1T3ZA

Formyl-coa tranferase mutant asp169 to ser
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGSSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
molecule keywords Formyl-coenzyme A transferase
total genus 145
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1t3zA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1t3zA01
1P5HA 1XVTA 2YIMA 4ED9A 1PT8A 2G04A 1XK7A 1PT7A 2GD6A 2VJQA 2VJLA 2VJMB 1XA4A 1PQYA 2VJKA 2GCEA 2GD0A 2GCIA 1XA3A 4HL6A 2VJPA 2VJNA 2VJMA 2GD2A 1VGRA 1XVVA 1X74A 1PT5A 1VGQA 1XVUA 1T4CA 2VJOA 3UBMA 1Q7EA 1T3ZA 1T4CB 1XK6A 1Q6YA 1P5RA
chains in the Genus database with same CATH superfamily
3ZH2A 1FTQA 1YGYA 5I7RA 2A9VA 1NXQA 3HWSA 4YRFA 1N57A 4GOJA 3FRJA 3CKLA 2HWUA 4HDRB 2ZAGA 1ITZA 4KRYA 4NOJA 4FJ2A 4MPPA 3TI9A 1B23P 1T25A 1KJ9A 1TUEA 4F9GA 3Q8MA 5FPHA 1L5RA 3K0BA 3VI4B 1SKUA 1A7AA 3CE6A 3N76A 3QQPA 2B8NA 2AEMA 2VDRB 4D42A 4FYJA 1RAAA 2HJVA 2EDCA 1QNLA 2E4YA 3SBDA 1NASA 1WLSA 3H0KA 1DBRA 2AOVA 1GKLA 3EHDA 3WK4A 1WCIB 4HUTA 3OZBA 4EABA 3D2CA 2WSIA 3UWSA 1F51E 5B6JA 5DASA 3FPGA 2IPMA 5CNMA 2GN4A 2QZ9A 4WZBE 1AUOA 1P31A 3ACBA 2CMKA 5FO0A 3K8OE 2QN6A 1TCVA 4U6NA 3K16A 2GHQA 2QMQA 4HF7A 4OGWA 3NV7A 4U7WA 2R6CA 3LCJA 3ZVKA 4M0CA 5FWXB 1UQUA 1Z2OX 4GW3A 3A27A 3M6VA 2WPNA 3SXPA 4D3SA 2CVOA 1N7HA 1YQTA 4CCWA 1O94D 2CB0A 1E5DA 3CB4A 3BAFA 1YC2A 2CBGA 3JAWB 3MRVA 4CIWA 4DMUB 3A6DA 1V47A 4DREA 2ZIEA 4PX2A 1GPMA 4KPUA 2GTHA 2XUHA 3ROQA 2PO7A 4GPZA 4ASUD 3TM5A 2GPTA 3G68A 3L02A 4HJXA 4KWTA 4RAOA 2ZUEA 3OZTA 3TO5A 3IA7A 3H1FA 4QQKA 1NMZA 3G1TA 3EZ2A 1HZZC 2NPOA 1L5HA 1YDGA 4L5JA 2BHSA 3N53A 4IJ5A 1VE5A 2I2CA 2P2YA 3ZIAD 4DKXA 1HLFA 4YV2A 3QX3A 1MABB 4WZBB 2ZRIA 3UK6A 3CRZA 2NZWA 3K31A 1P44A 2C8JA 4JJFA 3OQIB 4YFVA 5KUTA 3W7BA 4YXFA 4F3TA 2VS1A 4IXNA 5TF0A 3LAWA 4A8PA 4KUGA 3QFCA 1SUSA 3QTLA 1FYFA 1OYVA 4M38A 3UPUA 2QD2A 4E1BA 5EXTA 4UNNA 1YHNA 2C5SA 4DXAA 1IB0A 3H1BA 1Z3CA 5CU7A 1JAYA 1PK9A 1JBKA 3FNGA 5AW3A 5P8WA 2ECFA 3ZV3A 2DBYA 4N3GA 5CGZA 3WO0A 4U7DA 4CFSA 1HNWB 2R1TA 4HI0E 1V6SA 4MAMA 1ZH4A 1XMQB 4JXZA 5HMMA 2EIXA 4MS1B 1JKFA 2M6LA 5CG1A 5E4TA 4F96A 5FOSA 4AP5A 3FPJA 4HXEB 4M1SA 2YUTA 4MWZA 4CDNA 3VFDA 1OR8A 1J8MF 3O6VA 4MGKR 2OZPA 1UQRA 1Q0ZA 3OT4A 2MHCA 1CD5A 3K20A 3R3JA 3ACDA 4DARA 4DMMA 4J2OA 4KQHA 3T3GA 3PNBA 2PS3A 1NJ2A 4ZAXA 3RGWS 4CLHA 3WBKA 1O57A 3T7CA 3B1JA 2ZUCA 2FF7A 3RD5A 4FDMA 1YZHA 4N5IX 3VOAA 1HL3A 2J32A 2I80A 5GZ3A 5KX5F 3R5SA 2REQB 3RTGA 3W5HA 1PJSA 1RHMA 3BK1A 3MINA 3BJEA 1U3UA 1WPGA 3O5AA 3LVRE 2HBRA 4RGBA 1NQWA 3ROZA 2PX5A 3EDRA 4G4GA 3FTFA 1NDUA 1FRZA 1EK1A 2C04A 3JQAA 3MTQA 2A1UB 4DQKA 2HR1A 3RUEA 2O7QA 4Q93A 4E4TA 4A2QA 1XKLA 1SQ6A 3OFVA 2C7BA 1Q0QA 4ZQHA 5EZSA 5GIPE 2VXYA 4ZHQB 2UUAB 1XQXA 3E84A 4WNAA 5SYMA 1J2JA 1MX9A 3U31A 1CK4A 4LY6A 3FDZA 4O2BB 4D02A 5HHTA 2P4QA 1SB9A 5AHOA 1TEHA 1N2IA 2Y66A 1IBMB 2G40A 4BLSA 4MEJA 5IT0A 3NETA 1JVBA 4QTUB 2KWIA 4DCGA 5JCOC 2C57A 3CSSA 3NMUF 2Z57A 4TV9F 1DQYA 1DBWA 2WU8A 3D8BA 3FN4A 3N58A 1OTHA 3Q0EA 3HCNA 1O95A 1VMEA 1V1RA 4LJ7A 4W5JA 4FOTA 2D5CA 1UDRA 1N2XA 2J9YB 4PZDA 2VHCA 2IH5A 1F20A 4CI0B 3HYTA 3OPNA 3WDLA 3IIEA 2GF9A 1EPUA 3QPUA 1CF2O 1PFQA 1G4HA 1Q7BA 1WQ1R 1LBEA 4UQPA 5CDTA 2Q8PA 1R6AA 2FP4B 2EKZA 1CY2A 4MINA 2HHHB 3X2SA 4IDAA 2C42A 1E1KA 1Y3AA 4B83A 4X94A 2O5EA 2IZ5A 4I4TF 4CM6A 4YT2A 2B78A 1FVHA 2RB5A 3GN2A 1K4KA 4RPKA 4YJ2A 1IBKB 3ABIA 1UBSB 7MDHA 1YVDA 1F3LA 1QIGA 1XI2A 2VK2A 1KQPA 2X0IA 4RPJA 3TQRA 5BSKA 1XEFA 4AFNA 1DEOA 2YZNA 5HRUA 2XXBA 4PWZA 4BDSA 1MH9A 3RFTA 4XYEA 3FLBA 2ZIZA 4QXAA 1RMYA 3U4MA 4I14A 3UGJA 4ANFA 1DV2A 1XFAA 4WERA 3B9RA 3HCAA 3JSAA 4Q19A 4ZD6A 2ZTHA 3FKQA 3GFOA 5CH8A 2Q41A 3KNZA 4PSKA 3M70A 4TZTA 1T3TA 2VYVA 4G4JA 5DHRA 3A9RA 4ZIRB 3TGLA 1YF3A 2PZFA 4E5NA 3FWPA 3KQNA 4PLPA 3L3BA 4DLWA 3TSWA 3EHEA 3I72A 1UXIA 3NC0C 1WF6A 3BGWA 2HHJA 4IDFA 1GTVA 4PRYA 3TYXA 4ZEXA 4A27A 4B8WA 4DG5A 2RH5A 2P3QA 1PUIA 2NVOA 4K1LA 1GIAA 2ADOA 1NRXA 1I94B 2C98A 3MMXA 3GUHA 3OFKA 1LH0A 3W1WA 4HV4A 3CZAA 4DXDA 2OK7A 4CQNA 1HDYA 2PT9A 4ABTA 4UZEA 4DCNA 3L6OO 3WB1A 3OFSA 2YQ4A 5F7OA 3WGJA 1RRVA 1C9YA 4UUAA 1QIIA 1VIVA 1S3FA 3BMNA 1BHSA 1YL7A 2VHVA 1QH1B 4JZKA 3OTHA 4DPMA 3MWEA 1C7RA 3AHGA 1V6AA 2G8NA 3PR3A 1JQ5A 2BR5A 2G9QA 1PR4A 4UEKA 3OFND 5A9TA 2H8KA 4D9EA 1P5ZB 3L0CA 1ND6A 3VO2A 3T1HB 5JPDA 4WKCA 1II0A 1KIAA 3HVIA 3O3MB 2NGRA 2RAPA 4UHEA 4B45A 3UICA 1M8JA 3K0FB 4QFCA 5EKSA 5EIHA 4B4KA 1H1TA 2VG8A 2YMLA 1QV6A 1RLUA 1ZA2A 5JZSA 1DBQA 3ZE7A 4UUMA 3USCS 4BMSA 1Y33E 3O8QA 5FTWA 1NMEA 3OZWA 2GPSA 5CDYA 3MJSA 2O8DB 3N2ZB 3U1VA 3VX4A 1F2DA 1QQ7A 1IM8A 1YI1A 1ZI9A 1SC1A 3ICOA 3VX3A 1MRZA 2AEJA 2F17A 4BFYA 4Z1OA 4PW0A 3HY4A 1CUCA 5U1PA 3OOEA 3KB6A 2PT7A 3HM2A 3KS9A 4EHNA 4WTOA 3E2IA 3ON5A 1K8QA 4DMRA 3SDZA 4S2EA 2G5TA 1DJMA 2PMEA 3DKVA 1FIUA 3CQ9A 5EZYB 1Z36A 5K0GA 2VPZA 1BOOA 1PYGA 3DE0X 3WI7A 1QLWA 5MN6A 5BQ5A 1VLHA 2I03A 1B14A 2W58A 4FMCB 4DOMA 1A1VA 3CY6A 2GOYA 3A1FA 5DNAA 1N33B 4NWIA 1J8FA 3P9KA 4WCDA 2XYRA 2F2TA 1ZKDA 2CKDA 1KNQA 3JVIA 4GI3A 4M2LA 3WB2A 1U3TA 2OPBA 1WTCA 4WBXC 3HBLA 4G8DA 3JQRA 2IV3A 2PX6A 4CIDA 1IPEA 1SKQA 3IPRA 4O4LF 4D9MA 2VQSA 3LRXA 5IK2D 4QLOA 5DCLA 1V6CA 4CG3A 3I9NA 2ZUBA 2EOAA 1YR2A 2XVAA 4GVXA 4CL8A 1PTJA 3V6LA 4LSMA 4NF2A 2FPPB 1XVIA 1SG6A 2H48A 2QMEA 1UM8A 2W2XA 1OUMA 2CYCA 3CX4A 1VJ5A 3GA0A 1E3IA 1O87A 4DN6A 5A4FS 4OTZA 2ZJZA 1GQQA 5LA6A 4MTLA 1ESEA 2ZBGA 1PWHA 2KB0A 3INYA 3MUFA 4QTZA 3U7IA 3T9CA 2WYHA 2JJ2A 4ARVA 3SQWA 1PF7E 3H17A 2EGGA 4AY2A 1P1BA 1GAJA 4JXKA 4WKPA 4HYTA 4OMDA 4DV7B 2PT6A 2JBAA 3R5JA 4TTPA 3RC3A 4EG8A 4FFSA 3UMYA 3B1ZA 3I9V6 4OQMA 1CY8A 421PA 4EF4A 4EX7A 3EF1A 4KDCA 4ENQA 5LP6A 2EP7A 2Z0MA 2WWIA 3GFFA 5C4GB 1DDOA 1P1IA 3PT9A 4IP0A 8LDHA 3E05A 4FDAA 3AFHA 2J08A 1SVKA 2BI7A 2QYTA 2CFCA 3GFSA 3UO8B 4MJ7A 3ELYA 4YWJA 1Y7TA 5AMXA 3G5MA 3TF5A 1G9XA 1M1UA 3W8FA 1RHRA 4PLZA 8ADHA 1WSWA 3DZDA 3RK4A 3H1TA 5AI6A 1JH9A 3LWBA 4IRXA 4P32A 2PO5A 5CDSA 3F3KA 5AO9A 3LO5A 3VUFA 2XQVA 3C8UA 5LMNB 2PTHA 3DGEC 2RH9B 1JQAA 4KE7A 3L82B 4NY1A 1NBEA 2V9CA 4MHSA 5FUXA 2IU0A 3BVPA 4Q9AA 1S01A 3OWHA 5HE8A 3KLPX 1PRYA 3EWIA 3D2AA 2C2XA 3NTQA 1N25A 1XT6A 1Y5RA 2I55A 1MRSA 4R1TA 1DZ3A 3LC1O 5CRIA 5AUQA 4BU1A 5IANA 3KV3O 1HZJA 1WL8A 2Q3DA 2CXRA 4RTMA 1Q83A 3AWDA 4MKRA 2ZG6A 1LNZA 3OU7A 1HYEA 5IAOA 2UYGA 4KMSA 1NSYA 4R05A 5JO0A 4JB2A 4M7OA 1QQ5A 1KZ9A 2Z5GA 3OE5A 3ZV5A 5DSZA 1N4AA 1P45A 4J1QA 1XJ5A 3EEFA 4Z4HA 4XQEA 4KV7A 1UBOS 2Y6UA 4BNWA 1GQOA 1N0HA 4Y8VA 4EA6A 4ITVA 4RVGA 4B3HA 2A33A 4TMTA 2KLBA 2YJZA 2RMKA 3RFFA 1XXLA 4G36A 1FLDA 3EIHA 4EG5A 3EZGA 3MWGA 4HLUC 1B93A 2VHJA 4F84A 2JH9A 1PD1A 2VP5A 3OCZA 3CEAA 4WN9A 5GGXA 3R7AA 4PO8A 3CLHA 5JJBA 4OXYA 4V2IA 4BN4A 2G9RA 3M4NA 3H5VA 3JSXA 3DNPA 3ISVA 1AE1A 4L7VA 5IHXA 5AD1A 4CETA 1QG2A 2NZXA 1RLTA 1IEXA 2O6LA 2PZ8A 4IIDA 3G7UA 5EEGA 5BN3A 2BFOA 3U6BA 4M86A 2GLTA 3DA8A 1BE1A 4PS0A 2O7SA 3N28A 3QE0A 4JUAA 1P8JA 3VPXA 2K2WA 4B4WA 3UJ7A 4BFTA 4D4LA 2OBFA 3EXFA 4ZVQA 1G9TA 1M34E 3B8EA 4X6YA 1GLVA 3P32A 3NKVA 4KO2S 4YK7A 3ASZA 5FWAA 3AMVA 1EXNA 1YZGA 3I76A 5AM0A 2JF0A 1E60A 3AYZB 3HSYA 2OE2A 4KAJA 5DBIA 1M83A 1LDGA 3L07A 4K9NA 1DXOA 2O7VA 1JIUA 2XLCA 2ODBA 1TVMA 2BOVA 2PUTA 3UHFA 4XQ9A 4I1PA 3QVOA 2PN1A 5K3BA 3IQEA 4I9HA 3K72B 2OO5A 3V97A 1SBHA 2DERA 2JI9A 1F5NA 2AIRA 3BSWA 3F78A 4IMRA 4L3WA 1E18A 1K8XB 4F6LA 1GQ2A 1H1DA 2BHLA 3ICWA 5J63A 3WIEA 3O4HA 1JHYA 1IHXA 5EMLA 3UGQA 1ISPA 5KTTA 3E3AA 2HCJB 3GEIA 5H9VA 2VJKA 4BX0A 1QGAA 1M34B 2I3BA 3E5NA 3LGSA 3P9IA 2ZQZA 3NIFB 4AURA 1FQWA 2DPXA 4UHCA 4CMBA 5AHKA 2NU8A 1XMVA 4Q05A 4EYSA 2X4GA 4PYMA 1COWD 4LZLA 4D6PA 3GLHB 1WHSB 5BSMA 1EZ1A 2KM1A 3TRJA 1DX4A 1E5XA 3B70A 3WYCA 1LSUA 5KNDH 1CZUA 5EUQB 2DTEA 1E2BA 1KSHA 4OUDB 3CINA 4UZSA 3MWKA 5D3KA 1W36D 4O1MA 3UNXA 5CFLA 4AYTA 4YYZA 5C4MA 4L0MA 4V0OA 1WE2A 1G8SA 1NXSA 2CW5A 1YA6A 4EPVA 2CDCA 3I6MA 5B1SA 3FYUA 4CMAA 3G1WA 1P0CA 2GF2A 4P53A 1NZJA 2FZGA 2D7DA 1VI6A 5JC1A 1E79A 3IP1A 3WBJA 2WU3A 4HS9A 3TLXA 1ND5A 2IU3A 4RMIA 4EZBA 4IIJF 3H5NA 1W44A 3M7IA 1UOPA 4J07A 4KGXA 4EUNA 3FCAA 3PPVA 2NSHA 3Q98A 3BICA 1NNEA 1VSQA 2BN4A 5A4MS 3PXAA 3ZS9A 1U2ZA 1LTKA 4KI0A 4ZOQI 1Q0LA 2LNDA 1Z45A 2HHLA 3DWFA 1BFKA 3JVUA 2Y3IA 2J7PD 3GLHE 4JB0A 3HNPA 2I4OA 4XD7A 2HGZA 3H18A 1Q7EA 2W2TA 4J9VA 4QRIA 3DSRA 4UD2A 4P2GA 1VHLA 1VJGA 3GH3A 4MZXA 5LXTA 3L84A 3SC2A 2YRXA 4PBTA 4CTJA 4JUIA 4TZ0A 1SBNE 3AI3A 4Z2YA 3FCCA 5F3RA 3BOSA 5LZ2A 4J7UA 4P3OA 1EVZA 4NATA 1ML4A 2JGIA 4XOUA 1EDBA 3PJFA 4CMIB 1I2DA 1L5VA 5HBGA 1I7DA 3COVA 4YIHA 2VC2B 3NOXA 1RIFA 4RSRA 1NXWA 3OF3A 5FTNA 2Q2QA 3LP8A 4E46A 4D6XA 2GXUA 4X66B 3N6RA 1MJ5A 3RODA 4YRZA 2V54A 2CF5A 4J29A 1NVMB 2NUPA 3GG9A 2WPDD 1MXHA 1IDN1 3P8ZA 1XJQA 4N5LA 4ZVKA 2YMPA 4LDAA 4BKUA 1JW9B 2RHRA 2WZBA 1A9QA 3H9GA 5TMEA 4ZXPA 4E22A 1F2TB 2ONJA 4QRDA 3TW4A 4YXWD 2HV8A 5KDLA 3IJEB 5IC5A 3B52X 3O8OB 5EUBA 1NFRA 5HKKD 5LP1A 3NBFA 4YJGB 5JDIC 2MR6A 4HFRA 4XGRA 4KXFB 4BC1A 4GEGA 4UNQA 5AVTA 5GJBA 1D5CA 3S2UA 5HJ7A 2C9MA 4C01A 1AU9A 3L7IA 1LTHR 1WU7A 2F62A 4TLMB 3DBHB 1WKCA 3OIWA 3T7AA 3U09A 2J9GA 1NOKA 3QWFA 1PWEA 4ZEOA 4CV3A 4LF8B 1PR1A 1LZKA 5AKKA 3HR4A 4OPMA 3KDPA 4MR7A 4P4SB 3ND9A 4JEUA 4M0DA 1OXMA 1IVYA 5AW8A 5A06A 3R09A 3WNVA 1LVHA 1XMPA 4OSPA 5CVDA 5C9ZA 1RE0A 1BG6A 1KFJB 4KO1S 1ARZA 3ZWCA 4RD2A 4X92A 2VT7A 2OMKA 1YSCA 3V42A 1DEAA 3C98A 5CT6A 4JP1A 1CQXA 2A5LA 3U56A 2GBLA 5CYPA 3JD2A 1IZ0A 3R6TA 5EHGA 5EZ5A 2G5GX 2NUTA 3SXJA 2G70A 3HI4A 1TQ6A 4OJKA 1R6UA 2Z2YA 1IQRA 4NIMA 1YVPA 2HBQA 4Y67A 5F5LA 5FWXA 3UJ6A 5C8YF 2RI1A 3WNQA 3VR1A 1QZZA 4QNRA 1DBSA 2CLHB 2OR3A 4WN3A 4I1YA 1USGA 3BMQB 2VDKB 2GARA 5KTYA 2C4UA 2C97A 3HO8A 5DGXA 5I7WA 5IRCD 1N75A 4Y2XA 4H1TA 2GHRA 2HA3A 3HBJA 4OQYA 1BDHA 1LU9A 4PXAA 5CPFA 4MQMA 1DIRA 5CH3A 3CUUA 4B34A 2C61A 2Y68A 3L05A 2GM9A 3NDIA 1MUUA 4S1WA 3EA0A 1VP3A 3LWZA 5T8KA 4O59O 2Z1NA 1D2CA 1R0CA 1KH2A 1NXPA 3OCUA 2VSYA 2C1XA 3F5DA 4QU0A 4RMNA 4AJIA 4EHHA 4CLOB 2EP8A 2YNMC 4AWXA 4WFJA 1DO2A 1QYCA 1BWSA 1KZ7B 1Z6XA 2WUFA 4GI1A 4C08A 3IVGA 4KK3A 1ZNZA 2X6QA 3VZSA 4S05A 3DP7A 1C41A 4GVPA 3VHQA 3HY6A 3ABZA 5B7QA 5CVTA 1XWWA 2DBRA 3T5PA 1VCMA 2Z5VA 3W2HA 3SQXA 2WJPA 5FV4A 4EGQA 4OGLA 4HWTA 4LY9A 2XDAA 2BRUA 2WA1A 3HKDA 1IUOA 4DVGA 1QIFA 3JQGA 2ID8A 5IK2A 3B7GA 1XD2B 4CYMA 1KEUA 3BWBA 3TVDA 1GNQA 1Z38A 2ALJA 2QSZA 3PUXA 4E94A 1RTKA 5LQKA 4DB2A 1QFMA 4MA4A 4J6FA 8OHMA 4FHZA 1FFAA 1WZNA 2LD4A 2B2XA 2IX3A 2CXSA 1EFHA 1BW9B 2JS7A 3DHNA 2NACA 4XE5A 1V0JA 3DL0A 4G01B 1K06A 2QVCA 3QVTA 1JHMA 4JGGA 4E2XA 3GNTA 2XXAB 4FS3A 2D06A 2OQ2A 1M0TA 1MEOA 1C7ZA 3O92A 4YASA 4M60A 3Q3VA 4PNZA 5GV7A 1L4BA 3WFJA 1RPJA 2X2PA 5E3JA 3WLQA 4E31A 4EKEA 3IX7A 1ZK3A 3BMCA 3CRQA 4U02A 1L0BA 1HTWA 4Q5IA 2EGHA 3WMFA 2AVNA 1SIWA 3D6FA 1PV1A 3QVWA 4LXXA 1HDGO 4A91A 1K2WA 3FJYA 3GRUA 4Q3LA 4QULA 4KFSA 1LVUA 4FFDA 3NFRA 4FCCA 3TRFA 1JDSA 1YBHA 3KJEA 2P5UA 3E53A 4HVAA 4KREA 1W75A 1YU9A 3M9XA 3PYMA 2FU5C 3CF2A 4MX8A 5B6IA 1CR1A 3DE5X 2Y6VA 4S1TA 2O8FB 5JH7B 5IU6A 1S6YA 2GILA 2Y0BA 2O5VA 1FU7A 3PUKA 5JBNA 1KGDA 2WU4A 2YWBA 4KN8A 4RIHA 2O4CA 4JLVA 3NIGB 3ZGVA 3KT0A 1EGHA 3SIWA 3TSYA 1M2GA 5EJ5A 1JFRA 5KJ1A 3UGTA 1OVMA 2QN1A 2G0TA 3TJMA 5CFPA 1G7CA 2GZMA 2JJ2D 3GK3A 3Q9NA 2OO3A 1J7JA 3QENA 4HEHA 2MSEB 4NXMB 3ZE8A 2P9HA 4Z1MD 3L7BA 4DUYB 4IY1A 5I7SA 1J6UA 1JDPA 1KI6A 4QGAA 5HUQA 4FU0A 2QU7A 3TIVA 3PQ4A 3M6AA 3RTEA 3F7MA 3ZI0A 3IIMA 4OY3A 5IX8A 2UVQA 1RYDA 2EBWA 2JC3A 1FXSA 1CQWA 1D4AA 1W25A 3I53A 1E9AA 1X1TA 3LLSA 3Q41A 4YACA 1DOHA 1I01A 1UKAA 1H2BA 4H6VA 5MFZA 1JPUA 5ILOA 5LQAA 4FQ7A 1Q92A 3PUHA 4XGKA 1JTEA 1N2CA 3B89A 4L6CA 1LSJA 1H85A 4HVLA 4BRUA 4BNFA 1ZLYA 3CPEA 3JQ7B 4EGJA 4IQ8A 4DDTA 4X1KB 4BZQA 3ZXSA 5AI0A 5JVDB 4KR6A 4RUKA 3U40A 3HY3A 4LOJA 2DRIA 4KQMA 5BXQC 1OC2A 2AHOA 4D8TA 2A92A 2QGFA 5A3SA 1RM0A 4DSZA 1Y63A 3L79A 3DWEX 4MVXA 2HZ7A 5CK4A 3UKDA 1QB7A 3HN2A 5EIAA 3ZVLA 3W5CA 4WQMA 1NBAA 4DNFA 3BL8A 4ISBA 4YUAA 1KEEA 1ENPA 4G97A 5FADA 1CUAA 2BMDA 2G06A 2UZ0A 4EY5A 3RYHA 1RRFA 3V1NA 3JWPA 2OC4A 5BWCA 1GAQA 3FKSA 4C7BA 1WBBA 2XHEA 4BNVA 3VR4H 1R4MB 2ZBDA 3OCXA 3ZDBA 3MUNA 1K97A 4V0LA 2G17A 3FB1A 5K3EA 3PNMA 3W77A 1P39A 1NT2A 2FUEA 1NUPA 1QFZA 3RKSA 2IKSA 3QKRB 1Q0PA 1I36A 2B35A 1SY7A 2G09A 3DV0A 3ZXXA 4HDCA 3BMNB 4QOSA 4NBSA 2DXIA 4H0NA 2H65A 2XEDA 5ED0A 4M8KA 4KZPA 5A7GA 1FUUA 4OI2A 3AH8A 1VTKA 1H8HA 3MBKA 4WSOA 2D5AA 3Q88A 1C1DB 1DC7A 5IARA 1ORIA 4MULA 2AFHE 4CT0A 1DQRA 3NJ8A 3K8ZA 1Y37A 9ATCA 2JLXA 2J7KA 4OXQA 4V24A 2LE0A 2PD6A 1R7RA 2A9JA 1RYFA 2X40A 1W47A 3WYAA 2GBPA 4JU9A 1EFAA 2B6HA 2V59A 4YIKA 2HDNB 1L4HA 3U3JA 4TOIA 2ACVA 2PLRA 4NTZA 3COYA 3LTEA 2ECOA 3D8HA 4Z0NA 4D3FA 1J21A 4HEA6 4NYJR 5EE0A 4CQLB 4HB4A 4EDHA 2Q3HA 5EZYF 3FVWA 4C14A 4FMBB 3CWZA 4DANA 2F7SA 5IYZB 1U0FA 4XRRA 4AF6A 4MZDA 1EIZA 2PIDA 3TQFA 5M29A 3ME5A 4HT3B 4JYAB 3HKBB 2AN4A 1IUNA 2WKPA 3TD6A 2Q2OA 1L4GA 3ZQ4A 3E2PA 2EQ5A 2I4RA 3NOQA 5HFNA 4DRXA 4UUOA 4BPRA 5FHRA 2FMFA 1KP2A 2CUNA 5LBTA 3DKRA 4DY4A 4YCLA 1A04A 4J0DA 1Z4JA 2OHHA 2ZBQA 5HFAA 4F0JA 2QG6A 4OSEA 4EW3A 3S2SA 3TCXB 3DPSA 5GINE 1GSOA 1G1AA 4TKMA 1HSOA 3F47A 4FCWA 2HK7A 1N5JA 4WZ6A 3FOEC 2YXPX 3K9HA 1ONBA 3AVWA 1OHHA 3DEJA 3L7CA 1GUAA 3NRBA 2AMJA 4HN4B 4I9UA 2CFOA 2XB2A 1M6NA 2ZM6B 2FOXA 4NBVA 5KYKA 4BMYA 4FDLA 2CNWA 4A5SA 4BAZA 2ZCUA 4KFCA 3JR7A 5LA6B 2G4VA 1CJTC 3AIKA 3W2GA 5C8VA 1HDCA 1CY6A 2I66A 4K28A 2ZYTX 3H5OA 4HWPA 3UAYA 4ZTZB 1IN8A 4JI0B 3GWGA 3NRCA 2HIMA 5IAGA 2IWHA 4AY4A 3BMOA 2YOHA 4L9RA 5FTKA 4KQEA 2B4KA 4IJWA 4X63A 3TXAA 1TDJA 1II9A 3BGOS 5IXJA 4U5XA 4N9WA 4MDFA 1ZD3A 1E6MA 2HUPA 2GSDA 4UCFA 3RV4A 2YIJA 3BAZA 4XIJA 1JKXA 1IVNA 1RJ9A 4R2IA 2IDKA 5F9HA 1M0WA 2E82A 2OAP1 1RJFA 3EVNA 1N3YA 2CL6X 4RE5A 4FKZA 1VGRA 5JYCA 2OBMA 3GLRA 3NQ41 2ZUVA 4HQ0A 4N01A 4GZ3A 1FDSA 2WSYB 1HXHA 2IV7A 2WV7A 3V8BA 4QUBA 2B7BA 3PL5A 3BGSA 3FWHA 3H2YA 4I9FA 3U7QA 1JA0A 4OQFA 3KUCA 5AK6A 5HTKA 3T0FA 4N12A 1MC8A 2YY7A 3F6SA 3M6IA 3PNOA 4AS3A 4BE4A 3IR6A 2J5XA 2Q6LA 4HCJA 1VHWA 2NW6A 3O2JA 3Q3EA 5JEDA 5K8JB 4J0CA 4P3YA 4TXMA 2EW1A 4Y6RA 1GCUA 1JU3A 1U5AA 4G0XA 2SICE 1K7CA 5JJIA 1KI2A 4FOSA 2MT9A 2QUBA 3I61A 1USVA 5KVCA 5IXSA 4KVGA 3EPJA 1OJLA 5K0ZA 4X24A 1UXKA 3QUAA 3THYA 2NM0A 1X74A 4X44A 4X3CA 2ZPAA 2EV9A 5M7EA 1H3EA 3LUGA 3BFXA 3Q4GA 3AUUA 5D3ZA 1CJVC 1G7SA 1Q6ZA 1DJOA 3OZFA 1V5GA 3R3SA 4H16A 3WIUA 10MHA 3WHKA 3HVJA 4IHJA 4QDKA 4D5EA 1Z4OA 2Z6UA 3OURA 4FXOA 3N5KA 4TV8F 1L5GB 1JLHA 2O2XA 4ZCLA 2OM6A 3H0EA 4ZJZA 4Z4IA 4TLAA 3OOHA 3ZY5A 1WR8A 3FKJA 3VH4A 5IF3A 2HREA 3PXUA 5JI3E 1E92A 1CC1S 1D1QA 3U60B 1KBOA 5JSKA 2QV7A 4JYMA 2P6MA 4MIEA 1QOQB 2JNWA 1PKEA 1NLZA 2WOOA 3K73O 1O6CA 1VHTA 1I14A 1WHSA 4MV5A 4YRPA 4LKRA 4CM9D 1RXUA 3CLSC 5BV7A 5B3LA 1KDTA 1Y80A 5F21A 1N3BA 2H2FA 3E9MA 4FBMA 4R16A 4RDCA 4HRAA 5HF9A 5JJKA 1CKEA 1O9GA 1GTG1 2PLWA 3TRHA 1FNMA 2ZRPA 5JARA 1XLTA 2DPLA 2NO4A 1YI0A 2ZSKA 3ET5A 4LHYA 1LBQA 4O4IA 3UCEA 4IIJA 1IY8A 2GM3A 2IU6A 1EAMA 2E6UX 1AIPA 4QBKA 1ZH8A 3F5FA 2QVLA 3OJEA 2QDKA 2RIPA 3A6ZA 4XYGA 3VC3A 4CKYA 2ZYGA 5SY9A 3KQLA 4NJOA 1A2KC 4K3UA 3VZCA 4MS4A 2AG6A 4G5YA 4Q39A 4DA7A 2B1RA 3QFTA 3EC7A 1Z4MA 1M72A 3VVMA 5CIYA 4E6EA 4AUEA 1HDXA 1U8YA 3MWFA 5EZYA 4PC1A 2XV1A 3HXQA 3P5SA 2ETVA 3LUBA 3OZSA 2QVBA 2HB6A 2ZT7A 4MDYA 2WHXA 3S5JA 1EDZA 3VPCA 3EA5A 4NDZA 4BGEA 1NG9A 1NZFA 4YI3A 4RCVA 1QVRA 2P9EA 5H02A 5JQWA 2YZKA 2MDTA 2RHOA 4F2WA 2F1JA 5KS2A 6ADHA 1UK9A 3E58A 2GN0A 3FUUA 3ONVA 1KMNA 3JVDA 3K30A 2GAOA 4J49A 4L27A 5FLKA 4KQIA 3NS7A 3HA2A 2C7QA 3QP9A 1CUGA 2GFIA 3K3PA 2XNSA 3RM3A 4Y18A 4QJIA 1MO2A 4QU9A 4F91B 3ROPA 8AT1A 2QLBA 4YRSA 4HH4A 1W7AA 3TDKA 3A1TA 3NCHA 1X7WB 1GR0A 4LZOA 2E3JA 1HPLA 5DBGA 3MWEB 2FZWA 4UJ5A 4ZVRA 1T1IA 2F67A 3V4VB 1UJ6A 4TMWA 2NXJA 1SU6A 1IMJA 4WVFA 2H16A 4E5PA 1F8XA 3GLFB 2BE7A 3TL6A 4QEKA 1MF7A 1U3VA 2VJLA 4JZYA 5D1NA 2XECA 3SEFA 4AZ3A 4F1KA 1OZFA 5A04A 2Q6OA 2PKRA 2C8KA 2VF5X 1P7VA 4MCAA 4KPFC 3LKBA 4PN3A 1IXKA 1HYHA 1ZU5A 1PFGA 4B3FX 3Q72A 4ECEA 2GBFA 5BNIA 3F6RA 2B99A 1L6RA 4WZAA 4Y7DA 3A1VA 1JHRA 3F98A 1OF1A 3NGLA 2CHFA 1FUYB 4EW2A 1Q1BA 5FTLA 3WO1A 3BRQA 1KU0A 1ZVKA 1ZUWA 2Z08A 4ER5A 2ANCA 1TM7E 2H1CA 5LP6C 4XTCS 2XAUA 5FNVB 3G0HA 2CCJA 3AYXB 3QPWA 4UFOA 5JD5A 4ZHSA 2VZLA 5L45A 4GL4A 5U9CA 4K87A 3T15A 3ZZ0A 4I55B 1YE3A 3QOXA 4QXRA 4YO8A 1HDIA 2Q50A 3CR3C 5DYYA 3FI0A 3OU6A 2HF8A 3B82A 1VE1A 4HXFB 2XH8A 1BCRA 1PVVA 2A88A 5JD3A 2C94A 5A9SB 1AUVA 2H4WA 3TI7A 3HG7A 1IZ7A 1W581 1WRBA 2Q8NA 5FKJA 3S8MA 3EMKA 4WY5A 2FE4A 4JLDA 4EMUA 5C7YA 1PZXA 2PJUA 3F6YA 1U7HA 5IC4A 5KYWA 2FSIA 2QLNA 1K08A 1G59A 1BCSB 2V98A 1PFWA 3MXTA 4CQMD 3GP5A 4ER7A 1SHJA 4K6KA 4R1PA 4K6OA 3W79A 1N77A 4OQDA 1QVAA 5B12A 2HA0A 2AUTA 2B2NA 4ZPJA 3UJDA 1DCMA 1NR1A 2QN3A 3WLOA 4YCJA 4RH1A 4CMHA 1WCXA 2PUVA 1Z13A 1V41E 3HB4X 2VQ3A 1SEPA 4JLKA 3RUPA 1C9EA 3GROA 2YX1A 4DW8A 3ZU4A 4HQKA 4UBMA 1H22A 4AX8A 1GRNA 5C34B 3VGPA 1X7ZA 2PXHA 2I6GA 4FNAA 4IV0A 4BE7B 1AHHA 1TXGA 5HDBB 1EK6A 1TAUA 3NAGA 3NHJA 2MYUA 1T4GA 3O3OB 4WK2B 3RJ5A 5NULA 3VDRA 2QDXA 1N9ZA 1KEZA 4JT2A 2FA9A 3QVMA 3IT1A 3G89A 4NBNA 3U7RA 1UJMA 4AF8A 4CDRA 2C4VA 1LNQA 3KQTA 1ZK4A 3STXA 2A86A 4GGPA 5BWMA 4QKQA 2HCBA 3X3HA 1EQ2A 2OYSA 1E7SA 1J07A 5JW6A 1Q11A 4FILA 1I2MA 1W5TA 5FDFA 1HT1E 2AJTA 4WBSA 1TIBA 1US8B 1CQIB 2AFIE 2LDXA 3GAZA 4HDRA 4Z9XA 4TKUA 1QIHA 2W6ZA 2H4FA 2QAGC 2RGAA 2WEKA 2IH2A 5EWMB 2OK8A 1VJ0A 3I04A 4M9CA 1ZWLA 1ESDA 3CB2A 5ALJA 4GXTA 4P4SA 4AG5A 4EM6A 2A84A 2DSTA 4EJSB 4UM5A 1IIRA 3K05A 2CNDA 1ACJA 1PR3A 1YL5A 2C5AA 2FPIA 3QPVA 4R1LA 4EYEA 1MAWA 4UOEA 1E2PA 2B4AA 4XDHA 2V8OA 1B42A 3SF0A 4HAIA 4IINA 4IXDA 3SQMA 5DNEA 4E4YA 5JD6A 4G37A 1AOXA 3GFGA 1MPTA 1MB4A 1V1JA 1N6PA 2BKXA 3W2TA 5FBWB 1E62A 2Z56A 2FB9A 3TEJA 4YUZA 2OQRA 3AKDA 1TD1A 2GLXA 3FFWA 3FZQA 4HLQB 5CH5A 4BYGA 3KXIA 1EI9A 3LY5A 4F56A 3GDFA 4NCKA 2FRVA 1MA0A 3DH0A 1GTL1 2FN4A 1U02A 2FN8A 4U1RA 3HJHA 4P38A 4YRDA 5JNSA 4JDPA 2V3VA 3Q9UA 4YJFB 3SHOA 3VNAA 3I83A 1AN0A 1FVOA 1L7PA 3THSA 1HORA 2NNLD 3DAFA 3F7NA 2BKAA 1UDBA 3T9BA 1MTZA 3VRHA 4MB0A 4BNYA 1AJEA 3LKVA 4CV2A 2PXAA 4P82A 2A4MA 2C84A 3MCAA 1HV8A 5AJZA 5DX0A 4BWVA 3D1VA 3NAMA 1KJIA 3L18A 1FFYA 5BSHA 3DJYA 4JC4A 1M34A 2YXDA 2BBSA 3S8YA 3L6RA 2PYDA 5T4HA 4KPUB 1QYDA 2DHEA 3TZBA 3RSGA 1IAQA 1E9BA 1KKUA 2QJRA 2DFKB 3NAQA 2DTXA 4L8VA 4MKXA 4R7ZA 1CR0A 3HABA 3U62A 4BO9A 2EJVA 4Q3OA 4RWEA 2FEMA 4DABA 1CEYA 5JZ9A 3JQFA 4KJXA 4RK4A 4Q1AA 4JEHA 1MABA 3GYBA 2G9ZA 5CPBA 3KV1A 4DLYA 3RBVA 1U2DA 2GK7A 4M99A 4UE3S 2YVLA 3T7DA 3REGA 1MMFB 5ER9A 4BFSA 5CG2A 2VHYA 2OCGA 3LXUX 4HGQA 5FJIA 4AZ0B 2CC2A 4JY7A 1OASA 1U0NA 1ISSA 1XZQA 3JWHA 4N6GA 2XCQA 1BN6A 1GTSA 1EWVA 4YPFA 4L50A 3PFFA 2J5KA 2CXNA 5HTOA 2IXEA 2X5OA 3AF4A 3ANYB 3P9CA 4HFMA 4LCJA 2OAEA 3T8YA 4UTNA 1QO0A 4MLPA 5FBQB 2WG2A 2GA8A 1TNDA 2YBDA 3JQPA 3MRXA 2UZIR 2XWQA 4D0LB 5K6AC 5CX4A 2Q0HA 4XOIA 4BQFA 4MPTA 3WLSA 5JMTA 2HEGA 4JLPA 1K7XB 1OBHA 5TE9A 1YS6A 1VYTA 4JC8A 4PS1A 4RKEA 4TLLB 4B8YA 4JB3A 4G09A 1I0LA 1IE3A 3R4VA 3RTDA 1GNRA 3LT0A 4J3JA 4W9RA 1DCTA 4OJNA 3RJMA 3D8NA 4E2ZA 3I1IA 3HSSA 4ZOEA 3JQ6A 3K15A 4J1TA 3UAZA 5IVKA 4I6GA 5JVDF 4ND8A 2G0NA 3EZLA 4R1UA 2X3FA 4JEMA 3WE7A 3O73A 4QM6A 2Q5FA 4DR1B 1O54A 1GDDA 3J81A 2GZRA 2B1IA 1V37A 4LJ4A 5CTAA 4JJGA 4KRGA 1YD7A 4NH4A 2IHUA 4REQB 1I2ZA 1D6JA 2WAYA 5DVZA 3RYHB 1DCKA 1DARA 4CUJA 2ZXEA 5K05A 2J0UB 5DTRA 4Q9KA 1H0HA 5ITVA 3JQ9A 1MH1A 1S8AA 3ZPXA 2BDUA 4Q34A 4A92A 2PRKA 2OD7A 2OSVA 2OGWA 4O3MA 2QMZA 4LTMA 3X43A 4CVNA 1HG0A 3AUYA 1YC5A 1F5SA 1I6KA 3QVKA 4I9NA 4ECAA 4FFBB 3TH5A 4EJ2A 2TMKA 2R8XA 1G8YA 2X4IA 2FKAA 1VKJA 5TNXA 5A5FA 2ATVA 3RVSA 1EGAA 2QZPA 3W9SA 4Q3NA 4B7XA 2NO1A 4WJKB 4KE9A 3L0OA 2QUJA 5G3YA 4YV0A 3KZCA 2Q5CA 3ZC3A 5HZGA 3R6GA 4F9FA 3FYDA 5LWQA 2IXFA 3TDNA 1LLCA 4DV1B 4Q1VA 1UBUS 2WINI 4HB3A 2OXEA 2WU1A 1NSTA 4RNCA 5BV8A 2DT5A 1J23A 1JTFA 3U3MA 1J9ZA 1RDFA 4AO7A 4YLYA 3CW9A 2TMGA 4A2WA 4PC7A 4A0SA 1MJFA 2AWOA 1M6HA 3JYOA 3ND7A 4L3OA 4X84A 1ADFA 1S3SA 2Q0XA 2R84A 4PV7A 3H4TA 4DYDA 3M81A 2FP4A 4XSGA 1KY5A 1PGPA 2P1RA 3G2HA 3KFVA 3UAVA 4JB8A 3NBMA 3FYCA 4BE9A 2BGWA 3BT7A 1RP1A 5A62A 3U44B 3ZWKA 1HDOA 2PQ2A 4QDUA 3U9SA 1DAMA 2H06A 3UQZA 3ROMA 1O0BA 1TC1A 2QZSA 3CT4A 3DQZA 4XRGA 2XUPA 2AEEA 4O4JF 2CV0A 2HLDD 1BD3A 5ITSA 5KC8A 3MYRA 5AVZA 2PLFA 1P1CA 1YR3A 4B79A 1G4UR 3AEZA 4M4SA 721PA 2NVUA 4LVOA 2VI5A 4KRXA 3HCRA 3HNOA 2FGJA 3ZKWA 5CM2Z 4CKEA 4U2CA 4W8GA 4CTMA 5ES4B 4PG5A 4HPWA 1KK2A 3NJRA 3PFKA 4F2HA 3WL4A 2ZYIA 1LS1A 5K0EA 2XT9A 3TIGA 1OFHA 2V58A 3KKNA 4DBLE 3GI1A 3RV3A 3ZTWA 3PIIA 2VWPA 5I6DA 3O82A 2OENG 2GD6A 1GG5A 1Q14A 3N7AA 4REMA 1CQZA 4D0SA 3KBBA 1D0VA 2WG0A 4IHJF 4C9BA 1A96A 1IIBA 3WLKX 2O59A 3G02A 1M73E 1G5IA 3B1VA 1SVWA 5I5EA 3S70A 1T1SA 3K92A 4GE0A 5JZVA 2QUIA 4FHDA 3PPWA 1YV9A 1K7EB 4BKQA 2V9ZA 1SUEA 1E1QD 1UBEA 1ZNWA 2O20A 1MO3A 3DUFB 5G0VA 1YDEA 1MX1A 1N5OX 3P27A 5F5XA 3AXSA 5THQA 5MN4A 1EX1A 1KJYA 3Q7SA 1HFEL 5KPJA 1XVUA 2WIBA 3MAGA 2ZJ8A 1H6DA 4KXQA 2DC1A 1M7HA 2JLCA 5FHQA 2DP4E 2WMOB 3EB9A 4OD0A 3ECCA 1CDOA 4PGGA 1U7PA 1KYQA 4B3BA 4TTSA 2Q3LA 1WXEA 4P83A 2QY6A 4QYIA 4YJDA 3LL7A 3ZEAA 1CP3A 2NSJA 2XSZD 4L08A 1E2MA 1KR5A 3QWBA 2PKCA 4X3PA 4PLYA 4OG2A 2C5LA 2VF2A 4ONEA 5DN9A 3S40A 1MPXA 3W5SA 1RKBA 2DLNA 2DKNA 1WM1A 2RK4A 4LYFA 1HFJA 1O94A 1ML3A 3VU1A 4NAHA 4WXHA 1Z56C 2HHAA 3O47A 4A0GA 4DYHA 5H70A 3B38A 3E9EA 3TCNA 1EXVA 3D7RA 3V80A 4RHXA 1QC5B 1NTRA 2PFKA 1ONNA 2JCSA 2IE8A 4H6PA 4HFJA 3TLYA 2I2BA 1F8FA 1G1MA 2UYQA 4HXGA 3TKLA 1IXZA 3ZHXA 1DNPA 4MEAA 3TE7A 3HLTA 4ZT7A 1ZOSA 2WABA 1VPEA 5FL7D 3B6IA 3ITKA 4FNGA 4OB8A 4RF4A 3WIBA 1KVUA 2JLRA 2ZJ6A 4BQOA 5DBHX 4EZEA 5AHRA 1XZDA 1QKIA 1EVEA 1RJEA 4MQEA 4ZAWA 1FJXA 4FT4A 1Y3FE 4RK0A 3RHSA 1KC1A 3OPMA 3VR4D 1D1SA 4PBRA 1NW5A 1ZR2A 5JU6A 2EZUA 1OBCA 3CISA 3KU1A 1ZP6A 3C2QA 3OY2A 3IURA 1E7YA 2OCAA 3DXYA 3PGA1 1H0RA 4M1MA 5DYNA 4YUVA 5HZKA 1YKGA 3M3DA 821PA 2CFSA 1QONA 4WK6A 5AW0A 5SY4A 4RTNA 2I0FA 4CRWB 2K5UA 1KQOA 3ADOA 5B4UA 2QE7A 1J2UA 1FBTA 3RFCA 1CUJA 1A4UA 3TPCA 5H3LA 1VCNA 1Q12A 1NV8A 3ORRA 2J0VA 5AP9A 5EKXA 3OM8A 1T6ZA 3DVAB 3HKCA 2AZDA 1JRLA 4MUHA 3S2IA 2AG8A 4TLBA 1P73A 1Z6AA 4ZDIA 2OLEA 1BGWA 2BMJA 4YA6A 1PNVA 3BEOA 4MP6A 4RWZA 1Y48E 3IP5A 4RHFA 3BWMA 1C0KA 3QVUA 4MI1A 3UMRA 4YQZA 2XA1A 4AO8A 1SK8A 1TK3A 3U9TA 2X9QA 5FPQA 4CM5A 1SR8A 5BWBA 3KM0A 3R0XA 1XMXA 1WW2A 1PK7A 4HDKB 3SY8A 3IPYA 3SSAA 1JHPA 1XEXA 2Q1YA 1QFYA 3PR1A 4QT0A 5K20A 2ZLBA 2FVYA 1YJ8A 1Y1RA 1B2RA 4HGRA 1LDBA 2WSLA 5CA0F 2IW1A 2NYVA 2CDBA 5KQMA 2YIMA 4DCTA 4TZ6A 2AN1A 5LPNA 2O3TA 3EMDA 4FEGA 4G1UC 4N5HX 5EP4A 4UPDA 4YCDA 2A9FA 3UOGA 1F06A 3BX1A 5HNKA 2UXBB 3I01A 5L53A 2H7CA 3N3BC 4G5SA 5DGIA 1W1WA 4HNAB 5F1PA 5SZIA 4GKVA 4WOKA 3DL4A 3V2GA 2BMFA 2VHWA 3WKAA 4YCNA 2QLMA 1RZUA 3BF7A 1OH7A 5A0TA 2J3DA 3KO8A 4J76A 5LCXA 1VLMA 1EK5A 3WR5A 3CG4A 4KLCA 3HYCA 1TYBE 3JAKA 4INOA 1Y6QA 3IBCA 5FXMA 5LZ5A 3WX0A 4DILA 4FHCA 4F3NA 2BVNA 4Z8XA 4LQ4A 1ULUA 2LP4Y 1NXVA 5BN4B 2Z1DA 4RMHA 3F97A 4IMJB 5CX1B 1T3ZA 2GDZA 4B84A 5BVGB 2JFWA 4L5AA 4EY3A 5C4IA 3WZ2A 1R4MA 1E98A 1UKVY 3I58A 4KR0A 1RWXA 1XXHE 2FGKA 1JX6A 4IX1A 4EHDA 5B4VA 3HCWA 4C04A 1DIBA 3FROA 4M0KA 5DHUA 1YA8A 2E0IA 3L6CA 3VR6H 1LI4A 4KO3S 1QRAA 1C3LA 3VV2A 4A15A 1BA3A 2WE8A 1YO6A 1L8LA 1WHTB 2Q3JA 4B0PA 2VLBA 3L7LA 1O03A 3M4JA 5DWVA 2OP0A 1T9GR 1V4NA 1RJGA 5EXEA 2DVMA 3D4NA 4K26A 2XQJA 1EUCA 1SKYB 3RLIA 2AZXA 4OQNA 4B43A 3CH7A 1J00A 2BWJA 1BFDA 2GERA 3LLCA 2GBGA 5KHLB 3N39C 3UG6A 5E6SA 3DFFA 1R3DA 3BF8A 1FLAA 1M1XB 2JDIA 4RHEA 1G5FA 4IICA 4DZRA 3MFQA 4CMEC 4ACAA 1VP9A 3ZDXB 2QRUA 5AKIA 4EF6A 1EXDA 1N6HA 1NPDA 4IUBS 4FR2A 4YC7A 4JI3B 1XXHB 2W2LD 3HDQA 3WDSA 1XU7A 1V7QA 5BURA 4P22A 6LDHA 1CW2B 2EKPA 5I7EA 3JQ7A 2W6MA 3NIWA 4MRMB 4D9JA 3AEKA 3B1XA 4HTFA 3SLGA 2WUDA 2VSXA 3GFBA 3TUIC 5BW4A 1DDIA 1KK1A 3QY9A 4G25A 4RFLA 1RAFA 5A5GA 1OBFO 4KC0A 3VDXA 3DPIA 3NHPA 2PH5A 1EHYA 2ZE8A 2V0GA 1NDQA 1P0FA 4QATA 4AS2A 2C92A 2NADA 4ALNA 3FOZA 2QN7A 1AV6A 1SKYE 1U8FO 2W6IA 3LCMA 2INGX 1OH6A 1GV1A 4WXRA 5LLSA 4J9UE 1XB2A 4DUZB 3SZLA 4PAWA 2CV1A 4IIUA 3FF4A 1GL7A 1MQ8B 2FWJA 4NFYA 2DFPA 3FVQA 3TPFA 1EA5A 1OAOC 2PVSA 2JA1A 5K0TA 4B3IA 4GD3Q 2YHBA 3LBYA 4EI9A 3AOGA 4XQCA 1PD0A 3IMGA 3IQFA 3KSUA 1QU2A 1E3QA 1W2GA 3I9MA 6AT1A 1RYNA 3V7YA 4ZTUB 1L4EA 3R5XA 3VHLB 4LVNA 4EJSC 5FUWA 4RZ2A 1O6FA 1VJCA 4Q3AA 5DK6A 4BAUA 1FK8A 5EA2A 2XADA 3KSDO 3PIDA 4GP9A 1JECA 1WXDA 4ZVOA 5BR8B 4L6IA 3RQIA 4DJFC 1E6UA 2Z8YM 1NKSA 2XWBF 3I6QA 3IBTA 3O9ZA 3FZNA 4GFDA 4WJLA 5AIAA 3TEFA 1ZAYA 3LSYA 2AN9A 3PE4A 1A9ZA 1T8UA 5FOVA 3Q12A 3HYLA 1BA2A 3F8WA 3ZGZA 1YKFA 3QF4A 1JKMA 5DSXA 4DNOA 2JFZA 1S1CA 1NW4A 1GCGA 4ENUA 2RB4A 4JJKA 1NATA 3I1JA 4P5PA 4RE6A 5AJUA 4GXQA 4X20B 4LS3A 5FA8A 1CQIA 4EQ6B 4FI3C 2ZI9A 1SBYA 1YDWA 3OTWA 1N9GA 2YUIA 2M6SA 1QK4A 5EWMA 1QH8B 2YWFA 3F4KA 4LF7B 3EIUA 3A2KA 1CEEA 4JP5A 1I2BA 4ZQIA 4KN9S 1O95C 2C9DA 4MQ4A 5DN6D 3K94A 3OHPA 3DAOA 4A2PA 5I3ZA 3DDCA 1E6KA 2XB9A 5FF9A 1LX6A 3I2YX 4OV6B 3NHZA 1FLNA 3WDKA 2IV2X 3P20A 3QQ5A 1VI5A 2NXCA 4R2WA 3JRXA 3ZU5A 2EW2A 3OJ0A 1RU3A 2V74B 2XGSA 4CL0A 2QNBA 2X22A 3NUQA 3OCCA 4HY3A 1ZIPA 2JAPA 5JDCC 4H7HA 1VDZA 3NDPA 1KDRA 4IRUB 4JUBA 2QRVB 4RULA 3THYB 1K6MA 2WSBA 4DGSA 3BILA 3DL7A 4DWWA 3OEWA 3RAGA 3QPDA 3WV5A 1RKVA 4XJTA 1P91A 1W4CA 1T9KA 3AVTA 4BO4A 3OM0A 1P5JA 2FZ5A 3U16A 4ZCSA 3E7DA 2E87A 2O2JA 1XGKA 5DGTA 4F86A 3EEOA 2PQ6A 3KUKA 4QLAA 2VDJA 4JKOA 1GUFA 4DR6B 1G5PA 3AR6A 1KVRA 3NC1C 4M55A 5C0OE 3SZRA 9LDBA 2Q5JA 2QVGA 2IOYA 4U9HS 2X7XA 3T5GA 4C3UA 5B3AA 3UANA 2UKDA 3V34A 3R7LA 4IGIA 4F9TA 1I2CA 1XD8A 3LYAA 3FAZA 3ZLTA 4GKBA 3CA8A 4D4IA 1Y34E 2H1SA 2RH4A 2ENWA 3BMOB 1E2IA 3SX2A 3ZVNA 4D0NA 5M04A 4P3NA 4PCVA 2HQBA 1ELOA 1MDFA 2FQYA 5DRTA 3FMGA 1LV8A 4ZDWA 2H00A 3CEPB 3O0DA 4U8GA 3HA7A 2KQUA 3EVCA 1XNHA 4KXYA 3TM4A 2QW1A 5B7NA 5KI6A 3TQTA 4AI6A 1GADO 4UNRA 1BN7A 5AI4A 3B13B 3GGJA 1JALA 2CMDA 1EQUA 3EN0A 3T6KA 3R3YA 2VIIA 1B43A 2M1XA 5BYBA 1IN6A 2RSLA 5LZ9A 3W3ZB 1JAIA 4BNZA 3A2LA 1KAHA 2G1AA 2PH7A 4N65A 4X6LA 5ALEA 1KSGA 4KNWA 4Y2JA 3U7QB 5BSWA 2G1KA 1N5LA 3L43A 4Y1RA 2AXNA 4WBNA 1VXOA 5ICMA 1VG8A 2PSSA 2G6TA 3HYSA 3M5WA 1TUIA 4B17A 4MR7B 1OLOA 3AJDA 2OZVA 5IH3A 3ZCUA 5C81A 1A5ZA 2I2DA 5AXDA 3QU2A 5TSDA 3K2QA 4ZEWA 1P3DA 2FMXA 4MW2A 3EXEA 2W48A 1GLNA 3D6MA 2I54A 3AUXA 4W82A 5EEHA 4YQEA 2ON6A 4MGEA 5KWVA 3PLAE 4GKJB 2GJKA 4MR9B 3WZLA 3MTAA 2W43A 1LW7A 3RWMB 4Q03A 1U2QA 3TOZA 3U6KA 4C4ZA 1Z5VA 3OTIA 1FP2A 3FBTA 1Y81A 5JCJA 3QA9A 1YJXA 1KEKA 6NULA 3K0CC 1AZLA 4HAXA 1I3NA 3NAZA 3FSEA 1ZN9A 1B6RA 3CMCO 3E48A 2OY0A 3V2HA 1AMUA 3QWHA 1E7WA 1F3OA 1B0UA 4UJ3A 1QHSA 5EIBD 1T36A 3K2BA 3VOBA 4YRGA 1JH8A 1WSDA 1Y8AA 2P9ZA 4ZC8A 1FFGA 5AJVB 5K8TA 1Z34A 2I6SA 1CTQA 3AZOA 3RDPA 5T5QA 3CZPA 3O91A 1RFLA 3S2EA 3EDCA 3GPLA 2EATA 1WMAA 1GN8A 3OJWA 5EE5B 3TZQA 4YMGA 1ABEA 3ED5A 2DWCA 2WLSA 4XWKA 1KAEA 3MJEA 1ONPA 3IBSA 2HF7A 5BN1A 4FWTA 2VBIA 2YL2A 3HSKA 2XYGA 4DCCA 4PQYA 5E6RB 2IYNA 2P27A 3U3KA 4Z9BA 2WJYA 4AY6A 2W98A 3DTVD 1XZFA 3G0IA 1JNYA 2GEDA 2Z2IA 2A5DA 1FFDA 3GT0A 2HIGA 4OLFA 4BFUA 1SXPA 3QVSA 4DF3A 3PKJA 1G3IA 5A02A 2EHDA 4PEVA 1XTUA 4GSYA 2YXNA 2JFPA 1KI1A 1U7ZA 5JADA 1KTVA 2XMBA 1G8HA 3OZUA 4Y6PA 1PI3A 1T0JB 3CMMA 5U4QA 2R7LA 1PUXA 2W22A 3HUUA 3TTYA 3ELDA 4Q12A 4F7DA 2XY4A 5DHSA 1CEXA 1OT3A 1Q1ZA 2CLFB 1L5QA 5F23A 2QTTA 2D1YA 1TA0A 1YR6A 4NJEB 3RSLA 3O93A 1R0WA 4HSGA 5D5PA 1ZK2A 4DWOA 3SSNA 2HLPA 4ZJPA 5JSYA 5HS4A 2AD5A 1NAIA 1H4QA 4KKXB 4RHTA 3KOUA 1F14A 1M6YA 4QXMA 2WNIA 1QNFA 1S3GA 3SM3A 4EK9A 1PBNA 5KSYA 4GKAA 1TM1E 1AS2A 2R8ZA 2UDPA 1GWNA 2YV5A 3VOTA 3ZK9A 5I7OA 2PA0A 1NE7A 3KQVA 4GOKA 4JUFA 4F4FA 3HKEB 3M5PA 1BEEA 1QF9A 4REQA 3LCRA 4D9GA 4RIEA 3WNBA 1TJNA 4RQBA 5KIAA 1ZQ9A 2AKEA 4IIFA 2G9VA 4C7KA 4EHLA 2QTMA 2EWWA 2JGDA 4W99A 1FRQA 1P1RA 4Y9TA 4PY2A 4ZRMA 5AI5A 3AIIA 1QE3A 2X6RA 4XCXA 4DRYA 4EYOA 4RTLA 5CITA 2J3QA 1GT91 3B53X 1W73A 3UT5A 1UFOA 3TX6A 3WSVA 3RYFB 4CUKA 1CJUC 1JSCA 5A71A 1E6CA 3I2IA 1DKOA 4RXTA 4JR0A 5LD2C 1X70A 3CJRA 1VE7A 1LDMA 3LW8A 1JJVA 3NM5A 3QEMA 4LMAA 4M7RA 4PO9A 3F6CA 4UAJA 4YREA 1AD2A 5M3BA 3M6UA 5LQCA 3P2JA 3K9CA 1KI7A 3K9NA 1UADA 4O2AA 3HZRA 3KZKA 4KE6A 2QTRA 4ER6A 2JFNA 1ENYA 2MWMA 5E2BA 4AKEA 3RJTA 4KQ6A 1GTJ1 3SEQA 5A03A 1CJSA 3ISJA 2OV4A 3L7MA 4ZAYA 5A7HA 3LUPA 2XZLA 4GDFA 1T2NA 2ZRMA 1KI6B 4ATNA 5E9JA 4R81A 4IS2A 3P26A 2GZ1A 2AS0A 2MSKA 3GFPA 1BMFA 4YRAA 3K6SA 2PL3A 1DRJA 4GICA 4HQFA 5AI9A 1KQFA 4BDTA 5HK8A 2WHYA 3O3CA 2WJZB 1G6KA 3EXIB 2ZRFA 4NSNA 4TXNA 4RVSA 4AMVA 1H1LB 4JL5A 1VE9A 1ZIYA 4QIHA 5AHXA 3SZMA 4G89A 3A37A 2Y2VA 4WJZA 3UB2A 4DT1B 1I6LA 3LY9A 4W9MC 3IVMA 1UJ4A 4Z49A 4UTRA 1B1AA 2R47A 4RD1A 1ZYUA 3B78A 4MDEA 3SR4A 5I48A 1EINA 5LL6P 4ZU1X 1IPHA 1D2HA 1CZOA 2W42A 2A58A 5E1DA 3JQ8B 3RVRA 1KK3A 4X95A 3L5OA 2A1UA 5FH9A 5BOSB 4A1FA 3NC4A 1VMDA 2ZVJA 1A27A 3AP1A 4QU5A 1UWLA 5B1IA 1KOFA 1T5IA 3LBHA 3NZEA 4R84A 1PR2A 3R3WA 2OFOA 4FINA 3UK2A 1DRKA 3D5EA 3EDMA 4RF2A 1Q21A 4RZSA 4TT8A 2E48A 2HMSA 4LXIA 4YRNA 3DCNA 4QNNA 2QAJA 1WCV1 2W2OA 3A4LA 2ZI3A 1AKNA 5JS7A 1P4AA 3OJCA 4YFYA 5ERYA 3OD5A 2F55A 4QL3A 2AYXA 1HOTA 1YCDA 1N36B 3BB3A 3GOQA 3I1YA 4UVEA 2IYFA 3S81A 3KFLA 1NXTA 2HY7A 3WJ1A 4JLUA 2QYHA 3LUCA 3DQQA 4UM7A 7REQB 4P2BA 3I4CA 3SX0A 3ZYCA 3W6NA 4W9NA 3LVFO 1Y5MA 5F77A 4TKUB 3L6BA 5FLYA 3W04A 5BUSA 3T1YB 1QHXA 4C6SA 4DLBA 3BULA 3IBGA 5ANRB 2CHGA 1A5SB 2A7XA 1FFHA 1GOTA 2A9RA 4H4DA 4NYJQ 4U7JA 3FCOA 2CKMA 2ODEA 2VHUA 4JC5A 3D2BA 3H9CA 3OBIA 2IW3A 1DC4A 4I3GA 1ZHOA 3V7FA 3LYHA 2Q1XA 3JARB 2JIZA 2AV6A 3KLNA 5EIOA 5EQJB 1NKVA 1T4MA 1TT5B 1Y4DE 1OZ0A 2CNLA 5LKRA 3RYIB 3FMOB 4TLCA 3I3OA 1VM6A 1NZDA 1OXUA 3IUQA 4N7BA 1IOWA 5TRTA 1UFQA 1DKLA 1ZWKA 2Y9MB 1MG0A 3H2HA 3PGKA 4KIFA 1GYRA 4ENRA 3FZYA 4XGQA 1B74A 5DHFA 2HF2A 4HNAA 4Q3KA 5IULC 4Q15A 1U0BB 3QEOA 1NJSA 4IIYA 1JR3D 1G8PA 1D2NA 2GTPA 3PQ8A 4MV4A 1FRFS 1QFJA 2JANA 1DOAA 4IWNA 1CWUA 2VPWA 5EOVA 3VYVA 1HRDA 1VLJA 1R5JA 2AEFA 5HRCA 2DR2A 3QFSA 3PFGA 4GM0A 5FQNA 1LI5A 3HU5A 3NNNA 1Y42X 2IK8A 3O4VA 5ULLA 3T9AA 3VR4A 3OTQA 1RZRD 2D2XA 1XRSB 3AP3A 4NU8X 4YT8A 1UEJA 1TU4A 1YQWA 1GXSB 1RBZA 5EP3A 2NO5A 4UASA 4KFRA 4PYLA 1U0TA 4J0QA 3S2GA 5AYVA 4D0GA 2UYHA 4XGIA 5AVQA 1F0PA 3G0OA 1WOYA 3K96A 3KWMA 1XTRA 2LPMA 1CIJA 2AK3A 1GGNA 4EBFA 2HK8A 3Q7RA 5IZCC 4AO6A 4D8VA 5BUQA 4QODA 4E5YA 3SYTA 2HU5A 3BRWA 4C6TB 2NLOA 4DDUA 1NV9A 4O1HA 1YIAA 2PU7A 4JR1A 2VAPA 4HRYA 2NO6A 5GVRA 1JL3A 4MCHA 3N1UA 1CYEA 3TEMA 4O4LB 2FXVA 4J91A 1UXGA 3KYCA 4LXTA 3LX8A 4K0KB 4QFMA 4QYSA 2IHKA 2WZCA 2ZB4A 3PSHA 4BZXA 4QFDA 1WZIA 1X1RA 3MZ0A 4QREA 3RVBA 4J0JA 2XPCA 2GBCA 2VBFA 4Q4DA 5FFFA 2NT4A 1VL5A 1R3UA 4E15A 3V4PB 1FFXA 3M1IA 5C18A 4TTIA 3ZWBA 2ODQA 3EC2A 1VJ1A 1IBRA 5G1PA 3CM0A 1C7IA 4FDVA 4MUJA 4F4HA 2WSMA 3PHIA 2R65A 4Q4HA 2BCEA 3VXKA 4ZZ3A 4A0FA 2EJBA 3LC0A 2BY4A 3B20A 1LC0A 2J3IA 1Q0UA 4FLFA 1Q22A 3HBAA 4LOKA 3HB5X 5IFLA 3T1NA 1K5HA 1I6MA 3U7EB 2FF5A 3AEKB 1Z4PX 1ZQ1A 1LBHA 1P4SA 1SXIA 2NTVA 4IZOA 4MJ3A 3FDXA 4RGQA 4NFSA 4HZGA 4DJ5X 4CQJA 2PHZA 4CKCA 3VJRA 3PQ7A 4CCYB 1CULC 5JYDA 4EUHA 1GUZA 3AK4A 3LF1A 3MSCA 2GTIA 3KL2A 1G5HA 4XFDA 5LZ8A 5CVEA 4KPEC 3ISTA 1LRJA 3FA2A 3LX4A 3VSDA 1NN0A 2AXPA 4Q1DA 1PEAA 5TC4A 1CDZA 1BDBA 4MUBA 1PJ8A 1GKIA 5AR1A 1O4VA 4LRSB 1YZNA 4AJOA 3BCUA 3QNWA 2RHTA 3JALB 3EGVA 1T26A 4G1VA 4BJ1A 4AMYA 3P0IA 5BW8A 3B1WA 4QAQA 4TX1A 3SFZA 1PQUA 1GGJA 3PC8A 4KXLA 3PQDA 5TDHA 1GZ3A 1DEHA 1U9IA 2GKGA 4H1VA 4LW8A 3AQ4A 4K6HA 2OCPA 2BFEB 1GAWA 1XAJA 3N8HA 4D92A 4M8IA 4CN8A 4HAUA 5AVRA 4MLDA 3A7DA 1EWQA 1KZ6A 1QV9A 5DYIA 4UOZA 3RAEC 4YJ2F 2PCLA 3NEYA 5G40A 4A16A 4MCJA 5IN4A 2J5RA 2R79A 5H80A 1RBMA 2XMCA 4GRAA 1NYRA 4C78A 4Z54A 3O94A 4GC5A 4MA0A 1IQ0A 4DSUA 1NW7A 3EH1A 3G79A 1I10A 1JSLA 3LI2A 2ZRJA 4OHBA 2QIOA 2VSQA 4EG0A 2VO1A 4AW9A 5F35A 1I9GA 1SC4A 2PZJA 2O8DA 4YRIA 2AC7A 4BZZA 3AERA 3D5TA 1U65A 3EF0A 1W5EA 4HTFB 1FP1D 1JKJA 3GNQA 2GHTA 4GVLA 4X64B 3WADA 2YWXA 1R5NA 1IB6A 5JDIA 1PLKA 2VSOA 3R1IA 1XJCA 4UMDA 5ECDA 3KQKA 1E0JA 2GNOA 4GBJA 1H8ED 3OE7D 4HRVA 1U0SY 2AK2A 2HI0A 2NZ8A 2VP4A 3L8EA 4RLQA 4U5QA 1X8KA 5E7MA 1TKRA 1CNFA 4E1AA 3RWOA 5TS2A 4CIYA 1P0IA 3WOVA 4MVJA 5L3ZA 5KYTA 3KKEA 1I1HA 3PT5A 3GT7A 1R74A 4I9GA 4D7AA 3DFIA 1SEVA 5AVJA 3EX7C 2COUA 2ID9A 3P7MA 2LWIA 1W48A 5JAMA 2F8SA 2G4CA 1U81A 1AGRA 1CBUA 2D1QA 1VL1A 4A2CA 5J2TA 2NAPA 1DHTA 2MSDB 2FFBA 1UP4A 3H3FA 1L8QA 5HS6A 5HF6A 4QTXA 1FRVA 1MV8A 1IOZA 5KC9A 1HLDA 4RPIA 4M9SA 5IABA 1AG9A 1E7MA 2EX0A 2WAXA 3MT9A 2C54A 2R6JA 2VRCD 3AHEA 1JIJA 4WFKA 1P3JA 1AQ6A 3L1UA 1B15A 4X54A 3L4SO 1EGMB 3A9UA 5DYTA 4HLCA 4AUNA 3ZCPA 2W0SA 2ZVPX 4G8CA 3BIFA 3BWVA 3R3HA 4Q3BA 3ZDZB 4IYRA 2B69A 5DEIA 4IILA 3AQIA 4EDFA 2V6IA 3ZHRA 1FYWA 1RBYA 3FZEA 3L2OB 4XDZA 3UXEA 3OX1A 4F11A 1QH0A 3UAOA 2BELA 3D3NA 2RHWA 3OD1A 3SE7A 3TQCA 5KYUB 1XWFA 2JIZD 2YXEA 1WB6A 3F96A 1AURA 2W6PA 2YJ5A 1Y4SA 3VYSB 3EGDA 3ECAA 1U3CA 5SYAA 4UU1A 4C4XA 5DWQA 2YVQA 3C5WP 2AB0A 5I7VA 2WJAA 2Q0SA 1T6XA 1MFPA 5EI5A 3RFUA 1J5PA 2I33A 4RZUA 4EUKA 9MHTA 5B3KA 2YRWA 3F74A 1Y3HA 2HMYB 3MCVA 3NG1A 3QY0A 3NBUA 1OIWA 2GCOB 4KBYA 4I6JA 5IJXA 4LF9B 3KVVA 1ZNQO 3SD7A 1H5QA 1V26A 3G8AA 2H2HA 2H8GA 2GB4A 1JMYA 1JEQB 1EZZA 5JO9A 3FB4A 1UK8A 3X1WA 3ZNQA 2OORC 3OEHD 2X86A 5AOVA 1PV4A 2N46A 2D74A 2Q0QA 4ZARA 4C4RA 3NGXA 3RVLA 2B25A 2BDEA 1ZLXA 3A9WA 1LLQA 3TB4A 3IKJA 4XVQA 3ZCRA 2BJHA 5DI9A 3DMNA 1QPBA 1K98A 1MIHA 3ORSA 2EKLA 4K03A 4G26A 1R6XA 5G0WA 2QLJA 4I4LA 2HJHA 2ONCA 1IEQA 3F71A 1YJ5A 2B4RO 4YBZA 4FXPA 4EA9A 1ENOA 3GARA 4A0QA 3GEGA 2C20A 1BS9A 2YWCA 4YP9A 1E6WA 1R64A 3FWKA 2IEAA 2F59A 4E3ZA 5JMWA 3TB6A 2A5FA 3HLYA 3VU0A 3O7WA 4OJQA 4PPYA 1L7OA 5HEKA 4P4NA 2EZTA 1ULSA 5C53B 3LUDA 4X71A 3SR0A 4CCSA 3V2UA 1NAHA 2ORIA 2LXNA 3TNFA 4QEZA 2FFRA 1ZDMA 5IBCA 2OGSA 3C6QA 2LDBA 1V39A 1VG0B 1XF9A 1YNOA 1OY1A 2DLDA 4I0WB 4MVJG 4PM4A 4LE2A 4E11A 4Y9SA 2ID7A 2VUSA 4KFUA 4KQ2A 4O4JA 4BUCA 2O8CB 1CS0B 3MJDA 3ZUPA 2H7YA 3HN6A 4JCOA 1OROA 4OBBA 1NW6A 2FSVC 2MINB 3VU8A 2BD0A 3THWB 2Y76A 2WWGA 2NSLA 4IW3B 3RADC 4L2IB 1R2QA 3Q1LA 3C4VA 5J9FA 2YN0A 1V8ZA 3A2MA 5AKXA 5IH7A 5KOYA 1QG6A 4IBOA 2X76A 3DB2A 1VZ3A 4UKDA 4ZK6A 4XI9A 4TT3D 3OT5A 3TOSA 1U9CA 3SYMA 1QIJA 4F4DA 3R3ZA 3OKCA 1C80A 3ETJA 1I3KA 5D7BA 5ALHA 1I4TD 3PD7A 4KW7A 1BS1A 4HGNA 3K9FC 1FPMA 3DAHA 5IDVA 1QGOA 1GDHA 3UJCA 3L40A 2JAQA 4S04A 1RXWA 3WRYA 4Q9IA 2RI0A 4G8BA 2IDMA 1PN3A 4MV3A 4RIGA 2LCQA 5EGNA 2NU7B 2V9PA 5LXTB 2OWEA 4U7HA 1O96B 2OT3B 1AUXA 2IYXA 2Q5OA 2QTGA 3C3PA 1MGPA 4JLWA 1G8FA 4MGIR 3BWEA 3R6LA 3AL3A 4NBWA 3PUIA 1I4LD 3KPWA 1U2EA 1FL9A 3EBLA 1NA5A 3FPHA 3VZPA 4DQXA 4DQLA 5JASA 2V45A 2J5QA 2HQRA 5KOJA 1Y89A 3PEVA 1NBOA 1MC5A 3IE1A 1QIKA 1GAEO 1PLJA 4DLNA 1WBDA 5AJTA 3TCKA 2B5WA 4DJEC 4MW6A 2DUWA 4L76A 2FR0A 3EQ2A 5HP4A 1HYBA 1YIOA 1QHHA 4HAOA 4P4TA 2Y4OA 1S4QA 2X5JO 3E0XA 1XNJA 4QGHA 5KKCA 2AYYA 4RH0A 4Q6WA 5G0UA 3BQ9A 2WI8A 3KQWA 3AJ8A 3NXKA 2QR3A 4O5OA 4EFKA 4CLRA 4C2BA 2I91A 2BZ1A 2Z3ZA 3AJEA 4UU7A 2I65A 3UYKA 5TMPA 2XCTB 4GLOA 1M1NA 4JVNA 5DBFA 4D56A 1B73A 1IULA 1K5GA 3IVAA 2ABWA 1EVQA 1BDJA 1V5IA 5CHEA 5KCMA 4CTNA 1DAHA 1C4OA 2R7MA 4I46A 4UAGA 4UQOA 3BE5A 4A4DA 2HSZA 2ZYAA 1SOVA 4Y0AA 1BJTA 3UPDA 3LXRA 3SFVA 3EY9A 5IAKA 3L7OA 4LE0A 4ARZB 3ZJ4A 1XDDA 4FQ8A 2OXIA 2C0PA 3C87A 1L5MA 4MWCA 1I0IA 1K75A 3U0VA 4FIDA 3G8BA 3JQDA 1OHHD 1H65A 4M0FA 2VNHA 1XZNA 5BR4A 5TMBA 3FAKA 2QOEA 2UZ1A 3LUKA 3HB1A 4Y2UA 4HYQA 4ME6A 4HFNA 4W1QA 4YCBA 3DPUA 4W9NC 1GTMA 4RANA 3IMFA 2ZJ4A 3MK31 4JQZA 3BDAA 4TKLA 1U7TA 1XZIA 2GRAA 1R8QA 3RCBA 5ARBA 1Z29A 2GVZC 4MPRA 5LC1A 4LF6B 2IUTA 2DE0X 1JYFA 4NG5A 2ZSUA 3LLMA 1FJ2A 1T5LA 3ELWA 2DJ5A 3W9YA 1P74A 3IJRA 2JLSA 1DJLA 1ZW1A 1XP8A 3O8DA 3LC2O 4JENA 4O25A 4G4SO 4AQYB 1I4DD 4M21A 4X61A 4GIBA 1ENZA 2QZZA 3V4OA 4EBBA 1CUBA 2ZVDA 5ESDA 3BZWA 5JPIA 1ORHA 1SIUA 2NTEA 2SNIE 1N7JA 3BS4A 4D79A 4UE2A 3CUSA 3EFOB 3QVXA 4MW9A 5H59A 4ZJUA 4KJZA 3RYCB 4F5DA 5FI0B 4JBIA 3Q3CA 3FOAA 1Y6ZA 3TLMA 3JV7A 1D4FA 1P6UA 3ND8A 4B44A 1R37A 3Q3IA 3T5TA 2IXDA 5KYYA 3W2EA 1DTWB 3C8HA 3HUEA 2KLHA 4RF5A 4B76A 3U4GA 4EOGA 1FJGB 1MHTA 4TRMA 1QUEA 1TLFA 5L40A 3UFXA 1HUQA 2Z30A 5EE1A 1M6VA 4YI5A 3OICA 3VR2D 1W76A 4LOIA 2VRBA 1XP5A 2CY0A 2Q9BA 2VYQA 2QAGA 1T9DA 4M6WB 5CXUA 1SCAA 3A4MA 1MOPA 1IM2A 1X0VA 1PT6A 1GQYA 1J2RA 1PGNA 1MOZA 3JARA 1YRBA 4FHGA 3RS7A 4N0PA 1JHAA 3KKZA 3WG9A 1EUQA 1DKQA 3FYSA 4M3NA 2Y92A 4TL6A 1E20A 1G2IA 1KYTA 1XLUA 2QU8A 4GWKA 4JUDX 4YRMA 5IJ0B 1B4DA 2JI7A 2PZEA 3B1KA 1JG2A 5FAXA 5T8KC 3A70A 4Y0NA 1UWKA 1Y9DA 5K4GA 4GLFA 3R3XA 1YRLA 4MWEA 5LQSA 4EJ6A 5DM70 1NDHA 3HTXA 1RI4A 1MP0A 4JBYA 2WHPA 1EB8A 2Q28A 4Z8YA 2Z2ZA 1XVLA 5AH0A 2QRVA 2C9OA 1N8TA 1U0RA 3KJQA 3MT7A 5DGHA 4F9EA 1PU2A 1D03A 5EMMA 1NQUA 2BEKA 4OQLA 5EWJA 4DM4A 2E85A 3LDUA 5LJIA 5HCUA 1A7JA 1OLXB 4RJJA 1U2SA 3QI7A 3E5HA 3O0TA 2RGNA 1W19A 3PPYA 4ZO7A 1BSVA 5ALDA 4BLWA 4KV9A 3GAAA 1AKYA 1T36B 3DYBA 3MMNA 2NPFA 3ZK8A 1SXJC 1WA5A 3GJ3A 3V8VA 3JQBA 3RKUA 2QL7A 4TMFA 4N4AA 5I45A 2P9YA 4WESA 4N47A 2YMQA 1I0ZA 1V45E 2V4MA 2W2NA 3CUVA 4Y2YA 5L3QA 5EQDA 4UAVA 4WNAB 4LIPD 4BP1A 1WUHS 1YUBA 1FQOA 2XMPA 4A8JB 2OMEA 3EYAA 1G3MA 2B9VA 3H1GA 3O75A 2HFKA 3KKPA 2A9PA 2FPPA 1HMPA 2GRJA 5CFRA 1JMKC 4L0CA 1PWXA 2V8BA 3BXEA 3OEHA 1CZRA 1NPTO 4GPD1 4O4LA 4AT1A 7REQA 3QE2A 3LMKA 4YRJA 4YS6A 4J8PA 2ZRHA 1P5FA 4DCPA 2O8BB 2ZS8A 5IT4A 1W5AA 2RKBA 4PR0A 3ZWXA 1OGYA 2YHIA 1DQSA 5E0KB 2WP0A 4GU5A 4J7CA 1A9XB 4HR7A 2GEJA 3OECA 4K9PA 2WK1A 1ZY2A 4LOAA 2PS1A 3TMYA 1XPRA 6ABPA 1ZNYA 2FSVA 4I1SA 2BGMA 5CGQB 2C4WA 4Z3KA 4FUTA 3MM4A 1HE2A 5KYXA 4V1CI 3KWLA 4DIEA 3A04A 1C0PA 3RTCA 1VKHA 2BYTA 1O8CA 2OGUA 4XPZA 4YCAA 3S2YA 3X1XA 2B83A 1WKVA 1DKRA 2AZ4A 5TQJA 5F76A 3VH1A 3RRMA 1T8RA 1FMFA 4R6WA 3FPEA 4WEQA 3QG1A 4Z9YA 3W5AA 4F92B 1DWUA 2VK4A 3I4LA 2Q5LA 4Q9HA 5FWYB 3RFVA 2PM8A 5JBQA 2XXJA 1RXYA 2V7BA 3CVJA 2ODAA 1AY0A 1GVHA 3VKHA 1ZNXA 4BFLA 3ENKA 5BOVA 1USWA 2I29A 3BGVA 4C0XA 3CVVA 3ZV4A 1QMPA 4HUQA 3JD0A 4EB0A 3QVVA 1ZL2A 2GZDA 5A2QA 1ZCAA 4KITB 3E3OA 3HM9A 2G1JA 4MUKA 5FB3A 2O2EA 5DTEA 3IULA 5GWXA 3DOEA 1XRMA 4YRCA 5EPUA 4RK7A 4C1NA 4O4HB 3WXMA 4J75A 1OBOA 1SQ0A 5GP1A 3BXXA 1H8EA 3OE7A 5TJHA 4ZDKA 2YH2A 4TTTS 1HEYA 1XZMA 2O4UX 3DGFC 4YT5A 2QRJA 4FE4A 1JQDA 4PGHA 4RHUA 1RPZA 1PFKA 1XWIA 4IJVA 3QEMB 4RESA 2FE1A 1SBIA 5CA0B 4L1KA 2VRCA 3ZY4A 3I30X 3O21A 3FGPA 4V0MA 3ZYZA 5BV0A 5IF9A 3C3CA 3E4DA 4ZK2A 1YZUA 4XIGS 3GZNA 1JWBB 1SRRA 3LDFA 1CVLA 1YI8A 2KPOA 4DIFA 2FPSA 4CG1A 3CTMA 1RWWA 5K2MA 5KAMA 1NQVA 4ARUA 1TO1E 2ZU0C 4LCBA 1OLUB 2O3RA 5ICGA 4O1IA 4QWWA 1U8CB 1RRMA 3KSMA 2D2EA 3D64A 2JIMA 4LWZA 4OGKA 4R8MA 2R00A 1B76A 5ALMA 4WDRA 4EENA 3EFHA 2V6GA 1VPLA 5TPWB 2FFAA 3LT1A 3RVMA 5DIFA 5H82A 3UWPA 1IZ8A 4X1KA 4C21A 4INAA 2XOXA 3BZBA 4EKGA 4V1CB 1XNQB 4PZYA 3ENNA 2B8JA 2I34A 1E2QA 1E0DA 2EFDB 4HDAA 1OYOA 2JCBA 4LNUA 4RL6A 1NF8A 5B2FA 2BFAA 3CIOA 1UPFA 2JAXA 2ECQA 1QR6A 1T2AA 2QTHA 3IP8A 3L7NA 4HDNA 3EXFB 5CMLA 4G3XA 1YFKA 1RVDA 2VSNA 3IEPA 4DT1A 3U5TA 4HNHA 2XD4A 4NFLA 2OXTA 4QDXA 5BWOA 4HDOB 3CLUD 3DMTA 3K0HA 3OOSA 3IT3A 6Q21A 2CK3A 2FK8A 5LNK1 3DOHA 4TYPA 2BUCA 5C5DA 1KFBB 1ZGHA 1FUKA 3TX2A 3WAJA 5LMCA 1YDMA 4ZO4A 5FR1A 5I9MA 5AVYA 1GRVA 2QTVB 1VSVA 3C6YA 4LV8B 2D0DA 4HEJA 5CJPA 5I7HA 2QTNA 5K0SA 1FTYA 1ZJWA 4RHYA 3EGXB 4C4SA 2IYVA 3VKUA 2ACEA 1FXWF 4CT5A 5BVGA 3ZJTA 2QF7A 2RGCA 2GEFA 3GUZA 1AQYA 3JQ9C 1XYGA 4V0SA 2M6KA 4XEHA 4JIMA 4AKGA 3DFUA 2IY7A 3SS8A 3BWDD 5BUCA 1QJCA 2YWGA 1C0IA 3CW8X 3KVYA 1A98A 4BTVA 5BVHA 2Z8ZA 4BX3A 5KTRA 5ISMA 5TS3A 2PH1A 4J0EA 1V3UA 1NQXA 2NOAA 3SJZA 2BCJQ 1J2YA 4FW9A 4D41A 4W7IA 3L8YA 2CFRA 3WGZA 4RFSA 4P9NA 2DCUA 3DXFA 4P5DA 5EMJA 5JCPA 3RAJA 2P0EA 3KQSA 1TF5A 3MJTA 5AQ1A 4ZYLA 4YNBA 3EZ7A 4MV6A 3WLMA 1YS7A 2C00A 3GGCA 4BB0A 4BNUA 1E3MA 4OLHA 2BM9A 3WA7A 1ZOIA 1U7XA 2JFVA 4LOHA 3K0FA 3SS7X 3EJWA 3ZX4A 1BW9A 1SQFA 2CVQA 1N5IA 2IA5A 3TOXA 2W9XA 5DTIA 1IXSB 4FONA 4DMCA 2CBZA 1NNLA 1WXGA 4ZZ1A 2XCSB 4MR8A 2H0RA 1GSHA 5GQSA 2J59A 1IN4A 1YQQA 2QRKA 2UZAA 1IDOA 2O5CA 2J31A 1VE6A 3WMXA 2FW7A 4P4LA 1WY5A 3R6WA 1NY5A 4QHYA 1E9FA 4KR9A 4EMTA 3MRSA 4ILEA 4NK4A 2W83A 4QFBA 4TWZA 1IWPB 1DAIA 3J7AC 2H07A 1ZMBA 3RWBA 2GX6A 1A5AB 4GR4A 3H7AA 4HTAA 2OZEA 3SNHA 3B85A 4JA2A 3FHLA 1WABA 3CEMA 1JLLB 1VG9B 2PU5A 2OCDA 3NHWA 4YJ3F 5ALLA 1NVFA 4LXHA 7MHTA 2FSFA 1PUJA 2Q2WA 1L4NA 1X8LA 3BBLA 4HH0A 1DIHA 3FCEA 1B2LA 4R8LA 5DM0A 2VTBB 2JD1A 2OG1A 3S27A 3TQSA 3JASA 2QKYA 5EMHA 2B1QA 1SNYA 3QU9A 2ZTMA 6REQA 2YWHA 2JGJA 1ECCA 2X4DA 3D4OA 1K6XA 4KDRA 3AF5A 4PPNA 2OM2A 4W4TA 2JCXA 2JBWA 4HWRA 1JHZA 4HXYA 5K51A 3KETA 1RFGE 3QOYA 4PIMA 4N3NA 2R7AA 3E1KA 4DA6A 1EXMA 1FFSA 1PZMA 2QSYA 3TFOA 1WDMA 4B0OA 1UPTA 2XX3A 2I67A 3NEAA 1BD4A 1N5KA 4NLLA 4NENB 1NW3A 3VYRB 4C3VA 4LSWA 3UAXA 3VU9B 2FEKA 3RNLA 1TK9A 9GPBA 3HVRA 1JU9A 2E4UA 2GZHA 1EEHA 1Z18A 2DG2A 2V6MA 4N3AA 2ZJAA 3O9MA 3GLSA 2HX1A 4GECA 4WLEA 5B37A 4YUXA 5LP6B 2QP9X 4WXEA 1DCFA 2ORED 3KB8A 3MJCA 1FVFA 2Y27A 4GH5A 4GGOA 2HADA 3THWA 3GPDG 1NG1A 3TL2A 5DGCA