1Y1PA

X-ray structure of aldehyde reductase with nadph
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
pubmed doi rcsb
source organism Sporidiobolus salmonicolor
molecule tags Oxidoreductase
molecule keywords Aldehyde reductase II
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y1pA01
4K6FA 3FR8A 3EY4A 1VI2A 4N5LA 3QJ5A 4I5FA 5G4KA 4TQGA 2EJVA 3QVXA 5L4SA 1NXQA 4XYMA 4AJOA 2FPIA 3QRWA 4IZHA 3OF2A 1Q7GA 3B1KA 4LCEA 4Z6KA 3DO5A 2J3HA 2YQ4A 3DC2A 2X5OA 4PLWA 1EQ2A 1ZK4A 4FFRA 3N74A 1CQJA 2Z1NA 3ZW9A 3DHYA 2WDZA 4AJ2A 5DOVA 3VZPA 4F6LA 3MOIA 2EGHA 5JC8A 1RYDA 1XA0A 3TOZA 3BHIA 4PGFA 1E3WB 5GZ6A 1I2ZA 3G1TA 3WMWA 3QVWA 4R9RA 3SEFA 4IXWA 1VE9A 2B5VA 4Q3EA 1B2LA 5JPIA 4DQXA 4E6PA 2Q99A 2DKNA 2Z1MA 2G5CA 4R3WA 5JMPA 5L40A 4I9NA 2D3TA 3F4BA 3R0IA 4U8GA 3VC7A 2O7SA 3H9EO 4EYEA 4MO2A 2VUTA 1U4SA 1PL8A 3IJRA 3FR7A 1DRUA 4CMIA 1KVQA 3TFQA 2ET6A 5F5NA 3RUCA 2YZ7A 2IDZA 2WJPA 5EQFA 4D46A 5L53A 2Y1FA 1DXYA 2IYOA 3NT2A 3S2IA 5A3VA 3GRKA 2UV8A 3OETA 2EP7A 2IXAA 3AFNA 2EERA 2Y0CA 1D1TA 3K6JA 5AXAA 5ICSA 5HTOA 2HJSA 1YL7A 3ABIA 4WNCA 4J2HA 3U4DA 3JYQA 1H6AA 2V6BA 4GX2A 4J1QA 4JNKA 5KVSA 4B4UA 1DSSG 4GWKA 1I0ZA 3PWZA 1Z82A 1U3WA 2PD3A 2IRWA 4URFA 2FY8A 4RLSA 1HDYA 5A02A 4IMPA 4Q3DA 2VT3A 5DULA 1BSVA 3E6AA 1WW8A 2I67A 2Q4BA 1U2DA 3WGZA 3RC7A 2HU2A 4K6CA 3EDMA 1MXFA 3PDJA 2DQ4A 4R16A 1XQ6A 4GLLA 4DYDA 5IDWA 2ZJ0A 3WSWA 3GQVA 4FFNA 4YQYA 5T8KA 1ISGA 2IE0A 3F46A 1PX0A 3TDKA 3OM9A 4XIYA 2CUKA 4Z0HO 5T57A 1XWFA 1MLDA 4GX5A 4A7PA 2ZATA 3JYLA 2PD4A 1LRJA 2VUSA 1PL6A 4MVJF 1HL3A 1TI7A 2W2KA 2CF5A 4B3IA 3DONA 3GFBA 2OMEA 5TRTA 2EEZA 4FJ2A 5I8ZA 4IY1A 1O9BA 4I5GA 4IINA 4L4XA 2X23A 1JW9B 3LT4A 5GMOA 4L76A 3VVCA 1DO8A 1HKUA 1VLLA 1Y9EA 5H81A 4HUJA 1E7QA 5IZ4A 2PY6A 1ZEJA 1YWGO 1ISFA 3HNPA 2B5WA 3PHIA 1T2EA 4KWIA 5KJEA 3VDQA 5A06A 1V3UA 3DOJA 3WG9A 4AFNA 2X7HA 1MP0A 4M89A 2P5YA 3D64A 4CM6A 3UF0A 2Q49A 4WASA 4CM8A 1HDZA 1HDCA 1LX6A 3INGA 3IS3A 4P8RA 3BYZA 3GY0A 4FGSA 3C1TA 4J90A 4XYBA 2VTEA 1WMAA 4RPGA 2GLXA 4RVSA 3SX2A 4KTTE 3V1YA 4EUFA 1MG5A 2VZ8A 3JQFC 2NTVA 3ZWBA 4I5EA 2VRCD 1EQUA 3FTNA 1DFGA 2AHRA 3ZI0A 1RWBA 4WE3A 1SC6A 3C85A 4FC7A 4WLVA 3D7LA 3LT0A 1QR6A 2PGDA 4F46A 5ADHA 4BV9A 1GZ4A 4E13A 3H9UA 4A0SA 4NU5A 4JJIA 1U4OA 2DBQA 2J6IA 1PGPA 1YS4A 3LYLA 4RPKA 1GUZA 4HWKA 3Q9UA 2NU9A 3KM0A 3HSKA 3ZU2A 2NVBA 1U3UA 5EERA 2P91A 2VHVA 2AW5A 5ILGA 3S8MA 3ZWOA 2Y93A 1PS0A 4AJEA 1MG0A 1KOLA 1O95A 2OHXA 3AM4A 4FR5A 4WJZA 3DOOA 1N9GB 3M2TA 4HX5A 5LDHA 4DBZA 4R1SA 4HFRA 4UEKA 1ZMTA 2XF8A 3RQSA 1TLTA 5G4LA 4J0FA 3DBHA 5GY7A 3JD0A 5EESA 4DBVO 2PNFA 2Y0EA 1LNQA 3INTA 2F1KA 4MP6A 5JO9A 1YQDA 5FI3A 1X14A 4ITUA 2JAPA 3OECA 3PIIA 4DYVA 2YFHA 2B69A 3PLNA 3K30A 1GUFA 4YJFB 3RSHA 4WUVA 1W73A 1R37A 1I3LA 1ULSA 4WECA 3W4KA 2R00A 4E5NA 3WTCA 4E33A 2IZZA 1YE3A 5KNLA 2PZMA 1DJNA 3PYXA 5JAZA 1ZIDA 3ZHYA 1H2BA 4ZN6A 3U5TA 2XXJA 3OEYA 1F17A 4XB2A 1FXSA 4RPJA 4R51A 1YJ8A 4JJGA 2VRBA 1N1EA 5K6AC 3N58A 1QYWA 2UVDA 3ZNNA 1YBMA 3RAJA 5HWSA 1GD1O 1E92A 1E6WA 1LSUA 1LTHR 1JLLA 1P74A 3PJFA 3ZHZA 2FHSA 1LDNA 3PQDA 2R00C 4IXTA 4L73A 4LGVA 4F3YA 2DFVA 3ZCXA 4R5HA 3JQ9A 4CODB 3WQSB 5G0SA 4TROA 4IJVA 4GLOA 2GERA 3QLJA 4GX0A 4WCFB 1N7GA 4IBOA 2AE2A 4OO3A 1R15A 1E7MA 5DBFA 3DXFA 4FFOA 4PLZA 4BGIA 3H9QA 3V5NA 5KVQA 3RASA 5B37A 3SBOA 4IS3A 4PG8A 3MTJA 4DMMA 4PVDA 2YHIB 3GAZA 1ZEMA 3MJEA 1A27A 3MJCA 1QG6A 4QECA 3RC9A 1HDXA 1VC2A 4A2CA 2NU6A 2QYTA 2E82A 2YV1A 3LF1A 4M86A 4MVJM 4AJ4A 5IXSA 3ZDFA 2VTDA 3I9NA 2CVQA 4PRLA 8ADHA 2JD2A 2HK9A 3L0DA 1CIVA 5IF3A 3QWAA 3RUAA 4RDHA 4ZQFA 4YA6A 4II3A 3S2EA 4BO3A 2FN7A 1K6IA 5HRUA 5L95A 3CTMA 1C1XA 1QV6A 2VNAA 3I83A 3QWFA 4IQ0A 3I9JA 4IZIA 1E3EA 1SNYA 3UGKA 2HAEA 2J5QA 4RO0A 1ZK3A 5BR7A 3I1JA 1DRWA 3GNSA 3H9JA 1FF9A 3ROMA 3DMTC 4J1TA 3VH1A 1SPXA 3D4OA 2HK8A 4BNNA 4D45A 1DHRA 3AOGA 3DHEA 3ITKA 5G0TA 3U49A 3E03A 1GDHA 1E5LA 1BXGB 1B3RA 2RBEA 1SEPA 2AQIA 4ONEA 4CM4B 5TF4A 2X0IA 3QE3A 2V6GA 2Q2VA 5L7YA 5ITWA 4CM7A 4EDFA 3O8QB 3IAHA 5TJHA 3AI3A 1H94A 2I9PA 4TVOA 2G82A 4CLHA 2YUTA 2ZYDA 4AICA 3F1KA 3NJ4A 2VWQA 1S6YA 1LQTA 2NLOA 3JD1A 2OBYA 5TJ9A 1GADO 1GQ2A 4CV1A 4B7CA 3IMFA 5DOZA 4RLHA 3E18A 2EJWA 3GA0A 1ENOA 4NBRA 1GEGA 1ZBQA 2JJYA 3HN7A 1DIBA 2PGJA 3AUTA 2Y05A 3GHHA 4KQXA 1V0JA 1IZ9A 5JC1A 5FI5A 1TVEA 1ZJZA 3VVBA 1K6XA 2O3QA 4JX8A 5BT9A 4CQLA 4WLUA 4CMHA 1R0SA 2JCXA 1KS9A 3RFVA 1KVTA 4GI2A 2Y1DA 3DBHB 4TRJA 5IZCC 4CMEC 1J49A 3JQBC 4YEDA 3TZQA 5L51A 5C7LO 1EBUA 5BNIA 4RF5A 1PS8A 4IQ8A 3PYMA 2B4RO 2DAPA 1T25A 2PV7A 5I9NA 4Q39A 1MUUA 3SLGA 1PJLA 1YRLA 1T2DA 5A9TA 4L0QA 4ALJA 5KKCA 2DU8A 1R4MA 3ZWPA 3I4CA 2WYVA 3M2PA 3RD5A 3RUDA 4KOAA 5HA5A 4DIFA 1ISMA 4YB8A 4RL6A 1I33A 1SB9A 3L4BC 2NVUB 3WSVA 4IGFA 4D44A 3PPIA 1F14A 3QWHA 3BTOA 3LU1A 2BFPA 3JQ7B 3SC6A 3OJFA 3Q2KA 4RVDA 5JSFA 4EI2A 5KOIA 4BHTA 3GC6A 5TT1A 1R0KA 4PG6A 2V65A 3ADOA 3EC7A 1TT5B 1YB4A 1DPGA 4ZA2A 4CUJA 4YQZA 4PG4A 2FZEA 3WWYA 1DOHA 2AG5A 3JQAD 2GUGA 4I1IA 1GZ3A 1K6JA 3DZHA 2OGUA 2O3TA 1N8KA 3TL2A 4PLGA 3ZV3A 3DAFA 1OAAA 4RQTA 4RZHA 1Q7CA 5MDHA 3ZNQA 3EK2A 3NYWA 4B4OA 3H2ZA 2PK3A 3BMNA 2YFQA 4U6QA 4CJXA 2P2SA 2EXXA 2NU8A 2FR0A 1U5AA 3HE3A 3OP4A 2DUWA 2OO5A 3TL3A 4AJIA 1H6BA 2QZ9A 2ZTUA 2EP5A 5DCUA 3GF4A 3PWKA 1TXGA 3F1LA 4N5NA 1R66A 3CZRA 4BKQA 4R4JA 3E9NA 3ETGA 4B4WA 2Q1UA 3F6YA 4J1SA 2BI7A 2P9GA 1HZJA 1P77A 4YRAA 2R6JA 3MCVA 3TJRA 4YJGB 1VJTA 1PJ2A 1HE3A 2VNSA 1O0SA 1A72A 1CWUA 5CDTA 2V6FA 3AK4A 1ISJA 4HFJA 1QYVA 1N2SA 2VRCA 4KTVE 4KUEA 3PJGA 2NQ8A 2AEMA 1NASA 3WGYA 3L6EA 2B36A 1ISHA 2P4QA 1M66A 1Q1NA 1XG5A 2E49A 3BMOA 4W6ZA 1BW9A 1LXCA 3PK0A 4RGBA 5ENVA 3NGLA 3WFIA 3UHAA 1DRVA 1Z7BA 3UXYA 5KJ6A 1FDVA 3MJSA 4OKIA 3GZNA 1BXKA 1E6UA 3LT2A 4ZQBA 1NQTA 1UAYA 4GMGA 2O23A 1RKXA 2D5CA 2OP0A 1GCOA 4RJTA 1LEHA 2GN8A 4DPMA 3NDIA 1FMCA 3SJUA 1BW9B 4PLYA 3O26A 1NVGA 2D4AA 4K26A 5KVCA 3WLEA 1H6CA 4XQGA 2JFFA 2VOJA 2WSBA 5CAEA 3H9GA 4NPCA 4YT4A 4CPDA 3RU9A 1T2AA 1EFLA 1GPJA 1NX6A 2Q50A 4GWGA 1OI7A 1NFRA 4WOJA 1F06A 4IDGA 2YDYA 3RUEA 5ICMA 2NUAA 4ALIA 4OAQA 3ENNA 4AJJA 3VH2A 1I10A 2DBRA 1NYTA 3NTQA 4PCVA 4PRKA 1UUFA 5EJ2A 1U8FO 1G0NA 4E12A 2Q1SA 2ZJ1A 4IDFA 1E6EA 2JCVA 4ND2A 4QO8A 4RCVA 2D2IA 4CM5A 3FF4A 3GDGA 3GK3A 2XPCA 1X1EA 5B4UA 3PJEA 1QRRA 3U0BA 4TWRA 4NHEA 3H5RA 3GG2A 3JD3A 3ANNA 4NI5A 1JTVA 2HCTA 3PEFA 1U28A 5I9MA 3OMLA 1VL8A 3ANMA 3DHNA 3FWNA 4XJSA 5COBA 2WMDA 4CLOB 4LK3A 1A5ZA 1VKNA 2AG8A 3ZZNA 4OM8A 2Q2WA 3KEQA 4MIOA 1ONNA 4RF2A 3B20A 3AOEC 2QRJA 3C3XA 4YJGA 1NAHA 1T26A 3FNHA 1KY4A 3GRPA 2EKLA 3DFUA 1Q7BA 3W6UA 2HMSA 2JCYA 1E7YA 3KHUA 2YV2A 1XEAA 5T5QA 4UUMA 1I32A 3RWBA 3IDSA 5F3RA 1HDOA 2W98A 3HHPA 4QFCA 1I5RA 2C59A 1E7RA 1V6AA 1LQUA 2RH4A 4IJKA 4NH4A 3U3XA 1HXHA 3CE6A 4YJDA 4YJFA 5HS6A 2GZ3A 1ONOA 2P9CA 3GVHA 2JHGA 3EW7A 1A4IA 2HMUA 1NVMB 3ZWMA 3C7CB 1GYQA 4MJLA 3RUHA 4BUCA 1JQBA 4Z0PA 1XIVA 4D3DA 1R6DA 1WP4A 1CERA 1IHXA 2Q1WA 4GGPA 1P1JA 2HUNA 2VWGA 2Y0DA 1ADCA 3ETDA 3RC2A 3M1AA 1NBOA 1UXIA 3DBLB 3L6DA 1E7WA 2ZKLA 4GL4A 1YJQA 4AJLA 4I8XA 4S3MA 1YGYA 3LVFO 3G79A 4UEOA 3MOGA 3UICA 1AHHA 1GUYA 1NWHA 4FIZA 1P1IA 5JDIC 2OOSA 4NBTA 1WNTA 4OHUA 4TRNA 1LDEA 1NNUA 2VCYA 4P38A 4YAGA 1QYDA 3K8ZA 2B37A 3Q1LA 4FD3A 3GDFA 4CMCA 2OL4A 3UUWA 1M76A 1BVUA 4II2A 1DJQA 4BO1A 1E1KA 1SEVA 2ZQYA 1ISIA 3ZV6A 4EITA 2CNBA 3RBXA 5IDXA 5JAQA 4IUYA 4Q3BA 4CV3A 2Y1OA 1UP7A 3ZW8A 1PJCA 2VHWA 3E5RA 1C0LA 1C0IA 2C5AA 4PG7A 4C7KA 4BMSA 4CM4A 4GBJA 4DA9A 3WDSA 4CR8A 4D0SA 3IOYA 3JQ8A 3AI2A 3DZJA 3HFSA 4BIIA 4DXHA 3O8QA 2NSDA 4EEZA 3RKUA 3LF2A 2ZB3A 1NQ5A 3GVCA 2ZCUA 1AGNA 5L4LA 4DTIA 3LC2O 3W8FA 4QTZA 3LSYA 2DTDA 5LC1A 1LSOA 1T1SA 4PLFA 1ZSNA 4MP8A 1X7GA 1DLJA 2J5KA 4I9HA 3ENKA 5K9ZA 3PJDA 1WVGA 3LQFA 4PG5A 3IKTA 3F5SA 4CMBA 4LW8A 2OUIA 2QX7A 4ALKA 1PJBA 2UUPA 5JAIA 2IODA 1QLJA 3O4RA 2HRBA 3FHLA 4YT2A 2A35A 5DNAA 1QYCA 3KYDA 1KY5A 2O3SA 4R3NA 3B1FA 3G3EA 2NU7A 1H9BA 4YAJA 2WD7B 1Z74A 3AU8A 3BZUA 4IMRA 4M55A 4PLHA 3TZKA 1TEHA 5L3ZA 4BO9A 3NRCA 4WNIA 3QV1A 3DEYX 1I2BA 1BRMA 3C8MA 3DDNA 1MV8A 4O6VA 4FJ0A 4J7XA 1C14A 3U4HA 4I5DA 1WMBA 2VYVD 4CM9D 3JQCA 4GAEA 4PLCA 4D0RA 1RJWA 2I3AA 4XX0A 3ROQA 1WWKA 1MA0A 1Z45A 1ZZEA 2J8ZA 4UVGA 4ZD6A 4DREA 5I7SA 2C5EA 5C37A 4J9VA 2H9IA 4B3JA 2HMTA 2G76A 1RM3A 3UCEA 5BSHA 3O9ZA 4IM7A 4BKUA 2PGLA 5JW6A 4J4BA 4HFNA 2EF1A 3WGOA 2NNLD 1GL3A 4NBVA 3SVTA 3JQAA 3TRIA 3M6IA 5L9AA 2FPGA 2VZ9A 1ZSYA 4ZVVA 4BO2A 2X0RA 3VHRA 2O4CA 1VRWA 4LISA 4MVJD 1C3VA 3MTGA 4U5QA 3BXXA 1AE1A 3TF5A 4YTEA 5HBRA 1KBZA 3PHHA 4JJFA 5EQDA 3K5PA 2HSDA 3ZNOA 4EGFA 3OQ1A 5JDCC 2Q46A 1LLCA 5F21A 3WJ7A 2PZLA 2H63A 3ORFA 1M6WA 4H16A 2E48A 3TWOA 3Q0EA 4BNZA 3NTOA 5A05A 2FR8A 4R1NA 1ZSVA 2FR1A 1R4MB 1ENPA 3QVSA 4YR9A 4LN1A 5TX7A 3F4LA 1H9AA 4RPLA 4W4TA 5TGDA 1NFQA 1WDKA 3LK7A 3BMOB 4E5KA 3U9LA 5IZCA 4NIMA 3R3SA 1ZFNA 3JQBA 1XR3A 4JLWA 5AXDA 4L4SA 1EE9A 4DL9A 1QYXA 2H1SA 1KERA 5CDGA 4KP7A 1JWAB 3RUFA 3WTBA 1PGJA 3I9OA 2X86A 4JP2A 1PIWA 1LDBA 4YCAA 2IYPA 1XDWA 1IZ0A 4L8VA 1GCUA 1E3IA 5K0ZA 1X7DA 2AQHA 3HFGA 1TB4A 2GPTA 3QP9A 3GGGA 4FC6A 2X8LA 1TT5A 2Y1GA 1P0CA 4P4LA 4BNUA 5IFLA 1EDOA 3VH4A 1JVSA 1P44A 3RCBA 3HB5X 4XA8A 1NPYA 3CZMA 4RV9A 1LDGA 1E3WA 3R1IA 1I30A 3IUPA 4WKGA 3GH3A 2VHZA 1GFSA 1BXZA 1DLIA 3GPDG 3KLMX 3V2GA 3RJ9A 3ZWYA 1RM5A 2UYYA 3KSUA 4OXYA 3E8XA 1AN9A 2C29D 3KRTA 4UVEA 2E37A 7MDHA 3P2YA 2VOEA 3M1LA 4OOEA 2OBNA 1U9JA 4KUGA 1YOVA 3SC4A 1VL6A 4LVCA 4MINA 1H0KA 2V7PA 4FCCA 3GGOA 3GAFA 3EVNA 4OSOA 4X54A 2FP4A 2EW2A 4TZTA 3RFTA 4C4OA 4EJ6A 1U7HA 3TNLA 4MIEA 2A94A 2DTXA 5TIIA 5A9SB 5KJ1A 4BNIA 1LLUA 2BGLA 1E1MA 3C1OA 3GFGA 4CR7A 1DC3A 1N9GA 4XYEA 5F5LA 3PDUA 4E5YA 4JBHA 3JQDA 5DBIA 1D3AA 3FRJA 3G0OA 3L9XA 1N1GA 3JCZA 3EHEA 5CPFA 3JQGB 4CL8A 1TA4A 3A14A 4QEDA 1B0AA 1UXHA 4BV8A 1Z73A 1J5PA 1PGQA 3D4NA 1M2WA 4XRGA 1EE2A 4A03A 9LDBA 2OP1A 1R16A 4GVLA 4MVJI 3B70A 3D4PA 2GZ2A 4E21A 1HF3A 3ZV5A 1HYGA 1T2FA 4FOSA 2FRDA 4MVJE 4XCVA 3OQBA 5C7OO 4J16A 1IE3A 4IDEA 5CDUA 2EWMA 4UVDA 4XRRA 4QO7A 1OZAA 3DBRA 3WBFA 3NV9A 4BNXA 5L7TA 5F1PA 1U1IA 4BNMA 1T2CA 2TMGA 2JKVA 4U7WA 1AXEA 3I9MA 4FQ8A 5B1YA 1R4NA 2W90A 2W2KB 4DVJA 3GN2A 4UUOA 1F12A 4IDDA 4J43A 4OQZA 3VPGA 4IIUA 3BHMA 2Q2QA 4AJHA 1T24A 1YH3A 3ZWXA 3NAQA 4MVJP 2D0IA 3IL2A 4MKXA 1L7DA 2RCYA 4Y9DA 1U8XX 1ADGA 2G0TA 3KSDO 1NP3A 4BNLA 2DVMA 4NR0A 4LSWA 3K96A 3ZU3A 1LC3A 4NFSA 2PKRA 1A71A 3JQFA 4GQAA 4BB5A 5AQ1A 2GN4A 4JXKA 2WD8A 4BNWA 4JGBA 2AE1A 3AUUA 3ZWVA 1QXSA 2HO5A 9LDTA 2W4QA 1CJCA 4OXNA 1NFFA 1KC3A 2PFGA 3AY7A 1GTMA 3WNQA 1CQIA 2GCGA 1JVBA 3DTYA 3Q11A 2HK7A 5U1PA 4B4VA 4BNFA 2OFPA 3JQ8B 4LRTB 2G17A 3OJEA 5JDIA 3BMQA 4PZCA 5B4TA 4ND3A 2CDCA 3PWSA 4Q3NA 4DMLA 4EZBA 1HTBA 3GVPA 1UJMA 2ZYAA 4XB1A 4KMSA 1HE2A 3FWZA 2X9VA 3H2SA 3MWEB 4LCJA 4BNVA 2WYWA 2ZTLA 3TZ6A 1JKFA 3OA2A 3RVDA 4XJTA 1SOWA 4BO6A 5IAAA 4FOOA 1KVRA 5ES3A 3ASUA 3QW2A 1DDOA 1NVTA 4HADA 1G6KA 3GMSA 3GNTA 3INRA 1PJ3A 3GZ4A 3HDJA 5TNXA 4B7XA 5BSFA 5B4VA 4BNJA 5DP1A 4CV2A 3SJ7A 1EVJA 4GSLA 5JNLA 5JBIA 1A7AA 5EINA 3VZSA 3OHSX 3G1UA 4WEOA 1Y1PA 1IOLA 1ZJYA 1LLDA 4ID9A 5GZ3A 1AUPA 3CH6A 3F47A 4MKRA 3WB9A 1O6ZA 4WLOA 4ZQHA 5IXYA 4Q3AA 2JFHA 5G2OA 1PU2A 1V35A 2EGGA 5CP8A 4BVAA 4D79A 5A5EA 4OYRA 1U5CA 5BSGA 3NUGA 1QORA 4NQZA 1OFGA 1JWBB 2FPPA 1UDCA 4YXFA 4Z9YA 2XXBA 3OH8A 1T4BA 3DBVO 4JP3A 2QRKA 5AOVA 5JFOA 3C7DB 1B16A 4I08A 5K6AA 3BAZA 2V6MA 2O3JA 1X0VA 1Q2XA 2QW8A 1G0OA 1VL0A 1X15A 2WWRA 3ZGYA 1YQXA 4E4YA 4J4TA 1J4AA 4UREA 3FSRA 3KB6A 1GEEA 4XWYA 3MJ4A 3ZWNA 3K31A 4Q9NA 5JYDA 2VYVA 3JQAB 4CM9A 3ADPA 3ZH2A 1P1FA 5CDYA 4E0BA 2XAAA 2VHXA 1KVSA 2YW9A 5JLAA 1ZCJA 2BRUA 1NAIA 3QIVA 2HMVA 2DLDA 1KYQA 3STHA 5B12A 3GUYA 1QMGA 2PZKA 1E3LA 2JHFA 3NTRA 1K0UA 2BF7A 1E77A 4LRSB 4GKVA 4YPOA 2I5PO 3OQ6A 3VH3A 4CLXA 1UR5A 1R12A 4XYGA 1PS9A 5EIOA 2YY7A 1ZUD1 2BH9A 4KQWA 3HDYA 5IJZA 1C1DA 3AUAA 3BA1A 4MVJA 2WTBA 1MFPA 4B79A 3NEPX 5A1TA 3VZRA 1YBVA 5A03A 4LVUA 1OC4A 1P1KA 2QRLA 5FEUA 5CG2A 2WD7A 4IPTA 2QYSA 4ILKA 5GZ1A 4FJ1A 4H15A 1HLDA 4ALLA 2NTJA 3QVOA 3ZHBA 3VTFA 3V1TC 3RFXA 5TS3A 4PVCA 1O89A 4RVUA 4Y6SA 1EFKA 2H5LA 2ILTA 2LDBA 1HWYA 3FNFA 3PGJA 4TRRA 3SLKA 1MB4A 1Y5RA 2NVWA 4NJMA 3W8EA 3H5AA 3S1LA 4PIVA 1A4UA 1EZ4A 1IPFA 2C2YA 4CQMD 2C7GA 3W4JA 3I23A 4DGSA 4JBIA 1BVRA 4NMHA 1B15A 1EK6A 4S1VA 4CM3A 3TN7A 4E5MA 4PLPA 1KEWA 2DPGA 2QQ5A 4DPLA 3QA9A 4BNHA 5ITVA 1I36A 4YT5A 3PTZA 2WYUA 1E5QA 3L4BA 4CMIB 4NK4A 1HZZA 1U3VA 3D3EA 1YB1A 3PQEA 2FSSA 3OIGA 4CM8B 5U9CA 3WWZA 1UXJA 4CUZA 2WM3A 2W8ZA 4E32A 5H82A 1L7EA 2I3GA 4I9UA 3NX4A 1AHIA 1Z6ZA 4ZQGA 5DDIP 1FJHA 2O3RA 4BO5A 3D3WB 3AM3A 4HXYA 3QQPA 5ER6A 4YAIA 4C7JA 1HSZA 3UOGA 1RM0A 1ZK1A 4PZEA 4UULA 3KV3O 1MGOA 3W1VA 2HLPA 4BO0A 5L7WA 3S2FA 1NR1A 2BFOA 1UDBA 3GUCA 1SB8A 1XKQA 1Q0QA 4W7IA 3DB2A 1DB3A 4Y6PA 5KKAA 4FFMA 1Y8QA 4J0EA 3C1AA 4WK6A 5EMHA 1Z7EA 4K28A 4UUPA 4NBWA 4RORA 1DAOA 3V2HA 2Y66A 3K92A 3Q6IA 5JO0A 4HFMA 3ZNPA 1P31A 2XOXA 3UFXA 4QXMA 2C54A 3ETEA 3T4EA 3BMCA 4J2OA 1EEHA 3EZYA 3LT1A 4PLTA 3ULKA 5FFFA 5CG1A 4QSMA 4LMPA 4DWVA 3WGGA 5IG2A 1E7SA 5J23A 4DQUA 4YRBA 1BGVA 2CFCA 1I3MA 3DZKA 1CDOA 3L9WA 4E2WA 5JYEA 4LSMA 8LDHA 1HE4A 4FFLA 4XQCA 2A9FA 4L9RA 1ULUA 1EUCA 3WGTA 2BGMA 1O8CA 2GRAA 2ZB8A 3BMCB 4A27A 4ZJUA 1DIRA 4D41A 5CFZA 1ZNQO 3EGOA 3JD4A 2YJZA 2C07A 1SBYA 4WOKA 5TSDA 3QSGA 2Q4EA 2WE8A 2X4GA 4OQYA 2NADA 3WGIA 2TMDA 2B4QA 3CINA 3KUXA 4GGOA 4MP3A 2C82A 1NHGA 2CVOA 3I9KA 4TKLA 1HYEA 4MKZA 5G0VA 3GDOA 4AJNA 1ZO8A 1DIHA 4DC1A 2ZB7A 1QLHA 1EVYA 3U09A 3GEMA 3CPSA 4ND1A 2Q45A 4D3FA 3GMDA 3DMTA 4L75A 4A26A 4A5OA 2IZ0A 3VKVA 2I6TA 3BMNB 4INAA 4U0JA 3VPSA 2BFMA 4WLFA 4AJKA 1VJ0A 4IDCA 4CQMA 2I65A 3HZZA 1WPQA 2CF6A 2CDAA 5TQVA 1R4NB 3I6QA 1FDTA 3CEAA 3WX0A 5T67A 3TSCA 5JS6A 2BLLA 4WEQA 2A4KA 2GN9A 4OSPA 4DLAA 4H7PA 5MGBA 1WDMA 4ZRNA 1SCUA 1LA2A 3ZHXA 4UVIA 3KYBA 1SAYA 3Q2IA 4J6FA 1E1LA 4ZQEA 5CEJA 2FMUA 3PGXA 2FSVA 4IJWA 3VPXA 3DL2A 1LRKA 2X5KO 4R68A 5THQA 2E6UX 1N5DA 2AQ8A 2YYYA 1B26A 4J91A 4YDRA 6ADHA 3PI7A 2O50A 5DBGA 3UCXA 1LLQA 2BELA 3NJ8A 1EK5A 2C2XA 4YAKA 1BHSA 4BNTA 2Q3EA 3WGQA 2BMAA 4TZKA 5HM8A 4NFYA 4KUHA 3X2FA 3LC1O 1GQYA 2O3UA 2JD0A 5DN9A 1PZFA 4PFJA 4TSKA 1LBEA 1PJSA 3COSA 1SO8A 1I01A 4QQRA 4HP8A 4ALMA 4BB6A 5KJCA 2YHUA 2AEJA 4HY3A 3L6OO 2PWZA 3KZVA 3PHGA 1YKFA 1HLPA 4MIYA 3H8VA 2NTNA 1XCBA 4EEXA 4BO4A 3EUWA 4A10A 5A3JA 2DT5A 4JIGA 3O38A 4ESOA 1NQOA 4CMAA 4RVFA 2QZZA 1ADFA 3K73O 4FW8A 1K3TA 4LMRA 3E1KA 1Y8RB 4JCOA 2O4UX 1UZMA 3V2UA 3NT4A 1JA9A 4Y67A 4YJHA 4RDIA 1VKOA 3DZIA 3QWIA 3B1JA 5AYVA 4A73A 4NFHA 1PR9A 5IDYA 1Y8QB 5A4DA 1ML3A 3DZGA 3GR6A 1ZK2A 5JY6A 3PRJA 1JAXA 4M54A 3A06A 1PQWA 3NDJA 4J7CA 2Z95A 4R5MA 4HV4A 4QT0A 3UW3A 3A28A 1MFZA 5I7EA 1PZHA 2YHIA 3OJOA 5I7VA 5COAA 2NWQA 1W8DA 4KDEA 1U3TA 2D8AA 4DRYA 3MJTA 1JKIA 3HJAA 3PVZA 4Y8VA 3G17A 2PKQP 1EVZA 1YO6A 4PLVA 1NPDA 5CPBA 1BTOA 4R54A 5JCJD 2D59A 1ADBA 4DPKA 3DZBA 4M49A 1BDMA 5BNTA 4JBGA 2GF2A 2FOIA 2I76A 4J49A 2NM0A 2J5RA 4BGVA 3JV7A 2Z5LA 2O48X 1BWSA 1FDWA 1SMKA 4W7HA 1LSSA 1P0FA 3O03A 4W82A 1Y8RA 1FDSA 4BO8A 2NQTA 3IKVA 1KC1A 3U4CA 4NK5A 2C20A 3WS7A 1KEPA 2DUUA 4D7AA 2VUUA 3H4VA 3P7MA 4PZDA 1V3VA 3FPLA 1NQAO 2CY0A 2FZWA 3Q9NA 3TQHA 4EW6A 5ILOA 4MOWA 4EUHA 4ZU3A 3UAGA 3AY6A 4L74A 4M8SA 1IUKA 1V8BA 1H6DA 3HWRA 3DAGA 3PZBA 5TC4A 1EUDA 2J3JA 1H5QA 4WLNA 1DFIA 1WAMA 3W4IA 4J7UA 4NZ9A 4B7UA 1V9LA 3I9LA 1B14A 1XU9A 4R69A 4BO7A 3IQDB 2HMWA 3HQ4O 3L4SO 3WBBA 1YB5A 2O2YA 1CF2O 1NHWA 1UZNA 1EVIA 4P4GA 3JQ9C 4BKRA 1YL5A 2BGKA 2F00A 3PZRA 2WE7A 4O5OA 4B8ZA 3HDHA 2RHCA 5CEFA 1K2WA 3IJPA 4BKPA 4M1QA 2EV9A 1B8VA 3VDRA 4F45A 4CQLB 3CSDA 1NWCA 5KCZA 4IS2A 3AY3A 3CKYA 4ZICA 4XGKA 4DQVA 2BFAA 1IB6A 1W6UA 2VZ0A 4E2ZA 4ZRMA 3E9QA 4XGIA 2X1HA 1PEDA 3SXPA 3ZU5A 5TLSA 5FF9A 3UCFA 3DTTA 2ZQZA 1X0XA 5LCXA 4XR4A 4CLRB 3ROPA 4AJPA 4DLLA 1I3NA 2UDPA 4BS9A 1W0CA 1HT0A 1F8GA 1FDUA 1YDEA 4XD2A 3RROA 5A9SA 1P1HA 4EJ0A 4RZIA 1PR3A 2RAFA 1EBFA 2ZCVA 3OJLA 3ZN2A 3RJ5A 4D42A 4BKOA 3NT5A 4Z0TA 2B0JA 1YVEI 2P9EA 4KWHA 4WLEA 2W2LD 2CD9A 2Q1TA 5IN5A 3KETA 2GD1O 4L4RA 2IEDA 1ONPA 3ONFA 4HBGA 2X0JA 3KBOA 3RBZA 3DQPA 2C0CA 4F6CA 2PKQO 3EAGA 2NV6A 5G0WA 1K89A 5JCJA 1PJTA 2VWHA 1NTOA 4YJHB 4W9NA 1A9ZA 1F8FA 3W6ZA 4ZGWA 3H3FA 2ZK7A 3TZHA 1TT7A 3ZWCA 4YWJA 3WNVA 1PZEA 3A4VA 2Y1CA 3TOXA 1ZXLA 2IZ1A 3VOSA 1GQQA 1O5IA 3WMXA 5BQFA 4HNGA 3KO8A 3S55A 3LLSA 1Y5MA 3WFJA 4Y6RA 1WZEA 3VZQA 4EBFA 3ANLA 1P1RA 1I2CA 4MVJH 3V1UA 1DC6A 1GAEO 2EG9A 1HDRA 4MPDA 3DAPA 1LSJA 3KEOA 2SCUA 2JD1A 4UEJA 4WCFA 2DBZA 1XSEA 4N7RA 3NDRA 4FPXA 2VWPA 1UDAA 1HYHA 2AXQA 2DPHA 1P45A 5DCWA 1JN0A 4BQPA 4E5PA 1PQUA 3BIOA 3ROKA 4Z9XA 3ICCA 2DM6A 4BNKA 5KVVA 4XDZA 3GLQA 3JQ7A 1EMDA 4CR6A 2AMFA 4CMEA 5KJFA 2Y67A 3KTDA 1X7HA 3GN1A 1L1FA 4CM1A 2X6TA 3NGXA 3JYOA 3WR5A 1PWXA 4PN3A 1GYPA 2YV3A 4G5HA 5CEEA 3OIDA 1H93A 4AJ1A 2P68A 2UAGA 4YACA 2JAHA 1I24A 3PFWO 4FFPA 1O94A 3U4IA 5JMWA 4WCFC 1EDZA 1B8UA 1BDBA 1LC0A 5DT9A 5DZSA 3AFMA 5G4KB 3WLFA 3GPIA 3ICPA 3WQRA 1GYRA 4XYLA 4O63O 3RU7A 2EW8A 1DBVO 1IHYA 2HJRA 4DUPA 3D1LA 4YAEA 2OXIA 4FGWA 2PH5A 3OBBA 4CUKA 2OORA 3BTUA 3E5MA 5T8KC 3KVOA 1BXGA 1UAGA 1WXDA 3MJVA 3AI1A 4CLRA 3E9MA 3UH1A 2EKQA 4BL5A 4QX6A 3CMMA 1PSDA 4CMKA 4GX1A 4OOFA 1K5HA 1CYDA 4NDNE 3PP8A 3PIDA 3FBTA 1M67A 3VTZA 1QP8A 3R6DA 1N7HA 3OA0A 2VYNA 4Z3DA 3ITDA 3IP3A 3IC5A 4OH1A 1NM5A 4JK3A 4KDFA 4WCDA 4AG3A 1DC5A 1RM4A 3WGHA 4NBUA 4GKBA 5JDCA 4HKTA 2GNAA 5FYDA 3U62A 3DBRB 3FTPA 2H6EA 1VM6A 4R1TA 2C7VA 1HEUA 4KZPA 4OIMA 3FNGA 1B3BA 4E3ZA 3H3JA 4R01A 5CDSA 4OKNA 1MC5A 1M6HA 1XGKA 2AA3A 3FD8A 1D4FA 3UKOA 4BMNA 2ZTMA 4E31A 3WIDA 2GDZA 1H2HA 3QWBA 1D7OA 1PTJA 3KYDB 1JDJA 2GN6A 4ALNA 1V3TA 1DC4A 1LDYA 4N18A 5JXWA 4RF4A 1ZXBA 4XDYA 4FB5A 3I5MA 1UXGA 1OOEA 1IY8A 4TRMA 1XU7A 1CEQA 1OBFO 3K2BA 1UXKA 1C1DB 1IPEA 1VJ1A 1YL6A 1LU9A 2DFDA 4IIVA 2E4AA 1VSVA 5F1KA 3IP1A 3ON5A 4IDAA 4N5MA 1Q0LA 4DIOA 1PJQA 1D8AA 1C0KA 3A9WA 3JYPA 4NJOA 1Z75A 3C24A 1MX3A 2D1YA 2O2SA 3KYCA 2EHDA 3WJAA 5A9RA 5AVOA 5JAMA 1QSGA 4N54A 4XEHA 4R1UA 2PA3A 1YXMA 1HE5A 3WQQA 2ZB4A 1D1SA 5F1OA 3QHAA 4YRDA 1DFHA 3I3OA 2X9NA 3ONDA 4AVYA 3GVIA 5THKA 3WOHA 1PWZA 2GGSA 2X9GA 1HDGO 2PTGA 3PQFA 4FDAA 5T6BA 2PH3A 3CIFA 2DC1A 2PR2A 1KEUA 3GVXA 3MEQA 3K9QO 5DP2A 2HRZA 2B83A 3RIHA 3QY9A 2X5JO 1I8TA 2UUOA 3P19A 3ZU4A 2QG4A 3K2EA 3S2GA 4QUKA 1DIAA 4AL4A 5ER9A 1U2GA 2PD6A 3DWFA 2YQ5A 3GG9A 5LDGA 1UP4A 1LI4A 2PLAA 4Z3KA 5C7IO 2CDBA 2VQ3A 3AJRA 4TVBA 4IDBA 1GY8A 3ZWAA 4OGWA 1ARZA 3OEWA 3P5SA 4BOYA 2QHXA 1UH5A 3I4FA 3JTMA 3CUKA 3DBLA 3DMYA 3H7AA 1MC4A 1GU7A 3GGPA 2BKAA 3D5TA 5KIAA 3I52A 4Y98A 2LDXA 4IQGA 2CVZA 1JKJA 2CSUA 1XQ1A 3JQ6A 4G81A 1AXGA 2IEBA 4GPD1 3T7EA 4ZHSA 1ORRA 2D5AA 4R41A 1DAPA 3AOEA 3E48A 3ONEA 4CV0A 4B8WA 1Y6JA 3BTSA 2NVUA 3BHJA 5BNFA 2BI8A 3HB4X 1ZW1A 1LDMA 3IUSA 3T4XA 4W99A 1YDWA 2P4HX 5L45A 4NNJA 2ZYGA 2RH8A 4JN6B 1ENYA 2J3KA 2X58A 1WLYA 2VN8A 4Q3CA 1WDLA 1E3JA 2X0NA 1NPTO 1NR7A 4J3FA 1A9YA 5A5FA 1P33A 1HRDA 5U4QA 3WICA 3OJ0A 3EMKA 1LUAA 1J0XO 1XYGA 4R9SA 4RF3A 5IN4A 2GO1A 3BTVA 3D3WA 1F0YA 1YONA 4EUEA 2DBVO 4ND5A 2JL1A 1RYEA 4NG5A 4IGEA 5FWNA 4CLDA 4O1MA 5EN4A 4NJMB 3GEDA 1R0LA 2GZ1A 5AXCA 3HADA 3ZWWA 2ZTVA 1T4DA 3PFFA 4OXKA 4BNGA 1S7CA 1OMOA 1GV0A 2FWMX 3C7AA 1ZH8A 7ADHA 4YT8A 4ROSA 4DC0A 4XZ3A 3VPHA 1X1TA 1MXHA 2A92A 1XLTA 2EKPA 1UP6A 2WEKA 5TT0A 5A04A 2W2LA 3OSUA 4FS3A 1KVUA 3OFSA 4BNYA 3W8DA 4P4NA 5H83A 1RPNA 5COQA 2Y68A 1KEVA 1PJ4A 3DOCA 1LJ8A 4CQMB 2G1UA 1C0PA 4HNHA 4K9DA 2B4TO 1DHTA 3HDQA 2DTEA 4J4HA 1DIGA 2GSDA 4XKJA 3GEGA 3WYBA 1WZIA 3N7UA 4JQCA 4XR9A 3JQGA 5BSEA 1PGNA 3EYWA 3NKLA 3TZCA 4G65A 5T64A 4OL9A 6LDHA 3P2OA 4P22A 2RHRA 3LZ6A 1XELA 4CL3A 2CMDA 3Q3CA 3FN4A 3E82A 2GR9A 3MZ0A 4XIJA 5DF1A 2AQKA 1BG6A 2IXBA 3D0OA 1JU9A 3KOUA 3R3JA 4OJNA 4FBGA 4QFDA 4TKMA 5I8WA 3KSZO 4CMJA 1UZLA 1ZVMA 5KWEA 1P3DA 3F9IA 4B3HA 5G0UA 4EJMA 1ZMOA 3HN2A 3OIFA 2GASA 2RIRA 3CXRA 5DCYA 3A1NA 1E1NA 4RVHA 1PGOA 2HKIA 4WPGA 3PYLA 1P9LA 4OMUA 3OICA 1HETA 1Q0HA 3AUSA 4CLOA 2Y99A 4IJUA 3TPCA 2VHYA 5I9LA 1PL7A 2Y1EA 2J3IA 3T7CA 1KETA 1YQGA 3H5NA 3ZV4A 3HUDA 3RBVA 4U6SA 4BQRA 3CMCO 3TFOA 4ND4A 4E30A 4FSHA 5HS4A 4FN4A 4E2YA 3KLPX 1VSUA 3QVTA 3PLRA 4GSKA 4RVGA 1GPDG 3G49A 1SZJG 1ENZA 4TMFA 3FNEA 4MVJG 3JD2A 4DIBA 1QKIA 5IDQA 1GZ6A 3JYNA 4XQEA 3JSAA 3WYEA 5C3MA 1HSOA 2GYYA 1U7TA 1EUZA 4W9NC 1B7GO 4NU6A 2QIOA 2HDHA 2JFGA 3KYCB 5JY1A 3JQEA 3H65A 3AU9A 1I3KA 1QV7A 3IIEA 4GMFA 1VPDA 1Y7TA 1FK8A 4UUNA 5ENDA 3WYCA 3PHJA 5AXBA 3D5QA 4JROA 4DLBA 2VYND 4UVHA 4BGEA 1IL0A 3PHLA 4BGUA 4D3SA 4YYZA 1CRWG 1B8PA 2I99A 3ASVA 3AM5A 1XHLA 1IULA 2ZIZA 2NACA 5KTKA 2CZCA 2BD0A 3GZNB 1OC2A 1GV1A 1C1XB 4G2NA 4H3VA 1DEHA 3VKUA 2POQX 3V8BA 3GOHA 3DFZA 1T1RA 3PXXA 1JAYA 4MDHA 4RQUA 1E3SA 3HG7A 4M87A 1ZKMA 4J9UE 1E0DA 3DR3A 1X13A 4D43A 1W4ZA 2OZPA 5JCXA 1PZGA 3ST7A 3BMQB 4GVXA 3WIEA 5C5IA 3I6IA 4Z9FA 3VAZA 3VPFA 2P5UA 2YDXA 1J6UA 2PZJA 3X2EA 4UAGA 3WXBA 5CHEA 3MWDB 5I7FA 5EPOA 3FPCA 4CLEA 1GR0A 3FI9A 2VT2A 2X22A 2AEFA 3RC1A 3RKRA 1LRLA 3AWDA 3LDHA 3UVEA 3LC7O 1PQPA 5EL0A 4GH5A 1A7KA 1ZK0A 4J1NA 1YOVB 4XQ9A 4XGNA 3KXDA 4RPHA 3EZLA 3F5QA 4YVFA 4E2XA 3F3SA 1Y81A 2HQ1A 3GHYA 4BMVA 3B6ZA 3AW9A 1BMDA 4U0KA 5JE8A 3FCOA 3L07A 2BHLA 1SOVA 4WGGA 3H6KA 1M75A 3RUIA 1YBAA 4K1LA 3LLVA 1ID1A 2B35A 3RI3A 3GNQA 3GT0A 3L77A 1IYZA 3UN1A 3FBGA 2I66A 1Y9AA 4O59O 1KIFA 3EVTA 5L4NA 1G1AA 1CETA 2O7QA 2EIHA 4O0LA 2R2GA 3DZFA 4YBZA 1N92A 4CMGA
chains in the Genus database with same CATH superfamily
3G5MA 1RLMA 3EY4A 4OHBA 3U19A 1DUVG 4G0YA 4N5LA 2HV8A 3QJ5A 4HYYA 1N5JA 2CD7A 3JWHA 4I5FA 5G4KA 3ETLA 3VNAA 3IELA 2C03A 1NXQA 1S2IA 5CT6A 1KHTA 4NDAA 3OF2A 2MSNA 5BV8A 4P4SA 1ISSA 4AX4A 4JHXA 4M3NA 4FEGA 2J3HA 2YQ4A 1F6DA 2I71A 3S8EA 2W6JD 1ZK4A 1RWPA 3NHSA 3O2SB 1IN7A 3FHOA 2OYRA 3LUBA 1QTQA 1XA4A 3OZIA 2O2JA 5JWRA 4JZYA 4N3GA 2V0CA 3C4VA 5KPDA 2QE6A 4F06A 2CWDA 3MOIA 5ALDA 2RHGB 2Y4NA 3QJYA 5JG7A 1RYDA 3TOZA 3I8OA 3BHIA 4KQJA 1Y6GA 1E3WB 3ECSA 4LJLA 4OX9Y 2GHRA 2QLFA 2CVHA 1RQ2A 3M3PA 3K53A 3QVWA 3F98A 1JSZA 2AT1A 2JASA 5DE3A 3SEFA 4WA8A 3WMWA 3PVCA 2B5VA 1XMIA 2EG5A 3BWVA 5JPIA 4EKEA 5AW6A 2V97A 5CXSA 1QG2A 1RTTA 2Z1MA 2VHJA 5EJIA 1W75A 1IPHA 2DPMA 4ZTBA 3ND7A 4BQOA 5EQJB 1ZMRA 4J6EA 1CJKC 4EHHA 1RJDA 3VC7A 1G5PA 4UMEA 5CA1F 3EZXA 2VUTA 3BXZA 2O1SA 5TQ0A 3A9UA 3O92A 3SS8A 4Q03A 3PCRB 2I1WA 2I6GA 3AL3A 2ET6A 5F5NA 4I4IA 3RUCA 1UKBA 2VSYA 3HLYA 3ITNA 4FHCA 3U48A 4NCIA 2WJPA 4M1OA 2WU0A 4DB4A 2Q5HA 2Y1FA 1DXYA 5FNVA 2DEUA 2IYOA 1XZMA 1JQEA 2IYQA 5EE0A 5GONF 1NMXA 1D04A 1ZJ6A 3M4NA 4LXXA 5C5CA 3NUQA 2QNIA 2NMVA 3G5UA 4ZEOA 1ZD5A 3L6UA 2BSAA 4EFKA 3PVSA 1IVSA 5H02A 3SHTA 2JFZA 3D6AA 4MWSA 2Y0CA 3QUTA 5AXAA 3CUUA 5DXFA 3UWMA 1P0MA 2A7XA 5F64A 3EH1A 3A11A 3ABIA 4CKBB 4Q37A 4QWWA 2V6BA 2APJA 3FWPA 2ZTSA 3L7CA 5HKAA 1SIOA 1TQ4A 4PBSA 5KVSA 3PFIA 1DKPA 3CLRD 3WL7A 4YY3B 1DEOA 4OAOA 1U3WA 4URFA 3HBNA 1J2YA 5KNDH 1BWRA 4BVLA 4X61A 1FUIA 5HIMA 3VR2A 2CB9A 4MPJA 3FBWA 5DULA 3VNQA 4UFNA 1BSVA 4MUJA 3IRUA 5FAXA 1P9OA 2C3UA 2Q4BA 2WZBA 2ZE6A 5SYMA 1GGFA 1YI1A 2HSZA 1E79D 2OO3A 4MK4A 1ETHA 1E9VA 1L0BA 2Z56A 1XQ6A 5C34B 2O1XA 3VYWA 3I5YA 2ZJ6A 4I81A 3EMDA 2ACVA 5IDWA 2WIAA 4XUGB 3TLJA 5KNDA 2GPBA 4H3KB 4RCZA 4WZ6A 1PQ4A 2HXSA 1ISGA 2GK4A 1K5DA 2CYCA 2R8OA 2ZSKA 3ICOA 1U94A 3OSZA 4DMHA 1GXSB 4Z0HO 4ZZ0A 1XWFA 3BE4A 5SZHB 4UJ3A 3HACA 4JUDX 3AX6A 4AZ3A 1C3XA 1LRJA 4UBJA 1BMFA 2A67A 2W2KA 5B1SA 2BKLA 4B3IA 2C2BA 2OMEA 3O6VA 4XX0B 4XCQA 1V5FA 5I8ZA 3DZ8A 3KQOA 4I5GA 4L4XA 2NO5A 3LT4A 4YRMA 2IU6A 1VLLA 2BGRA 4X63A 2P79A 2ZUSA 4X71A 2X13A 2OESA 2PY6A 5NULA 3HP4A 1ZEJA 3QKSB 3TNYA 1VCHA 4X1KB 1VL2A 4OHCA 4IFEA 1OWPA 3TFWA 1C9YA 4N3CA 2R3SA 2I03A 4X0EA 5DLQC 5C46F 2QA5A 4HHEA 3TUZC 4QM6A 4R2JA 1XROA 3MRTA 3OPQA 2WJVA 4WASA 4TL7A 3G2KA 1HDCA 4CM8A 1EGAA 4D4HA 4LCBA 2AFIB 1JHDA 4DV3B 1OH6A 1IDN1 1HLFA 1HX7A 1WMAA 3V1YA 2GLXA 4KTTE 4ME6A 3ZWBA 4B75A 1C5KA 4ZI2A 2H92A 3FTNA 1OASA 1P18A 4TT3D 4W5QA 1WHTB 5EZYA 1TRHA 2AHRA 2OLKA 1X8KA 1IUNA 5FUYA 3C85A 1GVNB 4M60A 3LT0A 4UTXA 4UOQA 5A7GA 3OQHA 4BV9A 3N53A 3V1LA 1U4OA 4L6CA 1WZUA 3DD5A 2ZAIA 4RK6A 1TW2A 5IASA 3VV3A 2A5GA 3L93A 4IVQA 4KFTA 3U4QB 3K8YA 3NBFA 2NU9A 3ZU2A 1D7AA 2QMEA 1XHEA 3FCYA 3GJ5A 1QQBA 1ZH4A 4AMYA 3VDXA 4N7JA 5JTTA 4HAIA 3S8MA 1JBQA 4AIRA 1PS0A 1DI0A 1MG0A 3QOWA 1KOLA 1O95A 3ZK7A 2J6CA 2OHXA 5K3DA 4BFTA 4LPKA 3T3PB 5CX1A 1N9GB 1Q0RA 4L57A 3CX8A 4V1CB 3IERA 3GUZA 1CRQA 4R1SA 4Z7QB 1I80A 3KKQA 3M81A 5HXAA 2GJ4A 1KTVA 4P80A 1TLTA 5CA0A 2O8NA 3JZAA 4Y1EA 3Q41A 2QX9A 1UK6A 2ZZKA 1Q20A 4K6GA 3INTA 1LNQA 4MP6A 2B1GA 3NBAA 4MYUA 1BQ4A 4ITUA 1Z56C 2QMZA 1MX9A 2ZRJA 4ES6A 1UPAA 2RI0A 2BKEA 1VJDA 3OECA 1YZLA 4J0DA 2B69A 4YJFB 3JALB 5KVVA 4D9JA 2AN5A 5IX8A 1L3BA 1ZI6A 1E3DA 1ULSA 4WECA 4ON9A 4PC2A 2BDEA 2R00A 3WTCA 4ZT3A 3H05A 5KTMA 1XCGB 3AG6A 2O7NA 3K0AA 5DNWA 2PZMA 4MR7B 1AO0A 5J4LA 2GJKA 4RJIA 3E05A 1GFWA 4RZXA 4XOUA 5JAZA 3ESCA 3W5AA 1E79A 2A9PA 2BKUA 3OEYA 1SWVA 1IQ0A 4FZVA 1PX2A 4XB2A 3WB1A 2Y27A 3QEAZ 1YJ8A 2XDYA 4JJGA 2VRBA 4OFBA 1WD5A 2RAVA 1E0KA 4PZAA 5K6AC 2HU5A 3N58A 3PT5A 3X1MA 2UVDA 3DEAA 1M0WA 1QRSA 2QX6A 3O0DA 4GVPA 4KIUA 4B32A 2OSBA 2W9XA 4QDZA 3TG8A 5HWSA 1GD1O 2X1VA 5T4FA 4I4CA 4D82A 4M1YA 1LSUA 1G6OA 1OFUA 3E35A 3ORQA 2PMEA 2BM1A 2JIDA 1IY0A 1JLLA 4GPBA 5I4IA 5IVPA 1W34A 3DT6A 2IH4A 2P9FA 3ZHZA 1TTPB 2HRCA 3QW4B 3PQDA 5AVYA 1NG1A 2YIVX 4IXTA 1T6XA 5C3UA 3R3ZA 5HKBA 1G60A 2AJDA 2A1TS 4HH4A 3TLGA 2ZOSA 4EK9A 4GLOA 2GERA 1A8SA 1ONSA 1N6HA 3VR6D 1CJMA 3D7RA 1RP1A 2AE2A 2CWWA 3HRIA 2IT1A 4ZI7B 1R6VA 4BBPA 1RE1A 5IT5A 1R15A 4NTZA 1GKUB 5E8RA 3DXFA 4TGLA 3AO0B 4KWEA 4ITRC 1QFYA 2K4MA 2EX4A 4JKYA 3FLAA 5FL7D 1ZLYA 1PYGA 2QD4A 2AD1A 1AK9A 2HJWA 2MDTA 2J0UA 1KGDA 5C8YA 4DMMA 5SZKB 4IIHA 2QTHA 4D9HA 3MJEA 4MUIA 1A27A 2Z98A 1QG6A 3Q4GA 2CHQA 2XRMA 1P72A 3DOIA 1L5QA 2W2OA 4I19A 4U63A 5KHAA 1NXPA 2OQIA 4P5EA 4UTZA 4A2CA 1CZOA 5BPFA 5A2QA 3HCRA 4A6PA 4KR3A 2VTVA 3MJRA 5IANA 5IXSA 5I9SA 2VTDA 5DO9A 5IUNC 2QWXA 2O2HA 4PRLA 4MVYA 1U5BA 4Q9LA 3MD0A 2FFJA 5IF3A 3CUEF 3C87A 3QWAA 4RDHA 4AAYA 3F71A 5EJAA 2B4KA 1K6IA 1QZXA 2JVIA 3I30X 2OCDA 4ZVSA 3T52A 5L95A 5HRUA 1QV6A 2ZWPA 3D81A 3FWKA 3I9JA 1E94E 3K0CA 5HJ5A 2H48A 2HAEA 5D6NA 1AK2A 1TVKB 2R5WA 4GDMA 4LZLA 1KMHA 3FUTA 4B8ZA 2WDPA 1DRWA 3FMIA 1Z5GA 4BUZA 5AW5A 4AZWA 5E9JA 4BJ1A 4Y2QA 3VH1A 1G2PA 1O96B 2I0FA 4WWHA 2HK8A 4DMKA 4DLVA 3AOGA 3DHEA 3ITKA 3U49A 4IICA 3E03A 4M0LA 2VJAA 1Y5IA 5CJPA 1E5LA 1BXGB 3QV2A 4ONEA 1SEPA 2AQIA 1WMFA 4CM4B 4BECA 3DXXA 2X0IA 1LH0A 5LP6F 2V6GA 2IPNA 2Q2VA 3H18A 3GPBA 5L7YA 1OXSC 3K0HA 4CM7A 4EDFA 2LRHA 3ILYA 1JDBC 3IAHA 2I34A 3X1DA 3AI3A 1ZCBA 2AJBA 3CBQA 4H7DA 4TVOA 4CLHA 1Y6ZA 3WVNA 3ND5A 6NULA 3E1SA 3F1KA 4BLSA 3VC2A 2VWQA 2X2EA 3FWYA 3KE9A 1DVRA 4L5CA 1VLMA 5TJ9A 2DQSA 4AROA 3FOWA 4KX5A 1Z13A 1GADO 2IY7A 2PSSA 4Y7DA 4CIBA 4WBNF 3IMFA 2WFLA 2DE0X 3VNSA 4M1MA 5CX4A 3BEOA 3IUYA 1HBJA 5ICGA 3GPCA 4NBRA 3I05A 4X44A 4P3NA 1H3EA 1USKA 4IFIA 1ZBQA 2WJWA 1SQ0A 3HN7A 2YASA 1MIOA 3EIFA 3B8EA 3F97A 1VLZA 1OJLA 1FUKA 3TG2A 4WTOA 3V4SA 1JEYA 1RAFA 2GYVA 1G63A 1KH3A 2HD4A 1TVEA 5FI5A 4JB3A 3VVBA 3SYLA 3LUHA 4BQEA 4FMPA 4E4RA 4QUAA 3H1EA 1VGRA 2GPSA 2XTMA 1TJNA 4GI2A 4D56A 3LDFA 5FLYA 3D6MA 1SVKA 4NMLA 5GTDA 5IZCC 1X7WA 2FN3A 3PR3A 2YINC 3N59A 5FOVA 4LSGA 5JQGA 3JQBC 3HU3A 2QENA 3OCWA 1N2ZA 5FWYB 5BSUA 1W2WB 2V7QA 3CCFA 1JSLA 3MMNA 3SR0A 1II8A 1PS8A 3CISA 1I7QB 4IQ8A 4KFCA 4ARIA 3O8CA 4O8CA 3SJCA 1ULZA 3R7LA 5FBLB 2PX0A 1NC3A 1PBTA 1DX4A 1Y98A 3NTXA 4Q39A 1E9AA 3S2UA 2O0LA 1ZG3A 1PJLA 1YRLA 4TOIA 5G3ZA 4DA8A 2OVBA 4WXPA 3N9IA 5A9TA 2OXTA 4DLZA 5KKCA 1LVHA 3MAGA 1R4MA 3U7EB 3E0QA 3M2PA 3RUDA 2CHGA 3ELUA 5CVDA 4KOAA 1NVXQ 3QY0A 4YB8A 1L5WA 1SB9A 5ESDA 2NVUB 4DVGA 2PWYA 2CL6X 2EFJA 2HDNB 3I0NA 3BTOA 2XWQA 1Z6GA 2I91A 1JQDA 4ZJYA 4K81B 2QY9A 2NOAA 2Q21A 5B6PA 1QIGA 1U11A 2NYUA 3EVCA 1R0KA 4LKOA 2JB9A 2VDNB 1W96A 5IT0A 4PZPA 2DLNA 4FKBA 1KO8A 4ZA2A 4C2BA 1K8YB 4A3SA 2X2PA 4EL0A 4YQZA 3T38A 2LCFA 3TD9A 2ZU0C 4PG4A 3WWYA 2VNKA 5KYVA 1YZVA 4I1IA 1GZ3A 4I55F 4G85A 2OGUA 1AMOA 1NA5A 1YI8A 3ZV3A 2V3VA 4NENA 5AK4A 4ZHQB 1DO2A 2B1IA 1XDGA 3I34X 2OHHA 1EDDA 1BHJA 3CLTD 3R20A 4B4OA 3HJCA 3RVNA 4DM3A 4R9UC 1H2RS 1OVGA 3BMNA 4PXAA 3ZDAA 3ZCRA 2BCEA 2FMXA 1PR4A 3OFNA 1OLSB 4O02B 4JJZA 5EUCA 2B8NA 4P4UA 1R27A 1W93A 5WRFA 1OI4A 5HDBB 3KQVA 5JXJA 3HVUA 1TF7A 5AUOB 4GI5A 3OX3A 2JH3A 2XDQB 3P71T 1Q6ZA 2EXXA 4XM0A 1XMSA 1P6UA 2XYPA 4OBWA 3MXOA 1ICIA 1ZDMA 3OPVA 1H1LB 5ICFA 4DDUA 3TL3A 4AJIA 7MHTA 3KKEA 4LV6A 5DI3B 4KL8S 4GLFA 4QC2A 3PF9A 4WKCA 1K5GA 4TSFD 3UA4A 4G9GA 1KIAA 4XWKA 4R4JA 1T8WA 3WRWA 4B4WA 1CQJB 1C50A 3S1AB 2FZ5A 3K35A 1QVZA 1D03A 1RIIA 3OWHA 4J1SA 4L4UA 2VEOA 3CEMA 4DSNA 4G0WA 3PQ8A 3JW8A 2R6JA 1P4JA 4LYJA 2O0JA 3AR5A 4GO1A 1DBPA 4HRAA 1C1HA 5F35A 3TJRA 2VNSA 1O0SA 4WVLA 3RPEA 3VISA 1G9TA 3PJGA 3UO8B 2AEMA 2IXDA 1Z5WA 2NPOA 2QORA 1DT5A 3L1HA 1SKYE 4JBWA 3TZBA 2VDKB 1QF7A 4CF5A 3QNWA 2P4QA 2E49A 3BMOA 5EMLA 3PK0A 3G2PA 1V6CA 3EFEA 3IUNA 3UXYA 5KJ6A 1YR7A 1MORA 3UV6A 1PNQA 3N86A 2RKWA 1JEQB 5ITZA 1BXKA 1WB9A 3FJ1A 4Q05A 4RIEA 4JR0A 4COOA 2AZTA 5L3SB 3LT2A 4Q19A 4LC9A 2BMVA 2F17A 4ZQBA 1JHRA 1NQTA 3UKDA 4QYMA 4LXUA 4JQOA 2JFYA 3PC8A 4GMGA 2O23A 3D5EA 1NN5A 3DHWC 1HPLA 2D5CA 4HOYA 4X7PA 2R1UA 1DG3A 2ZJZA 4RU1A 1KO4A 2GTPA 2QLMA 3MIIA 3NRBA 3VBCA 4YAUA 3OLQA 1B23P 1DX9A 3DZDA 3I2IA 1TUEA 5FJJA 4MRMB 4XQGA 2WSBA 2GAOA 3VNVA 2ZVQX 3H9GA 4TSRA 2W83A 4UPVA 1DP4A 2LVBA 2BFNA 1EFLA 2QNBA 4YMTA 4GWGA 5KWSA 2V7VA 4MUEA 1M6EX 4NMMA 2QT1A 2VSQA 4KXQA 1NYLA 3D2BA 2W48A 4OHFA 3HU5A 2ORWA 1VE1A 4RELA 3L1UA 4OMCA 4ALIA 3KHKA 4OAQA 3S68A 4NPHA 1Z25A 2DBRA 3IESA 3MG9A 4JJAA 4U7GA 3NUZA 3C14C 3Q40A 2G72A 4JOCA 1F3OA 1MF7A 4PCVA 4PRKA 5EJ2A 3SHFA 3QX9A 3ZGZA 1C4XA 3T9FA 1G0NA 4MX8A 1V71A 5FA8A 3I01M 2ZJ1A 4IDFA 1JHZA 2W6IA 1T6ZA 4JLJA 5FBRB 3A2NA 4XSVA 1QRRA 1RXYA 4TWRA 1L5LA 4LRQA 2VO1A 3I3SR 4I6GA 1TOAA 3AF2A 2IEGA 3GG2A 4WAUA 4DA6A 2WB2A 3JD3A 3SJZA 1U2ZA 1JTVA 5GM2A 1QTNA 4X8OA 5LIPA 4Q4LA 1TTTA 3T9BA 4KRGA 4W5OA 5I5EA 3AKCA 1M2OB 1K3FA 4JIMA 4PR0A 2CT8A 3FWNA 1JU4A 3B9RA 1PDWA 3JWIA 1W5TA 4CLOB 4HAOA 1T3GA 2J4CA 2SECE 1BQEA 5J2TF 4HNTA 5I9IA 5JNUA 2QW0X 3KEQA 4MIOA 4RF2A 3PR2B 1ZU5A 2G71A 1Z4KA 3RYFA 1WRBA 2EP8A 4YGYA 1YHZA 2FWRA 1YUNA 1A4RA 1NAHA 3BG5A 3FNHA 3BRWA 1Q7BA 3W6UA 4EHJA 3EPLA 4C7BA 1ZUWA 3PWTA 2JCYA 1E7YA 5CBPB 1EB8A 3RG2A 5AJTA 4IH4A 2GM5A 1Y3HA 4WXHA 1KO1A 3RWBA 2PSFA 4B3CA 2O5CA 3VR3A 1FYFA 4C0WA 4RJKA 2ACEA 3N8KA 2IF2A 2RH4A 2A5DA 2PWPA 3BOSA 4XLTA 4ZEWA 4KR6A 3G2OA 3EODA 821PA 3CE6A 1GRRA 2CHEA 1D6MA 1EWYA 1W88A 4RFVA 2GZ3A 2M9MA 2XA2A 5HS6A 2JHGA 4ND6A 1FRZA 2J3LA 3Q9LA 3DE6X 2Q28A 3K6RA 4U9UA 4QG3A 2PUFA 1GQRA 2G4CA 2CL7X 1XIVA 3MILA 1YUMA 2GEKA 1WP4A 3GLRA 2Q1WA 2YXNA 5K0SA 4GMHA 3CGWA 3TQTA 1RPTA 3IBTA 2OBMA 1Y7PA 1J25A 1X1SA 3V4ZA 4GDFA 1UXIA 2N1BA 4IHJA 1OXKB 1E7WA 2YZKA 5FO1A 1P5FA 4HGZA 2AG1A 3GNLA 2HUPA 2XR1A 4M9QA 3NIDB 3LBAA 2AX3A 4S3MA 1YGYA 3LVFO 1R5BA 3BVPA 4HB3A 4UEOA 3WDKA 4ACAA 1GUYA 1Y3CE 3WYAA 2PUAA 2B20A 1P1IA 3QELB 4C4TA 1J23A 5JARA 1G2IA 1YE5A 4ETIA 5JMTA 1W581 4M9RA 4R7GA 4ZWNA 3TIFA 5DIZA 4HQKA 2ZSAA 4N8DA 4TRNA 1FP4B 4UASA 3WV4A 1M5TA 4P38A 1QYDA 4B43A 2ZP1A 2B37A 3Q1LA 4KX3A 4C7OB 3K9NA 3FRIA 5AKZA 3GDFA 2OL4A 1GPYA 1Y63A 2Z3ZA 1E2JA 2GBFA 4A8JC 4E5UA 3UMYA 4ZI3A 3W8RA 3C8HA 5CH5A 1CVRA 1E1KA 4R9NA 1NUAA 1SEVA 1M33A 2DUJA 2WICA 4GRAA 5EXEA 3U7JA 3A9VA 2QE7A 3PUIA 3KPVA 2VK1A 3KD3A 4AMBA 4Q3BA 3VUFA 3ET5A 3ZW8A 1S5PA 4FBMA 4RHCA 4LWPA 3UJ3X 1PV1A 3O3MB 4AMGA 4RULA 2HZBA 1L5HA 3LPLA 2VAWA 4WOPA 4QAJA 1C0LA 1C0IA 3P94A 2J09A 4G4SP 2XTJA 4K9NA 3RTGA 4BMPB 1M7HA 4C7KA 4CM4A 1W36D 4JKOA 4DA9A 3MTAA 4D0SA 4OQLA 3U39A 4Z49A 3NCHA 4QAQA 1LGYA 3FCUB 5FJIA 3L8CA 2HPVA 5LOVF 1EI9A 5IK2A 3H87A 4EBFA 4KQMA 5A4IS 5IARA 2ZB3A 3MLAA 3AEKA 1NQ5A 3SOZA 3WXMA 2V4MA 1AGNA 3GJ7A 4QDUA 4DTIA 3HP7A 1QM5A 5BURA 3LLCA 5L4LA 4CXMA 1QIJA 3EUEA 9GPBA 4FZRA 1IZ8A 2H1HA 5LC1A 1LSOA 4CEIB 2G70A 1ZSNA 2PXAA 1X7GA 4BBJA 3WZLA 1POWA 3U9SA 2ZAYA 4HEJA 1JQJC 5CYPA 4H7IA 2PZGA 3BF7A 1YMVA 4PINA 3BB4A 4QGHA 5GOTA 5B6IA 1XAIA 3ZQJA 4CT5A 3LPDA 3T95A 4KWTA 3ZJ4A 2LE0A 1D1PA 1V1RB 2QGFA 4F5EA 2P27A 3GWGA 4CKWB 2QX7A 5B7QA 2F8SA 5B3JA 4D4KA 1PNRA 3AV3A 1UC4B 2QT0A 3EXG2 2IODA 1QLJA 2HEGA 2IIQA 3L7BA 1M6NA 2UUBB 4JAVC 5IAKA 1I7SB 2IXFA 2MTBA 3FHLA 4YT2A 4DV4B 4RSMA 1DQNA 1IM5A 1QP7A 2A35A 2LIPA 1TQ8A 1DTEA 1LPOA 2O3SA 4KQEA 2ZU6A 4CL0A 3TSZA 2RBGA 4D3XA 4YAJA 2RH5A 3BCRA 4KQ9A 2XOKA 4AI6A 1Z74A 4LJ4A 4M55A 2ZQ5A 2JLZA 2CNOA 3KPUA 4C3OB 4RY2A 3MQ4A 4AWBA 2Q3CA 1Y1SA 2J07A 3NRCA 1NBMD 4B80A 2R1TB 4BO9A 4RS3A 1RXCA 5EMMA 1QH8A 3OEEA 3VU9B 4ABYA 4ZMRA 3ZE8A 2OENG 1M5UA 1UIMA 1AZLA 2VDMB 3K5HA 1KL7A 4KFUA 5ICCA 1YI0A 4PSVA 4I5DA 5U4XA 5KDOA 3BL6A 3N0WA 7GPBA 1L4FA 3JQCA 4PLCA 3OQPA 4G67A 3TSYA 1NC1A 2I3AA 4HC4A 4XX0A 2DG2A 1WWKA 1YVUA 1Z45A 1M3SA 5HKLA 3DWGA 4C4ZA 4DREA 5I7SA 3OCYA 4RL4A 5C37A 1G8FA 2H9IA 1E18A 3GIWA 5LQMA 4XDGA 4OUDB 3ETNA 4IEIA 3PUJA 4BX9A 4CKEB 2HMTA 2J0VA 3R3VA 2H18A 2IPLA 4R8RA 5BYKA 1YQUA 2XHZA 3ESYA 3R0ZA 1Y9DA 2ZDHA 2NZUG 4FSDA 4JYBA 5JW6A 2UUAB 4J4BA 4K9QA 4HFNA 1GL3A 1Z5ZA 4NBVA 2ZBRA 4OB8A 4O4LB 3VSBA 3M6IA 4MQFB 4D9CA 3SVTA 2FPGA 2VPZA 1ZRNA 4URHA 3BGIA 3VVMA 4MRNA 4ZVVA 4BO2A 2JHAA 4HDOB 1U0FA 1C3VA 4Z7OB 1EUYA 4U5QA 6CHYA 3H2GA 4ARZB 1BE1A 4TTJA 1X1BA 3Q3VA 3WMRA 4JJFA 1JKMA 4EGFA 1IG3A 2HSDA 2AXNA 4MWGA 2XKJE 2I4LA 2C92A 2Q46A 1KQNA 4ZOLA 3PFNA 4JCCA 3FDZA 3GJSA 4HGOA 1Z4IA 2TMKA 1GPAA 5LBIA 3QBTA 3BX1A 2BLNA 5EKTA 4FYHA 5FPSA 3FCCA 5ILQA 5A05A 4DRXA 2D0DA 2FR8A 4N5IX 4RIIA 2UYQA 4UMFA 5K8LA 2XMPA 4RAOA 5EG5A 2QF7A 4PQFA 4PYJA 5JSZB 4OQFA 4JYCA 3EVZA 3O4GA 4RPLA 5FI1B 3QEKA 2MINA 1NFQA 1WDKA 3CVOA 3D6NB 3ZZMA 1H2AS 3BMOB 3LK7A 4E5KA 4PC3A 4TWZA 5DIFA 1XTIA 3SF8A 4NIMA 5F73A 4JB0A 1ZFNA 1UJBA 3MCTA 5BR8B 1XR3A 1LPBB 2AOTB 3IUQA 4JLWA 4B0PA 2OXFA 1Z38A 2YCBA 3FRHA 3V7NA 2CBZA 4DJEC 4DL9A 2BGNA 1KERA 3OC6A 2R8YA 1G5FA 4LOKA 5IK2D 3O2NA 1RWOA 4BMOB 2XCOA 1EWQA 4ZCPA 2IHVA 2W2QA 4LDJA 1WOMA 4EPYA 1XDWA 4L8VA 2Y77A 1WJGA 1ZOPA 1EG2A 4BBZA 5B64A 2XE6A 1NUQA 3BIXA 2XRYA 3L4JA 2IOHA 1GOTA 1XU4A 4N0PA 4WOBA 4CG3A 4INPA 3QP9A 3GGGA 4KGXA 5F2EA 1T29A 1KI3A 4OMFG 4BNUA 5IFLA 1EDOA 2Q5JA 1JYFA 3VH4A 4ER7A 3RCBA 3F7TA 2OFXA 3CZMA 4RV9A 4S1WA 3R3UA 5J9FA 3GH3A 4CKBA 3KLMX 2PJDA 3RJ9A 1T0HB 4MR7A 1BU8A 5AICA 2HIAA 3KSUA 3TLGB 3ZI4A 4ZVMA 3E9DA 3MUFA 4DTCA 2O5EA 2XGJA 2C29D 4H1WA 1RVDA 2XOKD 3B52X 3N05A 3QVVA 4KU4A 4UVEA 1YT5A 1FNDA 1R6AA 1Z2EA 2ADFA 2FW6A 1RCFA 2IK8A 1U9JA 4P31A 3FF1A 5K3FA 2PG3A 3WRVA 3H7IA 3SC4A 3LQKA 2R4QA 3B6EA 1THTA 4IIGA 2H17A 2C7RA 4FCCA 3GGOA 4QPZA 4QVKA 4Q1CA 5DHAA 1MMFB 3F90A 3KKZA 1UKVY 4X54A 4G8JA 2EW2A 4E14A 2QTBA 3B82A 3D8SA 3KS9A 3T7TA 1BCSB 3K09A 5AKKA 2GJAA 2X5XA 1XJWA 3RFUA 1M34B 3EXG1 4HYQA 4ZAZA 1S1MA 3TXYA 3W5HA 2XVZA 2V7EA 3RS9A 3ESAA 1KI8A 4AZ3B 2PL9A 4Z4IA 1E8NA 2YXLA 3VR1A 2DHRA 1D3AA 5DBIA 3NCTA 2V96A 2XJ4A 2B8TA 5GJBA 1RQPA 5A3SA 4ZI7A 4LFBB 4XD7D 5BW6B 3ZZUA 4F6RA 1WBJB 3LFUA 3BJMA 1CS0B 1UFRA 2PFKA 3DV9A 3U2QA 1B73A 3UUEA 4BFUA 4BV8A 1RDFA 1J5PA 5K3SA 1PGQA 3LUJA 2YY6A 4HAZA 1ECFA 1JDTA 3I12A 2DFKB 3BJEA 2OP1A 4C7VA 4GVLA 1WQ1R 4YUVA 3B70A 4EMBA 2Z2XA 4E21A 1HF3A 3EXEA 2WLTA 5FBKA 3TRJA 3OQBA 5C7OO 4J16A 4IDEA 1S4MA 4KK4A 3D4LA 4LXQA 2EWMA 4YDHB 3UUGA 4XRRA 5EJ6A 3NM6B 2BSQA 3PNQA 1GPKA 1OZAA 3IEUA 3HB9A 4O4JF 3WBFA 3P5BA 3NV9A 4KIWA 3HUEA 5F1PA 2V0GA 3HB0A 1U1IA 1QJ4A 3UJ8A 4G0VA 1SC4A 2Y1WA 5LXTF 1RYBA 3BFVA 2DUMA 4UATA 1XQWA 1W49A 1T36A 1YRQA 1WLSA 1JKXA 5E2BA 4B46A 1K9SA 4FQ8A 5A6SA 1JIIA 5DHQA 5BR1A 1YJXA 2I80A 1E4OA 4K2HA 4UUAA 1PT9A 3GN2A 4J43A 4IDDA 3VPGA 1T3LA 1IWPB 3PFGA 3V1NA 2CKDA 4ENTA 1GTRA 4LZOA 3TBKA 2QTVA 4FZ3A 5K05A 2Q2QA 1T24A 1YH3A 2OCXA 2R1VB 3MS7A 4MUHA 3ZWXA 3NEJA 3UJ7A 2D0IA 2D8MA 4RV4A 3IL2A 2XGGA 1Q0ZA 3SKVA 2WKPA 2PBZA 1U8XX 2IIPA 1J9EA 1ADGA 2G0TA 3HKEB 4TXJA 2Z8XA 3D7KA 1NP3A 3FYTA 2DVMA 3GRUA 3T5TA 4CFSA 4CEHB 4NFSA 1M8GA 1DJLA 1CUGA 2YNMD 4GQAA 1EFPB 5HRAA 3SR3A 4HN4B 1FSSA 2VJLA 3Q8KA 3AUUA 4KQ2A 3X0DA 1A69A 3DE0X 3SPXA 5KINB 4O1IA 1MJNA 4HPJB 2FPPB 3ZR4B 3B51X 1WBDA 1KK2A 2YIMA 2BVNA 3FMFA 4Y1FA 2ZR7A 2BHRA 4MYSA 3AY7A 3WNQA 3IV6A 2Q6VA 5ESWA 2QN9A 3IDQA 1JVBA 3DTYA 3Q11A 5GADl 5U1PA 4BNFA 3JQ8B 2G17A 5IKPA 1WSBA 1N2HA 4ER5A 3IHWA 4X6UA 2YMPA 3I9FA 4TVSA 3QA3E 3BMQA 4DR2B 2OD2A 5K3FB 4RTOA 2WJ3A 2ASEA 4Q3NA 4RTLA 1AK1A 2JBAA 2Q6IA 3JASA 3BMXA 4XB1A 2XV1A 4LZPA 1KO7A 1QQTA 1XPJA 3VUEA 3FWZA 1DKOA 3H2SA 3QKRB 1FQJA 2NT3A 2ZTLA 5F9FA 2JVKA 1HLGA 3KDAA 4KKXB 5IAAA 3IV9A 3NHRA 1KVRA 3A9RA 5ES3A 5C1OA 1R4ZA 2Q2NA 3GNTA 1MVLA 1OTXA 3GZ4A 5MF6A 4DSUA 1XC7A 2XY4A 4AY4A 1BFDA 3PXCX 4B7XA 3F67A 1L5FA 5AK6A 1GRQA 3AG5A 4I1YA 1QX3A 2G06A 1PP4A 1YDGA 1KMQA 4A8HA 3SSMA 1EVJA 3EVEA 3PKZA 5JNLA 4JBLA 5KAMA 2O2IA 1ZJ5A 1EFTA 4ZIRB 4W5HA 4KHPB 4R1PA 5F4ZA 1IOLA 5GZ3A 1LLDA 1GNTA 1XAJA 1AUPA 2IDKA 1HG0A 1BS2A 4G4JA 4K05A 5EUQB 1OA1A 4AULA 3TW4A 5EHIA 5ALFA 4RSHA 4PF1A 2ZRHA 1NXVA 3LLMA 3LX4A 1QIEA 4XD7A 2EWWA 3M9XA 3GT7A 4LE0A 4ZQHA 3U7IA 3L5OA 2FQYA 2IZ5A 2JFHA 2JGDA 3G1WA 4ILEA 4HXGA 4Q3AA 3TBFA 1G38A 4BVAA 4ZVNA 1UJCA 5DEOA 1FVHA 3NUGA 1QORA 4NQZA 4G9BA 3RVQA 3BICA 1RPZA 5EUMA 3A7EA 1JWBB 2FPPA 4K9RA 4UARA 2XT9A 4DMUB 5KOJB 2E1PA 4Z9YA 1BA3A 1T4BA 1VLQA 2OV4A 2AK2A 2YXDA 3CLTC 2QRKA 1N6OA 1P2TA 3NLLA 4JP3A 4EENA 4DZZA 4EPXA 1MZPA 2O3JA 3WGKA 1X0VA 4BZZA 3ZVKA 4W5RA 5CLLA 3ISTA 1VL0A 1XWWA 1X15A 3NW9A 4UBNA 5NLLA 4HO1X 3TCXB 2IY8A 1YQXA 4HS9A 4W8OA 2DULA 3F74A 1J4AA 4TN5A 3J81k 2X40A 4UREA 3PJRA 3KR0A 3C3EA 1DXOA 1M2OA 1GTSA 4OHPA 2XADA 2BTOA 3V4PB 3BSFA 1M6YA 2CNWA 2KYRA 4PHHA 1P1FA 4U3JA 4E0BA 1GU0A 1NURA 3EUAA 4DLRA 3GLGA 4F8EA 3GJXC 3QEMA 3LA8A 1RKVA 3G88A 4Y6OA 4EY4A 1GGJA 4C6TA 2YW9A 3SICE 1ZCJA 3MGAA 4HSEA 4JYPA 4AUMA 2HMVA 1KYQA 4F2DA 3S29A 1UMBA 4A0GA 3UENA 3I76A 4P32A 6REQB 2BGUA 3KKNA 3SQXA 1E3LA 2JHFA 2BF7A 4LRSB 1QUFA 2H7XA 1YCDA 1R12A 4EW1A 1NJ2A 1IBCA 3MFQA 3WWCA 2JVJA 4MUYA 2YY7A 4CN9A 4TKUA 5K0NA 2H8GA 2YNMA 3KAPA 3AUAA 5I7RA 4C2AA 2FWIA 4RIGA 3NOVA 1KXZA 1RKBA 1F0KA 3P1JA 3JVEA 2X1LA 5FEUA 1B6RA 1P1KA 2WD7A 4YHBA 3OCZA 5GZ1A 1B6SA 1NZDA 4FJ1A 1PWEA 4PNPA 3CVJA 1RRVA 4RJLA 2H2FA 3QVOA 4AS2A 3QITA 1CXZA 3VAYA 3NIFB 5TS3A 3ZS9A 1O89A 2W7TA 1WUHS 4KH1A 3L3BA 3QG1A 4D9GA 5HRCA 2LDBA 1HWYA 5JASA 3P4UA 1FYXA 2QEQA 3DV0B 3Q7IA 1Y5RA 4NJMA 3W8EA 3HCOA 4X1YA 2DWCA 2VP3A 1Z0FA 3DL0A 1JIKA 4PZYA 3TMAA 4CE6A 3VPDA 2C2YA 2G7ZA 3W4JA 3T35A 4QUIA 3WOVA 4JBIA 3LBIA 2XIJA 1U2EA 2KWIA 3DM9B 3H75A 2O1WA 2QPOA 1F2VA 4ENVA 2QB5A 4UBKA 3TN7A 4NF2A 1G42A 3VNBA 4DCJA 5ITVA 3G9QA 5J1SB 2OKCA 2EC5A 3UHOA 3L4BA 2CNKA 4MARA 3IALA 1S2DA 3PQEA 4HWGA 3ACBA 3WWZA 1SU7A 1JG4A 1OYOA 2W22A 1L7EA 4HWPA 1GPBA 1QR2A 3NX4A 4J76A 3DD1A 3LOPA 5EEGA 3FPAA 1K68A 5BN5B 5FR1A 3VZDA 2PZFA 2OHJA 4GZ6A 4WZBB 4OJTA 3VSAA 2F4NA 3V32A 2FWPA 3D3WB 4N6NA 3WIUA 5LD2C 3IAS1 5ER6A 3FGZA 3GRCA 5CAEB 1E6LA 4ZV9A 2RB4A 1HSZA 2CFOA 4C7JA 3R7WA 4YAIA 1QDLB 2QBYB 5JD5A 5HCIA 3H13A 3ZUGA 2HLPA 4R84A 3PF8A 2HLDD 1IEQA 4N65A 2BC9A 4NU8X 5I9BA 3AFOA 3THRA 1JNYA 4F12A 3GUCA 1SB8A 1FFXA 1XKQA 1Q0QA 3EQ9A 4W7IA 3DB2A 1DB3A 1TU4A 1HH4A 3N2ZB 4AUEA 3N2IA 2GRUA 2Z4SA 4J0EA 2VJBA 4HRVA 3L8GA 1Z7EA 4UUPA 4RORA 1CW2B 1ESDA 4OP1A 5JNRA 2ZIEA 4OJYA 4OK3A 3UZUA 3WKAA 3Q6IA 4G97A 3ZNPA 3IB3A 3R0VA 3UFBA 5LA6A 3ETEA 2ID7A 3V8NA 3HY3A 1NI4B 5LIRA 3VKGA 4J2OA 4OYYA 1W46A 5ELLA 2Q3BA 2DERA 1O4WA 3A1CA 5CG1A 3MXTA 4EL5A 4QSMA 3IEXA 1OV4A 3WIVA 1LPSA 4OHWA 2OA0A 4WKBA 1U7XA 2AFHB 2W8BB 521PA 4ZZIA 2PH1A 2MIIA 3EBPA 4X90A 5J23A 3KJQA 4DQUA 3G9TA 4FP9A 2RHHA 2Z5VA 3L9WA 3LXRA 2IS2A 4LSMA 3UOWA 5MN4A 4DBLE 1IBMB 4MQBA 1W0KD 3O2QB 3RK4A 5AVTA 3WGTA 5KC9A 2VPIA 2BGMA 2HA3A 3QPBA 4ZJUA 4A27A 1JILA 4LYHA 1DDIA 1SN7A 5JWHA 4NCBA 1ECBA 3FMOB 3HKBA 1OT3A 1AGYA 2F64A 4PICA 2YJZA 5BSRA 2ROQA 3IP9A 1Z0ZA 4D4JA 3QUAA 3WGLA 5TSDA 3EZ7A 3NIBA 2NO4A 3MCUA 2QDKA 2N1MA 1VSTA 1VZ2A 3C15C 3CZ5A 1DRKA 4GM1A 4EMUA 2QAGC 2ZRAA 3WHIA 1KQFA 4OQYA 3ZUPA 2NADA 1LBQA 1XVTA 3GLHA 3B7PA 3P2KA 5BWBA 2JGKA 3HKDA 2FZLA 4PPGA 4TKLA 5EP3A 5AIBA 1RZUA 2A86A 2HQBA 3GDOA 4O4IF 3GEBA 1TO1E 3AJAA 3P9ZA 1R6TA 1ZO8A 2IYLD 4L5AA 3PI6A 4NX2A 4PYOA 3WRYC 2IF0A 1EVYA 2VKTA 1I4WA 4ND1A 4F56A 4ID3A 3KKKA 3DMTA 2CXRA 4J1TC 3TTVA 5J2TB 3DJYA 3H11B 2OKGA 4ANFA 2IZ0A 3AHEA 3TINA 5MFZA 4GFDA 3VPSA 2BFMA 3NNNA 2EZ8A 4Q9AA 3BRQA 3NHJA 4DLSA 3DLTA 1ODKA 3YASA 1GZ5A 1WUIS 1WPQA 1SXJE 1GNSA 2CF6A 2I1LA 1O6GA 4KRYA 3T5GA 4Y2VA 1H8EA 2HBRA 4C1BA 2I22A 1A4XA 5DCLA 3CN7A 3EGCA 2PUBA 4LOAA 2QPAA 2TECE 1T5BA 3I04M 4F97A 4OSPA 3U80A 3FYUC 2C04A 4H7PA 3AKEA 1WDMA 1LA2A 4F3RA 3I28A 3KYBA 3B2EA 1E6KA 4J6FA 1X7XA 3PGXA 4YRTA 5AK3A 3Q7RA 5AW3A 5DGTA 4Z8YA 1SVSA 5EJGA 5JSYA 5HIAA 3MJDA 4A91A 1IOVA 1OGIA 5EC8A 1PF7E 2AQ8A 4FGJA 1U8EA 3OM1A 5EP2A 4GPZA 5G02A 1J00A 3EDOA 1FRQA