1Y1PA

X-ray structure of aldehyde reductase with nadph
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
b'AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde reductase II
molecule tags Oxidoreductase
source organism Sporidiobolus salmonicolor
publication title X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
pubmed doi rcsb
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y1pA01
3PZRA 3WMXA 3KZVA 1SB9A 2DUWA 4BKOA 1PL7A 3QJ5A 4AJIA 4J1TA 2DTEA 5IDWA 4YQYA 4L4SA 1XIVA 3LF2A 3G17A 2IXBA 3TZHA 4GWKA 5B37A 4PLCA 1QLHA 1QRRA 3DTTA 2AQKA 3ZDFA 2X4GA 2ZB3A 3GRPA 3I6IA 1LDNA 1MUUA 4HY3A 4U0KA 2B5VA 3S55A 5CEFA 2EEZA 4KWHA 4DQXA 2C5EA 4AJOA 1SBYA 3ICPA 4BNFA 3SXPA 4YYZA 1PWXA 1E6EA 1SO8A 1B8UA 2OBNA 1U4SA 1X13A 1B7GO 1LRLA 3AI2A 4IZIA 1R15A 2QX7A 5K6AA 1I8TA 2UUPA 3AUAA 4DIFA 1NM5A 1PJLA 2YYYA 5IXYA 1D7OA 3TOXA 4CLDA 3ONFA 1NVMB 3K30A 4AG3A 1F8FA 2PKQP 1PL8A 4N18A 3WGQA 3EAGA 1GEGA 2O3RA 2WTBA 4CLRA 3DOOA 1I3KA 4GKVA 2IEBA 1ZFNA 3LK7A 4RL6A 1VSVA 2D4AA 1Z82A 3NDJA 5A03A 2Z1MA 3JYNA 1J6UA 4I5GA 3GMSA 4Q3NA 3UCEA 4OOEA 3WGGA 2X5KO 2BD0A 4R3WA 4P4LA 2CVZA 3Q2KA 3O26A 5DDIP 4JNKA 4CM7A 1UUFA 3O4RA 3CMCO 2BHLA 1E3JA 2C7GA 3CTMA 4M8SA 2YV1A 1DAOA 1HWYA 4U7WA 4CLEA 3RI3A 4LSMA 4CMAA 1CERA 2HK8A 2AW5A 3ZWPA 1VJ0A 3A1NA 4YJHB 2PZKA 4ZQHA 1UDAA 3ASUA 3H9EO 4OXKA 5KKCA 2FRDA 1HL3A 4W7IA 1OC4A 3LT2A 3RU9A 3KETA 2PH5A 2JFFA 3PHIA 1LDEA 2Q1WA 2CDCA 3H5AA 4MO2A 4CR6A 2CNBA 3RUDA 3OETA 1DO8A 4XQCA 5KJCA 2GD1O 3NT4A 3DAFA 4CV0A 3H7AA 5BNFA 5IDXA 2X9NA 3L0DA 1T4BA 1GU7A 4UVGA 5C5IA 4U8GA 2A4KA 3HQ4O 5JW6A 1NQAO 2WEKA 4Q9NA 3PYXA 1SZJG 1YL6A 3HHPA 4L75A 4YJGA 1N2SA 2PH3A 4EEXA 2AG8A 4BNGA 4OQZA 2C59A 4ALLA 3MZ0A 3TOZA 1V8BA 2I6TA 3OP4A 5K0ZA 3LC2O 1RWBA 1ULSA 4HX5A 2NV6A 2P4QA 3P19A 1MXFA 5G0VA 2EGHA 2LDXA 5A5FA 1PS9A 2VRCD 2JJYA 3JTMA 4D44A 1B14A 3DO5A 3FD8A 1H94A 3MOGA 1EUCA 2ZYGA 2YV3A 3DDNA 3AFMA 4GPD1 1N5DA 3GG9A 4D79A 1NPTO 1A72A 3K2EA 2DU8A 1MV8A 3E03A 4XYLA 1N9GA 3W6ZA 2UUOA 3DEYX 2NSDA 4J9UE 4XYBA 3VH3A 3IJRA 4FIZA 2OHXA 1MG0A 1LBEA 2GYYA 2GN8A 3DBVO 1Z7BA 3QVSA 3OEWA 3DMTC 5DN9A 4OAQA 1L7EA 5IDYA 4DVJA 3RC1A 4XCVA 1JWAB 4P4NA 4G65A 3KM0A 2X0RA 4JJIA 3ZNOA 3GGPA 4IDAA 2AHRA 5HS4A 2Q2WA 2PKRA 4DREA 1T1RA 1JAYA 1HDCA 1YQXA 5JFOA 3AM5A 1ZKMA 2BFPA 1M75A 1D8AA 4FFNA 3GT0A 2PD6A 2DTXA 2H1SA 3IP3A 1LDMA 3H9GA 4WLVA 3BMQB 1WDLA 4Y9DA 4KZPA 3WYCA 4PG7A 4AJJA 1T4DA 1NWCA 4E3ZA 1LA2A 3QY9A 3RUIA 3EHEA 1Z7EA 3H2ZA 4S3MA 5TT1A 1K0UA 2AMFA 5TNXA 2Y67A 2W90A 3KSDO 4GWGA 5AOVA 1UAGA 4HV4A 1X1EA 3JQ8B 4OIMA 2QW8A 2DM6A 4BO4A 2GASA 3NJ4A 4GVXA 2DBRA 1UZNA 4AJKA 3NGXA 1IHYA 1EDZA 3R3SA 1DLIA 1C1XB 1ISFA 4RF2A 2CY0A 4TWRA 2X23A 1RM3A 4MP3A 1E6UA 3I5MA 1U9JA 1J0XO 2Z1NA 4JP2A 4Y67A 1DSSG 4B3IA 1DC5A 3DAPA 5L53A 4RPLA 1KYQA 1MP0A 4AJ4A 4Z6KA 4XZ3A 4MVJP 1NVGA 5EMHA 1YBAA 2J5KA 4G5HA 3UGKA 2NACA 1EMDA 2Z5LA 3TZ6A 4BNMA 3DZBA 4L4RA 1KVRA 4IQ8A 4XGNA 2P91A 3U4CA 4OXYA 2P4HX 5TRTA 4QX6A 1JTVA 3I9KA 3OJ0A 4RPGA 5BNTA 2CDBA 3ONEA 1EBUA 3VTZA 5JDIC 4BO6A 2SCUA 5KCZA 1O0SA 1P31A 2OUIA 3LT0A 1YB1A 4CM6A 4O1MA 3U4HA 3GGGA 4BKUA 3AY7A 4OMUA 2RIRA 1HYHA 3RQSA 3BZUA 5I8ZA 4MVJA 5F1PA 4JX8A 4LN1A 3OIDA 4BB5A 3INRA 3RC9A 1LJ8A 1FDVA 3P2YA 4QUKA 4UAGA 2Q46A 4BKPA 1HLPA 4FC7A 1E1LA 3JCZA 2P9EA 4OH1A 1HETA 3ETGA 3GGOA 5IAAA 5DBFA 3GUCA 5L7TA 2EJVA 4HBGA 4FFOA 1E3SA 1YRLA 1YKFA 2V7PA 4DGSA 3CUKA 4A03A 2AXQA 4HP8A 5F21A 5JE8A 4LCEA 3X2EA 3SBOA 4BGVA 4IZHA 4W9NA 2GN6A 2Q50A 2ZYDA 4R69A 5A9SB 1WMAA 1QYDA 2IZZA 4L9RA 1A9ZA 1C0PA 1MB4A 2D59A 3PLRA 3T7EA 1PJSA 2NWQA 4CJXA 2OP1A 2VYNA 4GVLA 1DIGA 4QFCA 1Y5RA 4Y98A 3K9QO 4WCDA 2O3UA 4B4WA 4EJ0A 2AQIA 3G49A 1CWUA 1SOWA 1XGKA 3KYDA 3F1LA 1R66A 5BSEA 1DHRA 1WNTA 1W4ZA 3MTGA 5AXAA 2A92A 4GMGA 3ITDA 2FN7A 2AE2A 4MKRA 1H6DA 2RAFA 4XGIA 3X2FA 4BO9A 4CLOA 2CZCA 4CUZA 5MGBA 2YQ4A 3WQRA 4ZD6A 3OICA 1XKQA 3ROPA 2ZQZA 1R4MA 2JFHA 4BS9A 4YT2A 5C37A 2D0IA 3WB9A 1U8FO 1GUFA 2Y1DA 4CL8A 4Q3DA 1MFPA 3VPHA 4Q3CA 5IF3A 4UVDA 2DUUA 2FR8A 3GN2A 4XB2A 3EDMA 4A10A 3GFBA 5A5EA 5F1KA 5U1PA 1VJ1A 5ICSA 5KVCA 2VHXA 4BGIA 4IGEA 3U09A 4FGWA 4INAA 2WE8A 4CV1A 1A7KA 4KQWA 3NEPX 2NADA 3PHHA 1GCUA 3FN4A 3ONDA 5TSDA 2JFGA 1GADO 3V8BA 1E7MA 3TF5A 1DAPA 5IZCC 3LT1A 1HF3A 1P45A 5L7YA 2EF1A 3RJ5A 1T25A 4RDIA 4Z3KA 1BXZA 5A9RA 4MVJF 5BSFA 4JIGA 3BYZA 4A2CA 1QLJA 1NAHA 2X7HA 5TT0A 3PLNA 4YR9A 4CLOB 1ARZA 1NAIA 4O5OA 2JHGA 4BNWA 4NK4A 4CMCA 5EIOA 3E9NA 4KQXA 1BXKA 3CH6A 2OMEA 1Y9EA 3GAFA 4NJMB 5IZCA 1GD1O 1KVQA 1E1KA 3WBFA 3WFIA 4NIMA 3GF4A 4ND5A 2B4TO 1UXJA 3FBGA 3FRJA 2OL4A 2UVDA 3DL2A 2RH4A 3FNFA 3VPFA 1XQ6A 3BMCA 4M55A 5IG2A 1CQIA 3FWZA 1XYGA 4BQRA 5KNLA 3Q11A 3STHA 3JQGB 5AYVA 1LSJA 2EW2A 4D7AA 3HSKA 1P33A 4NU5A 1GPDG 4NFHA 3V2UA 4YWJA 4TRRA 3BMOB 1QMGA 2JCYA 3FR7A 3HDYA 1E3EA 3E1KA 2CVOA 2Y1CA 1ID1A 1YONA 3DMYA 1PS0A 3R0IA 2BLLA 3F6YA 4OKIA 5I7FA 3SX2A 4BB6A 3UOGA 2EGGA 2DTDA 2ZYAA 4IXTA 4Z0PA 3GOHA 2NTJA 3L9WA 2VN8A 4NH4A 4BKRA 2VNSA 3KHUA 3VZQA 3K8ZA 5DNAA 3NX4A 1E3WB 1HE4A 3CPSA 1ZUD1 3G1TA 1M76A 2GUGA 2NVWA 1ADFA 5A06A 5FWNA 3QVTA 4FSHA 3H5NA 2C7VA 1BW9B 3SJ7A 4WE3A 3QLJA 4D3DA 2DBVO 1B8VA 1OC2A 4IM7A 4YAEA 4JROA 3HN7A 1PJCA 3TWOA 2FY8A 3N58A 2PWZA 4LCJA 1M6HA 3JQ9A 2AA3A 4J9VA 4K6CA 4S1VA 2GF2A 5FF9A 3MTJA 4BL5A 1ZNQO 1KY4A 3H3FA 3JYPA 1TI7A 1DFHA 3ZV6A 4KOAA 4CMEA 3JQBA 5COQA 2HAEA 3GHYA 3ZW9A 4N5NA 1KETA 4YDRA 4NBWA 2UDPA 4UUNA 1HSZA 4F46A 1HE5A 3AOEA 3D64A 1TT5A 1VKNA 2CF5A 3B20A 3LZ6A 3W1VA 2X86A 4IDDA 3IMFA 1JU9A 1LTHR 2I99A 2W2LD 1OZAA 1R0LA 1G6KA 4CMJA 1TLTA 4B7XA 2XXBA 1U8XX 3ULKA 2HKIA 2O2YA 2D1YA 1AHIA 4R1SA 2GGSA 1UZLA 3GVXA 1YB5A 4QO7A 2EKPA 1QR6A 1LLQA 3KEQA 3V1TC 1EFKA 8LDHA 1B3BA 3G0OA 3L77A 1DHTA 5EQFA 3U9LA 1HDOA 1VRWA 1E3LA 3OIGA 4MP6A 2VZ9A 4OJNA 1NQ5A 1P1RA 2V6BA 2J6IA 1H6CA 3EGOA 3P2OA 1SCUA 3GUYA 1H6AA 1SPXA 2VOEA 3IKTA 3M2TA 4ALNA 1I0ZA 2B4QA 3WOHA 1Q7GA 2C2YA 1EVYA 9LDBA 3S2IA 1QYXA 3JQCA 3RBZA 1EUZA 5MDHA 4NFSA 2AEJA 4IPTA 4GGOA 3WSWA 4YB8A 4CMGA 3BA1A 1GV1A 2A35A 1TT5B 3B1JA 1KC1A 3DZKA 7ADHA 2EHDA 2QZZA 4XYGA 3E9MA 5ILOA 2GZ2A 4PG5A 4JXKA 2V6MA 2XXJA 2HMSA 4J7CA 4BMVA 4YXFA 1YS4A 1T2FA 4RLHA 2PR2A 3C1OA 1DBVO 2VWPA 4AJHA 1NP3A 1XQ1A 3D3WA 1ADBA 2EV9A 4JJGA 4TVOA 3I83A 2Z95A 1ZSNA 3B1FA 3LF1A 4FJ0A 1DC3A 3VTFA 3M6IA 1N7HA 3AY6A 1O94A 2BFAA 1RM4A 4MVJM 4GAEA 3TPCA 1V0JA 1P1FA 4ALMA 3H9QA 1OAAA 3JQFC 5JAQA 1X0VA 3Q2IA 4ZRNA 1HSOA 4JJFA 1O95A 5A04A 1T2CA 1CQJA 2H5LA 1GZ6A 1I5RA 4IIVA 5DZSA 1ISIA 4BO8A 3DXFA 1K6XA 2Y99A 2PFGA 1W73A 4MVJE 4TMFA 3DMTA 3F4LA 3ADOA 3F4BA 3D4PA 3INTA 2ZKLA 1K5HA 2NLOA 1I3NA 2VZ8A 4TKMA 3S8MA 4OYRA 3I52A 1IPFA 1VM6A 3AI3A 1YBVA 4WGGA 2H63A 4G81A 4Y6SA 4IBOA 4CM1A 1WW8A 5G0UA 1NX6A 2EP5A 3BMCB 3DC2A 1JAXA 1CJCA 2VYND 4KTTE 4XIYA 1IZ9A 2AEMA 1R16A 1FK8A 3VZPA 1DRWA 3K6JA 1YQDA 4L4XA 3V1UA 1X7GA 3BMOA 4EZBA 2RHCA 2HMVA 4NPCA 1PJTA 4ZQGA 1KERA 5KKAA 1EQ2A 2P2SA 3GEMA 4HXYA 3DHYA 4GBJA 4IJWA 1NHGA 4X54A 4CM9D 4XDYA 2I5PO 2YFQA 3HB5X 4Q39A 3VZRA 2O3SA 3GAZA 1KBZA 4XD2A 1RPNA 5A9TA 1MC4A 2VRBA 3KRTA 3C85A 1CF2O 1ZK3A 2ZATA 5U9CA 2AE1A 2OORA 3NKLA 4XWYA 1Y81A 4NR0A 2FPGA 4GKBA 2Q4BA 3GZ4A 4TSKA 2OOSA 4M49A 4RZIA 3WSVA 3TZCA 3KSUA 1M66A 3ZWXA 4J2HA 3OECA 4DMLA 4D45A 1E6WA 3ITKA 5IJZA 5KJ1A 1EK5A 2GSDA 5H81A 3QP9A 3DOJA 3GVHA 1P3DA 3SLGA 4MOWA 4Z9FA 3MJCA 3WNVA 5TF4A 1PJ3A 2JKVA 2O3TA 2ZTMA 3B1KA 3ETEA 1GQ2A 1LX6A 2BRUA 4BGUA 5IXSA 4DIBA 1CETA 1DIAA 3C8MA 3QWBA 4FN4A 4FW8A 2G76A 1WXDA 2Q45A 1XELA 4NMHA 4BNYA 3UCFA 1KEWA 1VPDA 4Z0HO 1NR1A 2HDHA 5FI3A 2X58A 5DBGA 3W4JA 1MFZA 3NGLA 1ZO8A 4R4JA 4CLHA 1DFGA 3JYOA 3O8QB 4ESOA 3D5QA 1WAMA 5TGDA 1MLDA 1XCBA 2DT5A 1I24A 2CD9A 4XYEA 1LC0A 2AG5A 1XR3A 5ITVA 4F45A 5I9NA 2F00A 4YQZA 1IE3A 2FR1A 3M1LA 3U4DA 5A9SA 5JDCC 2HRBA 3FSRA 3GN1A 2DAPA 4RDHA 3IP1A 4GX2A 4WOJA 3UFXA 4YJFB 1GPJA 4XQGA 1N8KA 2NU9A 2W98A 2ZIZA 3JQAD 4G2NA 3S2FA 3KYCA 1ZEMA 2EW8A 4LSWA 5IDQA 5JNLA 1Q0QA 2Q1TA 2X0NA 2YZ7A 1ZBQA 1NQOA 3DHNA 3CMMA 1ORRA 1SB8A 3PYMA 5KJEA 5T67A 3UKOA 2FWMX 3V2GA 5L4SA 5LC1A 2BGKA 1ZMTA 1C14A 2IZ0A 2NU6A 1QYVA 3AUTA 3DZFA 4MKZA 1Q1NA 3OMLA 4U5QA 5T57A 1EVIA 4MIEA 3DZHA 4EUHA 3PJFA 3WNQA 2ZJ1A 2EJWA 3ZU5A 1ZXBA 1WVGA 5CHEA 2VNAA 3JSAA 5CPFA 2PNFA 5COAA 1ISJA 1ONOA 4EUEA 4M86A 5THQA 3VPGA 2O48X 4PLHA 1GYQA 2PD4A 3D4OA 4J16A 5KVSA 3LLVA 3TRIA 3WICA 4UVEA 4QECA 1J5PA 2G82A 2VQ3A 4BOYA 5JY6A 3MJVA 3NDIA 3V1YA 4YA6A 4TRJA 4PVCA 1YXMA 1CDOA 1A4UA 2GDZA 2GRAA 5F1OA 4K26A 4B7CA 4IDGA 4MVJD 4XQEA 4CR7A 4NBUA 4EGFA 4JQCA 4A0SA 3O03A 4YBZA 4JP3A 4K28A 1HDZA 2EERA 2FMUA 1U7HA 1PJ2A 1ENPA 2GPTA 4RQUA 1B2LA 4RJTA 4NJMA 1E5QA 2B0JA 4MPDA 4GGPA 4RF5A 1GYPA 4CQMB 4Z9YA 4KMSA 4D46A 1C1XA 2FR0A 4D3SA 4D41A 4BNZA 2EIHA 1GUYA 3A4VA 1H5QA 4I9HA 2QHXA 4BIIA 1N1EA 2X6TA 1DLJA 4PFJA 2Q4EA 1YL7A 2BFMA 3BHMA 5C3MA 4XJTA 2R2GA 1T1SA 1R0SA 2E48A 1YL5A 1JKIA 1B16A 5G4KA 5B4TA 3F5SA 4ZJUA 1BTOA 4CM3A 4WUVA 3RUEA 2CSUA 4DC1A 4ZGWA 5L95A 1P1KA 4ILKA 4ZQFA 4D43A 4DL9A 3TNLA 1F06A 2QQ5A 1H9AA 4WLEA 4AJ1A 1AGNA 5TQVA 4Z0TA 1KIFA 1RJWA 2BF7A 3JQ7B 4FCCA 1C1DB 4IQGA 1YOVB 4BV8A 4DLBA 3PWZA 2NTVA 5JC1A 5CFZA 1K6IA 4E5PA 2XAAA 3SC4A 4D0RA 1R37A 3NTQA 1Y8QA 3LT4A 1ONPA 3WMWA 3CSDA 1U1IA 3RASA 2PTGA 3C1AA 1P0FA 2VCYA 3OIFA 2BFOA 2FSVA 4DIOA 4YAGA 1U4OA 1PS8A 1GR0A 4ND4A 1NBOA 2IDZA 4UEKA 4NNJA 3C7AA 5T8KC 4NJOA 1YWGO 4II3A 3PK0A 3Q6IA 5JXWA 2NVBA 1NWHA 3JYQA 2O23A 3FNEA 4IJVA 3EVNA 2JCXA 2AQHA 1HDGO 3RAJA 3WQSB 4BO0A 3KSZO 4ALJA 3M2PA 3UH1A 3RKUA 3PVZA 3TZKA 3JQ7A 1C3VA 3E5RA 1BG6A 3LYLA 1ISMA 4BNKA 4P8RA 1AN9A 3OM9A 3OQ1A 5KTKA 4FDAA 1HT0A 1ZMOA 4I5DA 5CDUA 4CM9A 1YE3A 4BNNA 2PGLA 2VRCA 1BGVA 1XWFA 3EYWA 2NTNA 4BNLA 3SLKA 2G5CA 4YJGB 1F14A 2P9CA 4BO1A 3DZJA 1NPYA 3CEAA 3WIDA 1AUPA 1MXHA 3TZQA 4DA9A 4E2ZA 3OA2A 4E31A 4E5NA 1V3TA 2Y66A 5CDGA 4IDBA 3VH1A 3PTZA 2Y1GA 3PYLA 1B15A 1IPEA 1U3WA 2JD0A 2XOXA 2QIOA 5I7VA 2OZPA 3EUWA 1QYCA 2BMAA 2VT2A 1LQTA 3S2GA 2V6GA 3L6DA 1Y9AA 4ZQEA 4F6CA 4UUOA 3TFQA 4XRRA 5COBA 2WYVA 4CV2A 1H2HA 1I3LA 4K9DA 3WGIA 1PZGA 4CQMA 3Q1LA 2E82A 4GLLA 3S2EA 3UAGA 4XYMA 5A4DA 5LDHA 4GSLA 2HLPA 3D4NA 4JBGA 2VT3A 4BNXA 4BGEA 4ONEA 4JBIA 2POQX 1E7SA 4J0EA 4DPLA 1T2EA 2JD1A 5DOZA 4OKNA 4MINA 5BT9A 2D5AA 1RYDA 1SEPA 1D3AA 1DJQA 3RWBA 1BSVA 4UREA 4IXWA 4WCFC 1GZ4A 3GPIA 1VL0A 1AHHA 3ZWAA 3DFZA 1U3TA 3GNSA 1JVSA 4PVDA 1ZJYA 4H16A 2ZTUA 3E9QA 2Y0CA 2J3HA 3B70A 4A26A 4BNTA 2IODA 3BMNB 3VC7A 4HNHA 1L1FA 3F3SA 4IUYA 3L4SO 1TA4A 1EBFA 1ENOA 3VVBA 1OOEA 5ILGA 1X14A 4NBTA 5IZ4A 4YEDA 4DC0A 4D42A 1U3UA 5BQFA 1A5ZA 1D1TA 3HN2A 2EP7A 1V3UA 1HLDA 4TROA 3ZN2A 3ZV3A 3DTYA 1ZCJA 3GA0A 3OSUA 4GI2A 5C7IO 3K73O 1T24A 1YBMA 4B8ZA 3RFXA 3WJAA 1Y8QB 2WE7A 3AWDA 2EG9A 1HDRA 4EEZA 1GAEO 2O50A 3ASVA 2ZCVA 4L73A 4AVYA 5L4LA 3GNTA 1XEAA 1Y6JA 3WBBA 3A9WA 3JQBC 2NVUB 4BVAA 1LNQA 2ZB8A 1ZXLA 4BUCA 4WECA 3P5SA 1QYWA 1J49A 2QYSA 1VL8A 4XB1A 5ER9A 3I23A 3AU8A 2HJRA 4FFMA 1YOVA 1T2DA 3O8QA 3MWDB 3QIVA 3RJ9A 1JKFA 1E1NA 3HADA 5ENDA 4BMSA 4FOOA 3VPSA 3T4EA 1JQBA 1H9BA 1P9LA 3R1IA 3GLQA 4H15A 2VTEA 5G0SA 8ADHA 3AUUA 3PJGA 1PIWA 4O0LA 1EFLA 4RGBA 3G1UA 4II2A 4TVBA 5KVQA 1Z6ZA 3ST7A 2JL1A 3PWKA 2YY7A 4AJLA 2NU8A 2P9GA 4TRMA 4O59O 1Z75A 1A27A 2O7SA 2VWQA 2YQ5A 1MG5A 4WOKA 1N9GB 5ES3A 3ZV4A 3EK2A 4FJ1A 5JS6A 4Q3EA 3RU7A 1RM5A 2HRZA 3AY3A 4PLFA 1E7RA 3LDHA 1VKOA 1UZMA 1UJMA 1P44A 5FYDA 1FMCA 3GDFA 3GDOA 3NT2A 5DCWA 5TC4A 4OGWA 5B1YA 1ZJZA 2PD3A 3ZI0A 2VWGA 4BNUA 1N92A 3FBTA 3PQDA 3D3WB 3CINA 4P38A 3HB4X 5L51A 1TVEA 5TLSA 3PEFA 1I2ZA 1DIHA 1DIBA 3AUSA 2FP4A 3GG2A 2EXXA 2Q49A 1XLTA 3VZSA 4TQGA 4YCAA 1TXGA 1R4NB 1SC6A 2PGJA 4CL3A 4CQMD 4E2XA 4CQLA 3ZNQA 2UAGA 1A9YA 2J5RA 3BTVA 4AFNA 1G0OA 2OXIA 1NR7A 3OFSA 1ENYA 2PY6A 3I9MA 4O6VA 4BNHA 1UP6A 4R68A 1F17A 3Q3CA 1V3VA 4N54A 2E49A 4J91A 1MA0A 4GH5A 2IEDA 1DC6A 1N1GA 1XA0A 4YPOA 4M1QA 5C7OO 5I8WA 3WXBA 4ND2A 1ML3A 3KYCB 1R12A 4DPMA 4DRYA 2ZB7A 3SVTA 1A71A 3PGJA 4H3VA 3LVFO 3ROMA 4E5KA 4J0FA 3PWSA 1KY5A 3NUGA 4KP7A 4YT4A 7MDHA 1PZHA 3Q9NA 3KV3O 3QHAA 4LMPA 3ZCXA 1BVUA 3M1AA 1AXGA 1BMDA 2DQ4A 1BXGB 2O2SA 4IMPA 2BELA 2Q3EA 4RVHA 4MIYA 4AJNA 1X15A 4AJEA 4WEQA 2PZLA 2GERA 4KUHA 4YJDA 2DBZA 1FXSA 4U6SA 2C29D 1WWKA 3H4VA 4R41A 2AQ8A 4D0SA 4DYVA 2HMWA 1PQUA 3H8VA 1ZK4A 5EERA 4ZVVA 2O4CA 1O89A 4CODB 3TJRA 3UF0A 1LDBA 2A94A 2Q1UA 2QRJA 1V35A 2B4RO 1XSEA 3L9XA 4AL4A 1GY8A 5JMWA 1KS9A 4W99A 2RBEA 2GCGA 3EMKA 3LSYA 5HTOA 1PGQA 4RCVA 3PXXA 3ZHXA 4BNVA 2DC1A 5EESA 5T5QA 4YACA 1LSOA 5ER6A 3JQAB 1O6ZA 3W4KA 2C82A 4IMRA 3TQHA 4PGFA 3PQFA 3BXXA 2WJPA 5H83A 1LSUA 1K89A 5T6BA 4XA8A 1WZEA 3O9ZA 1DRVA 5DF1A 3GC6A 5BSGA 4BKQA 1Z73A 2OFPA 4TZTA 4WNIA 5CDSA 4E21A 1UP4A 4YVFA 4PG8A 1IOLA 4J7XA 5JCJA 3DBHA 5CP8A 3RUAA 4ND1A 4RVGA 6LDHA 4NK5A 3Q0EA 9LDTA 3AK4A 3PIDA 3GZNB 2R6JA 3PRJA 1LDGA 3PHGA 3WIEA 5BR7A 3EVTA 5KJFA 2OBYA 2DLDA 3H9JA 4AJ2A 2CF6A 4UVIA 5HWSA 1FDUA 3JV7A 3GRKA 3D7LA 2HJSA 3ENKA 2E6UX 4CMBA 1DFIA 4B7UA 5JO0A 3FPLA 1YJQA 2AEFA 3L6EA 4EBFA 1Y1PA 4KUGA 3C7CB 1QV7A 4XKJA 1LLDA 4WJZA 3JD4A 4IDCA 1NFQA 3N74A 2LDBA 1O8CA 1P77A 3IUSA 1HEUA 2J3IA 1S7CA 2HSDA 5JCXA 1B26A 3JQEA 1NFRA 5DULA 3H2SA 2V6FA 3ON5A 5CDYA 3PFWO 3G79A 3ZWOA 4UVHA 4PZCA 3WGHA 2E37A 3A28A 1IL0A 2UV8A 3R3JA 3OQBA 1OFGA 4OL9A 1IB6A 5TJ9A 4R1UA 3ANNA 4J2OA 3QVOA 1YGYA 3TSCA 1GV0A 1B3RA 3DBHB 1WDMA 4L74A 4E30A 2J3JA 3U4IA 1QP8A 4FR5A 3WG9A 1PGPA 3C3XA 3OEYA 3GZNA 1PGOA 2ZJ0A 5EL0A 2D5CA 5IN5A 1FDSA 4FD3A 4PRKA 1ZZEA 2DPGA 1DIRA 1K3TA 3ROQA 4E13A 1HKUA 1LU9A 2NNLD 4HFRA 4XR9A 3GH3A 1ZSVA 1Y7TA 1BW9A 2IZ1A 4I5EA 3FR8A 3IAHA 5I9LA 5CAEA 3FNGA 2WD8A 4W9NC 3JD1A 3RBXA 2OO5A 3KVOA 5A02A 2OP0A 3OHSX 3CKYA 2QYTA 3CIFA 5L4NA 3VHRA 1VJTA 1LXCA 4C4OA 5TIIA 4ZA2A 1WLYA 2Q2QA 2YDYA 1ZK0A 1NASA 1I01A 5LDGA 3D3EA 1CYDA 1LC3A 1ZW1A 2HK9A 4RV9A 3QVXA 3UVEA 1UXHA 4WASA 3D5TA 4E0BA 4FB5A 5T8KA 3AOGA 1EE9A 1SAYA 3NT5A 1PL6A 3H3JA 1QXSA 1XU9A 5HS6A 4KDFA 3IQDB 3NYWA 1ZH8A 2NQ8A 4ZICA 3BHJA 1LLCA 1QORA 4I1IA 4J4HA 2CVQA 3OJOA 5ITWA 2R00C 1VC2A 3I4CA 4PG4A 4RQTA 3PI7A 1JLLA 2A9FA 1B0AA 1I2CA 4RVSA 3DBRB 1K2WA 4AJPA 1A4IA 3AJRA 1MX3A 3RCBA 4RORA 1ULUA 3WR5A 3U49A 4CMIA 1I2BA 3VAZA 4PLZA 5G0TA 3CZMA 4JN6B 2D8AA 2GLXA 4IDFA 3V5NA 3NJ8A 1IUKA 5AVOA 2PLAA 3DZIA 1ZIDA 4J49A 4DUPA 4J6FA 4DMMA 3I9LA 4YT5A 3LC1O 3F47A 2ZTVA 4MP8A 1JN0A 4W82A 1VE9A 1W6UA 4URFA 1PZFA 3ZWBA 3S1LA 1CEQA 2VUUA 5JC8A 3AM3A 3ZNPA 4FFPA 1BXGA 1P0CA 3DONA 4P4GA 4QT0A 3GDGA 3E18A 1QV6A 4WKGA 1U7TA 5G0WA 1F0YA 3QSGA 4NFYA 4PLWA 5U4QA 4BQPA 2WMDA 3I1JA 2Q1SA 1HTBA 3I9JA 1KVSA 3WLEA 2RCYA 5ICMA 3AM4A 4F3YA 4QO8A 3FWNA 4PIVA 4B4OA 4IS3A 5EN4A 1LRJA 1NPDA 2YV2A 1CRWG 3RVDA 5I7EA 4TRNA 3RD5A 3TFOA 2QG4A 1Z74A 1GL3A 5A3VA 3KXDA 2WSBA 1GTMA 3ZHZA 1NFFA 4DBVO 2F1KA 1H2BA 4NZ9A 1E77A 1E0DA 3H65A 3WQQA 4QSMA 3JQGA 3FHLA 3QRWA 3ZWMA 1OMOA 1GEEA 1MGOA 2VZ0A 3JD0A 2J8ZA 1WPQA 4UEJA 4CV3A 4XIJA 2YFHA 4R9RA 1DC4A 3DOCA 4WCFA 1V9LA 4PLTA 4DPKA 2TMGA 5JAMA 1C0IA 3QVWA 3QE3A 4JCOA 1X7HA 2IE0A 1ZSYA 2HUNA 2DBQA 4XEHA 1M6WA 3TN7A 4R54A 4CM5A 1E1MA 5JAIA 4YJFA 3KOUA 4WK6A 1L7DA 2BGLA 4KWIA 2OGUA 5H82A 3WDSA 3MCVA 1UXGA 4FFLA 3W8EA 5A3JA 2DKNA 3FNHA 3FTPA 5GY7A 3MJEA 3DZGA 4IDEA 3WWYA 3WS7A 1U28A 1VI2A 4IJUA 2GO1A 4FQ8A 3UICA 4CPDA 4EITA 2CDAA 1JW9B 4PG6A 3QWAA 5L45A 4IQ0A 2ILTA 4U0JA 2G17A 3VPXA 5GZ1A 2VWHA 3HFGA 5T64A 4BO2A 5IFLA 3RUHA 3FI9A 4A27A 5JAZA 4I08A 1JKJA 1IZ0A 4YAKA 1O9BA 4LVCA 4WLOA 3UCXA 1SEVA 1PSDA 3IOYA 5JPIA 3ICCA 4B4VA 3C1TA 2BI8A 1HYEA 2HU2A 2HCTA 5JLAA 4ZQBA 3WLFA 2YJZA 3PP8A 1I30A 4E33A 1Q7CA 2DVMA 3EY4A 4CM4A 3EW7A 2HO5A 3L07A 4E32A 3IUPA 2P5UA 3WTBA 2Y93A 3ANMA 4IS2A 5F5LA 2FSSA 2VYVA 4CLXA 1UDBA 4OHUA 1GQQA 3NAQA 4TZKA 4CLRB 2EKLA 3OA0A 3GMDA 4R3NA 1MC5A 1T2AA 3KTDA 3GK3A 1GDHA 3DBLB 1Q0HA 1UH5A 3GVPA 1JA9A 3K2BA 5HM8A 3PJEA 4GX1A 4Q3BA 2I9PA 3B6ZA 1ZVMA 4MIOA 4DWVA 4ID9A 2DFDA 3BIOA 1RYEA 3ETDA 3GPDG 2GNAA 5CEEA 4PRLA 1JVBA 2GZ1A 1HDYA 4CMHA 5CDTA 4K6FA 2VHWA 2X5OA 4E5MA 4J1NA 2X1HA 3WYEA 2R00A 1JWBB 1T26A 3K92A 4WLUA 2I65A 1ENZA 2C2XA 3GQVA 1Q7BA 5A05A 5JO9A 3WGYA 2DFVA 2X0IA 4NHEA 2BKAA 4LK3A 3IL2A 3W6UA 3OH8A 4FJ2A 1FDTA 4KTVE 3PQEA 4UUMA 1YQGA 4Q3AA 2ZK7A 3EZYA 4OOFA 1K6JA 4CUJA 1S6YA 1Y8RB 5FFFA 4GL4A 4B8WA 3E48A 4QQRA 5DCUA 2GN4A 1LLUA 3CXRA 2PV7A 3KYBA 3PHJA 4LRTB 4NBVA 1KEPA 3WGTA 4L8VA 3WTCA 4B79A 3ZWVA 4FFRA 2YDXA 1PTJA 1UXKA 2Y1FA 2FHSA 5JMPA 5L9AA 3LC7O 1G1AA 2WYUA 1HZJA 2IYOA 3FPCA 3WX0A 4FPXA 4OO3A 2PZJA 5DBIA 1ADCA 4PLVA 3RKRA 3FCOA 5F3RA 4PZDA 4Y6RA 3UUWA 3HG7A 4TKLA 3A06A 2IYPA 2O4UX 1GUZA 1EVJA 5KIAA 1ONNA 2Y68A 2E4AA 4UUPA 2FZEA 4W4TA 1FF9A 4F6LA 3SEFA 3LU1A 4M54A 4GQAA 1E7YA 3P7MA 1PJBA 4ZU3A 3IDSA 4MVJI 5I9MA 1VLLA 3HFSA 4NI5A 2RHRA 3JQAA 5JCJD 3V2HA 3WFJA 4XJSA 5LCXA 4YAJA 1YDEA 1GQYA 1GFSA 3C7DB 2X22A 3BHIA 1GZ3A 3MJ4A 4Y6PA 4H7PA 4XDZA 2HQ1A 3GVIA 4E6PA 4B4UA 1SNYA 1ISGA 1NXQA 3HWRA 3GR6A 1H6BA 1NYTA 5JDCA 4OQYA 1D1SA 2VUTA 5G4KB 3RIHA 3QWIA 3ZU4A 2FPPA 1F12A 5DCYA 5L3ZA 4ZN6A 3AFNA 3MJTA 3D1LA 1IY8A 1N7GA 2QZ9A 2B36A 2XPCA 4JBHA 5EQDA 5AXCA 3NV9A 3KO8A 3PIIA 4RPJA 4ALIA 4ALKA 3SC6A 4HKTA 3JQ8A 3HNPA 4LGVA 2W4QA 5J23A 2Q2VA 1BDMA 3D0OA 3RUFA 3GEGA 1DDOA 2VYVD 3DBRA 2G1UA 5JDIA 1QSGA 2H9IA 4XGKA 5FEUA 1XU7A 4W7HA 3GHHA 1ISHA 1M2WA 4CMIB 4IJKA 3ORFA 4WEOA 1GCOA 1E5LA 4OXNA 2CUKA 1KEVA 2TMDA 5DP1A 2GR9A 4Z3DA 2FZWA 4HWKA 2B37A 2HMUA 4HFNA 4JK3A 4B3JA 3TL2A 1ADGA 1EEHA 4GLOA 2JAHA 4R1NA 1WP4A 3RUCA 2JAPA 2YUTA 3QW2A 3KLPX 1V6AA 2W2KB 3JQ6A 1OBFO 1W8DA 3OJEA 3WGOA 4XQ9A 2YHUA 4HFMA 1R4NA 3ABIA 4EW6A 1TB4A 3U62A 4P22A 3U5TA 4HUJA 5DP2A 1E7QA 3BTUA 4I9UA 3CZRA 1HXHA 2BI7A 4JGBA 5FI5A 2Y1EA 2JHFA 3MWEB 2X8LA 2ET6A 2XF8A 1EQUA 3CE6A 1ZK1A 4LW8A 4XRGA 3PZBA 2I3AA 3MJSA 4PLGA 4RF4A 2DPHA 1LSSA 2CMDA 4UULA 4E2WA 1NVTA 4N7RA 1HZZA 5B4VA 5G2OA 2VHZA 1E3WA 3PJDA 2W2KA 4RVFA 4A5OA 4RVDA 5BSHA 4A73A 4FS3A 4GMFA 3LLSA 1YDWA 1U5CA 1I33A 3L4BA 4OSPA 1J4AA 4BO3A 2QRKA 2BH9A 2Y1OA 3ZU3A 5AXBA 3KEOA 3AI1A 3FF4A 4YT8A 3I4FA 3JD2A 3K5PA 2D3TA 1PGNA 2GN9A 4BHTA 1DXYA 1PJ4A 4ROSA 3R6DA 3HDQA 1GYRA 2NU7A 5HRUA 3DWFA 2V65A 2I76A 1EUDA 3E8XA 2BGMA 5KOIA 6ADHA 3KYDB 4M87A 5EJ2A 2P5YA 4GX0A 1E92A 4R5HA 3UW3A 3ZU2A 4BNIA 1IYZA 3O38A 1U3VA 1U2DA 3PHLA 3ZZNA 3NTRA 1DPGA 4GSKA 3T7CA 3COSA 3KB6A 3GNQA 2H6EA 3JYLA 3F5QA 1X1TA 1LUAA 3L6OO 4CMKA 4BO5A 3ZW8A 1DRUA 2B5WA 4QFDA 3MOIA 4CQLB 1Y8RA 3H5RA 1ZEJA 4R51A 3JQ9C 1NNUA 3WGZA 4YRDA 1YB4A 4R9SA 4RO0A 5IN4A 1PQPA 1FJHA 1PWZA 4Z9XA 4PLPA 2P68A 2ZTLA 1LDYA 4WLNA 1UP7A 3FTNA 3IC5A 2RH8A 5B4UA 2C0CA 5TX7A 5JSFA 1BDBA 5DOVA 1W0CA 4WLFA 4UEOA 2IRWA 5L40A 2JD2A 4KUEA 5C7LO 1QKIA 2VOJA 4IINA 4NDNE 1G0NA 1Y5MA 4OSOA 4KDEA 3F1KA 1UDCA 3ZGYA 1U2GA 1KOLA 5HA5A 5F5NA 3TL3A 2NVUA 3SJUA 4NQZA 4ITUA 4R16A 4R5MA 3ANLA 3C24A 1PR9A 1XDWA 3W8DA 2O3JA 1LEHA 1DJNA 1SOVA 3ZWCA 4CM4B 3BMNA 4DBZA 1C0KA 1DEHA 3MEQA 5ENVA 4ND3A 1E7WA 5ADHA 5EINA 1PU2A 1O5IA 3VKUA 1A7AA 3RC2A 2PZMA 3HDHA 2ZQYA 2Q99A 4DQVA 4RPHA 1AE1A 3DR3A 3LQFA 3ENNA 3RSHA 2NUAA 2C54A 1HE3A 2HK7A 4DLLA 4PN3A 4DTIA 5JBIA 5JY1A 3BMQA 1LI4A 3H9UA 3QWHA 1R0KA 3HJAA 3DAGA 3K96A 1C1DA 1PR3A 4FGSA 3VKVA 2C5AA 2X5JO 3IJPA 4J1QA 3DFUA 4LVUA 3VDRA 3GEDA 4NBRA 4CR8A 4EI2A 4N5MA 4XX0A 3U0BA 5AXDA 2ZCUA 4HFJA 2PGDA 4JLWA 3WJ7A 5BNIA 5GZ6A 4J90A 4WCFB 4EJMA 4MVJH 2B35A 5CEJA 3W4IA 3OQ6A 3ROKA 1HE2A 1TT7A 1P1IA 4CUKA 3UN1A 3RFTA 5AQ1A 1PQWA 3HUDA 3K31A 4LMRA 5HBRA 1TEHA 3W8FA 4MVJG 1NQTA 4DQUA 1WDKA 3OF2A 2EWMA 4IGFA 4PCVA 2X0JA 4EYEA 2Y0DA 2C07A 2PKQO 4MDHA 4CMEC 4J3FA 1VL6A 5JYEA 3RFVA 1PZEA 2YHIA 1PX0A 4OM8A 2VTDA 4QEDA 2NM0A 1UXIA 2Y05A 3JQDA 3JQFA 3PGXA 4J4TA 4LRSB 5CPBA 3AOEC 5I7SA 5L7WA 4LISA 3BTOA 4DYDA 4I5FA 1KC3A 3ZHBA 1F8GA 3INGA 1DOHA 3UHAA 3E5MA 3IS3A 3QV1A 4RF3A 4WNCA 1XG5A 2CFCA 4PLYA 5G4LA 1EVZA 4M89A 3TDKA 3WWZA 4YRBA 1HYGA 1SMKA 4QXMA 3VH2A 2C20A 4C7KA 3ZWNA 4DXHA 4MKXA 5THKA 3GVCA 4EDFA 1B8PA 3DB2A 3ADPA 2I3GA 2O7QA 3PDUA 5EPOA 4D3FA 5KJ6A 4E2YA 2J3KA 3AW9A 1U5AA 4L0QA 2B69A 4DLAA 1Z45A 3KUXA 4AICA 1EK6A 4E12A 5GZ3A 4E5YA 4EUFA 1YJ8A 1XHLA 1EDOA 1IHXA 1P74A 2NQTA 4J7UA 4J4BA 3H6KA 3ZNNA 1H93A 1X7DA 2Y0EA 2YW9A 4XR4A 4B3HA 5B12A 5CG1A 1PEDA 3RC7A 4QTZA 1I10A 4Y8VA 1M67A 3QWFA 2I66A 2WD7A 4RLSA 3JD3A 1KEUA 3RBVA 1JDJA 3F46A 2PA3A 3T4XA 1KVTA 4RPKA 4EJ6A 1VSUA 2YHIB 3PFFA 5DT9A 3GY0A 1CIVA 3ZHYA 3IKVA 3OBBA 3KLMX 1YVEI 3HZZA 2EKQA 1P1HA 1BVRA 1C0LA 3PDJA 3ZH2A 3DQPA 1RM0A 1Q0LA 1P1JA 1QG6A 3EC7A 3IIEA 4W6ZA 1EE2A 3N7UA 1NHWA 4YJHA 1PGJA 3G3EA 3U3XA 2GZ3A 4BMNA 2O3QA 4PZEA 1OI7A 5KWEA 3RROA 1D4FA 3OJFA 1IULA 2JCVA 1YO6A 3I9NA 3QA9A 5CG2A 3WYBA 3PPIA 5K9ZA 2VUSA 3I3OA 2X9VA 3BTSA 3QQPA 4NU6A 2G0TA 4GX5A 1YH3A 3NDRA 3EZLA 4FOSA 1I3MA 3VVCA 3VOSA 2WD7B 2FPIA 3KBOA 4R1TA 4K1LA 4HADA 4ZRMA 2WM3A 2QRLA 3E82A 4R01A 3I6QA 2HMTA 4BV9A 1BRMA 1UR5A 4HNGA 5K6AC 3UXYA 1KVUA 3DBLA 1UAYA 4BO7A 2WDZA 2W2LA 5TJHA 1R6DA 1WZIA 1WMBA 1R4MB 4BNJA 1LRKA 1AXEA 2J5QA 1RKXA 2I67A 3HE3A 1I32A 3F9IA 3L4BC 4C7JA 3DHEA 2X9GA 4I8XA 3ZWYA 3OJLA 4N5LA 3ZV5A 3Q9UA 5A1TA 1E3IA 3GFGA 3HDJA 1PJQA 2IXAA 5TS3A 4A7PA 1FDWA 3NTOA 1NTOA 5JYDA 3VDQA 4WPGA 4J43A 4J1SA 1X0XA 3VH4A 4E4YA 4U6QA 2D2IA 4I9NA 1LQUA 2WWRA 4YRAA 2UYYA 3I9OA 4CM8B 2FOIA 1EZ4A 4NG5A 4MJLA 1Q2XA 4IIUA 2ZB4A 3BAZA 2B83A 4L76A 3A14A 4O63O 2PK3A 2VHYA 2W8ZA 4YAIA 3NRCA 1HRDA 5KVVA 4YTEA 5GMOA 4FBGA 1BHSA 4ZHSA 4FC6A 4RVUA 3ZWWA 4CM8A 1ZK2A 4IY1A 4RZHA 3E6AA 1HDXA 2VHVA 2WYWA 1DB3A 1H0KA 1BWSA 3AU9A 1I36A
chains in the Genus database with same CATH superfamily
1Z35A 2FW9A 5AO9A 4CG2A 3KZVA 2DUWA 4KN6A 1PL7A 4L9WA 5AHWA 4WY8A 4PHTA 1BKYA 5F7ZA 3K0FB 2BGWA 2BSAA 3RNLA 1XIVA 2ZBUA 4DDKA 3LF2A 4Z51A 3VHXB 3PGMA 4ZEWA 4GWKA 1BN6A 5BNWA 1QRRA 4J29A 4ABYA 2XMGA 4HZGA 3TD2A 1M1XB 5AJHA 3DE4X 5LYJA 4U0KA 3I6IA 5KI6A 3ZDFA 2Y27A 1FTQA 2C4MA 3EEBA 4OQPA 4C3UA 4Z4FA 5AQEA 5LJIA 4ETWA 5DLQC 2I4NA 3ZU6A 1JAIA 1EUYA 2Q2NA 3AGQA 3F8TA 4DQLA 3PQ5A 1V7ZA 4YUAA 3FGPA 4BNFA 1GN8A 1LCIA 1Z4LA 2C4HA 4OH1A 4KACA 3G9TA 4QPNA 1HT3A 1SO8A 1S3IA 3ZQ6A 2MYNA 4AZ0A 2IS2A 1U63A 3AF1A 2OBNA 3CF0A 2P4UA 3KKKA 5ERYA 2XA2A 1DAEA 2XWJI 2QX7A 3EUAA 4UBJA 3O91A 2EL9A 2QTFA 4TLAA 1FW8A 3HLKA 3RV4A 1XVTA 4DVGA 1THTA 2P0EA 2RGCA 2Z6QA 1RHQA 2JI8A 2XQKA 4P33A 1D7OA 1IBCA 1RWQA 2X8JA 3FDZA 4G86A 2QS9A 4CLDA 2Q6IA 3ONFA 1YI0A 3HLYA 1NVMB 4UCQA 3RLIA 4AG3A 2NXWA 1F8FA 1FY2A 2I03A 2PKQP 5M2QA 3KPJA 2C83A 3RYHA 1GEGA 1R6AA 4LYYA 2RARA 5KX5B 1SVUA 4GM0A 1JP7A 2FUG6 4BDSA 1SU7A 1ZFNA 3NYIA 4GO1A 1VSVA 2D4AA 1Z82A 1I7DA 1TUEA 1C80A 1M2HA 3EIOA 1NG1A 4LYHA 1RZRD 1J6UA 4AN1A 2EFGA 1UPTA 2AZMA 2VXYA 2YN0A 4Q3NA 5A1JA 5A4JA 5JJKA 2X5KO 2BD0A 4RANA 1CUAA 1F2TA 4P4LA 1DV2A 3UMFA 2ZRAA 3O26A 2HPZA 1Z83A 2TMKA 3N2LA 1R5NA 3RS2A 1TCAA 1Y82A 3DL4A 4QU0A 2JB9A 1J9EA 1MAWA 3O4RA 4DLTA 1DBIA 3BCHA 4FNOA 2C7GA 3O95A 4NTZA 4XFKA 5G3YA 4X6XA 2FPPB 3TMKA 3MWGA 5FBLB 4CLEA 5BV0A 3D7SA 5FOVA 4C4ZA 3QE9Y 2PZGA 3LWZA 3HBNA 3FPSA 4WZBB 2ZJ6A 2AW5A 4D02A 1FFYA 4H2DA 2PZKA 3X1XA 1KMNA 4ZQHA 4OXKA 3H9EO 1MO6A 1HL3A 5IC6A 4YJKA 2JRCA 3TNYA 3RU9A 3MCWA 3KETA 3MCTA 3MAGA 3PXGA 2XNHA 2PMDA 5T6MA 4N76A 3H5AA 4BN4A 3H2GA 3KTAA 1V5GA 3L7MA 4L50A 4LOHA 5FO1A 5JFGA 3WK8A 2AFRA 2XDQA 3L0OA 2GD1O 3DC7A 3NT4A 3OFVA 3VXKA 4EG7A 5HZKA 2EAUA 3QXGA 4XOUA 2XKKA 2X9NA 1F2UB 3L0DA 3OE7A 1GU7A 1EVKA 2WINI 2FFRA 5C5IA 2IDJA 2Q6TA 2VJNA 4XQ0A 3SY8A 3JATB 4BE7B 1MZPA 3M4YA 2WEKA 3EXIB 1ZWKA 4L02A 3PYXA 4B6QA 4LDJA 4RD3A 3L0ZA 1X19A 2PH3A 1VL1A 1FXWA 2C59A 1KJ9A 2FOLA 3B38A 3PA8A 1V8BA 2B1IA 2CLMB 3K7EA 3OP4A 1L4HA 2IE8A 2ZLBA 5EIAA 2MCFA 3DYVA 1D4OA 3PHCA 1TK9A 3PX7A 2RGDA 4B76A 3TRJA 4H7FA 1MXFA 3I0MA 2WP8J 4GRAA 1JALA 3WDKA 5HP4A 4D44A 3GUUA 2WB4A 1G5IA 5K3FB 3UGTA 3AVQA 1N0WA 1QVAA 3MMZA 4NOJA 1B14A 3FCSB 4I1PA 4KAJA 3GFPA 4MQLA 3KT0A 2YVQA 1EUCA 2ZYGA 1ZP6A 4EA9A 2H92A 2YV3A 2Z4SA 4GPD1 1YFKA 3AFMA 2NUTA 1N5DA 4R1LA 1LH0A 1QHXA 1NPTO 1A72A 4K05A 4X94A 1MDFA 1X1RA 3ZWQA 5C81A 3G9ZA 1QG2A 4DM3A 2X3YA 1N9GA 4DWJA 1LVGA 2UUOA 2XNSA 3DEYX 3WC4A 4EA6A 4MWTA 5KWJA 1E1RD 2G9ZA 3VH3A 3ZK8A 4N7MA 4FIZA 3HTXA 1MQSA 1P4RA 3UKJA 1EGAA 4NXMB 3R76A 1NVFA 3DBVO 1KJIA 1QOZA 1YMVA 1Z7BA 4QYSA 3TE6A 3DL7A 2RK3A 3QVSA 1K8QA 2DLCX 1K4YA 4MYRA 1EAYA 2C84A 1QG4A 5IDYA 3ZQ4A 4XI9A 1P61B 3O75A 4P4NA 4JJIA 3JRNA 3KM0A 1CULC 1V7CA 4INPA 1XDSA 3IDFA 4DREA 1KXZA 5JFOA 1DUSA 3OT4A 1ZR2A 2GPNA 1SCQA 1D8AA 2OBMA 2QDXA 3KYJB 3MC1A 3JQRA 3MFYA 2C5SA 2E55A 4LC0A 2JLRA 4OD0A 4Y0AA 3VUEA 2H1SA 3V6MA 5FOTA 4EQ6A 3KJNA 4ZK6A 3H9GA 1DT5A 2WPDA 3HI4A 2XBLA 1ID8A 3AKYA 4AJJA 2B1QA 4Y30A 5KTPA 1NWCA 4MCAA 1ND6A 2FMIA 2JJ8A 4MPTA 3IQGX 4ZVUA 4MQEB 4AG6A 3IPCA 5B53A 5D85A 4DJAA 5FHRA 4YCSA 1M6EX 2FHPA 1XNHA 3NATA 4GW3A 2JIZA 1CNEA 4HV4A 1N2CB 3CVYA 4X97A 3LTNC 4OIMA 1XZIA 2QW8A 3O3MB 4JQZA 4BO4A 3NJ4A 1UZNA 1VZ3A 3N2IA 1YZGA 2ZJBA 1DLIA 1C1XB 1PFVA 2C94A 2W37A 2ZIEA 3ACBA 1MU0A 2WAAA 4LAFA 1W0KD 2VPPA 3ADKA 4MP3A 1M2NA 3K4HA 3TYXA 4D5EA 4RLQA 4KK3A 4M0KA 1J0XO 2Z1NA 3UAWA 2CLSA 1U0SY 1JDUA 1IY9A 3LPMA 4HH0A 1MP0A 4ER3A 5KO2A 2ZVDA 4FDTA 1QMPA 5J4VA 3FDFA 1ZRMA 3FHOA 3QU4A 5EMHA 4G5HA 1XQXA 4U3JB 1LK0A 3EXFB 5E7MA 2CB0A 2FWJA 2NACA 2PJDA 1LBIA 3LCMA 4B5LA 1KVRA 1PV1A 3NHZA 4AN4A 2QL9A 2QX8A 4AO8A 1S8OA 4DT1A 3I9KA 4FMDF 4ANFA 1R50A 3IRUA 2CDBA 3ONEA 4Z9AA 1VL2A 3TTTA 5JDIC 2QRUA 2Q5LA 1L5GB 5I7HA 5KCZA 1PWYE 2OUIA 1YB1A 2UZ1A 2VJAA 1O6GA 3A3OA 1LQ2A 3NHMA 2JZCA 1WL8A 3AY7A 4J8PA 2RIRA 4I1VA 5K0LA 3RQSA 1CLEA 1NQWA 3BZUA 4QLOA 5EZYA 4BJHB 5KHAA 3U1VA 2J7KA 3QBJA 4MVJA 4ZT4A 4EI9A 1WD5A 2ZSFA 3BXOA 1Y3FE 4R8KA 2HDOA 3I39X 3GI1A 2ERCA 4OB6A 4KXXA 4WV3A 5DGDA 1NJ5A 3HEAA 3JXEA 3G6WA 3LXUX 3OIDA 4LN1A 5CXQA 3RC9A 1PCXA 1LJ8A 1R6TA 3TIVA 1IONA 3EFEA 3MD0A 2JPDA 3MRVA 3P2YA 4QGAA 2AGVA 5GGXA 1J5EB 2GM4A 3NOXA 2NZWA 3MF4A 5DVZA 1EB9A 4NCAA 1TVCA 1G8KA 2Q46A 2Q3BA 2QZJA 1ADYA 3GA7A 5IC5A 4BKPA 4FC7A 1HR0B 4HTFA 3JCZA 2P9EA 5KSWB 2VJKA 1KDPA 1KF0A 2GKSA 4MQ4A 3VJKA 5CDHA 5L7TA 2EJVA 3O74A 2V0GA 4FFOA 2GPAA 2V1XA 4U9UA 3P4XA 1YKFA 3X1MA 1IN7A 1J1ZA 1V5FA 3P0FA 3PNKA 1JKJB 1T9BA 4ZT2A 3WVNA 4OVKA 3JARB 4ER6A 5F21A 3R3WA 4PR0A 1FRVA 3U3MA 2F55A 3B2NA 2P30A 3P32A 2OCXA 4FWBA 3T06B 3CRMA 2QL5A 3HB0A 4J75A 4R0NA 4OLAA 2BFEA 3ZLUA 3PR1A 1TK2A 4R69A 1G9SA 1J1IA 2WIFA 5A9SB 1G63A 1IQ0A 1QYDA 1LTKA 3C6QA 1C0PA 1F8YA 1MB4A 2D59A 5HDQA 3T7EA 3U3ZA 1G8GA 3C5VA 1P7WA 2OP1A 4D5GA 1X7WB 1X8XA 2MSNA 2XVXA 1DIGA 1H1LA 3R3XA 4QFCA 3B3AA 3KU4A 1KRXA 3CLUC 4EYQA 3LDGA 2PM8A 3WRVA 4B4WA 1LPPA 3G49A 1CWUA 2PSEA 3P9IA 1XGKA 1JMKC 3KYDA 3F1LA 3SZLA 3CRZA 2DXIA 3F74A 5ICEA 5AXAA 3MTGA 1W4ZA 3U4QB 4B3RB 1GNSA 1J9ZA 4D3XA 8ABPA 3L1HA 3R3HA 2RAFA 2Z3ZA 2F9LA 4XDHA 3DF9A 4CLOA 4K9MA 5HX7A 1IAQA 4II3A 3REQB 1H42A 3WI7A 2O5VA 4N8EA 3OICA 4PQYA 3MB8A 5CH8A 3CBQA 5DXAA 4Y1RB 1TO6A 5AVRA 4V1CA 1CVRA 3I09A 2I80A 4FMPA 4M46A 2D0IA 1KZ4A 2Y1DA 1GUFA 1K0FA 2AUNA 3I37X 4WZBA 1RE0A 4CL8A 1OH7A 4Q3CA 3MA0A 1SBNE 3I2IA 2BN4A 4P9NA 1I5EA 1B42A 2A9KA 2CLLB 4TLDA 5DO9A 4F2PA 4EZEA 4HHEA 5K8UA 1NRXA 4HATA 2QROA 2YMPA 4PHFA 1Q20A 4B31A 4UTNA 4IHJB 4XJXA 2ZIAA 2ILVA 2C2BA 3U09A 4Q4AB 3M3HA 5KC9A 4M9ZA 3E0XA 2XB8A 1OVMA 3OZWA 3PCTA 4LYDA 3ZIDA 2F43A 2Q4RA 3NWBA 1HLGA 2IW3A 4JP5A 1GCUA 4ZDWA 3FN4A 1SA0A 1OTXA 3TF5A 3EUFA 5IZCC 4CIWA 2CMFA 3R7NA 4EW1A 2WRZA 4V0MA 1T25A 1M72A 1IEWA 2R8PA 1BXZA 2VXBA 5KTNA 4HAXA 5A9RA 3G8BA 2HEIA 3U80A 3ZHRA 3DDHA 3CH5A 1QLJA 2XA9A 1ZCFA 1WOYA 4K9KA 5DIZA 1ES9A 5KNBD 1NAHA 5F9HA 4FI3F 2HU5A 2W6QA 1C1YA 4IO1A 4TWJA 1PAUA 3STVA 4ER5A 1I9GA 5E6UA 4HDAA 1W36B 4F5WA 3SJBA 1ZCAA 3K35A 4CMCA 4DRXA 5ICFA 4PPNA 3LFUA 3E9NA 4DYHA 3CH6A 4QPDA 4LGCA 4ZKEA 1Y9EA 1YF3A 1Y5LA 1J9GA 5LWQA 1WB6A 2WWWA 4PR3A 4DB2A 1FSZA 1KVQA 2E4XA 1N77A 3HC7A 3R9WA 5A0VA 3VHLB 2QZPA 4QATA 2IS1A 3KD2A 4GEGA 1XFAA 4YO8A 4ZGBA 2B4TO 3VHXA 2XZPA 3PUXA 3VO1A 4CEIB 3FBGA 2UVDA 3QEJA 5AOBA 4F91B 4QIHA 1PFQA 5BV8A 1JMYA 4HPXB 3BMCA 3KJHA 3PUVA 3Q11A 4XVRA 3JWPA 1G5RA 2EW2A 3IP5A 4YRIA 1P33A 3WL8A 2R8EA 1I7SB 2OYCA 4QARA 4KR3A 3BMOB 3VYTB 3PPVA 4U7FA 1E3EA 1CNFA 1PDVA 2JAXA 2Y1CA 2FXVA 3R6GA 3LX5A 1P0PA 3P9RA 2I6SA 1C30B 3PE4A 4ZVKA 4RCYA 4BV3A 3IQHX 4LBWA 1ZA1A 2C88A 1V71A 3F6YA 3JZIA 3HU3A 4TM7A 2Q5HA 4ZAGA 5K4HA 3R20A 1SWVA 1GPBA 3DB1A 3RK0A 1RNLA 1XZBA 1AQ6A 2VS1A 3GOHA 4BKRA 2IVFA 3KHUA 4JENA 5DLYA 3T52A 4UQLA 4GKAA 4OK6A 4BMOB 2G25A 1RYNA 1L7AA 5JU6A 2FUCA 3OPYB 1GSAA 3W6NA 2NVWA 1ADFA 4RQBA 2WKSA 3QVTA 5C32A 4CDRA 1GL6A 5M5BA 4TUYF 2DCMA 1UL1X 1BW9B 3OPYI 4CZ2A 1YZTA 1N0IA 4IRMA 1J0BA 4MW9A 2WTXA 2XUQA 5JRZA 3T5CA 1Y9ZA 4JROA 1BE0A 4YAEA 3HN7A 1N5IA 1JHQA 3VSEA 4JKIA 1LPNA 2WSSA 2PWZA 3JQ9A 4LXQA 3AWIA 3CEJA 2ZUDA 4J9VA 4LXIA 5FI0B 1X1DA 5JXGA 4MYCA 1TI7A 1ZESA 4LNUA 4TXHA 5ALLA 2IFTA 2XLCA 2HAEA 3GHYA 1W5FA 3CWZA 3BB3A 3HB7A 4KQEA 1F2UA 4NL4H 1E4VA 1GFZA 4NPAA 1UT8A 4G4SO 4F46A 4GP6A 4XX0B 2IQIA 3Q8XB 2J4DA 3D64A 4QULA 4V0ME 5T4EA 4B43A 1KP9A 4Y7DA 1EP1B 1H1DA 1W6RA 3AIMA 4FHCA 4RK4A 3W1VA 1ESNA 3IMFA 3B9PA 4IDDA 4EB6B 5LQUA 1JU9A 1JYSA 1LTHR 2I99A 4E6EA 3DMGA 5DH9A 1ZAKA 6ABPA 2D1YA 4P5EA 4XPZA 3WLRA 2R66A 1ESDA 5AMXA 1SUCA 1UZLA 2QK4A 1YB5A 5HEKA 5HJ2A 4HOYA 5LUAA 1NW7A 2H2IA 2ZETA 5K3EA 5LNK1 1PR4A 1IWBB 3MPOA 1QPZA 4EAQA 1VJRA 1EFKA 2PQMA 1SQFA 4Y1FA 3ZHVA 1WBBA 3G0OA 1DHTA 1TD1A 1HDOA 3MBOA 5IBRA 1VRWA 3BKWA 3VU3A 4CI0B 1I0LA 2IOYA 3AONB 5AW0A 2GXUA 4HBZA 1UBTS 4MP6A 3VTAA 3U7HB 3ZXXA 1NQ5A 1SVOA 2XQIA 2ZXEA 4YXWD 3W3ZB 1A9XA 1FZQA 3HV2A 1L5SA 1H6CA 4FQ7A 1QGOA 2BM1A 1FYDA 2ZT8A 1H6AA 3IKTA 1XZFA 3M2TA 5DTQA 3GQBB 3DE1X 1FNSA 2B4QA 5KS2A 5BW5A 1IUPA 1EVYA 1K86A 1M2VA 9LDBA 2A30A 2J9ZB 3JQCA 4TUYA 2XX3A 1EUZA 3S2IA 4ZO9A 3NHWA 5CX1A 4NFSA 4IPTA 3PNPA 4GGOA 4QXQA 5MDHA 2HW8A 3N8DA 2HIGA 1RABA 2FA9A 1T6YA 3BA1A 2RGNA 2A35A 3KKQA 721PA 4X65B 1I3OA 1TT5B 1VZ2A 1KMCA 3B1JA 4TN1A 4V3CA 5F52A 1FRFS 2EG5A 1HTWA 3HO6A 2Q8PA 3RTCA 4I46A 4LCBA 2F4VB 3RK1A 2I8LA 2GZ2A 4PG5A 4XWGA 3S2YA 2DBYA 4JXJA 2V6MA 3DT8A 2P6NA 1O95C 5KQMA 3AP3A 4F12A 5KTRA 1X7YA 3K4PA 3N8KA 3SM3A 1G2PA 3E22B 2HOQA 3LQ4A 4Q1DA 1T2FA 3BSSA 1AQYA 2PR2A 2QE7D 4Q9HA 4UFPA 2C9MA 2UVQA 2Q8QA 4V0RA 1E3QA 1GPAA 2VWPA 3ONVA 3UPDA 4JJGA 4AJHA 5LQAA 1RPJA 3Q5DA 3LP6A 2ODAA 1MNAA 4M0LA 2WOOA 2Z95A 4D9BA 3R5XA 3WK9A 4OGGA 4MO9A 4OU5A 3VTFA 8AT1A 5AM5A 1M6YA 3KNZA 1UC9A 3AY6A 2XNDA 4L72A 4KBYA 2IKQA 3E3NA 3ZE6A 1EHIA 4GAEA 5CX1B 1G8PA 1KR2A 3H9QA 2QTAA 2NUTB 3Q2IA 4HYTA 3TR6A 1SU6A 1OX6A 1XX6A 4M8NE 1O95A 5T3YA 3WWOA 5A04A 4ZOEA 3W5SA 1P62B 1V41E 1Q92A 4QTYA 3H2IA 1GZ6A 2VLIA 1FNMA 3DNMA 4BO8A 3CCBA 1VPWA 1JR2A 3VR5A 2QPOA 1ZLXA 1LI7A 2Y99A 3CRNA 2VFAA 3Q2OA 3AJ9A 5EFOA 4EG5A 4TMZA 3THSA 3F4BA 5I7RA 5ALKA 1RWKA 1CNMA 2IY7A 5EIFA 1M6NA 3D6AA 4EQ6B 1O6CA 1EM8A 2IUEA 3C98A 1U2EA 4XWTA 3S8MA 5BWMA 1E2UA 1TLFA 1IPFA 3E9EA 3I52A 1TD9A 2PMCA 4WGGA 5B2ZA 1RZ3A 4DCOA 3UA3A 2CV1A 1WW8A 4JH0A 3JWEA 1IIRA 1NX6A 1P91A 2EP5A 3BGVA 1JAXA 2ZB2A 3DC2A 3E05A 3WKCA 5AD1A 3OE7D 3UAVA 2JA1A 1R5BA 4GT1A 1R16A 4YLYA 5FPHA 5EZYB 1E62A 2NUAB 3OX3A 3K6JA 3U0VA 1AA6A 4L4XA 1YD7A 3BBPA 5KWVA 4IQFA 1JI3A 2GBLC 8MHTA 3COYA 1NOKA 2HMVA 3E7PA 1BE8A 4O08A 4WDRA 4DXAA 5BVHB 4LDPA 1CT9A 1EQ2A 1PL0A 1SC4A 2OQRA 3DHYA 4HXYA 4IJWA 1NHGA 5G1PA 4O25A 5DW3A 5IXJA 3F6CA 5FO0A 2NO9A 4OQEA 1CY2A 3DYBA 1YRWA 2PZBA 3EOAI 4QRHA 2O3SA 2QRZA 3GAZA 1AGPA 5LNK6 2Q62A 3KRTA 3LP5A 3C85A 4JUDX 2ZPTX 1ZK3A 1EKXA 3DPUA 2LIPA 2XEXA 3AEKB 2CLKB 1G8YA 2YJ5A 3LUAA 1JFVA 3N1UA 3OKPA 3V8NA 4CBVA 1H8ED 1Q1EA 4X1KB 3ELUA 3HJFA 1Y81A 1G1MA 4MPRA 2FPGA 2QV7A 2FV8A 3HABA 4GKBA 4YCJA 4AKSA 4O2RA 2YWCA 4DV5B 2NZYA 3THXB 1G64A 1ACJA 3P0RA 4TM8A 3KSUA 4HWGA 4X60A 1KI4A 1MJHA 3FW1A 3EFHA 3OECA 4J2HA 4MWBA 1E6WA 2WAYA 2ZG6A 1DGQA 4MEBA 2ZAGA 1L9KA 3GJXC 4GICA 3COWA 2Z56A 1A9PA 2COKA 2V4UA 1DEKA 3DOJA 1DEOA 3GVHA 2PGNA 3IAEA 3QP9A 4G01B 2G6BA 2OQVA 3WNVA 4F96A 5FRDA 1SHKA 4FGJA 1BWQA 1H2ZA 4UJ3A 5EMJA 3ETEA 1GQ2A 5JANA 3VPDA 3HO8A 1Q3KA 5KHOC 4BGUA 1ND5A 4WX2B 3SKXA 3BIXA 1CETA 4FW8A 4N0DA 2WFMA 4JASB 4AY4A 2G76A 1WXDA 3TFWA 3N2ZB 3T15A 4BNYA 4ZMBA 1KEWA 1NATA 1S1MA 4IV0A 1VPDA 4ASUA 1NR1A 7REQB 3N0VA 3WLKX 1VYHA 1JJFA 3VR1A 3AEKA 2AXEA 1K66A 4I6JA 2FW0A 2ZIWB 4R9UC 5HPYB 5JS7A 3O8QB 5EHXA 1AA9A 1ZD8A 5DTIA 1WAMA 3OCCA 5JZSA 2HTFA 2PA0A 5LR6A 2CXOA 5EWMB 4AUKA 4LXYA 2XVMA 5J63A 2ATXA 3REQA 1MLDA 2H8KA 2WJ3A 4TT8A 2A7QA 2JAWA 2VP5A 3K9LA 1V45E 1P72A 4A9AA 3AEQA 1TJPB 1WHTA 2UYGA 3P9CA 5LZ8A 4B2PA 4WRRA 2CDNA 2VEOA 3UA4A 2L0XA 2NSLA 3DZCA 1BYUA 1S2LA 4Q47A 3LG2A 1K7SN 3D8RA 3M1LA 5A9SA 1EAMA 4A0GA 3D0KA 5A6SA 4F6RB 4WHMA 3GN1A 2I4IA 1ZIYA 4H4CA 1UQRA 3VNRA 4RDHA 3IP1A 4GPTA 4GX2A 2R8RA 4YJFB 2A5LA 2JKYA 1E0JA 3B1YA 1P4JA 4FYKA 4NCKA 3TM5A 3PUHA 2NU9A 3OURA 2WHXA 1IBLB 2BTOA 4G2NA 3Q98A 5JNLA 2VYCA 3SQLA 621PA 4ON9A 5LMNB 5I4IA 2A0YA 5ALIA 3CMMA 1NQOA 2D7CA 3PYMA 2REBA 1SB8A 2GPWA 4KSYA 5I7WA 3DDUA 2MINA 3LY8A 1RE1A 5L4SA 4TYYA 5IEJA 2IZ0A 1C14A 1CZHA 2NU6A 1N8SA 1E2FA 1DOAA 1F6BA 1Q1NA 4HLUC 4OQXA 4C6RA 4EB6A 1EVIA 4B8YA 1Z5OA 3RIXA 1VKRA 4QFMA 3RG2A 4ACBA 4MDEA 2ID8A 1FUKA 3VKHA 3ZS9A 2QVGA 1SC1A 5B7GA 4BP8A 4JXZA 4XX1A 2CWDA 1W25A 4CYMA 4DJJA 2C2WA 4PZYA 5CHEA 1HGXA 2JI7A 3DEZA 3KPUA 4MK4A 1ZNZA 4MWDA 2F8SA 2PNFA 6Q21A 2C3PA 1FP4A 1C7IA 3MJFA 4LE2A 5T4HA 1YJAA 2H1IA 4MUEA 3M4JA 5K09A 3IEXA 1W581 2I1QA 2BM8A 4M86A 2PRKA 1WCXA 3CHYA 4NCJA 4QUIA 5THQA 1GYQA 2PD4A 4HUTA 4YR7A 2C7PA 3A2NA 4A16A 3EQ9A 3R6LA 4UMDA 4AZTA 4HZIA 2EBFX 3MJVA 1JRLA 1V37A 3MERA 1YXMA 2WYOA 1CDOA 3RC8A 1M5UA 5C18A 2UZ1B 4JL5A 5F1OA 4Y2UA 1CS4C 2VHQA 4IDGA 4MVJD 2O0HA 4XQEA 3JZMA 1CUGA 4B45A 1E9EA 4DIKA 4URWR 3DVAB 4IX1A 2PLNA 1BVYF 1MB2A 3EJ6A 2PPVA 4G4GA 1AMUA 4YBZA 4E22A 3P2MA 4K28A 5ALRA 1T8WA 2HPVA 2IUTA 4UMFA 3CUVA 1T36B 3DO6A 4QKQA 1U7HA 1GVHA 1QF9A 2GPTA 1B2LA 2WWIA 4MQFA 1VHDA 4KC0A 4NJMA 4IFEA 1PW5A 4MPDA 3LO5A 4KXLA 3BE6A 2CL0X 5JSZA 4LZOA 4Q66C 5A7GA 2P0AA 1E2IA 1TMYA 2HF7A 5C8DA 1CY7A 4FGUA 2HUPA 1FFXB 1Y4AE 2QP9X 1Y6FA 2NTYC 3ETLA 2JFOA 3PDIB 3HK2A 4YJ3A 2R8OA 4BWYA 5K0BA 4R2WA 1LBHA 3N7AA 3QX7A 4UW9A 3QLUA 4D46A 1FNBA 1DNPA 2V8OA 4D3SA 4EY8A 4D41A 1FNNA 3UK2A 3PJRA 2WJVA 1GPYA 2PCJA 3A4VA 1TNDA 4XE5A 3AVXA 3IT2A 1XTIA 2QHXA 2YS6A 3CRRA 4XLZA 1IK4A 3AEZA 2Q4EA 2F1RA 3I8XA 3BQNB 3ESAA 1N5OX 2CE2X 2IEAA 4L5BA 5FTWA 2HA6A 4MW7A 5FADA 1B16A 3LL7A 4YY3B 1GSOA 4RIHA 3LIPA 1OV6A 3JASA 3QKRB 4ZJUA 3ZXSA 3KEMA 4OLBA 1MH1A 4ILKA 4PSAA 2IHJA 4D43A 3FSEA 4IJ5A 2QQ5A 3D81A 3ET5A 1DAKA 1KXJA 4G63A 3BJEA 3ZGXA 3RYHB 2M1ZA 2H4JA 3RJTA 3T9CA 3E1GA 1KIFA 1N6NA 5DYWA 3MRSA 5DNYB 4ECEA 4RIGA 4ZCLA 3TPZA 4IQGA 1BRTA 2X8JB 3FDZB 2NTVA 1TA9A 1K6IA 3CVXA 2KWIA 2GK7A 3DDSA 4ZCQA 3OD1A 1QNLA 2QMYA 4CDNA 2ZYHA 1RFGE 4XCQA 1S8AA 5A4IS 3SKYA 3QXHA 3EDQA 2VDMB 2OWEA 4ISBA 3WMWA 1RZRA 4R83A 1NW6A 1U1IA 5B1DA 2VDLB 3C1AA 4ZP1A 5DHTA 5IAOA 3GFSA 2AVNA 2G0AA 2GEUA 4CTNA 4DMUB 1W36D 5CAEB 121PA 4MQUA 4ND4A 1CEYA 1A9OA 5DGIA 3CV3A 2VJMA 5KOJB 3FMOB 1BCRA 1X9IA 4DLNA 1W88B 5T8KC 3C7AA 1YA6A 1GPNA 2BHNA 2YYSA 2VDOB 4IF4A 3EGCA 3OLCX 4TKUA 3EXFA 1NBME 4B2LA 5HRAA 2DMRA 2O23A 1KWKA 2AOTA 1JEYA 2JIBA 4NE9A 5K8IA 2PUWA 5A5GA 3KSZO 3QKSA 4I4LA 4ZYTA 7AT1A 5FL7D 2I22A 4HEA1 5ALGA 3JQ7A 3E5RA 1ISMA 2OSBA 1DC7A 4FHDA 3OM9A 5KTKA 3ZV6A 5TMEA 5CA1A 3E7FA 1ZMOA 3QPAA 1S3SA 3GLIA 4KMRA 2QL6A 3I72A 3V3TA 5IWCA 1Y1LA 3J80A 2C7RA 2PGLA 5E1DA 4F85A 2NTNA 1DO2A 3D8HA 1FNDA 3GCXA 1KI9A 3JX9A 2G5CA 3SLKA 1EFPA 1IM2A 4GKJB 2P9CA 1FIUA 4LKRA 4HEA6 3CEAA 3QOXA 2GWRA 3NORA 3A32A 2GEBA 3WIDA 2QAJA 4E5NA 1I80A 1OWNA 1FNCA 1Z16A 3NHKA 2BMWA 3ORHA 1NBMD 3UH0A 3QBTA 1WV0A 2Z3VA 4PIMA 1IPEA 1T10A 1JB9A 2QIOA 2VHTA 3EUWA 3DMDA 1QYCA 3B78A 1N3IA 4PHHA 3S2GA 1OU0A 1Y9AA 4ZQEA 4F6CA 4IGIA 3SBXA 4E14A 1WF6A 5HM8A 3ANYB 2VP2A 4P53A 2P2DA 4DC9A 1C3OB 1GRQA 4CQMA 4GLLA 4P35A 3QU2A 4M1SA 4MGEA 1EFAA 3O2SB 1J33A 2HLPA 3KQHA 3IXMA 4KWTA 1D6MA 1PWEA 1K3FA 4LWZA 3MG9A 3NPMA 2VBFA 1IVNA 3D5EA 3CLHA 3DEFA 5SYMA 4AD8A 4D99A 1HLFA 4MW6A 2HJ9A 3A58B 3CB4A 5CT4A 4D9JA 3WISA 4MINA 4PEVA 4LYAA 2CHVA 3AJDA 3UAXA 3JVUA 4UREA 3H2HA 5EJFA 4WD3A 1EPUA 3D43A 3JAWA 2GF0A 3O8LA 3RSZA 2Q5FA 3ZWAA 1AHPA 1U3TA 5REQA 3GNSA 4IHKA 4GI3A 4XH9B 4FFBB 3KOOA 4PVDA 3B3QA 4PYIA 1CVIA 1BJKA 4KRFA 2IUUA 4E4RA 3E9QA 4NU8X 1X8LA 3ZYZA 2IEIA 5FXMA 4BDTA 3OQPA 1E9AA 4HNHA 1L1FA 5BY2A 5AVSA 2IOFK 3F3SA 4Y2GA 1XQVA 2HI0A 4J0KA 2ZI5A 1G9TA 2YFYA 4P08A 2R97A 4G25A 1X14A 4NBTA 3AEUB 1OWPA 1PEYA 3ASZA 1U3UA 4HDKA 4YEDA 5BQFA 4TWZA 5JROA 4X66B 4TROA 4D1YA 1XJCA 4JEIA 3OSUA 4C05A 1ICEA 1EXMA 3K73O 2X0KA 3TIGA 1T24A 1GITA 3OPVA 2UZAA 4B8ZA 1BYIA 2ADOA 2XSZD 2G40A 2WWFA 2AR0A 1NYRA 3U7JA 3WJAA 3VQTA 5AJWA 1HDRA 2FX5A 2NZVG 5L4LA 3M81A 3ROXA 1RIIA 2H3HA 1QS0A 3GNTA 3N5KA 1XEAA 4EGJA 3WBBA 1NJ6A 1UJNA 3A9WA 3CS3A 3DMFA 4EENA 4EYSA 1E1QA 1IB0A 3WFZA 3VBEA 1DBWA 2P11A 5EJ9A 4LV8B 4NCIA 3P5SA 5A3QA 4I66A 1N6KA 1Z6YA 3D6FA 4N3NA 3Q4GA 3L0CA 4PXAA 1RHMA 3A4LA 3I23A 1IJKA 5C1PA 4LWQA 3L06A 2W83A 3V4VB 2CD7A 5IABA 2D62A 2J07A 2J5XA 4JY7A 3LOPA 3WGVA 1B00A 3ZBUA 3MWDB 3QIVA 4II7A 4BLSA 3V3KA 3HADA 3W2IA 1SELA 1GTRA 2VSOA 4KQHA 4PX3A 3A2KA 5IMBA 3VPSA 4JMLA 4ZYYA 3SHWA 3T4EA 1AB6A 1H9BA 1JQBA 2BSQA 4Y1GA 1WP9A 3H8JA 4R1MA 3KAKA 3GLQA 4K86A 4LJKA 4V0LA 5G0SA 5HFAA 4CGZA 1RWPA 4FWIB 2XYHA 1GTJ1 4CTKA 1YTLA 5JUWA 1XYYA 3I28A 5IARA 4DGQA 4HDSB 2ALJA 4F1WA 3ANTA 1C8KA 2JL1A 3G2OA 2QLMA 5J40A 3UJBA 5G1OA 5C1DA 3HYRA 5FIUA 2BTQB 4TRMA 4ZEXA 2E7ZA 3OVMA 5BR4A 2O7SA 1Y8ZA 5JS2A 1MJGM 3OU2A 4LYEA 1L8OA 2CXSA 3FSGA 4YAOA 4BECA 1PT5A 3M4NA 1NUTA 3G9XA 1U7WA 5JS6A 3ICWA 3ER8A 2PBZA 2IBTA 3D4IA 3AY3A 3LRXA 1FQJA 5JD5A 4KRGA 1E7RA 2H0RA 4OQ4A 3WSTA 3ACCA 1WTAA 2UVPA 1UZMA 3HVIA 4HNAA 5BRNA 3UV7A 1CJUC 2N9UA 3AVPA 1PKEA 1ONSA 1XDZA 2MSKA 3IEPA 1DINA 1EJ6A 1FMCA 2ZXFA 4HDNA 2FZGA 3H5OA 2DF8A 3SJCA 1QQAA 1MBZA 4H4EA 1UIMA 5DCWA 5JR3A 3MBIA 1QOPB 1JIQA 4QBTA 3UBTA 2VWGA 2Z9DA 2ZUEA 1YZ3A 3D3WB 3SE0A 4DRZA 1X77A 5A7HA 1GTSA 1E4EA 1G6HA 3AUSA 1DIBA 3GG2A 2ERYA 1YDMA 4Y9TA 3B8EA 1SXJD 1ZICA 2XNJA 4LE0A 3VZSA 1R4NB 3UJHA 4CKZA 3CZCA 4W5WA 2BRUC 1E8NA 3LE8A 3ZNQA 3BTVA 2VSXA 4FFBA 1G0OA 4LJ7A 4KJXA 3KALA 1NR7A 4BEBA 2MSWA 5CB6A 3TJZA 4LFAB 2NT4A 2W4IA 1LF0A 2EFCB 1Y3BE 3SHQA 3DFFA 3UMJA 4J91A 5HOQA 4GH5A 4CRWB 1C4XA 1DC6A 4NJEB 2YIMA 1N1GA 2V59A 3MGCA 4BMXA 5M7EA 3ZTWA 3OFJA 3RG8A 1KYVA 1MB9A 2KHZA 1GA6A 1VCHA 2OHFA 1S8NA 2NPIA 3NHYA 4HDQB 4UDNA 5AUNB 2HHHB 4DPMA 1R12A 3PGJA 3ROMA 3O21A 3GLGE 4M7PA 3J81A 4XDGA 1OB2A 4FQ5A 3PWSA 1KY5A 2HJWA 2ZANA 5FWAA 4BU0A 1PZHA 3Q9NA 3EEIA 5AKLA 2F7SA 3ZCXA 1KSFX 3TTWA 3FVRA 5DEIA 3UXMA 4YMGA 4UEQA 3SS9X 2ZSHA 4ZKDA 2AHOA 4J76A 4AF7A 4B87A 1NU6A 2Q3EA 2IXTA 2VF4X 3F9RA 3INNA 3TZBA 4CN9A 5LVAA 4W5RA 4JYPA 4WEQA 5AM3A 4YREA 2ODBA 2GERA 1G6OA 1GCGA 2QE7A 2AJLI 1FXSA 3B6EA 4U6SA 4X24A 4WL0A 5ANRB 4E09A 1UBRS 4C4RA 3DE6X 3VVLA 5LQCA 4LF4B 3LPAA 1HBJA 4ZVVA 4H17A 3AIIA 4I2VA 4CODB 1OFUA 1PJZA 4HJRA 5TARA 1CR2A 3ZUPA 1YZHA 3UF0A 4A8HA 1TYEB 2PUJA 4H0CA 3VMMA 1HMYA 1F0PA 4KVGA 3G23A 5GONB 3SCZA 2HHAA 3L9XA 5FPPA 4J94A 2O7RA 1XZLA 3P2KA 2NO0A 3I2GA 3V6LA 2OD9A 3EMKA 1N2JA 3LSYA 2JK1A 2HA4A 3PT5A 4DHEA 1TJ4A 4RDXA 4DQKA 4I9GA 4E4YA 1W76A 3WGMA 2HBRA 3WOVA 4FLEA 3ZIAD 3KUKA 3QFCA 3V8MA 4AXXA 5ER6A 1DKOA 3THXA 3F7TA 5JQGA 4JI6B 2RH5A 3UJPA 2OYSA 4L2IB 1E79A 1P7YA 3PQFA 4YXWA 1LVHA 3TQHA 2WJPA 1OX5A 4ERNA 1VYTA 2ZUVA 4QHSA 5JASA 5KSYA 1K89A 2NUBA 4N3AA 3FLEA 4HDMB 1DRVA 3V48A 3ND8A 3V32A 4JR1A 1A9XB 2QKYA 3FIUA 5CDSA 1AVTA 1GHTA 1UP4A 3DS8A 4NF2A 3S27A 4JLUA 3NBKA 2UXBB 5K3AA 3UHJA 4GXTA 1W2HA 2DHRA 2K2QB 4I99A 2M6KA 3LHDA 1T2UA 5CP8A 2FSPA 1L7PA 1P4GA 4MGHA 5C0OE 1B73A 4XVUA 3SN6A 2DFTA 2R48A 3NONA 5D1HA 9LDTA 4G3XA 2MSEB 1G18A 1C4OA 1WXGA 2AKAB 3C3JA 4H6XA 1QFMA 3GZTB 4HS9A 3KVVA 1C7QA 4U1RA 2AFHE 5BR7A 2YX1A 3S70A 2FYTA 3C7TA 1V1MA 2OBYA 2QU8A 5JSUA 2HF9A 3PC8A 2CF6A 2X13A 2C1ZA 1VE5A 4RS3A 1PJRA 2HJSA 1L5OA 2Q4DA 3R9KA 2Z2JA 2E6UX 4URUR 2GLTA 2Z2XA 2C9DA 3HJHA 1W47A 3L7KA 1EWQA 2G07A 3FPLA 2W22A 2ZW9A 2V55B 2ZI4A 4HVAA 1L1EA 3C7CB 2CFRA 1LLDA 3A11A 2Y71A 4C0JA 2LDBA 1XLTC 1O8CA 1Q1ZA 5CT5A 3ZQKA 1DMRA 1VIAA 1HEUA 4FYHA 4J07A 1G4UR 4DLSA 5BWNA 1R0RE 5KBYA 1B26A 1PZMA 1RQGA 3JQEA 1JVNA 3BEOA 1YUMA 4LE1A 5KVAA 2G5PA 2Q5CA 3U3OA 3VR4A 1QGED 1KZ6A 5H16A 3WRXC 3U48A 3PFWO 3G79A 4UVHA 1JHZA 2NO4A 4W5QA 1IL0A 1B93A 3U7QA 1AHNA 1OFGA 5LMCA 2WZCA 3ANNA 4LIPD 1W30A 3TSCA 1B3RA 2AJ8A 1TVKB 2BFDA 2XGGA 3AV3A 4FXOA 1B2RA 1J07A 4X1YB 5BURA 4UTPA 4G41A 1QHFA 4EHHA 3OEYA 1Z12A 2C5FA 2WWYA 4O2BB 3WYAA 2Z6VA 4G1FA 4ARAA 1X38A 1IM5A 1K3TA 2Z5GA 1HZZC 2XE7A 3LX6A 1YCFA 3HZOA 1NNEA 3U16A 3MSXA 4FCTA 1HKUA 4U5XA 2Q1YA 3ZX4A 1TTQB 4FS8A 2W2XA 1MGPA 2WA1A 2J33A 4HRYA 4Z8XA 1ZSVA 5C52B 3IFSA 2IZ1A 5LBUA 4Q12A 5CAEA 1CUWA 4PFSA 3FNGA 2FDRA 3LUBA 4UTXA 5KWEA 4REMA 1QR2A 3JD1A 4JKOA 3QY0A 4YDSA 2ZUWA 4BX0A 2KE5A 3OEHD 2P27A 5EYPB 4TV9F 1XPJA 3MSCA 1CP2A 2GCPA 2QYTA 4FI3C 2O2IA 4RXUA 1VJTA 3MELA 5JTUA 4X41A 1WLYA 2IHUA 1EHCA