5IKEA

Crystal structure of mutant-d97n of peptidyl-trna hydrolase from vibrio cholerae
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
194
Chain Sequence
SQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHNELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Unraveling the stereochemical and dynamic aspects of the catalytic site of bacterial peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ikeA00
2LGJA 2Z2KA 2MJLA 3KK0A 4QAJA 3TD2A 4FYJA 5IMBA 4Z86A 4QBKA 3VJRA 4JWKA 3TCNA 3TCKA 2Z2IA 4ZXPA 4QT4A 2NAFA 3V2IA 1RYBA 4YLYA 1RYMA 3KJZA 4JY7A 5IVPA 5IKEA 2Z2JA 2PTHA 2JRCA 4LWQA 4IKOA 5B6JA 4FNOA 3NEAA 4FOPA 4JX9A 4P7BA 3OFVA 4OLJA 4FOTA 4QD3A 5EKTA 3P2JA 4ERXA 3TD6A 4DJJA 4HOYA 4DHWA 4JC4A 1RYNA
chains in the Genus database with same CATH superfamily
2YC4C 4X1OA 1G2PA 1VMKA 2BFEB 3GOHA 1ZXLA 5GTDA 3ANLA 1Z0ZA 3Q8MA 2BJVA 5D8DA 5JNRA 2A5LA 4F85A 2ODNA 5AFSA 4L5AA 1Z0UA 1W6UA 1B8NA 2IF2A 1QIJA 2E9SA 3OQBA 3ZGOA 3M1IA 4CIWA 2JBHA 2XKKA 3TOCA 3BDVA 1CQIB 4RXUA 2NVUA 2VRWA 5F77A 4B4OA 3MS4A 1YA4A 2VA8A 2ZR0A 4ZZ3A 4J9VA 3WL8A 2CDNA 4ZOQI 1Z75A 3T7SA 4QELA 2FK8A 3U3DA 2JLZA 1SVIA 3M5PA 3ZK8A 3ELYA 1R4AA 3W3AA 3BA1A 3NYWA 4ZGWA 2VA9A 1PFVA 4OGLA 2VZ9A 3NHMA 4J0EA 2G0NA 1B4DA 2GK6A 2Z8YM 3IELA 4EHHA 3HBJA 4O4HB 4L78A 3PNYA 4NOMA 2XTJA 3FCSB 2QUJA 3GFPA 2NU7B 1Q5PA 5TF4A 2ES4A 2P9GA 1QCYA 2J3DA 1YRWA 3R5JA 4BUZA 4TS1A 1YCDA 4FDLA 3WLEA 4AWAA 2NWQA 1UDCA 3TQIA 1U9CA 2AC4A 2PEZA 5FWXB 4FD3A 1JEYA 1KJJA 4V0LA 1X14A 4YO7A 1X8XA 4QLBA 2G1KA 5JNLA 3TAHA 4UPDA 4DLBA 3F47A 1Z34A 3JWJA 4B1FA 2CLDX 2FWJA 2WAMA 2FLKA 1Z4NA 3D7RA 3NDRA 1KPGA 1M2HA 2MU1A 2V3VA 3FM9A 1C9KA 3FPJA 3H11B 3OI7A 3PSAA 3WAKA 1CY8A 4I46A 2IODA 1KI3A 1Z2DA 2IKQA 4E08A 2VNAA 2Q41A 2QNRA 1M10A 2RI1A 1OFVA 4G24A 3B7GA 5KKCA 4QO8A 4JJZA 1PJTA 2DFVA 1CQJA 2JF0A 2VJYA 1OCEA 2MOKA 3UV3A 4FFOA 1Q7GA 3SHQA 4RZUA 3T4XA 3AB7A 4PPFA 5K0LA 3SBDA 5MN5A 4PLFA 4PZ9A 3T9DA 1LPSA 1JXAA 4ZO9A 1CLEA 3E0QA 3LS2A 3OTWA 2DR0A 4GPIB 5F2KA 3RYIB 2P4UA 3E9RA 4GXNA 4L28A 2EP8A 5FI3A 2GTIA 5BT8A 3ANXA 3ZV3A 1SU4A 5FX2A 3FSJX 5D2CA 2G88A 3PEWA 1OLUB 4MWOA 3PFBA 5AWFC 3RU9A 3QX7A 4Z4QA 5EZYA 1WHTB 5TPWB 5LLTA 3L8FA 3N28A 1P6QA 2I71A 4CM1A 1BH6A 1C8KA 2BKXA 4UBIA 3BFVA 2XUHA 2N0SA 2QENA 4Y1FA 3TNFA 3TQQA 1J22A 1QRDA 2JCBA 4K6CA 3KOOA 5F35A 2FPGB 5EJEA 1ADYA 2C2BA 2AN1A 5EIEA 1A8PA 4HWGA 5HFJA 1GVNB 5KNCA 2WQ7A 2J3HA 4ENWA 1G1MA 2Z9DA 1AQ6A 2J7PA 4E5PA 1WB4A 2G7ZA 13PKA 2BGMA 1KIAA 2VH1A 3NRBA 4JY7A 2PTHA 2HXGA 5KNBA 4DJFC 1CYEA 1F4PA 3RS8A 1N9KA 1KO7A 2LKCA 2O59A 1BWRA 4BHTA 2GPBA 2ZAOA 5FLKA 3FFTA 3CWQA 4PYQA 5EA2A 5EWMB 4LGCA 4MV3A 2G9UA 4FNAA 4H35A 4N5NA 1XZFA 4R1NA 2FK7A 5HZKA 2I8AA 1S1CA 2WF5A 4NY1A 3F8SA 4ZFNA 2JLWA 1I7NA 3MS7A 1DKRA 1DRVA 1VGRA 4CI9A 2YR0A 1CZKA 3I04M 3EG9B 1WO8A 3GQBA 4LSWA 1XVUA 1E5XA 4K6FA 5E38A 2F1JA 4TYNA 1FIUA 2YVAA 3EDRA 4GDFA 4H60A 4DDVA 3N8KA 4WLEA 4WK4B 3PUHA 5FTNA 2FHPA 2XOXA 3PWZA 1E77A 1KQPA 5EP1A 3ZX4A 5THXA 2WF6A 3NXSA 4O8CA 3QJGA 1AKWA 2OV3A 1RQ2A 2FJPA 4KXXA 3ZJ4A 2VBGA 3FBWA 2VTDA 1RJWA 4Z49A 1MJGA 1MZPA 2CYAA 2Z5FA 4F6LA 3RS2A 3ZXXA 3FF1A 3E8SA 4H4CA 3OEED 3JS5A 3T12A 2NM0A 4S1WA 1FP4B 1YGYA 1AO3A 2X3FA 4JGGA 2GCGA 4DR4B 3S7TA 4ZYYA 4GQAA 3RUAA 3UHAA 1H8HD 1VHJA 4K0KB 4MPDA 1U3UA 3B5IA 1A9QA 2FW7A 4NZMA 1W36D 4D56A 1SKBA 4C89A 4OK6A 5DEOA 3TBHA 3KCQA 5I4CA 2FWIA 3KKEA 1DIRA 4QUKA 1Y6FA 3OCJA 4M1WA 1FFHA 5E6UB 1ODJA 4KQKA 2VP4A 3WLRA 4N8DA 4B81A 2H2AA 3ORRA 3WY9A 1K3FA 3ZDAA 1EG7A 1CJSA 3N9IA 5DCYA 2FLWA 2JFYA 3L9XA 2C8VA 1NC1A 3OFSA 4IDDA 2Z30A 4IQ0A 4KTTE 2QK4A 2ZS7A 1JR4A 1NN1A 4B7ZA 2GAIA 5B2FA 1BSVA 2NO6A 1L7DA 1XKTA 3QYFA 3LOUA 2GJ9A 3TZQA 1DQNA 1QCCA 3CB2A 4YP6A 5CB4F 3FSRA 3K09A 1LDEA 1JNYA 2PKQP 5L95A 1SCQA 5EQTA 1H0RA 1Z18A 3GNLA 1OLOA 4XSHA 5AM5A 5JI2E 3CGGA 3Q6MA 1P31A 1Y8ZA 3AVXA 1A2BA 1PDOA 4D6XA 1ZW6A 2CLEB 3DYIA 1NSYA 1BS9A 2ZIWB 3KB6A 2W2KB 2WI8A 3CH6A 2I7TA 4K87A 2JCXA 1OBHA 3DH0A 4IXMA 3JZMA 3OSUA 4BB9A 5JEDA 2H92A 3SICE 4V3CA 3IBGA 5K6TA 3IPAA 4KIWA 1VHQA 4ZQIA 3GZTB 4YJDA 1LB1B 3PNQA 2JATA 5IT5A 3FOWA 2IYTA 4Y67A 3PQ3A 4RH3A 4WJLA 2J0QA 4LI3X 3GD5A 3L5KA 4HAOA 5EHZA 3FNIA 1LJUA 2HMSA 3W5HA 1R4ZA 4KCGA 3FOZA 3C1AA 4HB3A 1J0EA 4QTTB 4JP2A 3JAKA 1I4TD 3OF2A 4RTJA 4PINA 3KO8A 3RVPA 2EGUA 1G5PA 1P61B 2QT0A 4ETMA 1PR0A 1DSSG 4MAFA 4TS4A 4BN4A 4MVJG 4DIFA 1EUDB 3E1KA 3G89A 3IAS1 1G5HA 5TX7A 4ARBA 5DTJA 4KVGA 4JJKA 3UMYA 4DA7A 1SOUA 2B1RA 4TT8A 5C9ZA 5HIAA 3L46A 1COWD 3DOUA 3LDHA 4XYGA 3VU9B 1G9SA 4K9KA 4C0JA 3FJYA 1PO7A 2M9MA 4I14A 3VKWA 1E1MA 1W4AA 1I6LA 2X7HA 2YVUA 5CA1F 3RAGA 2CL7X 1QUFA 1JDJA 2Y2UA 3RTAA 5LQJA 4BQSA 1WY7A 3UJBA 1SCIA 1UBUS 2I3DA 3NJ8A 4G5OA 4EVSA 2JFHA 4LXXA 4P3PA 4DCGA 4TRNA 3CTMA 4GMGA 1IZ9A 5CEFA 3MWGA 3UC9A 3LTNC 3D0QA 2H7CA 1ZHOA 2CLSA 4D4JA 4LXUA 4YV7A 4JCOA 5KTSA 5K3FA 1UWLA 2H4HA 4LMAA 4WXPA 4D0NA 2YZGA 2C2MA 3G8DA 1U99A 3W9BA 4EKIA 2W6NA 1NUQA 3OC0A 2J45A 3NKFA 3WYBA 2NV0A 2OBFA 4AJ2A 2J9ZB 1W88B 3BGVA 3BC1A 1DRUA 3F6CA 2YDXA 1JIUA 3THYA 3KZOA 4O2LA 3CUKA 4R7ZA 1SMKA 4R40A 4ZVUA 1R8QA 5AH0A 3A7DA 2ZUCA 5SZIA 2QN7A 4RU1A 4ZYVA 1E66A 2VP2A 3WDLA 1DC3A 5KYYA 3ZWWA 1KJNA 2QKYA 3CBGA 2A0KA 4G0UA 1GAEO 1ZP6A 2IT1A 1R15A 5EKSA 1WDWB 2RJ3A 3NGXA 1JAZA 3G1WA 3E03A 4MWTA 3DT6A 3X1XA 2CDCA 1SC6A 3EUAA 3OUUA 4C4RA 1DNPA 1UZNA 1Y5IA 3R77A 5JWOA 1NN5A 1SQ0A 3CUSA 5AVOA 3NHRA 1C7ZA 3H8WA 2X13A 1BFDA 4UMVA 3P2JA 1RKBA 4YYZA 5HVNA 1X19A 1EVLA 4UBNA 5AUQA 2FN3A 3N8HA 2EW1A 3TLGA 2A9PA 1RR6A 2XYPA 2QZZA 2OORA 3D8SA 1QXSA 2IUSA 1CJBA 1ZEJA 5E3HA 3RYCB 3I42A 2IW1A 5JNTA 5KDLA 3FLEA 1VL1A 1VQ1A 5I9LA 1BX1A 3W5CA 3UMCA 4R1LA 1C8VB 4XJSA 4HNUA 3G0DA 3D4LA 1R66A 2Y0BA 5TGTA 2BFBA 3EC1A 3PC6A 1FLVA 3PTZA 5J2TF 3BE5A 1TT5B 4HFMA 2AW3A 4BVBA 4XVHA 4D4IA 1QUEA 5IP5A 4EA6A 5EP4A 4KHPB 3H1GA 3HKEB 1SUIA 2X19A 4OIMA 5U1PA 1U9YA 3PLNA 5FIUA 1BU5A 4HNTA 1JMKC 3HO6A 5HFNA 1K7YA 2GPJA 2P6UA 3KLOA 2C5LA 2XUPA 2NU9B 4I81A 1LZKA 3RFFA 4RTMA 4B3RB 1P1JA 2PBRA 3FPLA 1PL8A 2IOFA 4RH1A 4X64B 1JQDA 1EHCA 5BSHA 2EWMA 1GL7A 1T3SA 3VO8A 3ZWKA 5CTJA 1ZU5A 5LP6F 2QGZA 3DMNA 1ABFA 5EQJB 5BQXA 1OX4A 2IU6A 2VJNA 4LDAA 1E61A 2QPLA 4AMUA 5K0EA 2V7XA 3IBTA 2ZIUB 1NLUA 4KE7A 5GVSA 1P2UA 2YVKA 2PXCA 3DAOA 1BD3A 4AJJA 3OKAA 1U3DA 2ZJ2A 5C3MA 1G17A 1C29B 2B8WA 2W48A 2VSYA 1WDTA 4G4IA 4O59O 4GFDA 4Q16A 3INNA 5LZ5A 1H2YA 3ZWBA 4I4CA 1ODFA 4TZ6A 2J3IA 4QQRA 3SYLA 4U2EA 2FUG1 1KZ1A 4R3NA 1BG6A 2EJWA 3QVLA 3JARB 2AN3A 5G0UA 3OFJA 4L5BA 3DXXA 3RVOA 4BGIA 4DLXA 1PUJA 3AFMA 3FRHA 4FEYA 4U0KA 4JI6B 4ARSA 3ZCUA 3HCOA 3M82A 2FPMA 5CX4A 2YMMA 4MDYA 1UP7A 2P4QA 4BJ6A 4CQMB 2DB3A 3ZD8A 3MWEB 1TTTA 1UJCA 3AYZB 4V0ME 3N8NA 3WWDA 4TMWA 3QWBA 2QAGC 1U9IA 1KS2A 3GD7A 5IPFA 1O94D 2XUIA 4EG0A 1I2BA 3ESZA 4JIMA 2AFIB 2PS1A 2Z57A 5T41A 3KS9A 4O4IA 1PG0A 4CMEC 2CZGA 3WIOA 1NI3A 1ZRHA 4QOEA 3D43A 3DD1A 2QTAA 4TS3A 2DFNA 4NENA 1PCXA 1NMSA 2D7CA 5IYZA 3ZC3A 4L15A 3WWYA 1ES9A 4V3BA 3ABZA 4ECAA 5HQ3B 1EXDA 1Y3CE 1FW6A 3EVTA 3KT6A 3JYLA 4H7HA 4IIJF 4YLGA 4B6JA 3DB1A 2VHXA 2W6JA 2AOVA 2CFOA 3NQ41 2VK1A 3GFVA 3NIGB 5J40A 1LLFA 4CLXA 4C0AC 1X70A 2ERYA 3EXFB 5JDCC 2EKQA 2J08A 4YRPA 4QXOA 2X41A 1OTYA 4JB8A 4F45A 4NC9A 2P0AA 2PT5A 1RS0A 2Y1XA 1EA7A 4HTAA 4KRGA 2FW9A 4I5IA 1J1ZA 4QICA 4W9NC 5A2GA 1DINA 2Z56A 3D8NA 3MM4A 2BEUB 4IZ6A 1NZDA 4R1QA 1E5LA 1YB6A 1DELA 3B89A 4GPTA 1W2HA 1QH1B 1JKXA 3VZCA 3MCTA 4ND5A 4Y2JA 1BWQA 3PT9A 1F51E 2IJGX 2XNJA 3IB3A 1WPGA 2VTVA 3TB6A 5DHSA 4LQCA 2C7BA 5LQKA 1E1YA 3BMQB 1NC3A 1YU6A 2I91A 3I62A 5HRUA 2O0MA 3CW2A 1DG9A 2Q7OE 3RVLA 4R71A 3U6BA 1EK1A 2J33A 4E5MA 4O4LB 4S0XA 4FZRA 2H1SA 2ID4A 1P1IA 4MQUA 1YOVB 1AZSC 1RVDA 2Y1FA 3L2OB 1DDIA 3OOYA 2J3QA 1ND6A 4FLEA 3U9TA 2RC5A 3DBOB 5ALKA 1JPVA 1RVV1 2QU7A 3DMHA 5J3JA 1M6YA 3E2MA 3JQDA 5AOBA 4KFCA 1KRWA 4J0FA 3DZKA 4WESB 3UMGA 4DLZA 421PA 4DKJA 3GV0A 2P7IA 2X9NA 3I73A 4QM6A 3WGVA 4FLFA 4JC5A 4OOEA 4WUVA 4U2DA 2IYXA 4CQLA 2LBPA 3BWMA 2SHKA 1OPXA 4N8EA 5BSEA 2EWWA 2JJYA 1K63A 3TKAA 1P2DA 4GOMD 4OAPA 5E8JA 1XZNA 1R0CA 1NQOA 1XCGB 1Y8RB 2JBWA 4QT4A 2EZ9A 2GOYA 3KD2A 2A58A 3CNEA 1QH8B 2H63A 3P45A 3SN6A 1ZDMA 4OKSA 3TAUA 3M34A 5H3CA 2XCTB 1SAYA 1XAGA 1HYEA 1ECCA 4HUQA 5M04A 4ESVA 1Z5NA 3CQ9A 1U8YA 5E6SA 5SICE 7REQA 1E1RD 2HPZA 3PP8A 4N3NA 4WY2A 4RHEA 2B5VA 4MO2A 3OLCX 1FP2A 3ILSA 3HBLA 1S2NA 5JAZA 3SEZA 1TZ2A 3NO4A 1OAKA 2B0JA 1XR3A 1Z15A 3FTDA 4I6JA 3ZIUA 1ULSA 1VFPA 2TSYB 2Z3VA 3K8OE 4PTZA 2DWCA 2H4YA 2D5LA 1P4AA 2R6R1 4G81A 2CNKA 3L02A 4QDUA 2LWIA 2P9YA 3FGOA 3KJIA 1QYWA 1P1FA 1UBEA 4PLTA 4YH1A 4BFVA 1YS9A 2HTEA 4R68A 4UQLA 5B58C 1KP2A 3TVYA 2I4LA 3D6JA 3K8ZA 3ZKWB 3U0BA 1Z45A 2H3EA 1IBMB 4OHOA 4L9SA 2AFHA 4B3TB 5K03A 1G64A 5G1OA 1EGQA 2QF7A 1TMYA 4CKWB 1GO2A 3V9PA 1ODIA 1SBTA 1XZGA 3HM2A 2J3KA 4FZ5A 5BUSA 3MELA 3LGXA 2HR1A 5AW6A 2VXYA 2PD3A 4BGDA 4CNQA 2UZ1B 4CIXA 1PK7A 1KSFX 2GPSA 3HYLA 2IYZA 2HMAA 1J2RA 1QK5A 1NASA 4JOBA 1QF6A 1X7XB 3GVPA 4FFBB 4KUEA 3WO1A 4BZXA 1XMJA 5B7QA 1B8VA 3EHEA 1EXWA 2GNAA 2C96A 3O3MB 3KYIB 4Y9UA 2R1ZA 1MHTA 1XJ5A 2Y1WA 4JSTA 3WYAA 3SD7A 4ITUA 1R74A 3PJEA 4RVCA 3ZS8A 2P5TB 3T1QA 4ZYXA 3G7UA 3DONA 3TN7A 3IUBA 4Z4GA 3FYHA 3H0EA 3I0NA 4IXDA 4DWWA 3A36A 3BG5A 5TQ2A 2Q4TA 4QA9A 3BOSA 5IASA 3MYYA 1X1TA 1AGNA 2DLDA 1K4YA 3DVSX 4YJ2A 2CLOB 3FDIA 3O2JA 1XTKA 3GT0A 3D8RA 2PS0A 2Y27A 1S6YA 4ESHA 3UW3A 3OQIB 5EP2A 1F5NA 1VJTA 4X91A 1Z22A 5FUBA 4CE6A 3ZI4A 5DTRA 4QYTA 1R7RA 2X7XA 3TMAA 3ZJTA 3EZNA 2NZYA 4CLDA 3I6IA 2VBFA 4BNGA 1GPDG 2ZJ5A 4IIBA 2YXNA 1Z4QA 2J67A 1YMQA 4F84A 1OA0A 1VGQA 1OXBB 1P1HA 2EYQA 1QBKC 1Y4UA 2YMLA 1JKJA 3I2FA 5E1MA 4FOOA 1QKJA 2JB9A 1J21A 4Y7CA 2CV0A 4W63A 4LY3A 1PRYA 3IBCA 4LYFA 3UGKA 5DI3B 3NP9A 3L01A 5F7XA 3VZQA 1EFRD 5DM1A 1P3DA 1DX9A 2Z98A 621PA 2VDKB 1I7DA 1EI9A 2DSNA 2J5BA 2Q6OA 2V7VA 3FB1A 3HXLA 2NUPA 4GXQA 4DBZA 3ENNA 5JCPA 2YWRA 3FR7A 4Z1MA 4E21A 2YS7A 5KHOC 4BNIA 2PGXA 4QVIA 1K68A 3KKMA 1FU8A 2X9VA 3VJRA 1ZOSA 2A9FA 2FEOA 2G9QA 3O0DA 4LHSA 3K05A 1BVRA 4HRVA 1SULA 2FPPA 5EHNA 3F6SA 2CJYA 3LP8A 2YH2A 2AF3C 4HVAA 1JDBB 4QWMA 2ONYA 3QI7A 1H0HA 3DKPA 3UGJA 3SZUA 4YHHB 4L16A 1C50A 1U0JA 2Y4NA 3H5RA 1ZSNA 3BD7A 2GRAA 3DDNA 4OY3A 3NJ4A 3D3EA 1LBTA 4JU9A 4CGYA 1YBVA 2HPHA 2NUAB 4XIFA 4B48A 2J4DA 1X2EA 4F3RA 4RDXA 3DBRB 3VFDA 5T8KC 4MJXA 5JG7A 3T7JA 3TW8B 3WMGA 2CD7A 1Y82A 3I01M 4JWTA 5GMOA 4FE7A 3NWPA 5EIFA 1PWZA 4JUFA 3W79A 4DCJA 4R2KA 1V2HE 2Q3HA 3IS3A 4DUGD 3RWBA 1R5BA 2IK8A 3CNBA 2FG7C 2ZZNA 5CK4A 1LH0A 4NCXA 3ELBA 1A96A 1KFBB 1XNJA 4FJ1A 1FFGA 1FF9A 2ADMA 2ZRHA 5IDVA 4EYSA 2DU8A 4KNYA 4KK4A 1XLVA 4NVRA 1XRSB 1GLGA 1O6CA 3D7MA 3ST7A 4F4HA 3BAZA 3PYMA 4RXTA 2RIRA 1WHSA 2F3PA 5BNZA 2YWJA 4MUEA 1HH4A 1WUJS 3JQAB 4BV3A 4BNFA 1L9XA 4B3MB 1WCXA 1FSSA 1G21E 5BQ3A 3TZLA 4A8JC 2I67A 2P2GA 2VHUA 1T9KA 3K7EA 4Y2QA 4F5EA 4UXHA 4YP7A 1C9YA 4YAOA 1PD0A 2IYPA 3DYBA 2AQIA 3UHOA 2GQ0A 4LWZA 4U7PB 1M8KA 2DPYA 5E1DA 1GYQA 4QL3A 4Q1DA 1PJRA 4GMXA 4PSAA 3VPCA 3ISTA 4RD6A 4RD0A 4Q9KA 2OG1A 1UKCA 4QFMA 3DZHA 5B1HA 3GJXC 2X5JO 3OEEA 4L4RA 4G5FA 2PGNA 1NX9A 5UKDA 3OE5A 1VOTA 1Q6ZA 1FPMA 4CCSA 4UFNA 1ABBA 1T8SA 1EJ0A 2VH2A 3I3OA 1MIOB 2E4ZA 2P5SA 4OQQA 2VBIA 3M4NA 1X3SA 4FP9A 5ADVA 2QTNA 1WPXA 2IYVA 4OHXA 5IU6A 1AXEA 5KWSA 2BMAA 2O7RA 4OOFA 2O2SA 1X77A 3L7DA 4PZUA 1L4KA 3CVOA 4YRZA 4Z2AA 4HWTA 5JCJD 1EIWA 3OEWA 1H2AS 1KBQA 3B1JA 2XE6A 3NHYA 4I5DA 3ZDFA 2VSNA 1LSSA 3Q7RA 3KLBA 2HHAA 4Q4HA 2ODAA 4DB2A 3TJZA 2PIDA 1VCMA 4JLWA 1K2VN 4XWKA 5C7OO 3AVOA 3VNUA 1L4MA 4Q1AA 3MN1A 2P5YA 2OM2A 1GYRA 2F3UA 3NHPA 3ZNNA 2W00A 3N8DA 1P1RA 4LUCA 5A3RA 3KQWA 2IDKA 1BCSB 3UXYA 5TDHA 1J49A 1CRQA 5LMUB 3ZTYA 3QG1A 4R8MA 1ZS9A 4IIDA 3WDKA 1NNUA 4BV2A 3KR9A 3BN3A 3CXRA 4B6PA 3SAJA 5JJKA 1TUIA 2HHHB 3ES9A 4XYMA 5I7WA 2HMVA 1LQUA 1P33A 4HS4A 1R9NA 4OHKA 3DDCA 4EBBA 4PZCA 3ZLBA 3Q0EA 4BLSA 8ADHA 1AMUA 1OWOA 1N0HA 4TVSA 5HUHA 3HXOA 1QAQA 3PQ6A 5BN4A 4UHFA 1FJ2A 1I4LD 1FRZA 5FA8A 1EUZA 1QZXA 4MYSA 1DG1G 2YVQA 2BEVA 5F7JA 1OGJA 1G18A 4MX8A 3QF7A 3TR6A 4FMCB 4NIMA 3UATA 4LQLA 2IDMA 2HU2A 4L27A 4XIIA 1COWA 2ZJ3A 2XYQA 4JVMA 5FTMA 3QEAZ 4C3UA 1TCCA 4B7CA 5C52B 5BVGA 2ZUDA 1RMTA 2BMWA 3GK3A 1T1JA 1T6BY 3UK0A 3AK4A 5CYOA 3EODA 3HL0A 3F5FA 1KVQA 1OKKA 2QTGA 4MUJA 4DLRA 2XQKA 1UEIA 5REQA 1GPMA 1J1UA 3G5TA 3R0VA 4OEHA 1II8B 3CM0A 2FOIA 2XDQB 3EZ6A 3FRIA 3OQ6A 4QXQA 1TQHA 3H13A 1DRJA 3NTQA 3K5WA 1X7YB 5TQJA 2Q6TA 2Y1EA 1NVBA 2Z8YA 4QTYA 1YZYA 4GZ3A 1AKMA 1Q1BA 2A4MA 3M3HA 3TSWA 2X8JA 5EE3A 3R9WA 1TJPB 2OV2A 2TS1A 2DUJA 5CXQA 3HN7A 2H1CA 3IOCA 1SZJG 2ZCJA 1VYVA 3IMCA 3KZCA 1QS0A 1I4OA 4PO8A 1KHHA 5A62A 1QV9A 1NXWA 2EFEB 2IZZA 2P2NA 4MVJP 4XQ0A 3Q3VA 1CF4A 3HNOA 4EMUA 4AI6A 3BMNB 1E2LA 1O95C 4RIFA 4X7MA 1M5TA 1OI3A 4R1SA 4RVUA 1FLAA 1AKYA 3M6LA 1IBSA 4YCDA 3L5OA 1UBGA 4HX9A 1ID8A 1SXJD 5A7GA 1LVGA 4QDZA 5ECYA 4B79A 1XDUA 2PBZA 4WZAE 3TTVA 1LQTA 3VPFA 1FYFA 1O9GA 2HA7A 1ENOA 3MAGA 3V8EA 1FQKA 4MQEA 3R5TA 1D7AA 3F4LA 5A9SB 1J8VA 2Z9CA 2ERXA 3LOPA 4IM7A 1PT9A 4G09A 4G0PA 4WCFB 4CDGA 4EPXA 1TAGA 2VNIA 2N1MA 3GGPA 2JHPA 3BWCA 4UDNA 2Z2XA 5CPFA 4YRRA 2O1WA 2XYGA 3TX6A 2GYYA 4LE2A 5EG5A 2C42A 1WOMA 1UEXC 1I6MA 5EIWA 4CIAA 3ZPXA 3WYEA 2NP7A 4DIDA 3ZVKA 3IV6A 1QQTA 5IJ9B 4S1NA 3ICQB 5AUPB 1QQ7A 1WXXA 4FCWA 5F78A 2VQDA 4X5OA 1O0BA 5LUAA 3U4HA 4Y0VA 3WBFA 2HU7A 1CHNA 1CR0A 1Z4LA 3Q3GE 2ORVA 1QG6A 1WM1A 4JLBA 5EQDA 1ZKDA 3E82A 2BKVA 4OBWA 1CB7A 1Z7GA 2ZK7A 1NBIA 1VLJA 2JH3A 4HH3C 2LCFA 4NU0A 4QYMA 5TVKA 2JGDA 2EJTA 3LRTA 1QOPB 4A0SA 1AD2A 1XIVA 5KYXA 3W6PA 3RRBA 1E18A 2FOXA 3B38A 2D3TA 2CBXA 3O8BA 2AE1A 3A2NA 3RK4A 3U13A 1X7HA 4B34A 1TLFA 2O0JA 1NATA 1DEXA 5E95A 1VYUA 4FDMA 1ZD8A 3R3UA 4P4UA 3RVKA 3HFGA 4GEGA 2P9CA 1E6UA 3W9YA 4DMHA 2OHJA 1U3VA 3QLJA 1UBHS 1TK9A 2QLLA 4BX2A 2XCLA 1P9LA 3TL2A 4QGSA 4MUNA 4E4TA 4BFUA 4P1ZA 4O8ZA 1L4GA 1XVLA 4PYKA 1N6NA 1HZJA 4MYDA 4WZZA 4YCJA 3BXOA 3SDZA 3TNYA 4ATNA 3I04A 2J8ZA 3KHUA 4Z7OB 1DT3A 3LX4A 4LK2A 4DBLC 4HDNB 3C6XA 4DQXA 4DABA 1N7IA 5IN5A 4EA7A 2AOUA 5KOJA 1EFPA 1PTKA 1YQGA 4Q6WA 3A27A 4TQ9A 3W2EA 1AQNA 4FJ0A 2WYOA 4XDYA 2HREA 1YUBA 2Z5GA 5LD2B 2QMUA 3ZE2B 2VK8A 3SQNA 1G8YA 3IXQA 2GZ3A 5H4HA 4LF7B 3UJ9A 4A1FA 1NA5A 2WLTA 1GZSA 3PXBA 1O9HA 2C04A 4LISA 4MSUA 5IVIA 3COPA 4XFDA 4CI0B 4DDWA 4CGZA 2XXAA 1W1UA 1AB6A 1AGXA 1I5RA 1Y4SA 2QYSA 3BL5A 2YN4A 4DIMA 4IVRA 5CK5A 3EGCA 4DKXA 1SJ9A 2Q8NA 3H42B 1JFLA 4FFNA 2WABA 3HCEA 2ACEA 3TIVA 1ZA1A 5AKJA 3FWZA 4CR6A 4DSUA 1EFCA 3ND9A 1JP7A 1O94A 4JN6B 3H2SA 3R0XA 4HPJB 4IIXA 5BQ5A 1HG0A 3GIWA 2YW2A 3SCZA 3CO0S 4MS3B 2J5KA 4RK0A 4XTRA 4IAOA 1MORA 4U7HA 2A86A 3HA3A 3QLVC 2ZDHA 1UMBB 4XRRA 4RX1A 4DIKA 2C7VA 4PO3X 1X80A 1A7KA 3JASB 4R4JA 2XCQA 3IDAA 3PENA 1GSAA 2DF8A 1RWVA 2WQZA 3A4TA 3JD2A 3N6VA 1KPIA 2GJ4A 2PWAA 1UBKS 2PZBA 4N82A 4PHTA 4FOPA 4KP7A 4REOA 4AJPA 3QRWA 4MQMA 2BD0A 3AEUA 3HTXA 4DANA 4KTVE 1U2GC 1ZK4A 1ZI9A 2I6QA 2VQ6A 2NVBA 3LKVA 2GM5A 3NB0A 1SKYB 2P1DA 4GMHA 4KXYA 2BTQA 2ZI7A 3ENQA 3ZH9B 2SNIE 2GEKA 1CS0A 1TVKA 1JFRA 1DIGA 1NBME 4IZHA 1U2TA 2FETA 3TRKA 5JC1A 1DO8A 2Y76A 3EC7A 4MKRA 4OP2A 4XUDA 4LWOA 4IFIA 4I7EA 1C4XA 3OCCA 1HOXA 2V3WA 1GL6A 1NMXA 1OXUA 2XSZD 2GARA 3BIWA 3ETNA 3NYQA 4TLLB 5B64A 2QUIA 3O92A 4C0KA 2JCSA 3AH8A 3TM4A 5JAMA 4U9UA 3RJ5A 3SMVA 4NJEB 3IBFA 5M7EA 4IUCS 3F5QA 2ZT6A 3A4VA 3OOHA 1V7PC 2PJDA 4GQIA 3KM0A 1SHUX 5CW1A 1Z4IA 1FBNA 3EGWA 3TD9A 4AU1A 5JZMA 2Z9BA 2YC2C 4GKVA 2VYND 3T5PA 821PA 1KZ4A 2QZ9A 2OV6A 4CUJA 1WB6A 4WBNA 4B4KA 3F8TA 2FW6A 2GYUA 3LOQA 3VVMA 2ZETA 1AT1A 4GMDA 3ER6A 3TPFA 4AZ3A 1M34A 4D0GA 1AF7A 3P2MA 1CU1A 4IILA 4N5LA 1D0VA 1YBAA 1HC7A 4Q1FA 4NEQA 3DP9A 5BV1A 3MGBA 1QVVA 3T9EA 2PO7A 2P41A 2EFGA 5FQOA 3PKZA 1KRHA 3I52A 5DM60 4CMHA 1WR8A 1NPYA 4IHAA 4Q37A 1LC3A 1MB3A 3E9QA 4QDOA 3QXHA 1CQZA 3MTEA 5ULLA 3AVYA 1PYOA 3THWB 2JLCA 4KU4A 3T3DA 1R4MB 3HXPA 4UAVA 5HCUA 2VJQA 2HMYB 4P5PA 3QU2A 2HTFA 1U7ZA 4O5OA 1JPUA 2HAEA 4WHMA 4HEA6 4C07A 3VZDA 4PX2A 2P30A 3VO2A 1C14A 3FETA 3LL7A 3NP7A 4HWOA 4A3SA 2QLFA 3BK7A 3HN2A 4TXHA 1K4KA 3PB3A 5IVKA 5TS2A 4CF3A 2Q3DA 3UWKA 3T99A 2P2YA 2QMQA 4M22A 3LLVA 4YXWD 5JBNA 2OAEA 1E1RA 5JS8A 2VKTA 4JP3A 1DUSA 3IKVA 2Q07A 4H7EA 1GT91 3I09A 3KYCA 3MCUA 4UFPA 3PDHA 3DMFA 3HYNA 4O2BF 4US0R 3W78A 2FGJA 2NXEA 5LBIA 4IQ4A 4NICA 2DUWA 3JRNA 1FFXB 2PL9A 4BP1A 4C7VA 3KXKA 2O8FB 4ZT7A 1P6UA 2ANBA 5C46F 3SWWA 1ECLA 4QNRA 1YI0A 2F3TA 1RM5A 5IAGA 2I2DA 2C3OA 3DFMA 4MUMA 4W7HA 3OPYA 1OV6A 2F17A 1OBCA 1RRVA 3SZMA 4L85A 3LC1O 2WK1A 3Q5DA 3PTLA 4OQ4A 4G1UC 4AQYB 1IN1A 2GAJA 3MBIA 3HJGA 2GKOA 1PJZA 4QOIA 3FWNA 4HQOA 4R8RA 3QUTA 1OWLA 2V45A 1FXWA 4WZBE 1UK6A 2NTVA 4DDKA 3GGGA 5AM0A 4IW3B 3FVTA 4HSGA 1X9HA 2AMLA 4MGEA 4HAUA 4I8IA 5EWLA 1NJ1A 1P0QA 2UZ3A 2IU0A 1RKVA 3GMSA 4QGGA 1I3CA 3KHTA 3UAGA 1R6AA 1NAHA 4YROA 3RUFA 2FZWA 2PN1A 2W93A 3IKMB 1F2TB 4TTRA 2IV7A 5FO1A 2PA0A 3IXMA 4KQEA 2OV8A 4E1VA 1E8MA 1F2UA 4W1PA 5EUBA 3A9SA 2HWKA 1LZLA 2RAUA 2RHWA 1EHIA 4QQKA 2AJDA 2PT7A 3G9XA 1PJQA 5JY6A 3E3OA 1VE5A 4HRXA 3WGUA 4JL8A 2ZR7A 3H5NA 2WJHA 2LIPA 1T0BA 3IODA 4QAJA 5CH5A 3VZSA 5K4AA 1LBHA 3QVGA 1U80A 3W04A 4ZI3A 4PPNA 3CVXA 3HU5A 2RKBA 4KPFC 4ZZIA 3UBTA 1GQQA 3UJ8A 2YYZA 1KO1A 2WT9A 3BK2A 1P0FA 3PDIA 1J25A 4KXMA 4ALJA 2L18A 2RIPA 1P7YA 2SKCA 1EA5A 3PGJA 5HS6A 3HVKA 2F1HA 3ZVRA 3AQIA 3U56A 1Y89A 3ZE8A 4NDAA 2CWDA 2QPAA 4A82A 4RVHA 4EITA 1U0SY 5LBUA 4D98A 4MI9A 1JFFB 1YC5A 3BHJA 1G9XA 1XK6A 3DNPA 3H2ZA 5AVKA 1HEUA 3QFSA 5CH8A 2H4FA 3K5IA 3KPJA 3DEHA 4A7PA 4R7TA 1NXXA 2QJRA 1QF7A 1COZA 1Z62A 1G6Q1 5DBHX 1JFTA 2O3UA 5M5BA 1V3QE 1MD9A 2VVTA 3KKQA 3PHIA 2AHOA 1NI5A 1NJ6A 4DLAA 2QZPA 3WMXA 1H4TA 3BYZA 1XEWX 1DUIA 3SKXA 3OOSA 1J56A 4FHZA 1WUKS 4ZP1A 2PUAA 5CCDA 1A95A 4LNAA 1SQFA 3RF7A 4U39A 2GO7A 1E7SA 2O2ZA 4LFCB 1XXHA 3EWIA 2W2MA 1OWNA 3W6ZA 4CMIA 3DKKA 4H1WA 1S2MA 3K5HA 3DL2A 3ZV5A 2GD0A 1Z4PX 2QJFA 2QRQA 4QX6A 1CEEA 2ZE7A 2WU3A 4N8SA 3U61B 2RG7A 2VWQA 1J2YA 2HWWA 3AINA 3CE9A 3VKGA 2WZDA 3DUFA 3FFAA 3E2IA 3V4RA 5IDYA 2MR6A 1MBZA 5DBGA 2LGJA 4D8UA 3FBTA 5AIAA 4JQYA 3WGTA 2V9CA 2FQYA 1IM8A 3CZPA 2VAXA 3V8BA 3IPYA 3AM4A 3D2CA 1NIJA 4OLAA 3IP8A 4CTKA 2ZBUA 2VZLA 1OFUX 5HK9A 1FU4A 2BM9A 2QRVB 1XNGA 3PUYA 4HGYA 5EC8A 2PX2A 2OHOA 1FQJA 1LX6A 4F2GA 1A7UA 4URYR 3SZOA 4UNIA 1D2EA 4YDSA 5ECWA 5TV2A 4FHCA 3W2FA 2F9MA 2XB2A 1RZRD 8AT1A 4KE8A 1N5DA 2DHRA 3EJ6A 3L92A 1IQRA 2Q3EA 4TTTS 4D96A 6CHYA 1MP0A 3B5EA 5DBOA 5KSYA 2IIBA 1UZMA 3DHVA 4KMOA 1OYWA 3IH5A 4O25A 5K3DA 3ZWOA 4F12A 1S02A 5A4AA 2PZJA 1DIOB 4M9CA 4BPRA 3MTQA 1K8ZB 5A4KA 3D4BA 1O96A 3I64A 1A9XA 4R41A 3CS3A 1PU2A 1SC3A 2R6GA 3Q7TA 4G3XA 1LY1A 4WNAA 4JYAB 1PWYE 1DHRA 3LGSA 4YC7A 3G2PA 3WGLA 2WKPA 1R88A 3KJQA 1XL0A 4IQ8A 1N9GA 4UM8B 4CPDA 2ZE8A 5BWCA 1XZ8A 2E7ZA 2EP7A 4D5EA 3U5ZB 2XXJA 3DXZA 1YJQA 3HPQA 4AY3A 3GLRA 3OQOA 3S8MA 4F9GA 3UM9A 4CFYA 1AKQA 2I87A 4U9IS 1X8JA 4KE6A 1U2ZA 1WQ4A 3HB7A 4K86A 3ZHVA 3O74A 1MNAA 4TWIA 1QWSA 3QYAA 3O03A 2B1JA 1Q1GA 1CRWG 1E2FA 1TLTA 2ZW9A 3KAQA 3M6FA 3EZLA 4RKRA 5HTKA 4CRWB 1USKA 3BGSA 3LI2A 1L5HA 3SVLA 5CM8B 1Q0RA 2G77B 2MYTA 2OAQ1 3C7DB 4EDHA 1R9MA 4X1YB 4EI9A 2R48A 2R25B 1R3DA 1SFRA 1QHHA 3CISA 2XCRB 1OAAA 2Q6VA 3P5BA 1ZR2A 2J3EA 4KVAA 2BGIA 4UJ3A 3RH0A 1MAVA 4JJFA 1SU6A 2CNWD 3HEMA 4JLNA 4NYMR 4BQOA 2AV6A 4PR3A 4YRDA 3TG2A 2B4KA 3C8MA 4WINA 3MG9A 3R41A 3ZK9A 3IUSA 4MCAA 3GLGA 1KVRA 2H2IA 4KYUA 2CF6A 1Q3TA 5J4LA 3IIJA 1ODKA 1W4CA 3LIPA 3SXPA 1LTHR 4U3JA 4TYMA 5I5GA 4QUGA 1HQKA 1Y9DA 3RUDA 1XYYA 4MWCA 1L5KA 1PR5A 2R87A 4MHOA 1I5EA 1NF3A 3QITA 5AM3A 1VBKA 2Y6VA 5AW5A 3E22B 1ULZA 4OQPA 3AONB 3NH6A 3L8GA 4IKOA 3BXZA 3S28A 3ZWAA 1KKUA 4YRGA 5CDSA 4V1CA 2AHRA 4M0LA 1XTJA 4N49A 3UWSA 5IKOA 3DZIA 4IFBA 1O5TA 3I8OA 2RGXA 4KDRA 4M4SA 4OU5A 4PTYA 2WOJA 2IXBA 4X41A 2JFXA 1ZG3A 4AULA 4YA6A 4RA9A 4DAEA 1WKBA 4C4PA 1P74A 3ZDCA 3OTQA 3R0JA 3GAFA 4JNKA 4LIPD 4MO9A 4Y6SA 5ALDA 2M98A 1DQPA 3LDGA 4LECA 2YZ7A 1GGEA 2HD4A 1Y6RA 3GOQA 3KQPA 1UDXA 5AI0A 5B2EA 4QUJA 1TU0A 1G63A 1XF9A 5FL7D 3LFTA 3M6IA 2IELA 3W2GA 1E2KA 3WLHA 4D4MA 4C2UA 1HEIA 3MWDB 1UBCA 2B83A 4Y2GA 4D02A 2IYSA 3MTJA 2XD4A 1INLA 5JVDA 5D6NA 1U0HC 1JB9A 3NVMB 2AG6A 5BWLA 3LWNA 4DT1A 1SXQA 4XDGA 1JQ5A 4PYNA 2PVCA 3BQNB 4PZZA 5FBKA 1FZQA 1F1BA 2DBZA 1WXQA 3INRA 4P31A 3TRHA 1T4CB 3WXBA 2WVGA 1THZA 2IH5A 1P5FA 4FINA 4ANFA 2I2WA 3QVUA 3W4JA 2VP6A 2FF5A 2RARA 4KXLA 4F3NA 4YJFA 1ZGCA 3HSYA 5GZ1A 2VDUE 4OLFA 5FCDA 1TB4A 5DNAA 5HR5A 5CFPA 4L08A 3WYCA 4EPYA 3BWEA 5G41A 3RSCA 2FX2A 2X22A 2JHFA 3MCVA 3FUWA 1K5HA 5KAPA 5K6RA 2UXBB 1ULBA 2C4NA 2IXDA 3VTKA 5LOVF 3FUTA 1QBGA 3FTFA 2YY6A 2LP4Y 4MA5A 1Z35A 4C0QC 4LF6B 4TZKA 4GX5A 2Y8EA 3OJOA 1B8PA 3IVCA 5MDHA 2OBXA 1B1AA 1BS1A 2H85A 1XJCA 2YICA 4HYYA 2E87A 1CJCA 4K46A 5JAQA 1R6DA 3NTXA 2ZB3A 5K0JA 4O4JA 2GZHA 4JLJA 1DG3A 2BKUA 3FLAA 2JI9A 4B75A 1CF9A 1Q2UA 3AB8A 2AN4A 1SXJA 3UY4A 1SVWA 1XDGA 2V6MA 4UBMA 2QM7A 3AJ8A 4EG6A 4J1SA 1AZWA 4L8GA 3ZHXA 3L3BA 1NDHA 4Q19A 3D6MA 3FHLA 3LVFO 4WNYA 4HUJA 2VF5X 5FV4A 1BHO1 4NL4H 1F8XA 3EIOA 4CR7A 4WBSA 4YIKA 5JQGF 4IJMA 3NPMA 1G291 2EKDA 1MTOA 1SZCA 1DHTA 4GH5A 4OGWA 3STVA 5C5CA 1VJ5A 2OGWA 5KUTA 1N1MA 1RFGE 5TEWA 2Q2WA 1D1PA 2ONZA 4BNYA 4EY6A 2FWRA 2JG3A 3INTA 4P84A 1MUUA 3HR4A 5AK5A 3GNTA 1BGWA 1KI6A 1O87A 1CY7A 3QHPA 1UP6A 5SYAA 1DFGA 2IEGA 2ZCUA 1P2BA 4DDTA 4Z5XA 2FN7A 2J48A 2VL7A 4UTVA 4M1KA 7REQB 2BL4A 2PH7A 3KLNA 3B82A 2PCLA 3O2SB 1JQEA 3PNBA 4GL4A 1Q16A 2ZBGA 3KFXA 1G8PA 4GPAA 5ALUA 5FO0A 3WYNA 5JTUA 2M6RA 3VR4D 5C34B 4YUAA 3CGWA 4LFAB 1XROA 1JH8A 2OSVA 2YCBA 2AOXA 5LYJB 1WMBA 1PLJA 1Z6TA 3W5BA 4LKOA 2VQSA 4B85A 1UMDA 4QM7A 4FILA 1FP6A 2X9LA 4OQEA 1DX6A 1YS7A 1F8FA 4DQVA 2O8BA 3PC4A 5DNYB 3N2ZB 4JUDX 4QU0A 1M1YB 2A6PA 1TYZA 3MINB 4OYHA 1DAKA 1WMSA 2JHGA 4S1PA 4L07A 7AT1A 1ZCZA 1YFLA 3I01A 1Z0KA 3AUYA 2DBQA 1ZRSA 3QPWA 4QPPA 2WFZA 1NW3A 4Y1RB 2GS9A 5G1PA 1P5JA 2BUCA 3OQJA 1OH7A 2VK4A 2WWGA 1BTOA 1FUIA 3DLCA 3S2EA 5K01A 1QZTA 1SKMA 1F8YA 3GMIA 1DKMA 5BN3A 1YZQA 3J81A 3E6AA 3P19A 3ZQUA 2VJKA 2REQA 3NOXA 3I05A 3OZRA 5FFNA 1KOFA 3D2LA 3SF8B 4O0MA 1CY2A 3G5LA 1BJKA 3ZX5A 1L5OA 5ALHA 5E7MA 4PXSA 2I1QA 1JEDA 5HW0A 2LTAA 4TUYF 3OFVA 1WCYA 1DRWA 3KXLA 1I4EB 4I5FA 2ERCA 4I2NA 2XCUA 2FEKA 3TIFA 5JFGA 4G4JA 4DILA 2YV2A 2O07A 1ITZA 3BHMA 3OJWA 4R0NA 4BMZA 4KOEC 1MJNA 2WJ3A 1NVWQ 2UZIR 5LZ8A 2VDNB 3LCRA 2IP2A 2EKLA 1G20A 1YL6A 1CUFA 1JMVA 5CP8A 3HKBA 2FW0A 4L8VA 4KQMA 3HDQA 2XGJA 3RFCA 1QU3A 5JC8A 1EFAA 3R7LA 4E33A 2C4HA 1CB0A 1KU6A 1NGSA 1KYIA 1Y6QA 3O47A 3MC1A 1XTTA 3D3WA 4OU4A 5IVPA 1PSWA 3UK1A 4E51A 4QARA 4LOAA 5EGNA 4CZ2A 4D9HA 5C5IA 4EKNB 4IUBS 2I2CA 1PDVA 1V1JA 2QA5A 2ZVJA 2RHOA 4GX2A 2WAOA 1A04A 3T8YA 1RYFA 2HYDA 2F43B 1L1EA 1C9MA 4GOOD 4ZHQF 2J30A 5EI5A 2C7QA 3H5OA 3U31A 3T15A 4JODA 2Q62A 1U1GA 1KFCB 2C82A 1ZBQA 2FPIB 2WIKA 3FNRA 3NOQA 4IHJF 1A2KC 1QG2A 4NJMB 2QTLA 4OBXA 5D84A 3EIWA 4DGSA 4MIEA 4JUCA 1LBIA 5ICEA 3S8EA 1EBFA 1L3IA 3CSDA 3O95A 4KGVA 4HQ6A 4KVZA 4AKTA 3OU7A 2WKSA 3ND6A 2CNBA 2YY5A 4R3UC 1MO5A 2R7AA 1K8XB 2D2IA 1K7SN 1YS4A 2IXTA 2YOHA 3BXGA 1CSEE 1XDZA 3I1FA 2CXHA 1DBIA 4TMVA 3PRYA 3ZGLA 1SY7A 2YWFA 3F5DA 3T6KA 1A9RA 1GCGA 2JD0A 4UZEA 5ITVA 1KI9A 4XFJA 2R1UA 5KJ1A 1R5OA 1P1BA 3G9TA 4P0TA 2HLDD 3VSDA 4M8LA 4HYQA 5DMXA 4L22A 2WWRA 2XSZA 4C4YA 3LUAA 4GPD1 3RO7A 4R6WA 1T34A 3V48A 3C6BA 2X0IA 2Y68A 5DSTA 1UT8A 2FPKA 5JS2A 1VG9B 2POCA 4CCYB 4TXJA 1PUIA 1S96A 1D8TA 2TMYA 1RRMA 2KI5A 5HG0A 1CF2O 1E9RA 4IIFA 4BWYA 1WL8A 1N32B 1OX5A 4FZVA 4UUMA 1P77A 2JJ2D 2EKZA 2QLTA 2WSSA 4HJXA 1OROA 4YUZA 2FKNA 3LHFA 1FDRA 4UNSA 2D0OB 1AZTA 1E0KA 4X1IA 5IH3A 4K9RA 4EUNA 2ZXUA 1LBEA 1U6IA 1OPRA 3VJKA 1U1CA 4B32A 4BO0A 4YQFA 3ANYB 4PZEA 3UH0A 2UU9B 1VFNA 2P8SA 5IANA 1D0IA 4JBLA 1D1TA 1PQWA 4PYIA 5LXTF 3FZYA 1NMQA 1Z3CA 2FCAA 3P9IA 2FPUA 3VM6A 5LN1A 2AYXA 5D5PA 3SLGA 5FOSA 4OHCA 4QNMA 2R62A 1OD6A 1E1CB 1DAMA 1RI3A 1CR1A 1PW5A 3MAJA 4BX0A 3U44B 1EZZA 3DWEX 4CLRA 3UXEA 2Q29A 2XOKD 1N3BA 1FYEA 4C05A 2HBRA 3WHKA 4DADA 2PLFA 3TMYA 4F3CA 5I9IA 4JC8A 3UJ3X 3T3NA 3ABRB 5J4KA 2UYGA 4K28A 2WHQA 2CE7A 2DHEA 1JA1A 1UIMA 2FZKA 3JVUA 4ND7A 4QG7A 1A3CA 4PGMA 5FWYB 3ABOB 4F9FA 5C7YA 5I8WA 1S3FA 3GJTA 4FZJA 2WYHA 4N76A 4JXKA 3B36A 4URFA 3RNOA 2GYWA 3IP9A 2Y99A 4YWJA 3D8TA 1FX0A 4FYKA 1X1DA 2QV0A 4OSEA 3DPIA 3SLKA 2EC5A 3O93A 4N0MA 5AKEA 5H83A 3LG2A 3EQ2A 4D45A 1GRCA 4RDCA 3AYXB 1P2VA 1QIFA 2GD2A 3H3FA 4U0JA 1L5MA 1UXGA 1QONA 1UR5A 1E3JA 2E5WA 2I6GA 4ZAFA 5AJUA 4AO8A 3OEYA 3H97A 3SS9X 2JFWA 4BLPA 2HRRA 4YJHB 4BVAA 4E1BA 2AEJA 4RYLA 5BUZA 3LP5A 4FQ7A 1Q0LA 3EXG1 4DV7B 3DVLA 5EUQB 3S3TA 4UM9B 3WHIA 1TUEA 4H16A 1YCFA 1HFKA 1CVLA 4GD3Q 1DEKA 3G8BA 1E3IA 4DCMA 1BCRB 1IHOA 2FMHA 2JGEA 3UICA 2O8NA 3B13B 1M6NA 2VEOA 3VPDA 3EVCA 3LYUA 4BUJA 2F1KA 6REQA 3HYCA 2LUOA 3ZXYA 3W1WA 3C3YA 4JEMA 4N41A 1VLZA 1ZXBA 5GY7A 2IIVA 1KARA 4QUIA 4F5YA 3TL3A 1EWKA 2V7PA 3N70A 1BE1A 4JEHA 4PX3A 2HJWA 4ENQA 5CAEA 4TKVA 1F0YA 5JXWA 2WP0A 1BKDR 3NC1C 2J6HA 1KH1A 2JZOA 4NOLA 5EZYF 1UPAA 1XWWA 2C97A 1M8GA 2R8ZA 5TPZA 2CL6X 3B1YA 4G5RA 4TTJA 5CT4A 5FORA 3HV2A 4KUHA 1KAOA 2OB1A 3N07A 4F5WA 2QQFA 4KBYA 2WU0A 1XQ9A 2ZFUA 3DOCA 4HXYA 4BATA 5JS7A 4C2TA 1MJ5A 2IYQA 1CRPA 2GCPA 5IEBA 5HWSA 1ZIYA 3D4PA 2VCYA 3QE4A 2WIGA 3ZHZA 1EFVB 3L4BA 3M5DA 4TQAA 1KK2A 4M1QA 5IAJA 9LDBA 1A2OA 3B2QA 1XEWY 1HPLA 1N6KA 1Y33E 3PVZA 4LOLA 1X74A 2A0XA 3B1KA 1PKXA 4RQAA 3QBVA 3IV7A 1FSFA 4HZUB 4XUGB 5AHXA 1EVQA 1X42A 2A9KA 2YV4A 3UWMA 2GASA 3ET4A 1M2VA 2UVQA 3E5NA 3WLTA 2AMJA 5AVZA 2W8ZA 3QEKA 1JTVA 2PRKA 1QMPA 3TRJA 1NT2A 2WHPB 2ZLBA 3ZR4B 4BRSA 2ZEJA 3T9AA 1XDWA 5IEJA 3I1JA 4WAUA 1X13A 1XMIA 2WT8A 3EFEA 2QI9C 3THSA 4AKSA 5K6AC 1YZGA 5AHOA 3PGKA 4DFDA 1ZVMA 2AKEA 5SYMA 4DMFA 3HDJA 5L3QA 2DBYA 3HK2A 4AY2A 4DPLA 1LPAB 3FHJA 1MX1A 3AUSA 3HWX1 3GJ6A 1V5WA 4GM0A 1NT4A 3PGA1 4JJ8A 4Q1BA 1ESNA 3RBZA 3X0DA 5FBVB 3FMIA 1UZLA 4JNCA 2Q9UA 2OLJA 3B1ZA 4PPYA 2OYCA 5DHRA 3QNWA 1QDLB 4R8VA 4EECA 3SIWA 2W6OA 1XCOA 3HV0A 1IXRC 5KU1A 1KI7A 3TDNA 4CHGA 3HJHA 3N0TA 1ZUWA 4EK9A 2A5YB 5BSVA 2KSQA 1H2HA 1WP9A 4AF6A 1JQKA 2TMGA 2X6QA 4DW8A 3J81k 1S8OA 1YL5A 3GA0A 3QF4B 5EYPA 2Q5FA 2XLBA 2ZUTA 3D5TA 1ILWA 5LCXA 1LU9A 3EFOA 1NOKA 2XBLA 3JWGA 3KKPA 4Q4LA 4AL4A 4NYJR 2ATVA 1ZXXA 3BJIC 5I8ZA 4B0OA 1NZFA 2J4CA 4OXYA 4ZWNA 3IEVA 5EE9A 2W2TA 3RU2A 1JJBA 4BNUA 3A05A 4LYEA 3CN9A 5AKXA 5BN5A 1EE9A 3IX7A 1WBJB 4Q39A 5L7WA 2CMFA 3O3NB 2PMEA 5HX7A 3MJFA 2EERA 2NSDA 5DI9A 4CM4A 2IUFA 4MB6A 1XZBA 1IAQA 2ZJAA 1RZRA 1I3OA 2QVLA 3EJWA 1GA6A 2BC9A 4KYVA 3HEBA 2Z8ZA 3N3AC 4BJ3A 2BFCA 1JGTA 1OXTA 4M89A 4BV9A 4HVLA 5L3SB 4FMBB 4U7TB 1SG9A 4D4KA 1IIBA 2BSXA 3A0RB 4BQEA 4DV0B 4YMLA 2HSDA 1T3LA 5DV9A 4DXHA 3H75A 1JR6A 2G9ZA 3PZBA 1UFOA 2I4MA 2JAUA 4TXLA 5AKLA 3BEDA 3EPJA 1TCVA 4P3XA 4NYIQ 4OSPA 4JDUA 3B60A 5B58T 2C3YA 2VPWA 5KOHA 2Q1TA 3SNKA 3T5GA 1XAJA 3MB8A 2R1VA 1WB9A 1J7JA 5AK6A 1EDZA 2O0LA 1VIYA 4Y2PA 1Y8QA 3MMXA 4KO1S 5BWOA 4MJ7A 5J2UB 3EB9A 3G49A 1W85B 4UCQA 3TE7A 3HXQA 3MIZA 1Q0TA 4G8BA 3A9UA 1E6MA 2FV8A 3JZIA 4K1LA 4AW9A 3GJRA 4P8RA 5K3OA 5TJ9A 4DRZA 1XPUA 3PPVA 1C1DA 1NOIA 2IP4A 5JNSA 2RGUA 5K8IA 3AI2A 3CSUA 1KMHA 3QBTA 1OAOA 1EQUA 1E7MA 3FY4A 3BD8A 3H17A 4BFYA 4GWKA 1B6SA 3FNQA 5FOWA 1MOSA 3MCAA 3LUHA 1B76A 1S2LA 3PTAA 1Z63A 1JJVA 4P22A 4B6QA 4WVFA 3CR3C 1WZCA 2IHJA 2PKEA 4QYXA 3PK0A 5DISB 4B8YA 5CLJA 1YWGO 1NMEA 1OT5A 2G28A 1YRHA 1FMTA 5DGIA 1ZWLA 3V4LA 1TM1E 2ZRBA 1IOZA 3KEQA 4AXXA 1IEQA 3L04A 3RVJA 5FNVF 3V4OA 4KLRA 2IHNA 1NI4A 2BW0A 1NE7A 1V9SA 2OWEA 1VLHA 2ZWPA 4LF5B 1GM5A 1Y5LA 4P3KA 4Y30A 1O4WA 3SR0A 2ZYAA 3IRUA 1SXGA 1UK7A 3N2KB 4M9UA 5K8TA 1EEXB 1NM5A 1KL7A 1ZJJA 2FEPA 2Q2VA 3K3PA 3K4PA 3LKDA 4Y9DA 5D00A 1TM7E 1JFVA 2X7JA 3CUVA 1TC2A 2GN8A 2IYWA 3HCDA 2O52A 1AM4D 4OMUA 3DFIA 3SLRA 4XLZA 4ZN6A 5FUQA 1JG3A 3LCUA 3CZRA 3QTTA 5GVRA 2IY9A 1D03A 4NBKA 5DM70 1DARA 4HB0A 1Q1EA 5LQAA 4S24A 4XGKA 5DE3A 2Q7DA 1JZSA 1XMPA 4PS1A 3WOHA 5HZGA 4KAJA 3RVMA 5LSAA 3C3DA 4N12A 3UJCA 4KQWA 4U2FA 1OTXA 2Y66A 1TW2A 2NSYA 5JWHA 2GX6A 4ZYUA 1M83A 2JEZA 3ORYA 3UJDA 2I7CA 1NHGA 3B8HA 3OPYI 3T5BA 2EBHX 3DBLB 2PJUA 3E58A 3G9QA 3EXHA 4YJKA 5TJHA 4Q15A 5HF5A 4ND4A 2CVQA 5FL7A 3NAMA 1M2OB 2JFQA 5JJBA 5D3MB 1WP4A 4NS4A 3A4LA 5INTA 4TL7A 2R85A 3AHIA 2HSEA 3HB4X 4YI5A 3UAVA 2IEYA 3N39C 3TO5A 4CUZA 3V7YA 3K6JA 2JD1A 4AYXA 4E2FA 3OJFA 1RAIA 2V3CC 2OR3A 4PGGA 1T1SA 3GZNA 2BGJA 4H0FA 3H1PA 3ZNOA 5K9ZA 1TNDA 4O29A 1AF4A 1DCFA 1CR4A 1JRLA 2EF1A 1IN4A 1GL3A 2VDMB 3EGXB 3GEGA 3C70A 3JAWA 1N2ZA 3KUUA 1Z74A 1OU0A 2E85A 2WOOA 5ENVA 1YB5A 4FFRA 3BJRA 3FXAA 3T4PA 2H51A 3G88A 4YPFA 3TL6A 3VV2A 1U3WA 2HWYA 4BN5A 3DAFA 2QTVA 1LKZA 4D3ZA 2O0KA 4EG8A 2FMFA 3KB8A 4C21A 3D1JA 2APJA 4G5SA 4EJSA 4QBGB 3EK2A 2PBFA 2MCFA 4C5BA 2FF7A 1HDIA 2B2XA 2G5TA 3AKYA 5I7SA 1L5YA 3D0KA 4H27A 3VKUA 2I65A 2NXCA 1GARA 1GQOA 1JEAA 1I5OA 2H16A 4M6WB 4X6YA 3W06A 4A5SA 1SXIA 2G76A 2GMWA 3DLAA 2C59A 4G0XA 3TS1A 2ORWA 2D2XA 2YDYA 2QMYA 4G5QA 4QBHA 1LSUA 2IHYA 1E6LA 2BELA 3IUJA 3ZY2A 2E1RA 2Q2OA 2V59A 1PEDA 2QYTA 3EISA 4Z3DA 4OP1A 5BQFA 3B6MA 1GPLA 4YRAA 4E5DA 2GVNA 2A3NA 1C1XA 3R0QA 1KNXA 3KYDA 2WWVD 4TT3D 4TMXA 3UTDA 3EVFA 1XF1A 5M2QA 3K09C 4E2XA 4HADA 3OCZA 5H9VA 5NLLA 4Z1OA 5JNWA 1TGVA 1BKSB 3I6BA 2DETA 2TYSB 1QGDA 1U2PA 4IQFA 3PC8A 3UQYS 3C3CA 4ZODA 3WZLA 5A1TA 2I4TA 3GLUA 3QH4A 4JJ6A 1G8SA 1K5DA 1TQ4A 2NZWA 3D5QA 3FKJA 4JBXA 4GKKB 3UKDA 1C0PA 2UZ0A 4RY9A 5A9TA 1G8HA 3HXMA 3CKLA 5ADHA 4OHFA 1T6XA 4FGWA 3QNUA 1NYTA 1PR4A 2PWPA 1MGPA 1ZUNB 4C4XA 2OQVA 5LNK1 1X92A 1SOAA 3HO1A 1JEJA 2BZ0A 2WKQA 3EVAA 3NKVA 2E5LB 1PJSA 3COVA 3K1TA 3QXXA 5D1HA 3PIDA 2H31A 4LV6A 1FDVA 3C74A 1BRTA 3OQVA 3WKBA 4H3SA 3BMCB 3BA6A 3NH9A 4OD0A 2E4UA 4RTPA 1GUZA 1K0FA 2Y77A 4WFJA 4YQZA 2GDJA 4WK2B 3I4CA 4MIOA 3O4GA 1ZQ1A 1FJHA 3ZHCA 2C7GA 3OM0A 5F3RA 3GA7A 3A25A 5IYZF 3WL3A 1UKBA 1IBRA 4K5QA 2OCDA 4R54A 1FMCA 4Q02A 2RJOA 4CTMA 1P5HA 2VG8A 4BPBA 1V95A 5DN6D 4R6XA 3QOYA 5GQSA 3I5AA 5CBPA 2JHAA 4BDSA 3OIYA 1SC1A 4RQTA 4L02A 1SIBE 2O2HA 3IUYA 4XE5A 2NSHA 3CF0A 3NC4A 2HPAA 5F4BA 3RTBA 3STHA 1A4IA 4F3TA 2Y9PB 3UJHA 4X20B 1EXVA 3VISA 5FBQB 1DWQA 4O6VA 4UCXA 3CVVA 3P9SA 1CVIA 2VJPA 1IWPB 3FR8A 3LA8A 2SCUB 1GA4A 3O94A 5JIBA 3CMMA 5A2QA 5C3UA 4CU5A 3RVBA 5JAPA 5T5QA 4DSTA 3I58A 3GDWA 3E9YA 1U90A 5C0OE 1WCIB 3ZZTA 4GI7A 4AD8A 3TNJA 2DBVO 1H2XA 1RMYA 1D8AA 2Q21A 3EMKA 3GGSA 4PHFA 4R8KA 3BFJA 4C2BA 4E3ZA 3F73A 4YO8A 4BNJA 1PWEA 2XTNA 3RUPA 3LLSA 1TOAA 2UUPA 3BKXA 2V6IA 3QELB 5J63A 3VYVA 5AW8A 5KX5B 2MTBA 4MP6A 5A06A 4LZNA 1ADFA 5CXSA 4Z9FA 2ABWA 3A6GA 3HL4A 4RTQA 3L0DA 3CO5A 5KWIA 1P2SA 2VKQA 5FAXA 1K3UB 1ZNYA 2AEEA 2CXUA 2ZU0C 4UVGA 2F6RA 2RGAA 1JHXA 4MUFA 1FVXA 3CCCA 3CPJB 1GLNA 1MH9A 2FMKA 3AZOA 2D1FA 4XYLA 2ZROA 3R3WA 5H9WA 1OB5A 1DC6A 2WD7B 2RHMA 5LLDA 2DBRA 3HKDB 1PG5A 3ZBTA 3II6X 1UWKA 1RLJA 3PHCA 4OIFA 2IYRA 4KLZA 3IVRA 5GV7A 1SUSA 1VECA 4B71A 4FSDA 3FYUB 4EHDA 1C0KA 4Q00A 1K5PA 1HNWB 3ETDA 4GGMX 3W5IA 1M2EA 1K8RA 1QH9A 3JYOA 3CUYA 5G4LA 1S5PA 1UDBA 1KZGB 2OORC 1G8KA 1KEEB 4UBOA 4UOZA 1OZGA 4QHTA 4XIGS 1E20A 3AFGA 1JSXA 1N2OA 3VR2D 3D02A 2MMCA 5EPOA 2XJ4A 3LRXA 5ALSA 3NWEA 4FU0A 2DX7A 1IN8A 3ECSA 3PFCA 2R7KA 1BEEA 2C9DA 4WLVA 4KMMA 1IQUA 4KRYA 1QJCA 1D2NA 3Q6IA 4KC0A 5KKAA 3K0FB 5JRJA 2P2ZA 3HLYA 4BRZA 1O95D 4PLGA 3L1IA 2HLDA 3UUEA 4UMDA 3ZBUA 2P9FA 4V1CI 1KXJA 4NCIA 4CMJA 4ZT3A 5DGCA 1A72A 5K0GA 3MFYA 3PFHA 4GLLA 2JDID 2NPIA 3ZHTA 4OHRA 2AFHE 4DGQA 1WU8A 3ZYZA 4OFZA 1BA2A 3Q41A 3AI1A 1KSHA 1ST3A 3SS7X 5AMXA 3SY8A 2G82A 5DSZA 3DEFA 5CFQA 1IVNA 1B8OA 3BQMB 1NX6A 1T6NA 2B0CA 4V38A 1M5UA 4XR9A 3C3PA 2I7DA 2NUTA 1RLOA 2VF2A 5IC5A 1KH3A 3UFXB 5HHTA 1JJAA 1Z8NA 1IVSA 1AHHA 2XQFA 3HB0A 3KYJB 3Q72A 4TRRA 2QD1A 4GIBA 2BFDB 2CYBA 2JKZA 3CRVA 4XAQA 1E2NA 1XQYA 2AS0A 3O1HB 3OZGA 1UOEA 4LHVA 1E59A 1OYOA 2R60A 4RCVA 4DYDA 3R5KA 4HVTA 1RAAA 1Z25A 2GBFA 1YV9A 3ROMA 1RHMA 3IAUA 3KU4A 4ASUA 4BMPB 4INZA 5CM2Z 4ZMSA 5EXPA 1GRVA 4KQJA 4PW0A 3DLIA 4RY2A 1KY4A 2OKCA 5JMTA 3I6MA 4G25A 5BR4A 4YDHB 7MDHA 2HLHA 4LE0A 4J7CA 3TOSA 3EUEA 1WXHA 4NCHA 2C9ZA 5AM1A 1LRKA 3PR1A 2GEJA 1U9ZA 3VNBA 2GJ8A 2XQVA 4KQ1A 1GZ5A 2DHDA 1U9IC 3BS4A 3DEIA 2HX1A 1D4OA 3DEKA 4YRJA 4G0YA 3AESA 2XNSA 3C6ZA 5G0SA 1KYWA 3O73A 5HJ2A 2MSWA 4YJ2F 4ZGGA 4REQA 5L3ZA 2I6SA 3GVXA 2GEUA 5B4TA 5L7YA 4ME6A 1OI2A 1MFPA 1BHJA 5H68A 2Z0MA 2Q6KA 3V46A 3U7GA 4TVOA 5AW7A 3QFTA 2HU5A 1RI4A 5CB4A 4DUZB 2RBKA 3ROKA 5L9AA 2XNKA 3LPAA 3SQOA 3WICA 1Q92A 1V5IA 3BB1A 2W43A 4FC7A 4KO3S 4PX5A 1SH7A 2LR0A 1PFKA 4LZJA 5DWDA 2A1UB 5DCLA 1XTVA 1J07A 5KQPA 3B6KA 3F1KA 3H2BA 4DCPA 1QX3A 2P9EA 8ABPA 4JD5A 1DKPA 1NBEA 3LF1A 3SXUB 1XCJA 2GM3A 3NYRA 4QDJA 4L5JA 4C1NA 3WRYA 5GZ6A 4LZPA 1J0AA 2CVFA 2IYEA 1EFKA 1ULUA 4DR1B 3M6UA 3EXAA 5HS4A 2CNLA 1JHVA 2VHVA 2E4XA 3AEQB 1JILA 4F92B 4EMTA 1C30A 3U6KA 3AL2A 2XVYA 1CJTC 5DO9A 1GKUB 1LWNA 1VJRA 1XG5A 1XMXA 4N03A 1E63A 3ZXIA 5IT4A 3AVWA 1ATZA 3PEVA 1ZIOA 2R6CA 1C7JA 4X94A 4I1YA 1HUQA 1N2EA 1ZM3A 3JPWA 3MD0A 2I54A 3CX6A 3QW2A 2HV9A 5THKA 3SJZA 1BRMA 1T9BA 3DM5A 4UOQA 4EHJA 2FFRA 2O2JA 5ARCA 2OO7A 1JLHA 2VDVE 3KOXA 3OAAA 3PGMA 1S2IA 4MS1B 3R74A 1XTRA 1NQUA 5ICSA 1MFZA 2QTWB 2VK2A 3K0BA 3MQ2A 4M9SA 4X71A 3T0GA 4EF6A 3FNFA 5FPKA 3C41J 3K5PA 2WJIA 2ZBQA 1A50B 4G0OA 2ATIA 1P0CA 2GPTA 3VYSB 1P60A 2JAPA 3BFKA 3QXJA 2HF7A 3O3OB 3WGMA 3IL2A 1WXFA 4FVTA 3TZCA 5EIXA 2JBAB 2PZMA 3OPQA 1V8PA 5CG1A 4YRFA 1PVVA 3RGWS 1JG4A 3T3MB 5IAAA 4M36A 3JQQA 2AJLI 3NBMA 4KQ6A 2C7PA 4R01A 2ZTVA 4JJ7A 4KO8A 4P5DA 2XRMA 3WK4A 3LM8A 1SCKA 4RAOA 1X1BA 4M8KA 4XPIB 5E6RB 1G38A 2NVOA 3C98A 3SXJA 3WAGA 2HH9A 3E7WA 2A3RA 1XPJA 4QUEA 5CB6A 4DR2B 1X9GA 2Q9CA 5G40A 1BXGB 1NFQA 5HNKA 4GYKA 3TKLA 2ZIFA 2AOWA 2G9VA 2WP8J 2Q3LA 1NXOA 5AVWA 1JQBA 2DHQA 3Q5GA 3VAYA 5KPJA 2YKGA 4OX9B 2H4ZA 2PRSA 5FULA 4W9RA 4DEYA 2FDCA 1TQ8A 1ZPDA 4FGZA 4L4SA 4M0UA 2IP1A 3EZXA 1NP6A 1S8NA 1Q15A 5T6MA 3HZOA 3R3XA 1GG8A 3PPYA 4W1RA 3EIQA 3WB9A 1UWCA 4FXPA 4BJ5A 1EUCA 1C3OA 4IGKA 2V0NA 3PDCA 3PQEA 4WDQA 121PA 4JI5B 4BLUA 5IF3A 3B7WA 4P92A 4ZU1X 2C4UA 4TN1A 1J8FA 5DHUA 3UA4A 2VT6A 1J2JA 5HCNA 3BZWA 2YZ2A 3C6KA 3OPVA 1GG2A 3REOA 5FOXA 4M1MA 3KQNA 4I1PA 2YFKA 2AQKA 4DYVA 4ZCRA 1B0UA 1M7BA 1DV1A 2OB2A 2V7EA 1Y3BE 5ETJA 3THWA 1NW4A 1SUFA 2HXSA 3AI3A 4TLEA 4DARA 3S1AA 4E15A 4PQYA 4LAFA 4Q3EA 2JK1A 3VH1A 1P17A 1G1AA 3KDAA 3ESQA 4HS9A 4IOJA 1V8DA 1ZNWA 2YXPX 4I3GA 3CRRA 4N5DA 4P0QB 5GGXA 3PUVA 2DERA 4BLVA 3LQFA 5K4HA 1F17A 3G2NA 4MRAA 3J7AC 1HDOA 4MGHA 4EJ0A 4XM2A 1T9ZA 4P32A 3QUAA 3QKSA 4N9QA 1BW9B 4X1KA 5E4JA 2QBYA 2HU8A 4GI5A 3KKNA 4W8GA 4EI8A 4I4LA 1N2XA 1NUUA 4U2KA 1AXRA 4EAQA 5JZVA 1OVGA 5J2TA 2D8AA 1QLJA 4K9SA 1PF7E 1WZUA 2IE8A 3EQ9A 4C30A 1V43A 2CV1A 5IFLA 1SC4A 2GZRA 3BD9A 4DNPA 1D1SA 1TZMA 2ZBVA 3HHEA 1XZKA 2IL1A 1TKRA 4WN9A 1A4RA 5CRIA 1ZO8A 2V97A 3M5CA 2PFSA 2AJCA 3DG9A 2PU7A 2X1LA 3A3NA 1XEXA 1FRFS 2IXFA 5HIJA 4EO9A 1T2FA 1K6JA 3KQVA 3U19A 1P5ZB 3VV3A 1MB9A 1H85A 3F46A 1XRLA 5BMVB 1WZIA 4E5UA 3A70A 2B25A 2V5VA 3BHNA 5LP6A 1G6KA 2P3LA 1K7FB 4K03A 4OMFG 4IPTA 3EIFA 4GF5A 4WKGA 5COQA 5B1SA 4EL0A 4P4TA 5H70A 1UMDB 4BO4A 2QMOA 1F0NA 4TWAA 1M2FA 3VAAA 4H1UA 1RHKA 3KUXA 3RRJA 4PC6A 2R2AA 2DFLA 2PYDA 2UYYA 4RS3A 2WJ4A 1BVHA 1EGAA 1SBIA 1IEWA 2WILA 3IR7A 3OHSX 5LM3A 4YAGA 4NCAA 2EP5A 2PX5A 2XMSA 5BUCA 4J29A 5D7BA 4F5DA 3ZDDA 2XGOA 3LUFA 2F3SA 2EU8A 1V3TA 2HCRA 3O9MA 3QXSA 1KH2A 5DCUA 2IPAB 3CCFA 2NG1A 3CA8A 4J0CA 3JATB 4W99A 4I3HA 3KXPA 4EW3A 1BE6A 4G2TA 4JX9A 1D7OA 2R8EA 1VSUA 2OUIA 4KWEA 4X97A 2ZYHA 1YB4A 5DX1A 3PJRA 2O5CA 3AV0B 4BNZA 1KYYA 4EQZA 3OIVA 5EZQA 2RB5A 3A28A 5TQ0B 3S81A 4KW7A 2LCQA 3SE0A 2VRCA 1MCZA 4MWZA 5DTMA 5LU8A 1FDOA 3PR3A 3H8VA 4PCLA 1UBMS 2DKFA 5D6OA 2OHIA 2RAVA 1NY6A 1IN6A 2V4MA 2XZDA 7YASA 3OJ0A 1U0EA 3A9TA 4NNOA 4B8ZA 2P67A 3DPSA 2X9QA 1FUYB 2BY4A 3TLXA 3Q6NA 2B94A 5KTNA 1GNPA 2GM9A 3IJRA 2Y2VA 4CV3A 3FTCA 4H6WA 4AQDA 3KJZA 1AU9A 4O1IA 1O57A 4PU0A 4EB3A 2Z43A 5A5VA 4YFVA 2QX4A 5FBWB 2IYAA 2CSUA 4C22A 4OHVA 5BPFA 3NDBB 4UHBA 1A98A 1TUBB 4KNVA 5KYWA 1D9ZA 4IRMA 3BSYA 2QQEA 5H1YA 1N2GA 1UIRA 4I1IA 3VR4H 5A0TA 3GWZA 2O7VA 4OXQA 1NJSA 2YYYA 3C6YA 1Z2PX 2EBWA 4UUPA 4ZVSA 1IWBB 1Q91A 3E9CA 3MPUA 2VWGA 5DGDA 3O75A 1EFTA 1RACA 1XLUA 1XKQA 3P8ZA 1T3TA 3Q3HA 4OXKA 4P35A 4F4FA 3ZV4A 4C0WA 3CWZA 5ALNA 1ZONA 1IU9A 4NQZA 1XLWA 2AK2A 1KP9A 1NXTA 1Q0SA 5JXIA 1M0EA 5CBKA 3H4VA 2IKSA 3LO8A 4FYVA 4U00A 5FQNA 3PT5A 2V96A 3OQMA 2VQEB 2CB9A 3S2GA 3FGNA 4BZWA 5DNUA 4MW9A 3F90A 3DBHA 3ONVA 4WT7A 2GRUA 2H5IA 3B6ZA 3TLAA 4UUOA 1KK0A 2JIMA 5KDOA 1UXIA 3I9MA 4NAHA 3BRWA 3W9UA 3JVVA 4BO7A 4MHTA 2H2HA 1XNRB 1W5FA 1R0ZA 2H59A 1XELA 3LF2A 3H2GA 2F1IA 2HMTA 4Y2XA 2D1QA 1Y9EA 4PHHA 2ZYGA 1A4UA 2WR8A 3A6JA 3MOSA 3ZI0A 4F56A 2AFIE 3VH4A 4QUDA 5KQGA 5BRJA 3PNVA 2PS3A 2Z5VA 1II0A 3BULA 3OIFA 4PHCA 4J3NA 3AVTA 1LW6E 3NETA 2OECA 4OA5A 1W36C 3AF0A 4X7BA 4KR9A 2JAXA 5BVHB 1LNQA 1AGPA 1YB7A 2XVXA 4N1AA 1DWOA 3KT8A 4NV3A 1XPOA 4UHCA 4OCZA 3I32A 1O0CA 3R9IA 5LU9A 2QROA 2JAOA 1N5IA 4WOBA 1EM8B 3VC2A 1TADA 3HWSA 1W0KD 2AMYA 2QQ5A 4MZXA 4E46A 3PJDA 1US8A 2C77A 4MRPA 1U98A 1ADJA 5AVUA 3KK0A 4OHYA 1F12A 1QIDA 4KKXB 3H6HA 3PPWA 1XVVA 3UAWA 2YL2A 5LQSA 3P5SA 3VHLB 4BVKA 3JQ7A 4A73A 2PL3A 4H7JA 3OG9A 4H6XA 5EJ7A 3ESYA 2BKEA 3K2IA 5DYGA 3KVOA 2G72A 5BWBA 1DWPA 1KXZA 1QAOA 1ENYA 1TRKA 3KSRA 1ECBA 2BM8A 1NU6A 2RBEA 1K6IA 4JCCA 4K3VA 5HF8A 2PLWA 2AE2A 1ISGA 2GF9A 2Q4EA 3R3VA 4IGAA 4WACA 1WUHS 5DHTA 5FV7A 4N65A 3I2HA 2XE4A 3I9NA 4Y2RA 1YCHA 4IDEA 5CYPA 3THXA 2OZLB 1LXCA 3OZXA 1PBNA 1TEHA 2GAAA 1LD3A 3R24A 1HTWA 3TFWA 1C2TA 1KJ9A 3BWYA 1NIPA 2WG0A 4E13A 4GSKA 4LYGA 4M0CA 3C3WA 3UAYA 5CFZA 1Z56C 5B6JA 3NEAA 4UCWA 5H3LA 4ZMBA 3V6LA 1JR2A 3QP9A 4TLDA 2G71A 3SSOA 4U1RA 5C8YA 3CRW1 5JNVA 4AG6A 4GUDA 5A4MS 3I34X 1YRLA 4IO1A 5DN6A 3L4KA 2CV2A 1IQ0A 3PL5A 5AJWA 1CNFA 3R44A 2F00A 3MMSA 4BAZA 3FDZB 4ZOLB 5B6PA 5HKLA 1LI7A 3LLMA 2P65A 1LF5A 2O8VA 4K1XA 4LVUA 5J4HA 3VA7A 1U63A 4WEQA 2MSNA 3B1XA 4ENUA 1R8SA 3BB4A 4JL6A 3MLEA 1QOQB 2OBMA 1EJBA 2YXBA 2ZRCA 1FSGA 1T24A 2NO7A 3QA3E 2WIDA 4ZDWA 3RS3A 3S99A 3TLEA 2R8XA 4Z7JA 3TE6A 1T36A 3PFKA 2PO5A 2FP4A 4GZLA 5DXFA 2OPHA 1JYSA 3KR1A 1SIOA 1ACMA 4PSKA 4M54A 1TA4A 4TKVB 2UVPA 4YCLA 3ZZUA 1W52X 4DR5B 3T35A 2HEGA 1SUAA 1VLLA 1YVDA 2YINC 4HGNA 4R9SA 4BLWA 5F23A 2HHJA 3AI7A 3NG1A 4K26A 3NRCA 1QX4A 3OBIA 3A26A 1ORDA 4V2UA 1ODCA 3NM5A 2JFGA 1M34E 4GC9A 3D6NB 5IM5A 3IO3A 1N6RA 3OOEA 2IHKA 1YHNA 4LTMA 4OHWA 2G3YA 2CKDA 5TB5A 4ARIA 4WBNF 3UT5B 3K0KA 5GOZA 4X7PA 2WA1A 3IAS6 2V7TA 2EX0A 5KJEA 4P58A 4KV7A 2J9YB 4Q24A 3RASA 2H11A 4HD8A 4JUIA 1BGXT 4K9PA 5KC8A 1YC2A 1XD2B 3Q7IA 1HNNA 3CIOA 1DFIA 4OB8A 4FFVA 4TLBA 4B7AA 1B14A 5KO2A 5DTIA 5BT9A 1WE2A 1E64A 1GZ7A 1EIZA 3EDMA 2PR2A 3DTTA 5LB2A 4A0HA 4UVIA 4IMPA 5EJ4A 3FFBA 4UZFA 3D7KA 2AI2A 4Z3KA 1QZZA 4IKPA 2FQ1A 4PN3A 5AIBA 3R8CA 5TY0A 5IXYA 2CXXA 3EMVA 4G1EB 4KO2S 5A3SA 2IZ0A 2JIZD 4AJ9A 2PNJA 5E7QA 2UVDA 3FYDA 3DZJA 4DB4A 4A36A 4RWEA 3CPSA 1WDKA 4E6EA 1ZGGA 1WD7A 1WV0A 1QORA 2JHCA 4V0QA 3U4QB 3ZHUA 3H6GA 1V48A 1SHKA 3IP3A 3KYBA 2P1ZA 5YASA 2MT9A 1WSDA 4LN1A 3PWSA 3KD3A 3ZIAD 1IC6A 2JH9A 3KWLA 1IY2A 3N2GA 4G84A 3ZGZA 2FH5B 1IY1A 1P7CA 3N0RA 2GN1A 3EX7C 3WFIA 4BO2A 1N34B 4UJ5A 1UPXA 3CLKA 3E9MA 1ZMBA 2W70A 1IEXA 1USGA 3RAFC 4R2HA 2XDYA 2X58A 1ZN7A 3PUWA 4EG7A 4XB6B 4ON9A 2JDIA 1QDUA 2RHCA 3CB4A 4MLCA 3MS2A 3ZIDA 3T41A 5A5DA 3U3RA 1R64A 3D8UA 1V7CA 1RAHA 3P0EA 5CFLA 2P6MA 2FG5A 2OCPA 5L6LB 4IDPA 3VR3A 4ZZ2A 4B4VA 1G3RA 4TTVA 4W9MC 3INYA 4IX1A 4OBBA 3ZD7A 2RCYA 4Q6BA 1RDFA 4TM7A 1WG8A 1JEEA 2E5FA 3O26A 1ECGA 1N8NA 3IMGA 4RFVA 1YONA 4FBLA 3BH0A 4GRDA 3A2MA 4OH1A 1FFWA 4HGZA 4K3UA 1FXWF 4X63A 3KQUA 1HOTA 3MHPA 2WMDA 5AVQA 1QNLA 2P69A 4OQMA 1IXYA 4XI9A 3T7AA 1UJNA 4WWHA 1FDTA 4MRSA 2BHRA 4PG5A 4OGKA 3LO5A 4B3IA 3BHIA 1KJZA 4CMGA 2W8BB 1DQZA 1JLKA 2JI4A 3C0KA 1TM5E 2QLJA 2FFAA 2ZULA 3QKRA 3SZRA 3N5CA 4J94A 5JARA 2FA9A 4KQFA 1H5NA 1GXSA 1QQ5A 2XJ9A 3T9CA 3Q8KA 3ASZA 3UGTA 1H2RS 1Z6YA 3C3MA 1IK6A 5AQEA 2FX3A 4MK4A 2XE7A 1O94C 4MV9A 1F4VA 1UKZA 1M6HA 1VIAA 2B35A 5EXEA 1L8OA 2YBEA 4IXNA 2PKYX 1OMOA 5HGXA 5F52A 4DZTA 3HLKA 1OUMA 2YTZA 3ZE1B 1CY0A 2XADA 2XKJE 3HU2A 3MT9A 3UKJA 4F72A 5M3BA 3EXIA 1NW8A 4I4NA 3OVMA 1QNFA 4AP6A 2L19A 1X7WB 5I48A 1NVVR 4YJ3B 2R6HA 4YN3A 4M1ZA 4GR5A 1D04A 4MMYB 2HCFA 3RIXA 4YMUA 1VJDA 2CLIB 3IC5A 4BO8A 5BRAA 1UDAA 2CXNA 3LBIA 1IBKB 4O2AA 4JI4B 2VH5R 1ZM7A 3KEFA 2D1TA 2NQ2C 2HPVA 3L41A 4URUR 3VNRA 3WLFA 2PUBA 1N5KA 2INGX 3MUNA 4HNGA 5C1IA 3JQ6A 5IKEA 3RS4A 1B43A 1I2DA 3VDNB 4K6HA 4KQGA 1ZOOA 1XXHE 4BLRA 4GYYA 3H5WA 4PICA 2QN3A 2ZWIA 3K15A 4R1OA 3RODA 3G2KA 1W2GA 1W8DA 1TJYA 2P9QA 1YS6A 3LUPA 4KJZA 1N2CB 5K0FA 1A1VA 5K8VA 5EKTA 5FLXA 1JIXA 1PV1A 4KR3A 3DE2X 1JEQB 3U4IA 4BN0A 4Z54A 5E3IA 4UQOA 5DHQA 3PHGA 3VNSA 1MX3A 1ESDA 1FUKA 4KAXA 4ES6A 2H4JA 1Z13A 2QR2A 1U2RA 5B7NA 3K0AB 2FUG6 1P9WA 2ZATA 4ZAVA 1B6GA 1IJFA 1TJ3A 2Q5IA 5CGZA 1GTJ1 4WXRA 3OT1A 4I4TB 2ZWMA 3T7EA 1V11A 1XT6A 1YZHA 4CUKA 5JDIA 1R0BA 1UJ2A 2RH9B 2WJAA 3QV2A 1ZRMA 4EGCB 1TIPA 1PWHA 1SHLA 5C8DA 4A2PA 4Z4HA 2PZFA 1YQTA 2WJYA 3AERA <