1T3ZA

Formyl-coa tranferase mutant asp169 to ser
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGSSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Formyl-coenzyme A transferase
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
total genus 145
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1t3zA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1t3zA01
2VJMA 1Q7EA 1T3ZA 1X74A 2VJLA 2VJKA 2YIMA 1PQYA 1XA3A 1Q6YA 2GD0A 1XA4A 2VJQA 1XVVA 1XVUA 2VJOA 1VGQA 4HL6A 1PT5A 1P5HA 1XK6A 2GCEA 1T4CB 2VJNA 2VJPA 4ED9A 1VGRA 3UBMA 2VJMB 2GD2A 1PT8A 2GD6A 2G04A 1P5RA 1XVTA 1XK7A 1PT7A 2GCIA 1T4CA
chains in the Genus database with same CATH superfamily
3AM1A 2DPHA 1DO8A 1NV9A 2KHZA 3DT6A 3GIDA 4GR4A 2WIJA 3SDSA 4C4YA 1KEKA 4PX5A 4EGQA 4WLFA 4LRUA 2O0HA 4KXLA 4GKJB 4CM8A 1OBVA 1XZ8A 2PXCA 2RGAA 1VFNA 4EI9A 5I3CA 1BGVA 5G0VA 4JI8B 1ZL2A 4NECA 1KOJA 2QVXX 2UZ0A 3EGDA 3HHEA 3KEGA 4CM9D 4HX2A 4OH1A 1KVUA 3WI7A 1DXHA 3FYUC 3INYA 1FJHA 4WW0A 3IHTA 3QVKA 1RTKA 1VYVA 5SZHB 2FVXA 3DF7A 3R24A 3ZQ4A 5U9CA 2ZS8A 2AFIB 1DJMA 4DB2A 5FFFA 3A26A 3L7CA 3GZ4A 2C4WA 3TLAA 2WUGA 4ZEXA 1DO0A 2GCPA 3F3KA 4B2PA 3DKRA 5JCJD 1EM8A 1WUHS 3EF0A 4IRMA 4GAEA 5FOXA 3FRHA 1IRXA 4BKOA 1RRKA 4BEWA 3SHWA 4YAKA 4OLAA 1K89A 3TLYA 3Q5DA 4ALMA 5HFAA 3U40A 1SCNE 4MMZB 1KNXA 4DNXA 4MV9A 4OMUA 2AD1A 2PA3A 3BWMA 4IDPA 4OUDA 4XM1A 5CAEA 1JNXX 3I5XA 2JLVA 1R15A 4EVSA 3CE9A 5EMLA 3BJIC 2PUGA 4Y30A 2H3EA 4X6LA 5LOVF 4DCTA 1GZSA 1W0KA 2C1ZA 4BFUA 4PLVA 1VYHA 4JZYA 1ZIYA 4CG1A 4EYKA 4U02A 3JQAB 3TH5A 1FSZA 5HFJA 4X3PA 4BNUA 4W5NA 3TLMA 4YFVA 5DM1A 1N6RA 3WMEA 3SI7A 5M2QA 3NNSA 8LDHA 2JK0A 2B94A 1OWOA 2OQ2A 4OXQA 3TD2A 4UBNA 2JKZA 1XAIA 4PZAA 5J63A 1NWCA 2RHOA 2YDYA 5EP3A 1F12A 2VP6A 2X0JA 1IOZA 3KYBA 1AX9A 3X1KA 3DZCA 4CDGA 1B23P 1DCKA 1ZK0A 3V4LA 1VLJA 2WU3A 2PZFA 4QOSA 1PT5A 4KUHA 4A0RA 3PNPA 2HDOA 2G9RA 5B55A 3GB9A 2Y6UA 2ZSBA 2ZXFA 3VHXB 4C21A 3W5UA 1Y7HA 1B0PA 3GXBA 4PN3A 1Z5ZA 1IHXA 3TX6A 1C8LA 3JVEA 3GFRA 4MKRA 1DAGA 5L3SB 1UJ4A 1ZOOA 1CJTC 3LP5A 2JCXA 3C43A 3K4PA 4UM9B 2POCA 4BLRA 1BOFA 3QG1A 2ZI3A 4IXNA 3T7JA 1WO8A 3N2KA 1IPHA 3GA5A 3W79A 1CUIA 4FIZA 3K30A 1H22A 5AVUA 4OFBA 5BPFA 2I5PO 1C9MA 3AUSA 2D6FA 1HQCA 4N82A 1ORVA 3BERA 2QTWB 4OA8A 2ZI7A 2WUWE 5IX8A 3RNLA 1S9DA 1UF9A 3W5DA 2L2QA 2D0PB 3BTSA 3CLTD 3OZAA 4BC1A 1QS0B 4L22A 3KSAC 4UMVA 5A5EA 4B7AA 1N6KA 2FZWA 4DCVA 3LPMA 1O9BA 2PGOA 3W9SA 5CB8A 5KYYB 4JV5B 2PT5A 1J25A 1XP8A 4RE6A 2Q7DA 2G70A 1TVMA 3H86A 3UYKA 3T7IA 3WK6A 3OHPA 3QUQA 3AKZA 2ZYTX 3F2VA 1GNPA 1U8CB 3CZAA 3FOCA 4KN8A 4QYSA 4RCVA 4MWZA 4Y18A 2UZ4A 3TTSA 1HDOA 4ZODA 4B3BA 1J7JA 2O7QA 4RACA 1LFDB 3A6LA 1MO4A 1DC3A 4JVLA 4LMRA 3ZZTA 1R8SA 1WG8A 3UKDA 2C98A 4WWHA 1HDEA 3EVZA 4OLFA 1DG3A 3M6UA 1JR3E 3NCTA 3NW9A 1T2UA 2NXEA 2WZDA 3PDIA 1N2EA 4YJ2A 4HT3B 3PJRA 1IY0A 3JQ7B 1L1QA 1MH9A 1UMBA 3RASA 3WGLA 3NVKI 1UBEA 3TRIA 4MQUA 4WY8A 2DTEA 3R0ZA 5KJFA 3ZY3A 2BV3A 3N74A 3RCBA 2VHCA 2X19A 3BGIA 3H0CA 3HSYA 3THWA 2IKSA 2VHUA 3DE1X 4TX1A 4WDQA 4D3DA 2JGMA 4MPRA 1GR1A 3PDHA 2WJ6A 4MLDA 5IBPA 3WZ2A 4EFKA 3FWNA 4P38A 1PGNA 1SG6A 3NT4A 4KG7A 3LLVA 3R74A 2H07A 3B1WA 4KDCA 1RBQA 4IS2A 5INTA 2HK9A 4P5EA 2IS1A 4A0QA 3JASB 3SIWA 3LBIA 1C7QA 4JKOA 3TTYA 4FHDA 1OMOA 4LY9A 1Y34E 1BXRB 4CMCA 2E37A 1K3TA 1Q0PA 5LXTF 1G63A 2YIJA 3AEKB 2FI1A 5M29A 3DF9A 3L6CA 2J5RA 5TEVA 1R3UA 1MFPA 2IUYA 2I2BA 4K2HA 5EHNA 2QAGB 1PQ4A 1KBQA 1M10A 2WSLA 4J0EA 1PJTA 3HA3A 4BWYA 4RPLA 1U1EA 4G63A 4QJ5A 4UREA 4WXYB 5K01A 1YFJA 3NR2A 1J2YA 2PGNA 1FL9A 4Z99A 5F7ZA 1Z6AA 5BN1A 1JA1A 1EMDA 1QDUA 5IFKA 2JGNA 1AUPA 3D3NA 2VNAA 4GXNA 3OFSA 5JS2A 5CVCA 4DADA 1YBAA 1ZVKA 3ZLBA 4D45A 2Y8EA 4FYPA 5FAXA 5GTDA 2XITA 1R6AA 4B7ZA 5K45A 5FWNA 4P3OA 3L8YA 1W73A 2QLLA 3HACA 4TT3D 2OG2A 4RD3A 5F76A 3SYLA 3WWCA 4MNTA 3O03A 1E8MA 2VTDA 4HVCA 5HZHA 1CUVA 3CVVA 3HDVA 3O2JA 4KV9A 4LHSA 4GSLA 3B3QA 4QBIA 2YWXA 2I7VA 2H4HA 2PR2A 1I9GA 3DQZA 1MCZA 3GRPA 3IUPA 3B53X 1RKUA 2O7SA 1JSCA 2HCRA 4RFVA 3M1LA 3TR0A 4IINA 2YXBA 3LX6A 3U3ZA 3ZWWA 1JDPA 3HZRA 2X5KO 3AR4A 2NU8B 3WC4A 5D6OA 1ORDA 4OGLA 5I47A 1GV1A 1M6VB 1YE5A 3BTVA 4XGQA 2GD0A 3QVSA 4MCAA 3OX4A 5FI3A 2O0MA 4J9VA 5BN4B 1N2JA 4UE6A 3SWWA 4OQFA 3VFDA 1SVNA 4DCSA 4AU1A 3UGQA 3COVA 5BSHA 1EHCA 3ET5A 2EL7A 2HRZA 4DR1B 1NL3A 2WOJA 4ED9A 1U90A 2AX4A 2XWBF 4CTKA 2HLHA 1XZEA 2E1RA 3A06A 4IJ6A 1H1DA 1E9RA 3H2HA 3D6HA 3M3HA 2BI8A 3W2FA 5GWXA 5A9SA 3HKCB 4FHFA 1NXXA 5IXJA 5D3MB 3PBKA 3GT7A 1I5OA 1KJIA 3DAOA 3GV0A 3PENA 1OH7A 3AHDA 4RVSA 1RABA 1SXJB 2IOFA 3F5SA 4E5YA 3WO1A 1UK7A 5FO0A 4OGGA 2PQ0A 4QGFA 1FCJA 4PR3A 1NVUQ 3OQVA 1ZWLA 1GD1O 1BXZA 1P18A 3MPOA 3R4VA 2HADA 1I01A 1FX0A 3USES 4LNAA 1OREA 1CX9B 1TYDE 2A0KA 3RS9A 4HMQA 3S2FA 4Q7JB 4WBNF 1PNQA 4JSTA 2HJRA 4E07A 3TSOA 1IXZA 3IDSA 4MW4A 4ZWNA 3VTKA 4TS9A 1CRPA 3AERA 4MJXA 4FYIA 3HB7A 1IPFA 2BMDA 1RNLA 1V47A 2CF6A 1H6BA 1F4LA 2I03A 2IYOA 3G9XA 3F8SA 4HRVA 4JXJA 4LDPA 1XR3A 4QPNA 3VKGA 1TCCA 3L43A 3KR2A 1DRKA 3FG9A 5EIHA 1TYZA 4OBXA 5FFMA 2JK1A 3CF2A 3EXAA 3FR7A 1KEPA 1KZHA 1AN9A 5JS8A 2DWQA 1EINA 2BGUA 3LUPA 1B4DA 2B8JA 1P7ZA 4GF5A 3AXTA 3EVDA 1K0UA 1L2TA 3LUKA 2CYCA 1PFQA 2OORC 3HJGA 1TM2A 3OPYI 1C0LA 5CU7A 1EFPB 2W58A 3KOUA 3FDXA 3AUYA 4XSGA 4Z0NA 3ZWDA 1E9DA 5KX5B 2DJIA 4LQCA 3IEMA 3ZZNA 2R5FA 2CL0X 2GD6A 1QM5A 4N40A 3FTDA 3V8EA 4AO7A 3GGSA 1RBMA 1B76A 2R6DA 3LH5A 3ZDYB 3LVRE 4HPJB 1BSVA 1O95C 2A4KA 3THRA 5J2TB 1FFYA 3PPIA 3EWNA 3SZLA 1L5RA 3I3SR 1X39A 3LPNA 3VU9B 3RI3A 3BORA 1HQKA 1XA3A 2AC7A 4FCTA 4HDKA 4PTYA 3FHLA 4FMDB 1DKNA 4RMGA 4MK4A 3T9DA 2LW7A 4EJSB 2X5OA 5CYPA 3WLRA 2WUEA 1XEFA 2BTQB 4HRAA 1KVTA 5HG0A 1NQTA 2GPBA 3MC1A 2YXPX 2P9YA 3H0EA 3EBPA 3GZNA 3NIWA 4L3VA 4DW8A 5C18A 4ROSA 1HG1A 4PZCA 1UAGA 2QK4A 2VHYA 4OFWA 1II8A 2XNKA 2ZSUA 4W5JA 2W42A 2WUFA 4QUAA 5TQ0B 4J16C 5DKFA 1H9AA 4OHOA 2PTGA 2JVIA 1EA5A 4BBZA 3PJFA 1NC1A 5DTJA 5DV9A 4DLPA 4F2PA 2R2AA 4PNZA 4X97A 1P1CA 1NX9A 2ZIUB 4P8RA 4FT2A 1V2GA 4DMGA 2Y05A 2Z2JA 3U4DA 1KI4A 3T94A 4L4UA 1BRTA 2O48X 1HT1E 1UUFA 5K3BA 3ZDEA 2VJKA 2NUAA 2BSAA 2YTZA 2W2LA 1Y6JA 1Z2AA 1QO7A 5HS6A 1W2GA 3HDTA 4TWJA 4TT8A 4ZQIA 3H65A 4UXIA 3HXMA 1XLTA 1YBFA 1TIPA 3L06A 4YCAA 3T52A 2UUOA 4WTOA 4ERNA 4GI2A 1XWFA 3F4BA 3NETA 2L0XA 4IX9A 1GL3A 2BEWA 3L0CA 4NDNE 4XGRA 3CR7A 2YCBA 3G6WA 3ZBTA 3H5RA 1U6IA 3KXDA 2OL4A 2WFLA 3EEFA 1SA0A 3GJ8A 1R0RE 2M98A 3ILHA 5BVGB 4ENUA 4IDGA 4R9VA 2Q1SA 1BYUA 1QTIA 3BH6A 3GCXA 3NIBA 4QDZA 3WMGA 4F60A 1KAOA 3CW9A 4IKPA 1TTQB 4XX0A 4CGYA 1GHTA 2AT1A 3KHUA 3RAPR 4UQLA 2CMKA 4ND3A 4MCHA 4Z4QA 3CNOA 3ABQB 1G8GA 4KK4A 1VCNA 4UHFA 1G8KA 4YP6A 4U39A 1JR4A 4KFTA 4DIKA 3FYUA 3NWPA 3P0RA 4L6AA 1XDDA 2TRSB 1F6BA 3GD5A 2XYQA 2O4CA 2ZQZA 5AOCA 1ZHFA 1UC5B 1PJ4A 1JG1A 2PL9A 3JWPA 4NCKA 4YR7A 4OBBA 4RY2A 4RQAA 4W5QA 3DTYA 5EZYB 4YRMA 4GKAA 4KRXA 4QUGA 1CIPA 4HFMA 1EWQA 1QRTA 4FILA 1JMVA 2YC2C 4NMXB 3WBFA 1BX0A 5FHQA 3FNGA 4UFNA 3J81A 3AFMA 3IDOA 4AQ7A 1NXVA 1Y5RA 2WWRA 3CRQA 2B7CA 2C2GA 1WCYA 2NUTA 4AT1A 4E5MA 5ILOA 3CLRC 3KV3O 1CETA 1U1GA 2EJUA 4WFIA 2MINB 1KERA 2YZNA 4G1BA 3IE1A 5CVUA 1FLNA 3GRFA 1A5AB 1FNSA 5T57A 1TU3A 1TTHA 1BMQA 3DAYA 5D7BA 2X2OA 3B6JA 3LQRA 1O8CA 1QZUA 1RFGE 1RJ9A 3S44A 3CGWA 2WA2A 1UT5A 4YRGA 4RKYA 1LF5A 2CLFB 2HFJA 4TKUA 3R5SA 3WNBA 2Y0CA 3HBLA 4UE2A 2OKGA 3S1AB 3VSCA 3THYA 2QRJA 4FGKA 4BNIA 3VBEA 3KZCA 4JT8A 4X6UA 2XJ9A 1YUMA 1R37A 2G4VA 3KIPA 1PLKA 4CMJA 3DLPX 4JLVA 2KLHA 1YB4A 3DH0A 4KYVA 1KY3A 2NZXA 2PV0A 3GDOA 1VSVA 3INNA 4LY6A 2V6GA 5AHXA 5K8UA 2WAOA 5HF8A 3TAHA 1DWUA 1Z0ZA 4UPEA 5F23A 2R85A 2OVBA 3CNEA 3BMCA 4PSDA 1PJSA 4R8LA 3B36A 2C9YA 1KPGA 4FFWA 1MQ9A 2W6JD 1MGPA 4BFZA 2IIPA 4R9UC 3A1VA 4BZZA 4KE6A 1OXSC 4LC1A 2WF8A 2Q2OA 3KHTA 5K3EA 3AL2A 4OU5A 1PR1A 3DNFA 3DTVA 3LP8A 4I50A 1DXOA 4LSWA 1D1PA 1R00A 4REMA 1OXMA 5E6UB 3TSYA 3WYEA 3T7RA 4HAWA 3HCNA 1ECJA 1E63A 2R87A 5ABPA 3MIZA 1WBBA 3OSZA 1S2IA 4YP5A 2FWNA 4YIHA 1U98A 2ZB4A 3Q6IA 2AVNA 1AV7A 1E3MA 2VHVA 5IC6A 1JIJA 2H92A 3MTBA 2QTHA 1YBVA 1Z4MA 3UH0A 2NYUA 2P2SA 5HP4A 3L6DA 4Z9BA 2FSGA 2FCRA 1FDRA 2CKDA 2FPSA 4KQ2A 1DL5A 4C08A 4D1YA 5C5EA 1S2NA 3GT0A 2IH4A 2JDIA 3NRJA 2QTCA 3BCUA 3WLHA 1KZ7B 3I8XA 1UP6A 2BE9A 5JD6A 1JLMA 3STXA 5KS2A 3GJZA 4I4TA 5CCBA 2YWJA 3NYWA 1QHGA 5GOTA 4XCXA 2JFQA 2QYTA 4G0YA 3B52X 4MI6A 2Q3MA 5B7NA 5HQ3A 3K6SB 2Q29A 4QPDA 2PUWA 3FMFA 1XRLA 2JGFA 3HP1A 3C48A 2OPBA 3C97A 4KLAA 3KPYA 4FFOA 4K0RA 2HIAA 4AK9A 4DLAA 4EUSA 1QHEA 4WSOA 4LCEA 4F6RA 3LAWA 4P98A 2M6KA 3SQMA 3RTEA 3DQQA 2QE7A 1U3TA 5IH3A 3JR7A 3X2FA 1RDFA 4YJFA 1E66A 1F9EA 2BBWA 2QLFA 1TM1E 3I05A 4IV5A 4DWOA 1ZY2A 2ZRJA 4CQNA 1JPJA 1MJ5A 2G9VA 3ET4A 3F7OA 3D8SA 3DE4X 3FPKA 4PW0A 5REQA 1IZ0A 4TRRA 4PS0A 1QANA 3WYBA 4B6RA 4D98A 2REQB 1LVUA 4DCJA 3SU8A 4C43A 3HO6A 5L3RA 1DHRA 3KLBA 1QB8A 4DKJA 1EM6A 1MO3A 2C2MA 1OVGA 3FIUA 1XPJA 4KO8A 4B35A 2A5DA 1YB5A 2OAGA 1PNRA 4D2IA 5G4KB 2QT0A 1X7XA 1UC4B 4CU2A 2BWJA 4RK7A 4IXMA 1N3IA 3GPBA 3QBVA 2IOYA 3GLHB 4WXHA 4H6PA 2N3ZA 3NQ41 1L7QA 2NX2A 2CGEA 3OFND 4JJKA 4R01A 4YBRA 4ZVLA 2GZRA 1TQDA 3GJ3A 3DULA 3PJDA 1KMMA 1L5MA 3C7TA 3DQPA 2I78A 4FNAA 3CN7A 1M1NA 3LUFA 1GXSA 3H8SA 4DR6B 2RGNA 3FMIA 5TC4A 2ZJ8A 3K2IA 1QIKA 1ES9A 2YWFA 1PBNA 5K3DA 2YY6A 3DVAA 5CIQA 2QR5A 4DIBA 4KIFA 4KGZA 2B3DA 1KGSA 2JCYA 3HWSA 4O4LB 4EW2A 1QRSA 5HOQA 5BWOA 3IT3A 1CPYA 2NV2B 4LTMA 3NX4A 2EWVA 1PLJA 4U00A 2GN8A 4XD7D 421PA 3STUA 3FSEA 4PG7A 3V1KA 3ZWOA 3B9PA 4AX8A 2QT9A 1EX9A 4J0IA 3UW3A 2CXPA 2Z8YM 4HPWA 1AQJA 1YAHA 5CVEA 1SWWA 3HB0A 1KKMA 4BZXA 4PYQA 4R6WA 1SHTX 1F51E 2A2ZA 3U09A 3LWNA 4OHKA 3HSKA 4FGZA 4YP1A 5KWIA 1XJCA 2N0SA 3BFJA 1LRKA 5DVZA 4GPZA 5CFQA 2FOIA 1TM7E 5FUWA 4GMGA 4L3OA 4Y2UA 2RGUA 5CPFA 4ZMBA 1QPBA 3G1UA 4D4MA 3KEQA 6REQB 5GZ1A 3PC6A 3BREA 4LY3A 3KLOA 4XSHA 4DLUA 1HLGA 4U2KA 1F0YA 3BGOS 3JY6A 3K9GA 2W83A 2AXQA 3K31A 1C3OB 4I5DA 5KAPA 4BLPA 1H65A 2GN1A 1P39A 3CLSD 3HE3A 1H3EA 4WX2B 1ZNZA 5CLQA 6REQA 2HV8A 2Q62A 4U4AA 2HDHA 1BRMA 3QX8A 4C4ZA 4DQ0A 4GZMA 1GQ2A 4K1XA 1HRDA 1UANA 5F78A 1JXMA 4UQOA 3ZC3A 1ZICA 2YWBA 1J21A 4Y1GA 1UPAA 2BM0A 3S8YA 1LSSA 2KMLA 1MPXA 4EDHA 1GTMA 1TJYA 1LJUA 4B4KA 4Q12A 2Z6VA 3MNFA 2OAQ1 3HKDB 3VHXA 4NQZA 4RLQA 3RE1A 1P8AA 2XWQA 2NIPA 2W2PA 5FPSA 1WSBA 5GGXA 4AICA 4F04A 5L3SA 4YRJA 1EUQA 5MGNA 1Z18A 2QJRA 5I48A 4PZZA 1MZPA 2IEDA 3SHQA 4GE0A 5LZ8A 3NBFA 4PCVA 3KQNA 4DABA 1SQ0A 1XK6A 1FK8A 4EO9A 2VP4A 3EIUA 3QPUA 5CDSA 3ICCA 4Q4LA 4CNQA 2VP5A 4DIFA 1W6RA 1IN5A 1V43A 2CZQA 1FNDA 4TKVB 5EXPA 1WXWA 2W37A 3O94A 4ZK2A 4UTNA 2W4IA 2F9MA 3JD2A 4LYJA 3ZHUA 4Z49A 1L8LA 2EJCA 2GVDC 4V0RA 1KO4A 4JNCA 2HFKA 1W36D 2OORA 4N5MA 4KL8S 1M3SA 1E6UA 3HVUA 5HS4A 5KYYA 1RXWA 1DEAA 1Z5UA 2CFTA 2ESRA 4L02A 4LOLA 1C14A 1HSOA 2H9YA 3HDQA 1R8QA 3H5TA 4IOLA 4E5DA 2IUEA 3Q8WA 1J8VA 4IZIA 3HNPA 2SCUA 4YJHB 1KSJA 5K9ZA 3MD9A 2CXHA 1WZ2A 1K86A 1H2XA 5CNIA 5K4HA 1G8HA 2Q1TA 1TZ2A 4I99A 4JJFA 4M37A 4DHWA 3IUMA 2WAAA 1O95A 4IG9A 4Z54A 2JARA 2BDUA 4FDTA 4O4IB 4PWZA 2CLLB 1ZQ9A 2ZUWA 2FB9A 4DC9A 5KREA 3JQ7A 3PC8C 1YHNA 1UXOA 4WY2A 3CRRA 2VHQA 1CUEA 3OU6A 1E9AA 4L72A 1G2OA 3O26A 3WRXC 3ASZA 4MYDA 4B4OA 1E1RD 2YJ5A 3C0KA 3ED5A 5CT9A 2NGRA 4J16A 4GZ5A 1VSQA 3V2UA 1H66A 3QXSA 4OQPA 1JLLB 1U28C 1Z75A 1NXWA 2FPXA 3NHSA 4OMDA 1EFRA 1IVSA 1QPGA 2EOAA 3BIFA 3KO8A 1Y5IA 3TMKA 3OKFA 2JASA 2FX5A 4ZO6A 3WLAA 1K4KA 4WUVA 4HXGA 2O2DA 4L9SA 1XN1A 5EJ2A 4B73A 2WYIA 1AHNA 4JI3B 3AY3A 4N3GA 1ESMA 1YA8A 4RHXA 3L6EA 5ELXA 3NBXX 2WHYA 3O90A 4HNQA 4URVR 3X1XA 4RPKA 2FPIB 2P69A 1ZUNB 4OJQA 4YR9A 2DOKA 3LCMA 5TMBA 4TYNA 1U3WA 3IBFA 1MMFB 1CE8B 1G21E 1KO5A 2JFHA 2JJQA 2QAGA 2V7TA 3DZKA 1M8FA 3B5JA 2HW8A 2GEJA 4PRLA 1J5XA 2C07A 3CH6A 2ZKLA 4DR7B 3B2EA 4KFUA 2WWHA 2MSKA 2GFQA 2F1RA 4XFKA 3QE9Y 3TZEA 2PIAA 2XBUA 3UAOA 4MS1A 4AYXA 2CJXA 3K8QA 3PHIA 3QOXA 3IKMB 4XZ3A 4E3ZA 4YMVA 4LI3X 3QKIA 2YVUA 4QYIB 4E1VA 4PPQA 5FJJA 2ZR9A 1A5SB 1U2TA 1LBHA 4N12A 1Y1RA 2H5LA 3EZ2A 3PQ6A 5H9WA 1FS4A 1KI1A 2WDZA 3ADOA 2KE5A 1YU6A 2P2LA 4YRFA 1EDBA 3H5WA 3GYBA 3L7MA 3Q0IA 4OJTA 3RGGA 4XM2A 1W46A 3UWSA 3VYSB 5B57C 3OD5A 4MH0R 1ESDA 4IIEA 4C78A 2HGSA 1DC6A 3SZOA 4YT5A 1GGFA 5IT0A 4XGKA 2F1KA 4CMIB 2JFZA 3DGFC 2XTJA 5DM2A 4X65B 3B9BA 1PZEA 3ESAA 2QP4A 1U3CA 3M5CA 3A6JA 4Q3EA 1MO2A 2FGJA 4M1KA 1M6VA 4U8GA 5EAIA 1Q0HA 5D5QA 4DLXA 5JXIA 1Q95A 3I3OA 3CT4A 1OH8A 3ZX4A 1RRVA 1OXKB 2N1MA 2ZYHA 3BIWA 3CWQA 1QTNA 4X7RA 5HJEA 2NO1A 3PLAE 1NDHA 2PH7A 3UHJA 2QPAA 3CEMA 1JAHA 1GPUA 5IU6A 1JG4A 1NVWQ 4HUJA 3M3PA 4NCJA 3U4HA 1EJBA 2ZPUA 4MLPA 1PF7E 1ADJA 4R9RA 4MVJH 4II7A 2NLOA 4ASUD 3VVLA 3HKCA 4NFHA 1QOZA 1NKVA 5DBOA 4BP1A 3H11B 4TM8A 5DJ5A 3LQFA 3V55A 4HB0A 1NT2A 1BFUA 4W1SA 4P4SB 4YXWD 4EG8A 1DO2A 1PW7A 1GL9B 2P3QA 1KE1A 2P2DA 4DDTA 1FSFA 1M1ZA 5JPIA 2HA2A 3F1KA 1VMAA 1ACMA 1Q1EA 3DA8A 5KIAA 2HSEA 4ETMA 1IMJA 1PL7A 1QYXA 3ZDXB 3HKBA 3WGKA 2ZUUA 4KAAA 2RK4A 1U8YA 5D84A 4ZV9A 1FMFA 5THQA 4RZUA 3T5TA 3K1TA 3S1LA 4F5ZA 4DAEA 5FLEX 2AXNA 4OB8A 1J39A 4JEMA 1R0LA 5ESWA 4FFBA 4AJLA 1Y5NA 4FEGA 1K7FB 2AVDA 5TQJA 3GLFA 3T1YB 5JRDS 5CNKA 2R751 3JSAA 4YACA 1HR0B 2EBWA 4XUCA 4EQ6B 3FDZB 1NFQA 3PHLA 2NQ8A 1DX6A 1FEZA 4UEWA 1XAGA 5CLLA 2L17A 1R5NA 4Q3NA 5K4AA 1AZWA 1UDBA 2HA6A 4IH4A 3HSSA 4NICA 4RFSA 2JA1A 2PKEA 3QJGA 4JOCA 3FRIA 1A7JA 4JYBA 4LN1A 1R9GA 1G7SA 5BQPA 1NY6A 2FPWA 3MWLA 4MV6A 3VTAA 1SVOA 2VR1A 4FP9A 4WJLA 2PNJA 3KDAA 1EFPA 2DKFA 1GEEA 3RLFA 2F3UA 4BUZA 1R0XA 3N8HA 4OMFG 4TZTA 4N8DA 1YBMA 3A2NA 2ZRNA 5L7WA 1OYWA 1ENOA 1T4DA 4TUYA 2E3JA 3CO5A 5MN4A 2VDKB 3QJ5A 4QL3A 1JEDA 1MO5A 3U4IA 1YVRA 3OX2A 4Z1OA 1U2ZA 2DWOA 2E1PA 5J2TA 2H29A 3U44B 4ZU1X 3W2GA 3ERCA 3DYIA 3LW8A 2OC4A 2GXSA 3VU9A 1SCAA 1ZMOA 2FUNB 3EE6A 3QTBA 3S2UA 1SQGA 3LSYA 2XBLA 1XLUA 4RF2A 4EJSA 4R84A 2A30A 3WXMA 4RZIA 2XCUA 1HOTA 2ZS7A 3OOSA 3UM9A 1LF0A 2FX3A 2BTQA 1PK8A 2VIIA 3JYQA 4RJJA 4CLDA 5BRAA 2QENA 1DDOA 1KHTA 1RKBA 2PK3A 3PGVA 3UK6A 5FWXA 2GSWA 2P40A 3BIOA 3HA7A 4JP5A 4ZGGA 4V1CB 2VOJA 4WHMA 3K0CC 2OD7A 3IAS1 1M2OB 4OX9Y 2VRCD 4AMBA 4QREA 4F97A 4P3XA 3BL5A 3IMFA 1KWKA 1WLYA 4IWYA 2REOA 2GYWA 4PFSA 1WSDA 3M6IA 4M21A 4XLZA 5B1EA 2TMGA 3NEYA 1EVJA 4EZBA 1PR5A 1ACJA 4HEHA 2G71A 4M87A 3PCTA 2EKZA 3EZFA 5HQTA 4BQEA 2Q5IA 1XCMA 3EZ7A 3ADPA 3RUCA 3S3TA 2AOWA 3JAWB 3KVYA 1I7QB 1I2AA 3ANXA 2Q4EA 1CF4A 4E3WA 1W25A 2WKSA 4HOYA 1R18A 3KKEA 4JDUA 5CH5A 3OT4A 5CXXA 5IW8A 2J5QA 1RAHA 2IU0A 4P4GA 4NJOA 2G07A 3DDWA 1GITA 1VXRA 5IAKA 2IU4A 1YDWA 4TYPA 1Z4PX 2I4NA 4RHEA 3DBLB 1UBGA 5BVGA 1FP2A 1UJCA 2IHYA 2FZGA 2JJ2A 2OQRA 4LVOA 5TQVA 3FCCA 4EFLA 3PNVA 3X1JA 4PTZA 2O2EA 3DXZA 3AUKA 2O2XA 4IDOA 3VPCA 1CF9A 1NPDA 3TWOA 4JP1A 4RL4A 4UUOA 3I2GA 3V48A 4OHXA 1EQAA 3GNQA 2ZBGA 4DA9A 1P2BA 4DUYB 4R81A 3PD1A 2JVKA 4HVAA 2JRLA 4UZEA 1V16B 2J0VA 1I6KA 2N1BA 4KX5A 1OH6A 3PI7A 4CEJB 1CSEE 3GJ4A 4UM8B 3WLFA 2FMKA 2WTBA 2XUPA 2X2EA 5T6MA 4AG3A 5HR5A 2ZBFA 1THGA 2YUTA 4ARZB 1B16A 2NTEA 3FPSA 5EHIA 2NT3A 2POQX 2ZI4A 2CXXA 3D9QX 3LI2A 3MB8A 2ZJAA 5I7VA 2DGDA 2B1IA 2B4TO 3VPSA 3S27A 2ONZA 4YV1A 3K1ZA 4BKMA 4CTJA 1TQ6A 3TZLA 5IG2A 3RVSA 1YE8A 2VQ6A 3IP5A 4YI5A 4W5OA 4X8MA 2PWPA 3UFBA 4NBRA 1IHPA 2ZYVX 4TXJA 2XVYA 5L3ZA 4BFXA 5KVCA 1MOSA 1RPNA 1X1TA 2AUNA 2JFXA 1G16A 3KOXA 3HEBA 3NDJA 7GPBA 2IHNA 1WQ4A 2X0DA 1ZNQO 2HLNA 3IR6A 3QZUA 2HT6A 4L51A 3S1AA 5IABA 4BNKA 3PTAA 1LEHA 2Z2XA 3F4LA 2DM6A 4KQ6A 5JH7B 1XRMA 4OQDA 3VAYA 1IPEA 4EGCB 5DNEA 1U1FA 1L5QA 2ZYDA 4K2AA 2GJSA 5IAJA 3Q7SA 3SQLA 6Q21A 5DM4A 1YQUA 1NUUA 4C05A 4EEXA 5DN9A 3ROXA 5B7GA 2R5WA 4H1VA 3IKVA 4KO2S 3TKLA 3AHJA 3FTFA 4YRRA 3OJFA 5HCNA 3BSSA 3E9QA 1K8QA 1U5AA 4G65A 4MO9A 4OHRA 3JALB 4WGGA 4FGSA 4AMUA 4CLRB 4O4JB 5LQRA 3MJCA 3Q88A 1VPLA 4RU1A 2ZIFA 3HBJA 4HB2A 4K3UA 3M6MD 3STHA 4DQDA 2AQHA 1EI9A 3WS7A 4RK4A 1EWRA 4L27A 3ZHVA 1QNLA 4ENTA 5GZ3A 2JFWA 2CJYA 1NQWA 3LP6A 2PX4A 1P4RA 4QBTA 4I50F 3MTQA 4XQ9A 3PGKA 3AONB 3AY6A 2ZYAA 3J7AC 3AM5A 2NUPB 1IN7A 3BGDA 3DFZA 2HREA 1XKXA 3D7KA 4OI1A 1GVHA 3Q9SA 4E0BA 1U80A 3UAVA 5ALDA 5FBQB 3FUTA 3KOZA 4X00A 3IESA 1IUOA 1OWNA 2PH1A 3E7DA 3L6BA 3T7TA 4D41A 3O8QB 3B89A 1PS0A 1WCIB 4MXDA 3ZG6A 1KSHA 1Q0LA 5EJ7A 2X6QA 1NATA 1M6YA 1IUNA 4CV0A 1QOQB 4D9BA 3WFIA 2J85A 3H9BA 5E3JA 2Y2VA 4M9ZA 3VYUB 4CIDA 4W7SA 3GPCA 4N9QA 3IYLW 4DA8A 3MWGA 3EXG1 4WKBA 2X22A 3RUHA 3K6SA 4C4SA 1KDYA 5JSUA 2CC2A 1Y3IA 1DB3A 1EHIA 1OVMA 2I2DA 2NVWA 4IVRA 3MRSA 1A8PA 2CDCA 4K9NA 4WMLA 4DARA 1E1DA 4ZDWA 4EMBA 4M76B 3JQ6A 3U7IA 3WRXA 1YCDA 1N6OA 2NTYC 3O92A 1JDJA 5AXAA 3O4JA 2LVBA 4EGSA 3VU8A 1D5CA 3HXTA 1DU4A 1LK7A 4M22A 4UPVA 1S8AA 2AMYA 1OHHD 4J1NA 1U28A 1FBNA 2UUCB 1G0OA 3ZJ4A 4ICIA 3B60A 2WSSD 1ONPA 1I1QB 4FOSA 5C7LO 2REQA 3LWZA 1C9DB 3ZWXA 1UKVY 1CR6A 2E5LB 2JIQA 3AH8A 1GVNB 5J5AA 3AGQA 4CL2A 5JEEA 1SD5A 3NH9A 2H63A 3MVEA 1U9ZA 2Z09A 4DLVA 5D51S 4KMMA 3T4XA 3T4PA 5JQWA 3AJAA 1FNNA 3LVBA 1UAAA 4DIMA 3PD7A 3UUEA 3GLHA 2K2QB 1TJ3A 4J3FA 4QUJA 5CHEA 5DI9A 5FWAA 3RSSA 2Z4RA 2ZCVA 5H4GA 4OYYA 4YO7A 5C32A 5DOVA 3ICOA 1RI3A 2HMYB 4ENVA 3VDNB 3SC2B 4C0WA 4Z4IA 5KSZA 1MB0A 1GYRA 2QN8A 2ZBDA 3OOJA 4KGDA 3ZDFA 3TXXA 5C81A 3REQB 1B93A 2OHXA 1YR3A 2QV7A 4CF5A 3T61A 5E3IA 1MN6A 2JFYA 4ZAXA 4EA8A 3ND8A 4FCVA 4RH1A 1M0SA 3KSRA 5MN6A 2IS4A 1B8OA 4IDHA 1T1GA 3RIYA 3VR6A 4YQYA 3KT0A 3AU9A 2WE7A 2XD9A 3P5BA 4ZT7A 1KP9A 1U0JA 2BFFA 2INGX 3HB1A 1PX2A 4XVCA 2VCEA 1BHO1 3BM5A 2EQ5A 2IEBA 1G8AA 1HUQA 1UAYA 3H99A 3TTUA 5DN6D 5LJIA 4F8JA 1VG1A 3G68A 2DBZA 2PQMA 3QMWA 4GP7A 1A95A 2CJWA 4ND7A 2I9KA 3DL2A 3HJNA 5KHAA 4EWLA 3KSUA 3N8DA 2X13A 1JJAA 1T4GA 4ZCPA 4EI2A 3OH8A 3ZJ5A 2QD3A 1ZMRA 3DW1X 4WKOA 1QHXA 2FHSA 5D5HA 4L7VA 4GRIA 2G72A 1XG5A 1CY2A 3Q7TA 1FP6A 1SHUX 3QGMA 3C6QA 3HB4X 2BKVA 3OETA 1VCIA 4JL6A 1W4LA 2XUOA 1SHZA 3Q7PA 1X3SA 1T9DA 2AXEA 1IG0A 2IZ6A 3Q3JB 4BX8A 2HOQA 5ECDA 3WYGA 4DEVA 3LZCA 3RQSA 1L7RA 2QVCA 2DY0A 3NP9A 4U6QA 3KJNA 4F1JA 4NYIQ 3MS4A 1OPXA 1HV8A 1I6LA 10MHA 2RDMA 1IEXA 4FYWA 4H3SA 3ETNA 4GOKA 5LQSA 3O3MB 4R2KA 3FPGA 1RJGA 3H2BA 3ONFA 4KP7A 3LQYA 5D2CA 2VQFB 1IBLB 4GM1A 4XLLA 5SY9A 5DBGA 1JKMA 2D3TA 4HWKA 2OBFA 1M2WA 3HKDA 4GBGA 4TROA 3SY8A 1SCIA 4WNIA 3VHRA 1R16A 2L19A 4EGAA 3ASYA 1P4GA 5P8WA 5FBVB 1E9SA 1KYWA 2B34A 3DWGA 1U4NA 1DAHA 1X15A 3E2PA 1NV8A 4FDVA 4N0QA 5JZOA 1E2MA 1LSJA 4P9NA 4XFDA 4AMYA 5GJCA 5BPHA 2V45A 2QTLA 1UBOS 4EIWA 3OWHA 3RVBA 4IXTA 1DLIA 3GCZA 1GAXA 5EG5A 2JKVA 3L1VA 1DCMA 3SNKA 4F3KA 3H4IA 1CLUA 4TKVA 4YRNA 1ZD8A 1OYVA 3BXGA 4WECA 1P80A 1AS2A 1HO3A 3FKSA 3N8NA 2ILTA 3UG6A 5DM60 3Q8KA 3IT0A 2BHLA 3GVIA 2IELA 3A9CA 1NURA 1OJ7A 1S02A 1TQ4A 3AWIA 4NP6A 1EKXA 1MP0A 3C8HA 3FX2A 3L0SA 4L0CA 1HKUA 1MC4A 1GKYA 1PR4A 2J41A 2BN4A 2PZGA 1KQGA 1K2VN 1Z4KA 3HJTA 2Q5FA 3PUIA 2EF0A 1B26A 2QL9A 4OKIA 4YJHA 1U7DA 1J1IA 2NYVA 1HEUA 1Z2NX 2GBIA 2QKYA 2CBZA 1NONA 2FSSA 4QAQA 2JF0A 1EFUA 3UUFA 4RABA 4AG5A 5A4AA 4RYLA 2WQ7A 1DTWB 2CHFA 4O4IA 4AQDA 3ISTA 1Z5OA 4F06A 3K6RA 5F1KA 4LHZA 1ZAKA 2VUUA 1GOTA 1FUIA 1ZLXA 3M4JA 5JD5A 3RF6A 4HYQA 2B1QA 3ZQUA 5JALA 3QHAA 1RPTA 4RJ2A 3TXYA 2FUG6 3MWFA 3EPPA 1SQ6A 2OBMA 3MWJA 2V97A 1L4LA 3TFQA 4NL4H 3KE9A 1MQAA 5LB2A 3OF2A 3ZGVA 4LFCB 3GFQA 4A36A 4LJKA 4CQLB 3TEFA 3R0VA 1SCBA 3AXSA 4KE8A 1P2SA 4YCNA 2ATCA 2FZKA 3KTFA 1M75A 3QFHA 4E2FA 5LD2B 2QX4A 1OWPA 1M8GA 2GH1A 3DKVA 4FD2A 2JS7A 3O1LA 5B30A 4PTLA 3WISA 1X7YA 1K4YA 1I3LA 4D96A 1ZUIA 4TMWA 3M5PA 1FYEA 3O2QB 1JB9A 1W5EA 4Q1CA 4UHCA 3GLIB 2P2CA 2HBZA 4GMKA 5DEOA 1I94B 1YS4A 3IHKA 3O6VA 3R7AA 1ZUNA 2JIRA 2ZIXB 3ETEA 5JT1A 1JHDA 1CS0B 2KBFA 5DBFA 4MPPA 4DBLE 1W2WB 5G4LA 4A9AA 3R5KA 1L4FA 3VQTA 3A6GA 3QVTA 3V42A 3MCUA 1ELOA 1E79D 2R96A 4G0PA 3DMYA 1N2HA 3Q2OA 4C2UA 4NXMB 1UDAA 4LCJA 4AWBA 2R65A 2DG2A 2HZ7A 2N47A 3DXYA 1J2EA 5DF1A 2WD9A 3RVJA 2G7ZA 2IVZA 1JE1A 4LWPA 4MR9A 2WYVA 3FI0A 3GK3A 3ZX5A 1C30B 2UKDA 2JI6A 3WIEA 5KB3A 2JJYA 4MARA 1Y3HA 2GPSA 3PHCA 5B7QA 2R8YA 4Y2TA 5JO9A 4LDQA 4PRYA 2DSNA 2V6JA 4K8RB 3HCEA 1JWAB 4NF2A 2FPOA 5E1OA 3FVQA 3UT5A 1TRKA 2VA9A 2ZWOA 1MT0A 2RC5A 4IMJB 4TTTS 3SYTA 4N6GA 3V80A 2VTBB 3IVGA 3OOHA 3V2IA 5K3FB 1JHOA 5K09A 1NMEA 1XTPA 1UBUS 3AI7A 3BDIA 2IP4A 3NHWA 2OUIA 3D0QA 5B7PA 1O96B 3E03A 5I4CA 2VQ3A 2X4DA 4MQBA 5JSQA 1JF8A 4GHWA 2GCIA 5HF6A 1TECE 2VK8A 4WV3A 2QRGA 2XD4A 1XNGA 4EK9A 4PPYA 1BJRE 1S3FA 3OPXA 1MQ8B 2Q5CA 1ZR4A 1QQ7A 2GRUA 2FGKA 3DVSX 4MV8A 3HXPA 2Y1CA 4BLSA 1ESZA 2YOHA 3QFTA 3CVXA 3RK0A 3FTCA 4DSOA 3ROFA 1GPH1 2WIAA 2FDCA 1LGYA 4YHBA 4BPBA 1PGQA 1R3DA 4DR4B 3BZWA 4XJTA 3HDGA 3GAFA 3K0KA 3QY0A 3BWYA 2JCBA 3RM3A 1FSSA 3IIKA 4IOMA 4MQ6A 1SD2A 2VYQA 4AQYB 1QIGA 1L4UA 2IYNA 2ZAMA 3ECAA 3MG9A 5EEHA 3H11A 5G0UA 3K2EA 4JEIA 2A78A 3IURA 2CKMA 3SFZA 3MAGA 4B0PA 2UVQA 1CR4A 5BNIA 4OHZA 3AU8A 1N5DA 4M46A 4IO1A 4M0MA 1IQUA 4EJMA 4ZALA 3MMPA 1A98A 4QQKA 1I80A 5KTYA 1NMXA 3H8JA 3UHOA 2HNKA 2PD6A 4K26A 4R41A 4JB2A 3WKCA 1K97A 1P61B 1B6RA 2ODBA 3IDFA 2A9FA 1V37A 1XIVA 3JXEA 4MKFA 3W7VA 4X6XA 4AJ9A 4AW9A 3HVRA 3F47A 1UIMA 4QRHA 2CLKB 3QWHA 1T4MA 3A6PC 3FFBA 2FK7A 3H9GA 2QUAA 3OQHA 2GRJA 4ZRNA 4B7CA 4MUXA 2Q4TA 3PXGA 1QAMA 4ODIA 4W8HA 3VR5D 1BGWA 3QA9A 4KR6A 7MHTA 4X1KA 4B3HA 3FDZA 1ZJWA 1ZJ6A 1T6NA 4HRYA 4BX9A 4B3TB 1U7OA 4KRGA 1CY8A 1E59A 1NBWB 2XAUA 2YVKA 5H16A 4NEGA 4KNWA 3CW8X 2XVZA 3MUEA 1IBKB 1X9GA 3O0DA 3WLLA 1XMSA 2H9AA 2OBLA 1LPSA 4KCGA 3PL1A 3AP1A 3PITA 1CZLA 1Q5PA 1M83A 3AW9A 3EQ2A 5DRYA 3CJTA 4CMKA 1JMYA 1NI3A 3L7LA 3GCGA 5FDFA 5E2IA 1F4PA 2IF2A 3NALA 3B7GA 5ALTA 1KE2A 3VRHA 4I1VA 4TUYF 4LF8B 1VE6A 4ZV7A 4AZVA 5BQXA 1P0PA 2JHGA 4XGIA 1EFDN 4KFCA 5JS7A 3QWBA 1PD1A 4TYWA 5IJXA 3HLTA 3NKLA 3PVCA 3U44A 5FTNA 4G0OA 4EUFA 2C97A 9LDTA 3GEHA 4L5YA 2AYYA 3AFOA 1QIEA 3O93A 5JZ9A 1GUBA 3GRRA 1J0CA 3TSCA 3OCWA 3O8BA 1NVEA 4FMDF 5DTMA 2FUKA 2C7GA 1UXIA 2D8AA 1YQGA 2J3HA 4L73A 4WLOA 2VH1A 3U49A 3DZJA 3TQHA 4KITB 2CUKA 3VSBA 2OTCA 4Q4DA 3H2IA 1BH6A 1I3MA 2XCOA 4JJ4A 1O6CA 5FB3A 3RB8A 1JEQA 3DVRX 3UMJA 1JQBA 2ZJBA 1K7XB 4HATA 4V1CA 3HJAA 4NC9A 2EZ4A 2HK8A 2PV7A 2Q6VA 2WFMA 4A8TA 1UT8A 4BQFA 4IV0A 1NRIA 4TMFA 2SKCA 1SM4A 2HXSA 3RJ9A 1IUKA 2A88A 1J24A 1DINA 3QUBA 3ELUA 4J8PA 2AWOA 1FA9A 3AMVA 3UK1A 1ZGAA 3I6QA 3SPXA 3P0HA 3V34A 3FVTA 4PLYA 4BBPA 4Z4GA 4H18A 1XZAA 4GVPA 4BRWA 2VP9A 4UU1A 2ZR7A 4MUKA 4DV0B 3IBSA 4JYPA 2P9GA 1T13A 5JCPA 3I72A 1E4EB 3JAWA 5TS3A 1QVAA 4NYJR 3IKLA 4YNBA 1KJNA 5LBTA 1E2UA 2EKLA 3DC7A 4DNQA 2W2KB 2O3SA 1SELA 1XHLA 3OT1A 4FOLA 4HGYA 4PIVA 1YIDA 5FT9A 2PL3A 5FCDA 3GLGA 4HWPA 4EHIA 3PFWO 2OZVA 1UMCA 2PAFA 4YJGB 5K2OA 3H42B 1RAEA 1K8ZB 1T9CA 1F2DA 3FWHA 3NIFB 5ELLA 3DBLA 5AOVA 4LF7B 1CQZA 1JLRA 1PEYA 3AESB 2GBFA 3UXYA 3JD3A 4GZLA 3L0ZA 1IHUA 2YZ7A 4NDZA 1SOUA 1OFTA 3FDIA 4AJOA 3E5NA 2ZGVA 3DE6X 1P6XA 1OBOA 1KFKB 2I7CA 2VQEB 3EZ9A 1DAEA 4IVQA 4HPXB 2XB6A 1G4AE 3UOWA 3OKPA 4Q21A 5HUJA 1NBHA 2Y1LA 4CEJA 4ES6A 1T24A 2WEKA 4MKIA 3VGJA 1A88A 2NUBA 3PGXA 1U8TA 3A3KA 4ARZA 1E5TA 1N6LA 1TT5A 3E1GA 1N34B 1FTNA 4MS4A 4X64B 1SRRA 1USGA 2O3JA 3MJRA 4L8YA 4LYHA 3ZCTA 3BRCA 5HMMA 1WHSA 3I4FA 3EQ6A 2Y67A 1LDNA 3HL4A 4C0KA 2FWPA 3D7RA 2X8BA 4PQFA 3WR5A 1ENZA 1Y7LA 5KWEA 5L45A 4QA9A 3N0WA 5JARA 4XWOA 4UEJA 2GZAA 3NU1A 2K6GA 3P2IA 2GLXA 3HG7A 4HAVA 1JFVA 5ES3A 2FP4A 1N5OX 3D6VA 3E5HA 3QU2A 5G53C 2EERA 3I1YA 2Y4OA 1MXFA 3HK2A 3QVXA 2LP4Y 1VIVA 2B35A 5DK6A 4GECA 3PPXA 4GRDA 2C0PA 3BXPA 2XMSA 4LXHA 4JLJA 1ZONA 2TS1A 5JH7A 3EIHA 3ER6A 3X1WA 3SXUA 3W8EA 3LFUA 3B5EA 4W6ZA 3TUZC 1UK8A 1VI5A 4F3RA 2PXHA 3U2QA 3UWMA 1QCCA 3V97A 1KO7A 2QUHA 1QQ5A 1P44A 3JZMA 3Q11A 1C8BA 3IQDB 3QUAA 4Y2XA 2EJWA 5DHPA 5FUMA 1TB4A 3K9QO 1VPWA 2CN1A 3LNCA 5LBIA 5LIPA 4Q15A 4GX5A 3GOQA 5H8WA 1KORA 4CLRA 3SE7A 1FYDA 4EYSA 1SIBE 2XYGA 3N87A 2CFIA 5AD1A 4GLOA 4YAGA 1RXYA 3DLCA 5CDYA 2H1RA 5D3ZA 3R9KA 1NW7A 2ANBA 2VPIA 4OJYA 3MIIA 4R5HA 5CGQB 2NO0A 4JELA 4Y7CA 3T54A 2GESA 2VSNA 1QKKA 1ECGA 2N75A 1TW2A 4Y2VA 4J0GA 1E2LA 3K71B 3LIIA 3I37X 5AW5A 4J0JA 4CM7A 3KQPA 2IS6A 1PT7A 1FTWA 1BMTA 2HGZA 1GP2A 2B4AA 3PPWA 2ZSFA 1P4JA 1XU9A 5LDGA 1QYRA 3ZZMA 2J7PA 3I5AA 3F5MA 1VOTA 2BGMA 5AK5A 4HYEA 2EDAA 1KDOA 1H2RS 4IIXA 4UHEA 4GU5A 4OQMA 4JXXA 3PKIA 1ZLYA 2XEXA 3AZPA 5CD1A 4L4RA 5JOQA 4WERA 5EJAA 4RULA 2CMFA 2CWWA 2BELA 1UXKA 1WCIA 3IR5A 3R5HA 1RQPA 4MIEA 4KR9A 4B3MB 4OHUA 4BO5A 2H31A 3OE7D 1A9PA 2OP0A 1WMEA 4UXHA 3UAZA 3OURA 3GLSA 2B20A 2IYLD 3DEIA 2YQZA 5AICA 1Z68A 2DTXA 4I1IA 2JCGA 2G1JA 1L5GB 4PC2A 3R75A 3AWDA 3X2SA 4A0HA 2JATA 1LQUA 2A35A 5K03A 1NJ2A 4R1LA 5BW6B 3C39A 1KVRA 2B2XA 5AJUA 1NNSA 1PW5A 3KD2A 5JD3A 4WH0A 5FUQA 2FN7A 2JAUA 2DHQA 4ZYZA 1YVUA 1KOFA 1NN1A 1TFUA 1CQWA 2X1HA 3I42A 4FGWA 4ZRMA 1GN8A 3QG5A 2IBSA 4R3NA 4RXTA 3WV5A 1GTVA 4WK2B 4BMVA 2GM5A 3ENQA 3WJAA 4F85A 2VTEA 4YT2A 1H9CA 4BV3A 4I3GA 2PX3A 3IAEA 3T9CA 4F2DA 5EGSA 4Z3KA 2XHEA 4KR3A 1G8YA 2GNPA 3MQ4A 2ADOA 3CA8A 2ROQA 2VRBA 4X24A 5F77A 3EIWA 3VUEA 4DQKA 4ZI5A 1SBQA 3U9LA 5SY4A 1PX0A 1OI2A 2WU0A 2ZWIA 1U8UA 3LRPA 2VZEA 4OYLA 3PI6A 3SHVA 3D6NB 1QP7A 3STYA 1T5TA 3C3YA 5HK8A 4AS2A 1UDWA 1ZEMA 3BQNB 4I9HA 5AM1A 2X0RA 3EF3A 1NG9A 3D3JA 3QKSB 3V1YA 1LI7A 1NW4A 3C5WP 4W6QA 4MICA 2F90A 3RF7A 3EZ6A 5F98A 2VUSA 4LV8B 2R9VA 3OHSX 5MN5A 5HDBB 3DMTA 3FVRA 2IQIA 1MBZA 2YW9A 3QSGA 2R6CA 4OXYA 5TF0A 1WVIA 2HLPA 1HDYA 2P9TA 4PHTA 3ZWQA 2VJAA 4XJSA 4F9FA 4V24A 1GYQA 3TFWA 3HCOA 3SC2A 3ZVKA 1LBIA 4MPJA 1KJWA 3D6JA 1OBFO 1R6TA 4ZT3A 1W30A 2C88A 5KTTA 4K9RA 1ONOA 4HZUA 1V45E 3B1KA 3G6KA 3BTUA 4Y6OA 1ZYUA 2Q2WA 4ER7A 3N2GB 5CTAA 3ES9A 5CT4A 1ABBA 2XUJA 1J42A 4M8LA 3RTGA 3JD0A 4HDAA 3BD6A 4TLCA 1WR8A 5AKIA 4HNAB 4NAUA 1JEJA 5IDYA 3C4QA 1A04A 1MHTA 1E62A 1V95A 5JMOA 5FL3A 1BMDA 1FTSA 1MC8A 3H1TA 3A31A 1PZFA 3KP1A 1MORA 4KW7A 3IQEA 1DC4A 3MHPA 3TTWA 4JHXA 1KEVA 4AB1A 3AKDA 4WEOA 2R00C 3W9YA 1C1XB 1SULA 3L40A 2ZJ1A 3AEQB 4QBHA 4HD8A 3KQTA 2QSZA 1YDFA 2W22A 4CF6A 3JQ9C 1KMCA 3GQVA 3QVOA 4G5YA 2VHTA 4II2A 5B5SA 4QE3A 3OWOA 3TLGA 4JUBA 1UZMA 4WJZA 3ZI4A 2AOXA 4ITUA 3PFCA 1DG1G 4EJ2A 1D1TA 1P0CA 1AGXA 2V6MA 5C0OE 2CNWA 4CCSA 2IWRA 3UWDA 2BC9A 4DA6A 2MWMA 3BK7A 3QKRA 3MT8A 3W2EA 1X8JA 3NHRA 3V1NA 3L9WA 3ICQB 4D4IA 1C1DB 3DMGA 2GEKA 3MGKA 3PEVA 5AXDA 1CVIA 4EVIA 4WEQA 4KO1S 1JDBC 5EQTA 2LGJA 3HYNA 1ULTA 1R0SA 3RFXA 5UKDA 3B9QA 2C4NA 5CM8B 2J31A 4IX1A 1AS0A 2HZBA 4R8SA 3T9AA 1ODTC 1MFZA 5C53B 3RU3A 3T3NA 2P35A 2NU6B 1PDOA 3HXOA 3RBXA 1OFUX 4Q3AA 1UEIA 3F97A 4MUBA 2RFLA 3I9NA 1VMDA 1M34B 1Y5LA 3OCYA 4DG9A 2VJMA 4GZ3A 5G1PA 2R1VB 3FDFA 4QECA 4TLBA 1YC5A 1FTQA 3HRHA 3PFNA 4A26A 4KWHA 2WSMA 3EXG2 1YAJA 1V1RB 2XDAA 1NW3A 3G02A 4JXZA 1HNNA 4BMXA 1GRCA 2PL1A 1KRXA 3AVYA 4X45A 5COAA 1KDZA 5HGXA 3FFAA 4ECAA 3HZOA 4FMCB 4OJKA 3ZNQA 5I4IA 3A2LA 3T0FA 3I5MA 2IEGA 1ST3A 4JQZA 2GN2A 4Q3BA 2OZLB 5ARDA 3QBEA 5IEBA 4KKXB 4YQEA 1SQSA 2XDQA 5F7OA 2CBGA 3VR4A 3AL0C 3AZQA 1SG9A 5EE3A 4KPUA 13PKA 1KI9A 1V3VA 1ZNXA 2WSYB 5KC9A 1PT6A 3G7UA 1I5EA 1TQ2A 3IEUA 1OR8A 4RVUA 3OIUA 4Q3LA 3D3QA 4C07A 2XMGA 4ENQA 3D7NA 5KNBD 1YRHA 2BLNA 5BURA 1J00A 3ZLTA 3U1BA 2ZJYA 1JH8A 2FE4A 1BIFA 3M7IA 1T6BY 2R47A 4LSGA 5C37A 1QYVA 2G4LA 4BAGA 2D1TA 3QVWA 3DAHA 2I8AA 1F6WA 1DIAA 1QK4A 4HAOA 2X76A 2QQEA 3FCXA 4NBTA 4O4IF 5E9JA 1K1EA 4Q6BA 3COJA 2VDJA 1SUPA 5IF3A 1M8JA 1MB4A 4L74A 4ZOAA 4FYHA 1U99A 1V3QE 3NLLA 5IAGA 2PUFA 4GT1A 2XGOA 2ALJA 5CXSA 3OG9A 2AK3A 1H4SA 2FR8C 4BV2A 5ERYA 3B12A 4NCNA 3WFJA 4F9TA 1LS6A 3LKVA 1KZGB 4HMOA 1CY6A 3SX0A 5AVWA 4QEZA 5I7UA 2PKQP 4FDLA 2XGGA 1U3UA 4O63O 3L8DA 4O1HA 1QBGA 3GVPA 4S3MA 3WHPA 5WRFA 1JTFA 5B1IA 1Q1AA 2JGLA 2X2PA 2HBRA 4A2WA 4EM6A 4KAFA 3U16A 1FDSA 4ZVVA 3AR7A 4KPEC 1SU4A 1DJOA 1YZ3A 3G9ZA 4DRYA 1E2FA 4INJA 1OCEA 5ADVA 3ACCA 2WQ6A 2ZRKA 5BP7A 2BF4A 2TSYB 5DB4A 1J9ZA 2GXUA 4WZAB 3WSTA 2C7QA 2C2ZA 2ZIXA 2H4JA 3HYLA 4KXYA 4ZC1A 2J3DA 1CS0A 2VZLA 3GG9A 1R6VA 1Z5WA 2WF9A 3ZEIA 4BY9E 3L82B 3USZA 1SKYE 3ASVA 1QC5A 4BVKA 3PVZA 1XDUA 4C04A 3UMMA 2I8CA 4ASUA 4M60A 4KQIA 2FK8A 2LKDA 5CH3A 4QFCA 1JBEA 4ZFNA 4ZDJA 5KBYA 2I6FA 1UM8A 1H23A 3F74A 2PZLA 5A2QA 1SUFA 2OXEA 4LGMA 3VPFA 1EXNA 3WK7A 3N2YA 4Y6SA 1C1HA 1L8QA 4UOZA 5F21A 2O8FA 4Y6GB 3Q7QA 3SBXA 1YZFA 3LHDA 2WYUA 1H1LB 3R7LA 4AN4A 1ZI6A 2R8ZA 2VPTA 4LHYA 1Q0RA 1F6DA 4UNIA 3DUFA 3AF4A 3HJHA 1UZUA 4KLNA 3OU7A 1LX6A 1UADA 2ACKA 1PKXA 5LNK1 1AUQA 1W87A 2RI6A 2YZGA 4BVBA 3C1AA 3MPUA 1XL1A 1W93A 4F5YA 3JQGB 3FCUB 4LBZA 3PIIA 3UFXB 1KARA 5TPZA 2O1SA 2YNMD 2ORIA 4RCYA 4BO0A 1M1YB 4IFTA 4RH3A 2ZAOA 1SKQA 4M98A 2X4GA 1FDUA 2ZJ2A 1HDGO 2B0JA 3WV4A 2QQ0A 5F33A 1L8OA 5MGBA 4RK1A 2AKEA 4L28A 3CLVA 4XOIA 3H5VA 1KVQA 1LK0A 1W4ZA 4LTDA 1H4QA 1A5ZA 4DIUA 3OAAD 2WJJA 2RGWA 2ZVJA 4HDQB 4QIHA 5BNTA 1U3GA 5AVJA 3NXSA 2HHHB 2VFAA 2G08A 1YI8A 2TYSB 4YYEA 4GX1A 3TNFA 3WNQA 5E0OA 1Z6PA 5KZMB 3DDUA 2ZK7A 4IQFA 1U6JA 3OLZA 1I0LA 2BM9A 2JD2A 2XNDA 4A10A 5ADUS 2CV0A 3Q7RA 2JI4A 3K72B 4YDHB 3A4LA 1OJLA 3RR2A 2R8EA 5KVSA 3FZQA 1P91A 3A05A 3NM4A 4GM4A 3L01A 5HBGA 3FOEC 3RV3A 1ZKDA 3MB5A 4RM2A 4HBGA 3QW2A 2ZSKA 2ZBQA 3NDIA 4RWEA 3HLKA 2GA8A 1FFAA 2H8GA 4NFLA 4U6NA 1HZJA 2CHGA 1FDWA 1S8FA 2PNFA 3C24A 2CW5A 3CZ4A 4H7DA 5GADl 2ORYA 4MUYA 2X8AA 2P79A 2FEKA 4POOA 3FWPA 1KI7A 5KKCA 2BSQA 3B20A 3DDNA 1YUBA 2RG7A 2R6HA 2VXBA 4G41A 1O58A 3E4DA 5C9ZA 2IKQA 4FW9A 4YRCA 3ZLJA 1J09A 4DYVA 2Z5GA 3TJRA 4R1NA 3OESA 2H1VA 5EE9A 4LTNA 4K7JA 5DW0A 4A2PA 3DFMA 1B43A 1GCOA 2WFZA 3NM6B 1CB7A 3UV6A 2DCMA 3HBMA 3L9XA 4HS9A 1FRVA 3BJMA 2JLSA 4CM9A 2RGRA 4URHA 1RLTA 4R1OA 3TOVA 5BNWA 3C3JA 4RTNA 4F7WA 1MC1A 3X1MA 5JAUA 1F4VA 3TUJC 3PEFA 1W4BA 1EEXB 5HDQA 4F92B 3AK4A 3BE4A 1MW8X 3R9WA 3LF2A 1ODJA 3AR3A 3HP7A 1WY7A 1KH1A 4H4EA 4BB5A 1NNI1 4Q1AA 5KTSA 4XTCS 4DOMA 3E4CA 2G09A 3Q9UA 2Q1XA 2P2GA 4PLHA 4HDNA 1V1JA 3TLEA 1IZ7A 4TXLA 4YONB 4UDYX 4KE7A 4KMOA 5ADHA 1PWHA 2X40A 4TTVA 3KSBC 3B48A 1ONSA 2VF8A 4LZAA 5E95A 4ABTA 2V5VA 3AV0B 1CJCA 3F7TA 3QFSA 1BEZA 1GZUA 3UJ3X 5DNCA 4HX5A 1PNTA 4J4TA 4H9GA 2OPHA 4FZVA 3IVXA 3RVRA 2I6TA 1Q0SA 4MWBA 3UXEA 4KWTA 3ONVA 2HU8A 3W7BA 1YB7A 1V8DA 1CJKC 3HFRA 3MTEA 4DEYA 3E3MA 1YCFA 1P77A 1ZK1A 1MU0A 2O2YA 1VSUA 2W11A 1AHIA 2XIJA 2ZAYA 1PQUA 2Q1YA 2AF3C 2A4MA 3RRNA 1KAQA 4OIMA 2ASEA 1KBZA 5ESDA 2R97A 4YAUA 1NBMD 3S5UA 3P9RA 4XUDA 3UG7A 4GO1A 5CJ2A 2I2CA 4TTRA 1OWMA 4QSMA 3FW1A 3ORFA 5JPDA 1SUWA 1HTTA 1XRPA 3L1IA 1Q7TA 1JA9A 1GO2A 1OILA 3PNYA 1Y9ZA 4P08A 2VYND 1JHMA 4MRAA 5ALGA 4JJ6A 4ITVA 1C7EA 1E4EA 1QG0A 3UXMA 3AW8A 4M88A 2FPGB 1QTRA 4PGMA 3VGPA 5KHOC 2AL7A 1XYVA 4MW9A 3F9RA 2BEKA 4OGWA 1IAQA 1NG1A 1SB8A 4U7WA 4TQGA 3HC7A 3WB9A 4RVOA 4JOSA 3SEQA 1YQEA 4FEYA 4RV9A 4BX3A 2XNSA 3DS8A 2BKEA 2O8BB 2D2XA 3IUJA 3DFFA 1O87A 2ACWA 2J4FA 4IFIA 1E2JA 1JDZA 2VSXA 2YASA 3QKTA 3WLQA 4IIUA 1ZK2A 3HM9A 4RPIA 3AESA 3HCFA 1TK2A 4JIMA 3DZHA 1XFAA 2PGDA 1JHUA 1H2YA 4LV6A 4U7JA 2NU9B 1IY2A 1V48A 1H5NA 1QHIA 3G59A 1ML4A 2V6FA 2YMQA 3G2PA 4MI9A 3L49A 2FTKE 3CCBA 4LDAA 5D1HA 3I64A 5I9MA 3TG2A 2Q2VA 1DJQA 1AOXA 1EX7A 4JNKA 1P7CA 1IK4A 1C7FA 2UYHA 1ND5A 1GPDG 2VK4A 4JGBA 4D8XA 2ST1A 2XWPA 2PWBA 4M4SA 5EEGA 3VNSA 5J1SB 2C9CA 2B98A 2QRUA 5MFPA 5JZVA 1VJRA 3PFKA 2BKLA 1I7LA 4DXHA 1JH9A 3FPFA 1K5PA 3IHWA 1W36B 2E0IA 4S1WA 3OQJA 2Z0MA 4IDDA 2B1JA 2OCDA 4XASA 3S8EA 5H0IA 4AY4A 3OPYB 1B14A 3D8TA 4L7QA 4W5RA 2OP1A 5DTIA 2D8MA 2QVYX 4BNDA 3MJVA 5CT6A 1G98A 3F9IA 3SYRA 1VTKA 1C7ZA 1Y6ZA 4IDAA 2R00A 3B1JA 1L4MA 4M1OA 4M49A 3SJAA 3V4SA 3ZKWB 1JI0A 4B17A 4F6LA 3UPUA 3UQZA 4WOJA 5A4KA 3EDYA 3JQ9A 4Q66C 3V8RA 3PVSA 1Y5MA 4QGSA 5FTMA 2GN4A 2BGTA 2PZJA 1T9KA 4LISA 4D9KA 4QDXA 1JQ5A 1VL0A 1MB3A 3FMGA 4BZPA 3WJ7A 1ITZA 3W2IA 2WW8A 1SB9A 1Y80A 4WZ6A 4M1SA 1WIWA 1L3IA 3KQWA 4UEKA 1QR6A 1HM5A 4IOJA 1JR2A 1D5WA 2NVUB 2NT4A 3CG4A 2C5EA 3NHMA 1GTRA 4ZQHA 1NZJA 5C5IA 3Q7IA 1RTTA 3VOAA 2AOTB 2JHAA 1GQRA 1JSZA 2XNHA 2C5FA 1E64A 3HU5A 4XWWA 4UM9D 1NA5A 3T1QA 3R44A 5EYPA 1NJ8A 3D3WA 4E5KA 4EKNB 2WT9A 3DV0B 1P7VA 1ZC4A 3OJ0A 1VBNA 3TIXB 1FNCA 2P3OA 1BS2A 2WAXA 3UK0A 4ATNA 5DHQA 2QP9X 2IE0A 2AEMA 2QQFA 4XEHA 1NKSA 5A1TA 1UQRA 4OFZA 2WD7B 5A3JA 1NRWA 1W9MA 1QIJA 1HDZA 4C2AA 4L8LA 1T8RA 1LDBA 5C34B 2X0IA 3K05A 5EMJA 1Z7WA 3T34A 1V0JA 1VHQA 2Z8XA 1G38A 2GPYA 4K9KA 4IMPA 1G6HA 1WUYA 2EBFX 4L8WB 5DT2A 4H6WA 4L50A 3RUFA 5EJEA 1MRZA 3VDRA 4PYNA 3VVBA 3HVHA 1NLUA 4JH0A 4CODB 3LDFA 3ICEA 3AIMA 3CZ9A 3NDPA 3ORQA 4P4LA 1W0CA 2JAOA 3TNLA 2Y92A 4OQYA 3VZBA 5E1MA 4OXXA 3K70C 1JDVA 1RHQA 2YZ2A 4PGAA 3T3DA 3WMRA 2H4YA 2QBYB 1JDNA 1RLIA 1YV9A 2V3CC 2QRMA 3EG9A 3FFTA 3QF7A 1RIFA 1NP3A 2OHFA 1ZZEA 2AKYA 2PRSA 2FSIA 1MABB 2XMCA 3R3ZA 4E7PA 2ONYA 2VWGA 4GSKA 3RWMB 1XZCA 3IQGX 3NTOA 1U5BA 1U65A 3NDRA 4IXDA 3ROKA 4ARUA 3A7EA 2PS1A 3OLXA 1M33A 1RZUA 3DE0X 4QASA 5FORA 2CV1A 1CS4C 1MAAA 4J07A 3C5EA 3L7IA 1KK2A 4YT4A 4LGCA 1MA0A 3PE6A 4TLDA 1QUEA 4HEQA 5HEKA 3K20A 5EOVA 1VCOA 1POXA 1TYEB 3EGEA 3R20A 4WESB 1PS9A 5AW8A 2FXIA 4FKBA 2Q45A 2Q3EA 4PS1A 5GONA 4EF4A 3QEAZ 2JLUA 4J0HA 4YO8A 3JATB 4MB2A 1PJRA 3RSQA 4FE3A 1UKYA 5DSTA 2B6NA 3S4YA 3CQ9A 3GFOA 1U9IC 2VNJA 3KQMA 2FLWA 3R6WA 1F3LA 3LDUA 1RAFA 3HFGA 3PUWA 4HH4A 1QG2A 2CCGA 2IXBA 2PZAA 3RS0A 4BX2A 1MX3A 2XRFA 2ZRFA 3BOSA 3LA8A 3BMQA 5GZ6A 5BSMA 2EFCB 1GTSA 3KAKA 1U2GC 2GUWA 1E7YA 3H7AA 1H2EA 2XR1A 4B9AA 4AJPA 1X9IA 1F2UA 4RF3A 4LRTB 4J91A 4TSRA 4EG5A 2H7XA 5EA2A 4L4SA 5JQGB 2ZETA 2GM4A 4J7CA 2EKQA 2HIMA 3DB2A 3IODA 1DQSA 3PKJA 3ZI7A 3H9UA 2MSLA 3KQHA 2ZWMA 2ECOA 2EP8A 3AEUB 2B8TA 3E6AA 3R3UA 4JP2A 4GPTA 1U2EA 1UOQA 1KL7A 1QPZA 1N57A 4W9RA 1UBMS 3ZXSA 4KIJA 4ZK6A 3IV7A 3CU5A 4KWEA 1YIOA 1FBTA 3IQXA 1ZJJA 4RTLA 3GCWA 1N2CB 3OTQA 5H7XA 5L6LB 2XKBA 4RGYA 1SXQA 3AUJB 2BGIA 4O29A 4YC7A 1N7HA 1ZCFA 1T15A 2A14A 1N0IA 1Y3DE 3GROA 1F2TA 3NONA 1QAOA 4R51A 1L5KA 1G64A 2FV8A 3UMGA 4ZEWA 1HQYE 3FN4A 2X1VA 5AI8A 1UCFA 1XQVA 2IYRA 3ENWA 3N2GA 2XQFA 4H7KA 1KS9A 5LZ7A 1WZEA 1KKUA 1EVEA 3V4OA 4F5DA 1Z0UA 1GQYA 4B2IA 1DKQA 1ODCA 2I1WA 3SE0A 2I9PA 3R3VA 4TXMA 4HNAA 3ZHQA 1SPBS 3SICE 3ZH9B 3KPJA 3VO9A 2P30A 2WYWA 4JEUA 4M9QA 3CURA 4OREX 1ZHOA 2JC3A 2JIBA 1NSTA 4DKXA 1GQSA 3EG5A 1V6SA 2HEGA 4IYRA 2G8NA 3MT0A 1SHLA 4P2BA 4CU5A 2VUHB 5IUNC 1FRFS 4Q7KA 2D5IA 3FCOA 2G77B 1ENPA 4D6XA 3ZHXA 3CF4A 3GJ6A 1KSFX 2Q28A 5CFLA 4YVFA 5HKBA 1WP4A 1UDCA 2GPWA 3SFTA 1SQFA 2Q9BA 4MVCA 2Q3CA 5JYCA 4RADA 1WKVA 1KZ9A 2WILA 1AGRA 3KRTA 2YKGA 5CXUA 4ZTUB 2A9QA 3C6KA 4MP8A 4MOWA 1TAHA 1C1DA 4IJUA 2C2KA 2ZBRA 2HHAA 3LYLA 4A73A 1S2DA 1ZP6A 4BU0A 1J23A 5C4IA 4LNHA 4F7DA 5EWLB 3D64A 4U1RA 1C3JA 1OYOA 2O2ZA 5B2ZA 3FUCA 1GRNA 2NPOA 2HNBA 4G5SA 4K05A 4TTIA 5EPOA 5F3DA 1CLEA 4DMLA 1L7VC 2CY0A 5HIMA 2J7KA 1PIWA 4QNMA 5CYOA 1Y6FA 4HAZA 1AXEA 1URPA 3HUUA 3SS9X 3ZWAA 3UY4A 1YUNA 2OBYA 3D8BA 3IIIA 4NCAA 2XZDA 2Y71A 1CFJA 2Q5OA 1D4AA 2RHTA 3C1TA 4MRVA 4BB0A 2IEAA 4C3UA 2LCFA 3PXAA 4AZSA 2DZDA 1M34A 2XMZA 3HN6A 2MU1A 3L3BA 1QNFA 5BR4A 1RLJA 3EUFA 5DCLA 3RAEC 2ZBUA 2HLDA 2R1VA 2DH5A 4E94A 4L4XA 4DYHA 2JAWA 3WP0A 4BC0A 3JAKB 1WLSA 5K8VA 1YXMA 2MT9A 1IZ8A 3EPRA 4MKZA 5EWJB 3R7DA 2OM6A 1L5VA 1ILEA 2XB2A 2AFRA 4FNMA 4PZPA 3RW9A 1BN6A 5TLSA 3EOZA 2OZLA 1QHYA 1PE0A 5ES4B 2WJPA 4OQ4A 2DR2A 1EEHA 3CMCO 3JS5A 4YMLA 2PU5A 1EU1A 2RHGB 4XQEA 3JWJA 2B8WA 4DFDA 1Q3TA 1MD9A 3DAGA 2HWKA 5BRJA 3EGWA 4IUYA 1U0TA 3MCTA 5JXGA 4Y1RB 3FZNA 2FW7A 5CK5A 2G1UA 4WOBA 2GFIA 5M04A 4Y2YA 2AN4A 5IF9A 2K4MA 2C42A 4QLOA 2PE5A 1WSWA 4X7PA 1OZFA 1Q3KA 3GA7A 4MUMA 4GI3A 1TW3A 2WNIA 2X1MA 5BWMA 3H1BA 1DHTA 3RSOA 2AIRA 1U5CA 3CUUA 2D5AA 3LXRA 3EQ7A 4DZZA 3I0ZA 3E9NA 2HWYA 2RAFA 2PLAA 4S35A 1E6KA 3HGQA 4MWEA 1Y1LA 4RKWA 3CUEF 4QG7A 5AVOA 4INPA 3Q1LA 4A6EA 5B4TA 5IK2D 2N46A 5DO9A 2QD4A 2WLSA 3LK7A 4BIMA 2VDLB 4J0QA 2C92A 1N75A 4US1R 2EC5A 2PJUA 4UBKA 2B78A 1S0UA 3TSAA 3MGGA 1COZA 4TWAA 3K1AB 4C14A 2PN1A 3WL7A 3LFTA 3TS1A 1DJNA 1C8VB 4QEDA 4H3VA 2EFGA 2HCTA 1JS1X 1N5LA 3QENA 1CQIB 3P19A 4YUWA 3G13A 2GCOB 2WMOB 4JP8A 3OPMA 4CVNA 2Y77A 2ZZKA 4RKRA 2Y99A 1XFDA 4WL0A 3QPBA 5ALPA 1XI2A 4A0GA 3M83A 2Y66A 4NNJA 2A84A 3TAXA 4R0MA 4LA4A 3ROZA 3RODA 5AOAA 2O19A 1OI3A 1TPZA 2VBFA 3EZYA 1EFLA 1FNMA 4EA6A 4WCFC 1AU9A 2AA3A 1E2DA 2C1EA 2Q0HA 3R3YA 3GP3A 3LHSA 2P6NA 1PFWA 4NJEA 3DOUA 4UOEA 4G1EB 3G8YA 2WY2D 5KI6A 2G1PA 3LIPA 3ND7A 5C35A 3PEYA 2W6JA 3FMVA 1XMOB 4RA6A 3KPUA 1KP2A 5JSZB 4S1OA 3QELB 4NARA 3OP1A 3CGGA 1LC0A 4KGVA 4MGIR 4EGJA 3AHCA 3M33A 3OEYA 1NTOA 2IW1A 5BOVA 4O0MA 2H4ZA 1EDOA 2I3BA 1KFBB 2OHJA 1XEXB 2RH9B 2YXEA 3EGOA 3NIDB 1CFZA 1T8PA 1Y6QA 2PH5A 1T26A 3QU7A 4F46A 1QGUA 3KNZA 4L4YA 4V3CA 4YCSA 3JW8A 4C03A 1OT5A 4MSUA 2NVBA 4QZVA 2ZRHA 3H9CA 3RHSA 1DBVO 2ZT8A 1TE2A 4RWZA 4CCYA 1S5PA 1YZHA 1N1GA 1OLUB 1U0RA 2CVHA 3D02A 4KUEA 1Y9DA 1JHVA 2A0YA 3HH8A 3VU1A 5IJ9B 3QI7A 1KRWA 1ZD3A 3EY9A 2XODA 1BMFD 2CWDA 1Z35A 4NK5A 4QGHA 3LG2A 1LV8A 4FE4A 3M4XA 2WHRA 4WCDA 3CJRA 2JIOA 2ZW9A 3UFXA 2E4ZA 4IF4A 1RWVA 1EP3B 5CHYA 1XWIA 2A1IA 2GD2A 3LUBA 4EPYA 3TAUA 3HM2A 3LCCA 1K5GA 2ZE7A 4Y9RA 2J9GA 5E8RA 4BYGA 4QKQA 1JALA 3GBPA 5B2EA 1RJFA 3DP7A 3RVQA 1XZIA 4B47A 2C4MA 3RG8A 3WOHA 621PA 1W5TA 4CR8A 1JLSA 1ZJ5A 1Z25A 1YKFA 3WL5A 3KJFA 2ONKA 3BH7A 2EATA 3LPLA 3QXCA 5IWCA 5JRZA 4FZ3A 2Z95A 1JFRA 4Y2RA 3FYTA 3O4HA 3RWOA 1JKJA 2I7XA 5G41A 5GVRA 5JADA 2X4IA 1PYDA 1SK8A 5K20A 1E2QA 1ZI9A 2G5GX 3STVA 3BWBA 5KNCH 1SZDA 3MJHA 4CG3A 1DGQA 2ZIAA 3OE1A 3TNJA 1LI5A 1C80A 1P2DA 2KI5A 3O9MA 4FDAA 1TC1A 1P1FA 3LGAA 3UJPA 3YASA 1QV7A 3ZQKA 1E58A 2HU2A 2GKSA 1EFCA 4KIUA 2BY4A 1RHMA 4B4DA 4ZYYA 3P2EA 1SOMA 6CHYA 3BX1A 4KQGA 4BO3A 1C2TA 3A9WA 4IDBA 4ZKEA 3WWDA 4ZICA 4JMPA 4UOQA 4B83A 4NBUA 4OSPA 4QARA 1J07A 4Q4JB 2Q0XA 3GUVA 1XPOA 4E32A 4PONA 2AEJA 2EFDB 2BGKA 3DCIA 2JGRA 3D8HA 2C59A 4WVFA 4AZTA 4BNNA 1JZTA 3KTOA 1G9TA 3L77A 4QJBA 5IC4A 4ZVSA 4P22A 4HFRA 2XLCA 4FXPA 3OQIA 5LBUA 4N8EA 3UO8B 1IY9A 1UM9A 3KYDB 4F3NA 4DMMA 4X84A 3KWJA 3BEOA 4XEUA 4CFSA 1A7KA 1UWLA 4GICA 3V8MA 1PFYA 1UJMA 3WGGA 1WMBA 2WINI 3LQQA 1T2FA 3E9CA 3WJ2A 4YUVA 1VJGA 2H1WA 3VZDA 4CBVA 4DGQA 2GBPA 1HDIA 1YASA 4HZGA 4ACBA 2BGLA 2AYZA 3RYHB 4DQUA 1CP2A 3MRTA 2A1TS 1D2RA 3ZGXA 2QY6A 4LJAA 1A4RA 1E98A 5KQLA 1KAEA 3HEMA 4NNOA 1ATIA 1T2VA 2V98A 4GOND 4XD7A 2XUHA 3BHJA 3D4NA 2WNHA 3DMPA 3L92A 3MUNA 3OZEA 3R8CA 4ALLA 5KSWB 3LY7A 3NO4A 2Z56A 4HDSB 5CEFA 2H2AA 1DAFA 3NGXA 2F2TA 3CZMA 4BNTA 4EO4A 1Z38A 1VLLA 2GZSA 3ZDCA 2YFYA 1IDOA 5AKGA 3WL6A 2ZT6A 1PQWA 3AR8A 4TS3A 5FBHA 3URKA 5KNCA 1UIRA 4U3JB 1JL3A 2QMQA 1TPYA 2JD1A 2R0QC 4H7HA 5HOEA 1SOAA 4FZ5A 5LUAA 2C7VA 1ISIA 3SYMA 3TINA 1LPOA 1AKMA 1OWLA 2QX6A 3DHVA 3E53A 1ODKA 3R4CA 1WXIA 2BZ0A 3GDHA 4KMSA 2O1EA 5J5CA 4C0HA 1IE3A 1K6IA 3O8LA 5IAAA 3FBWA 4NBNA 2Q4RA 1PKEA 4LPKA 4HWSA 1E1LA 1QYCA 2JJ8A 4CN9A 4XYGA 3OZWA 2J9ZB 4CM3A 2Y4NA 2JIZA 1Y42X 2PO5A 3DHNA 1A8HA 4RDXA 4C0BA 1FVOA 2DFLA 3JD4A 1Q1QA 3GFVA 5F35A 4X60A 1LQTA 2EP5A 1RYFA 4G01B 1YVPA 4JC0A 1BCRA 1BJTA 5JE8A 1NY5A 1ZD9A 1U8XX 3L7YA 2FPGA 5AVZA 2GAOA 4Q4CA 3M81A 1D2EA 3ZTYA 3OJCA 2FUEA 1SC1A 4G36A 2OO5C 1EK6A 2G8LA 4MTCA 4DA4A 1RWXA 2FWBA 3D8RA 1HY3A 1DBIA 2G28A 2WIBA 5FOSA 1TVCA 3U7GA 1W4CA 5JAZA 2G1KA 1C81A 2HJ9A 1ZWKA 1KXJA 2NU9A 1LY1A 1XE3A 2PD4A 4K28A 2WC1A 1DEOA 1OW3B 1E3JA 4ZD6A 2J0UB 5DTEA 4G6ZA 1XMJA 4G0QA 4W5WA 3T3EA 3WIUA 3K6KA 1DRJA 2V7PA 3MGAA 4IKEA 4CT5A 2HK7A 3W5AA 5DBEX 4DLZA 5A0TA 3I8OA 2PX2A 3IEIA 1U31A 3EARA 4TWRA 5K3OA 2G9QA 3D6AA 5ALFA 2G5TA 4INZA 2WP0A 4ZYWA 2C9BA 3SC4A 2H08A 5I9TA 3SOPA 3WKEA 3FPAA 3CX3A 4P32A 2E82A 2G83A 3JQFA 3X44A 2YMPA 2YV3A 3F4KA 1LTKA 3ADDA 2FPKA 1NF9A 2W2VA 2A86A 1N1DA 2X2FA 3WK4A 4R71A 3N59A 3LCVB 4YPOA 1U0FA 2QR2A 2BONA 3GJ0A 2VF5X 4KVAA 7ADHA 1AJEA 4G5XA 5TQ2A 2R4UA 4DWVA 1EWVA 4Q19A 3UC5A 3WGNA 3SKVA 2JLZA 3BRQA 1U7TA 5KHLB 3WAKA 5FEUA 3E8XA 1JAIA 2Z2IA 4LZWA 4R54A 5GVSA 3UJDA 4AD8A 2WKRA 3VOSA 1GKLA 3CH7A 3QNUA 1L3BA 2OFFA 4ZAZA 1I3CA 3C8ZA 4PLPA 1CUAA 1XKTA 4YGYA 2JJ1D 2GEBA 2LE0A 5CBKA 1QV9A 1KOGA 3UT0A 1QGAA 3VO2A 4RFLA 1ACLA 4DILA 2B5WA 4UZSA 4JD5A 1ODSA 4LE1A 3V1TC 1NN5A 2CNLA 3EWSA 1CJBA 5DHRA 1GILA 4FWTA 1KR2A 2XBMA 4QRDA 1DUSA 2H18A 2AOTA 4NZMA 5JYEA 1XLWA 4BJ5A 1GPBA 4JLUA 4B4WA 4KLRA 1QQTA 1X87A 4P84A 4FEAA 2AN9A 1DAKA 1EQUA 2VRWA 4R1UA 3SXPA 3G2QA 4ZAYA 3M6WA 2L82A 1QE0A 2ODTX 2P6OA 5DM70 4DJ5X 1DCFA 3KXKA 3DV0A 2F59A 3H1GA 4GSYA 4IIJB 1TL7C 4X94A 3QIVA 3DMRA 1TVKB 2P0AA 1OAOC 3MK31 1UINA 2R84A 2WD7A 2X0EA 5FNVF 1O57A 3RUAA 4Q7QA 1BVYF 3RJTA 2WZCA 3KAPA 3DBVO 4MVWA 1YRLA 1T0BA 2HXGA 2YV1A 1ECLA 3AJ8A 3NNNA 3MLEA 3WIOA 5FA5A 2OBXA 3VUFA 4DSAA 3UIEA 5YASA 1L5HB 1EXWA 1E2GA 2FX2A 4MDYA 1HETA 1V4BA 2H06A 4R40A 5IPFA 3AQIA 3AYXB 2FU5C 4ZZ0A 2VPXA 3QIAA 4EF5A 5LUBA 2OCKA 1OYYA 1XVLA 4CNBA 1OFVA 1V7CA 2IYZA 2WWIA 2YY5A 4L08A 3OZFA 1NYTA 4KYTA 1GPYA 2CUTA 4DM3A 1FLVA 3GGJA 5HMLA 3VVMA 3VJMA 2CLMB 4B3XA 3EK2A 5CB4B 2BFOA 4J0FA 3QLTA 3ZGLA 4O5OA 2J0EA 3ECCA 3V4ZA 4N4AA 3RUIA 1UC9A 2BKUA 1J97A 3IQIX 2WM2A 5E9WA 3U80A 1EVZA 2O2IA 3H97A 5DH9A 2B30A 4Z4EA 5BV0A 1T2NA 4M9RA 3N3AC 2AYXA 1LWNA 1S3SA 4HGOA 3SIXA 1MABA 1BD4A 4EHHA 2IEIA 3QRWA 1NKTA 4ZOLB 4DZRA 5NLLA 3P2OA 3M1AA 3S2EA 3NAZA 4BWVA 1YR6A 5T7BA 1VE7A 4ZGWA 3DNMA 2CJPA 5EGNA 1JEYA 2W6NA 3A04A 2C4UA 4DYDA 1PDWA 2QLBA 2NSJA 3BWDD 3TQFA 3RC7A 3FPCA 5ITWA