1T3ZA

Formyl-coa tranferase mutant asp169 to ser
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
427
structure length
427
Chain Sequence
b'TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGSSNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyl-coenzyme A transferase
molecule tags Transferase
source organism Oxalobacter formigenes
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
total genus 145
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1t3zA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1t3zA01
1PQYA 1XA3A 1T4CB 1XK6A 1XVVA 1XVTA 2VJNA 2VJMA 2GCIA 1PT7A 1XVUA 2VJOA 1XK7A 2G04A 1VGQA 1XA4A 2VJKA 1P5HA 2VJPA 1PT5A 1PT8A 4HL6A 4ED9A 1T4CA 3UBMA 2GD0A 2VJQA 1T3ZA 2YIMA 1Q6YA 1VGRA 2VJLA 1P5RA 2GD2A 2GCEA 1X74A 2VJMB 1Q7EA 2GD6A
chains in the Genus database with same CATH superfamily
1LVGA 1NN1A 1UMKA 3OKAA 5JSZA 2BFBB 1EJ2A 4QEZA 4MVJG 1XWFA 5LP1A 3S8EA 3H8VA 4P38A 4O0MA 1RRKA 4NG5A 2H5IA 4CM5A 4DRXA 5BSHA 1XEXB 3M3HA 4AICA 1E4EB 1GPLA 4EPWA 3Q98A 2PWYA 3VR6D 2CJWB 3ND7A 3GFRA 3ESRA 4MO2A 2KI5A 4HDNA 1TL7C 4WVLA 4UXIA 3WTBA 4DIUA 2WKQA 5M2QA 2Q4RA 2GPAA 4ACAA 3OT4A 2D6FA 1ULZA 3VXKA 4JXKA 4AYTA 1PQWA 3L8YA 3PC8C 4HS4A 1P1FA 1P2FA 1TK2A 2EARA 2FN7A 3VTZA 4GR4A 2FFAA 5EGSA 1T9CA 3A27A 1HDEA 3L0DA 2I8LA 2XSZA 1EFCA 5JPDA 3MJSA 3MSXA 4GSLA 2HOQA 4QYIA 3OZGA 3R74A 2PUBA 2V6BA 2P8SA 2ZB8A 1WW2A 3W90A 4NU8X 2F64A 1D8TA 3H0EA 3AEKA 2XVZA 2D5AA 2FJ0A 5LXTA 4HNQA 3WLQA 1NQUA 1LUAA 3QMPA 4I5DA 2HKIA 2DC1A 4TV8B 1O0CA 3OA2A 4KP7A 3JQFA 3VRHA 1YO6A 1DG9A 2P4SA 4RFVA 4IR7A 1TQ4A 1SCQA 4Y18A 3U4HA 1YR9A 3IELA 1YL6A 2PX6A 3TKYA 4BWYA 2D1FA 2J0QA 4DWOA 1IY9A 2DCMA 4TLCA 1XPOA 3OTWA 3DEYX 4INZA 1D2HA 1QFMA 2I2AA 2VSNA 3F8TA 2W71A 3KC2A 5E95A 1KF0A 3FB1A 3B82A 3FDJA 1A9ZA 1G41A 4W7IA 3ZDBA 1XO1A 4G4SO 4BFCA 2J4DA 4OHZA 2Z8YM 5DNAA 4BRUA 1GOTA 2XITA 5IX8A 3B13B 1PZGA 2EBFX 4DQKA 5LQJA 4YLEA 4XQEA 2CZGA 1IN8A 3ZVRA 3OT1B 2W2QA 4HOYA 2CBXA 3SJAA 2Y71A 4WTOA 4GBJA 1FYFA 2BSXA 2DYKA 1CG6A 3I3OA 4QTZA 1MO4A 1GUFA 2MSDB 3R0QA 4IGAA 4TUYF 1GPH1 1GL3A 3C85A 3ML1A 3TDMA 5J1SB 5TJHA 2QG6A 2QUIA 3FTDA 1S7CA 2CNWD 3P20A 5ESDA 4MV4A 1XMPA 1T2AA 1PD1A 1SKUA 4GXTA 4WLNA 3OAAD 5JD4A 3NWEA 5B7NA 5JYBA 3EPJA 1H4QA 1QRUA 4EW1A 2GERA 4GQBA 1XCPA 3LHIA 5KSYA 1HGXA 4Z54A 1XXHB 2FFHA 2KLBA 2OE2A 2XXJA 2QTRA 1CYEA 5B5SA 1I1OA 1GL6A 2GBIA 1ZRNA 4UULA 4M54A 1YB4A 4PFSA 4J1TC 5CCDA 1B74A 3NBQA 1PTJC 2WC1A 2Y1GA 3CG0A 1JHUA 4ND4A 1MVOA 1A88A 1AS3A 1DO2A 1QGUA 2HA3A 1R2QA 1U7UA 2HU2A 2P5YA 2IU6A 2W5UA 2YVKA 3NM4A 4FFNA 1FVOA 3SQMA 3TTVA 1A77A 1DSSG 2CUNA 3QPCA 2HMSA 1YZFA 3G5TA 1R0YA 1CR6A 1YK1A 3D43A 3I76A 3WNDA 1Q19A 2CT8A 1T3HA 3V2GA 1ZVKA 4S0ZA 3BJIC 1TRKA 2Q7OE 3KKPA 3NBMA 3NANA 4H7HA 3LA8A 5BMVA 2BEUA 5F51A 4U7JA 3U26A 4BY9E 5CXUA 4PO9A 1HC7A 3N2EA 1KYZA 2Q1TA 5CVEA 4DIDA 1JG4A 1U8EA 3GN2A 5K3FB 3U9TA 5HRCA 4XWWA 4I9FA 3VGPA 1PW5A 4DLTA 4D2IA 1U2EA 2LPMA 3VSBA 4OXRA 4TPKA 4XDYA 2BF7A 4JFRA 5J5CA 1XUOA 2YOFA 2DGDA 2JLUA 2GBGA 2Q2QA 2H08A 2EX1A 4WJLA 2CDRA 2JLCA 1QPBA 3MRVA 4B81A 3PEYA 2GXQA 3KTAB 5EWMA 1P9LA 4FYHA 4NONA 4DNPA 4MVXA 4ZC1A 1NV9A 5BN4A 1W4BA 4NSNA 4TT3D 4MGHA 1D4FA 4YS6A 5J3JA 1E4EA 2UZ1A 1RBMA 2EXXA 3QWAA 2HA2A 3O5AA 4BMZA 1YAJA 3UJDA 1OC4A 1HM5A 4DIMA 3KZCA 4NARA 1AQ6A 1US8A 3A1WA 5GOZA 4ZHQF 3V55A 3BFPA 3FFTA 2C8VA 1M2JA 1YCHA 3QKRB 1OXTA 1UJCA 1O95D 4RLFA 2DBVO 4YCAA 3U3DA 3UFBA 3IS3A 3KKQA 221PA 1K8ZB 2P6MA 3UK7A 3SZOA 2BBTA 2OD9A 3ZVLA 4AWAA 2W70A 1BCSA 2GZ1A 2H06A 2N1MA 2OCXA 2ZSUA 4JC8A 4RMJA 3HEMA 4J1NA 1OFGA 4AVYA 1Q83A 4BZQA 1KEEB 3DQQA 3OOWA 2PZEA 2ZRQA 3O8LA 4OIFA 5KQLA 3ENNA 2PQMA 2ZYAA 1A0OA 2P69A 4U2FA 3UJBA 4HY3A 1B23P 1RMQA 4CHTA 3ODPA 1P4GA 2VPWA 5HUQA 2GJSA 4X3CA 4YP0A 3MMPA 2JPDA 4RHUA 3TSYA 2OC9A 3KB6A 1PNQA 4TV8A 1G3MA 2DQKA 4HS9A 1LRKA 2GT1A 1J09A 2O7RA 2C03A 4YJGB 1DAMA 1UH5A 4CE6A 4YT8A 4YV0A 5KX5F 5JCXA 3K96A 3V8NA 2Z30A 1JG1A 3GVCA 3C6QA 1YMVA 2W0MA 4QZVA 1EIZA 1TD1A 1SVNA 2II6A 1PJZA 2X9GA 2YXBA 3L7NA 3M7IA 3P71T 3LXXA 3N7UA 3PE4A 3VU9A 4YDRA 1L5HB 5JZOA 5ALWA 4D80A 3DZKA 4F56A 4F1WA 2J6CA 4M1YA 4WASA 4L9RA 4F2HA 3AI3A 5AI9A 4ZVMA 1RJ9B 3DVAA 3HR8A 3SK0A 5CFPA 3ABZA 3RE1A 2WU1A 3BWCA 2Z2KA 4FYPA 4EVQA 3HHPA 3JTEA 4TL8A 1UC9A 1IJEA 2PKQP 2XAUA 4JVNA 3NTVA 4G1UC 7REQA 4KRGA 4XD7A 1NULA 4CZ2A 3QYFA 3CPJB 1U28A 1YVUA 3RABA 2X0JA 4JBXA 1M0TA 4CCYA 3O8OA 4GVPA 3TBHA 1FNNA 1I9CA 2A9QA 4QQFA 4UUQA 3TSCA 1NX9A 3P9NA 4BVJA 2YBEA 1RPAA 4YRSA 5K3EA 2UVDA 1C9KA 2WAXA 3P5BA 2XV1A 5HE8A 3K6JA 2ACKA 1VRCA 1ZESA 5JAUA 1NXOA 4LNUA 3DQPA 4Z86A 5LQKA 3D54D 1NUSA 1GRVA 2LD4A 1JHDA 2P62A 1NW7A 1RIFA 2GCIA 1CE8B 1DI0A 1XJ0A 4IXMA 4R9NA 1T10A 4MUJA 4TLDA 5DSZA 1FNSA 1VMDA 1I4TD 4Y2SA 3ZOKA 4K9OA 2WF7A 4LK3A 1H0RA 5HF6A 2QV7A 3PQ8A 3SHFA 1IK6A 3RC9A 3TL6A 3WRYC 4BMVA 2QM0A 3BAFA 1H2ZA 1RVV1 4WBXC 3IR6A 3Q7EA 4CTJA 4YAGA 5KVVA 1G8HA 2VUIB 4QXQA 5BNWA 1YVRA 5A4DA 4BTEA 1YB2A 1G20B 3EGXA 3TCNA 4V24A 4DB2A 3OIFA 3VKUA 1X15A 2YMPA 4FUQA 1SMKA 4AKHA 3ZVMA 3J81A 1FS6A 2XUDA 1QFXA 1SWWA 5TQ2A 4Z49A 1W4RA 2IYSA 2PUTA 2L69A 4X63A 3CG4A 2PRKA 1SOVA 4L4RA 3W9SA 3EQZA 1GAEO 1YWGO 1X94A 1BYIA 3T7RA 1M6NA 1R4NA 3M81A 2P3SA 2A94A 2OGUA 3BOSA 3BWBA 1V26A 1JDPA 3FY4A 1QO0D 2HO5A 1MFZA 1VQ1A 3SM9A 1CZRA 3IAM1 1YZLA 1AKUA 1OHHA 1XRJA 2ZXEA 3E5MA 3RSHA 3UYLA 2OCDA 3K1YA 1E89A 3V1YA 5DN9A 1M5RA 2ZE7A 4B6OA 3PXBA 1OBFO 3C5VA 1QAQA 1NDUA 1S9HA 4DIFA 2VJNA 1UKEA 2JAQA 4KOEC 1RABA 3HJRA 2H29A 2QRZA 3AR2A 2WWGA 2E4VA 3GLSA 4YEDA 2ISQA 1T3TA 4NRDA 5DTMA 2BGNA 5B37A 5BOVA 1P2GA 5AK5A 1FZQA 1UK6A 3UWOA 1BS9A 3DDCA 3QXCA 4GW3A 4BEWA 5K6TA 2OBMA 3UT0A 1M74A 2HUNA 3EZ6A 4U00A 4RCZA 4WIAA 1L3IA 3MWDA 2GHRA 2XWPA 1NR1A 2A58A 4YCBA 1MH9A 3KUUA 1CUFA 3TLGB 2Y9PB 1KIAA 1D1QA 2FF7A 2Y3IA 3KUXA 3PB3A 4PPFA 3TMKA 1WWKA 1NMEA 1MA3A 4AG6A 4GVXA 4QXAA 1Z4KA 5GZ6A 4DG5A 3R7NA 1QIDA 2KMLA 3U9LA 1ONSA 1G3UA 4KNWA 3TTTA 3EEQA 1UMCA 3BRCA 3UB3A 1R18A 3QMMA 4CMKA 1TC2A 2V4UA 1H2WA 3RHFA 3P2YA 3C3MA 1SXQA 1YE3A 2P4HX 1GTMA 3GJ5A 1ZUNB 2R68A 5E38A 4MAMA 3EXEA 5CLQA 1OX4B 3ICOA 4EGQA 5IJ9B 2A5GA 4FFOA 1W34A 4Q47A 1PTJA 4EHDA 1F2DA 2H3HA 4B3MB 5KYXB 3G68A 1DG1G 1Y7TA 3EARA 2OV1A 2ZBDA 1YDFA 5JS7A 4CL2A 4BQIA 5FBHA 1MX5A 1IUOA 3H42B 3EXFB 1W2HA 1QO0A 3BMCA 3I6IA 5DGCA 4JXJA 1LPAB 1ZGCA 1XZDA 1MG0A 3DM5A 2FG7C 3LT5A 2QI9F 1GHTA 1RRGA 5LXTB 1LC3A 4B75A 1OHHD 1UODA 2QTFA 2OXCA 5DJ5A 3JZDA 1KFEB 2G1PA 4IFIA 1FDVA 2DR3A 1PYOA 2XE7A 2DY1A 5DP1A 1EK5A 1BKYA 1NU6A 1PKXA 1SHTX 1UP6A 3A3KA 3NH9A 3K9WA 4R1PA 1JALA 4UBLA 5JWHA 5BRAA 4Y9SA 1YFZA 1YI8A 5CT6A 4JJ8A 5AJTA 4WOCA 2Q49A 4MJ7A 1P9RA 4GLJA 1BVYF 3DOUA 2OXFA 2Z98A 5G3ZA 1IC6A 2ZW9A 3M6VA 3RUAA 4F8EA 5KQGA 3DXZA 4H7PA 3LG2A 4PC1A 4Q7EA 3SYNA 2C2WA 2FUG6 3QM1A 4G4JA 1I36A 3UGTA 4O3MA 3FKSA 2NUPB 1TADA 2BMDA 3L02A 4PN3A 5LUBA 2QW1A 4PLPA 2VDNB 2QIPA 1DINA 3R7FA 1KZ6A 3G1TA 2J3HA 4L9WA 1M2WA 1R6DA 4I1RA 1T26A 2C1XA 1PBNA 3E22A 4R2IA 5JNLA 2WFMA 3D2AA 3RJ9A 3C3XA 5ICEA 5I4KA 4PU0A 1U7XA 2WYHA 1GAJA 3FUVA 4UZFA 2ZYGA 1VP9A 5E3IA 3VX3A 2OFFA 2Z5VA 4NI5A 1EXNA 5HWSA 1UPAA 4GLOA 2GJ8A 3B3AA 5B1IA 3WKEA 2ZR0A 3ZWNA 1UKVY 4OQLA 4YRGA 2X22A 2CLIB 4LDJA 3VH2A 4EHKA 3VKGA 1BE8A 3F4LA 5AVXA 4NY1A 2QGFA 1XVLA 2I2FA 4MUYA 5H0IA 5B3JA 2P68A 4B45A 5K20A 2WSBA 1HRKA 3VNQA 2P4UA 2RONA 3F8WA 4MTLA 4BNFA 1SELA 4CDMA 2B1QA 2KW5A 3UXEA 5DPMA 3CA8A 4H15A 1K0FA 4XB6B 3JALA 1V5WA 4U2DA 2RHMA 4HJRA 2XEXA 3CN9A 1EK0A 1JDTA 1OKKA 2HA6A 3CLUD 1Q0PA 1A04A 3E3LA 1NY6A 4HTAA 4HN9A 5KNCD 2O0LA 3JQFC 1O1YA 3PIIA 3QPAA 1BDIA 4C1BA 2GA8A 2AD1A 5MGNA 1CEEA 3ONFA 3VR3A 1NP7A 3L4BA 3ED1A 3BMQA 2REBA 2JATA 2Y76A 3D1LA 3KT3A 3KOZA 4HRVA 4M8IA 3NKFA 3PQFA 4F1KA 4NQZA 1C14A 1GQ2A 1R37A 3AZOA 4UU8A 1RCFA 1V1MA 5JE8A 3TNJA 4YAOA 1FRQA 2BELA 4OQZA 2JI7A 5DYWA 3DG9A 1YRLA 1GDHA 2KM1A 3C97A 1DIOB 1N5RA 1NMSA 3WWYA 5KX5B 1J0BA 1U3VA 4YHBA 4MPDA 2NU9B 3V4RA 2VOJA 1A96A 3HZHA 1YZUA 3KXPA 4F6CA 4XEUA 2QM3A 1SIBE 4PC6A 5E1DA 1OU0A 4DSOA 1HOXA 3OTGA 3R9WA 3K8YA 5A9SB 1NMZA 3ENWA 3GGPA 5DRYA 4K6CA 2PKQO 1I7SB 2XUOA 2QR2A 4KXXA 4ZU6X 4BFLA 3AI7A 1MOPA 3WLSA 2D0OB 1QIHA 3JCZA 1BGVA 4GLLA 4UATA 3UWMA 1J56A 4CYMA 3AEZA 2GILA 4S05A 4F7WA 2JFNA 1GSHA 2HWWA 2VEOA 2OXTA 3W5VA 2C00A 3FXAA 2J3JA 4MRRA 4HFNA 1QG0A 2HSZA 4FBLA 4EHFA 1VMKA 1K88A 4H3HB 1R9NA 2WM9B 3FWYA 1B8UA 4EH1A 2P65A 3TZ6A 4YK7A 3ZNOA 3G3EA 3ICCA 5IBPA 3FZYA 4ZANA 2Q3CA 3E8MA 4KZKA 4X24A 1RAFA 2FPIA 2Q3MA 2HMAA 1P6QA 1UL1X 3RSGA 3TG2A 3KJGA 1NM5A 1TZBA 3RAGA 2OV6A 3V7NA 5ARCA 2WTNA 3AJ9A 3H5RA 4GXNA 4ZDKA 5KNDH 3FZEA 5HR5A 1K68A 3CH6A 3CX7A 5DNYB 2H48A 5CGQB 3P9CA 1CVIA 1GXSA 4KR9A 3PUYA 4B7AA 3FVRA 3IUYA 1KPGA 4KPFC 4CTOA 3KQYA 2WYUA 1EDZA 2HRQA 3PJFA 3SIWA 3HBFA 4U6QA 4BO7A 4HDKB 2AG6A 3GFVA 3LF1A 3LP5A 1YJBA 1BQ3A 4B84A 2NUTB 2PBFA 5T3YA 5ESWA 3EZXA 2Y1OA 1U0BB 2BE7A 4QQKA 1WNTA 2UYGA 4CKEB 2BCEA 4JK3A 1T1IA 2CK3A 3EB9A 2H7CA 2Q5LA 3HP1A 3KJFA 5CT4A 2DHDA 2J30A 2Y8EA 3Q15C 4B83A 4EP1A 4ARSA 1VLQA 4BGEA 3DD5A 4AY5A 2JB9A 3VKWA 2VJCA 1IONA 5FA8A 4M1ZA 3SKVA 3RC1A 1H1LB 4JJAA 1AB6A 3IKVA 1LTHR 1H9BA 1YBFA 2DTXA 5JCOA 3X2EA 3HJNA 3EW7A 5BMVB 1XE3A 3M5WA 4YAKA 2C4WA 3IOEA 3G82C 4DLUA 4XTCS 4FB4A 4ZIRB 1AQUA 5L53A 1PK9A 4KXFB 2IU0A 4CL3A 2P2SA 2XE6A 3QNMA 3KOYA 2UZAA 3JD2A 3AUTA 5AKIA 1AQYA 3PWTA 5FTLA 3ZY4A 3ZI7A 1E2EA 4R6WA 1RI4A 1TUBB 1GTL1 4CKBA 2AX4A 4BVFA 4PGHA 3UHAA 2OGSA 5ER6A 5GZ1A 1IEVA 1R0XA 2YJ4A 2A3RA 2VCHA 2ID8A 5L6MB 4MLCA 4IFTA 4L7QA 3MWKA 3KSZO 2PIAA 1K75A 3DBHB 4B3BA 5C1PA 1S2IA 2CWWA 1AUQA 2HCBA 2BCGY 3TLAA 4FXOA 4BJ1A 4JEUA 4F38A 3IC5A 5E6SA 3VAAA 5IJ0A 2PKYX 5DGDA 4C7VA 5DTRA 1QOZA 2AK2A 1GZ3A 5ALLA 1U2QA 2H18A 2XHZA 3OX1A 4M8SA 5DHTA 2KJQA 3ZWVA 3W5CA 1NFRA 3DOEA 4J4TA 4UBKA 1PJAA 4JSYA 2BR3A 5EQFA 3U0BA 4BATA 5AW4A 2CXHA 2G25A 4I1UA 5JMOA 1Z8DA 2M2IA 3FYUB 5LOVA 2Y1WA 1NRIA 3IAS6 4FW9A 5B2ZA 3LE8A 1U3TA 2HDWA 1XFAA 2ZI3A 1QDLB 2UDPA 3CW8X 3JZIA 3AJ8A 4U02A 3REQB 3T3GA 4CI9A 2I99A 1CUXA 2I6SA 3NNDA 4HDRB 1SXJC 2JAWA 1S2LA 4CI0B 2R7NA 1OSNA 3EPLA 3LMKA 4OOFA 1TI7A 1SXJD 1UPUA 4URYR 5JG7A 5F21A 1O89A 4JBYA 3IVXA 2FWNA 5CUQA 3W2IA 2AZ4A 3EZLA 1M2OB 1AGNA 1P5HA 1HDZA 4LZOA 5F64A 3U3KA 4LJ9A 4I14A 3QVVA 2JH9A 3R20A 3U2QA 3WQQA 4GXQA 4IRXA 3DZGA 4DE5A 2ICAA 1JR6A 3KFLA 4Q9HA 4PZDA 2O1SA 1C7RA 1G4HA 3LQ1A 1KJZA 4XSGA 1ZXXA 2X1HA 5CD1A 1Q7GA 1ZJ6A 3GPDG 3M1IA 1L4EA 3N28A 1TQ2A 3QKWA 3TL3A 4C4TA 4EB3A 1EFAA 4H4CA 3PXXA 1D2MA 4F3TA 3GWZA 4HJXA 2WUVA 3OEWA 2PUAA 2XUJA 2IYVA 3EN0A 4Q05A 3EIEA 2XTJA 1QHNA 3R75A 4MCAA 2XB9A 4OHVA 1FIUA 4O3FA 4ZCRA 4EEXA 3JVUA 3DEAA 3LY5A 2FZ4A 2BFFA 3W2EA 3P45A 5A05A 1WVMA 4Z7OB 4NZMA 4D8WA 1Z3IX 1D6MA 5JH7A 1CUBA 1UT5A 1Y3AA 1DJOA 2GPTA 2Q1XA 3I34X 4Q5IA 4GLBA 4ZO7A 4YRPA 1XPUA 1MGPA 3HLTA 5KEIA 2WU3A 1OWMA 4K0RA 3SS9X 3UHFA 4L73A 1F8GA 1LRLA 5CB4F 5GOTA 5ITVA 1P2VA 4S1PA 4UEWA 2FJPA 4QE3A 1DWUA 2FG6C 2ZVPX 2XUFA 4Q21A 4KO8A 3C3YA 1ULAA 4FK8A 3IT3A 5GONB 1T8YA 3AB8A 2OYSA 2A4KA 1DKNA 2HJGA 3F97A 5AJVB 4J90A 3ZIAA 1KK1A 5C9ZA 3PC3A 4ASUD 1UDWA 2A3NA 2YV1A 4K46A 1WXQA 1UQTA 1R9MA 3ZG6A 2BFPA 3KEMA 5C5DA 3OLCX 1MIHA 2JGIA 4OGLA 1IG3A 4DMLA 3GZNB 3RLIA 1Q57A 3GD5A 4DKXA 2P9CA 4L2IB 2X8WA 2W58A 3GT4A 2HX1A 2P9ZA 1ESDA 5JD3A 3RYHB 3COYA 4HSGA 1V8DA 3PEEA 5FORA 3ZE7A 3EBPA 4AJHA 4B4KA 4N7BA 3DT9A 5JATA 2CCJA 2NIPA 3EVAA 2EJVA 1L2TA 3DE5X 1YHZA 5FWAA 3UVEA 1TVKA 3OUTA 3VNRA 2FRXA 5CU7A 1ZH2A 2ZIGA 4UOZA 5G4LA 2I4NA 3RVOA 5LQNA 3OIGA 4EY5A 5GJCA 2ZDHA 3AEKB 1XKLA 2W4MA 3OPMA 4C07A 2XCTB 4EMTA 5JVDA 4AJKA 3E4CA 2O0KA 4PSCA 1WXDA 3ORHA 3N53A 1P0CA 5FR2A 1VJ1A 2VF5X 4E3WA 1A9YA 3MQ4A 2DP4E 3ICEA 1Y89A 1Q2UA 2ZBEA 4AUEA 1D2NA 2OO5A 3L77A 2NSDA 1LD3A 3H5TA 4QXPA 5JAQA 1QQ7A 1EVYA 4O6VA 1SRQA 1YS2X 3ABRB 1QG4A 2IP2A 4UMEA 1ZD9A 3T5PA 1TTTA 2GBCA 2ZKIA 2CJPA 1YZTA 5C8YB 5JBIA 3E9RA 3ZBQA 2VAMA 1VIAA 3FIJA 5J47A 4F04A 2ANBA 4KHZA 1QF6A 2B9VA 2VF8A 3GFOA 4MW4A 1K4YA 2C5FA 1DC4A 3PUKA 5CVJA 5B4UA 3AVQA 1SU7A 4WZAE 3PUXA 2MSCB 3R6LA 3FFBA 1Q50A 4L0QA 2R96A 4QFMA 4DM7A 1EX9A 1YVPA 5C4MA 5L3QA 1YF3A 5TEWA 1O0BA 2P35A 5A2QA 2CN1A 4WKGA 2J3EA 1GAWA 3TW8A 1N2GA 1VJGA 4UUBA 1Z2CA 4DCSA 5JZ9A 1SEVA 5E4YA 5KU7A 1V7QA 1I3OA 1C3EA 2AUNA 1GLVA 1AY0A 1FYXA 3D64A 5DGIA 3Q8MA 5LN1A 4JX8A 1R9JA 1ZLYA 3O3OB 3T5DA 4R0MA 5ETJA 1GUBA 1I3LA 1IZ0A 4Z8YA 1N2BA 2K2WA 4KTVE 2X5NA 1BJRE 3OZSA 3FNHA 2YIDA 4YIHA 2XTNA 3M89A 3VZPA 2CNWA 1P4AA 4WAUA 4BZXA 2JIMA 5DK4A 3QI2A 4BAGA 3PA6A 2UZIR 5C32A 4TS1A 4PYOA 1DX4A 1AUPA 2VWGA 1T2NA 4L4SA 4GUAA 3RNOA 1QIIA 3AHFA 1XRQA 4NDNE 3UT5A 2HGSA 5ABPA 4Q00A 4DS3A 3WICA 2Q3LA 2ORED 3NW9A 5DSXA 3F6BX 4K88A 1NBOA 5KTTA 1Z26A 1LDEA 4KAXA 4N6GA 4BNDA 1KJNA 5C8YF 2LRHA 3TEJA 4R40A 4ZVQA 1OWNA 2WVHA 3CO5A 1NW3A 1Y9EA 2IOFK 4HWGA 4KLCA 4OFWA 3ZWYA 4DXAA 4RTMA 4FYMA 4AYXA 4ARVA 4CIYA 2GD0A 3DJYA 2ZGVA 5CG2A 2HFKA 3PRJA 4JH0A 3KWJA 2FQWA 1LDYA 4Q4JA 4TWAA 5FQNA 3T3EA 5LP6B 1PJ2A 3I01M 4MIEA 4AMZA 2FZWA 3A9SA 2PHZA 3H11B 4RMGA 5PGMA 4BZWA 1T8TA 1WULS 1LC0A 4KXLA 4G4IA 1TZKA 1H6DA 4OA8A 1X7GA 1OAOC 3EA4A 5CNKA 3AP1A 3SLRA 3K09C 3OX2A 1ZSYA 3UFXB 3V97A 4AQDA 4B6GA 5LOVF 4YCNA 4OVKA 1L5VA 2IBMA 4IDNA 5FOUA 4DV7B 3UC9A 1SBQA 4N5DA 2H00A 3EYAA 3TXXA 2I80A 4QUHA 2QVZX 3SC2A 3BXEA 1E1KA 1E3WA 2HSJA 3WK7A 3VHRA 4C0SA 3T8YA 4DCPA 1MJGM 1YRYE 1VL5A 4GECA 5HPYB 1YSCA 3PRKE 2VH5R 2FA9A 2FSVC 1G6OA 2HWYA 1B1CA 5LB4A 1F2TB 3RAPR 1U8UA 2ZPAA 3OPVA 2IOQA 4K28A 4MEAA 4KN8A 5CNMA 5H5JA 4BRWA 2PWAA 3CB4A 3CWZA 4FW8A 3L92A 4B6RA 1UBJS 4C7BA 1GL9B 3WZ2A 3B85A 5T5QA 1ADGA 4BCCA 1XQWA 1GNRA 3COJA 1GVHA 1R88A 2FR8A 2RGRA 5KTOA 4GX5A 1ODTC 1WW3A 4FGLA 1ZGHA 1WKBA 5EPUA 2YZ2A 1H2RS 1QYCA 2EWMA 3H3FA 3JRWA 2VNSA 4IGIA 4JASB 1E9CA 1EDBA 1Q0SA 1VBKA 4H31A 3NDIA 3UH1A 3Q5GA 4K6MA 2P75A 3RB8A 1ZD5A 3U4GA 1NF8A 1KYQA 1RXUA 4EGCB 2N42A 4F9EA 2BONA 2RAPA 2XVYA 2AWOA 3BMNB 3MQFA 3RTCA 1O9HA 3LWBA 1U1FA 2JFOA 1GR1A 4LJAA 2A5DA 3VUFA 4REQA 2BFEA 2O5CA 3GCZA 1KVQA 1OV6A 4DA7A 1TM2A 4B44A 4RK7A 4D9KA 1OGYA 4FOOA 4AI6A 2G09A 3OJFA 1CR2A 2EKPA 1KBZA 2QRVB 4GMFA 4V0SA 2C20A 2QUKA 2PD4A 2RGUA 3KYIB 4GUDA 5SICE 4EABA 1KAOA 4X62B 1P31A 4X8OA 1Z7WA 5JDIA 1F0PA 1M67A 4Q0MA 5FBWB 4G5HA 4C4OA 5A4JA 3UMFA 4RTQA 1T43A 1VLZA 2AIRA 4EG6A 4G24A 3I2FA 1ZHFA 1WU7A 1Z2OX 2AN5A 2FMHA 3A1UA 2V98A 3D7MA 4IIJB 4LC0A 4XPIB 4JC5A 3U40A 5IC4A 2JFFA 3WGOA 5HIIA 1KP3A 3JVEA 4I5EA 1WXEA 2HK9A 5EUMA 3HLKA 3ZX5A 3PE3A 4YUAA 3CZRA 1RLMA 3A4VA 1SA0B 2C83A 3LVFO 621PA 2VYFA 5C8VA 1VG8A 2CVHA 2YWGA 3KDAA 3AEUA 3UAWA 1Z08A 4F46A 3SDSA 2VVTA 5SV2A 2OFPA 2IQIA 3AV0B 1OFHA 4BKPA 3WWDA 4Q6WA 2NZWA 2JGDA 1QQBA 4YMGA 5BOSB 4AN0A 1NUQA 3IALA 3KX2A 2PZ8A 4D0GA 1PVOA 2I2BA 5JIBA 2X2FA 3N2GA 5FO0A 4JB0A 3M0EA 3WWZA 4AXBA 1CQPA 2VYND 3BGDA 3B8EA 3SHWA 1DAOA 1Q1AA 1QIGA 1GGEA 2WYVA 2VPTA 3G02A 4Q16A 1FJ2A 3MS4A 1GPAA 2VJDA 5E2BA 3RRXA 3NOOA 2YWCA 1L7XA 3I30X 2AJCA 2XOEA 3L2OB 1HG1A 2JGKA 5A3RA 2PT5A 1V11A 1JW9B 4KYVA 2PNFA 3OMLA 1BEZA 2I1WA 2AJBA 2X41A 4UTRA 1IBCA 4LNUB 1ZSNA 1ZI9A 2G3YA 2ZT6A 3LUBA 4H7IA 1SCIA 3A4NA 4L3VA 4FI3C 4ICIA 3OKPA 1CEQA 4CQMB 2QRMA 3LPAA 5LDGA 1V16A 3OFKA 3RS4A 2CXNA 1UK9A 2ZR7A 3AH8A 1C30B 1NVVR 1VP3A 3ETNA 5DV9A 1AXEA 2VYQA 4CFZA 1OLXB 2YFKA 3OPQA 3V48A 2QN8A 2IEBA 2PCJA 4MCHA 4YRQA 2QMQA 1XA0A 2YV2A 3HVIA 3HB7A 4CF6A 4KLAA 1QTQA 1JR3A 2PMFA 4OYLA 1JBKA 1LS6A 1WBJB 1D1TA 3EZ9A 3RS5A 3F9RA 4LFCB 3AR4A 2X3YA 1B14A 2IKQA 4HYQA 4PXYA 3QFHA 2VHXA 1OH5A 5L3SA 4C88A 5LUAA 4EL0A 1JYFA 1FU8A 3CUYA 2Z9CA 4CMHA 3UXYA 5HF8A 2AJ8A 2GZHA 2YWBA 3U49A 1ADCA 1KDOA 1OZGA 5IS2A 2NV6A 3QU7A 3E2PA 1CC1S 1FEZA 3BIJA 4CM4B 2EU8A 3CUKA 2IOHA 5EESA 3JD1A 3RDPA 1P1HA 3C48A 3DL4A 2W22A 3OMXA 4WXPA 3IODA 2ZCUA 3ENKA 3FVVA 2XQVA 1ADBA 4QYTA 4QM6A 5LQCA 1XL0A 1U9YA 3QIVA 2PMDA 3A4YA 4TTAA 5BP7A 3M49A 1R3UA 3AYXB 5LIPA 3I04A 1X8XA 3SSNA 1N6HA 2FMXA 2OHFA 1WSAA 2QLJA 1P1IA 2HIAA 3ESAA 1D2CA 1E6CA 2JI6A 3ZX4A 3LKBA 4A7PA 4ZK6A 1HTWA 4GX0A 3TW4A 3Q3EA 1ZHOA 2EP5A 1Z75A 3OOEA 4O29A 1JXAA 2MYTA 3IPLA 3I23A 4ZV9A 5AVVA 5EQTA 1Z73A 1KVUA 4CKZA 5IJXA 5H80A 5EWJB 2QMEA 1RYYA 4LDQA 4F8JA 1OREA 1K7FB 1V1RA 5ICSA 3SC4A 1G5TA 5FTJA 1T6ZA 3L0SA 2HFJA 1UWCA 1MEOA 5F4BA 2XYVA 1KVRA 1AN9A 3LZCA 1P3Y1 3ROTA 5JALA 2FXIA 3KYCA 1ZI8A 3GW8A 3W7AA 1ENPA 2VAWA 3L43A 4MLZA 5IUKC 3VDRA 1V95A 5TMEA 3UV7A 3PTLA 2ZQYA 5I9BA 4Q3KA 4L8VA 1M34E 2DFPA 2G1UA 5K3FA 5HZHA 4ANFA 4UM9D 2J41A 5M29A 2VZ0A 4ETMA 1YL7A 4WV3A 4EA7A 3ZR4B 5JQWA 2V96A 1Q22A 3AU9A 3MAAC 1VDZA 1AXGA 1Z4OA 1VG0B 5EQJB 2WY2D 1YGYA 1OLSA 1ZCAA 2ZOSA 1T29A 2V9ZA 4YPFA 5A5EA 3OQMA 4MRAA 4ZN6A 2EQAA 3OESA 1ZJZA 2VDPB 2Z4TA 2ZKLA 1C50A 2FK7A 2ETXA 4NCKA 5FA6A 1LJUA 1VL2A 2DPXA 3BSSA 4XA8A 5A0TA 3ZDYB 3QMVA 5A4KA 2Y0PA 2AZTA 2W2MA 4FP9A 4XUEA 4BVBA 5ED4A 3KR1A 4DMFA 2EL7A 4FHZA 4LG1A 1UM8A 4M9RA 5EIAA 1QP8A 2NVBA 3BJRA 3T1VA 4MUAA 3ZTYA 1U11A 4FDAA 1U0GA 1FFSA 1V6AA 2W9XA 4IOLA 3E35A 4OHCA 4UU7A 4H0FA 3GLFA 2AYZA 3ISTA 4R31A 1GPJA 1Q95A 3RK1A 2ECKA 4FD3A 3K53A 3REOA 4B9EA 4DYDA 2UVPB 2ZG6A 1I01A 4FIDA 1GNQA 1EAMA 1JHAA 3U7HB 5LKRA 3GEGA 1L5SA 4W6ZA 3E84A 2YVLA 3T7KA 3VVCA 2FAXA 1XV5A 2G7MC 4HAWA 1P1CA 3WIOA 2XRMA 1D0VA 2PEYA 3OOJA 5HEKA 4DQLA 1IN1A 3FBTA 1GKYA 2I87A 4L6AA 2OCLA 5CH8A 2O52A 4N3AA 3RWOA 4F9TA 1K8QA 3QUQA 1FUYB 1OT3A 3M6IA 1LBTA 4XFDA 1CNFA 1G5HA 1UCFA 4E07A 5DNCA 1Q7BA 3KZVA 3UPDA 5JJBA 1NBMA 4WY8A 1FMTA 3W1VA 4BN4A 1DMRA 3HA5A 5ITSA 1ELOA 5COBA 5F3WB 1PS0A 4RUKA 4LY0A 1E3DA 3X0DA 1IATA 1ZGJA 1W0CA 4M37A 3UMGA 1OT5A 2F3TA 4UREA 3M3DA 4NZYA 5JROA 3HV0A 1KSHA 1Q77A 1U6JA 2H63A 1R27A 1RI3A 3EEYA 1CVRA 3JTMA 4Q4JB 2GDZA 1FK8A 3PT9A 2GN1A 5T64A 2OOKA 1G0NA 5KAPA 1AKWA 1RXCA 5BYJA 4CIWA 3W8NA 5LP6C 1P7PA 5IM5A 3OE7A 2AKAB 2O1XA 4O2LA 1Q0LA 4Z9XA 3H17A 2DM6A 3WHKA 3V9PA 4DIEA 6GPBA 4OQXA 3HNOA 4CIBA 1PQYA 4HQ0A 4EI9A 3KYJB 3OO0A 4MTCA 1US8B 2PGNA 2R6DA 3PKIA 2B34A 3SYTA 1KZYC 1BG6A 2PSSA 1M0EA 4PICA 1DV1A 1NPTO 3ONNA 4IKPA 1USGA 3W2HA 1YZ3A 3PNPA 2OOSA 2Z5FA 2CB0A 3OHPA 4E5KA 2X9NA 3KCNA 1DKQA 3E5RA 3GUZA 4IDAA 1IZYA 3B6JA 3BD8A 3CX8A 3R24A 3WKAA 4NR0A 4OK5A 2EW8A 1RJGA 1BFUA 1C8BA 3OQ6A 5B4VA 1UFVA 3WBBA 4Z4EA 1J2UA 4ZJYA 2C57A 2ET6A 2FSVA 4KYIB 4F86A 4EM6A 1GL7A 1KI7A 3IB3A 2AJTA 4F7DA 1F9EA 2GK3A 3UJPA 3VA7A 4HQRA 1OGIA 2LE0A 3D6NB 1NRJB 3WXMA 3F2VA 2QU8A 3G13A 3QWHA 4D4LA 2HA7A 5GADl 1N4AA 4OBBA 4C4PA 4A03A 4HV4A 5BWOA 2QD5A 1XK7A 2CL0X 3KP1A 4GPTA 2AF3C 3IV6A 4GT1A 4I46A 3MPOA 5CT8A 2FVYA 1U5CA 2WDPA 4L0DA 3GLGA 1ISHA 4DQDA 3F5QA 3OHSX 4ED9A 2Q5JA 5FPQA 1UKAA 3PC7A 3PYMA 2OK7A 4UHJA 4BDSA 1O97C 2C3PA 4QM7A 2FZCA 3H1GA 1MFPA 4AJ9A 4BMOB 3S4YA 1MIOA 4QJ5A 3ORYA 4GRAA 5B6PA 4V2UA 1T4MA 2N0SA 4Y6RA 4RDCA 4S3MA 1AV7A 5E3HA 2D1RA 2QVXX 4HDQB 4K03A 3RT9A 5ISMA 3P52A 4J4BA 5KQRA 5I6DA 5ELMA 3PGJA 3ONEA 4M60A 3WB9A 4YMHA 9MHTA 4GHWA 3JWPA 3QF4A 3GLQA 3RYFB 5L3RA 5B1EA 5LQMA 3PT5A 3RIGA 3KLPX 3M70A 3WL6A 3FUCA 5ITZA 1FC0A 4RY9A 3KEGA 4H27A 1JIXA 5EMNA 4FNOA 3IB6A 2DEUA 4G0UA 4RKQA 1E9VA 5H81A 3VYSB 5CVDA 1ECPA 4LYEA 1WCWA 3CJRA 4ENSA 2GCNA 2C29D 3L07A 1S3SA 1T8WA 2NYAA 3CO0S 2F43A 3HA3A 3HNPA 3K1JA 3TQSA 5G4KA 3HXKA 3WV4A 4Y2HA 2VTBB 1JMYA 2D2VA 3N2IA 4LGCA 4FJ0A 4N0EA 1JFFB 3MT9A 4L6CA 2QU7A 1S01A 2JFZA 2X5JO 3N5KA 2R6FA 2UXDB 4G86A 1DAEA 2NSYA 2W4IA 3TCKA 1DDOA 4MUXA 4EDHA 2I91A 2HIGA 2AE1A 1B0PA 4Y1GA 1ADJA 1B73A 1X77A 4P33A 1YDMA 3WIDA 2VJYA 1WVGA 1Q0QA 3HB1A 1JHXA 1IVNA 4LY6A 2Y1DA 2D2EA 3X1ZA 2GF9A 3FTEA 2Q29A 3E81A 4CEIB 5K51A 3JAKA 2BFFB 1NTRA 1Y98A 4DJEC 4L50A 4D9CA 1OBHA 4DCJA 1JFVA 1F8YA 3F6EX 4X44A 4MI1A 4CTMA 4JP8A 2ZI6A 3LLVA 4KPYA 2PUVA 2JJ8A 1V9SA 2XF2A 2H2AA 5KSWB 4ZJUA 5AVYA 1BO6A 4DN6A 4RK5A 1X1EA 2PMBA 4XR9A 3K15A 1WLSA 5GZ3A 3EOZA 3MWLA 1XVUA 3JPYA 4EDFA 1BS2A 2K4MA 1AK9A 2C9MA 1FNCA 2HHAA 1KH1A 2X1MA 3OD5A 3ZHYA 4DLSA 4P58A 1YAHA 1IVYA 3C3WA 2O8FB 1F6DA 4B3JA 1DP4A 1JN0A 1XROA 1Z7BA 1TM3E 2RGDA 3BICA 3BWVA 4LJYA 5TVGA 3ZCXA 1TCUA 1GTRA 1HT2E 1MC1A 1DZ3A 4MW6A 4Z5XA 4MNTA 1OILA 2CLLB 2CVOA 1ZMRA 1J8MF 2I66A 5JLJA 1ECFA 2ATXA 2QZSA 2X6TA 2GJ4A 4X8HA 4MAAA 3QEAZ 1IY2A 3ZU5A 1R1DA 1AUOA 2IEDA 2R79A 2XEDA 3A0UA 1JVSA 4J76A 1JKJB 2O07A 1AQNA 3S2UA 1OXXK 2FWRA 2NMVA 3NTUA 1OLOA 4RZ2A 3M9LA 1ZJWA 3GAFA 4WZBE 5FI0B 4KR6A 2ZSHA 1N36B 2ERCA 4KQKA 1SKYE 4RSHA 1XELA 3IULA 5TT1A 2A59A 5IKOA 4FZ5A 3IP5A 5D1HA 1C4XA 4KHPB 1SUCA 4TL7A 2JKYA 4D43A 2NXWA 2CSUA 3RFCA 4M83A 3FOAA 1EVQA 2RFLA 3JW8A 2E5FA 4HVAA 3EW9A 2TMKA 1X13A 2X5OA 4KMSA 4AY4A 2J3IA 4C6RA 4BE4A 4AO7A 3UPUA 2YVQA 3FNFA 3ZU6A 1I5EA 1L8OA 4FYJA 3OTIA 4LSWA 4MVCA 3GMDA 2B4KA 4ZT6A 4R1NA 3KETA 1W5EA 2PVPA 4KIWA 4Q3CA 4F6LA 3V8EA 1FFBA 4RBNA 3MMNA 5E4TA 4COKA 4PS1A 3I6ZA 5FQOA 5K3CA 1EFRA 2JEOA 2Q1YA 4K2AA 3TEMA 3ONVA 1W49A 1DKUA 1VJRA 1XQXA 2MYNA 2GNOA 2XB8A 3FCXA 3OLWA 1O96B 4I5GA 1WMDA 4G85A 2R8ZA 3QUAA 3WWOA 2X3FA 3PQCA 1TM4E 4BLQA 4X84A 4IQ4A 5EPOA 2I3GA 3AYZB 2P90A 1MV8A 2W7TA 5K2OA 4BO8A 1XZKA 2ZP1A 5A6SB 2IUUA 1ODCA 4MEBA 5THQA 2BC9A 3UHOA 1RBQA 4J0IA 1NV8A 4BFUA 1QGED 2O8BA 5C7LO 1UEXC 1WUJS 1OI3A 1O6BA 3AEYA 4EMSA 3S1AA 1XD9A 4IHQA 3U7GA 1U9CA 4OFBA 3A3PA 3X1YA 5DTQA 5E4JA 3ZWPA 2ZPUA 1M54A 4RVGA 1ZH4A 1VHWA 3M34A 4IDGA 3RG8A 3BZBA 4FI3F 1KSGA 1D07A 3RYFA 4PANA 5AK4A 5H1YA 1QAMA 3BHIA 1JLLB 1PR2A 1IHDA 3KT6A 3MHPA 1XZNA 3H0KA 4A0GA 2GBLA 2PRYA 2WLSA 3DMHA 4IHJA 1DJMA 4PR0A 1FP4A 3B89A 5GTDA 2Q3DA 4GPAA 3UMJA 1YR3A 4U6NA 4WGGA 5FT9A 1JJVA 4RACA 5B30A 3R6GA 3QVTA 4K26A 2B30A 1GUZA 3FD8A 3MFYA 1ZK3A 4Q1EA 3IFSA 3Q10A 1OJ7A 3P2IA 3N0XA 4D0LB 3FAZA 2I2WA 2XQKA 4BBAA 2AOXA 2IV7A 4XW2A 3KXDA 1N25A 2GFQA 1CT9A 2K6GA 4F3RA 2C2XA 4HNAB 2PSHA 3B3JA 4GI5A 1L7PA 1D0IA 1KE2A 4NVRA 4R9RA 1IJKA 1CUAA 5AW3A 2FW7A 2WV7A 4IW3B 5ALYA 5KTYA 2D74A 3HI4A 4HNVA 3ZS8A 4EJSB 1AGRA 1N2EA 3AEQB 4ZVOA 1YH3A 1G7SA 1U9ZA 3BJEA 4RF4A 3CUTA 3GRPA 1ZNZA 2QYOA 3GOQA 1NRXA 1EE2A 4BFYA 3ZWMA 5E6RA 3C98A 3MW8A 3OBBA 1GZSA 1N5DA 1OYYA 4UM8B 2Q5HA 3D7LA 1YQGA 4Q7KA 1UXIA 3G0IA 3NKVA 5BN5B 1O77A 2BTQA 3DXXA 1JYEA 3N58A 4TXLA 4XH9B 2DETA 3VPDA 1YBVA 2ZRJA 2PL5A 2X1VA 1J39A 1CY2A 1E4VA 3HB5X 4FHFA 4M36A 5KWSA 2B3TA 1UZAA 3ZJTA 1O5IA 1VBNA 3HKCB 5BMVF 1MAUA 5DLDA 3ROEA 4IDFA 4OBWA 2FSSA 2FOIA 2X86A 3UXMA 4NQRA 4PRLA 3VC3A 4AU1A 1C7QA 1E3JA 2JZOA 1J2RA 1DEXA 4OGFA 4P9NA 2E3JA 3TOZA 3VNUA 1CJBA 1JL3A 4L8YA 4D4KA 3CH5A 2NV2B 4WN9A 3WGZA 1N0HA 2IYNA 2QQEA 2R7MA 1JXQA 1L7NA 2QGZA 2ZE6A 1EFVB 4RPLA 4EYGA 1VBFA 1NBWB 3L01A 2XZDA 3HU2A 4LUCA 2F6RA 3R3ZA 4FFPA 4LXIA 5EYPB 4A9AA 3SE7A 1WXHA 1W30A 2AQHA 1ZJ5A 4YNBA 5CB4B 1SPBS 3ES9A 3HI6A 2ZU6A 5DTJA 4YT4A 3JVIA 1EQAA 5CLJA 5EIBD 3BL6A 5BQ3A 1YONA 4JLDA 5LZ7A 1RPJA 2A9OA 1IQUA 4GC5A 2CHUA 2R47A 4LJSA 3RT7A 2A92A 3UAZA 4YRBA 2C4MA 2ZJAA 2E85A 4A73A 1BMFD 1ZM3A 2EVWX 2HGZA 5EJ2A 1YI1A 3PDJA 3PDIA 1W44A 2DWPA 3BTUA 3O0DA 2HDNB 2WU4A 4JUAA 3WA7A 3DW3X 5CTJA 2J59A 3KHSA 1RYFA 1HRDA 1JG7A 1YACA 3Q6NA 1PEYA 4R1OA 4ND2A 1ULTA 2RGEA 3LZ6A 1LU9A 1GCUA 1UBHS 2H4WA 2X8JA 3GFPA 2G17A 4MW7A 1DBVO 4ALMA 5KYYA 3EEFA 5L3SB 1P2TA 3C0KA 5JVDF 1OWPA 2YRWA 4W5TA 3NOVA 4D96A 2XB6A 1XMSA 4B43A 4YDQA 3SICE 2XCIA 4YJKA 5H4HA 5LU8A 4YRMA 3GLGB 1JLHA 2H8KA 3NAQA 4UHKA 3PEFA 4RULA 3W5DA 5G1OA 4F3NA 1CIVA 1SBIA 4MRNA 1XQ1A 2JFYA 2O57A 2FV8A 3WRXA 2OORC 3JSXA 4OXXA 1W1IA 2B5OA 3OAAA 1JPNA 4X7RA 2YIVX 4L15A 2XMSA 1XKQA 3I8OA 2QX4A 5TF0A 3WOVA 1T2CA 4B3DA 1T6BY 1LKZA 4BMYA 2Q99A 3ZNPA 3ZHVA 1Q7TA 3ORSA 2VSQA 4ZC8A 2PLNA 1YT5A 2IXEA 2V7VA 3DH0A 3I5MA 1M6VA 5T7BA 3WAKA 1UUFA 2NZYA 2E7ZA 2R6JA 1KI8A 3IEPA 2VJMA 2CDCA 4X8LA 2Z83A 5D85A 5DXFA 4ZARA 5FV7A 4A23A 2PRIA 3PTZA 1JQKA 1QYIA 1S9DA 2FHSA 3FI0A 3HSSA 1TVMA 1AKYA 2FJUA 3GF4A 3KAJA 4K6FA 4LHZA 4LTNA 2XTZA 3CONA 3LIIA 5EE5B 4JYMA 4BMPB 1ZCZA 4AN1A 4PTLA 1WSBA 4DNOA 1JRLA 2XR1A 3IIEA 4E14A 4IAOA 4U3JB 1TJ3A 1G8FA 4BWVA 1PHPA 4BPRA 2WNIA 3GFQA 3FHJA 3IHWA 3PPVA 2W48A 4I2VA 4BNYA 4BU1A 4DYVA 4YRNA 3THOA 3EG9B 3KO8A 4TMWA 3WGNA 5BV8A 2VKTA 1L4YA 4MVJD 4IV5A 1H69A 2GARA 4TYPA 3VR4A 2E1RA 3NBAA 3BVPA 4JP1A 4CV3A 4D4MA 1E6UA 4ENPA 1KQ3A 5TF4A 2UYHA 2O3JA 1ODFA 1FSZA 1PHRA 1T6YA 5B1SA 3F67A 3SBOA 1ZJ4A 3N0VA 2I4MA 4M21A 3WTCA 4MKZA 4B3HA 3DCIA 1DT3A 2XBUA 4HEA1 4R71A 4CEIA 3AFHA 3MHTA 5BRJA 2F2TA 1HH4A 4K3UA 3NTRA 5GV8A 4GKAA 2AZDA 1MPTA 4DMGA 4LYFA 4IXNA 3TM5A 1UMDB 4HB3A 3VH1A 3MM4A 1DC8A 2E18A 4I50A 4JIGA 4C4AA 1ZIOA 2OHIA 4D0RA 3UYKA 1RYZA 4UAUA 5JFOA 3QY0A 4IF6A 4KKXB 1Z6PA 3UICA 4HPWA 2HI0A 2YYAA 4JXZA 2AOVA 4G4SP 1X7ZA 4M1OA 1ONOA 2QLFA 4RY0A 2X19A 2BWJA 4C4XA 1RWBA 3IPYA 1V45E 2DUUA 3IEXA 3LY7A 2AMLA 2GVZC 5EP3A 5EQDA 3I9KA 4XOIA 5AW2A 5I8WA 2WYOA 3V1UA 1NI4B 3GJ6A 1FLNA 3LRXA 2X23A 1XC7A 5IAGA 4MIYA 4NE9A 1PF7E 4XDGA 3PJRA 1QR2A 3FDFA 3LUFA 3PQ5A 4X1KA 2ECFA 4IXTA 1LB1B 4BMDA 2ZTUA 3SFZA 4XRGA 5JQGF 3GAZA 4DHEA 2WJAA 1T4CB 2FI1A 2V7QA 1CUJA 3WLTA 1M2GA 4MGIR 5G02A 4M38A 4H59A 2F8SA 1N5OX 3H2SA 3WNBA 4LXGA 3KBBA 2R97A 1M66A 2DFDA 2QLMA 3FCCA 4QG7A 5IN4A 1MQ9A 3SN6A 4TUYB 1SRRA 1RVDA 3GOHA 3JARB 5JASA 2XAAA 4H6WA 1K97A 1E1RA 1HQDA 3M6MD 4IYRA 5H3CA 1OX6A 1R4MA 3EFEA 1HOTA 4ND3A 4JOQA 2W6QA 3C43A 2VRBA 2VNKA 4JI6B 3MYYA 4B2LA 4ESHA 4ZHQA 4QQNA 4C4SA 1A5BB 3GHYA 1ZGBA 4LZLA 2I7DA 4MRSA 5K0GA 2FPKA 1K5GA 1ZL2A 1ZIDA 1Y3BE 3O3MB 4KXYA 4PNPA 4S35A 1ZXBA 4YJFA 3HDJA 3FOFC 2AXQA 3L04A 4LZNA 3V4ZA 3DCNA 2CCGA 4AD8A 3ICQB 1HEYA 4ODIA 4EB0A 4RZSA 5IJAA 3UH0A 1TU4A 4K8RB 3TECE 3NBYC 1OTHA 5LZ4A 5CMLA 5BW4A 1J9ZA 2R4UA 1KZ4A 1OXUA 3AR7A 3OJLA 4F85A 4ZI3A 4KITB 1UDAA 3WB1A 1P29A 3BZWA 3I1JA 3RBAA 5D00A 1FU4A 1H3FA 4PYMA 4EVRA 2EZ9A 2HTFA 4QKQA 3NDRA 1FQJA 2PYDA 4MQ5A 3KQMA 4PR3A 1RWXA 3HPQA 3NYQA 4K6HA 2C2ZA 2VP2A 3NUZA 4LRXA 2OCKA 3HXTA 3IP8A 3W9YA 3ZZ1A 4F4DA 4ZO9A 1XN4A 5KX5A 3MRSA 3UAYA 1WXGA 3FPAA 1Y5LA 4Z3KA 3EBOA 4LVCA 3AVVA 1Z8HA 2ZRNA 5EFZA 3W8RA 2JGJA 2DBYA 1RPZA 5ADUS 1CB7A 1OYOA 3HE3A 4X60A 2I9KA 2FSUA 1JI0A 2GS9A 2J3QA 4EUHA 4G9BA 4A0SA 4ZVTA 2QYTA 2AMYA 4O8ZA 4F45A 3UOGA 1L6IA 1ZCJA 5FWDA 1HE2A 3KWMA 1B6SA 2MIIA 5ALVA 3GLHA 3SIXA 1MN6A 3UG7A 1F17A 1NRWA 2SCUA 3MUOA 1Z4IA 3QLEA 1CHNA 3A1TA 3M6UA 1M8GA 1RQNA 1U7WA 1Z4QA 2Q5EA 3INYA 2H2WA 3QVGA 3ZLVA 1ZG3A 5M04A 5EHIA 4M89A 3BD6A 1Q5PA 2OMKA 2FX2A 2EFGA 1BA3A 1E1RD 3CNEA 3FMIA 2BR4A 2WJPA 2YH2A 3MELA 3OPNA 3QKSB 3Q3HA 1YULA 4O2BA 2EQ5A 3T9CA 1YCGA 3WIEA 1F8XA 3LGSA 4OP3A 4QXMA 2CEAA 2N1BA 3C8HA 5DHSA 3V4LA 1UOEA 3RV3A 3VU1A 2BHNA 4MJLA 4YI5A 3C6KA 2GASA 2GZMA 4XASA 5JWOA 4LF8B 3SX0A 5EG5A 4ZXFA 3IUJA 2O2JA 3HXOA 3PQDA 4TXNA 2NTYC 1RXIA 1APBA 2ZQ5A 1M1ZA 2FUEA 3BEOA 2IXBA 1TJ4A 1K9SA 1M5UA 4K9DA 4JDUA 3H8SA 2HUPA 4YAWA 5CLHA 5EXDA 3H9QA 4PPGA 3G0HA 1LZLA 3LQQA 3VVLA 4ZVRA 1IB6A 1O87A 5IXYA 2RHCA 3Q6IA 5GP1A 1GUYA 1SBYA 1W35A 4D26A 4EJ6A 3HKBB 1F2TA 3OEEA 2TS1A 4RZQA 5I7EA 3VO2A 2H1WA 5MGBA 4ZYTA 3EPKA 3MUEA 2C5EA 5BORA 5C31A 1U31A 3FVWA 4ZQIA 3EFOB 3Q0TA 2HRCA 2PT7A 1RLOA 1ZNQO 2AQ8A 4WCDA 5EXPA 2IYQA 1GLGA 1OIXA 3WYGA 3TD6A 4UTOA 1A82A 1WZCA 3H9EO 2R9VA 4GGMX 4KQ9A 3LK7A 4EIWA 3Q8WA 1XTZA 1A1VA 3Q3IA 2HWUA 1NLUA 3RSQA 4TLMB 1Q0ZA 1M6EX 3U1TA 5BQPA 1CY4A 1U1IA 2F1RA 1BXRA 3A7EA 3EF3A 3H8WA 3KKKA 4XARA 4MPPA 3R3VA 3R7SA 5AUOB 5D3MA 3G0CA 4GF5A 3OIUA 4GSYA 1XNHA 3A9VA 1SCDA 4PF1A 3QKTA 4D4HA 5CX4A 3DCYA 3DDZX 2PS3A 1NVEA 3QLJA 4LXUA 5AHRA 4AZVA 5H8WA 1VIVA 3DA8A 1C9NA 4D4JA 4DM3A 2OQIA 3ZE6A 5F1KA 1JSZA 3K16A 2HRDA 2JRCA 3C3EA 5CDUA 1E64A 4LYGA 2V0NA 4U5QA 2H9YA 5JAOA 5JXJA 4WDQA 3UHPA 5KOYA 1Y8ZA 4RY2A 1R7RA 4PO1A 1TYCA 4W5WA 5KTMA 3ROZA 2ZWOA 1F0NA 2RIRA 3A04A 3OPYB 2B5VA 4WZBB 5LQRA 2WD7B 1MGOA 2AF4C 1LSOA 1OI7A 1Z5WA 3CPSA 1Y6JA 2BHTA 2KLHA 3IP1A 4W5HA 2IITA 1EVIA 3K9LA 4OAQA 4IJVA 4PZLA 3NBXX 3C6XA 1ZICA 3WXBA 5D3ZA 1NQ5A 2GXAA 1YJCA 2CLFB 4CMJA 3A06A 4UMFA 3DGFC 3L0PA 1HDGO 3ABOB 3PHIA 3TOCA 2ZT7A 2ZRDA 3AEUB 1YU6A 4RIFA 3L9WA 4KIJA 2NU7B 1CV2A 4UHHA 3STVA 3JYPA 4U7TB 2J3DA 4R2LA 4RC9A 2VQFB 3KR0A 1NR7A 4OF4A 3ELWA 4C76A 5L45A 3SP1A 4G5GA 1E98A 2YJ3A 4YAEA 4F4IA 4ME6A 2XMPA 3D3JA 3DS8A 3WLKX 2X5KO 3FBWA 3AJEA 2NW6A 5AKXA 2F9MA 1YB1A 2QB5A 3ID6C 4QNNA 3SQNA 3OUZA 3CZ9A 5DH9A 1TEZA 1NF2A 3RSZA 2R48A 4KH1A 4EKYA 3DO8A 3TINA 1X1QA 1H0SA 1HYHA 4ZI7A 4O2AF 4G5SA 1ONPA 1RLTA 4UUPA 4HAOA 2QR3A 3PJEA 1Y7LA 3GJ0A 1VSUA 2EG5A 5TPWA 5J58A 3RIMA 4HLQB 1A2OA 4JC0A 4MWSA 4JUFA 3T5BA 4DDVA 4RXUA 1OKKD 1W48A 1XRRA 4B3TB 1QVWA 3N2KB 1I32A 1ZD2P 2DULA 4AQ7A 2ST1A 3A10A 1RJEA 4GI2A 3BGVA 3JQ7A 4NENB 3WC4A 5HCNA 3GNTA 2IV2X 2WSMA 2VQ6A 3HDHA 1N6NA 2WWWA 4H4EA 4OP1A 3ZV4A 3LCJA 1TLTA 5DSTA 1CUEA 1M6VB 1LBHA 1XYYA 2A0WA 1ABBA 2G4CA 3KB2A 3V7FA 4EQ6A 4Z1MD 1SKQA 3OE1A 1DJNA 3W0LB 3ZHTA 3CURA 2DXIA 3RC7A 3HV2A 2BGRA 4XLLA 2XUHA 2VHJA 1G291 4O2BB 3QEBZ 4DV1B 4HVTA 3ENZA 2OLKA 2ZM5A 4DQXA 3O73A 2V3CC 2NVWA 5ITZB 1ZK4A 4GZMA 4NZNA 5CURA 4LSGA 1H42A 1P45A 3K0HA 3M4XA 3NGMA 3OEHA 2P1ZA 2PNJA 4D4IA 1L5RA 3CUWA 4JL8A 6LDHA 1R0CA 5ESRA 1JKMA 1SD1A 1FRZA 3HL0A 4D3DA 3KQTA 2ZDQA 4JXXA 4GR5A 3CCBA 1T2UA 3OM8A 1A7AA 2B7LA 2C78A 3HUDA 4LV6A 3ZQJA 5FDFA 2WWIA 2QJRA 2V0CA 2ZJ7A 2EJCA 2NTNA 3R5TA 3SI7A 3ZWWA 4ZZIA 2HDHA 5IVKA 3TFQA 5H68A 5D7NA 1E77A 3G2IA 4C2BA 1LLCA 4Q37A 3H9GA 5I47A 2RI6A 2JARA 2PA0A 2QM7A 3AR9A 3NIGB 4UJ5A 3VZBA 2OECA 2WFZA 2EX0A 2WKWA 4NYIQ 1VHQA 4NYMR 1XJCA 4MA4A 5M3BA 3AF1A 4AZWA 3U6KA 1GILA 2B36A 2F9LA 1NI4A 1SEPA 2HADA 1CSEE 1KY5A 3DZIA 2I8AA 3E3MA 4DDUA 1ODIA 4HUQB 1NW8A 2E4WA 4LPKA 4OH1A 4Q93A 4RPGA 2OZKA 3NZEA 4V02A 4CCSA 4MWZA 4GYKA 2ZYSA 1FVHA 5J2TA 3A9RA 4D44A 5BR8B 5JY1A 1BX0A 1RC1A 3E8SA 3LBYA 5KYUA 3ILHA 2VBFA 3R6TA 3SYLA 2QXTA 3B1FA 2ZAMA 3DE2X 4L8FA 3JQGA 3MWEB 5B2EA 4OHXA 4F92B 4AS3A 3KSAC 2JJ1A 3DMFA 2BRUA 4H1UA 2JHFA 1HURA 3I4LA 1IXRC 3T7DA 1U81A 1TM7E 3KKLA 4E70A 4UU1A 4IY1A 4L78A 1FRFS 5C53B 4DR5B 3VKHA 2RSLA 3G88A 4R2JA 2UYYA 4F9FA 2IE8A 3ZVKA 2E1PA 2IQ5A 1POXA 4U39A 1NLYA 3EDYA 1U4SA 3P9ZA 1ZUNA 4FSXA 4LZZA 4LJRA 1C7ZA 1IU9A 2NACA 1SCNE 2WG0A 3A1FA 2ZB7A 3DV2A 3UKDA 1UDRA 2C9YA 2ZE8A 3G89A 2X0DA 2VAXA 1UMBB 5TT0A 4KVZA 4J0DA 1QCYA 4CLOB 1FCJA 4KJZA 5FTKA 1JYSA 3C45A 4WKNA 5BPHA 1J0EA 2FPPB 3G2MA 4CM7A 4AUNA 3PHLA 4KC0A 1NSTA 5CB6A 4DILA 4CEJB 4JVSB 4OHKA 2NUTA 4JI7B 5DM2A 5EZ5A 3WK6A 1FDUA 2COKA 2AFHE 2VHYA 2JHCA 4Z4CA 1G16A 3GELA 2WG2A 4U0JA 3SZRA 3TTWA 1EFTA 4KO3S 1O6CA 2IOFA 3CJQA 4CQMD 2E89A 1GGVA 2WUGA 4H6XA 1N77A 2JGMA 3GD7A 9LDTA 2VA8A 4NNPA 1N2JA 1EXMA 1XNGA 2JS7A 2F00A 4NPHA 1H3EA 2HK6A 3CVJA 3DP9A 3HEAA 2IH4A 2XNCA 2X7HA 3IIJA 3NT2A 5DEIA 1E1YA 3UKOA 3GU3A 5BR4A 3WHLA 4YCMA 2PLAA 4QNMA 4PG8A 1A9SA 2PCLA 3G0GA 3LM8A 2DERA 2FPOA 2R65A 2EC5A 4TM8A 4CODB 3A9CA 1MRSA 2OCGA 3BXOA 2BIFA 5EWLB 4ARZA 1OAAA 1INLA 3DO6A 1KI6A 1MNQA 2CE7A 5GM1A 1QONA 3ZU4A 3HDQA 1WR8A 3WRYA 4BP3A 1TEXA 3DZCA 1IN6A 2YQZA 1BWQA 3ITKA 1CNEA 2E6UX 3PLRA 4JUBA 3TIFA 4MB6A 2GN0A 1NQVA 1YQDA 3CW2A 2RHDA 4PEVA 2ZBPA 1EH5A 1R4NB 1KMQA 3F8SA 3FYDA 1M1NB 3DZ8A 3KALA 4QGBA 5F73A 5B3KA 1DKOA 3ADBA 5LNK6 4MV1A 1QO9A 3V6LA 2IS4A 4WZ6A 2ID9A 3IPCA 2HNAA 3V6MA 4EGSA 3KS9A 5D86A 3KLNA 3GFSA 1UDXA 2X58A 4WRRA 4NJEB 1B42A 2QSUA 2WHQA 3KSBC 4P98A 2GM3A 1Y3HA 2Y4OA 3EDOA 3N6RA 3DMTC 1P0IA 4HNRA 1LVUA 3WIUA 1SUIA 2TSYB 3UJ7A 1OZFA 1DMSA 2DAPA 4Y6GB 4J03A 2XBLA 3RI3A 5ARDA 3R4VA 3RFFA 4QREA 4P6VF 5IDQA 5BN1A 1PR9A 4QPDA 2ODQA 3BGSA 5F76A 3K31A 3E48A 3HGQA 4G37A 2RHJA 4NL4H 5EHXA 3HYTA 3L05A 3RH0A 4TZKA 4B74A 2VWQA 3L7OA 4RVUA 1ZO8A 2PL3A 4JLJA 4KQFA 4MEJA 3T3MB 3VO1A 2OP1A 5M34A 3K8OE 3GRFA 2HAEA 4HQ6A 4XKJA 4ER6A 3CNQS 4F21A 1B8NA 4JAVC 1YQEA 4R84A 5CHYA 4TKVA 1G9TA 3BC1A 3IOBA 1RWNA 3NHJA 3R0IA 4EUKA 5JRDS 3ZBPA 3K0EA 3N39C 1L6RA 4C05A 4OHFA 5E9AA 3LXUX 3H5VA 2OG2A 2YJGA 5AKJA 5ESXA 5ULLA 4BNZA 1IZ7A 4Y2RA 1XEFA 5J4YA 1IVSA 2WUWE 3ET4A 4P80A 3CPEA 1RTKA 2C7VA 2X6QA 2JIQA 3GJRA 4UNNA 3PXEA 4I4TB 3MLEA 1TRHA 1U0SY 3P4XA 2FWJA 3EZ2A 4LOIA 4PHGA 3BREA 4U7PB 3S70A 1IJFA 2V74B 4MGEA 2NLOA 2E37A 4A2CA 1QRSA 3P9KA 5LC1A 2ZVJA 3F6CA 2C7RA 3A28A 2HJVA 4INOA 4JYBA 3DTTA 3THRA 5A9RA 4PYRA 4L02A 5D5PA 2BMJA 1YQXA 4U9HS 3JD4A 1DBPA 2FMIA 2YXPX 4YGYA 3ZZMA 4BO1A 3W5BA 3O8QB 3HXMA 1O3YA 3DJFA 1LNSA 2G9NA 4M9XA 3NYWA 4RVOA 4FR5A 4GDFA 3B1VA 3EWIA 2EIXA 5DTIA 1SKMA 5BRNA 4DR1B 3WKCA 2O8CB 2D0IA 5DBFA 4ZYLA 1R0BA 2VP4A 3PUJA 2BZ0A 4TM7A 4M9QA 1N78A 1YE8A 2XQFA 5TMBA 4OYRA 3IV7A 4NDAA 4WKOA 4O2AB 5LQUA 3D0RA 1EE1A 2GRUA 1ZNXA 2BHSA 3BHJA 3CUSA 4HB0A 4HD8A 1KYIA 2B25A 5DMHA 4AWBA 4CCYB 4IO1A 3CZQA 1W52X 3GUYA 3ZW8A 2VJBA 5B3JC 1S89A 2ZIVB 4IQ0A 1K3TA 2P11A 1TJ5A 3V7UA 3OZCA 4B5LA 5EC8A 3AUSA 4RTPA 1N2XA 2R2GA 3GA5A 2Z1NA 3PK0A 5G40A 2FQYA 3FCEA 1E6KA 3VJLA 3X2FA 5HIAA 2G9UA 3CHYA 3JWJA 5JADA 1Y4DE 3UAXA 4NZ9A 1L1QA 1STOA 2DFNA 3ZHUA 1T1EA 5J1TB 3GIDA 1KMHA 1J7JA 4PFQA 1Y8QB 3RYIB 4MVJH 3H99A 1YOVB 4MRMB 2ECPA 4LOLA 4JEHA 3U7QA 3IIIA 2PGLA 1GT91 2R3SA 3WIVA 3RQSA 3QPDA 4BFXA 1V4VA 2J7PA 3WK8A 1OBOA 3PDUA 2FWBA 4XEHA 4C4RA 3SYRA 5IK2D 2OBFA 1QH8B 2IYLD 4OQQA 4DCGA 1NTOA 1LDBA 1X38A 1OLXA 2POQX 1FTYA 1L5MA 3GP5A 1Z17A 3PVSA 1KY4A 1QVRA 1G0OA 2B4QA 2YJTD 4MLPA 2F67A 3DTVB 4E5UA 1D03A 1O5TA 3THYA 2CLMB 3D3KA 3V1NA 3VBCA 1VPVA 2FX3A 3GZ4A 1B93A 2Q8NA 1T9HA 2PUEA 4IL5A 1Q91A 2I3AA 2I62A 2GQ0A 3KB8A 1ZKMA 4BNLA 2ZUUA 1J25A 2HCTA 3CNHA 3FHLA 2XYRA 4FBGA 4GXRA 3ACDA 4ILKA 3QFTA 4EZEA 4FCTA 2P3OA 3L8GA 4O4IB 1V4BA 3OP1A 3RJZA 1ZSVA 2FRVA 4R3WA 4GH5A 3ZY2A 2BEUB 5K0ZA 3IEMA 2QGNA 4G8BA 5M5BA 1K98A 2ILTA 1EDDA 3D8SA 4F97A 4BAZA 4MGKR 2AHRA 3WDSA 4YRTA 1F51E 4NC9A 4IM7A 1XRPA 2DWOA 3VKVA 4RW0A 4PX5A 4MV9A 3PSHA 2HN9A 2WVAA 4P7BA 5A5DA 3BIFA 3DVSX 3S2ZA 5A5VA 5LQAA 4L57A 4NJOA 4Y0NA 2VWPA 3L7YA 3UEOA 1L5FA 3HP4A 3H86A 5KNBD 1T0HB 1THZA 1NUUA 2DR0A 5GMOA 3QVMA 2H2FA 3V00A 4LQDA 1YRAA 1ZH8A 5ILOA 1GRQA 2AE2A 2HJWA 5AK6A 5KVAA 3OF3A 2OC4A 3ZQUA 2GF0A 1FZTA 2VK2A 4L16A 5LA6B 2E4AA 2GKGA 3AERB 3LU1A 2JFWA 4H17A 5EZYB 4KVAA 1ZA1A 4YT5A 1KE1A 3IHTA 2Y05A 3PKZA 4G1FA 1ICIA 2VSFA 5B7PA 5AXAA 1DGQA 3H97A 2WWYA 1ZM9A 1GITA 2CD9A 2XIQA 4OIMA 3X2SA 2GZRA 1GUDA 2BFAA 2IC5A 1DBQA 5FYDA 1NLMA 1PK8A 3GA7A 1XTPA 4QU5A 4D46A 3PHCA 4ER3A 5FPKA 2PANA 1K66A 2DTEA 4S1VA 1A5TA 1HWYA 2WSYB 4BZPA 2Z6VA 3BK2A 2WFAA 1XP5A 3LYAA 1HT3A 3WLJA 2W2XA 1R0LA 5D8DA 4MR9A 3UW3A 3DEHA 4PHTA 3GQVA 3TE7A 1LS1A 1N6IA 2QNRA 2IL1A 4TLLB 5JCPA 1U6IA 2D2IA 2WJJA 4L7VA 4BC1A 2P41A 1EKXA 4N7MA 2QUJA 1WS6A 4OLJA 1U8XX 2AMJA 2IW1A 1DDIA 3QELA 4MQFB 4YUVA 1QZUA 1DEOA 2GOYA 3BN3A 3G6WA 5TGZA 2ZBQA 4A91A 3UC5A 3PCTA 2BF4A 2J5QA 1O96A 1X0VA 3EY9A 4CKWB 4X92A 1E96A 2XRFA 2ZANA 2H07A 3HQ4O 4LISA 3RIEA 1T34A 3AIMA 2CFIA 5B7GA 3K5IA 4X97A 5FNVA 2HU8A 1KBQA 2BBSA 1TTPB 3BBPA 3I8XA 4DBVO 4XUGB 3VISA 2NM0A 2VBCA 2JJMA 1NJ2A 1PUXA 2LUOA 1OWOA 2IF2A 2HK7A 4XWTA 1KQNA 3CRZA 1NUPA 2AOTA 3F78A 1CS4C 1E2HA 4I3GA 1JT2A 1JXOA 4DRZA 3C1OA 1SHLA 4CF5A 5C3MA 1LLFA 4NICA 4WH0A 3PITA 1QK3A 1J42A 2Q9CA 3A32A 4DM4A 4AECA 3HH8A 4IJMA 4OI1A 4J75A 2BSAA 1XDDA 1XHLA 1Y1PA 1UWLA 4XXHA 3AEQA 2IIVA 4NE2A 4E21A 1E1CB 5AFSA 5JI2E 4XQCA 1PJLA 1WPXA 4QPZA 4ZOLB 3PPYA 4FGJA 4ND8B 3UY4A 3X1WA 4E5MA 5COQA 3GVXA 3L4BC 3K0SA 3ADOA 2FEMA 4KE6A 4CN8A 4D99A 1D5CA 2NPFA 1UEIA 4H9GA 3DVLA 1ULHA 3MJHA 3DBHA 4CLRB 1DIHA 4KU4A 4WW0A 3K32A 5BVGB 4NIMA 5TVKA 5LR6A 5FRDA 1F3OA 3T3NA 3PV0A 5JECA 2NZVG 3INRA 3IBYA 3SZUA 4QPJC 2HXSA 4CMCA 1I2AA 1E69A 4KRFA 1K7EB 5FLKA 3VTKA 2OYCA 4FEGA 5DM0A 5B53A 6ADHA 3AR5A 1EVZA 1JB1A 1JDSA 3RK4A 2VBIA 1B8PA 3HDYA 3I2GA 4TQAA 4FLEA 3OZRA 2WFLA 4IH1A 4ATNA 1II9A 3QXSA 1FX1A 2HY7A 2WHPA 1A1SA 4AJEA 2CLEB 3FHOA 5IHXA 4YQEA 3OCJA 5T57A 4MWBA 1RJFA 2JIBA 2PX8A 2VFAA 4WDRA 3VSDA 5IEJA 2G72A 1ADYA 2Q0HA 1XVVA 2VLIA 1SAYA 1RQRA 2Q28A 3CLSC 3JY6A 3PX2A 3QUCA 1Q1ZA 1AUXA 3FDIA 3OZXA 2GEUA 4Y2JA 2A0KA 4F3CA 4L5CA 5A1JA 4RK0A 2O3RA 2WPDA 2AZMA 1OGJA 1P0MA 3K30A 3PEUA 2XUAA 3HZOA 4UAJA 4FQ7A 2RB5A 3K4QA 3UN1A 3H4MA 2Q21A 3PNVA 2DVMA 2Z6QA 4DCTA 2IZ5A 3DGEC 2O2CA 5FI5A 3W5SA 4M1EA 4TX1A 4RD6A 5LD2C 1CJTC 2CF6A 4LVOA 2OVFA 5T4HA 1DIAA 3T7EA 3VPHA 4G63A 4Q3AA 2UAGA 3F3KA 4RK4A 1NZJA 3QVKA 1NATA 2Y99A 3KWLA 5EIFA 1GCAA 3TYXA 2W2VA 3W79A 4OLBA 2IHKA 1IUKA 2QA5A 1JJFA 1Z28A 2A9JA 2NZJA 2R7KA 4QTTB 2GN2A 1SCKA 2RBEA 2GN8A 3P2KA 1N0IA 13PKA 5I7OA 5AWFC 5EPEA 4ZCLA 4HNSA 3W3AA 3SXPA 3TUJC 3W9UA 1NDHA 2QVBA 1F5SA 1IOWA 2D8AA 1OYVA 2HMVA 2PKCA 3AI2A 3K94A 5IZ4A 5LXTF 4TMZA 4JUDX 1NQOA 3KYDA 2SCUB 1O94D 3VPCA 5KOHB 3ZYZA 3WFIA 3CVXA 3NG1A 3TDKA 4U7WA 4LQCA 4P34A 4B32A 2P9EA 4Q3NA 3B2NA 5JQGA 1MX3A 1BVHA 2BL4A 1VG9B 1NYLA 3FPJA 3TWOA 3J7AC 1GXSB 3IO3A 3AKDA 1MP0A 2CSXA 3ZCQA 1K8XB 3UFXA 1JQLB 4EA9A 4RKWA 4EPRA 2XHEA 3OKFA 1QTNA 1NXWA 4CPDA 2YC4C 3DMDA 4AW9A 4DUGD 3ND6A 4I4LA 4EATA 3JQQA 3L4SO 1FDIA 5DM60 4C6SA 4EB6A 2CY0A 4LEIA 3QKIA 2POCA 2Z2XA 4EFMA 4HDCA 2MWMA 3BK1A 4JI0B 4KQMA 4NEGA 3GT7A 3ZHQA 5IVHA 3TLBA 1IJBA 4BN0A 1WMFA 3C70A 3GRCA 2V7PA 3DMTA 4TRMA 4X66B 2G76A 1FJGB 1GYQA 1XJWA 4U7FA 2X77A 3WL7A 3D2CA 4EI8A 3K70C 3U81A 1XQ6A 2RJ3A 4Q1AA 4GP7A 3D0OA 5K4GA 3FOCA 2HYIC 3UQZA 2ZSAA 2QN3A 3DZFA 3F5FA 4LV5B 3BYZA 4RH1A 5A3VA 3I3SR 3G0BA 2D13A 4HMPA 1L4BA 4NG4A 5ALKA 4LZWA 5G53C 3A58B 4HT3B 5LL6P 1JR3E 4D9MA 1Z0FA 3L8EA 2G04A 3SXJA 5KAMA 2R85A 1KMNA 4E5DA 1SUEA 3O84A 3DBRA 1L1RA 2YOHA 5EWJA 3R8XA 4E3ZA 1DHTA 3PBKA 1TUEA 2CBGA 1LY1A 2ZB4A 7MDHA 3I53A 4H7FA 4BOYA 4A5OA 3DBOB 5DK6A 4TTVA 4WKCA 5K3AA 1W88A 2ZRKA 1E1CA 3P1JA 4KQHA 2PSJA 2BMEA 3W7BA 2QNIA 5FUYA 3U4QA 1E2QA 4DC9A 3PQ3A 3TO5A 3U13A 4DV3B 1KVTA 2BH2A 4WZAB 3PRYA 5E6UB 3FHTA 5AVZA 3DFUA 3FOWA 3EOBI 3M3PA 5KTNA 1VL8A 4UCFA 4R1TA 4ZEWA 5ELXA 1DLIA 3NHLA 5BW8A 3GUVA 4V0QA 1NNSA 4Q3LA 3ZDAA 4FT2A 3UJNA 2MR5A 4BV2A 1EP2B 3V4FA 4C0XA 1CULC 4IIHA 1QV6A 3T41A 3NHZA 4YMUA 2R7AA 3P4UA 5CA1F 3C3BA 1V9CA 4DLBA 2HLPA 2YWJA 2A0FA 4PBTA 3RRJA 2RK3A 4QU9A 3QF7A 4UVDA 4YPVA 2F3PA 1P19A 4HDRA 3EXHA 4LYDA 1UBOS 4E32A 5EXEA 1M83A 5FAKA 2I1LA 2CJWA 1LLUA 3P32A 4X6YA 1D0SA 4ZTUB 1NBEA 1KORA 5THXA 3F4BA 1EUYA 2E82A 1VYUA 3V2HA 2NGRA 2X2PA 4L3WA 3WYBA 1CR1A 5FUMA 3JSAA 1BH6A 4N3BA 4BNGA 4ZRDA 5K0NA 4B5KA 2PM8A 5DNUA 4H2DA 3RHTA 1UAGA 1YNSA 3KOXA 4WBNA 1DQPA 1WM1A 4G0NA 3UF0A 3AUUA 1QPZA 4LSZA 4F6RA 5JT1A 3D7NA 4JJZA 1PV2A 2EHJA 3DWIA 2WF9A 1OZAA 2BFDA 3AIIA 4OAOA 2HLDD 3SAJA 2V8OA 3G0DA 3SHQA 3UOWA 3PU6A 4YJ2B 1P7WA 2W8BB 2XCUA 1UBNA 3Q85A 4IUDS 4JBNA 1F1JA 4CG2A 1LK5A 4Z0NA 1RAGA 3BB3A 4RSRA 1MO3A 2D00A 2L0XA 4V1CB 1S2GA 3WDKA 1XMQB 3MXTA 2WIFA 1Y1QA 1L5GB 2V7WA 3NPAA 1I4WA 4EK9A 1OVMA 2YJZA 1PX2A 1XCOA 3P0FA 3ONWA 3JQ7B 1YI0A 3Q3VA 4HAXA 4KUHA 4NENA 4R5MA 2Z3WA 3KFXA 4E03A 3WAJA 2O59A 3CEAA 4J07A 1RRVA 2HA0A 4HDMA 3HBJA 1PX0A 1Y80A 3NHUA 4PHCA 2DFKB 3WGVA 3KPYA 4D8YA 2WU8A 2JLBA 1ISSA 3HVKA 4B3FX 1VECA 2PO5A 3UMVA 1AHPA 2XCSB 1NZFA 3ZD8A 1UBFA 4PHFA 3ZCPA 3LFTA 3GMIA 3BE5A 3S2SA 2QTCA 1E1QA 3NV9A 4DB4A 2GAAA 2ZRHA 2A35A 4MKRA 2VQDA 2G70A 3EVEA 2YNMA 5BQOA 2DHCA 3NHPA 4PZPA 1BROA 2QZ9A 1XTKA 2A1UA 4PLZA 5EZYA 2WMOB 3G17A 5BUQA 5I7FA 4KQEA 1G18A 3EIQA 3CNLA 3PGKA 3UV3A 4F1JA 4BO2A 3L49A 1LPPA 1RJDA 3C1TA 5EIXA 3W5JA 1XNJA 3PFHA 4I9HA 4LK2A 3H5IA 2OUIA 4NBVA 4NLLA 4ONEA 3RTDA 3E15A 3ZDQA 3TGLA 3KUCA 1WZIA 3HJAA 1F06A 2C42A 5DVZA 1IHYA 1OXKB 1TLFA 4O5AA 2IS6A 3UJ3X 1JHRA 1I4LD 3BBLA 2R66A 2QRVA 1RRCA 1KRWA 2BGTA 5IT0A 3KZ1E 4MR9B 3S44A 4ZYYA 3DKRA 1P2SA 4PLWA 1EBBA 1ZD4A 3V8PA 1X3SA 4BNVA 2HSEA 2IDZA 3HJUA 1A9QA 3EXEB 1YVDA 2DCUA 4D82A 2JFBA 2O0JA 1JQ5A 1WPQA 1YIAA 2IKSA 3MXOA 4JKIA 4QELA 5ECGC 1RZRA 1RI5A 1Y63A 3GVHA 3O1LA 2VP9A 1G63A 4FKBA 4IKEA 2WM2A 4DA8A 5K9ZA 2PDAA 3TQTA 1CQIB 4RDIA 4MCIA 5FB3A 5LQSA 4IH9A 4CF4A 3DVRX 4EFNA 1CUIA 2IP1A 2PUHA 3HCOA 3O9ZA 4D8XA 1KGSA 1P75A 2ZJFA 2EWVA 2CWDA 3ZXYA 1C9MA 4DJTA 5GJVC 1CQXA 5JXGA 4EPXA 3T1YB 2GM4A 1FFGA 4PRYA 5JMWA 1SC3A 5CAEB 4CEJA 2ZYUX 4BP8A 5JJ5A 2YCBA 4CF3A 3Q2IA 2QN9A 1NL3A 1H66A 1LQTA 1WV0A 4M9UA 5CLFA 4KXNA 3VNVA 4TTTS 3TSAA 4V03A 2VPIA 5BXYA 1EIWA 4YO7A 1QMPA 2HHJA 3EVBA 1QDUA 4LRSB 1U98A 1ABEA 2XYGA 1AGXA 3I62A 5F2NA 3B2QA 2PWPA 7GPBA 4L1KA 4MIOA 4UEKA 5ALMA 2XT9A 5LMUB 2QP4A 1U2DA 1LXCA 2GF2A 3OVMA 4ZXPA 1G64A 4AP6A 4FINA 4BLSA 1KYVA 1WKCA 3AL3A 3Q7QA 2WAYA 2XCLA 4IINA 2PZBA 4WUVA 1GGMA 4HGYA 5G1NA 5BNIA 2GEJA 4HADA 4PYIA 3WLEA 5JY6A 3K2IA 3NHRA 4INPA 1N2SA 1VIMA 2VDJA 3F3MA 3V80A 3W04A 4IPTA 2C94A 1AB5A 3KKMA 2JAUA 1UANA 4NNOA 4F2PA 1VGVA 5CVCA 3GBVA 2SBTA 1KU0A 4IF4A 4AJLA 3HN2A 1A2KC 3NASA 5D3MB 2PR2A 4A36A 1JAZA 1L5HA 3EHEA 3I4FA 3MJDA 2DZDA 1GQOA 3KUKA 4R8VA 1H4VB 3PUHA 2O23A 3H2BA 4FMDF 3AJRA 4E22A 1F38A 3RS2A 2HQBA 4FC7A 5DEOA 4ZU1X 1GPNA 3DBVO 3QUBA 4K6KA 4OMFG 5DIFA 3F46A 5MF6A 2JEYA 1QQAA 3RFXA 1VKOA 1IPHA 3WJAA 2VHEA 2OY0A 2GPSA 3PQ6A 4QUGA 5JAMA 5LZ2A 3DDUA 1EXDA 2ZS7A 1WPGA 4MX8A 3RVRA 4HYTA 4WE3A 5GPBA 1EB9A 3A3OA 4ZP1A 2QLLA 3QVXA 1U3UA 2WWXA 4YJHB 5FTMA 1WEKA 5KINB 1N1GA 3QFFA 3O4VA 2LKDA 2ZI7A 2I6FA 2OXRA 3GJ8A 2FEAA 2GBPA 1WUHS 3KYDB 4CLXA 1O8CA 3BMQB 4FHCA 3SR4A 3SNKA 3T5TA 2GUGA 4BRSA 1Z63A 4JJ4A 3NRBA 1UBCA 5TRTA 2RIPA 4OUDB 1GRRA 2PZJA 3C15C 4Y7DA 4ZPJA 1P17A 1E1MA 5I5GA 2FLWA 1FQWA 2WAOA 1QHSA 1CS0B 1EVJA 3IDAA 2ZAYA 1T3ZA 1M1YE 2GETA 4C04A 4DRXB 2WWRA 1OA0A 4J2TA 4L9SA 4NMWA 4O2AA 1XMIA 2ODBA