDA 1K8XB 3W8EA 2QL6A 3WYGA 8GPBA 2CVZA 4O3MA 2P8JA 5LKRA 1H2FA 3I8OA 1IZ0A 3G7UA 2E89A 3ABIA 1GAWA 4MO2A 4FHGA 5ALRA 2OHFA 1E63A 1NBHA 3CUEF 1JFTA 1X8KA 4KV9A 3K6RA 5HMLA 3V8VA 4M0FA 4PPQA 4YAEA 1VI6A 5ER9A 3D3WA 4JY7A 5K3BA 3GGOA 4QQNA 3O8NA 3WLHA 2HLDA 4Z4FA 2EX0A 3Q6NA 4WCDA 1YUMA 1O87A 1SULA 2HJSA 1N4AA 2WM3A 4P58A 2BJVA 2QORA 4IKEA 1YRBA 1PD1A 2PA0A 2G6BA 1HOTA 4OFXA 4PHHA 3REQB 1I94B 3A6FA 3CISA 2XZLA 4QREA 1YRHA 1XN1A 5BY2A 1XTPA 3HSSA 4HWRA 4N5DA 3VA7A 2E4UA 3FBWA 2CD7A 2F9MA 4HWOA 2R4QA 1OI3A 1QHFA 2ZZNA 4QOGA 2BFFB 5JXHA 3T5GA 1HXHA 3U3RA 4AROA 3EFEA 4E33A 4EF6A 2D2XA 3ASYA 3AETB 1QQ6A 5GVSA 3GJRA 1NBOA 1T2CA 3CFYA 3VR4H 2VJQA 3SYNA 4FEYA 2FPMA 4LXQA 3MAAC 3K31A 3TIGA 5MHTA 1HNZB 2DTDA 2GN6A 3HI6A 1W4RA 4IQ4A 1J23A 3MYYA 4MYTA 2UVDA 2ZSEA 2AGVA 1BOFA 2WSYB 5EJ5A 1MKYA 5ALFA 1KH1A 4Y9SA 2WF5A 2FMHA 1YVRA 1IRIA 2Q5FA 5LQUA 3K2IA 1FK8A 1KC3A 2IUTA 1V7CA 2C59A 1WUIS 2YMPA 5K09A 5EP3A 1D2GA 2ERYA 4FB4A 1A04A 1BCRB 4OXYA 3LDAA 3TBKA 3WC4A 1IJFA 4MV7A 3GELA 4G26A 3CEHA 2CCKA 3AERB 3OJWA 1DCMA 2VRCD 3RFXA 4P81A 1Q1QA 2FW0A 4HGQA 4U0KA 4WY8A 3MCTA 4L57A 3T9AA 1HYEA 4INOA 2JH9A 2DPGA 5E3JA 2PH3A 2VKQA 2GK7A 2VUHB 3A4TA 4FNMA 5ECYA 1P9OA 1SD1A 3C85A 3RSLA 16PKA 3FROA 2C88A 3WLSA 2Z6UA 2IS1A 1VA5A 4GI7A 1LJLA 2PGJA 2PMWB 1NVXQ 3HP7A 3OPXA 5H9VA 2ZXUA 2RGRA 5EJIA 3NGXA 3AJ8A 2FG5A 4AJHA 1J09A 4WTOA 4Y67A 1L7QA 2P78A 2YN4A 1PSWA 3UHJA 4YIKA 4IIXA 1Q0UA 1C7JA 1CNFA 1TCAA 2RCNA 3LBHA 2VUUA 4XCXA 1Y8QB 4LQCA 1M1NB 3A1NA 1SCUB 2BAGA 3ZU4A 2PUDA 1FBTA 3DZIA 1UK6A 2CNWA 3MWLA 4H59A 2CN1A 3A26A 4O25A 5JVDB 3RHSA 5BQFA 4ES6A 2X4LA 2IPAB 4Y1FA 3AW9A 3ZQUA 3LC0A 4WZBE 4DS3A 1GAEO 2NV6A 4UD2A 4O2AF 3PQ2A 2H4HA 3D7LA 4YRNA 1BC5A 2AS0A 1YRYE 1PKXA 1SR8A 2B5VA 2I80A 3A70A 3WJAA 1UBFA 5DHUA 5A04A 4F8EA 4FWTA 5FULA 4QA9A 3PT5A 5IH3A 2UXBB 4FHFA 4LJRA 1OA1A 1RHUA 3N8IA 3C14C 3KKKA 5ESRA 4GMHA 3ZWMA 2VYNA 3ZR4B 1I3OA 1Y4SA 2C3OA 3H2JA 2ZRIA 3DCJA 4TS9A 5DK6A 3A25A 2RGUA 1NDHA 1BW9B 3KR1A 4ZN6A 1YFLA 3SZRA 1QH0A 2CC2A 1W9MA 2P27A 4P3YA 1P1RA 1D2MA 5E2AA 5BSTA 4D8TA 2DJIA 4EOGA 4YUXA 3PEYA 2QNBA 4NX2A 2D2FA 2PCJA 3IMCA 3LUGA 3JQBC 4RDCA 1GQ2A 2E87A 5IXJA 2CVFA 3OH8A 4DUZB 3GMIA 3I23A 4R0NA 3OTWA 1FYFA 1KMCA 4D3SA 4EKNB 5KVCA 3C6MA 1CVLA 2D7CA 3PA6A 5LR6A 1M5UA 1U90A 3EFOA 5C37A 4DMRA 1RCTE 4L75A 1OF1A 1A7UA 2Q8NA 3DV0A 1AQYA 4TSKA 4MRPA 3FCEA 4C3ZA 2ALJA 2QDXA 5G41A 4TXHA 4MUMA 3A32A 3FPAA 3F1KA 5CHYA 5JT1A 5KC9A 2V3CC 5IUNC 3AZPA 1U9IC 1J07A 4S24A 4B76A 1L6IA 3T1NA 3ZZUA 4A6PA 4YCMA 4DTIA 1QSGA 2CWDA 3DA8A 4KE8A 5LQSA 1QIIA 2LTAA 2ODPA 2HY7A 2QLJA 1FFGA 2PV7A 5HF8A 1JILA 1PG0A 1J90A 1IWBB 2QRNA 3BJMA 1WDLA 4RKFA 4JFAA 2RONA 5AM3A 1T4CB 2Q4OA 4QBKA 3AL3A 2DG2A 4GMFA 4PM4A 3UH0A 4O29A 3D3KA 3T7AA 3VR2A 1JXMA 4RDXA 3HXMA 1H5QA 3FPSA 4QULA 4B79A 1VJGA 5AKEA 3K71B 2ZRJA 2J9RA 1X7ZA 1GU0A 3OLXA 4H4DA 1SOUA 4R1UA 2IYZA 2XMBA 3T1HB 1F2UA 1M73E 4R31A 1PCXA 1Z7GA 4IIEA 4UNSA 2BMWA 1XAJA 1UT8A 2GRUA 1JR2A 3L5OA 4X1YA 4X41A 1PWYE 4GDFA 4D9MA 1A7JA 1DAOA 1W5FA 2ECPA 3QNWA 4FOPA 4J49A 1W2HA 4JL8A 4K9OA 4FHZA 4KQEA 4RKRA 2J3MA 2VT2A 5LBUA 1VJTA 2TS1A 2GZ1A 1AUQA 1XZLA 4I4TF 3TRIA 1VIMA 5G1NA 3V46A 1TUEA 3VTKA 3ACCA 3DDHA 1EA5A 1E6WA 1LLCA 4ENSA 5HZHA 2RKOA 1ISHA 5FEUA 2R7LA 2EJTA 2HIMA 2GAAA 1XZPA 3CJRA 2BY4A 3SWWA 2Q6TA 3CLSD 2Y1GA 1Y3DE 3IHLA 3Q9UA 4CKBB 1PK7A 1QVAA 4DADA 4AO7A 4U7WA 3SPXA 2H9AA 5KSOA 4TWBA 5EE0A 1JA1A 5A9SA 2DR3A 3L1UA 4JA0A 4MI3A 3CRMA 5L9AA 2V4ZA 3AM5A 3JTMA 3KB2A 3CE9A 1W85B 2CFRA 2O14A 2WE8A 3TJZA 2GJAA 2HO5A 4JLOA 4PO8A 4B83A 4BMNA 1YCDA 4A8JB 4RTQA 3U2QA 1HQCA 4RHUA 4Y7CA 3WAGA 5CVCA 2BI8A 4CIXA 5BT8A 2EGGA 2EGHA 2PXAA 4Q39A 1DIOB 1TZBA 4WGFA 3V4FA 4GVXA 3A10A 5FOWA 3FGPA 5DMHA 4CL3A 2A5LA 2BKEA 4H1UA 4GX0A 1XDGA 1PP4A 2ARKA 4DXAA 3ZGXA 3FWNA 2R8EA 3FKQA 1ZN2A 4GI3A 5FUBA 4Q3DA 4WBNB 4TWRA 4TZTA 7ADHA 1PJ8A 3K9NA 3NEJA 4XD7D 1XK7A 2J1LA 1Q6YA 3CNNA 4BUJA 4I4CA 4J76A 3S2ZA 3T3NA 1GLNA 1Y8AA 3MMNA 3K9GA 5CT5A 2VZLA 4I4TB 1SVOA 1XT6A 5CNIA 3RJTA 1YRQA 1K08A 3OMWA 4XR4A 3AIIA 4GZ6A 4K9DA 4OQDA 4DR1B 4DA9A 1HTBA 1SBIA 3GPIA 1JAZA 4LDRA 4BNTA 3M6IA 1EE2A 2IZ5A 2KLBA 4FB5A 3PXDA 4FFVA 3IT3A 3IUEA 1Z47A 2PL1A 4H7HA 3JRWA 3A0UA 1QS0A 1HG1A 4PICA 5B3LA 2NO1A 4B7ZA 1LA2A 3PE6A 4JVMA 3O3MB 2ZBUA 3B1WA 5EKDA 5FHQA 4AF8A 3RIXA 2ZW9A 1UBOS 1AV6A 3PPIA 4R2MA 3QOYA 1FMJA 3FR8A 3KSDO 1PGNA 1DC5A 3L04A 3R4CA 5KJEA 1EVLA 2BM9A 1USWA 1IXSB 2WG1A 4O2RA 5LZ8A 3KDSE 3HUEA 3LM8A 1T5TA 2AIRA 2QZZA 4MA0A 5BSGA 3SE7A 3ZHVA 2X8BA 2Q27A 3EWIA 3SS9X 4DUGD 1RZ3A 3E9RA 4QNMA 3NB0A 4WN3A 1HC7A 2O2DA 1R0KA 5KUTA 1HYGA 5AK3A 3BILA 2P62A 1IEWA 1WHSB 3QU9A 2OAQ1 5CTJA 3TINA 2C9DA 3QU2A 2COEA 2OUIA 2I7DA 3FNBA 3IBGA 3LCCA 1CS0B 4IH4A 5K8IA 3PJDA 4RJKA 3WOVA 2JJ1D 1JIUA 1U2EA 1W8DA 2A1TS 3QELA 4KMOA 5HP4A 1DG9A 3FGZA 2YQZA 4XOIA 4Y6GB 3H04A 4EI7A 3U6KA 3C2QA 4EYEA 2GA8A 4O2BB 2X7JA 1DKUA 3DL7A 3IH5A 1U0RA 3KJEA 2Q7OE 3B52X 2UZ4A 1N2OA 3IBYA 4OQ4A 3AVYA 5I5GA 1SVKA 1CFJA 3KSRA 5EXTA 2PX8A 2C4VA 1V5FA 1B4DA 5FOQA 1G8MA 1I3NA 1XCBA 3OX1A 1OFIA 3Q2OA 4FMDB 4O02B 3CPHA 3FGOA 5BT9A 3RANA 4DIBA 4WNYA 4DYHA 2WQZA 4RADA 5IC6A 3TPFA 3NHLA 5LVAA 2NXCA 3JD2A 4E5DA 1M0WA 5L6MB 1U11A 2N42A 3DP9A 3NBXX 1C1DA 4MUBA 4ZCPA 1VA4A 2SHKA 3OC6A 1LZLA 4IF6A 1GYPA 5JALA 3I92A 1GR1A 4HNHA 4JH0A 3U61B 4ARBA 3QEJA 1JKMA 1Z7BA 2BR5A 3OEWA 4AMUA 1JFFA 5C4GB 3SEQA 3KSBC 3C39A 3QG1A 1GL9B 4QDJA 1W6RA 3AEQB 4XJVA 2J0EA 1XEAA 1N2CB 2JJQA 2SKEA 4GBJA 3GCWA 4H1HA 5FL7A 5IANA 1YJCA 1ENOA 3OLWA 3TCNA 4Z4GA 3GEMA 3VNRA 2ZLBA 1YCFA 4KPGA 2Q1TA 2HDWA 1LWOA 2ZCVA 3CZRA 3LZDA 2PG3A 1MO4A 4QKQA 2FSGA 4DLAA 4IWYA 4YRCA 4CMJA 3ZHUA 3SHFA 5FFMA 3W0LB 2HA5A 2V7QD 3KKOA 3FLAA 5A2QA 2FN9A 2QTNA 3EGOA 4GYYA 4B6GA 2V65A 4YP6A 4ENTA 4R0MA 1PNOA 4B7XA 4BFCA 1DRKA 2ORYA 1QH8A 1M1NA 4UBNA 4FOTA 1P4RA 2CZQA 3E9ZA 1C7FA 1MU0A 4OIMA 1VHLA 3KL4A 4EMUA 2BMDA 3FVVA 2FWMX 4DY4A 3B2QA 4I5IA 1ODIA 4NU5A 5J4YA 2YJNA 1XJQA 4AKTA 3U7GA 3PDIB 5DHFA 3HGMA 1SZDA 2F48A 1L8OA 4KSCA 3ZJ4A 2EFEB 5K0FA 1VC2A 3VR1A 3ZE6A 1OZHA 3EIUA 2PV0A 1E4OA 2ZZMA 2DZDA 1NQWA 3DO5A 3EMDA 3AB8A 3DDCA 4X94A 3ZGNA 5CG2A 1UZNA 3L82B 1CTQA 3IERA 1KAGA 4B85A 3BB3A 1KHHA 2BTQA 1E6EA 1DEXA 1F0KA 1JQ5A 3GHHA 4ZVTA 4C87A 4Z3OA 1X9IA 2PS9A 1FFYA 1XF1A 1VLQA 3AYZB 3EEFA 4D56A 1U6JA 1FYEA 1YB2A 4NI5A 4BO9A 1NLFA 3R5SA 1SQFA 3FYHA 2ZB7A 3FNGA 5A0FA 4PG7A 4Q3AA 3OE7A 4QYIB 4Y30A 2O3JA 1GKLA 2JK1A 3WV4A 1PYOA 4DA4A 1E60A 1NT4A 4XCQA 5CM2Z 1K97A 1N5IA 1VHJA 1UM9A 4U3JA 1VYVA 2C7VA 5EZSA 1DQPA 3U1VA 3KK0A 2PUGA 3O8RA 3B9PA 4M6WA 3UTCA 1T4DA 2YV5A 2C5LA 3CKMA 2GX6A 4AIIA 2OV1A 2ZB8A 3GVIA 1GNPA 1PZEA 5J4VA 1VP9A 3FG9A 4DIMA 1UZLA 2Q2WA 4QOSA 5JY1A 5EQJB 4XKJA 4ARAA 1ZGJA 1XKXA 4NULA 1Q12A 1JHXA 1X8LA 4D4IA 1RFGE 2GLTA 3HZZA 2HJRA 1U6IA 1M34E 4Q5IA 4WMLA 1WZ2A 3QVSA 4I6JA 4KB5A 4C1BA 1U7HA 2Z1DA 2VPYA 4BO1A 1CR1A 4ASUD 3U81A 5KVSA 3L18A 3ZYZA 5E7JA 4YY3B 1GCOA 2HREA 2KMLA 5I9TA 4HX2A 1CB0A 5BW5A 2DFLA 1LPPA 3OKFA 3V3KA 4JT2A 2WUFA 1TPZA 2JLCA 2QJRA 4F11A 1MGOA 2QM3A 2J7PD 1NYQA 2BEWB 2QKYA 2ZDGA 3EAQA 3RAGA 4GXRA 1PEYA 1MQSA 2HBYA 3MOSA 2V6JA 4JUFA 2P6PA 4PCAA 4X60A 4DIEA 1H4QA 1NLZA 4FOOA 3F74A 4EF5A 5LNK1 1KE2A 2O3UA 4NVRA 4LMAA 4X1IB 1N9GB 3EZXA 3U39A 3HN2A 3H9EO 4HNQA 3GUUA 5JD6A 2FP3A 3Q15C 2XGJA 4MVJM 4ZC1A 5TQ2B 5CIWA 3ZY3A 4ZGGA 3O26A 4GPAA 3P20A 3BCUA 1NU6A 4GIBA 1O6BA 2HADA 1B6GA 1SUPA 1ADJA 2I33A 3LF1A 1ZC4A 4UVEA 3EPJA 2G0NA 3NBAA 3MD9A 2OO7A 1NSYA 2F90A 3QUAA 4HDQB 4ZQFA 1B26A 3VPHA 4BQIA 4DXHA 5TX7A 2OVBA 3O94A 1RKQA 1UC4B 2MT9A 1EFCA 3FB4A 3P2IA 2I4MA 1XL1A 4W8GA 1RXVA 4OJYA 1EXDA 2IPXA 2FWIA 2H1VA 3PV0A 4JQCA 3SEZA 3BWVA 4HQKA 3FGNA 5BV1A 5BOVA 4UARA 2IZ7A 3MWFA 3PD7A 1G6OA 2DFTA 2VYVD 4FLMA 2EFCB 2VG8A 3DO6A 3ANLA 5ES4B 5IYZB 4ZVUA 1QF7A 1JN0A 4M0KA 4CQLB 1P6XA 3RRJA 1E4VA 3IFSA 1NY6A 4HK4A 1TM7E 3USCS 4KN5A 3ICWA 4P5DA 5ADVA 1XPOA 1SG6A 1SUBA 3H3JA 2Y66A 2ZYWX 4MV9A 1XZGA 4GQIA 1X2BA 3M4ZA 4KLAA 1S0UA 3VAYA 4HRVA 4R69A 3ZTTA 1QV6A 5TE9A 5I51A 4DLPA 4XIFA 1Z75A 1EBFA 1ZA1A 1RP1A 3EBPA 3BFJA 1ULUA 2G80A 4QPJC 4MKIA 3FSGA 3LWDA 3DMYA 3C7AA 4CIWA 2V4MA 4CT4B 5ADWA 1Q2XA 3BWDD 5FXMA 2Q7XA 2H2HA 4ZGWA 5KQSA 1EFTA 3AR6A 1T4GA 1L3BA 1XQVA 4TZKA 4ZZ1A 1AV7A 1BCSA 4X45A 5KX5F 2O05A 4O4LF 4UATA 3THWA 1B3BA 1OXSC 1ORTA 2AEJA 4U7FA 3QF4A 3O1HB 1IDOA 5HUJA 1YRWA 3GEPA 1PGJA 3P2KA 4PHFA 3RO7A 1KAMA 4DJFC 4X24A 4GYJA 5B3JC 4JELA 1BXZA 4NQRA 3VVCA 2CHEA 1YE8A 5TARA 4C1NA 1HT1E 1XZHA 1OWNA 3QUCA 2RHBA 3CBGA 2O2XA 3JATB 3QELB 4FN5A 3CNHA 1P5JA 2CBXA 2R5FA 2GBLA 3GW8A 1RQLA 5AR1A 3ZNPA 3CIOA 4JLDA 4FFSA 1F2DA 2GAJA 2ZSKA 3I4FA 5AW1A 3BEDA 3BQMB 2C9ZA 4CN8A 1JDNA 3H8JA 3RKRA 1CUIA 2DM6A 3K0FB 2ZDHA 1YB6A 2GA9A 1KSJA 2NZJA 2XE6A 4JGIA 1OU4A 4KQWA 3RI3A 3EAFA 3TQCA 2I9KA 3LFUA 1ISSA 2JH8A 1N6KA 3OLYA 4IHKA 4UEQA 4CPDA 5BR4A 1D6NA 3W5AA 5DPMA 1SEPA 3UKJA 1I80A 1C1XA 1TIBA 4XD2A 4HPWA 4IW3B 4X7RA 4FGUA 3BK2A 5J2UB 3U48A 2HTEA 2YUTA 3DL4A 3GGGA 4G5QA 3O84A 1WXHA 4ZAXA 5EWLB 3LVRE 1WW2A 3S5UA 1HYQA 4AWXA 4IIGA 1WCXA 3DCYA 3QBDA 4L4ZA 2D5LA 1DXOA 1PAUA 3NU1A 1HZZC 2R00C 2X8JB 3P8ZA 1RLOA 5E6SA 3SYLA 2AL7A 4O4JA 1E9SA 1QIGA 2NWQA 4P35A 4X20A 2WK1A 1JU3A 4N8SA 3ZIDA 3SNKA 3GF4A 2ZI9A 4YJDA 4TKLA 4EKIA 3MUFA 4INPA 1H3EA 4F3NA 5E7MA 4E88A 4MB0A 3ZBQA 1M7HA 3M89A 1FMLA 2X9VA 3KTFA 1CJVC 4WDQA 4ROTA 5EQFA 4E5NA 3P7MA 4K7JA 1VLMA 2O20A 1A96A 1Y80A 1X7GA 4IVRA 3GARA 3H65A 4HWKA 4ZKEA 3C3KA 3AVTA 2QP4A 2FPUA 3RUEA 5JW6A 3ENWA 3JCZA 4J3FA 4NBRA 2C5HA 1JDJA 2IZZA 2Z3VA 3GMTA 3UKDA 3DEHA 1EFAA 3E9QA 5BV0A 1SIWA 3EBLA 1J0AA 3N2YA 2HEIA 3K0KA 5EINA 3RBZA 5B5SA 4AL4A 3MVEA 2J46A 3IAM6 3LHKA 5KNDD 4U0JA 4OQPA 5K03A 1RWVA 3N1UA 1OZAA 1C9NA 3NV7A 4URFA 3DFFA 1E9EA 1EI9A 5BR1A 1E0JA 2J4DA 2ZANA 3ISVA 3RC8A 2C20A 4Z7JA 3DV9A 1CIVA 4HXEB 1XXHB 1JE0A 4BQFA 2Z09A 1X1EA 4N3NA 9LDTA 1YBVA 5KNBH 2FX2A 4YQYA 5AO9A 1ZH4A 2FSPA 3WJ1A 2SKCA 5IF3A 1ZJYA 1QFMA 2HSGA 4IRXA 4EY3A 3JQAD 3PWZA 4RVUA 2O6HA 5ECDA 7GPBA 3NORA 2DKFA 4GX5A 3RU2A 3VKHA 3LT5A 4J0FA 2DHEA 5JTUA 1BRTA 3GEDA 3OEHA 1S2GA 1OGIA 1TFUA 3LUKA 1BXRB 1K5HA 1SUSA 3R74A 3PFCA 1XELA 2AZMA 4CI9A 4X1YB 1P2BA 5E1BA 2A84A 3O31A 4DABA 1P5ZB 1GPKA 1UP6A 2ZSBA 4O2AA 2AE1A 3ZXYA 4KO2S 4O6VA 4JLPA 3GY0A 1T8WA 2A0FA 1XMPA 3VZRA 4BEVA 4LCEA 4B2YA 3L0YA 3JQFC 4YI3A 4XVQA 4MGZR 1KRWA 1SQ6A 4W1RA 4DEXA 1PHPA 4QUKA 2NGRA 1YQGA 2ZWVA 3JQGB 2QRQA 1I6MA 1RLJA 3KPYA 5IKEA 2J5RA 2IDMA 1HSZA 2FETA 1RCUA 4QU5A 1ZWKA 4JOCA 3UJAA 4HEQA 4MRNA 4N6GA 4WLVA 1T0UA 2CZGA 4NCAA 1DOHA 2NTJA 2ZBFA 2QTVA 2W70A 3TW0A 4E2WA 1G3QA 1HRDA 1Q1ZA 3A31A 3HK2A 2FPXA 4QJ5A 4HZUA 4OD0A 5D7NA 3O9VA 1E0AA 4HBGA 3C5EA 3S2EA 3VGJA 3GCZA 1B43A 2QNIA 3M5PA 3O4VA 3CO5A 4O1IA 5AI4A 1GSAA 1WVIA 3PDUA 5F52A 5J23A 3W05A 1UC9A 1ZM7A 1T8PA 1FTGA 2RHJA 4RJTA 1JHQA 3HCRA 3I5AA 1DV1A 2HWXA 1HLGA 2EBHX 3GLRA 1RQRA 1XROA 4P31A 4KWCA 4MKRA 2XWJI 2CXHA 3ICPA 5KDLA 2FLVA 1KOFA 3LGXA 3A4YA 2XUIA 4MVJG 2OXIA 2GERA 4PN7A 2HV9A 2DFKB 1JG2A 2LDBA 2YJ4A 2P2SA 2C8VA 3FCAA 4H6WA 4UFOA 2UYHA 3PC7A 3O91A 4KGXA 5JRJA 2XNJA 4MVYA 1M8GA 4GRDA 5TDHA 3BKXA 4MS4B 2BYTA 3ILSA 3N2KA 3QVGB 4EFLA 2F1RA 3QVVA 1V3TA 3DR5A 4ERNA 3AP2A 4UBMA 4B0OA 1NF9A 4OSEA 4CMCA 3R0ZA 3FHLA 1WF6A 2PLAA 4TM7A 1PJTA 3CX4A 3NUQA 4PG5A 5EPEA 4BX3A 3LXUX 1U2DC 4CF3A 1K89A 4JDUA 4OB6A 4UOQA 2A9PA 3EUFA 4HFMA 2A4KA 2QYOA 3B8EA 3PJEA 4RSRA 2WP8J 2AFHB 4HVCA 3SM9A 1KAOA 3KVOA 3HKBB 4QSHA 2OM2A 3B7PA 3IOYA 5I7VA 2ZEJA 1IY8A 1CDZA 2TMGA 3WNZA 1OWPA 2XE4A 4GPTA 1SOVA 5CT6A 1S1MA 1EX7A 3IVXA 4ZZIA 5F12A 4MP6A 3RBXA 2BGLA 2R1VB 2CVQA 2Z4TA 3VMMA 3WTBA 3ZWWA 2Q5IA 3RYHB 1FA9A 1Z6AA 1C4WA 3ZY2A 3OE1A 3F8TA 3OZVA 4MEBA 4K1XA 2XTNA 2W6PA 4P6VF 2R8OA 3DO8A 4BLQA 3I9OA 1KOGA 4R1LA 2R86A 1OFUA 2GB4A 2XMPA 3DXZA 3E84A 3NP9A 3DE5X 5FEMA 4U39A 4QQKA 3ZWYA 3EF1A 4HNVA 3ND7A 4QZVA 3PVCA 1QG2A 3MD0A 2EJCA 4A0FA 4CQMD 1Z36A 2GS9A 2GAIA 2W6ID 3MPUA 1IY1A 2C2ZA 4L8WB 1IU9A 4M0EA 4RY2A 1QH1A 3Q8MA 1NV9A 3MCVA 4ML3A 3T3EA 3LT0A 4LNAA 5M34A 1QCZA 2A5DA 4L95C 1JTEA 3WMFA 1CZNA 3WRXC 1Z88A 2J67A 2ENUA 3GFVA 5C1DA 2QTAA 3MHTA 3TLEA 3SM3A 4B3GA 1FDRA 1TMKA 3O93A 1LU9A 1C3VA 3HEMA 5CGZA 4MO9A 4ZU1X 2X0DA 1V6SA 1SZPA 4E5PA 5EJ7A 4KO8A 2HA6A 2VN8A 2X40A 3GBPA 4KPEC 2WRZA 2UV8A 2O3QA 4BBJA 4ETIA 1EQAA 3R6TA 2CV1A 1FJ2A 4BNWA 2MSWA 2BFCB 3OQ6A 4RE6A 3EZYA 4HB2A 4MR7A 4QHSA 2I2DA 3SEAA 4MTLA 4H7IA 3LLCA 3WGJA 3EWAA 4BEWA 3ZCPA 2Q8QA 3LGSA 3P52A 4CM4A 2I3ZA 4PZCA 2QN9A 1PWHA 1A8PA 4U7TB 4X3CA 1R4ZA 1T9GR 4PPFA 3R0JA 1P0MA 4GI2A 4WUTA 3U0VA 2GN1A 2R9VA 5BN5A 1IULA 1ANKA 3DVLA 4P7FA 4R8VA 2FOLA 2GSDA 1XK6A 3A7DA 3BRSA 1KNXA 5KTPA 5D51S 5E6UA 1V8BA 2YVLA 4IDOA 3PNQA 4YBRA 4MIEA 1W96A 3BAFA 2IXGA 3KSZO 1QFZA 1DIRA 5CB8A 4UPVA 3V9PA 4LX0A 5EJ4A 4CF6A 1W75A 3GWGA 2BEVA 4JLAA 1XEWY 4O4LA 5ALXA 3ZI4A 4CT5A 1M2OB 1T9HA 1H6BA 2PJDA 3QLUC 1RVV1 4JI4B 1E6KA 1W29A 1PLKA 3JQAB 3LYLA 4R1MA 2AZDA 5AKJA 5AYVA 3NONA 4AO8A 4A3SA 4RCYA 4R40A 1GL6A 4Q1FA 2JKVA 3K0SA 4KXLA 2CVHA 3RVMA 3T0GA 4ZYXA 4UMEA 4PAOA 1Z2NX 2HHJA 4S05A 2EC5A 3FY4A 2E48A 3H3XA 1KEKA 2JIMA 2YUIA 3EDMA 3FUWA 2O2IA 5LQDA 1AK2A 3HVUA 4BJ3A 5KYNA 3EY9A 4FZ3A 4HX9A 1GA1A 2RHOA 1GP2A 3OIFA 2QG4A 1KPGA 2JHAA 4M49A 4PO9A 4ZT3A 3TO5A 2ZJZA 1L5HA 3RV3A 2YC4C 4UUBA 4ER0A 3AEUA 1Y3FE 4KQFA 3RRYA 4DLYA 3DC7A 1ZUHA 4AS3A 4FM9A 3C7KA 2WMDA 1O5OA 3VR4D 2GWRA 4M0PA 2H1RA 1LVUA 4KR3A 3G6KA 1P4GA 3WWCA 5KTOA 1NASA 4MWZA 2YR0A 4PRYA 2GBFA 3N2ZB 3OLVA 5CBKA 3GLKA 4IEFB 3G1WA 4GBED 4OVKA 4DRZA 3CKYA 3PENA 3SLKA 2VQFB 3PGA1 3NYRA 2DFVA 4YK7A 3RTGA 1NC1A 1L4FA 1SBHA 1U0JA 1WXGA 2O0KA 3P5BA 2D8AA 4JHXA 1P2UA 3VSBA 1DKRA 3KJNA 3IE0A 3L02A 2Q5OA 2C4HA 4OKNA 4D8XA 4EDFA 1J0EA 1G5FA 2ISSD 3M1YA 2GPBA 1VSQA 4EA6A 1J2EA 2EAUA 2JATA 3U4AA 4OI1A 1ENZA 1OV4A 5CPBA 3GBSA 4LE0A 1I5RA 4EX6A 3KE8A 1QJCA 4WBXC 2C4MA 3SJUA 1NW5A 4PSCA 1T2NA 1JJIA 4LF9B 1Z8FA 1SURA 3CUYA 4BO3A 5HKBA 3OE7D 3MWJA 4FMCB 2QMEA 4X20B 2D0DA 2WSSA 1AU9A 2WU4A 3V7NA 2A5GA 2ONCA 2X0IA 1V7PC 3MTBA 4GD3Q 1M8KA 4BHTA 3U3KA 2HCTA 4EIWA 3WLEA 4PSUA 5LQAA 3VTFA 4H7JA 1AHNA 2C1ZA 2R6ZA 4ZIRA 3IULA 1QU2A 1MAVA 1Z4NA 3FJ1A 2P79A 3QXJA 1E3DA 1Q83A 4EVIA 4Q4CA 2QROA 1DXHA 3TLJA 4RU1A 2M6KA 4BLPA 1WY5A 2D3TA 5IDYA 1C1XB 2C2XA 3KM0A 4AMYA 1GTJ1 1EZ1A 1WZCA 1KFJB 1P2GA 4WJKB 5F64A 2IT1A 3UW1A 1G8HA 3TSYA 4CKZA 1QQBA 3V5NA 1F1BA 1RYMA 4RLQA 3R1IA 4TYYA 2X2PA 3DQPA 5GJCA 4LY9A 5DSXA 2VVTA 2H4FA 4R81A 4YMGA 4AZ0A 3UUFA 5EIXA 4BNUA 1HSOA 1II8A 4ODIA 5JZOA 1OC4A 2ETXA 1WUJS 1VPVA 2Z8ZA 1DEOA 2ZB4A 1PR6A 2XCRB 2O48X 4MI1A 1AF7A 4J16C 1R0YA 1KEUA 1V2GA 4MW4A 4RCZA 5CXUA 2EFHB 4ND3A 5C4MA 1LNSA 3K9FC 1V0JA 3WMRA 3PLAE 1KXZA 4B43A 1O95C 3GGPA 1V9CA 5C7YA 1ZL2A 1NUQA 3EDYA 3W4JA 1NW3A 3U4HA 3V00A 3PL1A 6Q21A 2WJAA 4QU0A 2I4RA 4FYJA 2WSBA 1HLDA 2JJYA 2W37A 2DH5A 2CLFB 2ZYHA 3IKMB 1BWPA 1TVKB 5ALVA 5J2TB 1OH6A 3FDJA 3CEJA 4X5OA 2O8CA 1DAKA 3T7EA 3LZCA 4JI0B 1M2NA 4C6RA 1A95A 5CLIA 3BOSA 1JKIA 3BULA 3JAKB 2FR1A 2VJCA 4KH1A 1HUQA 4TV8B 2NU8A 1QF6A 1CQIB 1Y7HA 5J47A 4JITA 2A0UA 3W2HA 3WZLA 4YUZA 3DL2A 1G8PA 3H2IA 2IUFA 1AOXA 1WWKA 1G7RA 4MB6A 4N7MA 4Q9AA 5LA6A 7REQA 5BMVA 2QW0X 1C81A 1VHTA 1LBIA 1OILA 3ZXIA 3THYA 2PS1A 1GG8A 4DREA 3VKVA 3U13A 4A15A 2I4LA 4CQLA 1MJNA 3JD3A 4PINA 4KEAA 4L85A 1B0PA 1QORA 3E3MA 2B8TA 2CUKA 4M1KA 1ZH8A 1ENPA 4DJEC 4J3JA 1A9TA 1ZGAA 2WSSD 1ZD3A 2QX4A 4BLRA 3FHCB 3IEKA 1D6JA 1MABB 1T5DX 2VSOA 4CCAA 5L3VA 1R0ZA 2F1KA 2JJ2A 3HACA 2LCFA 2OBLA 3UWSA 3KPUA 2Y1FA 1QQ7A 2XIQA 1XDWA 1IQUA 1JNXX 2AMLA 3HKDA 1NG1A 3H84A 4I36A 4IJQA 4RY9A 3VR6D 3I1YA 3JR3A 2VAXA 1L7NA 1UOEA 3WQRA 7MHTA 1CJBA 5E7IA 3WGLA 1BH6A 1M1UA 1UJ2A 1KF0A 4Y3UA 4B3BA 1G2QA 5TQ2A 4BV2A 2NMVA 1BMFD 1NE7A 3T4EA 4CIVA 1NUPA 3BXHA 5CX4A 1GN8A 3TUJC 3BSWA 4BO5A 4DZRA 1WDWB 1RYDA 4N5HX 4OHBA 5BO5A 5E3HA 3OD5A 2H7XA 2Q0QA 1H05A 1DO0A 4EG6A 4FUTA 4JX9A 1XFAA 1PS0A 521PA 2RGYA 1Y4AE 3VYSB 1QHXA 4LYYA 4DWOA 5JQGF 2C3UA 3QUSA 1XAGA 1LXCA 3MWGA 3VU9B 1CE8A 3TZQA 3G8BA 1R66A 4LX8A 5HMMA 3KUKA 1J4AA 3TSAA 5GONF 5BR8B 2OD2A 2B7BA 1QX3A 2DLDA 3HUUA 2ZE6A 3V6MA 3W3AD 4DARA 5FLXA 2C9BA 1P7ZA 3WRVA 1QX4A 2Z57A 3TL6A 1ECPA 1EGQA 2YH2A 1VL6A 2R79A 2YBDA 3F9RA 1WRBA 1I3CA 5A5DA 1NYTA 1IATA 4QDKA 4C0QC 4B4OA 3FZGA 4KO4S 2BHLA 4DEYA 3CLTC 3N0WA 5A4DA 5AJWA 3M1AA 1GXSA 3MMZA 3OESA 2NUAB 5BMVB 5GAJA 1ZMXA 3HXTA 4UMVA 4ZV7A 3IVRA 1V11B 3G8AA 4HR7A 1L4YA 2VXYA 3QLJA 2A3NA 1B93A 4H0FA 5KKAA 2VP3A 4DAOA 4JL5A 3SFTA 3GD7A 3A4IA 3VYWA 2MSNA 4D25A 4H15A 5AOCA 1N5DA 3GIDA 2P8SA 4NEGA 4RZIA 3HYSA 5TS2A 2XQJA 2ZE5A 1N77A 2AH5A 1A8QA 4TLLB 2J6HA 1TVKA 1JVBA 1WXFA 2OHGA 4I50A 4N5MA 2CHFA 4UEJA 4M8SA 3OKPA 3EGIA 1VPEA 2YJGA 4M1QA 3ITNA 4J1NA 1TYBE 1J33A 2QYTA 1MR3F 2XUAA 4XIIA 1IBMB 1CUHA 5LNK6 3TZBA 4D6YA 4F4HA 2ZUSA 4YLYA 5C9ZA 4QX6A 4MWOA 2ZAOA 2CNDA 4F97A 3GGDA 3GROA 3CCCA 3PFIA 3QKUA 1H2AS 4YPVA 1JUDA 2AUMA 2K2WA 1R5JA 4FJ1A 4K3UA 4WE3A 3NEAA 3PDIA 5EIAA 3RIHA 3HXPA 4GMKA 3KOUA 5HFNA 3EQ9A 2QRVB 3ADBA 1N8TA 2A0WA 2I6FA 2W2LD 4BFYA 1YZKA 4W7SA 3U9LA 2QAIA 2VHZA 3OHPA 3O03A 4L8LA 4XGRA 2JAHA 3EWSA 2AG8A 1QH8B 1SHLA 2QE7A 1Z2EA 4KE7A 1SC9A 1Y33E 2Q9UA 3FMVA 4MLPA 2WMOB 4ZOCA 5SYMA 1KTIA 4KUHA 1W9HA 4CZ2A 5K0SA 4KODA 5M5BA 3C6ZA 2VLBA 2UKDA 1T8RA 2EQ5A 4X8OA 1QP7A 3JQ9C 3SHOA 1EVEA 1UEJA 2IIBA 4Z9FA 1XA0A 3II6X 4LHWA 4X93A 3ABQB 3LY8A 4ZIRB 2KHZA 5F2NA 5IRCD 2R65A 2ZR0A 3WL7A 5AI5A 3IIKA 1NOJA 4FZRA 1S3FA 5DCUA 3BGDA 4V03A 5AVYA 5KOYA 1DRJA 1A1VA 4BVKA 2IH4A 2A59A 2PBFA 2UYYA 4G36A 2Q2VA 4QXRA 4V3BA 2OC4A 1XL0A 4TQAA 3OPYA 2DTXA 2GYVA 3N6XA 1JFFB 1R5OA 1VMAA 5KVQA 1U3UA 3PR3A 1J20A 2HN9A 3WRYC 5JY6A 3NWPA 4A4DA 3F1LA 4GLOA 1YR2A 2BCGY 4IQFA 3SSAA 3WLNA 1WPGA 4HZGA 2W6OA 5IZCC 1XYYA 2X14A 4AUMA 5C8DA 2WABA 1UKAA 2II6A 4CLDA 3WBKA 2HRCA 1KEEB 3MJSA 3OZAA 4G97A 4MV0A 3EGWA 5H82A 3CLKA 2QZSA 1BGXT 2TMYA 3HJBA 3OO0A 2BISA 4N5IX 4Z9AA 4KQJA 5A6VA 2GKGA 2W8BB 3O7WA 4Y6OA 1SC6A 2G7ZA 3BZWA 4MYSA 1RM4A 3UZUA 2IBMA 1EFPA 1HE8B 4JMLA 3DVRX 4BMSA 4CRWB 4EPVA 2ICAA 4YRLA 3NHUA 4BQRA 2OBNA 4IDDA 1PNVA 1SXJA 5EERA 2UZ3A 4JLNA 1KFCB 3R7FA 1AKRA 2HBRA 5B36A 4LQLA 1E9CA 4BQNA 2VNHA 2P9TA 2YW9A 1YGYA 2NXNA 4Q7JB 3UJ8A 3URKA 3ZUPA 3I5YA 1A9OA 2J8ZA 1FNBA 1IBSA 5AHWA 4MVJH 4J3NA 2GXAA 2ZWIA 2QTVB 4AECA 5IJ0A 3TH5A 4LZLA 2R00A 2Y3IA 5AJZA 5B58C 3B6IA 3GCDA 3MTDA 2SNIE 3DD5A 4EY4A 2OCAA 3GJQA 2OB1A 1KJJA 1RM5A 1Q0ZA 2RH9B 3P2EA 4FCCA 3HCWA 4FGSA 4HLDA 3PXGA 3HS3A 3CCBA 4GGOA 2QTFA 5CB4F 2GTHA 1UEIA 1NURA 3RRBA 2HUPA 2M6LA 3B70A 3MK31 3TRDA 1X70A 1Z83A 4H0NA 2H48A 2RFLA 2BFWA 2ATVA 4IG4A 2DWPA 3D43A 1HK7A 3Q7PA 1QO7A 1WABA 2FN7A 2DY1A 4F9GA 1FTSA 4RD3A 5LD2C 1Q3KA 1N6RA 2DF8A 4AUEA 4EELA 1NHGA 5DNDA 2J33A 1DC6A 4KHZA 4D98A 2EP5A 1AB6A 1HOXA 4EB6A 5LOVF 2H65A 2XKJE 3H97A 4BIMA 2X0JA 4N9WA 1NKTA 4HJXA 4RZ2A 4U2GA 2REQB 2FHPA 2Q7DA 3IUNA 4PX9A 3VYRB 3HJHA 3VOAA 4E09A 4YUAA 4R8SA 4XM0A 2HM7A 4G3XA 3GT7A 3EVNA 1XZMA 2D13A 3F8SA 3NT2A 3PNSA 1DTEA 1GTSA 4S2UA 2G40A 2ZUWA 1P2SA 3LOUA 5EJ9A 4D82A 4G0PA 3TIIA 4QFCA 1AMNA 1XTQA 4XW2A 1DUVG 2YRXA 3ZD6A 3RFTA 4CKWB 5KYVA 3UJ3X 4L51A 2G7MC 1CETA 1FQJA 1HGXA 5ES3A 3W5VA 2P4UA 3CRZA 4D6PA 4EY5A 5AW6A 1Q11A 1ZVQA 2NN3C 4MYHA 3ET4A 3EQ7A 4O63O 2QTZA 4ZAVA 4XFDA 4ZVPA 2XGOA 4OHKA 1N3IA 4CGZA 4K26A 1XVTA 4IMIB 4W6ZA 4QLBA 1GPBA 4FD3A 1JKJB 1E1CB 2XYQA 2IV7A 4UHEA 4BKPA 5A9SB 1Q1AA 2D5BA 2NUBA 4IHAA 4LKOA 1QB8A 4C89A 1FDVA 3DOCA 3WGNA 5I47A 1D1QA 2ODWA 1VL2A 2DPYA 1XU4A 1X8JA 3CY6A 1J5EB 4F38A 3JD4A 3BMQA 2TSYB 5ALKA 3Q7IA 1Z13A 1SBCA 1QH1B 2NACA 3JYNA 1QDLB 3OF5A 4IH1A 4CMHA 421PA 3FLMA 3WB0A 1J49A 2I87A 4E5MA 1Y7PA 1G17A 3BF7A 5JZVA 2P0EA 3EQZA 2VOJA 1UDBA 1FNSA 3OPVA 2EW1A 5H59A 3W2GA 3OY2A 4N6NA 3RJMA 4JCCA 2PPLA 3CX8A 4J90A 4IDEA 1F0PA 3HR7A 4R41A 2C9OA 3N5KA 2Z9DA 4OTZA 4KR9A 5IN4A 3O0DA 4UBJA 4XPZA 4IYJA 3BRCA 4LMPA 3T4UA 5JQGB 1DL5A 2E4AA 1JR3E 5J2UA 1BVYF 1KYZA 3ANMA 3KDAA 5JI2E 1H8ED 3QBVA 1N1MA 5HJ2A 1GZHB 3OZRA 3HCBA 4Q05A 5DCLA 1JIXA 1G2PA 1U2GC 3C5WP 4QC2A 4S1NA 5FO0A 3IB6A 1UMKA 1OMOA 3GEBA 4QPCA 5A0VA 2CFTA 3CVVA 3TXAA 2D74A 4B87A 2AWOA 2ZYUX 2VOEA 3P2OA 4ZOEA 1KYQA 3FPBA 1Y6GA 4CM8B 3A1TA 1LPNA 3MMSA 2C0QA 2QBYB 3HB1A 1SRQA 4R4JA 2MSCB 2AFHA 1Q0RA 1C0LA 1JF8A 3G6WA 1OTYA 3KLPX 4RV4A 3TKLA 1K68A 3H4MA 1WMEA 1O6ZA 1PYGA 3IAM1 2IXTA 2UYQA 4XFKA 1OTXA 4LDQA 5KVAA 5IDQA 4GL2A 2YIVX 3D2AA 3DDNA 3QEMB 3QEAZ 3JR7A 2YCBA 2AJTA 4KN9S 2ACVA 3H11A 1B23P 2HQ1A 3DKRA 3DUWA 3SSMA 2VK8A 4BFWA 1GUYA 3FN4A 1J2JA 5HKAA 1K5PA 3PRHA 1XZBA 4C4XA 1A9SA 3ENVA 4JKYA 4L8FA 3K73O 4QODA 5ENDA 3WX0A 4X66B 1Z0AA 3E05A 4F96A 4ZI7F 5H9WA 1MNQA 4G5YA 3TSWA 4F9FA 2ZPUA 1Z0JA 4M88A 3S28A 3RWBA 4DNXA 3GP3A 1S2OA 1QGDA 2H63A 2HTFA 2O7NA 2VAWA 4W9NA 4FFDA 3UA3A 4B35A 1TRHA 4QPZA 4CL0A 3ACDA 3MJEA 4LOIA 3UT0A 1OAAA 3RG8A 3WI7A 3O8QB 5DX0A 1XP8A 2OCLA 1GXSB 4L16A 1LVHA 1QH9A 2JH3A 4RVGA 4ESHA 1V39A 5HOEA 1M1YA 2R8XA 3V1NA 1U2DA 4K8OA 3Q0EA 5JZSA 3SY8A 3SLGA 4E1VA 4HADA 3SZLA 3VAZA 5ALUA 1S3IA 5HCIA 1SAYA 1TD1A 1ZMOA 4EGCB 2R62A 3BE4A 1JA0A 3O9MA 4WK4B 3L7LA 2OCPA 1DAHA 1P7WA 4YGYA 2V5AA 4YRKA 3TPCA 1F2VA 2VNAA 1TECE 3L6CA 3PKZA 4H7KA 3PHHA 2QN8A 1A98A 2V1XA 3LKDA 4JENA 4OBXA 4R8RA 2X0RA 2GRJA 3NYIA 1BE1A 4LJ5A 2L19A 4CG1A 3AY7A 2GN2A 4DSNA 3FOAA 3OWXA 1CHDA 4NYIR 2BGGA 2ZATA 4YDSA 5EJGA 2Z30A 3RUDA 1C50A 2HUNA 1QCDA 3FYTA 4HTFA 2KWIA 2O0MA 1W4AA 2OY0A 5EHXA 1YQWA 3DZ8A 2X8WA 5AIBA 2MMCA 4PLVA 2B4KA 1MW8X 3NPAA 3GFGA 3AIKA 2B69A 4UE2A 4X1IA 2C2HA 4PIPA 3VNQA 1Y1PA 2B99A 2GD2A 4CGYA 1W76A 5AKZA 2Q3HA 2VL7A 2CE7A 3EIEA 1C2TA 4W7IA 4WXMA 3SS7X 4QGSA 1WX1A 2I1QA 3TBFA 1CJCA 1XD9A 2J0VA 2LP4Y 2PFSA 3LUDA 4G1EB 3H1TA 4BNVA 3ML1A 3BZUA 3O73A 3LPMA 1V7ZA 4RLSA 5DI3B 4JUIA 1LW6E 3JZFA 1D4AA 4PC1A 1C7ZA 3K4QA 1C29B 3QVKA 3F3YA 5JCXA 2DAPA 4F46A 1JG4A 2YQ4A 1UFKA 1IL0A 3DQZA 3CKKA 3M6LA 4RHTA 4RO0A 2J45A 5KYWB 3ETHA 4OLBA 1PWZA 4PNHA 3GU3A 2XXAA 2BCEA 5DT2A 2IGBA 4RPJA 3SG0A 1L4BA 3HYRA 1NRWA 3M1LA 3TNDA 2FEOA 1QYRA 2UDPA 1W2GA 2XUQA 4YRIA 4DPMA 1P72A 2VF5X 1TAHA 1OI2A 1NQTA 2O4CA 4L3WA 2MINB 4YQZA 3E5NA 4WA8A 3S2IA 4C01A 2P41A 2GEFA 1U1DA 1N3YA 1W25A 3IBTA 4JGGA 2QVLA 3P9IA 4IZOA 3GLTA 2CYAA 5L51A 3KB6A 3QU7A 1E8NA 1PTKA 4L5BA 1UM9B 3N3AC 1LLDA 2VJMB 3KOYA 1RXIA 5HQTA 3FR7A 3KQTA 4LTMA 1XCGB 1E69A 1USKA 1XEFA 3GJSA 3NC0C 4NBKA 1XRJA 3W4KA 2ODEA 2NP6A 4J2HA 1K98A 1N5RA 1RAIA 2GUGA 2QYSA 2YXDA 3I4LA 2BR3A 2Q9AA 2QRMA 2PX5A 2WD7B 2HL6A 1W4BA 3L9WA 2NZYA 3C3CA 4KQ2A 4OYLA 2Q1UA 2CYBA 2ZJOA 2NPOA 2YXBA 3BGSA 2QMQA 3CHYA 3DAYA 3GX1A 3ORSA 4JJ7A 2VCHA 4MVJD 1MF7A 3ZKAA 4CLRA 2WUVA 4MRRA 4GDMA 4FPXA 5BQOA 3H1FA 5GPBA 4L08A 3ROFA 2QIOA 3U7JA 4DIUA 4M87A 4Y8VA 4H1WA 2RAFA 4CIDA 2GETA 2IWHA 2FZWA 2HWKA 9ABPA 5WRFA 5ERXA 3P2MA 2V7UA 4C29A 2AXNA 3A4LA 4MDEA 2WTAA 5KC8A 2CLEB 3RAEC 1TQ6A 4UMDA 1H6DA 1EKXA 4K3VA 4CM7A 3RM3A 1J8YF 1GCAA 1X9HA 2NM0A 3AR2A 5TC4A 1F51E 1Z7YA 4IIVA 3NC1C 4F9EA 1V1JA 4NOKA 4FXOA 1R4NB 3VR2D 5JDCA 2F3UA 3I5XA 2HU5A 2RJOA 4PQGA 3WTCA 1PZXA 4BC1A 2BIFA 3Q10A 2YNMD 3MC1A 3TLMA 1ZHFA 1GNVA 4HATA 1VRCA 4M9CA 4DC9A 4E07A 3ZD9A 1FLVA 2ZTUA 3LFHA 4KIUA 1J21A 2J85A 4P3PA 5FO1A 4D9BA 5K7SA 5I7SA 1E98A 2UZIR 3GRAA 1NXVA 3JAWA 4Z8YA 2OBBA 5IDVA 1N3LA 2ZXFA 4HQ6A 5KWJA 1GILA 2XMCA 3RGGA 1OFUX 2VTDA 3ADKA 1CG6A 3C7CB 3LRPA 1ZGCA 4MWDA 4MR9A 4QVKA 1IXYA 2IS4A 4G0XA 1UKBA 3EH1A 3OQVA 3HMKA 1Z0ZA 5LYJF 1AXGA 2EQAA 4YRFA 2FKNA 2WF6A 1XEXB 1LNZA 1P73A 2XRMA 1RYZA 2HDOA 2EGUA 5FQOA 3RYCA 2Q6KA 3D4BA 1BMTA 1TTQB 2PMCA 4I3HA 5MGBA 2XJ4A 1XTRA 3ZWXA 5GOZA 4JJFA 1EG7A 1Z5PA 5AJVB 1KE1A 4ARSA 5K4AA 2FG7C 4A5OA 5ERYA 2QY9A 3OX3A 5IG2A 1TEXA 3FJOA 5KHLB 2BI7A 4IGEA 1QRSA 4YRTA 2C1EA 4Q21A 2HT6A 4HB3A 4A0QA 3FMFA 4E21A 2B21A 4KMMA 4AFNA 3T1OA 2HHCA 4I9FA 4L5CA 8ADHA 5LOVB 2O54A 4PBTA 1Y9ZA 3K2EA 4A73A 1NAIA 1X1DA 1U9JA 1CERA 2XYRA 2FQYA 3LXXA 1Z62A 4JNKA 3RSFA 1XB2A 3OVMA 2MYTA 4MVJE 1S96A 4YB8A 4GP7A 2R3SA 4XIGS 4DMFA 1CUGA 1VBMA 2YW2A 3ZY5A 4P93A 3Q3CA 1TCCA 4YMLA 2AN3A 4FCTA 3SP1A 1UPTA 4QM7A 1N6OA 1QVRA 2K7FA 2BPOA 1VZ2A 1G291 2BDUA 2I4NA 3I9KA 4G9BA 5FWNA 3Q87B 1ODLA 5JNVA 2UXCB 3PEFA 1RJ9B 2B1QA 4O4HB 4BRSA 2FMTA 2FCRA 3GFSA 1YV9A 1SBZA 4V0LA 1Q7EA 2OFPA 4QXPA 2HD4A 2M6RA 4Y0NA 5L8VA 2AD5A 3CH6A 2OZKA 2PHZA 3EHEA 3Q40A 5C31A 1UXJA 1U7PA 2BEWA 4Z9BA 5AESA 5EEGA 2NTYC 3OTQA 1M76A 3HNOA 4Q4HA 3IQIX 5FBHA 4EKEA 4JOQA 4JYBA 1MX3A 3AG5A 3EAGA 3FWYA 4C30A 4RGBA 1RC8A 2PQ0A 2XY4A 4LKRA 3RKUA 2RC6A 1ZKDA 2ID4A 1YJXA 2EOAA 4L7QA 1UZMA 1CCWA 1G42A 1YE3A 1JLLA 2R6FA 1CZLA 1AZWA 1YCGA 3B6ZA 3ZQ6A 4BTVA 2HLNA 1P0IA 4R9RA 1RPZA 1JG7A 4JI5B 1E7MA 1JP7A 2GPYA 1DKQA 4NDZA 1L8AA 3F4BA 4E03A 1G38A 1CUVA 5EY5B 1U0NA 5A05A 2BONA 1ZCAA 4Z3KA 3BXOA 1UAGA 1IHPA 4PNZA 2J3QA 2EEZA 3GD5A 5IBCA 1Z5UA 5IT9A 3LQRA 1WP4A 3ZY6A 4FQ8A 5JTTA 2KX7A 3L0ZA 3MINB 4YYZA 2P1RA 1QF9A 3N8HA 4F45A 1QHSA 2N1MA 1UMCB 3LA6A 1DX4A 4WNIA 3KYCA 4F5ZA 2XDWA 3H18A 3WNBA 2PLWA 3UXHA 3OQIB 3ID6C 1PI3A 3I45A 4MMZB 4YUYA 4QLAA 5AJHA 1QGYA 3C3XA 4HGYA 4Y6LA 5DI3A 3ESYA 3GUCA 2C97A 3IMGA 1CNMA 1RS0A 3FBGA 2GZDA 3VAAA 5JC8A 1NVVR 4NYJQ 4CXMA 1KI7A 3VNVA 3N76A 1HDOA 3AQIA 1V16B 1CDDA 2QRZA 3TD6A 3K6KA 2UU9B 4HDRB 1T0HB 3ANXA 4LY3A 3H1AA 1CUSA 2FZCA 2BR4A 2PZKA 3F49S 1MRSA 4Q93A 1OR8A 3JQEA 5DLYA 3WY9A 3IUMA 1N0HA 1LDMA 2YOHA 1T1EA 1G16A 3NDPA 4K2AA 3TW4A 3CB2A 4G65A 4KE6A 3IUYA 3M3DA 2BFDB 1A97A 5JSHA 2B61A 4DCSA 2KW5A 2VXCA 3G9XA 2PGXA 4B2IA 5CBPA 2G9ZA 2IU6A 1AKTA 5KYUB 1S01A 1OXXK 4GC9A 3A8TA 3U3ZA 2CNLA 4KH0A 4BE9A 4O5OA 4EPRA 4KCGA 1F2UB 2ID7A 3B3QA 3QVMA 1H4SA 3LFTA 4EPYA 3WHLA 3A6PC 1F6BA 1L9KA 2ZJ3A 2ZPTX 1BHO1 3GVXA 1ZR2A 2BZGA 2V55B 1JDBC 1J9ZA 2DUWA 2VWGA 4R9SA 4K9MA 1ZK4A 1HM5A 4FZJA 4MRSA 4PIMA 3V34A 2XYPA 2H9IA 3BFPA 3EASA 1J99A 4PLYA 1IVYA 1RXCA 2JANA 1C0IA 2NYAA 1AQUA 3AVOA 3OM0A 4L4YA 2WUDA 3GV0A 1D5WA 1PW5A 1Z3IX 3MCWA 2JRCA 3OJCA 5HOQA 1ZVVA 4F4UA 2FOIA 3X2EA 4G2TA 5DGIA 5JSZB 3R76A 4PLPA 2ZRAA 1CS4C 1YR9A 4L9SA 3WYCA 4C7KA 1MOPA 1RZVA 2VQDA 1BHSA 3AESA 2QRUA 1NDQA 2GVNA 3MZ0A 2YNMA 4BFXA 2V1UA 3AUKA 3HUFA 4I19A 3K16A 3KELA 5A5GA 1EIWA 3CRQA 2X77A 3KPJA 4MK4A 3QWHA 4QIHA 5THKA 1HDGO 1TQ4A 1RD4A 3CH5A 4KMRA 4FT2A 3RABA 1FUIA 3WWPA 3HCFA 1XJ0A 2JLQA 3JYLA 4I9UA 2Q3MA 5TVGA 1EX1A 6NULA 4D9JA 3SS8A 1CLUA 1Q0QA 1TA9A 4YRGA 1U8TA 2PUFA 2AYZA 1U6KA 1YDEA 4BY9E 2WPNA 4C4PA 1ZK3A 1DIBA 1KI3A 2ORED 2V0GA 2BGKA 4KL8S 3AEKA 5AQEA 5HZKA 4QJIA 2WFZA 4ZYYA 5AUOB 3PLNA 3PA8A 3ONWA 2DB3A 3CN7A 4PX2A 4ADSG 3U4QB 5AW3A 5IABA 4BLTA 1B7GO 1WHSA 4AW9A 1RXWA 5F76A 3NWOA 3IEPA 3SBEA 3EQ2A 3EGCA 3AHDA 1U0FA 1BGWA 2GHRA 1ZSNA 3V1MA 3PF9A 1TU0A 3QPAA 1FNCA 4DV5B 4GM4A 2J5KA 2PCLA 2JLYA 1HZJA 1PJQA 2JGDA 3OLZA 1JEAA 3P26A 1ZLYA 5FQNA 2WWVD 5FBWB 3X2FA 2ZQYA 3GH3A 5BNFA 1HE5A 2POQX 1SM4A 3CLRD 3KHTA 5HCNA 1T26A 1MO6A 2A9FA 3GZ4A 3JQ7A 1V9SA 2Q0HA 2E3JA 1QTIA 1RRGA 2JLBA 4LGVA 1X0VA 4KN6A 1M34A 1QE3A 3GOHA 3SF8A 4F5YA 4EBBA 2HSJA 4Q3LA 2K4MA 4RD2A 3V7UA 2YN2A 1ZW1A 1E2EA 2C8LA 5DXAA 1R9MA 2QX7A 3OFNA 4YX9A 4XWWA 3ZE9A 4KITB 4H18A 2ZJ0A 3OZTA 4XSGA 4LJ8A 4RNCA 1RSZA 1GRVA 2AFIB 1UFRA 3IJEB 5DP1A 5F1YA 1HORA 4Q12A 3TDMA 1AZLA 5JMWA 3ZEAA 2OFWA 3W34A 2DH6A 2HDHA 3L40A 2VZ9A 2WWYA 1FDSA 2FX5A 4TTVA 5CAEA 3M2TA 2ZB3A 3R7BA 2P11A 4WBNA 3ZBUA 1QO0A 2Q1YA 1RIFA 4RESA 10MHA 1WLSA 3WXBA 2P6RA 2PGDA 3OSUA 2OM6A 4M1YA 1D2NA 4OU4A 3UAWA 1MDFA 3QG5A 3ZW7A 5LUBA 2QI9C 2QTTA 4R0VA 3P71T 4QVIA 1K4MA 3BD6A 3K5WA 1R18A 2RBGA 3WO1A 4NMMA 2FI1A 1P0PA 3E22A 4IJWA 3L05A 4C5BA 4CF4A 2CSUA 3VYTB 3MWDA 2GLUA 3VR5D 5H80A 3SXUA 2ZBVA 3MTGA 1FEZA 2Q5HA 3N6RA 4PONA 3UWKA 2EL7A 2DBYA 4KO3S 3FKSD 4P5PA 1RDFA 4WY5A 5JYDA 4EVSA 2FEKA 4E51A 2FMUA 4YP7A 1GARA 2O57A 4PLZA 4WGGA 4I99A 2IOHA 3IPAA 1SQGA 2WJHA 5KCMA 5KIAA 1B8PA 5KNBA 3IEXA 4P54A 4UHKA 4NZYA 5TV2A 5DSZA 3OZFA 3RVDA 4DB4A 1SWWA 1NXQA 2CBZA 2IITA 1CZRA 1REQB 1JLLB 2QJWA 3WL8A 3V6LA 3F0TA 4M83A 1WU7A 5A3SA 5KBYA 1DX6A 3DVAB 4NATA 4UTVA 3OP1A 1NJ2A 4ZQHA 4DA8A 1SUEA 2C78A 3K0EA 1CX9B 1L7AA 1OXKB 3REQA 4A8PA 1I24A 1LV7A 3EVCA 5J9FA 3U4MA 1KGDA 1CK4A 5C18A 2Q3EA 4G9GA 4XUCA 1HDRA 4A0HA 3OOEA 1VCIA 4KIFA 3WL5A 3ENQA 3V1TC 1NFQA 3BORA 2ZIGA 3FUVA 2RHWA 3QHPA 2R1ZA 4WLOA 2LR0A 3PGKA 2MJLA 2RAUA 1T4CA 5JFTA 3SZUA 2B37A 3IJRA 3LCRA 3ZVMA 4TLMB 1U65A 5C53B 3CW2A 1T0JB 2FR8C 3SKVA 3LC2O 5T7BA 1QHHB 3DPIA 3GJ3A 3V7YA 2BEKA 4H31A 4BYGA 1ZNZA 2WEKA 1H0RA 3IB3A 3ILHA 2QVGA 5P21A 5JMTA 4MOWA 2QMHA 3B8HA 4O59O 3TGWA 4DPLA 4ZOLA 3TS1A 1PEDA 3MMPA 3P0EA 2QT9A 1FMFA 1OYYA 2QTWB 3KNZA 1ZGZA 4A36A 1X7WA 3ESBA 3OQJA 5ELMA 1U99A 1KSHA 4IL5A 4CTJA 5JASA 1AT1A 4MQBA 2R11A 1TM1E 5DO9A 2C5GA 1E58A 1XQWA 1VCOA 1ZN8A 3ODGA 2C2GA 3BWBA 2I8AA 3LKVA 3V8PA 4Z4EA 4L50A 1DNPA 3F6EX 2JJ1A 1T1JA 3HTXA 3CVUA 2A0YA 3EOZA 1KMQA 1UEXC 2WA2A 3AF5A 3IR7A 3TVTA 1BVHA 1KEEA 1ONSA 2GILA 1MB3A 3CWCA 2ZGVA 5FUYA 3AK4A 4PAGA 1RCFA 3NT5A 1JHZA 4TRJA 3CVOA 4DT1B 3HRIA 1E9RA 1KZGB 1ZC3A 3NBMA 4C4YA 3VC7A 2NYUA 1O94C 2IDZA 2HIHA 4OJQA 5EKTA 3T6KA 5JC1A 4QICA 2OLJA 3OURA 1E4EB 3D8UA 3I2FA 1L1QA 2R7MA 3O47A 1KO7A 3R6GA 5JZMA 3W8FA 1U7ZA 4CEHA 1OREA 2OMEA 3AR9A 5DH9A 2PSEA 2PGAA 3BHNA 3F8WA 1YS4A 4N0PA 3AOEA 4YT2A 3TR0A 4MYUA 2J30A 4RHCA 4DV4B 2XVMA 1L7MA 1W30A 3JAWB 3KT6A 4Y7DA 3OCYA 4IRUB 1E2FA 1VLLA 3FXAA 3TQTA 2PUEA 3BCRA 5BRJA 4Q1BA 1Q20A 2DEUA 1N7GA 5EKUA 1PQYA 2F1OA 3L0PA 4DIFA 1RWNA 1TLFA 4EBFA 1QOZA 4BZXA 1DEKA 3DAHA 3JZDA 2QRHA 1XOIA 1AO0A 3DTVD 1Y5LA 2QEQA 5F9MA 2AMFA 1FTWA 2QT1A 2H5EA 3QLEA 2BVNA 1X1SA 5DV9A 1R4NA 4G0WA 1V43A 4ZHQB 2YHAA 3IQWA 3H86A 4FINA 3IC5A 4YP0A 4P9NA 3SQLA 3NCTA 1ZYUA 1T5OA 1BH2A 2CK3D 2GBGA 2XSZA 2YZ2A 2FP4A