1T3ZA

Formyl-coa tranferase mutant asp169 to ser
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
b'TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGSSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyl-coenzyme A transferase
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 145
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1t3zA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1t3zA01
2GD0A 1VGRA 1T4CB 1X74A 2YIMA 4ED9A 2GD6A 2GCEA 2VJMA 1P5HA 1Q7EA 1XA3A 1XK7A 2VJPA 1XK6A 2G04A 2VJOA 1PT8A 1T4CA 1XA4A 1Q6YA 2VJKA 2VJNA 1PT7A 1XVUA 2GD2A 2VJQA 1XVTA 3UBMA 2VJLA 1T3ZA 1P5RA 2VJMB 1XVVA 1PQYA 1PT5A 4HL6A 2GCIA 1VGQA
chains in the Genus database with same CATH superfamily
4QQRA 2X22A 2UVPB 3RYFB 5TJ9A 3NKLA 3QKWA 2UZIR 3R3WA 3CM0A 2HDNB 1H0HA 2CLSA 3EZ2A 4HGRA 5F3WB 1JHYA 1WDMA 3WMRA 3R3SA 4RJ2A 5AJUA 4KPGA 4OM8A 1A71A 1R0ZA 3KQUA 1GHTA 1U2EA 1TU0A 1Z6YA 3GUYA 1WLSA 3TCNA 2AR7A 2WRZA 3LHDA 2PSFA 4DG9A 3FPJA 3I2HA 3SHOA 5LKAA 1SZJG 2O06A 2P78A 5BY2A 1KEKA 5I51A 1GGKA 3V8PA 3SZLA 1PU2A 1R0CA 3DFUA 1SO8A 1U81A 1ZK0A 3KLBA 4ZT5A 4EO7A 1UBSB 1M8GA 1VKHA 1XVLA 5JARA 2A1TS 4TS3A 1QTNA 1U0SY 3ND9A 2I4TA 3ADCA 3S4YA 1MX5A 3AUJB 2B7CA 1CJMA 1MO6A 3K1AA 4UMDA 5ER9A 3R5SA 1VBNA 5JO9A 4DCGA 4FT4A 3ZE9A 1R0LA 2HC9A 5KSOA 5DGXA 4A0FA 5EHGA 3OQIB 4F86A 3K9QO 2G07A 2WJWA 3FTQA 5AH0A 3U3KA 3FLBA 1WJGA 3JALA 4B3DA 1U9ZA 4QVIA 2O2JA 1AN0A 2UZ1A 2XDYA 3HKEA 4RKFA 3NWEA 4PGAA 1PR3A 2ZYTX 4R2XA 1LJLA 4RKQA 3BA1A 4BEVA 3BMQB 1GG9A 5HKLA 3A9RA 3NHUA 3D6MA 3F71A 4C08A 3KZVA 3QV2A 4U7PB 1U0GA 1JBEA 1F3OA 4IV5A 4C0JA 4GPZA 3UCFA 1Z26A 2EGUA 2AMVA 5JFGA 4H3VA 2WLTA 1F4LA 3QEJA 4MVYA 3TEFA 5C8ZA 1B76A 2OZLB 1E59A 5CDUA 2JLUA 5FNVB 3QV1A 2CSUA 2FX3A 3K7EA 4IIUA 1C9MA 2O6LA 4QU5A 1SUWA 2JAHA 3SF8A 3T41A 1S3IA 1GTVA 2BL4A 1NQVA 3CEPB 2VSQA 2C9OA 2IXAA 2Y1OA 4HN2A 3BORA 4K86A 4PS1A 1FLDA 2W6ZA 1ESDA 2XMBA 4IMIB 3G8DA 4HXEB 4LPKA 1XFAA 1V2GA 4YJGB 5AW6A 5K0SA 4YB8A 3DMNA 2DBRA 3FWNA 4I1YA 4ESVA 4N7BA 1P2VA 5GM1A 3NOOA 2QS9A 2MDTA 4TT3D 5JAHA 1OTYA 4XVHA 1U7ZA 1SEPA 4RZQA 4EEXA 1RQLA 2EZ4A 3OPVA 4B3BA 1VL2A 1ABFA 5KUTA 1SG0A 4L5CA 2OCBA 3D5TA 1Q0UA 3BB4A 3B6JA 3NOQA 4JXKA 5K8CA 4YV0A 3IS3A 3TMYA 2F9FA 3TQTA 2AUNA 5AM5A 5JSUA 2OMEA 3ZCUA 1COWA 1WZCA 1SVIA 1Z6AA 3I9OA 3VGPA 4BNDB 4EG1A 5J4VA 2ZSUA 5G0UA 2QUAA 4A0HA 3GUCA 1QPGA 3HEAA 1G5PA 2NGRA 2NO7A 3NLLA 3OHSX 5T4EA 2ACWA 1NU6A 3ADOA 1JHOA 3IDSA 4GS5A 2Y68A 3EXIA 1AV6A 1ZNZA 3H99A 3DAPA 3SYLA 3EF0A 1JAHA 3P9QA 4M6WA 4DUZB 3MA0A 2A5JA 1X70A 5CEFA 4DV6B 4QM7A 4ZTBA 5FCDA 3C3XA 2IHZA 9LDTA 1ISJA 5DN9A 1G5IA 2ZJ0A 4TYNA 4PNEA 2I6TA 2DQZA 3LLSA 3UPDA 3OFJA 2VNAA 4QGGA 3PTLA 3ACDA 4HMQA 2PGAA 1YCDA 2YXNA 7REQA 3H42B 4K26A 4OREX 1ZBDA 2Q6LA 5I45A 2YN4A 1A95A 5JCZA 3H11A 4B6QA 5DLYA 1PFKA 1X7ZB 3TBHA 2G88A 4EVRA 3DYVA 3WK8A 5CFZA 1LPMA 4D02A 1P60A 3CR7A 3RADC 4Q9KA 1GTMA 4BNUA 1C4OA 3GG9A 1P1KA 4ITVA 4JXJA 5FFMA 1P2TA 4FKZA 4LJKA 4R1QA 5HR5A 3AR3A 1SA0B 1FFXA 3BXHA 4PW0A 3SY8A 4GXNA 3DVQX 4TSFD 4TQUS 1QQTA 4KK3A 2Y66A 2VBGA 1DVRA 2VDQB 3K71B 2FRXA 4WTOA 5EI5A 3W4IA 3RSOA 3UH0A 3ABIA 1PR2A 3IPLA 2FMIA 1JSZA 4ZEXA 3ZY2A 1DRUA 2PWPA 3RFCA 2P1DA 2BI7A 3I6YA 4ME6A 5EJ2A 3FMOB 1XCJA 5E95A 5KDLA 2ODEA 5JD4A 5FOUA 3KV3O 4CQMA 4XX0B 5BOSA 1V26A 1RWPA 1E1RD 2DPYA 2IDMA 3HUEA 1GADO 3PJRA 1BA2A 8GPBA 1H9AA 2A0KA 3LKDA 1NBMA 5CBPA 1E1DA 3N39C 1C1DB 2Q29A 1OYOA 2GASA 2AOUB 3DM9B 2FPGA 3IR6A 2WWHA 4W7IA 2V1XA 2VHWA 1U4NA 4G5OA 3GMDA 3CUWA 1WMFA 3DE2X 2QWXA 3QM1A 2QR3A 4LJRA 4UDYX 2DY1A 4EECA 3GMSA 4JH0A 5CX1B 2WF5A 3HDGA 4YUAA 2PXCA 1QK4A 2JGDA 1ZK2A 3D0RA 4KQ6A 4TLLB 4BLUA 1N0UA 1IHYA 3BHIA 2FFRA 4EJ6A 2V54A 3C3DA 3R41A 1O58A 3RUDA 2IPMA 4U7HA 4DCUA 1UAGA 2J0EA 2GO7A 1GPNA 1W6UA 4MIKA 2WBLC 3BZUA 4GLJA 4GPIB 5AP9A 3TIXB 3VOBA 3I37X 4OHVA 3ZJUA 5DX8A 2Q3FA 3K0CC 1BOOA 4E3WA 5L4NA 5K3OA 1IHUA 4GPBA 4NFYA 3HN2A 4NPHA 2ZJ6A 4DARA 1SWVA 4CTNA 1BX0A 3RVJA 4CV1A 3U17A 4O3MA 4P54A 3EXFB 2OCLA 3URMA 2P7HA 1OJ7A 4N5HX 4MV5A 1V47A 5KBYA 1QHHA 3E3MA 5GY7A 4XGQA 1OXSC 4ZDWA 4HS4A 3TMKA 3G7UA 1PR6A 3PLAE 2Y1GA 4UVEA 1L5WA 3R3JA 2TMDA 2QRGA 3FSGD 3Q6IA 1K7SN 2GOYA 3DVRX 3VSDA 5E1DA 4C4XA 1ZBQA 5KTKA 3IKJA 1ZN8A 4E4RA 3EZYA 3KAKA 2WJ3A 2Q41A 4DM7A 1WV0A 2N1MA 3TAHA 4ZOAA 5DN6D 1E6EA 1ZMRA 1EBBA 3ACCA 5ALQA 1P9OA 2WU1A 4F5YA 3D0KA 3ROTA 3GT4A 5KNDH 3EPRA 4Z1MD 4YJFA 1X7HA 4IJ5A 2H07A 3Q15C 3DE1X 5U1PA 4P0QB 2O8BB 1NATA 2J6IA 3UUFA 3E22A 4CV3A 5D5QA 1BKDR 3AP1A 3Q8WA 5F77A 1OWPA 2HIMA 4FYXA 4M1QA 1W0JD 3MOSA 4IDGA 4UXHA 1RQ2A 3QITA 5JC8A 4YRQA 3CV3A 2AYYA 2RHCA 2C4VA 2WMOB 3LGAA 3OC6A 1CUBA 4XM0A 4CHTA 4G41A 1Q0PA 3OCZA 1YR8A 3NM4A 5EJAA 5AKYA 1RFGE 4KQEA 4OB6A 2V7WA 4HX2A 4DNXA 4EP1A 4AZVA 2VP5A 1SHUX 3DVLA 5EINA 3OFKA 1TPZA 2WPNA 5KNCD 4FFPA 2QP3A 2QN1A 2H2AA 5AKJA 3VPGA 2CL0X 2CJWB 3QVKA 4XX1A 3AUUA 3UVEA 2PR2A 5AUNB 1BX3A 5BN4B 1V8OA 1I2MA 3KAPA 3OZTA 5HQ3B 4ZREA 3ZV7A 2Q1SA 4NFHA 3TD9A 3T1HB 1JJIA 1KA9H 3KCQA 4EVQA 5CCBA 3EXG2 3D6NB 4FOPA 2C94A 4NNPA 5F1KA 3M6VA 2NUTA 3I9NA 2E49A 4G8DA 3L1VA 3AF6A 4I50B 3RDPA 2JJ2A 2XMGA 4L6AA 4DMKA 5FUBA 5A9SB 3C8ZA 3WIVA 3QFHA 4FWTA 5HQTA 3JWGA 3CIOA 3E7WA 5AVYA 3C6MA 4OI0A 1DNPA 1QYWA 5B1HA 1VP3A 2W90A 3U4HA 5FPHA 4DCSA 4URHA 3BJIC 3RIMA 5B53A 1EGMB 3HDYA 3AVPA 3QNWA 4O4IF 1GARA 2COEA 2F2TA 1W46A 1GUAA 4AJ4A 1QYXA 2O5CA 4WHMA 4BV3A 3ZIDA 2PMWB 3GPIA 4MINA 1CYDA 2Y77A 4I36A 2OBMA 4F9EA 2AFIA 4G0ZA 4GLLA 4UNSA 4OLBA 1YE3A 3I39X 5I8ZA 1GPYA 4CT0A 2PGLA 1SUDA 1OXXK 3LQYA 1WXXA 2P9JA 4NE7A 3X2FA 3K3PA 2EVWX 4CN8A 4OXNA 2WP0A 4WOBA 4IAOA 5DOVA 2NXNA 5F23A 4WN3A 1CB7A 1QJ4A 2AOTA 4R8LA 2A86A 1CQJB 3AFHA 1UFRA 4MWDA 1U2DC 2C8KA 3UA4A 4C0SA 4GUAA 2VA8A 1GV0A 1F0KA 5CFPA 1TW2A 1ZNXA 2L2QA 1LFAA 4XSGA 3GJRA 4DM3A 3J7AC 5ANRB 4ZTUB 1BAPA 4BLWA 1ZR4A 3IEVA 2GN9A 1RI4A 1E8DA 4QXOA 3QU5A 5C8YA 5G1PA 3RVDA 2CT8A 3RD5A 4MJXA 4E1VA 3GRZA 1XAIA 3ROQA 4LI0A 4TYYA 1L5FA 3WKCA 3B20A 1NX6A 4GVLA 3KKLA 1L6RA 1ZWKA 4WUVA 3CUYA 4IS3A 5KYYB 1Y6GA 1Q15A 1A76A 1TA4A 4US0R 2BMJA 1N7JA 1GO2A 3BCSA 5L3QA 4FI3C 2PJRA 1AUXA 3V7YA 3U7FB 3DHVA 4HSEA 3QNUA 3HA7A 1V8FA 2RC6A 1A7JA 4W6QA 4C22A 4BUCA 1NJSA 2PSDA 2PEYA 4TKVA 1NVWQ 3IXMA 3EW9A 1SBNE 2QUIA 2BONA 3G1UA 3G9UA 4CKCA 2SECE 5G4KB 1CUWA 1JHXA 4PGFA 3ZV5A 4J90A 2E87A 3VNQA 1QONA 5G0TA 4QO8A 4BJ6A 4DMGA 3GGGA 1L4LA 2NN3C 2V5AA 2YWHA 4I9FA 3RSSA 4JROA 3TLGB 2A1UB 2H2WA 3NTOA 4PPNA 1WABA 3AK4A 5COAA 4QWMA 5BN1A 4LSWA 3L8GA 4AG5A 3M5DA 4JXXA 2ACVA 2IU6A 5FYQA 5EJGA 1ZKMA 3NTXA 1T2FA 2EFCB 5I7AA 3AUXA 3W8EA 4V0QA 3A1SA 4CXMA 5JJKA 4NDAA 3AFNA 3HHEA 4B2PA 4JKYA 2B1QA 1RXSA 2PNFA 1NW8A 4HJXA 3OPYB 3CLTD 5HILA 5B37A 2PQ2A 4KWEA 3IAXA 1ENYA 4NNJA 3WLQA 4J0IA 1ZCBA 4OU5A 4U7JA 1JSLA 4YBRA 5DOZA 5IBQA 5JSHA 1L0BA 1WW3A 3G2HA 4YCNA 5HJ2A 5JSKA 1HT3A 5CFQA 3HADA 3EWSA 3INYA 3HL4A 3PKZA 4LZLA 4TL8A 2BKAA 1P18A 1LBHA 1NJ8A 2B2NA 5EXSA 1M76A 4BJHB 1JR6A 2B4YA 4UW9A 4XR4A 2RONA 1ML4A 5REQB 3FVWA 5TARA 1MLDA 3RB8A 1NC1A 2VPXA 4MUXA 4QUIA 2VPPA 3PFIA 2FWPA 2YBDA 3NJ4A 5IK2D 5DGCA 3P8ZA 2YWEA 4K6OA 2GKOA 4NBLA 5IANA 4YJHB 4K28A 3IP7A 1NI4A 2Q3BA 2YDYA 3JYNA 2CV2A 3E1KA 3KL2A 1U8EA 2VSFA 4RZSA 5DB4A 1H2FA 3VI4B 1A8PA 1W49A 2O0JA 1I5RA 3W8DA 2BV3A 3M6FA 2IH2A 3H2ZA 4GWKA 4BBPA 2BWJA 3N8KA 3OIVA 4II3A 1A9SA 3MG9A 4UHHA 5F1OA 1OZFA 1WDLA 2ZWOA 3U9SA 4AQDA 4GP6A 1RHRA 2FUCA 3BD7A 4GSKA 4MW6A 4RD4A 1UBLS 1K27A 3PGXA 4IWYA 4Q3EA 4NNOA 2ZQZA 3DQQA 1COZA 3F97A 3U7IA 1NXPA 1PJSA 4P3KA 4YXWD 4UD6A 2FPRA 4FYVA 2H1SA 4H3KB 5F2EA 1KDPA 2VF8A 1T8UA 2H52A 2HRQA 2I2BA 1NPYA 2DTEA 3NIGB 4LXUA 1U8YA 4V3BA 4X1OA 2I66A 5FLYA 1XB2A 5KOYA 3LFUA 3UOGA 4JLMA 1EAMA 3FW1A 4IX1A 1FTWA 4X84A 5DBHX 3X2SA 4H6WA 1MC4A 2XADA 2X7JA 3AFGA 3JQ8A 3K8ZA 2ZUDA 2BTOA 5HF5A 1QP8A 3VOSA 1N2SA 1JIIA 3JD4A 2V4UA 2ZJOA 3WRVA 1E2LA 1RRPA 2GBLA 4M54A 1VHDA 2LZ0A 3IQWA 3PBKA 3O75A 1DPGA 5LUAA 2FFAA 4KV9A 5C8VA 4X3PA 1MF7A 3N87A 3SSMA 2JHCA 4YTEA 2QJTA 4DDMA 3UHAA 1JR4A 5FPTA 2D1RA 3A4YA 5KTTA 1UKBA 2BFMA 1V5WA 3OJFA 3UHFA 2Q99A 5K1ZA 5CPFA 3WWPA 9ATCA 4QUHA 2G1UA 3BQNB 4XVCA 2Y1WA 3A37A 3KOUA 3A7DA 2C7RA 4LECA 4TTVA 1YZLA 4I4TA 3U9TA 1YNSA 2XUKA 4I8DA 4KVZA 3FH0A 5JJBA 1P3DA 1WOMA 4YALA 5L6MB 1FLAA 2HPZA 2YZNA 5J2UB 3LY9A 4UNNA 4B3GA 1EDBA 4P3OA 3FVVA 5I5GA 2YVAA 1RXVA 1HRDA 1XD2A 1KNXA 3RS8A 2I3AA 2OLKA 2BC9A 4REOA 4WESA 1Q1NA 5KVQA 3EUEA 2QD4A 4R69A 1UMDB 2A9JA 1AURA 1S2GA 5K03A 1GZHB 3NH6A 3X1MA 4EUSA 4CKEA 5C1PA 2OM6A 3R5FA 2PUVA 1DG9A 3RQSA 1REQA 1HDIA 1DEKA 1HQDA 2R1VB 2XWSA 4J0DA 4P0TA 4X92A 2D0DA 5FHRA 4FFMA 3G2NA 2K87A 3FJYA 1FDOA 4HN9A 4ZVSA 3ZXXA 1SZCA 2O05A 1QYIA 3QQ5A 2XT9A 3TYXA 4HC4A 2QW1A 4GO1A 3A4MA 3R4VA 3LX5A 4NYJQ 4AROA 5LNK6 2AC2A 3I0ZA 2MSEB 1ZOPA 3PC4A 1L5MA 3FKSA 5LBUA 2VDUE 4JHXA 1XK7A 2ADOA 4Z4IA 3KE9A 1Y9EA 3IILA 2GCNA 2GVNA 2HWXA 2PZGA 2VL7A 3JAMA 1NYQA 1XI2A 5KYKA 2B83A 1QFJA 4XGNA 3IUQA 3MSCA 1Q3TA 2YS6A 3B13B 1LSUA 3E5HA 3QENA 2B3TA 4UATA 2VJNA 2Z58A 3HBMA 4P7GA 4X61A 4YRGA 3E7FA 3F78A 1JQLB 1P4AA 3DZKA 1FRZA 4HGQA 4CMEC 3RT7A 2TMYA 2JLRA 3DFKA 2GM5A 2JAXA 4G85A 4IFIA 1XD8A 2HUNA 4QBGB 4UMVA 4MNTA 3UV6A 4BKQA 2B1GA 2PM8A 2WG0A 4WERA 2X86A 4B40A 5D5PA 4NY1A 1FFYA 2A0FA 1OIVA 4ARZA 3AL0C 1GXSB 3UB4A 3VKVA 3NHFA 2NUPA 1YQUA 2O0LA 4FOSA 4ECAA 1U8ZA 2HA3A 3IAM6 1W94A 2Q5HA 5I7WA 3N0RA 3FBTA 4P4TA 4H16A 1CWUA 3IBGA 821PA 1IHXA 1Z0KA 1JQAA 5IDWA 3RC3A 1CRLA 5M7EA 4TWIA 4JP8A 2A9KA 1E0SA 1W19A 3B1VA 3N7AA 1YQWA 4W8OA 4XA8A 5E9QA 1F8YA 3CWZA 3OJEA 5ER6A 4FYJA 3HSSA 1YK0A 5L51A 2C4WA 5B6PA 3OEHA 4QYTA 3GOHA 5T6BA 1J7KA 1LPNA 2LVBA 1B0AA 2XUFA 1CRQA 1P7YA 1WMBA 1MBZA 1EINA 2OCIA 3SYMA 1TTPB 2B36A 3HUUA 4U0KA 3SD7A 1V45E 4UQPA 1QQBA 1YL7A 5K5EA 5DM0A 5J3JA 3MVEA 2QYHA 3TOZA 4CCWA 2G0AA 1TRHA 2J87A 1EWTA 1HQKA 3B3QA 5CDYA 2FSIA 2R8XA 2WTBA 3B6EA 3C15C 4OXQA 4XUCA 3BD8A 1XJWA 3H2IA 5AHWA 2GEUA 5JYBA 4HUTA 2XA9A 4AMZA 1KAHA 2JIQA 2ZB8A 3GFRA 3TOCA 6REQB 4QDKA 1RHJA 2R6JA 3IHKA 1C2TA 1S2IA 5GQSA 2NOAA 2HGSA 3KOXA 2W2PA 5FNVF 3TW6A 4LNAA 4UHFA 2D7JA 2W83A 3ABSB 1CUVA 4D9BA 1XIVA 2IK8A 3EMDA 3E48A 4EF6A 3OX3A 3DEYX 4XJVA 4B3MB 5CURA 1DIBA 2VDVE 2IA5A 3QX3A 4A91A 2VJLA 1QIKA 4RF5A 3ZE2B 3SYNA 1QGZA 2MR6A 4GDFA 1ORRA 2XE4A 5ICFA 3KSRA 1A77A 1FB5A 4IIJA 3CXUA 1D09A 4WOCA 3USCS 1IPFA 2DT5A 3T7IA 4O4LA 1UPBA 2WFZA 1QO0D 1VRCA 2VRWA 4A03A 4AMBA 1T5BA 2ENUA 3D6HA 3HU2A 1O97C 1XPUA 2VRBA 4ISCA 3PEWA 1RWVA 2VJAA 4A4DA 3ZWWA 1YA8A 3JQBA 3ZS9A 4I08A 4RUKA 3JS5A 5KJCA 2XVZA 3RG8A 1CUYA 2GAJA 3KQOA 3KXIA 4PIPA 3RANA 4MP6A 3VO2A 5KWVA 1VFPA 4L22A 2ERCA 3U37A 3VBCA 4F6CA 5KYYA 3G8BA 4Y9UA 5JRJA 1B4DA 4X1KB 1GRRA 4P38A 3NIWA 4ARCA 4C07A 2HWKA 3KHKA 1EFCA 3NKVA 2J9FB 1KZYC 4OGKA 3AR7A 3NRCA 3EZFA 3UIEA 1SD5A 2E3JA 2Y0EA 5FR1A 4BUZA 3RC9A 1VKNA 1H05A 5KINB 3IL2A 1SVSA 5JS2A 4CLOA 5ECDA 2QLFA 2G36A 4FYPA 1GLVA 2XJ9A 4ZANA 3WGMA 1J6UA 1G3UA 3OCCA 4FHZA 2UUBB 4PLPA 1XV5A 3Q7SA 5HCIA 1M6EX 1VXOA 4NU8X 4UREA 5JEEA 2MYTA 1HK7A 3KYDA 2ZI6A 3OLQA 2ZR9A 1HFEL 2CFOA 2J4DA 5JH7B 1TYEB 1KJYA 3FPGA 3PJEA 1IOLA 2FPWA 3ELUA 3M4JA 3L1JA 1CX9B 1P74A 2C58A 1KI1A 3A36A 4RIGA 3AY7A 4X90A 3BCUA 1TZBA 2RHJA 1B23P 2RJOA 3C45A 1FP4B 3OIUA 1Q17A 3NXSA 1TM3E 3OCXA 2BGRA 4N3BA 3ZHBA 2CMFA 2NVBA 2GYWA 5JAZA 4TOIA 3AI3A 4MGZR 3SIXA 5ICEA 1ODIA 2POQX 3OQ6A 5FA6A 5FPPA 3B2EA 4P83A 3B51X 1G2OA 4HNTA 3TSZA 1TD1A 2GZRA 2JAOA 4CYMA 2VDWA 4C0LA 1GZ5A 1HH4A 4MQMA 4B47A 4PG5A 3RC7A 3BK7A 3PWTA 4LWQA 2XWQA 4LF9B 1G0NA 4HXFB 5IPFA 1E60A 1T1RA 2QJWA 4CM8B 2GZSA 3I76A 1KZGB 1D2RA 3NFRA 5EFZA 5JMPA 4ZVMA 1TQ2A 2QTZA 3IA7A 4L4ZA 4C6HA 4TKLA 3ERCA 2JI4A 3JAKB 4KX3A 2I6SA 1NLYA 2X8JB 4PG7A 3RTGA 2VWPA 3TECE 3NM6B 4TSRA 1ZX1A 3VR4H 2CNKA 2FW9A 4MHTA 2JFFA 2G6BA 4FW9A 4YCCA 2ACEA 3ETDA 1E1QA 5CA1A 1MNAA 2H59A 1XTBA 3LUDA 3QWHA 1ES9A 3S99A 4U8GA 5I9SA 4OHRA 5AVSA 1W85B 1XTVA 2BEUB 1BGWA 1EWYA 2X0EA 3V6LA 1EVYA 1O6CA 3HCRA 4I81A 1D2GA 1OX4A 2GJAA 3TVTA 2WNIA 1LV8A 1R4MB 2A14A 1XEXB 2QR2A 1XTPA 2VHEA 4NYIQ 3QWBA 4R98A 1I9GA 5E4TA 1BE8A 1U63A 5BPFA 2FSFA 4BP1A 1B0ZA 2A57A 3CSUA 3M5WA 3OC0A 4KQIA 5K6TA 4PLCA 3D3WB 1TFRA 5J5CA 2GPBA 4G5GA 1BE6A 3LFHA 4LOJA 1V11B 4RHTA 4Y2UA 2G7ZA 1TCUA 4WLEA 3VHXA 2YWFA 2IYRA 3QKUA 3DHNA 1FYVA 1U1FA 4H3SA 3ZCRA 5KTSA 3U1BA 5I47A 1LBTA 2HREA 2C82A 4IUDS 1UT5A 3FMIA 4QJ3A 2YNMA 1RM3A 5JD3A 1FUYB 3K0AA 3ZE0B 5KSYA 3OT4A 4C5BA 3LPAA 1MXFA 2V7TA 5GONB 3MIIA 5C9ZA 4EG6A 1HYBA 3NOVA 2Q2NA 4GKAA 2B8NA 5KYTA 4R2KA 3FFBA 2HJ9A 1QCYA 3CZCA 4ENQA 2EKBA 2Y05A 4P3XA 2BGJA 4Y1GA 2JIZA 4ZI7B 1PQPA 4JA0A 2ZAIA 3LLCA 3OAAA 5K3DA 3QKTA 1UBNA 2Q3CA 2C5LA 3QLUC 4IBOA 4L9SA 1A5ZA 3TIVA 2XCOA 1K7CA 1IHOA 2HTEA 1HTTA 2EWMA 1XZBA 2P9ZA 2LNDA 2V4MA 2OESA 2FWJA 2WEKA 3AU9A 3P0IA 4PYRA 4Q5IA 5C32A 2IODA 2WPDD 3RAGA 2X0NA 2P27A 2ZIXB 3F5FA 4RD1A 5EMMA 1HT0A 3E9RA 4DXAA 1ZK1A 3U62A 2ATIA 2E85A 2XODA 2AW3A 2J6BA 3LVQE 1HDZA 2P90A 4RVUA 4TL6A 1SHLA 3UV3A 1QGYA 4LCEA 1EJ2A 5EESA 4KVAA 4AJKA 4UAVA 5IBRA 4DE5A 3FOEC 3MRTA 3EFBA 4L1KA 1C7FA 1X19A 4XIGS 4EQ6B 1NASA 4H18A 5BYAA 3PEYA 5K8LA 3F67A 1T3HA 3QG1A 5F3DA 3G17A 1Q0RA 1QYVA 3C7TA 3H86A 1OROA 2FEMA 2FPIB 3A1TA 4J7AA 1GEEA 1W52X 4S1WA 4XDYA 2FOXA 1WMSA 2LBPA 2YHBA 1ST2A 1GTRA 2FNAA 4I50F 3GBPA 5JO0A 2ZIWB 3ESZA 4F4HA 1TXGA 2Y4NA 1GR0A 5DBGA 3I01M 1NT4A 3THWB 1FRVA 4BXOA 1F2TB 4EMUA 1XPOA 4HADA 3RS3A 4JU8A 1PT9A 3LGXA 5AR1A 3C3EA 3GUVA 1CUEA 2BZ1A 3BULA 1QE3A 3O2JA 3Q1LA 4TMVA 3VV3A 2L17A 4F4UA 2C78A 1BFDA 4UMEA 2ONYA 4HFRA 4AJNA 1X1RA 3KP1A 1G20B 2AHRA 3AEQA 2O3RA 4WT7A 2QRKA 5DIZA 3NM5A 1G291 1UDRA 4KZKA 1HYGA 2A9RA 2G1KA 3C3WA 3E9EA 4WFJA 2Q5FA 1ACJA 1T4MA 2I34A 1ABEA 3HZHA 4GM4A 4AJEA 2HSEA 4JENA 2BCJQ 4EF4A 1KYVA 5EIFA 2QD3A 1VE6A 1KBOA 3BWDD 4IKOA 3GJ8A 4GM0A 4P36A 4GFDA 4DV0B 2QRQA 3SIRA 4DR5B 5JIBA 2KBFA 2H92A 4OAPA 2G4CA 3I9JA 1PQ4A 1W0KA 3ENQA 3UNXA 2AJ8A 1ZJ4A 3FCXA 3U0VA 1NLMA 1GNSA 1F7VA 3EQ9A 3NHKA 2OK8A 3AOEA 3KBBA 1CYEA 3QHPA 2ZRFA 1MB0A 4I3GA 1AZSC 3VQTA 4F38A 4RTLA 2A30A 2NQTA 3KEQA 5B7NA 5ELXA 1XJCA 4OBWA 3WP0A 3VHQA 3QYAA 5C7OO 3RYHA 1BROA 1QBKC 3E7DA 3ND8A 4QOHA 3KV1A 5HPYB 4FOOA 3HB0A 3OQ1A 3UWDA 1UQUA 2WFAA 3LUGA 3TI7A 2YYZA 2GPSA 5DVZA 1M5RA 4GOKA 4S1TA 3FB4A 4EKEA 4EPVA 4JCCA 5LDHA 5KNLA 2I1VB 1WXGA 4V1CA 5IF3A 4DVGA 1NF9A 4UVHA 4RJKA 2Z9CA 3G88A 3BM5A 2WICA 1O5IA 1KFKB 2B4QA 4Y2TA 3S2IA 4BZZA 2VXCA 3ZD9A 4DIOA 5B5SA 5JNSA 1V8ZA 2C3PA 2Q5IA 4XEUA 4F8EA 1RNLA 5JNUA 5EPUA 3FYUA 4IV0A 3LM8A 3VR1A 2JH9A 2RAUA 5T4FA 3Q8MA 4LMBA 4XCXA 4Z4QA 1WZEA 1P61B 1E1YA 2A5YB 5EVCA 2NZYA 1M8KA 2JK0A 3UYKA 1JILA 1H6CA 4YWJA 4QOEA 1WOYA 3GWGA 4FGKA 1L1FA 1C7QA 4ASUA 4MAFA 3BE6A 4I1OA 4OKSA 4G36A 5CM8B 2MT9A 4AX4A 1VLZA 3WIDA 1X15A 1P5HA 4NIMA 4JSYA 2I9PA 2QXTA 3CB4A 1GUYA 3ETNA 5KTMA 4TUYA 1KEVA 1GTSA 4M9CA 2ZFUA 2QROA 3U26A 2VYNA 2OQIA 4F3NA 1P0FA 2WVJA 2LCIA 4I1UA 4WXEA 5DSZA 4EW1A 2OBLA 3UUEA 3PUZA 1OH6A 2EG9A 1FL9A 1POWA 2R9VA 2YFHA 3H83A 1TJYA 5IVIA 3RASA 2XNSA 2JB9A 3SEZA 4C29A 3CUSA 1U3UA 2CC2A 2PV0A 3BSFA 3MWLA 1J07A 1RJWA 5B1DA 3WGYA 4TQ9A 3H1AA 1XKQA 4Q7LA 6Q21A 4WCFA 4QYSA 4JVNA 3NHJA 4RTJA 1KOJA 5G41A 4Q3DA 4X8MA 4UHKA 5FBZA 3RBAA 5DHFA 1B8UA 1D7OA 2QIPA 2O2YA 4X94A 2F9MA 2CHUA 3DE7X 1V41E 2YRFA 3EB9A 4IJWA 4BNKA 5JALA 2VDOB 4QUAA 4DW8A 1F48A 4H9GA 3IKVA 2MSLA 1F6DA 2N75A 4L2IA 1KBZA 4R2IA 1Y4AE 5JS7A 1RXCA 4U7WA 1FJXA 1D2MA 3GCGA 4AZWA 1Z5WA 4YMIA 3NBFA 1E0KA 1OI2A 3IR7A 4J0HA 2IPOA 2DHQA 2AZ4A 3EQZA 2AE2A 4XTCS 3FCSB 3G79A 4PG4A 1XWWA 3TN7A 5K0NA 3VUFA 3ZWNA 3IO3A 4NJMB 4CDRA 3PYXA 1ISPA 1U0LA 2ZUBA 1B6RA 1XP8A 5DO9A 2FXIA 2IY9A 3GCZA 3LPDA 4BMNA 3WWZA 4RH3A 1SNYA 2NV6A 3OA2A 3FHOA 3ZNPA 4MWGA 2GWRA 5IJ0B 2RH5A 5DEOA 1K3TA 1CU1A 3RSZA 3F6BX 1NRIA 4ZHSA 2Y0CA 1JAXA 2ETVA 4L73A 3THYA 2O7QA 4WZAA 1JYSA 2GDZA 2I2DA 3N05A 2ICAA 5EKDA 3TQCA 5KNDA 1N0HA 4FCWA 5DTQA 1GPAA 4JGBA 3DOOA 3SEAA 1P1HA 1IY8A 2YW2A 4DA7A 1T0JB 1GZ6A 2W4IA 3D5EA 2XOXA 3EUWA 2ET6A 3KZOA 3JD2A 1C9NA 1FVFA 2PQ6A 1T5DX 1HFJA 3PHIA 4YRMA 4L16A 4EZBA 1ZM2A 3WGOA 1J2YA 3AHCA 1KO7A 5FBKA 3M81A 1GPUA 3AF3A 2XT6A 4J7UA 4N5NA 3ZK7A 3H97A 1JTVA 4HJRA 3M7IA 2QXUA 2X0JA 2MSDB 1Z2CA 3N75A 1KORA 3GLIA 5BNZA 1O0CA 4MUGA 1QZZA 2GEKA 2ZRIA 1NVDA 3HUTA 4E33A 2PANA 1ZIYA 2AL7A 1XALA 2F8SA 3KEFA 3K0CA 2YC2C 2HIAA 1E2IA 3QFRA 3LLMA 3AFMA 4ARBA 1BXRA 4DUGA 2I4RA 1U8FO 2F3TA 2FSUA 1KEZA 3LW7A 4CLRB 4EAQA 3L18A 1I2AA 4JYPA 1SKYB 2H7CA 1BJKA 3BXPA 3HWSA 3UMFA 4UTVA 3UWOA 1YQEA 4BB0A 1YZGA 5A06A 5I3ZA 2O8FB 3ELBA 1S3GA 1QS0A 3F8TA 1X1BA 3KR9A 1P5RA 4OY3A 1TAQA 2ZSEA 3BMOB 5AO9A 1ODCA 1Z6QA 4JUDX 4WNIA 4RS4A 1QHXA 3JVDA 2W7TA 4IFEA 1N1DA 5J2UF 4PHFA 4AQYB 1ZM9A 2DU8A 4TVOA 1FP2A 1GCIA 3LD9A 4QLAA 5HF6A 2WJPA 1I3KA 2UV8A 5KZMB 1IN8A 5T3YA 2B78A 5JISA 1JWAB 2JGLA 2QR5A 2EW1A 4KKXB 4L5IA 4NE9A 3LQQA 4DRYA 2W93A 3TZKA 1NHGA 3AERA 4H08A 1ZJ6A 3FCYA 2MSWA 1J2JA 2DFLA 3PK0A 2HU2A 2HMAA 5ALVA 4RVDA 1HTWA 4Q16A 4LMPA 2KQUA 4DTIA 4R2LA 4GXRA 1KBQA 2B2CA 3MWDB 4RGQA 4EJ2A 1BU5A 4ALIA 1V16A 4EVSA 4WZZA 1D8TA 3TQFA 5F7ZA 1U2SA 1MW9X 3TZQA 1PGOA 3JQ9C 3TLZA 3LQRA 1Z17A 2EZ9A 3AKEA 5H5JA 2P3QA 2FSHA 4HAUA 3W5DA 3QRWA 1Q92A 1V4VA 3F3YA 1Z07A 4LGMA 5BNFA 4P5DA 3G82C 3P2OA 3DOIA 1M67A 5KX5A 2JI6A 3K8YA 1JNYA 5GWXA 4F5EA 1CS4C 1K6JA 1UIMA 1KQ3A 1AKUA 1RRKA 3G7SA 4FGJA 3AIKA 3KSMA 4IGIA 4G4SP 5H4HA 3CIFA 5IJWA 2NZWA 3FUCA 2I2CA 3VX4A 3QXHA 2QT9A 3FNBA 4DF3A 3BF8A 4YLEA 4ML3A 2ZS8A 3Q0TA 2EW2A 4RELA 1JA1A 4DLXA 1Y4UA 5TGDA 1XOIA 1P2UA 2CFSA 1N5RA 3I2KA 2FEWB 1EFHA 1IATA 3VZPA 1ZMXA 1AGPA 4NF2A 3GDWA 3B6MA 2R00C 1GYPA 4N7RA 1EVIA 1MABB 2XTMA 3KRTA 4ND2A 1MDFA 2BFBB 1NV8A 4DCMA 3S55A 2H1VA 2Z3WA 3GA5A 3GOQA 2R1TA 1OXKB 3V2IA 4BASA 1OMOA 2GT1A 3EGDB 3PT5A 1Y9DA 3GY0A 3VM6A 5KMGB 2OECA 2AMFA 2WU8A 2QHXA 1E1NA 3LUBA 5FOXA 1ZESA 3REQA 1E8NA 4IVNA 2QLTA 4R4JA 1SELA 1UM9B 3U13A 9GPBA 1LLDA 1NMYA 2LIPA 1NNEA 3TTXA 4J3NA 1SKYE 1U2TA 2J8ZA 3KKKA 2NTJA 3OT5A 2NVWA 2JIPA 4ZAYA 3T54A 4EAAA 1CJSA 1RPZA 1OXVA 2NXCA 2V9PA 2Y1FA 5DH9A 5IN5A 4OF4A 4OHMA 4QNMA 4QYIB 2GHIA 2WAYA 1U2DA 3BICA 3LQ1A 1TM2A 4FLMA 4G26A 4EH1A 4PC3A 4WW0A 2BFDA 1RHMA 1STOA 5EWLA 1EHYA 4OK3A 3LF2A 3D8SA 4YUYA 2YCBA 3EQ6A 2AD1A 4ER7A 4KRXA 5JJLA 3D8BA 3L7AA 4W7HA 4A0QA 1UDAA 1DDIA 3DW3X 4Y2PA 1D7AA 5JDIC 1XCPA 2N47A 3A1DA 3A0UA 1JDBB 4WK6A 2ZRPA 3WLAA 2VH2A 4OJTA 4FFBA 1K06A 1J23A 3FHCB 1O94D 1Z9BA 5AKZA 1EX7A 2OCGA 3FD8A 5GZ1A 1BCRB 2NYVA 2FPOA 1P1RA 1ZKDA 2XMSA 5A71A 1JI0A 5JEDA 5G3YA 2C9DA 3WNZA 2YMPA 4O3FA 5AM0A 5TVGA 1PKXA 3EXEB 2FMTA 4J07A 3NU1A 3AGPA 4IGFA 2FDCA 3C0KA 3WAGA 1CP2A 3MYYA 3NHMA 3A31A 1H4QA 3TKAA 1XKLA 4RMNA 1F5SA 1WCWA 1I7PA 1NLUA 1NVVQ 3KWJA 2EFGA 4POAA 1IBRA 4QO7A 5L45A 5GVSA 5M04A 1IOVA 3UICA 4TV9B 2YHIA 5HZKA 2DFVA 2VSOA 3OPNA 2HQRA 5L95A 1TYZA 3GB9A 1S96A 2P6MA 1LFDB 2ZU6A 4L02A 2QTNA 2P2SA 1QZUA 4C4PA 4QHTA 1K8XB 1VBKA 1Y42X 2CZQA 1TUBB 3PIIA 4RK7A 1M2HA 5IVDA 4ALKA 3BXXA 4F5DA 1RPAA 3MWJA 4REMA 4OJKA 2WFLB 1YH3A 3DOEA 3OLYA 5SY6A 2XQIA 4G1UC 3VO8A 4R3WA 5J4HA 4D26A 3A2KA 5DM60 1J1UA 5JH7F 4QA9A 1T0UA 3TNJA 2C8JA 4HQ0A 4MVJI 5AI4A 3AJEA 1BSVA 3R3VA 3QUBA 5FKJA 3F7OA 1Y1RA 1US8B 4IJKA 5CT8A 2QV7A 3KDSE 3T3PB 4BCBA 1MFPA 3EVTA 4BVJA 3MXOA 5F2KA 5IULC 3HUDA 4G5XA 2XGJA 5HGJA 3KLMX 1YB1A 2BHTA 3LK7A 4EKIA 1MQ8B 1Q0SA 2HQOA 2R66A 3JPWA 4EA6A 1EDZA 1OBHA 1C7IA 4P7KA 5LU9A 1UPTA 3W77A 1AGXA 1T2DA 1W4LA 3SKYA 2AZTA 3QHQA 2QU8A 3BGWA 3MW8A 4KGZA 4P0PB 1GPH1 2QL7A 2AZMA 1E6WA 3L0DA 3PEUA 4IL5A 1P5ZB 2PRZA 3NC0C 4K05A 2QB5A 4ZO6A 2WD7B 3WB1A 1G17A 2I78A 3IV6A 3CINA 2XX3A 4PR3A 2Y2VA 1PFUA 5FWDA 2AOVA 4RYDA 1C3LA 1M34E 4C5AA 4HQ6A 2J0SA 5JSQA 1JDZA 2PTHA 3GZNB 2Y1EA 3H75A 3IKLA 3L8DA 5DGHA 4AZ3B 4O29A 4ALJA 4EHKA 1FVXA 1T5LA 2B1IA 1A50B 2OR3A 3FVTA 3PEEA 1I4WA 2C8LA 2Q2WA 4AC9A 5A0TA 3MFQA 1N2OA 1OWOA 4TZ6A 2GPTA 1EFUA 2A9VA 2KBEA 1VPEA 3UEOA 3QZUA 1QIFA 2IYLD 3LA8A 3EFHA 3FPHA 4FIDA 4LVOA 3CX7A 4KRGA 3VYVA 3L41A 2VP3A 2VH5R 3Q6MA 5CG1A 3IUJA 2VPWA 3IJRA 2R85A 1V3TA 2JS7A 4TMZA 4QU9A 4QBFA 2XUJA 3MWEB 5F35A 1G66A 4IWNA 2FWIA 2Q1UA 4PC2A 3E9CA 4Q34A 4QT0A 5HBGA 3WGVA 3FCEA 4N12A 1PP4A 4E5DA 5KC8A 1L4MA 4XOIA 4JDPA 2D13A 1RHUA 3UJ3X 3WLIA 3L40A 4B31A 4RTPA 3RSHA 1PJ2A 2ZTSA 3LUHA 4HNSA 4AB1A 4KWTA 3AEUA 1XLUA 4RJJA 2QAIA 2C83A 1W9HA 4E5NA 2H1LA 3IVXA 2VTEA 3EWAA 4BJ1A 3RS0A 4II2A 1HGXA 1RC0A 2AKAB 5GONF 1TYAE 2BM0A 5C46F 5HTOA 3E53A 4IKEA 3MHTA 3I01A 2QMQA 3DE0X 1Z0ZA 5FI1B 3WLEA 5IRCD 3PSHA 4F9GA 3PUYA 4L8VA 1LTHR 5CIWA 3TEMA 1ZD1A 2P5YA 3TLKA 2G04A 4YRLA 4FK8A 2ETXA 1XRLA 4TZ0A 1ZLXA 1L6IA 4ZOEA 5IZ4A 4KV7A 4ZI7F 2P5TB 4X6UA 2G1JA 1ZQ9A 1GQFA 2FG7C 5CDFA 2ZIZA 2EX0A 3O82A 1I2DA 4XJXA 2WWVD 1R0KA 4QGBA 3IKTA 3X1XA 2GS9A 5TR9A 3OBIA 4BIMA 2YJ6A 1UMCA 1VG9B 3ZCPA 3LZDA 3VTAA 1C30B 4KN9S 3LX4A 4CEIB 2QSJA 1U1EA 4KQ2A 3E3LA 1T36A 2RB4A 5HMMA 2JHAA 1I14A 3L4BC 1OKKA 2OBBA 4DCCA 3E84A 4JT8A 1AB6A 5LLSA 3W2IA 4DS3A 4OSPA 4TWJA 4B5KA 4EK9A 1TA9A 5ITSA 3JAWB 1EGAA 2DPXA 4OI4A 1FOEB 3L7DA 1L7NA 4MR7A 1QVWA 3DBIA 2PZEA 4LTNA 4DC0A 1DJNA 3KQTA 2Z1NA 3R3XA 4OBEA 1TJ4A 2MTBA 2PS1A 3L8HA 1PK8A 1KHHA 2CN1A 1XDWA 1NVGA 1GIAA 1NFFA 2PD3A 1OFUX 2BM1A 3O8QB 2AJCA 1J06A 4JSRA 4WY8A 2O8DA 3DLAA 2ZRGA 4C7MA 5TF4A 1XJ5A 4J2TA 3W5AA 3A6JA 1G3QA 3B52X 4Q1VA 2BELA 4F7DA 3D43A 2XYGA 1TZMA 4KYVA 1ZPDA 1XYGA 3KCNA 3F8WA 3AB8A 5D3MB 5ALGA 3SYKA 3W3AH 3QKRB 1G6HA 2WAMA 3KXPA 5I7SA 4WA8A 3ENVA 2FQXA 4G5RA 4TRJA 5BMVB 1KMNA 2APJA 3U7RA 1V3VA 4LSZA 1FC0A 2XKAA 4YT4A 2FRDC 4AT1A 1Z4MA 3IQZA 5IJAA 4F3KA 2PGXA 4LHSA 4CMCA 2XOEA 1H2EA 3W3ZB 1U4OA 1M8FA 3PRYA 2ERXA 3ZTTA 3HBLA 4ZPJA 4FD2A 1WD5A 3G9ZA 4HMOA 3K6KA 4I7EA 4YV7A 2HFKA 4ZARA 5JFTA 1CDEA 5HIAA 1NA5A 1CV2A 1VDMA 3F4BA 3I92A 2EJCA 3N5KA 4YI3A 2VQFB 1Z37A 3FBWA 1HFWA 2R65A 3HKDB 1ZD9A 1RQ7A 1GYQA 3I9FA 1NW4A 3VKWA 4KR6A 5ALOA 3BDVA 2CVZA 3ILXA 4JR1A 5IP5A 1M2KA 3GI1A 3R20A 3SLGA 4GLOA 3TWOA 1CFJA 2Q07A 2QA5A 2R44A 1M1ZA 2ZJ3A 3N8GA 2VRNA 4KU4A 4US2R 1RWXA 4F5WA 4RE6A 3F5DA 5D7BA 5KPJA 2ZWIA 1NN3A 3MMPA 3KT3A 4R40A 3RRYA 4B3TB 1E2NA 3SPXA 3RC8A 4PSAA 2AXEA 3SDSA 4EB3A 4U3JB 2QT1A 2QM3A 1O4WA 1UZLA 2ZBUA 3DC2A 1JR3E 3UMCA 4MIEA 2FTKE 3W6UA 2J7PD 4KREA 3L8FA 2WT9A 2Q7DA 2EZ8A 2I76A 3STWA 1FYXA 1QAMA 2YQ5A 1Z18A 4UASA 3WB2A 4HOYA 2DHEA 3IOCA 2H2IA 2VCHA 3HLYA 4JWTA 1A27A 4Q1FA 5C80A 2LUOA 3P9IA 5DSXA 4BFLA 2CUZA 1UXGA 1TCBA 2WKPA 4F3RA 4KR0A 4HDNB 4NLLA 1PNOA 3NHPA 4ZT6A 2IZ5A 5EQFA 1E3WB 3IVMA 3FZYA 5CLIA 5FTWA 1DWQA 3O74A 1WZUA 1ZM7A 5H3HA 5TQVA 3KWLA 1JEYA 3TW4A 5F98A 4JX8A 1V6AA 1ZICA 2Z2XA 4F97A 1YB4A 3BWCA 2NU7B 1ZK3A 4GZ6A 3NC4A 1E4YA 1RDFA 3L1KA 4KL8S 3RHZA 1OBFO 2KPOA 3EYWA 4QRHA 4B7UA 3AEKA 1E7WA 2IUYA 3HYLA 4NS4A 2ZJ5A 3UAGA 4MULA 3TW8B 1N0WA 1Z0AA 2HY7A 5K2OA 2X2OA 1PRYA 4UBLA 5F51A 1G8FA 3T5BA 3HBNA 2R7AA 4NENA 2R11A 4QBKA 1SUIA 2ZE6A 3VHRA 4CUKA 3ZE7A 1N3IA 4GOMD 3HBFA 1H4VB 3DZGA 1X86B 4IIVA 3PC8A 4NZPA 4YAOA 2O7SA 3K6SB 3Q3GE 2Z6AA 3GUUA 1XLWA 5A7GA 3VR4A 4ADSG 5IASA 2ZCVA 2YIVX 3V1KA 3DMFA 3PF9A 3ZDYB 5AICA 3ZHSA 1TTTA 2V4ZA 3AL2A 1PNRA 1EESA 2LP4Y 1SU7A 1NDHA 3IAUA 2CE7A 3AKCA 3ZU4A 4JV5B 5LQUA 4Z9FA 4R81A 1II8A 3ZH2A 3RU7A 1HE5A 3DW1X 2V7PA 3AQIA 4YPFA 3SU8A 2OZEA 5KREA 4LTMA 5BRJA 3F3SA 2G8NA 4DIBA 5DTRA 1N2CE 1E2JA 3CSSA 2VZLA 5KC9A 1G6Q1 3IIIA 3HH8A 2C1ZA 3K1ZA 3SHQA 2HSDA 2G77B 4BFYA 2QYSA 5IF9A 1ORIA 3MGBA 3O8NA 2WF7A 4RXTA 1N6OA 5K09A 4BDTA 3MCVA 2OQVA 3K70B 4OXIA 1HORA 5CXSA 4AP9A 4ZJZA 5AM4A 3S1AB 1ZSNA 1DB3A 3RS5A 2NO6A 2C2YA 3FWHA 4YRNA 1VXRA 121PA 5KU1A 1OFVA 2JCBA 3NYRA 2F1RA 4BP8A 3UMVA 1YRLA 1RM5A 4QASA 5ALJA 4ZT4A 4P34A 3OG9A 1D3AA 1PIWA 3TCKA 2ARKA 2PU5A 3TLAA 3A3NA 3H9JA 1NOJA 3D81A 1G8PA 3DG9A 3VU1A 3ZK9A 4CUZA 721PA 4CM5A 1KC1A 1W75A 2ANCA 2AFHB 3T4PA 5CLHA 1NAIA 2UUOA 2VZ9A 4PLGA 3CUVA 3NEYA 4C0BA 4G0WA 1E96A 3OEYA 2DYKA 3L0OA 4MUEA 5GM2A 4NMMA 3A58B 3DMTC 5IZCC 2I3BA 3IQXA 2PLNA 5EYPA 3L7IA 5K0LA 2AT1A 3B1ZA 4EATA 2VEDA 4UZSA 3I9V1 2VJYA 3ICPA 4JZKA 4OHOA 4BO4A 1JFSA 2QMYA 1JEAA 1RJGA 1N92A 3H2YA 1CS0A 3O94A 2HXSA 3WL7A 1CQZA 3PXEA 2AN9A 4EJSC 4KRYA 1YAHA 4KAXA 5CNIA 3R24A 1EB9A 3V9PA 3WDKA 2DETA 3KJEA 1UKVY 4F11A 3LC7O 3QIAA 4ESOA 2V5VA 1Y9ZA 3P5BA 3T3DA 6CHYA 2XQJA 4KFRA 3ZWMA 3FZGA 4LJYA 1N3LA 4D9IA 2IHNA 4PEVA 3JYPA 3BOSA 2FJUA 1J21A 2RBEA 3KQQA 3Q0IA 1QP4A 2PSEA 4FSXA 5FOWA 2AKEA 4J1QA 1G8JA 3BBPA 2FR8A 1WD7A 2F3QA 3QE4A 1C4WA 2H48A 1LXCA 2RIRA 1QC5A 4XGKA 2ONKA 3AIMA 3JQGA 1AB5A 1LZLA 3K1JA 3OT1A 4JT9A 4KGVA 4ND8A 4Y6RA 4U9IS 2H17A 4QTYA 1XMXA 3FDZB 1GU0A 3P32A 1KS9A 2M1ZA 1PD0A 2OB1A 4JJGA 4NV3A 5ALTA 4J4BA 1GPMA 4ZRMA 5FEUA 3ZE1B 1XU7A 1G42A 1QH1A 3T4XA 5HFAA 3WTBA 3DAOA 2Q6VA 3DBOB 4JNCA 4RMGA 1WHSB 4EMTA 4LJ6A 4MVCA 4Y1EA 4ZQIA 3OU2A 4CTMA 4EJSB 4EGJA 4RY0A 5JSYA 3RTCA 3TGLA 5KSZA 3FCOA 2FX5A 1JHVA 4IGAA 2GK4A 2Q2VA 1Z2OX 4H7KA 2JJ1A 4KNWA 4DIKA 1XXHE 2MHCA 4DRZA 3H8SA 4DT1A 4Z8YA 4CV2A 3OTGA 4YJ2B 5I48A 1AKVA 1JPUA 5FBVB 3H87A 3DT9A 3HZZA 2I3DA 3QX9A 3H1BA 4C7BA 1UXKA 3U7GA 1OA1A 4FJ2A 1NW6A 4ZMSA 4YFVA 4L72A 4S1VA 5JDCC 3RI3A 4V3CA 2WK1A 4M53A 1LSJA 4DLWA 3HRKA 4JBYA 1GD1O 1VG1A 3C4VA 1LLQA 2RGXA 3BTOA 3O38A 1BQEA 5L4LA 4F4JA 3JZDA 1XYVA 4HGOA 2IXEA 1WKBA 1PTJC 1YGPA 4NAVA 4RKRA 5EA2A 3T8YA 3UMGA 4GL4A 1N9GB 5CA0B 1LBEA 4DNFA 3PHBE 1E7QA 3VDMA 1Z35A 5AM3A 2E4YA 1SQSA 3CGGA 1DLJA 4X85A 1KRXA 5AW4A 3B53X 4CL3A 1N0VC 2OFPA 4BRUA 3TUZC 1YJXA 3I12A 1ZMOA 2EL9A 3AYZB 1AM4D 1WAMA 3NRJA 3OO0A 1P7WA 1ZD3A 2LIVA 4GICA 1G16A 5DBOA 2YR0A 3PENA 1TFUA 4MSUA 2H29A 1P0QA 4J0FA 3HR7A 3D8UA 1CQIB 2FWMX 3KFXA 2JH3A 3MGAA 3P26A 2XAUA 3JTEA 2AFHE 4L8WB 3T3NA 1V6CA 3DMRA 4S12A 2XYPA 4XFKA 1Y3BE 2QX9A 3T4EA 1FZQA 3EAGA 2IZ7A 5IDQA 2QTBA 3I53A 3L7BA 4XDZA 3RFTA 1U94A 2FLKA 2QTRA 1CUCA 1TGYA 2N0SA 1N2BA 2ZRJA 3M4XA 3ANLA 3ROZA 1VFNA 3GELA 3FTFA 2WHQA 3CCCA 1PNQA 2C95A 3FTCA 3NJ8A 4IG9A 1JIXA 3SBOA 4ALLA 2BFCA 1M6HA 2J6HA 1ENZA 1JE0A 5TPZD 1YA4A 1IZ0A 4ER3A 2WWRA 2PKEA 4O2LA 1OFTA 2MSKA 2OLEA 2Y9PB 1ISFA 1SBTA 1C7ZA 2PYDA 1C0KA 5KSWB 2HPVA 3LCUA 1P5FA 3EMBA 1R88A 3NIDB 4M46A 4QFDA 3R7FA 4E2FA 2EP7A 1UZAA 1G7TA 5KTOA 2P5SA 4YUZA 2XT0A 3C2QA 3R1IA 3T1YB 3OP1A 2GN1A 2HK8A 1KEEA 2W00A 3INNA 4O02B 2ID9A 1F06A 4XB1A 2F59A 3C7AA 1KJWA 2Z9DA 5AWFC 2NV2B 4AF8A 4R6WA 2A4KA 1Q7BA 1T34A 4IP0A 2WIGA 5MHTA 3KSDO 3B9RA 1RRMA 1EQAA 2R6GA 4IXMA 5GIOE 4E46A 2WMDA 1CUJA 3NC1C 1THZA 4KBGA 3ZR4B 2RGEA 4HTFA 1BMFA 1L4GA 1QK3A 3T3EA 3TTTA 1A0OA 3ML1A 2ZBVA 4FDTA 1Z0FA 2C2GA 5A2QA 4URUR 2ZJ2A 4M7WA 2NSLA 3TXXA 1GFZA 4PNPA 2AV6A 1E32A 3HKEB 4QDTA 1OPRA 2QTVA 1AA6A 4JR2A 2XRMA 2C00A 4H60A 2PD4A 3I6IA 1M10A 5AI6A 2R4TA 3RVKA 1JG2A 3CG4A 1QHNA 1GKYA 1UBUS 3UJPA 1GU7A 3HDJA 5J1TB 3K70D 5EIOA 1EA7A 6AT1A 5ADVA 2H8KA 3SNKA 4EI2A 1ZIDA 1T5HX 1FP6A 4DJTA 2XQVA 5EEGA 1FK8A 3WRXA 5KJ1A 1SBQA 2H2GA 3VPAA 4IMRA 1J2TA 5TY0A 3I3SR 4C0QC 1VE3A 1VP9A 1Z16A 3ZWVA 3E03A 4H27A 1KWKA 4TTTS 1R4NA 1D04A 4G0QA 3FTEA 3KNZA 3ZX5A 4TV9F 2ZRKA 3CLUD 4MYHA 3CNQS 3T7JA 3WNCA 1E1RA 2JA1A 5B1SA 4QEZA 3IYLW 3BXZA 1ZXBA 1BDJA 1YB5A 2GD2A 3HXPA 2MINA 1BWPA 1JFRA 4BWGA 3IQDB 1ODKA 3VI3B 1NUTA 2OVBA 4IY1A 3F6CA 1DJMA 5JR3A 1SVNA 1KQPA 4H17A 2IUSA 4TLBA 3WGHA 3SK0A 1SU6A 1MIOA 2XITA 3KDAA 3MLEA 4BP9A 5K99A 3Q7RA 1NUQA 1E9RA 4FGZA 1IRIA 4ZCPA 3VPCA 1CG6A 2RGDA 2N3ZA 2HEGA 4GQIA 5E7MA 5KAPA 3EFEA 2WWFA 1BMQA 3OY2A 5F7XA 3FI9A 3HCWA 4E13A 1T91A 2A33A 3DEFA 4PIMA 3RU2A 2ZR0A 3R7WB 5B57C 1FUKA 1VJCA 2BFEA 3H5RA 1NXVA 2INGX 2UVPA 3KUCA 3RYFA 5GP1A 1TK3A 2WSIA 4G4GA 3QE9Y 4KFTA 3EXIB 2XWPA 3QLVA 2NVUA 1SVWA 3HNOA 2AC4A 4O2AB 5KCMA 4ESEA 2EHDA 2IEYA 3JQAB 2I6GA 3ID6C 3WK9A 1U99A 2CXHA 1MX1A 3FSJX 1UKZA 4MYCA 1ID8A 1BN6A 2VNKA 3EOZA 3AO0B 1PYDA 3LUKA 4OXRA 4F9TA 1H5NA 2ZAOA 1OYYA 3UMJA 2F48A 2YVUA 4FNOA 1ORDA 3FSGA 2GZAA 5KYWA 3FUWA 4X1IA 2YQZA 2Z57A 2C0QA 7REQB 2VR1A 4EY6A 4AP5A 2FN4A 1SJ9A 2QUZA 1R5NA 4EI7A 1DXQA 3SJZA 2EWVA 4MR9B 2IQ5A 2Y1KA 1AE1A 2GYUA 1AVTA 2NXJA 2D2FA 1OTHA 4KI7A 4XWGA 5CVCA 4ES6A 3EIXA 3GAFA 3P9KA 1KZ4A 1TE2A 1VDZA 1JIVA 2PMEA 4DCVA 1GRNA 6NULA 2RH9B 4LZWA 5F52A 1FFXB 2IDJA 4BVGA 4FKMA 4ZVQA 4Z1MA 3GJQA 5DYYA 5JWHA 4OD0A 3ESAA 4D1YA 3HCBA 2OHOA 3VOTA 4HUQB 5FWXB 1I94B 2G0NA 1EWQA 1XJ0A 3ND5A 3DV0B 2JEYA 4ZMRA 5DNWA 3C97A 1EK2A 4E5UA 1ZH8A 1N33B 3SFZA 3EWNA 5FJIA 3ZWPA 4DGSA 4OKIA 4JJ7A 1YU6A 1W0JA 2ACKA 4PG6A 2PL9A 1FNBA 2BI8A 2QP4A 2ZT8A 4RMJA 3N74A 3T0FA 3RAFC 1EFRD 3HG7A 3DAHA 3GDOA 1TEXA 1TLLA 2A1TR 2JBHA 5CBPB 4URZR 3PUHA 1A8HA 3LQFA 4K9PA 5ALKA 4LWOA 3CNLA 1IN6A 1PZEA 2FPGB 3QUQA 4FXOA 2H7XA 2B4TO 2JGNA 3M49A 3AZQA 1ZOLA 2ZVDA 1IXRC 3DP9A 3FNFA 4XGRA 1N2JA 1O96A 2FMFA 1DIRA 4KCGA 3AKZA 3BIOA 1N1EA 3A1NA 2ZPTX 2H63A 4ZYWA 2Z1DA 3FYSA 3O6VA 5CP8A 4RJTA 2OZLA 1MENA 3FUXA 4K03A 1SD1A 1WMDA 4RLHA 1VM6A 1UP4A 1OBVA 1WPXA 5CYFA 3SXJA 4QATA 3ZOZA 5DM70 4X63A 4MDEA 1ZOSA 3E3OA 4OXYA 3RSFA 1TNDA 3DTNA 3R5XA 2VK8A 1G5RA 4YJGA 3UMBA 2BSQA 4PM4A 2OB2A 4TGLA 2EJUA 4LC1A 4LJSA 4JBHA 3TTUA 4RA6B 1NR1A 3NASA 5C37A 1Y3IA 3TVDA 4FM9A 4R31A 1NFQA 2FSVC 2M6RA 2WM8A 3JR3A 2PX4A 3A8TA 5B3JA 3R3HA 4PRLA 3F1LA 1W47A 1KYIA 4ZC1A 3UJ9A 4XTRA 4DWJA 5CFMA 3Q9LA 1QIGA 3SFVA 3VR6D 1R37A 2YQ4A 1Z4LA 2V97A 3U4MA 1NMEA 3FNIA 2VPQA 3Q2IA 1ENOA 4D43A 2C4HA 2W6IA 3ZI0A 1G41A 3GNLA 3ED5A 4A8JC 1EQ2A 1LW7A 2HQBA 1KO8A 4BNDA 4CF3A 1WCXA 1MAWA 4N48A 2H7YA 3ONNA 4ZEOA 3NQ41 1W59A 5HE9A 1BKYA 3ROMA 4LJ4A 5AJWA 1R6TA 1GA1A 2XB4A 3RUEA 5BW6B 1U1DA 4CHGA 5CPBA 4X20B 4AZSA 2W2TA 4NEHB 3VZBA 3EA0A 1V1MB 3T1TA 4YA6A 4P2GA 4QICA 3WMFA 2P5UA 4MV4A 1RS0A 4YCJA 1E9DA 1YDEA 3E22B 3MEQA 5LU8A 2NP6A 3KM0A 1Q6YA 4LVUA 3UUWA 1SXJC 1RP1A 5JLJA 3KU1A 3MINB 4QT4A 1ZUWA 3MB5A 1YMQA 4PY2A 2FN8A 3W1EA 2OLJA 4C14A 1T3LA 5D85A 1WSBA 7ADHA 4M7RA 2P65A 1K5HA 2GAIA 2R48A 3PTZA 3UG6A 1PL8A 5CFNA 2XYHA 3FJOA 1CUAA 3DTVD 3H0KA 3ZQ6A 1JPVA 4HQFA 5IKXA 1VJ1A 5BSVA 5AXAA 5EZ5A 1ECBA 3DMYA 3ZCSA 2GO1A 3QOFA 1E94E 1YBFA 5KQLA 1O94C 3JYLA 3KUKA 4K9KA 1SA0A 4OQLA 3IHWA 4QARA 2QVBA 1BXGB 2R8YA 1NVMB 2GCGA 3EH1A 4WVLA 5BMVF 4DMFA 2LV8A 3M4NA 2NO0A 2V7UA 5AVVA 1T3SA 3A6ZA 2Y3IA 3BDIA 4R2MA 5DHUA 3TEJA 1KC3A 2DLCX 2P30A 3TLXA 3TB6A 1F17A 2HU8A 3FPLA 1XVTA 1N9KA 3R4CA 5T8KA 2R00A 1AK1A 1G3MA 1Z8HA 2FZEA 3MUOA 1T9BA 5ALLA 1NBME 1Z08A 4R71A 4D0SA 1ODJA 1QCCA 4Q24A 4XX0A 3BH6A 1I2ZA 4RWEA 2NUTB 3C5HA 4FD3A 3TQQA 3HXMA 4XM1A 1OLUB 4OHUA 3NEPX 4AW9A 1C1DA 1N5LA 1ZI8A 2Q5QA 1R00A 2BHNA 4OYYA 5U4XA 2IX3A 2RGUA 4MYSA 3BMNB 3NBAA 4NQRA 1J90A 1M6YA 3OJOA 1V1JA 4DKJA 4I46A 1A5BB 1P17A 1WUKS 2RKOA 2YN0A 2G72A 3R3ZA 4OHFA 5CX1A 1GTJ1 1YZUA 3M3HA 3G5LA 5JAUA 1Z4OA 2AJBA 3CYFA 1S1MA 3PDCA 3QK7A 2CFCA 4QYXA 5JPIA 2RI1A 4BC0A 1AXEA 2XXJA 4GVPA 1WXQA 4NBRA 4BO8A 1XRQA 2J32A 3M34A 3RVLA 1Z0JA 1JA9A 4GOJA 2YWRA 3PJGA 4PZ9A 5CXXA 2R1UA 2QPAA 1A5TA 4NJEB 5LZ9A 4WXPA 1EHIA 1T8YA 4I4CA 4AL4A 3AUYA 1KI2A 5GTDA 4OX9Y 3NHLA 3JQAD 3U0BA 5TEWA 3EXFA 3OJXA 4C4SA 1M73E 1T25A 1K8RA 4LYDA 1EX9A 3WE7A 1V5FA 1WVMA 3P27A 4JP1A 2G1PA 4KO1S 1KK0A 2PLRA 3RR2A 3V2UA 4EW3A 2HF8A 4JBNA 1WBBA 1UEJA 2I71A 4MLZA 3AKDA 3PNVA 2CVHA 1DXOA 4AG3A 5IK2A 2BGWA 4RHCA 2X8LA 1H2YA 4KLCA 4PN7A 4N9WA 3WX0A 1H3FA 1KZ6A 3OD5A 3DD1A 2D2VA 5CTJA 4MV8A 1KYXA 5A6VA 4OG2A 3NORA 3BMCA 5A04A 3H13A 3Q88A 2BEJA 2QX6A 4HEA6 4LHZA 4TXJA 5KQPA 2XF2A 1PGPA 3LDGA 2E82A 4CM6A 3RHSA 3BE5A 3PXDA 5L3QB 3FROA 4LX0A 3EVCA 1NQXA 3F6SA 2O8BA 3RJ9A 3URKA 3OMXA 4FZRA 1XCLA 2AK2A 4NONA 4BNLA 1WETA 3RRBA 2DPLA 4YXWA 1LI7A 2XDQA 1O7JA 1PYGA 2XIQA 1JSXA 2Q6TA 2JBAB 1Z8FA 2R47A 2P4HX 3NDPA 3PHJA 2IH4A 3FCAA 5FI3A 2VHJA 2P2YA 1K8YB 3IXQA 4JBWA 3REOA 3GK3A 3K4PA 3UXHA 3FCUB 1UPXA 1N2GA 5IXSA 4G24A 5BQFA 2ZRNA 3L8ZA 3K0SA 4W9MC 4DEXA 1JRLA 3EQ8A 2WSLA 4R1SA 5BV7A 4LRUA 1G5QA 2GXAA 2O0HA 3DYBA 4X71A 4ZZIA 2GCPA 3AM4A 4D98A 2PRJA 3VYRB 2PZBA 5B12A 1YASA 2JFVA 2K6GA 3KYIB 4W9NA 1OYVA 1THGA 4V24A 1JYEA 2QPLA 2QVYX 4V0KA 3I32A 3WWCA 3WLLA 4AYXA 4NDZA 1IRXA 5FOQA 1K8ZB 4QPCA 4UPVA 1Z74A 1BH2A 1ZW6A 2J7KA 1H0SA 4OQPA 1VLMA 4J43A 4CODB 4I2VA 1C7RA 5SZKB 2ZE5A 2Q4OA 2VWHA 1QM5A 3DLPX 1GY8A 2REQB 3ZE8A 1EKXA 2C3MA 5I5EA 3PIRA 4LE1A 3WSTA 2P11A 4BJ5A 2J9ZB 3AR4A 3QI7A 1KMHB 1E1LA 2B7LA 5FB3A 1DLIA 2BUBA 5AVRA 4C3VA 3R6TA 4I50A 4Z5XA 4B9EA 5A9SA 1ULAA 2P79A 3NP9A 3QYPA 5BN5B 1KJIA 4IDAA 4KMRA 1L7MA 3A4NA 2WYVA 4HBGA 4DCOA 1J49A 5AK3A 1IOWA 3G02A 2BEVB 3NVKI 3LUPA 1RP7A 1E9VA 1ZUD1 4R9RA 1X77A 3E7XA 5I4BA 2RD2A 3M0EA 4BTLA 4II7A 2AFIE 1ODSA 3MOIA 3NTQA 3PI7A 4LYEA 1VHLA 4KR9A 3VXKA 4LY6A 1RT9A 5HEKA 4WBNA 3UK7A 4IDCA 2QGZA 3X1KA 4AECA 4LF7B 3L02A 1PV2A 2G7MC 1MG0A 1I10A 3CU5A 2BDUA 3EBLA 4E31A 1M0EA 1GQOA 5JROA 4G8JA 4ZVTA 3VR3A 2JKYA 3TZLA 5SICE 1HYEA 1EXMA 1R9NA 1ACLA 1QH9A 4N01A 1QVVA 1V5EA 5ECYA 1MOPA 4XLZA 1GZUA 4DA6A 4FYMA 5DGTA 4W9RA 3W9SA 5DNYB 3SDZA 4JB0A 1W96A 1CQJA 3PFBA 1R6BX 2O0MA 2W6QA 2ZBQA 4IXNA 3O1JC 4DGQA 1ISSA 3IUPA 3NR2A 4ETIA 4R0VA 3P2KA 1ACMA 3WQRA 2IPLA 1RXEA 4FP9A 1K66A 3CTPA 3GFFA 4QDXA 3P9NA 3WBKA 3J81k 3Q7QA 3ANNA 3U7QB 3IE2A 1CZUA 2VK1A 4I4NA 4LDJA 3ZOKA 2BISA 1W9MA 4EI8A 2WT8A 4PYOA 5E4JA 1L5HB 3J7TA 3WGTA 1D8AA 4Z7NB 3JQ8B 2YRXA 3BWYA 2DX7A 2Z3VA 1G38A 4MPPA 1WB4A 4RLSA 4URWR 1NVFA 4NCXA 4H7FA 3ZZNA 4R41A 1ZITA 4UXJA 3DFZA 3NG1A 2C54A 1ZIXA 2W9XA 4E94A 3LPMA 2H2FA 1U3VA 2IYTA 1S2MA 1QO7A 4NYMQ 4WA7A 3TR5A 1Z68A 3W3AA 1LSSA 4YJ2F 3EOAI 3DO8A 1FXWF 3FZQA 4NPAA 5G4KA 4DNQA 5FI0B 4WH0A 1PQUA 2JGEA 2PKQP 4KE9A 1S7CA 4HBZA 1HDXA 3TLGA 1YA6A 2A1UA 1E2UA 2BAGA 3CC8A 3GP5A 4OUDB 4O6VA 3HK2A 1K2VN 1N8NA 3R40A 4B8YA 3IQEA 3FXAA 2DPGA 1RLUA 3ABRB 1C41A 5P21A 4ZT7A 5BWNA 1GGEA 3X1YA 3BKXA 2FEPA 1P39A 2AD5A 4RCZA 1YRQA 3U3JA 4N8EA 3WO0A 1Z45A 2E2WA 4XB6B 5CA0F 4PX3A 1W76A 1IM2A 2CLLB 2UVQA 3DDWA 1TIBA 3USZA 3U5TA 1N6RA 1NRJB 3AFIA 2FMXA 1Q1ZA 4FX5A 1J2UA 1FJ2A 4KYUA 1XLTC 1PUXA 4IDBA 1TGVA 4KMMA 1GSIA 3PNBA 3OPYA 4KZPA 5AKLA 1KJ8A 4ZAWA 1ZVJA 1GCAA 2ZRBA 2O3JA 4C2UA 5B4VA 2YOHA 3GLGB 2C4NA 4CKEB 5JZBA 1EGQA 3B3AA 1IU9A 2QRZA 1FRQA 3GQBB 3LX6A 4HWSA 5C8DA 3HNRA 4U2CA 4UE6A 1MQ9A 1AQUA 2DBZA 4RESA 3W7VA 3FWPA 1IOZA 1AKRA 3CURA 3ESDA 2E1PA 5HG0A 2W6MA 4EB0A 5REQA 2VYVD 1H6AA 3CJQA 4LF6B 4KRFA 4L8YA 4I5GA 4YRKA 4N5DA 3ZU2A 5BRAA 1CDDA 3DHWC 3LYLA 1ZISA 3N8IA 3MCAA 1L9KA 5ECWA 1JKXA 2FPSA 2ZT5A 4HDRA 4N8DA 2P0AA 1U6KA 4D0GA 1GSOA 4TT8A 2PA0A 3RSLA 3TG2A 2RI6A 1YS4A 2EP8A 2DQ4A 2WW8A 2JBWA 3VR2D 4G5SA 2PUJA 1J0XO 4GW3A 1MRNA 1JL3A 1SVLA 4NOKA 1I7DA 3KJHA 2FG6C 3IP5A 4COOA 4HLQB 1T0BA 2CVOA 3OPMA 2OYRA 2WE8A 4GUDA 1XLVA 4HRXA 2B4KA 3RF7A 3TRFA 2I4NA 4IDNA 4ZYZA 3NNNA 3ZY4A 1J0AA 4FE4A 2NUPB 3HCDA 2BF4A 2V65A 3MS2A 4HI0E 1P2FA 1QDEA 1YFKA 2FKNA 2H4JA 4P3NA 1ZD4A 2ZSKA 4RGYA 3UAWA 1V8DA 2YY6A 5BSGA 2JH8A 2QP9X 2BR4A 1Q11A 4MS4B 5C1DA 3D1JA 1LEHA 1QTIA 3CX4A 1LNZA 3FDFA 3H6GA 3RVPA 3AMVA 8ABPA 2Z08A 3JSAA 5BO5A 2CL7X 1OX5A 4BFXA 3AP2A 1PEDA 1CHNA 4D81A 1QZ3A 4CKWB 4JP2A 4KK4A 4M37A 5TMEA 5FBWB 1IB0A 3GP3A 3JRWA 3U81A 2PUWA 3AJRA 4QAQA 3ABZA 1PK9A 3FRJA 1EGVB 4KLZA 3SE0A 1JTFA 3EAQA 3WTCA 5I7FA 4BMVA 3WAJA 1KMQA 2VS1A 3S3TA 1QMGA 2OM2A 4O4HB 2YWJA 3FLAA 4RL6A 3R7SA 3DQPA 4E2WA 1UXHA 1GA6A 3R8CA 3DMDA 3GAZA 4D3XA 1R50A 3CONA 2DSNA 3EVZA 4YGXB 7MDHA 1I7QB 3I8OA 6ADHA 1H3EA 2UUAB 1QG0A 1I0LA 4EB6B 1E9EA 4I14A 1U6JA 1GGNA 1U2RA 4UKDA 3UJ7A 4B3IA 4H7EA 2FUG6 3MFYA 5H81A 3HB4X 1C8LA 2HV9A 3EDRA 3D3QA 2J0QA 4WD3A 2I33A 3BX1A 3A6LA 3RVSA 1JT2A 5MGBA 2QQEA 1UOEA 1NM5C 2ISSD 1Y0BA 1O3YA 4PO1A 1E61A 4B87A 3MJEA 3KVOA 5CXUA 1KO1A 1UMDA 1PEAA 1R6UA 3N8HA 4IF6A 3AILA 3AF4A 3EK2A 1C5KA 4M98A 1KXZA 4ZDKA 5JBQA 1XMQB 2GBIA 2XGGA 1XEAA 1VE1A 2QEQA 1JW9B 2IEAA 2R1VA 4JJ6A 4IKPA 4J0GA 3HYCA 1EP2B 4Z8XA 3LHKA 4XDHA 3V8QA 5C4IA 1O77A 3I04M 4OQDA 1I51A 4GX5A 2FQWA 1RVV1 5AJHA 1Z8DA 1ZN2A 3OP4A 4DY4A 2F4VB 4NCNA 5J1SB 3MCZA 4O2AF 4KSYA 1GLNA 2D0PB 3CR3C 3R0IA 4JEUA 4TTPA 3D2LA 1DWOA 2GPJA 3IEKA 3PGJA 1XNRB 1Z6PA 2QUBA 3GARA 4LJAA 4O4JB 2G5CA 5EE3A 4ZVVA 1ZSYA 3DO6A 2BHRA 4RIFA 2MOKA 1CVLA 5FBQB 3V2GA 4BEJA 1H42A 4KQ9A 4EG7A 4F2GA 2FQYA 5DNVA 4B48A 2PHZA 2J1LA 2G0TA 5IM5A 5G3ZA 3WNBA 3ZKWB 1Q2UA 4NSNA 3TOXA 3HB9A 2IUUA 4BMOB 3WNQA 3EX7C 3KOWA 3HPRA 3KYDB 3NMUF 2OZVA 4I3FA 4OQMA 5HW0A 1B2RA 2XF8A 4RAQA 1E2FA 5CB8A 2FFQA 4MUJA 3LBYA 2YJ3A 4RS3A 2EU8A 1CIJA 3C3JA 4KNVA 3V8NA 4F85A 2OV6A 3U4IA 1UDWA 2CF6A 1I36A 1D0VA 1DC4A 3HVJA 4RD3A 3VAAA 1JMVA 1V95A 1C3JA 3P9SA 3EIWA 4M0FA 1QUFA 4ENWA 3OZUA 3RTAA 3E9YA 2RGYA 3B85A 1WQ1R 3UK2A 2HDWA 2WVGA 1L9XA 1XTZA 2EAUA 3DULA 4RVHA 3K2QA 4YMSA 5DFAA 6YASA 3C6QA 1IN7A 1FDUA 1NQ5A 1Y81A 4L4YA 1U65A 4E1BA 5CIYA 2R1ZA 4J1TC 4IIEA 4W99A 4ACAA 3I62A 1JB1A 4JQSA 3OEED 2QVGA 2O1EA 4NBSA 3B2NA 4IXTA 5G4LA 1TIKA 4CKYA 2FW8A 2ZCJA 4R1MA 4A10A 4IRMA 1VMDA 4DSOA 1D4ZA 4E5MA 4BFZA 4HK4A 1MVOA 1TA0A 2GDJA 3LBFA 3LQ2A 2CDNA 2Y27A 1CKEA 2VWQA 4M8KA 6REQA 4UBOA 4Y0VA 3QVMA 4KITB 2HIHA 1SBYA 2GK3A 2VK2A 1KI4A 1L1QA 1UOPA 1RXIA 1KVUA 2HJWA 4QGAA 4URXR 2B8TA 4BFSA 2XZPA 1VIAA 3QG5A 2AJLI 2AFVA 1WA5A 4W1PA 2FGKA 4KI0A 4I5FA 4Q3NA 4YRPA 1YQGA 3JU3A 2QRVB 3HY6A 3NCTA 2O2CA 4TV8B 3T9BA 3D3JA 3MHPA 4JUBA 3C3AA 3M33A 5LQCA 2JVKA 1VL6A 3TE7A 1RABA 2PL1A 2WYIA 2YUTA 5AJVB 4CDNA 1W5BA 4Y2HA 1KYYA 3VHXB 4C7XA 1EP9A 2G63A 3E4DA 3WXBA 3SYRA 2KE5A 1N0IA 3DZDA 1SUAA 1BNCA 1QXSA 1T9HA 1A9YA 1ADYA 5AQ1A 3ADDA 3K9HA 2P68A 1D2HA 2CLEB 3K0AB 3JWPA 2ZT7A 3K5IA 2O1SA 4TZKA 5DK6A 3SVLA 1YKSA 3DMPA 1ISMA 1I4LD 3CZRA 4UBKA 1ZXLA 4L7QA 4B3XA 4X1KA 4IDHA 4HNUA 1HR0B 1Z4KA 4QJIA 1JI3A 2EEZA 3EA4A 4L5JA 2J9FA 3H16A 2HMVA 1L1EA 2I29A 2P2CA 2W2LA 3RHTA 3X3HA 1N78A 1PW7A 3C1OA 3BG5A 3T61A 3G9TA 1B14A 5DTEA 3L93A 1TTQB 1CEYA 4Y2JA 1FNMA 2DUMA 2DH6A 1QBGA 4HFMA 3HJUA 1ECGA 5GIPE 1J00A 1XDZA 5D3QA 3OZEA 3JD0A 3OM1A 2ZSJA 2B20A 3UMSA 2H5LA 3OD1A 4U4AA 4A2WA 1N5KA 3MK31 4HL6A 1GEGA 1I5OA 2A5LA 5LD2C 4LNHA 3U6KA 4P7BA 3UHPA 1JMKC 1XXLA 2Q4TA 4C3UA 1TKBA 4FJ0A 1IBCA 3SM9A 2R0QC 1PR5A 3EWIA 1ZRSA 2P67A 4DN6A 4RQTA 1CJTC 1DBSA 1YOBA 3OQOA 3TBKA 2ZAMA 5E0OA 4W6ZA 4CWAA 1IUPA 4LY9A 5FFFA 5HKKD 5JTTA 4DBLE 1N5MA 2JPDA 2VAPA 4J6FA 4DLZA 4IH9A 2IF2A 4RA9B 1DRWA 3MRXA 4KXUA 5DM1A 4BBAA 2AG6A 4D56A 1UIRA 3AU8A 2PFGA 2DWUA 5CUQA 3SBDA 5MDHA 4PNZA 2ZVQX 1W4BA 2FLWA 4R2JA 3I3OA 3ZQ4A 1I9CA 1KARA 2YOGA 1V9CA 1WMAA 3HSYA 2H9IA 3N3AC 1KSGA 3QPVA 3OEWA 4BQEA 4OQ4A 2IBMA 2YV3A 3OCYA 3DUFA 3FSEA 4CM8A 5D7NA 4RVNA 2HKIA 2QL5A 3K2IA 5EOVA 1V7PC 2PAFA 5FUWA 3Q5EA 3HABA 3GRPA 3I5AA 4MP3A 1SAYA 3JAKA 3RFFA 1L5YA 4TS4A 1L7DA 4LKRA 4KIFA 2LDXA 4IYJA 4B4DA 2XXAA 1SKQA 4Z3DA 3UB2A 4D8VA 2CD7A 2Y99A 3CLVA 5AVUA 5AW1A 2QK4A 4H2DA 1ZGGA 5ED0A 1WVIA 4YX9A 1T6YA 1H8ED 3W1VA 3JQ7B 2A92A 4HNQA 4XGIA 5SY9A 4YQFA 1LWOA 2KYRA 2M6LA 2BEUA 5CFRA 2EC5A 1T3ZA 2PZFA 3DZJA 4XUEA 1RADA 1R4MA 2AG1A 1NRXA 1XEXA 3PCXA 5IYZB 1XTIA 5E1OA 2LD4A 2D6FA 1Q0ZA 1UXOA 3GLRA 1HOXA 4PPGA 4CBVA 4FGLA 1NAHA 3D3WA 3ER8A 3WYCA 4V38A 1K5DA 2MU1A 3KL4A 1JLLB 3K6RA 1PEYA 1V11A 4RK0A 2AUMA 4XR9A 4GU5A 3V00A 1KIMA 1PS9A 2DKNA 2IGBA 2P3SA 3FWKA 4L85A 1XZLA 2XQKA 3PA6A 4Q4AB 3Q8XB 1L5KA 4YPOA 3C41J 3H05A 2QMHA 4QRIA 4ZRDA 3FNHA 3U1TA 4KAAA 3RKRA 4QGSA 3ILSA 1C4KA 4FQ8A 2GBCA 3SQDA 3STVA 1JVSA 3C85A 2QG6A 4Y67A 5GONA 1TB4A 1U7PA 2EXXA 3QVGB 2Q46A 4KN5A 3BL5A 4OQYA 4XIYA 1LLFA 2VO1A 2CNLA 3TW0A 3UXYA 3WLFA 4CETA 3I2FA 4N6OA 4JI6B 3W2GA 5J4LA 5K0FA 1NQTA 2V6BA 1RRVA 2PAAA 4PZYA 5C35A 1YTUA 2A3NA 4ZI7A 3I9LA 2Z0MA 1H1DA 3NT5A 4NU6A 3QELB 4ARVA 3GPLA 3CUTA 3M4ZA 4ONEA 3ZHTA 1W34A 4C4OA 4PCLA 3L06A 4K9NA 2RGNA 2D59A 4C0XA 4C2TA 2ODWA 4WKNA 1UJMA 5I01A 1MVLA 3TB4A 3NTRA 1RLJA 5A5VA 5K3CA 2DLNA 3RGWS 1Q57A 1VE5A 4FB5A 2ZIXA 1X0VA 2ZJ7A 1SUFA 2XI4A 3ZCVA 1VB5A 4IYRA 1GR1A 1HYHA 1BS1A 1RAIA 3SXUB 1UBJS 5AKHA 1FX0B 3L0IB 3BYZA 4I1VA 2MR5A 2XYRA 4JBXA 2FWBA 1T9KA 3H5NA 4BO6A 2X4GA 2UYHA 1PL0A 5D1HA 2D5AA 3FNEA 2RGCA 1JR2A 4J0CA 1NYLA 4X3OA 2FZ5A 3ZBQA 4EQ6A 1E69A 3NOXA 4MROA 2OAQ1 4P4UA 4YREA 5THKA 4Q12A 4C7VA 1GUDA 4DLRA 1M72A 4OHBA 4FJ1A 2FPIA 4WRRA 4C30A 2J6CA 1F6WA 2AI3A 2JKZA 2CE2X 1M2VA 1SU8A 3L4SO 2ORVA 2WIFA 3EXHC 1HZZC 1YUBA 1RAHA 3GHYA 5EJMA 3L6RA 1YB2A 2ZPAA 3BKWA 3K9GA 4CL8A 4XB2A 4L2IB 4BO3A 3IUNA 2JLXA 4G86A 5T7BA 2Q8NA 2BFWA 3WFJA 1JQBA 1MU0A 4ZV4A 2DQKA 3KQWA 2AEJA 4QQFA 2OUIA 4F92B 1G20A 2Q5CA 3EVFA 3VVCA 2I7CA 1GILA 2E6UX 4CEHB 1Q83A 3HFRA 5IAKA 2ZJAA 1IDN1 4AUKA 1JLKA 1YFJA 2CBGA 2V0CA 3AVUA 2ORYA 4KAJA 4O0MA 2J3EA 3Q3EA 2OHXA 4HWOA 4P86A 5I9LA 1P2DA 1DRJA 3PKJA 4GPAA 4M8NE 4YJ3B 4KQWA 1LDMA 3H0EA 2PBRA 2DGDA 3OY7A 4K8RB 4OA8A 1BGVA 4WZAB 3FWZA 5PNTA 2HWWA 4U0JA 3TUJC 5F7OA 5JXJA 2ZSBA 2BH2A 1CRZA 2VKTA 3JD3A 5THXA 4D4KA 2VDLB 3QWIA 3IRUA 3IULA 4KAFA 4KSBA 4OP3A 4RD6A 4ROTA 1K63A 4F4DA 3UUGA 4KPEC 2X5KO 5HXAA 4DA0A 3V48A 3JQQA 1U2GC 1HDGO 3BF7A 1M0TA 2IYWA 2H06A 4H7DA 2R68A 2DQYA 5HM8A 1TVMA 1ICIA 1QFMA 3L2OB 1A2QA 5JCJA 1R3UA 4MW4A 4WASA 4WVFA 3IJPA 1KYZA 4HMPA 4BNWA 2BN4A 4EHNA 2ZRMA 5THQA 4EUKA 3GLIB 3K35A 1G59A 5BNWA 1RC8A 2X77A 3HJFA 4EBFA 4KLAA 2CCKA 1EBFA 2MJLA 2ORED 4FYYA 5A3JA 1M2WA 3BWMA 3CZ4A 2J5BA 4YVFA 1YR3A 3QWAA