5IKEA

Crystal structure of mutant-d97n of peptidyl-trna hydrolase from vibrio cholerae
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
194
Chain Sequence
SQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHNELDLPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQELDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Unraveling the stereochemical and dynamic aspects of the catalytic site of bacterial peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
total genus 63
structure length 194
sequence length 195
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 5ikeA00
2NAFA 3OFVA 4YLYA 4Z86A 3VJRA 4IKOA 5IVPA 3TD2A 1RYBA 4QD3A 2Z2KA 2Z2IA 4FNOA 4JY7A 4QAJA 4ERXA 4QT4A 4QBKA 5IKEA 5IMBA 4LWQA 4DHWA 3KK0A 5B6JA 2PTHA 4FOTA 1RYNA 2Z2JA 4P7BA 2LGJA 4FYJA 4JC4A 4DJJA 3V2IA 2MJLA 4ZXPA 3NEAA 4HOYA 2JRCA 4JWKA 4OLJA 3TCNA 3P2JA 3TD6A 4JX9A 1RYMA 3TCKA 3KJZA 5EKTA 4FOPA
chains in the Genus database with same CATH superfamily
4HX9A 2BEKA 2HCRA 1EFKA 3OJCA 1A7UA 5KYUA 5KQMA 3ZDCA 3GRKA 4OYLA 5A4JA 1UBGA 3VISA 3A4IA 4BQRA 5IVDA 2VJMB 5A7HA 4GM1A 4K6FA 4XCQA 4MVXA 1Q95A 4ZQEA 4DSNA 2Y6VA 2AMYA 4D3YA 1MRZA 3E5NA 4P0QB 1WKCA 2JEYA 3L79A 1EBUA 1EEHA 3MGKA 3NUZA 1VLMA 4C2TA 1UJBA 2GK3A 3G8AA 4KC0A 4YMLA 3J81k 4PSKA 2Y1LA 2ZJ8A 3C41J 5EZ5A 4O2AB 4O1MA 3LHIA 1LK5A 4NFHA 1K7XB 3H5LA 1CUSA 1QBKC 2G4LA 4FHZA 2LZ0A 3EVNA 5I7OA 1M2GA 3K5WA 4NABA 4BO7A 4PYOA 4K3VA 3EAGA 1T36A 1II8B 2SBTA 1CF9A 3DUFB 1GNLA 1WCIA 1WOYA 3KZCA 4CM8A 4CR8A 5IZCC 3F5FA 2ZTMA 2VPWA 1L3IA 1WMFA 3TW0A 1WKBA 3ER9A 3DPIA 4OOFA 2V03A 5IJAA 1K86A 1W7AA 3OOYA 4WBNB 1IY8A 3C5EA 4EGFA 4BQIA 3AWIA 5ELMA 3TUIC 4RS4A 2JCYA 3HB5X 4RK4A 4ETWA 2GFQA 4B31A 4LDZA 1J5EB 1U0EA 2LP4Y 1NW4A 3AR6A 2FPSA 2E1PA 4EIWA 2MU1A 4TTSA 2OVFA 5FF9A 2IEAA 2QD5A 1W4CA 3FY4A 1W8DA 1Y5MA 1U7ZA 1URPA 2J3EA 2XXBA 1SHKA 1WV0A 2ZR8A 3BN3A 4IRMA 2G9UA 4ZVTA 2QVGA 5I5GA 1EKXA 2VQ6A 3SQDA 2P90A 3AMVA 2JD0A 4ALMA 3KXIA 4C0HA 4II2A 3BMXA 4L74A 2LNDA 2EWWA 4INAA 2EARA 4EF6A 2QLJA 2VJNA 4ECAA 5BWBA 5CLJA 5FQNA 4RPGA 2XSZD 1A8PA 2GD1O 1VJDA 3RJ9A 5JS8A 5I9SA 2GEKA 1ZD4A 2WIGA 1ADJA 2HU7A 2QV0A 2YR0A 3CKYA 4MW7A 4W82A 5F5LA 4UU1A 7GPBA 2IXAA 4F4DA 1KMCA 3C97A 3K96A 4RZIA 4WD3A 2H07A 4TRJA 1P29A 3DKPA 4HR7A 4L0CA 5DIZA 3E3NA 4HNTA 2BRUA 1QZXA 2BGJA 4M37A 4ZC8A 3BXGA 2C5LA 1SBQA 3NORA 4BTVA 5GVSA 4DR5B 1P7ZA 3GEEA 5K45A 4V0SA 3WYBA 1NXSA 2H2HA 4UTXA 3BB3A 2B69A 3GLRA 1I1OA 3TOSA 2AT1A 3DE1X 3NKFA 4BLQA 4CM9D 1Z9BA 1CUVA 2RB5A 4I55F 1J42A 1YWGO 4WCFC 3F4BA 5EIWA 4RK5A 5KNCH 2QQEA 1Q1NA 4M46A 1F2UB 2YYAA 5H9VA 5HGJA 2Q1WA 2XCLA 5LMNB 2RGWA 5BWLA 5BY2A 4FC6A 3A4LA 4FT2A 2P2GA 1C1YA 5FV4A 2QAIA 3KQOA 5DT9A 1SHLA 1STOA 4MR8A 3ZX5A 3LQKA 2WFAA 5GGYA 4ZEWA 3NDBB 4ENSA 1VFNA 5K9ZA 3FAKA 4WFJA 1P2VA 3KE9A 4JJKA 4W5QA 3U9LA 1H6CA 4BBJA 4TYMA 1P5RA 4BNLA 4GRIA 1NULA 1S8NA 4BO6A 3H9BA 3CUSA 4FZJA 2NO6A 1RFGE 1CT9A 2K2WA 3EBPA 5FFFA 2OQVA 1A72A 4HHEA 3VHQA 1JKJB 1HDIA 3OBIA 1Z0AA 3ABIA 1H0HA 1L5HB 2EKBA 1CDZA 1V11B 2WAYA 3F90A 3MJEA 4UHJA 5EFZA 4HXGA 3OQIB 3A6PC 1T8TA 1ZD9A 2IXDA 1BE0A 3L7BA 2WSYB 4Q82A 4I50B 3PIDA 3LSYA 4DL9A 4DEXA 4Z3OA 1VSQA 4MQEB 2CXRA 4J9UE 3IJRA 3T5MA 1RQXA 3UG6A 1GAJA 3RRBA 1XCGB 2RK4A 3LS2A 5J4VA 3IIJA 1N5DA 1XTKA 2ZIXA 3AXTA 2PBLA 2PGLA 4U3JB 1UMBA 3HSKA 5BNFA 5A3VA 1ZC3A 1EDBA 2KW5A 2WSSD 1UPUA 3EGXB 1A8SA 3UOAB 4DADA 2ERXA 2ZBVA 3BHIA 3PEWA 1H5UA 2WP8J 3FPHA 2GBGA 3ONFA 4YMIA 5C80A 3B3QA 1QO0A 1C3OB 4MIOA 2OCLA 3HEAA 1BCSB 1P7YA 3CN9A 1YULA 4UCQA 1MH1A 2NW6A 2HAEA 3VZSA 1V8BA 2FP4A 5JAOA 1C1DB 1EUCA 4WERA 4GSLA 1X39A 3AF0A 4PSDA 4A10A 4ETNA 5CEEA 5AVVA 3GT0A 1QHFA 2XTJA 1RAIA 4C5CA 4CV2A 3G9UA 2AZXA 1HXHA 3DXYA 1ZCFA 2OECA 3LVRE 1QM5A 2PAAA 3ICEA 4I5GA 4KXFB 2H16A 2WEKA 1C7FA 2Y9PB 4EFKA 4X24A 1NLZA 2CJXA 5EESA 1RLTA 1WSAA 3K6SA 3KEFA 1CETA 3CH4B 3W5UA 1ID1A 1UWCA 4M7PA 1VDMA 3OZBA 3EDCA 4NU5A 1TQ6A 5EHXA 3WL5A 5EJ9A 1GJRA 1VPVA 1A77A 3FFWA 2QR3A 4FWBA 1S7GA 1I2MA 1SC9A 2WSBA 2Y1OA 1D1QA 1J9EA 3HSSA 4J16A 4MMZB 4UNIA 4Y1RA 3TN7A 4IMJB 3L7OA 3F3YA 3MPOA 1EFPB 1GYRA 1QHHB 3EODA 5EE5B 5FBVB 1XN1A 5TEVA 3KZVA 1N6RA 2JJ2A 3MF4A 3T0IA 1YJAA 1N4AA 1A8IA 1G1AA 1OBHA 3CB2A 3NXSA 4FEGA 3V7YA 4S12A 4F45A 1SVMA 3F3MA 2XB4A 4GVXA 4B87A 1EHIA 3V4VB 4F4IA 2HLPA 4LRWA 2W98A 2OZEA 3TRFA 4ZD6A 3X1XA 1A27A 1K08A 2JAQA 3PYLA 2Z6QA 4MA0A 4R05A 1I32A 2VDOB 1FNMA 1GZ3A 5AM4A 3EG9A 4I1RA 4GP9A 4IMRA 4ZPXA 5FPSA 2QTMA 4CKWB 4ZZ3A 5HQJA 4KX5A 4UUAA 1ZM3A 5LQJA 1BCRB 1FRNA 4OXYA 4RELA 3COWA 1KMIY 3L0ZA 4I19A 3MCAA 4KAJA 5FO1A 1M0SA 3WSVA 1L3CA 5BYJA 2B34A 5YASA 2G67A 3AR8A 4IDHA 1V1MA 2FFAA 2P75A 1AQIA 2NM0A 3AR5A 5JDIA 3QTBA 5GZ3A 1KI2A 3FDJA 3W1EA 3OZSA 2ZK7A 3G2MA 3ZKAA 4B6RA 2HCJB 3HADA 2IPAB 5IC4A 1N34B 3U7JA 4DMUB 5KC9A 1RQGA 5DK4A 2GTHA 4TV9F 2LV8A 4OHVA 3BFKA 1PLLA 1ZITA 1KAOA 4I5FA 4HGOA 1ILWA 1P2GA 1UH5A 3MJTA 1TT5A 1U1IA 1LJ8A 4ZHQF 2BVNA 1WRBA 5BMVF 2X0IA 1OLOA 3I9OA 1P1IA 3ILVA 4PSCA 4ZZ2A 3OPXA 1TYEB 1T6BY 2IF2A 1E1MA 3RANA 2AC2A 3ZJUA 2EP7A 4FFRA 4J7XA 4JKOA 5EJ8A 1BU5A 1ISMA 3A4MA 1NI4A 4QEZA 3NBMA 1PWHA 3BFPA 2CXNA 2BL4A 2EX4A 2AVDA 2H0AA 2HIGA 2ZTLA 3DBVO 5MHTA 3KQNA 2MWMA 1ONPA 4RLQA 1XQWA 4ZYWA 3TUZC 2QRPA 1ZVVA 2Q4TA 3KALA 5BR4A 3WFZA 3NNSA 5AW6A 1XRMA 4QKQA 2CCKA 2R6ZA 2YXNA 2KX7A 2NUAB 3V80A 3KYDB 4O8CA 5I8ZA 3QKSB 5BT9A 3W90A 4W1RA 4ALJA 4B3DA 3T5CA 1JALA 2R3SA 4B3XA 1KKUA 4UHBA 2WC1A 1V0JA 2YUIA 5LZ7A 1N32B 2GUGA 3A4VA 4W1SA 3TOCA 1GAQA 5DHFA 2ONJA 1PJLA 4C7JA 5JD6A 1ZEJA 2ODBA 1FA9A 5C2JB 1PK9A 2G40A 1ZRNA 2WV9A 2FRDC 3QVOA 1DCKA 3S6JA 3UJNA 4MO2A 4N0QA 4X1IB 1GGMA 1JDJA 1MTZA 1RPAA 4EAAA 3PFWO 4MULA 4CL3A 3DVRX 4KQFA 1E3WA 2X6TA 1CP2A 5CGZA 3PWSA 1VZ3A 5FORA 3TNYA 2OHIA 3D5TA 2KWIA 2HWWA 4GD3Q 1XQ1A 5CIQA 1IL0A 3ESCA 4XWKA 1ZIOA 2NUPA 4L27A 3ZIAD 1U5BA 2A2ZA 1E1RA 1J0BA 1ZI6A 4EHKA 3OFSA 1CNFA 4HLDA 1PQPA 3G9ZA 3IS3A 1L4FA 2QMEA 3I53A 3IP5A 2I4OA 3LMKA 4PBTA 4XAQA 3ZLVA 1OBCA 1GKKA 1O7JA 2Q49A 3NHMA 3FCAA 4PBSA 2A92A 1VE6A 4AF7A 1T3HA 2BDTA 2JEZA 2ZYUX 4R1QA 1ISHA 3T34A 2I7DA 2AQHA 1OXTA 2V6JA 5B12A 2ALJA 3TLBA 4CL2A 1XQVA 4LXUA 2GEVA 2ZE6A 3T61A 4YHHB 2PZGA 3BS4A 4R0NA 1CIPA 2X5OA 5B1YA 1JTFA 2WTUA 2VDNB 2GYYA 5DYWA 3PDJA 3WKEA 4RTPA 3WGKA 3O8QB 3PDHA 1BN7A 5FNVA 4BKPA 1INLA 5FUBA 1RACA 4KLCA 3UYKA 2CNBA 4WECA 2IYXA 1WB4A 4BRUA 5FOTA 2YN0A 1UBUS 2C29D 4AAYA 5DNYB 1CUIA 4N0DA 4U2FA 1R66A 1VP3A 1JG6A 2VRCD 3EAQA 4QHYA 2AN4A 2PH3A 2OHVA 2X4LA 3GJ5A 2VUIB 1X80A 1SA0B 2EKDA 4G0ZA 5JYBA 2DLDA 5T41A 1AXGA 2D8AA 2SHKA 3DQQA 1XL0A 2CL7X 3C3PA 3SJ7A 1UBKS 1NDQA 4FVTA 4UXIA 5IT5A 1XCOA 4JAVC 1K0UA 2ILTA 3QVGB 3DO5A 4XLTA 3JQEA 3VJRA 2WZQA 3TTUA 5LJLA 3O74A 3G1TA 4MIYA 4GBMA 1Z25A 5FOVA 4M1ZA 1AB5A 1UC8A 3E7PA 4KGXA 1Z38A 1P1RA 1V1JA 4QDXA 2CZQA 4Q4AB 3A9VA 4TWIA 1ETUA 3DWEX 3LU1A 3MWDB 4S1WA 3E9QA 5K3FA 2BEUA 4KPYA 3H8VA 3ROKA 1K9SA 4G85A 1L7XA 3Q8XB 2VQDA 1Q14A 5EQJB 3RTAA 5J2UA 3WNDA 2V5UA 3QEOA 1Z8DA 3HCRA 4YJDA 3AESB 4BNNA 4YCMA 3PJRA 4FGZA 2O54A 3KTFA 3PSAA 1EGAA 3F5QA 5CJJA 1EFRD 4XPIB 2I2CA 2YJTD 3R3SA 1KRXA 4WK4B 4HMQA 5DCYA 4LS3A 4P2BA 4JIMA 2UUOA 2I4NA 3LV8A 4JJFA 5KJ6A 3FOEC 4AJOA 2C5FA 4BNUA 3BBPA 4MVJM 1I3CA 4ZMSA 3EGEA 3D54D 4JGBA 5JROA 3FWKA 3G13A 3Q3EA 1YTUA 4DEYA 4UNRA 3QY9A 5F77A 2O8DA 3T94A 3NJ4A 1TRKA 4IHJB 3PPIA 4LJ5A 2XMCA 1FUIA 3U40A 4CMIB 2A1UA 5D2CA 3A2MA 3KUKA 4LV5B 1JBEA 1UAGA 3ZKWB 3E05A 3IBSA 2EQAA 1HFKA 2P11A 5AM2A 1QX4A 2C2GA 4PX2A 3DV0A 5BURA 2JLUA 1IZ9A 1WZIA 2W6OA 2GJSA 1KIMA 4PGGA 4UOQA 2IRWA 3VPCA 4IDEA 5LYJA 4ZRNA 3PIRA 4FUQA 1P4JA 1MOPA 4FYHA 4DRZA 4ALIA 2Q3BA 1QWSA 3RYTC 5TY0A 1V71A 5G4KA 1XJ0A 2JGKA 3OQNA 1DRWA 1PSDA 3FMIA 4IJWA 4LY6A 4M99A 4RVSA 1G8YA 4R2JA 3NX4A 2UYGA 1J0AA 3EIQA 1QC5A 2DHRA 4K9MA 3PWTA 1KEWA 3L46A 2FQXA 2VLIA 4RF4A 3MWFA 4HQRA 5CXQA 1OH7A 1UBTS 1C8LA 1ADYA 3UENA 5AM5A 1Z0ZA 3AR9A 1MEEA 1VMDA 2JH8A 4IUYA 1FUYB 1OFIA 3INTA 1VLLA 1RTTA 2H1WA 2JGFA 4ZODA 5EP2A 1G6OA 4PNEA 5AI5A 5BYAA 1RCTE 2XR1A 1B6SA 3ET4A 1RR6A 3PZBA 3Q98A 4TT3D 5B3JA 1QYRA 4Z51A 3ZY6A 1N2CE 2O6LA 3KLNA 5JNUA 1JQEA 3EHEA 2O7RA 3IB3A 4LZAA 4QULA 3T1TA 4FP9A 2ZJ3A 4F84A 2I76A 3AM1A 1C0LA 1G0NA 3HQ4O 4XEUA 5E0OA 2RIPA 4UTRA 4MV3A 1FX0A 5EIOA 1N3IA 4YWJA 3G5LA 2XF2A 4NNPA 3IEVA 2X1HA 1DINA 5KNLA 4M0LA 4UHDA 3IELA 2DKOA 5AR1A 1C4WA 3HA7A 4FI3F 4DRXB 3SS7X 2ZJYA 4EB3A 1Y8ZA 1T9HA 4AZSA 1TMOA 4F1WA 4F9TA 4CV0A 5C32A 1DXYA 3NM5A 4HN2A 4QPJC 1SVSA 3EUEA 4G0OA 1U6IA 3DE6X 5KVSA 2G6TA 1L6IA 4XRGA 4BJ1A 2HRQA 2VKTA 1HEIA 3L1KA 4KK4A 2IEBA 1DBPA 1IHOA 3Q0EA 1QZTA 5FOUA 2P4EA 2ZTVA 4ZXFA 4Q5IA 2A1IA 1IOLA 3GUVA 4IIUA 4RADA 3DZDA 1JTVA 1FMJA 4O02B 1FQJA 1CUAA 3OQ6A 3VZBA 5JWOA 5JV5A 3X2SA 1SZJG 3MWKA 4JD5A 3VNVA 3C3DA 1EEXB 3HGMA 2YZMA 4FCVA 4FS8A 2PEYA 4ISCA 1LX7A 3FMFA 1PJZA 1L6RA 3FYUB 1E2LA 1RE0A 1H2BA 4BE4A 1AA9A 1SUAA 3N0VA 4RU1A 3CINA 5SY6A 4DLKA 3H2SA 3B1FA 2QLTA 4LWPA 3WV4A 4C0QC 3HJBA 3WLAA 5U4XA 1TVKA 4WOBA 1A7JA 5H83A 2ZVQX 2I2XB 3ANTA 3D4BA 3MUEA 4TMZA 3CEPB 2KJQA 1KDTA 3TO5A 1GPUA 5K6RA 1F38A 1LZKA 2FX5A 1JKMA 2FG5A 2ZBDA 3AHCA 1QX3A 1Q3TA 1TAQA 1U3CA 3H2ZA 5DYYA 2BTQA 2L82A 1L5KA 5HZGA 5DN6D 2QK4A 2BN4A 3FA2A 4OP2A 4JJ8A 2V7UA 1SB8A 3DTTA 3M4NA 1ESMA 1JJIA 2O2JA 4PHTA 4WL0A 3GLGB 1J0CA 1FRFS 4K9QA 4YAJA 1J6UA 5IHXA 4RK6A 3MJHA 4RO0A 3V4FA 3GLIE 4KK3A 4JKIA 1UFKA 3IQXA 1XZPA 3ORHA 4M22A 3HU5A 4F2HA 2M6KA 1XZQA 3R20A 1OAAA 2DTDA 1FXWA 2F43B 3IAAA 2F9MA 4IUDS 1YUMA 1G64A 4NCNA 3U44B 1YS2X 1HWYA 3QM1A 2XE8A 4L3VA 4S1TA 5E6SB 4DBLC 2Q0SA 2XQJA 2O8CB 2H2DA 3W77A 4DBLE 3MAAC 5KNCD 3V7NA 1E3IA 2NT3A 4EUKA 4FMCF 1VLQA 5D6NA 1UANA 4PONA 1KR5A 4MHTA 3GEIA 5I7VA 3UKOA 2VAPA 3BPSA 4DAEA 3QNMA 4MVJH 3NHRA 5DBOA 1HG1A 1ZC4A 1GQOA 4U2KA 4HCJA 4PX3A 3T3PB 3H1FA 1T3ZA 2QGFA 1R0WA 4G09A 4MRSA 1UT8A 2X4DA 3JRXA 3P9ZA 1H4VB 5CX1B 3JVDA 4MYHA 4W5JA 3UJPA 1U1DA 4YRZA 1VQ1A 4WXHA 1VI2A 2WSMA 1SKMA 1BMTA 4LJSA 1HF3A 2ZWPA 4LY0A 4JYZA 1JKXA 2ZUTA 3FNEA 5K3OA 1NQAO 4B73A 1G5IA 3LWDA 3MOGA 2OENG 4FBGA 5B1SA 5C8ZA 2GK7A 2ZYIA 1C1XA 3I62A 1IJFA 4NTZA 4TRNA 4L72A 3ZZNA 1NQOA 4GLLA 2O14A 4NXNB 3IJEB 2ZWVA 3WMGA 3OLZA 3GUYA 4ND5A 2A9PA 2P4SA 4JZYA 3OPMA 4I4NA 5FFNA 2XLBA 3RUAA 2EQBA 4MRMA 1EQAA 5BNWA 3AVVA 1X1RA 2KPOA 3HJHA 4M9CA 4Y2YA 4RNCA 4RQBA 3DOHA 3RRXA 3W5IA 3EN0A 3HMQA 4B8YA 1XJWA 1BEUB 4K9DA 3BREA 3VO2A 1JA1A 4PN7A 4HQFA 1Q7BA 3JQ8A 2WQ6A 1CVRA 5CVTA 1MT3A 1Q3KA 1QLWA 2EEZA 1RWXA 3RRMA 3VPSA 4C3VA 3DAHA 3GLHA 3JYHA 3KELA 3T7JA 3I72A 3NONA 3Q5GA 4IJMA 5BW8A 4D92A 5KWSA 2O2XA 4YYEA 2H3HA 4EABA 1P0IA 2DQSA 1C3JA 2RHJA 2QN2A 4QGAA 3D0QA 1N75A 1X0XA 4GQBA 3H42B 3QELA 5EMKA 4OXQA 3WR5A 3CISA 2VQFB 4FDUA 4Y2RA 3HVJA 3U26A 2PZKA 4F04A 1O03A 4OUDA 4PG6A 4R2HA 5DWQA 2BRUC 3HZHA 4V0NA 4KXWA 4N4AA 2UZ1B 4KQ1A 2RFLA 1NVVQ 1M6VA 1RP1A 1XZFA 2VP9A 3QE2A 4CUJA 3QFSA 4OI0A 5BYKA 1W47A 1NBMD 4OQDA 1GXSB 2ES4A 1KZ6A 3QU7A 3P2MA 4UBJA 5CVVA 3BRWA 3PNSA 3Q7RA 5L3ZA 2F7SA 2JFFA 2RAVA 2FLKA 3PQDA 4LZJA 1KZ7B 2B1GA 5C5IA 2ZREA 3ZD6A 1FZTA 2VNAA 2G82A 4LZZA 2P3LA 4EO4A 1Q0PA 2EZ9A 3RFFA 4M0DA 1JIIA 1LVGA 1O96A 2AOTB 2VF5X 2BELA 4ZO8A 4TRRA 1MOZA 3D3KA 2OUIA 2DH6A 1YOVA 1NURA 1HYBA 3RTGA 2ZVPX 3JQPA 4GG1A 3GDWA 1P7WA 5L4LA 3TH5A 5DOZA 2B4TO 4RY8A 1JKIA 3VX3A 1KOJA 3ELBA 4QDJA 4OHXA 1QIFA 2PZ8A 2FMXA 3U56A 2Y8EA 2N9UA 4OGFA 1SHZA 1NLFA 1XTRA 3FDXA 5DI9A 3M9XA 3U17A 1NQTA 4ES6A 1NI5A 3BWMA 4UASA 2ECOA 4UM7A 4YXWA 3D3NA 2GQ0A 1WABA 4XIJA 1HDEA 1X1EA 2HSZA 2CLEB 2CB0A 2OORA 3HB0A 4N6OA 1M33A 4RSRA 2V0CA 4UEOA 2AD1A 2D3TA 4IWNA 1M6YA 4B79A 3TSCA 2ZLBA 1SUDA 3R1IA 5CVJA 3G85A 4RMHA 4UAGA 1Z2AA 4ZO6A 2GN0A 4HRXA 5HZKA 4WCFB 3A36A 3ZHZA 5IF9A 5KDDA 3DAOA 4G01B 2H54A 4JYBA 1QONA 5L95A 2H00A 3Q0IA 1DX6A 2IHNA 4URXR 4GUDA 4RMIA 2XAUA 3H5WA 4PG7A 3ZWOA 4ND8B 1JLMA 1JE0A 1KSHA 3VYWA 3H2YA 3U0BA 3SN6A 3BL8A 2UUAB 2H9AA 3R3HA 4E46A 3OQJA 2HCFA 1XMOB 1E5XA 3TZHA 1CE8B 2VXBA 3V4LA 3ZLUA 2JJ1D 1WF6A 5L45A 4DV0B 4TYYA 1CNMA 1SULA 1FCJA 1ZD3A 2GPJA 2ZSAA 1PR3A 2AUMA 1RWKA 1GUBA 2XNDD 3KQVA 3OEHA 1NNI1 3HYLA 2XOEA 4EG6A 5BV8A 1L9KA 1S3GA 2BF4A 1R0SA 2WTMA 2P5YA 4HFRA 1K66A 4C0KA 3FKQA 3CX4A 1U02A 1YRLA 1Z0FA 3FNQA 2KB0A 4EGSA 1FS4A 2A9JA 3AF5A 5FIUA 1UP4A 1AO3A 2P6MA 3QEJA 4KBFA 5C7OO 2QBYA 4WSOA 4DLAA 3PYMA 3WO1A 3GHHA 3N7AA 1OBVA 4WZAB 4J16C 4TX1A 1QV9A 3I3OA 3NHUA 3I6YA 1G3MA 4B3IA 4QGBA 2Z8YM 3DNPA 2V4ZA 1GUZA 3N5CA 3LM8A 3UAZA 5DO9A 2QP3A 1WV1A 3W4JA 3RH0A 5E6UB 4YJHB 1J1UA 1GGKA 2ZCVA 2I4IA 3SXUB 3TL6A 3FN4A 4BO3A 5C34B 4I55A 5T4BA 1W75A 1KERA 4JIGA 2B61A 5AMXA 4F71A 4JQYA 2ZT6A 3TMYA 4OX9B 1VZ2A 1XNGA 2Z9CA 1KMHB 1UJMA 2W2KB 3AZOA 3OE4A 3BSFA 2IZ5A 3MHPA 4ZCQA 5KJEA 1ISSA 4GR4A 3A9TA 1UKAA 3OOHA 5FADA 3AVPA 4H16A 5K4HA 3OWOA 1KQGA 3EVZA 1VRWA 1D2EA 4IV5A 2A0WA 2AEMA 1BDMA 2VHJA 4LJ4A 5ER6A 4ZAWA 2X3FA 1TD9A 1P33A 3VZDA 2QRKA 5JUWA 3ANXA 4WLNA 2HM7A 4KV9A 4QODA 1SKYE 3DTNA 4KLAA 5DISB 5T4FA 3UXMA 1WZUA 1OLUB 1YQTA 2JAHA 2FPWA 2PKYX 4J7CA 3LQQA 2IQ5A 1ZHFA 4Q03A 4ZCRA 1P45A 3PT9A 4WN3A 4B6SA 3VDMA 4B7AA 5JMPA 3C6YA 3S8EA 2EFHB 1NYLA 2WFLA 2WP0A 3IVGA 3VU1A 1A9SA 1RAAA 3U5TA 3SHOA 4MKZA 4I4TF 5JZMA 1BXRA 3E6AA 4YI5A 2A3NA 4CN8A 2QX7A 4IGEA 2PLFA 3RSSA 5CG2A 5JXHA 4KOAA 5IABA 1LX6A 4XCVA 1GAEO 2CFIA 2Q9CA 3TRHA 4AS3A 4D79A 4DR7B 2WHRA 2ADOA 1KDRA 3H2GA 5JPDA 5BWMA 2WU8A 5CFNA 4JT9A 3W5CA 5KYYA 1PV1A 2P9HA 3PNPA 4BZQA 1Z36A 4V39A 3KU4A 2QIOA 3T1NA 1QRTA 4EI9A 1N2OA 1QH1A 3V8PA 5BVHB 1DJQA 3OU2A 4NMXB 4UM9D 5ESRA 4CHTA 5IRCD 4ZVQA 2HI0A 5ALIA 2R6HA 4QYIA 2GZMA 1BA3A 2JAWA 3C5WP 1KMNA 1T4CB 1CDEA 3N1UA 5HILA 1U7DA 4KH1A 5LZ8A 4YRGA 4BC1A 1NP3A 1M1XB 2HJSA 4RA9B 3COZA 4X6YA 2B98A 4FJ2A 3CN7A 2BGKA 4DTIA 1EFUA 5IEBA 1PR2A 3S68A 4D9FA 1A5TA 2W22A 5BSWA 4YDHB 2XB2A 3P4XA 2JCBA 3QV1A 5JO9A 2MSEB 3R3XA 2KE5A 5HE8A 2R751 3TLGA 2BR5A 2R86A 3ITDA 3QKUA 1JEDA 4OU5A 2FSIA 4KVGA 1XAIA 4RPCA 2P68A 4ENRA 5IXJA 3PHIA 1H5NA 4KFCA 1KXZA 1EJBA 1L4YA 3OLVA 5IMSA 2WQ7A 3NGMA 4PTYA 2EIXA 4L07A 1T0JB 1VPDA 4L5IA 5L3RA 1PR5A 4S1NA 4XQ9A 2AH5A 5LC1A 2CHUA 1A4RA 1NW7A 1U9YA 3B1YA 4EECA 3B53X 5MFZA 2HU8A 2IUEA 3WFJA 1E8NA 1BU8A 1NC3A 1OH8A 3FF4A 3URKA 1FZQA 4S24A 4XWTA 3MCZA 1OSNA 5HGXA 2J46A 121PA 2ZE5A 2XNCA 4XQEA 2HQSA 1J0DA 2I2DA 5HDQA 3W6OA 3KL4A 2H4YA 1X1TA 1D2GA 1QUEA 3DF7A 3RFTA 2HBZA 3QJGA 2BFAA 1YQXA 4A4DA 4PRYA 4MSUA 4BFLA 2DUUA 4JY7A 3WDMA 3MMSA 1G8JA 2B4KA 3H5OA 3Q3JB 1T25A 2GBLA 3BUSA 3GBPA 3VU0A 1EUZA 1VL1A 1YZVA 4R5HA 1HE5A 4WW0A 4AXXA 2O7SA 1FTYA 3G82C 3BZBA 1PP4A 3W7AA 5EXDA 3UWPA 3IRVA 3QHPA 4KVAA 3ROGA 3U13A 3UV3A 3PWZA 1P31A 4IEEA 2EKPA 3UK2A 2VEOA 3CCCA 1NPYA 1QGED 1YRAA 3VYSB 4KR0A 2NU6B 1U3WA 1CUHA 1KE2A 2IUTA 3AUTA 1SCKA 3E1GA 4TV9A 2C1EA 3UT5A 1RJGA 2BKAA 1QIGA 2AZ4A 1JHZA 1G3QA 1IHPA 1QKKA 1SO8A 2D74A 4UHEA 4BMYA 5KTKA 4RY2A 2NGRA 1TJ3A 2FLVA 3GLKA 4HDKB 3A6GA 4DDUA 3FSJX 4ZHQA 3UHAA 4PRZA 4ZYYA 2FB9A 3FB1A 3O4HA 4GICA 5L53A 1LBQA 3MJ4A 1UK7A 5AOVA 2DHCA 2ICAA 4NL4H 1W9MA 2ZI3A 3P9QA 1JILA 3PNMA 4EHIA 1HLPA 3CW8X 2VS1A 1VKZA 4MOWA 4ZAVA 4EG8A 5JALA 3QBTA 3T3OA 4ESVA 1IWPB 5DTMA 1YMVA 5L8VA 2I3GA 4L95C 3K6JA 3KYCA 4RABA 2NO0A 3ZK7A 2O7QA 1PZXA 4HO1X 2XXAB 3D5QA 3UGJA 5CDTA 1VL6A 3QXHA 2C42A 1RYBA 1ZG3A 1DOHA 1VHJA 3KM0A 3BL6A 1XVUA 4KEAA 4TL9A 4DLNA 2GZ2A 1AO0A 3O3MB 3O2NA 3DVQX 3LDFA 4ACBA 3KVVA 4JU8A 5EXXA 3FIUA 2GPAA 3KQMA 4XLLA 5AJUA 8LDHA 3UNXA 2EAUA 4G1BA 5TT1A 1LC3A 1L4HA 2AKAB 2PZBA 3E4DA 3LKZA 3HRIA 5HMMA 4ZYUA 5JSZA 2P7HA 5CFLA 1UEJA 3TCNA 1SOUA 3SBOA 2VHYA 5AOCA 2C04A 2YMLA 1AHPA 4GOMD 3PQ6A 4RWEA 3WIBA 1BQ3A 2AGVA 3AJEA 4K26A 3JR7A 4EWLA 1KS2A 4I6JA 1NT2A 4BBPA 3FTEA 1WB9A 3K0EA 3LGAA 4I1SA 4YMWA 2FUG6 4B35A 3KOMA 2HEIA 4MWGA 2AVNA 5F12A 3RC2A 1OAKA 1UBNA 1G8PA 1PYOA 3EXFA 4DQ0A 1ODLA 3WL3A 2E37A 1G38A 1R4MA 1H5QA 3ULKA 4O1HA 4E5PA 2JLCA 4IICA 4BQFA 4MP3A 4BXOA 1YZHA 2ZFUA 3ICOA 1HDOA 1V9SA 3LVFO 5A6SA 1XVTA 2FPLA 2ZANA 4F3NA 3HU2A 5FL7D 5DTJA 3ZI4A 1SZCA 4FDLA 1YKFA 2RJNA 5BXQC 4LJ7A 4EP1A 4K86A 3BE4A 2ODEA 5BP7A 2C8KA 4EZIA 2ZDQA 2PG3A 4JLUA 1GSHA 2OCPA 3M82A 4M9XA 3L1HA 4RZUA 4EG1A 4V02A 1EVJA 1SK8A 2MIIA 1AHNA 5IEJA 2IXTA 2Y9MB 1DSSG 1USGA 2BEWB 4DZRA 3JZDA 2AC4A 4E6PA 1V7PC 2VP0A 4U2DA 4I9GA 3IBFA 1F4LA 3L1JA 4C3OB 3NCTA 5THKA 2ZSKA 1NW8A 1WUTA 5BW4A 3T4XA 3L7MA 1H69A 5EWJB 3VDRA 1JDTA 2R7LA 1GPAA 1QVWA 2FHPA 2NYAA 1GGEA 2ECPA 2WM3A 4OQEA 4ENVA 3VXKA 4E5UA 2RKBA 5B3JC 5AHRA 1BXKA 4R2IA 5J47A 3WBFA 1APBA 5P21A 3KYIB 4MS1A 2Y0PA 1Z15A 3CVJA 1JIVA 3DLIA 3JXEA 4X20B 5F33A 1Z7EA 3ZTTA 2AG8A 1P81A 2YQZA 1PZFA 3TAXA 1XI2A 3G89A 4ZOLB 2O06A 4UU7A 3L4JA 5A9TA 4Q9AA 4DYHA 3B20A 4BLVA 4F93B 1U63A 1E4VA 2UYQA 2WTEA 2E5WA 3ZCRA 3WK4A 3EH1A 3H83A 1KRWA 1SU8A 2XCIA 1K6IA 2G7MC 4GSYA 1OYOA 4J1NA 2H1LA 3CVOA 3RKSA 1QO7A 1E3SA 1YB1A 2DAPA 1M54A 2GILA 2ID9A 3AEKB 3ORRA 2ECKA 3RV4A 1SM4A 4A8JA 2Z08A 3A9UA 3UHJA 3U48A 1PL0A 3NHYA 3LP8A 4OI4A 2DHQA 5CDFA 1NQWA 5F23A 3EB9A 1OFUA 1G20A 2WF5A 4DBVO 3KBBA 1YE3A 3DEKA 4P6VF 4BQOA 3NHSA 4YRNA 4BPBA 5ALJA 4ND4A 1MC8A 4DV5B 3H9JA 3K32A 3T5PA 1WULS 4DLPA 4OHZA 3ZEIA 2QL6A 2ZVJA 4IKOA 4DLSA 4DDVA 3ZDRA 3PQEA 1OLSA 2BR3A 3GZJA 2X7XA 4G25A 1N2CB 1X3LA 2B25A 3CLKA 3ZYZA 4FGJA 3ADBA 3OUUA 2HDWA 3A6KA 4MLDA 1C7ZA 4MMYB 4HNQA 2Z83A 4MW1A 3EZ2A 1DMSA 3R9XA 3UJDA 3EG5A 4MVJD 4Q3OA 4ZTUB 3ZQ6A 2I3AA 3LX6A 5ALXA 1IQPA 2CCJA 2N47A 4Z0TA 3U3OA 1W0KA 1AA6A 2J07A 2J7KA 4EPWA 4LF9B 3EXHA 4AT1A 1U7HA 1XYGA 4WA7A 1GGNA 2DBQA 1OU4A 1C5KA 4F8YA 3GF4A 2I6UA 4G67A 1E79A 1KJZA 4ZCTA 5FB3A 1UFVA 2PWZA 2PT6A 5HKAA 2F3QA 2GCOB 2NU8A 2HC9A 1SQFA 1TJ5A 4R31A 3TB4A 1T8WA 4C5AA 3G2QA 3HRKA 4W9MC 1W52X 2J48A 4W63A 2NZYA 5ABPA 4EB6A 4FM9A 3GEHA 2IHBA 2WF7A 2BFCB 2Q1YA 4AUNA 1C29B 2QD4A 2Y93A 1MO6A 1M0WA 1TT7A 3OCXA 2XF8A 5IM5A 4DXHA 2WR8A 3LCVB 1N0WA 5JMWA 2B37A 4JWTA 2O0MA 4JGGA 3MTQA 1J9ZA 1NU6A 4LVCA 3F6CA 3UAVA 1QGUA 2CLOB 3DWIA 4C08A 4TRMA 2VDRB 1Z13A 5TB5A 4F06A 4XVUA 4OJKA 2REXB 4QPNA 4IRUB 4DIOA 4ZVPA 4D56A 4BMNA 4RY9A 1T0BA 1USUA 2QN6A 4Y2PA 4FKBA 3ZZTA 4DQUA 5KNDH 3E3AA 1AURA 1DEAA 3NALA 2HY7A 3IE1A 3R8CA 1FLNA 1NA5A 2C9DA 4LMPA 2QAJA 4H60A 3LT1A 3K53A 3QU9A 3IC5A 4MO9A 4TQ9A 3V3TA 5IVHA 2XADA 5FI5A 4OHOA 4L16A 5LLSA 1MJ5A 4DHWA 1NZJA 2INGX 3QYPA 4CM3A 1UK6A 4ZVRA 1NXPA 2PRIA 3NTXA 4C4OA 2HXYA 2XRZA 3KJQA 1QR2A 2LDXA 5CCDA 3SLGA 2NMVA 2QMQA 2MTBA 4FZRA 3AUFA 5KWJA 3CJQA 3HDHA 1N7JA 1SXPA 1UZLA 3E70C 3IR6A 5CLHA 3I45A 4YRPA 4R7TA 4RZ2A 1QRUA 3G0BA 2OSBA 3R0QA 1O6CA 3N2YA 4ARIA 1GDDA 3CUTA 1R9JA 2QYSA 4FOOA 2GF2A 3PQCA 2D0IA 4D9GA 1B73A 1DVRA 4A7PA 1I4LD 1GR1A 2Q5CA 2XUHA 1D2HA 1G8AA 4FZ5A 4H1UA 3RT9A 5BSFA 4RJLA 2YY5A 3I9KA 3L8MA 1PJ2A 4P93A 5FLXA 3VZRA 3MUOA 2HF9A 4OYRA 4IJQA 1U6KA 5B37A 1GTRA 1DBIA 6Q21A 3KKQA 3BQNB 3LWNA 4F11A 1CR2A 2CHVA 5A0VA 1PR6A 3GLHE 1QXSA 3ZWCA 4CQLA 4C7OA 4WPGA 1QKIA 4OBBA 2FPXA 4OQQA 3ZVRA 1ZSYA 2JI8A 2C54A 5TPWA 3CPHA 3I3SR 5L3SA 1C14A 1O95D 3LPMA 3PDUA 1BWSA 1EESA 1SQ6A 1I4OA 1WCIB 4CM8B 1EBFA 4TLAA 1KI7A 2DFDA 2X58A 4HAXA 3ZV5A 3T1YB 1Q7CA 3Q8KA 2UYCA 3DTVD 3R6TA 2W2LD 3QXCA 1R0ZA 4QU5A 5CD1A 3VFDA 3W8RA 3LCMA 3MTIA 4PVCA 2A94A 1JL3A 4L0QA 4KNYA 4K46A 5DKFA 4LTMA 5AICA 4DPKA 4N82A 2GMWA 4GI7A 3PL5A 1J7JA 4DJTA 2ORIA 2EX1A 4KITB 5JTUA 1VCNA 1CR1A 1JMYA 3C24A 3IBCA 4M8KA 3UM9A 4UBKA 3ESDA 4YP7A 4ZWNA 3PI6A 4G81A 3W2EA 5FUVA 1B23P 3IP6A 1SHJA 4PZ9A 2EJTA 1WDTA 4D9JA 5AW8A 1JU3A 3SFZA 2OB1A 1AKNA 3UTCA 1LNZA 1SRQA 1Y1KE 3WWPA 4ARZA 5FWNA 4OSOA 1YV9A 3CX8A 4FGUA 3GJ6A 5CA0B 2MYUA 3THRA 4AJJA 4L08A 1USKA 4PYMA 1X7HA 4E4TA 4BFWA 4HB4A 1KQ3A 1SBCA 2BM0A 4N0MA 1B0UA 5CEJA 4QOSA 2GYWA 1KQNA 4UBOA 2L18A 2P4HX 2YXPX 1SOMA 2C9CA 4CW7A 2RHDA 1KYIA 4DNXA 3FROA 3O1JC 5DNVA 1CUGA 1IE3A 4EY6A 2VXOA 2JANA 1VP9A 1W94A 3O0DA 1MG0A 2OORC 3QVXA 4ESOA 1UAYA 1F6WA 4GE3A 4JC8A 4ZGGA 3H0KA 5AVZA 2H5IA 1T24A 4BX8A 2GAJA 5GY7A 4LKRA 1WZEA 3KETA 1FS6A 2B4YA 5D86A 1WA5A 3PKZA 5DX8A 1O6GA 3LDUA 4IFIA 3OCUA 3UOGA 2PZLA 2XD4A 4LYEA 4BRSA 5FUQA 1U0FA 5G0TA 4A8HA 2B94A 1L7DA 1KZYC 2FFBA 1X7ZB 2G0NA 2VL7A 5EAIA 4YPFA 5LWHA 2AJBA 2FUG1 2O8VA 2QRHA 3H04A 3FZQA 4KXLA 3U4QB 2H48A 3BJIC 1GZUA 4LHXA 4ZQCB 1BE6A 3COVA 5IKPA 5A5GA 2I4TA 5CXSA 1M2VA 4L15A 1SCDA 3SF0A 2Q6TA 3RREA 1ZH6A 4PC3A 3ADDA 4MW5A 1ML3A 1S8OA 4XGIA 3DB1A 3LUAA 3O8DA 4BZWA 4EM6A 1B6GA 5CJPA 1A9ZA 1F1BA 5KS2A 4JJ6A 4L8VA 3DKIA 1FFYA 1L7RA 2YBEA 4EY7A 4N7MA 2OR3A 2E0IA 1E7QA 5LQSA 3D4OA 2C2ZA 5BT8A 2GLTA 2QUAA 3HACA 1MGPA 3G2JA 3DLAA 4DM7A 4DLTA 2DERA 1N3LA 2ACKA 1YB4A 1PZNA 2HJGA 3MTAA 5KOHA 2ANCA 5G1NA 2ZAOA 1T5TA 1I7DA 1FFXA 1GCIA 1QRAA 5E4JA 2IPNA 3AKEA 1PNRA 3FNGA 5HFJA 2O2YA 5TMPA 4AF8A 1T4GA 1PS9A 3AL0C 1NPDA 1Y8QA 5ERYA 3V8VA 2H7XA 3NTUA 3JD0A 4CIXA 2ZIXB 2XEXA 3I1YA 1UKZA 3AH8A 1UMBB 4X8MA 5FTJA 2R7AA 3THYB 1TAGA 4OJTA 1UWKA 4BPRA 1NWHA 4FSDA 2OV6A 2R4TA 4ILKA 1K7EB 1W5FA 1OFTA 4RSMA 4RVOA 4F6RA 3F78A 4LYJA 2IPOA 1AKMA 3QKTA 1YNSA 3ZX4A 3DHNA 1FJHA 4FLEA 1XC7A 2FP4B 5F2NA 3MTEA 2IV2X 4MI9A 4MKFA 3T06B 2BMWA 2P8JA 4ZP1A 4JUFA 3SHVA 4BLRA 1GPLA 4JB0A 4EOGA 5IVKA 2IGBA 2I6GA 3DVAA 3OZIA 2JIZA 3EQ2A 3G6WA 1ZI9A 4NIMA 5EE0A 4YCDA 4ZTZB 1YJQA 3THXA 3JYOA 4RD6A 3GLTA 1X42A 4AB1A 1B0ZA 3R6LA 3SHQA 3TCXB 1DCFA 1MEOA 3JD1A 2WIBA 4RSHA 1N2IA 1K4MA 4JBXA 1R0RE 3EIEA 1EE9A 1QZUA 4L73A 2O1WA 3I2FA 3OE5A 4OGWA 1CCWA 2VP5A 4TLEA 5DLQC 3SQMA 3UUGA 1KJIA 3PZRA 2VBIA 1E96A 3QMWA 4K9OA 4HADA 4LW8A 3OF3A 1CJVC 1T2FA 1ZQ9A 4AKHA 5CIWA 3V9AA 2X22A 3IDFA 3WQHA 2C7OA 3B1WA 3E61A 1WPXA 4BFXA 2ZBRA 2BISA 3Q9SA 2WICA 2XZDA 4P36A 1QRDA 1GEGA 4FHCA 1EH5A 4QYWA 3BXFA 4LXTA 4GLBA 2QI9F 2OZKA 4Y6SA 1SIBE 3V7FA 1PTJC 2ECQA 3KV1A 2VYFA 5CB4B 3UJHA 4YY3B 2FE4A 4JR2A 4CF6A 3IMKA 2R8OA 2JCXA 4RJTA 1YZGA 3W3ZB 3EG9B 3I6QA 3AO0B 1H2WA 5BUZA 1GN8A 1I4WA 1N8NA 3ITEA 1UC5B 4LDRA 3TG2A 2NXCA 1CJCA 2AD5A 3FUVA 2FMIA 5B2ZA 2PGJA 4J0EA 5CDSA 2FZWA 1HT3A 2OK7A 1DTEA 5E8JA 1Y3FE 3QWHA 2C2OA 2EJVA 3UICA 4ATNA 4F1JA 1BKYA 4EKYA 3QRWA 1GTZA 2J9ZB 3AY0A 1NBOA 1HE3A 1WD5A 1XZMA 4ZT2A 1SKYB 2FN8A 5G4LA 2BONA 3R6DA 1ZMTA 4H9GA 4A9AA 1V1MB 3LOUA 2F1OA 4BWFB 4HNSA 3WLPA 1TK2A 1KOGA 4IIFA 4D8YA 3BMNB 2QRVA 4IJUA 2Y1DA 4UARA 4GWGA 2GBPA 3JD4A 4K3UA 2DP4E 1A9PA 1BO6A 2B1QA 2PSHA 1ZN8A 2WILA 2CK3A 3A9CA 3GEMA 2ZRIA 3OO1A 5T3UA 1IDN1 3M6IA 4RH0A 4RZ3A 5FI1B 4EHLA 3VSEA 2SCUA 1MPTA 1ZX1A 3THSA 4E94A 2Z4RA 1UWVA 4NDAA 4Q3BA 1JEJA 4BNJA 4BMSA 1TT5B 2OCYC 2X2OA 1Z6AA 3L0SA 4M1MA 4DLVA 5K01A 2ZRPA 3PC7A 2NQ8A 4K9PA 4E1AA 1KO5A 4FEYA 5AJZA 5BNTA 4D9KA 3M6LA 1T8SA 4BZPA 5DCLA 2E89A 3CJRA 3D43A 2NVUB 4GP7A 3A1SA 3UK7A 5EHQA 1G7RA 4RULA 5KKAA 3IDQA 3TTSA 3VU9A 1K3TA 1LY1A 5FHRA 3FHOA 3A4TA 3G9XA 1M8PA 2EFJA 2JFVA 1NI4B 1HORA 4PR3A 4WLVA 4JT4A 5CM2Z 2BTOA 4C78A 2H7VA 5B7PA 6GPBA 4DXDA 3P9RA 5TMBA 3JYPA 4AROA 1MR3F 1O9BA 4W8GA 1T43A 1JAHA 1XGKA 4G5YA 4DNFA 2PGDA 4FCWA 3W6ZA 3KWJA 1F8XA 1UBSB 2IU0A 4DUPA 1ZK1A 4OU4A 4WKNA 4YH1A 4B3HA 2HUNA 3QOWA 3OX2A 2QPOA 4PF1A 4FWTA 3NDPA 3FNRA 2DR0A 1Z2DA 2H2IA 3N8NA 1TI7A 2GBLC 3ANSA 4XA8A 4X7MA 4XUEA 1FP1D 1SN7A 4CUKA 4R0MA 4CBVA 4NC9A 1JYEA 1YCHA 3C6ZA 1O6ZA 3V34A 3W7VA 2MSKA 5HJ7A 1NHWA 3HKCA 4PCVA 2GRUA 5HFNA 3TMKA 4G2NA 4UEKA 4WOKA 3IRUA 4TOIA 5AHKA 3UXHA 3LIIA 4B17A 1KZHA 1Q7TA 4HB2A 4OHKA 5AW2A 2RC6A 5JI3E 5KZMB 3NBFA 4R68A 3DOOA 1T1SA 3SKXA 1FP6A 4S0ZA 1X2BA 5JFOA 4J91A 3RHTA 1N6PA 3M81A 4QQFA 3FG9A 1JLLA 1YU6A 2FUNB 2NZVG 2WPDD 3JQAA 4U7GA 5KPJA 1QPZA 3B3JA 2J45A 2RONA 3NTOA 3E8MA 4X6UA 2NUPB 3RCBA 3O9VA 1U5BB 4B6QA 2IPXA 4W9RA 3PQ7A 1QHGA 3LYHA 5CB6A 1AUPA 5EP3A 2DYKA 1CUYA 4HQNA 3WLQA 1O5IA 1N5JA 2B4AA 2O9JA 5DHSA 4C4SA 5J63A 5JVDF 2F62A 1XALA 4UE3S 2IBTA 2ZKLA 1UFQA 3P4UA 4MI6A 2QN7A 3GXOA 5BYBA 3RADC 4AQDA 3OFNA 2CE2X 5HCUA 1Z06A 4TQGA 2VZ0A 3VR2D 2DSNA 1CZOA 1HL3A 1ZN7A 2H31A 3L6UA 1RZRA 2EW2A 4OHBA 1AS0A 3JQ6A 1DC7A 2YZGA 3N07A 4BO0A 5LP6C 1NNEA 1JDPA 1FDUA 2V55B 4L0MA 3T1OA 1GG9A 3VR3D 2D54A 1LD3A 3F2IA 2J9XB 2WT9A 3G0GA 3QYJA 4M1TA 1O5TA 2P9EA 2XUPA 5F76A 1CR4A 4BGUA 16PKA 4BRZA 3NDJA 4BDTA 1FIUA 4M9ZA 3D4LA 4UKDA 2E2WA 3EK2A 2JKVA 2QTVA 4R9SA 5FNVB 5AK6A 4N3NA 1ZW1A 1VXOA 3ICVA 5EIBC 1P5HA 2O2HA 2C00A 3EFOA 5IW8A 3SHFA 2GT1A 2R6FA 5EE3A 4TYPA 2Z1MA 2JEOA 2VK1A 1IK4A 3NIDB 1GLVA 3C3KA 4K6OA 1JFRA 3F6EX 1ILEA 2W8ZA 3IVCA 1EWYA 4LSGA 2CMDA 5ESXA 3S8MA 4DMRA 1KK3A 4DCPA 3E5HA 1TA0A 3KSBC 1L8OA 2PRSA 2ZIEA 1Q1EA 3OFJA 3O3NB 2O19A 2MT9A 1GPWB 1BNCA 1H6AA 4XKJA 3EC7A 1QQTA 5CH8A 5BQXA 2VHQA 1U8XX 3RYHA 1T9CA 1Y4UA 1GLNA 1TF7A 1G8HA 1LBSA 1TVCA 1YK1A 1MHPA 2R7KA 2WHQA 2WWTA 3M6AA 4F3YA 1TD1A 1I1HA 4BQNA 5IG2A 3FNHA 4G2TA 2GLUA 3IV6A 4IV8A 3ZNQA 1G5TA 2D5AA 4L2IB 1RKQA 2DU8A 4OHUA 4C6TA 2OXRA 5K3FB 5LZ2A 5JU6A 2BEUB 4O4HB 2O48X 3F6RA 9LDTA 3MM4A 3RARA 2HA3A 5C7IO 3N2ZB 3ZR4B 1JXMA 4QDUA 1DBWA 1FUKA 1QYIA 4JHXA 4OOEA 4QFCA 4K9KA 5J2UB 3K6KA 3WDSA 4PLFA 3THWA 2EZTA 4JJ7A 3QJYA 2FPGB 2PSDA 1P1JA 3UHFA 1U2DA 3QVMA 4LMRA 1TZKA 3OIUA 3DZ8A 2EHDA 4XR4A 3WGTA 1UP6A 1QTQA 3ENWA 1QYVA 4MA5A 4YCAA 4JENA 3AIMA 1E61A 1CIVA 2P4QA 5FPPA 3VV2A 2YS7A 4U9IS 1TCAA 4X85A 5LUAA 1S8FA 3I12A 1BQ4A 1M2OB 3SX0A 2O8DB 3IAS6 1QV6A 5BW5A 3FR7A 2Q3DA 3BWDD 1GSIA 3I39X 3MQ4A 4ZXPA 1YQUA 2R47A 1JIKA 3QXJA 3RVJA 3AERA 4ZVUA 4BVLA 2IJGX 2QENA 3T6KA 5WRFA 2BMAA 1YJ8A 4G8DA 3WOVA 2E9SA 5BQ5A 5LYJB 3R4VA 3HVKA 2YL2A 3DKRA 3G2HA 4ZAGA 3T3EA 4B3GA 1I1NA 3NRBA 2SKDA 1AV7A 3LQ2A 2AEJA 1WB5A 1X8JA 1K6JA 1R6UA 5G4KB 5FUMA 4A8JC 1FSGA 1Z22A 2FPUA 3SC4A 3RVOA 2RGGA 4P98A 3FLBA 3MOIA 5CDFE 4KLRA 2V8BA 1QC5B 3GGPA 3OECA 4UD2A 4NAVA 1G20E 3MS2A 3KTOA 3QNUA 3WZ2A 4WX2B 2AIRA 1SOAA 1D7AA 1P9WA 1V4VA 2ZXEA 1JJFA 4D3DA 2WJPA 4L4XA 1SIUA 3WHIA 1O0CA 3GEGA 3C0KA 5FTLA 3URMA 1SCBA 3GEDA 4MKRA 2HHJA 3PNYA 5FBRB 5EIXA 5JJIA 4ER6A 3PXXA 4B33A 2P5TB 1FDOA 2PX6A 2QT0A 3R5TA 4IWYA 4E33A 3L04A 3TZKA 3NC0C 3D7NA 3KSRA 2LTAA 1KVUA 1ZIXA 2JJ8A 3CZ4A 2RCYA 4FNMA 4O5AA 4XB6B 5IYZA 1PVOA 3HBFA 3IQGX 1J5XA 2ZJ2A 5GONF 3WHKA 1KJ8A 4WKOA 4D0GA 3BD9A 1Q0UA 3EXHC 5D5HA 2FH5B 2XITA 4IGIA 5KC8A 2QR5A 2PWBA 4QXMA 7REQA 2PAFA 1P62B 4HEQA 2KYRA 4IKPA 5TVKA 3A6HA 1QCZA 2EBWA 3HUEA 1NVVR 1ODCA 5HKKD 4MRPA 1XJQA 3M6VA 2TMDA 4PYNA 4ZREA 4BGIA 5K0TA 5GJBA 2R8ZA 2PYIA 4OHRA 3A1VA 1QVZA 3UAOA 5FP0A 4XWGA 1XN4A 3TIFA 5IBQA 1JHDA 3TLZA 3FRIA 1MG5A 2P6PA 3L1VA 5CW1A 4YROA 5C1BA 4FPXA 4WCDA 1QLHA 5DI3B 2PS0A 4G4SO 4RTNA 1U9CA 3TBHA 1HE2A 1Y98A 3UGTA 1Q16A 4XQ0A 3UEOA 4IFEA 1JVBA 1OT5A 1X7GA 3GFPA 2VHCA 4U4AA 3CR7A 1IEVA 1Q84A 3QXSA 3U3KA 5EMNA 4F4CA 3LUHA 4OG2A 4BMXA 1V6SA 3O73A 1FSPA 1W2GA 4HRAA 2AXPA 4MV0A 2BGWA 1HDCA 2F6RA 4JJAA 3NV9A 3B36A 3VA7A 4NBLA 5H0IA 1TJNA 3ZBTA 5KO2A 4CG0A 2WYVA 3ODGA 4GOXA 4E88A 1YIOA 1ZRHA 1M7HA 2VAMA 3IUBA 1THTA 2ZIAA 3MCVA 3OWHA 1XXHA 3WDLA 2I22A 3GLUA 1UL1X 4O63O 3OHMA 4C7XA 1Y81A 2Q2VA 4KE9A 1BYIA 3AHDA 3GGGA 3PFIA 4IGAA 3TG8A 3RC8A 3NHJA 1ONSA 5DWDA 1GVNB 2QM3A 1AMUA 1N5LA 5B36A 2IYFA 1TIPA 3EW7A 4HWSA 1X77A 2C07A 4KXMA 4DYDA 1DU4A 1SXJB 3L41A 5D8DA 5JXWA 3U7IA 1NQUA 3C5HA 3UUWA 2PPLA 4HATA 4KE8A 3DYIA 1XTBA 1A8QA 2DUJA 3LLVA 4KAAA 4EARA 9ABPA 5EMHA 3SQLA 3REOA 4CU5A 2VPIA 4FI3C 2ZRJA 2Y6UA 3GGDA 2DCMA 3ZU2A 4MDHA 3NG1A 1XRLA 5HHTA 4HRYA 5GQSA 3KZOA 4PQRA 1N8KA 4GR5A 5C37A 4H3VA 1C9DB 4YECA 4JJEA 5EJ7A 4B6PA 2QSJA 1P7VA 1NR5A 3HHPA 5AXBA 3F6PA 1GUDA 2M6RA 5J4KA 2WDZA 4I14A 3WLRA 2FQWA 4ZV7A 1RHJA 4BP3A 4E22A 3I2KA 4Z4FA 3IEUA 4RQAA 3AV0B 1Q20A 1PR1A 5AD1A 1LV8A 1Z3CA 4WZ6A 2JH9A 4Q9LA 3HNOA 4CKEA 2BZ1A 3QUSA 2X0EA 3VYUB 1GPNA 1A96A 1G21A 1LPSA 2GFIA 1QGYA 4QT0A 4WCVA 3GGJA 3FWPA 4FONA 1B43A 1WUIS 4BJ6A 4JEHA 4P54A 4PW0A 3OLWA 2FMHA 3OA2A 4FU0A 4IVQA 1VPEA 3GZ4A 4ER0A 4A26A 1D9ZA 1TU0A 3L18A 3JSXA 3PF9A 2AFRA 2W2VA 3GP5A 3NS7A 4IIGA 4YQYA 3UPDA 1OI4A 3FPFA 3I9FA 3JQQA 1ORHA 1N6KA 2Q3CA 2J0SA 4B34A 1KETA 2P41A 4XD2A 2BHLA 2BCEA 4D26A 1LFAA 2CNNA 3K8ZA 2B1IA 4RV4A 3Q85A 3E22A 2CLKB 3HWSA 2QHXA 4CM9A 3OEED 5DGHA 5IAAA 5ICSA 2GCGA 3I5MA 1WDKA 2HLDD 1UJ5A 4H7HA 4BEWA 5IKEA 3V46A 4AN0A 4YRDA 8ADHA 5CJ2A 2GI4A 2CUNA 4JB3A 3ZWMA 4MRMB 3ZCPA 4WINA 4YFVA 3T3DA 2ZRQA 3A8TA 4NENB 2XKKA 4ZYXA 2R6CA 2WF9A 3OJWA 1PJTA 4QTXA 4B32A 3K70C 1R6DA 3GHYA 2ZIGA 4IYJA 3L7DA 4R9UC 4W1QA 4ZEOA 1ZINA 2JA2A 1HEYA 4Q3EA 1GT6A 2DFLA 1UXHA 1ZKDA 1F6BA 3BCSA 2IDJA 3M5PA 3RABA 3RUPA 4CL8A 1C41A 3GLHB 3V1MA 3WLOA 1FBTA 4RGVA 2EERA 2AJDA 4KN8A 2FAXA 1Z2EA 5HOEA 1ZZEA 3ELDA 1K6MA 3Q2KA 3CSDA 3UO8B 1E4EA 1RWOA 2R1VA 3F8SA 3NTRA 3QELB 4V0MA 5EOVA 3VNSA 1NYQA 3T35A 3AR7A 4A0RA 2DQYA 4ZAXA 4OUDB 4YJGB 3RS3A 4C04A 3WJAA 1M6VB 4A2QA 1GZ4A 3KB1A 3CEHA 5D7BA 4I1VA 3FUTA 3QUQA 4CCYA 4Q19A 3BOSA 3EXEA 2GWHA 3CEMA 4IVPA 4QEKA 5F1PA 3UPUA 1DKMA 4QO7A 2QYTA 4OFZA 1R0XA 4LAFA 1E9BA 2WD7A 1PFVA 3K1AB 4ND2A 1K4KA 5JPIA 4AYXA 5SYMA 2BH2A 4Q66C 1M7BA 3RKRA 3DFUA 3KOWA 4L9AA 1YVRA 4OAOA 3NFYA 5AJXA 1W5SA 4TZTA 1T2DA 1M2JA 4DCOA 1UMCB 4HYTA 4DDWA 1WUHS 1YOVB 3BWYA 1FFGA 4KFUA 4CM4A 3UMVA 4RZQA 2JH3A 1TO1E 1LJLA 4S0XA 1G5QA 1FFSA 2OXCA 3VSDA 4KDRA 3H1PA 4BNIA 1YO6A 1MB9A 1Q0LA 5DHPA 4CDMA 1OZAA 3D1LA 1DADA 3BTOA 3KOOA 3QYAA 3TLKA 3D2BA 4ODIA 1LQTA 3A9SA 2V65A 1ZR4A 2IP4A 3I23A 4EYOA 4I9FA 4MQ5A 4UE2A 3RASA 2ZBQA 2D06A 3I28A 1BVHA 5IVIA 3FTNA 1PEKE 2FSSA 1FP2A 5F1YA 1N1EA 2V98A 4D0NA 3KR9A 5TJHA 2F4VB 3LA8A 4NCBA 1M74A 3V42A 3WIVA 2TS1A 2EGUA 1CY4A 1N78A 4Q9NA 2M32A 4QTTB 3D0OA 4YX9A 1XNQB 2AYYA 4RX1A 5GJWC 2AOVA 2ZZNA 5LUBA 5FA6A 1J0EA 3IAS1 1V2HE 3IULA 3ZHTA 5G02A 3GVCA 2LE0A 3IKJA 1P80A 2YJ4A 2W6ZA 4NK4A 4YGYA 5G3ZA 2Y66A 4M36A 3QPAA 4U02A 1YACA 2P9BA 4DNQA 2M1XA 4G5QA 3ZWXA 1KPIA 5ERGB 5KKCA 2NAPA 3LPDA 1HQKA 3QWAA 1U0HC 3Q40A 1UDRA 1ZN9A 5BN3A 2V0GA 2IU4A 2J67A 3ODPA 2NO4A 4WLUA 4QDTA 3EF3A 3AFMA 3DT8A 4CMGA 1PGOA 5EINA 3SICE 4J1SA 5A02A 3UAWA 5BQFA 2PJRA 5F3DA 1AKUA 1WSDA 3JQGB 3WSTA 3PICA 2BLNA 4OKIA 3D6UA 1Q1GA 4PZAA 1MLDA 1Y9JA 3Q1KA 3ZI0A 4F97A 2IU3A 4K7JA 3VKVA 2QBYB 1B3BA 5ALZA 5HCNA 3O2SB 1FS5A 2VDJA 2W6MA 3C3WA 1IOZA 1L7MA 2G25A 2VF2A 4WFKA 4GXQA 2HMYB 4RV9A 2GKSA 2FRVA 4LGMA 2OAEA 2EFDB 1KEZA 2PZJA 2Q5HA 3FYDA 4IIJF 3Q7QA 1OFVA 2FXIA 2GKOA 4X1OA 5C4IA 3CPSA 3DOIA 4G0QA 1PQWA 1NKVA 5AIBA 5JASA 3GLFA 4QU8A 4G0UA 2H63A 2O3UA 2PXCA 5E2IA 4I55B 1NV9A 1U1CA 4W6QA 2RJOA 4KNWA 1VJTA 3EVTA 1WDMA 2M9MA 2Z30A 2FLWA 5B64A 2FR1A 2AG5A 4O1IA 5C5EA 4W7SA 4I81A 4D0RA 3L8FA 4FXPA 5AJWA 2JI7A 1A69A 5BNIA 4P2GA 1HKHA 3DL0A 1W85B 3TKAA 5IJZA 2ETVA 1Z5GA 4PWZA 3L0YA 3LBFA 3AZQA 2A9OA 3JRNA 2PGNA 2WTNA 4KJZA 3RS7A 3SJAA 4BMOB 3AB8A 4NLLA 1LBTA 1L5LA 4MW9A 1KORA 2C4KA 5HF9A 1BEZA 1CUCA 1E63A 3E4CA 2V1UA 1JHXA 3E0QA 3GRFA 1XDZA 2FVXA 4CMAA 2G76A 2WFLB 4MAAA 4S1OA 2K2QB 3GFOA 2H57A 4OQMA 2FYTA 3V4PB 3X1ZA 3B6MA 3KK0A 3QV2A 4YUZA 1GAWA 4E5SA 2XAAA 3UMCA 1IG3A 2QUKA 3TSOA 1CUDA 4PLZA 1YASA 1EB9A 4MLZA 3BCHA 3ELWA 3G2PA 2ATIA 3E8XA 2RH9B 3ZXXA 3SG0A 3P45A 3DMFA 4B3SB 3RTBA 2DPYA 4XQCA 4YRJA 3W6UA 1BW9A 2C1XA 3ZVKA 1P91A 3PP8A 4EY5A 4D4LA 1Y5IA 3QSGA 1JQBA 4QYIB 1O97C 3OKPA 4BBAA 3V8NA 5ER9A 3ISJA 3FWZA 3R9IA 3RIYA 1QWOA 3C39A 3R7SA 5EIFA 1Y1PA 4RWZA 4B43A 4P35A 4NJEA 4KVZA 3DGEC 3WNQA 4MQFA 3DP9A 2WKPA 5ALMA 4GHWA 1ZESA 4Q15A 3SEAA 1LW7A 1NVKA 1V16A 3M4ZA 3QE3A 3AIIA 1MIOA 2KSQA 3GH1A 3SZUA 3TECE 3QW4B 4YRIA 1BDHA 3O7MA 2I3DA 2V59A 3R6GA 4G36A 2PE5A 4M0KA 3WRXA 1DV2A 1Z6ZA 2VDPB 2J3DA 4JS0A 4PO8A 3TLGB 5BN5A 4DUZB 4X3CA 2XMQA 1FUEA 3WK5A 3FD8A 3ZK9A 4XIFA 2LRHA 2O1EA 4Z6KA 4ICIA 5FT9A 1YB5A 3NI2A 1BN6A 1OFHA 4H08A 3RM3A 2Y05A 4G1UC 1GTVA 3EGWA 3RD5A 3SJUA 2XZPA 1TAHA 2ZDHA 1PYGA 3NPMA 3IAFA 1X15A 5JNTA 1XVLA 5DIFA 2VRCA 2VJAA 2MMGA 1R74A 2CYAA 3DFMA 3ESXA 3H9EO 5E8RA 1UPXA 1DXOA 1VMIA 3TQOA 2E1RA 4AYTA 4EEKA 4Z4QA 1HEUA 1FYVA 1OYYA 4B3TB 3RO7A 1I6MA 2YNMD 4GX2A 3NWOA 5KVVA 4CG3A 3IMFA 3BE8A 1F3LA 1EMDA 2L0XA 3PGJA 4N76A 2AMFA 3HDQA 3W3AH 4Z4GA 3H4TA 2DUWA 1NM5A 4FKZA 1CRPA 1SPXA 1VIMA 2IOYA 1QG6A 2WHPA 4F72A 2VQ3A 4RTRA 3FOCA 1R8SA 2P2YA 4YCCA 2IUYA 4CWAA 4AZVA 5IBPA 5CGQB 3T3HA 3C3BA 2PVCA 5DM4A 4PQGA 4OI1A 2VPTA 2I1QA 3HR7A 3UGKA 4I6EA 1RRFA 4FYWA 4AIIA 3EWIA 4PS1A 3U4GA 3CRMA 1TMGE 2SKCA 4N9WA 3SR4A 3ZHRA 3O94A 4C4RA 2PUGA 1Z0KA 3Q87B 4O33A 3D3JA 4LDJA 4NYJQ 4TV9B 1EUDA 4UTZA 2J41A 3UT5B 2I9KA 3T4PA 4LOLA 3WK6A 4G4SP 3OIYA 1Y3BE 2I7VA 3ZGLA 1L5ZA 1EFRA 2YFYA 1SD1A 2WF8A 3ANLA 3DMNA 3GFVA 3I30X 4XDGA 1HT1E 2C3YA 3KT0A 4G24A 4YT2A 4ZHQB 4YMSA 5BMVB 5KJCA 3ETLA 2PL3A 3WK9A 3RSQA 3U16A 2XCRB 3SPXA 4L0DA 1SCQA 2J09A 3BULA 3DV9A 4L5JA 3OETA 3TD9A 1VXRA 4YP0A 4E09A 2C7BA 1QIEA 2BF7A 3ABSB 3DZJA 4HWTA 4N8DA 3MJRA 3AM3A 4ZALA 1I3NA 1Q6ZA 1OPRA 4YS6A 5IK2A 3ZDFA 5IT4A 1DAGA 1DG1G 3PR2B 3TFOA 1BMFD 1NLMA 4KG7A 3UT0A 4BY9E 5ALRA 3X43A 5K0JA 1JI0A 4OGLA 3BAZA 4PX9A 4HN9A 4TS3A 2ON6A 4JH0A 4R1OA 4KWEA 3M83A 1BDIA 1PJRA 5CDGA 1E18A 1C0KA 3GDHA 3A2KA 1EP2B 4DXAA 4O3FA 1ZK0A 2X5NA 3LF1A 3DMPA 4LCEA 2YWGA 4KZPA 1IBKB 3ZHUA 5JSZB 3D4NA 3MPUA 2ZR9A 1NW9B 3S2EA 2PZEA 1U2DC 1XWWA 3TSWA 2F1HA 1GG5A 5A6VA 2QP9X 3K16A 3FYSA 4RVNA 3ZCVA 2L19A 2EHJA 2HJVA 1QYCA 5KVAA 3E1SA 3WP0A 3QEAZ 1I0LA 1LDBA 2BMVA 3RSOA 8MHTA 4BO4A 1J22A 1EGVB 1QE0A 1QFMA 2C57A 1GU0A 1RCFA 2FKAA 3HY4A 4HDMA 4WBSA 1QDLB 4JLKA 3LT2A 4TT3A 1XCMA 3OTWA 4COOA 4BLSA 1A9XA 3EXFB 5I01A 1QHIA 3MQ2A 4I08A 4JEMA 2W90A 1R4MB 2HMAA 2EZ4A 3AUKA 5EGSA 3RRNA 2PX2A 3OE1A 4BXOB 2JKYA 3IV9A 1KO1A 4OJQA 4EG7A 5A6SB 1A97A 4MZDA 4X61A 5I51A 2ZUWA 3HBMA 1E1QD 3OLXA 2FWNA 3NUGA 4Q4JA 3U80A 3ZQKA 5CT8A 1ZCBA 3EXIA 1NE2A 2E87A 1KSFX 3K5IA 1C9YA 3ROMA 3EFHA 1E2JA 4LV8B 5K8CA 1MAUA 3S27A 3DOCA 2Y0EA 1E7YA 1MN6A 2OLEA 1CY6A 2G88A 2B0CA 1E6UA 2VSFA 3FBWA 3N0RA 4WOPA 4ZDWA 2GPTA 5I4BA 5KDLA 5IUKC 2W6NA 5DP1A 4DNPA 4ZKDA 2PUHA 2Q46A 3MMXA 3SM9A 4AKIA 1RI5A 3CX3A 1JDBB 2EDCA 1GVHA 2JGDA 4IHKA 1DDGA 5EN4A 1U8UA 4BKRA 3AI3A 3FJYA 3PHLA 4G84A 4KYVA 3LGSA 3OM1A 4G5OA 3L6BA 1E32A 2XE6A 5A5DA 4E2XA 4PZPA 5JCJD 1RYDA 1MAAA 2ZB8A 3CH7A 4Q3CA 1V5WA 5EZYF 3SC3A 1SMKA 2RGBA 1KEPA 2ZJ6A 2C4UA 3ZZ0A 4CT4B 1D03A 2H0RA 5IWCA 4JT8A 2UUPA 4MS1B 3H19A 1Q6YA 2PEZA 1NXXA 2JATA 5B7GA 5CXUA 2R9VA 4IXWA 4NBWA 5TEWA 2ET6A 2OG2A 5GZ1A 4HLUC 4MQUA 2YUTA 3N2KB 4MPPA 1K8QA 2RK3A 1IN8A 1P73A 3UFXA 1E69A 3O8OA 3V48A 1XKXA 3BWEA 4ND7A 4P86A 4MS3A 5F2KA 5JD5A 5FTMA 3QPVA 3N87A 1Z37A 2BGLA 2HSJA 3X1MA 3PUHA 2QVBA 4W7HA 1LI5A 1FRVA 2J87A 4U7HA 4HQKA 5J5CA 4A8JB 2PD3A 5NLLA 1ZH4A 4G0YA 5EEHA 5BUQA 2XT9A 3L8HA 1OGYA 5FR1A 5P8WA 4DUGD 4RTJA 3G0HA 4KW7A 1AQNA 1NUUA 4QM7A 4YAFA 2P3SA 1U8TA 4FEEA 1KI9A 1KS9A 5KNBH 3OPYI 1K7YA 3KVYA 3NHKA 5LDHA 2JFUA 1W2WB 1TTTA 5KQGA 4DM4A 1XP5A 4JL8A 4OA8A 4B74A 1L7NA 3RC3A 2H1SA 4R8RA 1A2OA 1NX9A 5DGDA 1OLSB 5JI2E 5JZSA 3LTNC 2GVDC 4MQ4A 4CU2A 3SZMA 2H18A 4DKJA 2VTBB 1RIIA 2RGEA 4Y1FA 3AY3A 1J8FA 1PLKA 1XXHE 3ZGOA 1D4ZA 1WOMA 2C03A 1NVXQ 1WQ4A 2IL1A 1RTKA 1G7SA 2YHIA 4Q4LA 2IWRA 3ZY2A 4AMUA 3HXLA 5AUNB 3ROTA 1T2VA 1EYZA 4PCLA 3CGWA 3EXHB 3BYZA 3ECAA 4M1KA 4KWCA 5CITA 1U3GA 2YXBA 4IUCS 3ZVNA 3FUUA 3R0JA 1IUPA 4JEUA 2W43A 4K2HA 1AT1A 2X8WA 2CLHB 3OE7D 1SG9A 4XVCA 3E3MA 1T3GA 1NUPA 2NU8B 4IUBS 2VK4A 1Q0SA 3PFBA 3K0AA 5TRTA 1E58A 3CVVA 4J76A 1GFIA 2ZYHA 4F4HA 5EUBA 3KP1A 1XFAA 2HSEA 4HAVA 3KEGA 3OOWA 3VPAA 1UXIA 5JZVA 2RE8A 3DYBA 1Y6GA 1EFTA 2YFKA 1D6SA 3ZDDA 1BXZA 2X5XA 4RPLA 3SEQA 4LYYA 3BWCA 3M4JA 4PQEA 3V4SA 1D6MA 2GPSA 4FJ1A 2O2DA 1QGUB 1XTZA 2ADFA 2UYYA 1C7QA 3IBGA 1YDGA 4W4TA 2IYNA 4KFSA 4FYPA 3UUEA 1XCBA 3GRUA 2GJ4A 3GB9A 1E98A 2JHCA 1KRHA 1NXQA 4FMDF 3ZJTA 3T52A 1D04A 5FEMA 1R0BA 3I8XA 1KK1A 5TARA 5ICCA 3QY0A 4M7OA 2YASA 3WYFA 5C0OE 5HIMA 3G49A 1X3SA 2C8LA 2NYUA 1G21E 2VHWA 4K9NA 4L4YA 3UA4A 1JR3D 3EVFA 5CMLA 3OX1A 1ZUD1 4RCZA 1JDUA 1E3TA 5FA5A 2QOEA 3OC6A 1U7TA 1SXQA 4LGVA 1V5IA 4X1KB 5GONA 3OPYA 3R77A 5D01A 1SIWA 3WVNA 5CTAA 2EZUA 5JTTA 3LRPA 2A1TS 4UVEA 4Y9TA 1S2MA 1DQRA 2MR6A 1EM8A 4C4TA 4QFBA 2P1RA 3TQRA 2ORYA 1HT2E 1VLJA 3BDAA 4OP1A 4MKHA 3SYLA 1GNPA 3C14C 5KUTA 1E6LA 2PANA 2GD0A 3L93A 3N05A 1P61B 1KFJB 1J2EA 2VCYA 1XUOA 1DL5A 2HSWA 4LTDA 3OLQA 2GM4A 5EYPA 3IO5A 5I9IA 5I6DA 2X2PA 3C45A 1IZ0A 4OQNA 4TMWA 3U39A 3RYCA 1K89A 4PFJA 3S44A 3TSZA 1TUBA 2V8OA 2Q6KA 3IIMA 5LLTA 2NSHA 4ZMRA 3C8HA 4MWOA 5HG0A 4BTLA 1ZMOA 4XD7D 2W4QA 4LJ9A 2ZSJA 3SVTA 3EHDA 4XH9B 4AY6A 4H7KA 3VR5H 1SVLA 3HB1A 5REQA 2Q0HA 1TFUA 4E5DA 1MA0A 4CM1A 4UOEA 3GOHA 3OCJA 4JZKA 4PC6A 4XWOA 4C7OB 2J3IA 1PKEA 3HRHA 5FRDA 3C4VA 3FH0A 1JWLA 3MAGA 1ESCA 3TI9A 2AG6A 5TPWB 5L3SB 1LLQA 4BVGA 1JRLA 4V0ME 3TDMA 3OX4A 5AVXA 1RQLA 4BUJA 1FFDA 3ZBPA 1IC6A 3REGA 3KYBA 1IHUA 5DLPA 1WXQA 1Z7WA 4Q9IA 3U9TA 3V33A 4FYKA 4RYDA 5C1PA 4CV3A 1NVGA 1Y1QA 2QS9A 2XYVA 4K9RA 4KXXA 3H13A 4NE7A 5HJ2A 3T5AA 1OROA 1HZJA 4V1CI 2P7IA 2MSNA 3T3MB 1COZA 3WB2A 1Q1AA 3PTZA 1ACJA 1WR8A 5F7OA 2ZZKA 3C5VA 4X92A 4MP8A 2GBFA 2Q28A 4KI0A 2UXBB 5D7NA 5ARDA 1GGHA 5JZOA 1SWWA 4EF4A 2GD6A 5EJGA 1GZDA 3BE5A 1ULAA 2APJA 2WWXA 1Y6QA 4WRRA 4FOPA 1P3Y1 4KBGA 3HV2A 2DJ5A 2NZ2A 3KKKA 4HWOA 4JJIA 3HVUA 4KV7A 1MA3A 4NBUA 4ARZB 1R5NA 3ACBA 1OZFA 2EKQA 2VXCA 4H1WA 1CZRA 4FMCB 2ZBGA 4X91A 3R6WA 3G0IA 3K9CA 4PZDA 4Q16A 4ZI3A 5LQAA 2JJ1A 1T5DX 1ZH8A 5B4TA 3JVUA 2WB4A 1Q91A 1ZK2A 2X9VA 2Z6AA 2G0AA 1GTJ1 4KWIA 3ZDBA 4B3RB 4MGYR 2NTYC 4E2FA 4U7TB 1WZ2A 3AEQA 2WNSA 4YCBA 2OPHA 4XJSA 4UFOA 1YI0A 2BY4A 2VP6A 4IOMA 4F3TA 5CLGA 1DARA 3BAFA 3K2IA 4U0JA 1S0UA 4A6EA 2JFYA 2QMYA 2WZBA 3N2EA 5CT5A 2PUAA 3RVLA 4NZNA 3SR0A 4RXUA 3BF7A 1UXJA 4WESA 4QJ4A 1PT8A 1RABA 2FHSA 4Z0PA 3QTTA 2UZAA 5KTNA 2J32A 4E12A 1EZ1A 1XZHA 4GXTA 4RIEA 4FR5A 1ZNQO 4L51A 4B2YA 1O9GA 1M2VB 3VOSA 3GCWA 4GGPA 3V1KA 4H4DA 3KR1A 3R5FA 3PUVA 1D4OA 2PR2A 4PU0A 2JDID 4OPMA 3BRCA 2AX4A 5LDDC 2IIBA 1XZEA 2NU9B 4F2GA 4WZBA 4M76B 1KQOA 2AN9A 3CS3A 4GKKB 5ALDA 4F1KA 3AFGA 3LNTA 3LT5A 4LE2A 4BRWA 4ER3A 1V4NA 4EJ6A 1XCPA 3NHBA 4YB8A 4V3CA 1YL7A 4D41A 2YVLA 3HC7A 4V1CA 2ZIFA 2FSPA 1Q11A 2HPHA 4ZJPA 1HNNA 5KOHB 3WYCA 2Q5EA 1EP9A 3ZQJA 3WBJA 1MEJA 1FFXB 1J99A 1PGQA 3ELUA 1W36C 3IDZA 3U3XA 2HTEA 1JAXA 4GH5A 4ZOCA 5AKYA 5C8XA 4RMGA 1KYVA 3VJLA 5HBGA 3T38A 2PVPA 5EFOA 3U5ZB 2XUFA 4FX5A 3ZEAA 2FN7A 1XV5A 2GTPA 3RJ5A 5TLSA 3CLRD 1NN0A 4G8BA 3OJ0A 5I7HA 4G1FA 1JHVA 2G8LA 1P3JA 2ZI5A 3HEMA 2IYPA 4DGQA 2FZGA 2Q4RA 2A78A 3AGQA 4NHEA 5CUQA 1XDDA 5FLYA 1U3TA 3RLIA 5EJ4A 2P2NA 4IINA 4IJKA 4JVMA 4UBLA 3O38A 3G8CA 3DEAA 3SEZA 4F6RB 3L9XA 3GLFE 2EZ8A 4GOLD 2ZGVA 2NX2A 2JI6A 2R6R1 2V3WA 3GCGA 1MJNA 1NN5A 1Z4NA 3HE3A 3MW8A 3PYXA 3UWDA 3ZCTA 1T15A 1U6JA 3A0RB 4FSXA 5COAA 1UXGA 1H2XA 2C5GA 1YOBA 3E27A 4GPZA 4LIPD 4RMJA 1XNJA 5CNJA 4JI3B 1YA6A 5IN5A 1FSSA 2OFWA 4F8EA 1LFDB 4J4TA 3VPHA 3FOFC 3K0HA 4BNMA 3B6ZA 5CVEA 4B1FA 1G19A 3THXB 2R25B 3AKDA 5AOAA 1E0DA 1ULUA 3MS4A 2DPXA 1TKBA 4F7DA 2E6KA 1S6YA 4KE7A 3B3AA 2O07A 4MUGA 2P6UA 1I4DD 4AECA 4GI2A 2XMDA 3CVWA 2E3JA 4B8WA 2B8EA 3KZNA 2YJGA 1FPQA 4MGHA 2CB9A 5H3HA 2V4MA 2BP7B 4J4BA 2CKDA 4F5YA 3H5RA 4R1PA 5I9LA 2CJYA 1E94E 2IEYA 3RS2A 4CIDA 2O2GA 4WV3A 3CFYA 2WMNB 4YTEA 3FWNA 3PX2A 1QNLA 5T67A 5AK4A 3ZYCA 4Q6BA 4EKGA 4W99A 4HAYA 4ZCLA 2ONZA 2V74B 2BPOA 1UPBA 4CQMB 3PGVA 2P1DA 4YV7A 2LWIA 3LXMA 4M1SA 2LDBA 2ZRAA 1HK7A 1G17A 4QRHA 1Z4OA 2ZB7A 5T6BA 1QIMA 1Z83A 1QIDA 2IYZA 3FR8A 4MTLA 4PR0A 3PGXA 1NMXA 1CKEA 2KS6A 3L8YA 1XA4A 4N3GA 4UE6A 4UVHA 3RSFA 4O4IF 4RJJA 2QN1A 3DONA 2C7VA 1JDNA 1MQSA 5DNEA 3UHPA 1LTHR 3G0CA 3T15A 2DY0A 5LZ4A 4JI8B 3B2EA 3F7MA 3BGOS 1RWBA 3W1VA 3H1TA 1R6AA 1B8OA 2V7VA 2GZ1A 3OTHA 4YMUA 2OAP1 1PJAA 5EXTA 1LRKA 5MGBA 4EB0A 3EIUA 3W3AD 2BM9A 1OVGA 2DVMA 4N8EA 4TLMB 3RE1A 1F9AA 3U7EB 4ASUD 1RCUA 3HKBA 1RIFA 2PTHA 4DLUA 1RJDA 4LC0A 3EEYA 3WRXC 1MPXA 5KI6A 4EK9A 3ZXSA 3B78A 1F4VA 4PZZA 3TOXA 5BVGB 2FY8A 1HLGA 1YS7A 5IBCA 2ZQ5A 3RK0A 5GMOA 3RGGA 3F97A 1JAYA 3BTVA 2AG1A 4ZDIA 3BBLA 4NONA 3TQTA 2NNLD 4R2LA 2P6OA 3O82A 2NU7B 2P2DA 1H9AA 4V0RA 1CP3A 3ZI7A 2C9ZA 2F2TA 2O4CA 1J23A 1PFWA 1T4BA 3FTPA 4B6JA 4QELA 5CVCA 3I83A 4HUJA 3VU9B 3D3QA 3CT4A 3NRJA 3GUZA 1PHRA 2HRBA 1XLTA 5T7BA 1WHSA 1Z68A 4QLBA 5CFMA 1CEQA 1GRRA 2I3BA 1SAYA 2IE8A 2VDQB 3A70A 4JBIA 3UATA 1OWMA 1T9BA 5AVKA 4R8VA 3OMXA 1GPH1 3FCEA 3SX4A 1S8AA 2MYPA 5DYGA 1D6NA 1M8KA 1PGNA 1L9XA 1M1YA 2CYCA 2EX0A 1V45E 3KPJA 3NC1C 1EFVA 4BV3A 4Q9KA 4YDSA 1NM5C 1UZAA 1VHLA 2B7CA 3HA2A 2W9XA 3MVEA 4P4NA 4DANA 4Z9XA 5LZ5A 1GIAA 1WJGA 3CRZA 2GAIA 3M6UA 5EP1A 1DELA 2GDZA 3I2HA 3FBGA 4M6WA 4PLHA 4DCSA 5KYNA 4QWMA 1T6XA 2QA5A 4KRFA 4REQA 4C3ZA 2RIRA 2JI9A 1L1RA 2X3YA 1VJ5A 3HKCB 4NOJA 4UUNA 5KTRA 1U5CA 1SFRA 1ECCA 1ZOSA 2QQ5A 4H7IA 3DEYX 5E1BA 2WINI 2CNLA 4HH1A 2C5SA 4EJFA 1Z29A 3GJTA 3O8CA 4D4HA 3VUFA 1M2EA 3H1BA 1P9OA 1MIHA 3CUVA 4I4TB 1W93A 2YVUA 1E2FA 2BGUA 1TZMA 2XUQA 3K2QA 1VE7A 3IEIA 1JLLB 3R2JA 3MD9A 2A14A 3JQAB 3RNOA 3SIXA 1EWRA 2P79A 2QG6A 4JI1B 2G4VA 1U1EA 5G53C 3SCZA 5JYCA 1MBZA 1FSFA 3FOAA 1RWPA 1DQYA 1CJSA 3L3BA 1GNVA 4Y1EA 3VPFA 4POOA 3GCDA 3WL8A 4JK3A 5TQ2A 4DWWA 2BSXA 3A1UA 1F4PA 2PKXA 1JBKA 3ZE9A 3Q8MA 3T0FA 2UUCB 3KHTA 1SBHA 4RS3A 1EGHA 2IBMA 2J0UA 4MR9B 1SG6A 2I55A 3M9LA 3RBXA 1I30A 4M7WA 4Z1MD 4OMFG 4X9XA 2IOQA 4EMBA 1WBBA 5BNZA 2Q5LA 4YXFA 3PNQA 5HK9A 5LMCA 3H3XA 4B45A 2BC9A 2UZ0A 4HOYA 5K0ZA 3TJRA 1OUMA 3M9WA 4FQ7A 5J4HA 1UBCA 2DTXA 2R8RA 3KKLA 2I8AA 3IX7A 1IONA 4B48A 3L6DA 4UVDA 1Y7TA 3AVXA 1R9GA 2KBEA 4I0WB 4Q4HB 1B0PA 2QTVB 2XRMA 5ILGA 3TR5A 5K51A 5E7IA