1Y1PA

X-ray structure of aldehyde reductase with nadph
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldehyde reductase II
publication title X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
pubmed doi rcsb
source organism Sporidiobolus salmonicolor
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y1pA01
1H6AA 3BYZA 3ZU2A 4I9UA 4J4HA 2J5KA 3D64A 4OOEA 5JBIA 1RKXA 1CEQA 5FWNA 1LRJA 4PZDA 5ENVA 4FFRA 1GV1A 1O8CA 2H63A 3PJEA 2PGDA 3E5MA 4A73A 1H6BA 2LDXA 1E6EA 1BXKA 1LU9A 2OBNA 3INTA 3I9MA 3ZN2A 3FI9A 4QFCA 4WCFA 3FWNA 2ZJ1A 2VHXA 2P9EA 1BDMA 1L7DA 3WX0A 3RQSA 1HEUA 3VHRA 2AXQA 3F1LA 1IY8A 5TIIA 4AJ4A 1JA9A 3HFGA 5COQA 4XDYA 4FW8A 1I33A 3GK3A 4NG5A 5K6AC 4FR5A 2A35A 4CJXA 5G0TA 1WPQA 1ZEMA 5AOVA 3F4LA 1SPXA 3IJRA 1U3VA 3WGQA 4RCVA 2P91A 1LC0A 4YACA 4LSMA 5KNLA 2VQ3A 3TZCA 4BB5A 4GWGA 4KQXA 4I5GA 3UVEA 1I3MA 5ILGA 4WOKA 1XU7A 4NQZA 4QO7A 2GZ3A 4EEXA 4J1TA 3SVTA 4E21A 4D3SA 4OJNA 3N7UA 1A7AA 3RUAA 2RHRA 1M76A 2YFQA 1Y5MA 2X9GA 4LW8A 4B4VA 5KJCA 3FR7A 2D5CA 1KVQA 1UXKA 2VOEA 3EVTA 1GD1O 1KVRA 3QWFA 3VKUA 3IJPA 3W1VA 2XXBA 3G1UA 4I08A 2DFVA 4PGFA 2HK8A 4O6VA 4NI5A 3F4BA 4RQUA 3WNQA 1TXGA 2GN9A 1DRWA 1XHLA 1DHRA 1QSGA 2J8ZA 4YJFB 1DIBA 5GZ6A 3PLNA 4YJGB 4DIOA 2X5KO 4FN4A 4RL6A 5JO9A 2Q49A 3GVHA 1XA0A 3QWHA 4RV9A 2G17A 3RBZA 1A27A 4TRNA 1B26A 1VSUA 1PR9A 2IZ0A 4FCCA 3JYQA 3H9QA 1LRKA 1P1FA 5EJ2A 1S6YA 3S1LA 1GQQA 2Z5LA 1EZ4A 2G76A 4GX0A 4E30A 5JYDA 1ISGA 3ONDA 1R15A 1C1DB 3MWEB 3FNGA 4GLLA 3FBGA 5TRTA 4Y98A 1HSZA 3DOCA 1U7HA 4JBHA 4GMGA 2E49A 4CMIB 5T5QA 1DFIA 2DVMA 4Y9DA 3DBLB 4YQYA 1KEPA 2Q1TA 3ENKA 1E7WA 3RCBA 3VOSA 2NVWA 5U1PA 4AFNA 1GPJA 4MINA 4DUPA 5A03A 4BNUA 4I9NA 4NDNE 2O3QA 3D3WA 3BAZA 4DWVA 2HAEA 3QVOA 4XYGA 4E2ZA 3AU8A 3JQ7A 4MP3A 4IS2A 4NFSA 5AQ1A 3CMCO 4CMEA 2Y0CA 3U3XA 4CR7A 1JAYA 3D4NA 3H5AA 4RO0A 3DQPA 4EUFA 3ITKA 3R3SA 5BSEA 3GFBA 1HZZA 1DAPA 5B1YA 1MA0A 4FOOA 4E5YA 2P68A 5MGBA 3BMNB 3MTGA 1LDEA 2QRLA 2DC1A 3LT1A 4LRTB 2VUSA 3ROMA 1PGJA 1AGNA 4N18A 4R5MA 4D46A 2BI8A 3BMNA 3GUYA 4BGEA 4AVYA 2Z1NA 5CPBA 3ZV4A 4BKUA 5HS4A 3WGHA 1E3EA 2PK3A 1JKIA 5IN5A 4K6FA 2A9FA 2Y1DA 4BNLA 3S8MA 3JQ6A 5JAQA 3SC6A 4FQ8A 1U8FO 3JQGB 4DREA 5KCZA 3NT4A 1IZ0A 1E7QA 1WDMA 1MG5A 3C8MA 2FOIA 2WJPA 3JQGA 1PS9A 4PN3A 1DC4A 4J3FA 1NX6A 4W6ZA 4W99A 4D0RA 3M2PA 4TKMA 3BTOA 4BNFA 3D7LA 4WEQA 4CM4A 3WIDA 3IQDB 1ENZA 5DT9A 3WTBA 3ZV3A 2OORA 3EGOA 2EW2A 2OOSA 4CUJA 3NTQA 4B7CA 5JY6A 2VRCD 3Q6IA 5T8KA 2YZ7A 4AJLA 4DBZA 1PJ4A 1XR3A 4HNHA 3JV7A 4U7WA 4Y8VA 4B3IA 4IINA 3KV3O 4CM1A 2VTEA 1U3WA 2GN8A 3WMXA 1NASA 4TSKA 5JPIA 3S2GA 4BKPA 4R1UA 3X2FA 3ZWYA 3LC1O 1SEPA 4WLNA 1EVZA 4YAEA 1EFLA 1QV6A 3TPCA 4JGBA 2BFMA 4PLZA 1NVMB 1KIFA 2WD7A 5DOVA 3OQ1A 2UDPA 3BTSA 3JQBC 1PQWA 3PYLA 4MVJM 3AUSA 1E77A 2R2GA 2WDZA 3RUEA 4GSKA 4M54A 1FF9A 5DCYA 2JJYA 3GAFA 2B5WA 3GDGA 5JY1A 3SLKA 1BG6A 2I76A 4QO8A 4Z9YA 4YT5A 5KVSA 2F1KA 3VDRA 3JQAA 1X7GA 2CVOA 5MDHA 4TRJA 2NU6A 1ULUA 2J3HA 1BSVA 2D5AA 2ET6A 2Q99A 3EC7A 5A5FA 3L4BA 5IDYA 3WSWA 2HK7A 4E6PA 1GUFA 4L73A 1IOLA 1PZEA 1MLDA 1YKFA 1GR0A 1YXMA 4UUNA 1YVEI 2DUWA 1N8KA 1JKFA 5C7IO 2VZ0A 2Q4EA 4FFNA 4J1QA 4J1NA 4GLOA 4EDFA 5IZCC 5LDHA 3PGXA 4WLUA 4XYBA 5JLAA 1N9GB 5DCWA 1UZNA 1BXZA 3INGA 1ENPA 5IDQA 4BS9A 3VZPA 4HWKA 5G0WA 3EMKA 4BNNA 1U3TA 3NGXA 4MJLA 1AE1A 3B6ZA 3TOZA 3P2YA 3E9MA 3KSUA 4XYMA 5G0UA 1OC4A 4BNHA 2G82A 3L6DA 1LSUA 1B3BA 1FK8A 4J4BA 4WOJA 2UUOA 1E92A 4ID9A 4DA9A 5LC1A 2O50A 2C20A 2YHIB 1SO8A 2HUNA 1B3RA 3ONEA 4NFHA 1SEVA 4NNJA 2YHIA 1OAAA 1EQ2A 2B4QA 1HRDA 3JYNA 4MOWA 4HFMA 4YQZA 2OXIA 1PGQA 3ROQA 4DRYA 3EHEA 3IUSA 3RU7A 2BFOA 2BGLA 5DZSA 4EUHA 3PEFA 3I9LA 4A26A 3JQDA 3ICPA 3VDQA 4AICA 3O03A 2OZPA 3KLMX 1T4BA 2V6MA 2FMUA 4JNKA 4NU6A 4WECA 1LDMA 1A72A 5ICSA 1UAGA 1LSJA 2AMFA 2X58A 1C0IA 5THQA 4CQLB 3MOGA 2QZZA 1VKOA 1H5QA 3Q3CA 3VPGA 1WMAA 5JNLA 1A71A 1J5PA 1NPYA 1KC3A 1XYGA 1M2WA 1RM0A 1XDWA 2CF6A 3WYCA 4J49A 4ZICA 1PGPA 3VVBA 1KERA 4KOAA 4PZEA 5EMHA 3ASUA 3QWIA 2Y93A 1U4SA 3SBOA 3TDKA 4Z9FA 1NVTA 2BF7A 4RF2A 1A4IA 3UN1A 1JW9B 2W4QA 4U5QA 3JQ8B 4IMPA 4OHUA 4PG4A 2H6EA 2HMTA 2BRUA 2J3JA 3H2SA 3JQ8A 4A27A 1YL6A 1D3AA 2PR2A 2G0TA 1XU9A 1XEAA 3H6KA 4HKTA 4MKXA 1N5DA 3NJ8A 4NBRA 4TZTA 4IMRA 3JYLA 2IDZA 3MJTA 1SB9A 1TI7A 5F1KA 3H9JA 2Q4BA 2X7HA 3GEMA 3DMTA 3DZFA 1LC3A 3WJAA 3FBTA 3RSHA 3ANMA 4FJ1A 3M6IA 3M1LA 3QVWA 2JD2A 1G0OA 2WYUA 4W4TA 2GGSA 4I5EA 2ZYGA 3GVCA 1PL6A 4PRKA 4DC1A 4M55A 1GTMA 3NYWA 4F3YA 1B8UA 3RFXA 2WTBA 3UF0A 5CPFA 4R54A 1GZ3A 2C82A 3MOIA 3N58A 2CUKA 1PJTA 3BHMA 3KVOA 1T25A 2D2IA 1GUZA 4BO7A 4FC6A 3LC7O 2JCVA 5ENDA 3JD3A 4I1IA 3NX4A 1WLYA 3KHUA 4KTTE 2HRBA 5G0VA 3RBXA 1GYQA 2WMDA 4R68A 3W8FA 1Y5RA 1C0KA 3COSA 1UR5A 3ZDFA 1IUKA 1Y8RA 4LGVA 3UFXA 5C3MA 4S1VA 3D0OA 2HCTA 4YRAA 2YV1A 1XQ6A 2B4TO 5I7VA 5KIAA 2AQIA 5KVCA 4ZRNA 1IHYA 1P1RA 4HFJA 4L4RA 2BGMA 4FFMA 5A04A 3UAGA 3TL2A 2VOJA 4OKNA 3GGGA 1YJ8A 3BHJA 3GNSA 5JDCC 2C0CA 1HLPA 5U4QA 5JDIA 1HSOA 3L6EA 4R1NA 2BI7A 3LYLA 3L9XA 4YT4A 4G81A 1YDEA 2P9CA 2VZ9A 3QVTA 4BQRA 4IXWA 3UCEA 4KTVE 1FJHA 2PKRA 3FNEA 5G2OA 3QQPA 1PJ3A 1YOVA 4N7RA 4BV8A 2OUIA 2AEFA 2D8AA 1RWBA 4L0QA 4WLFA 2VWHA 3AK4A 3DAPA 3DBHB 3GZNB 3WGIA 4YBZA 4RDHA 4PG8A 2J6IA 4RGBA 4JBIA 2HMUA 2QIOA 4IUYA 1HT0A 3TQHA 1VM6A 3QVSA 4WK6A 4JBGA 1A4UA 3UHAA 4W9NA 4QSMA 2JKVA 4F6LA 4XD2A 4QUKA 4R41A 4CMAA 1UDAA 2D59A 3AUAA 3B70A 5DP1A 3ONFA 2XAAA 3PP8A 3K2BA 2C5AA 5CAEA 1BMDA 4E31A 1CQIA 2BKAA 4TMFA 4ZVVA 3JCZA 4FOSA 2JL1A 4L4XA 4Z3KA 2PZLA 3ADPA 1VI2A 3FPCA 4ZJUA 3NEPX 1TT5B 4ALNA 1Y8QA 2EEZA 4CLOA 3G1TA 3P7MA 1ISHA 1PSDA 2CDBA 3NDJA 4J4TA 4XIYA 4KWIA 2OP0A 1U8XX 1WWKA 2RHCA 1XLTA 3G79A 4GGOA 3WGZA 1J0XO 3K2EA 2O4CA 4BO6A 1PWZA 3IP1A 2HRZA 1QP8A 3ULKA 3HUDA 3LT2A 5DBIA 3VZSA 1ZH8A 5GMOA 3LF2A 2IYPA 4ZD6A 4U0KA 4OSOA 2NADA 4E33A 4B4OA 3PI7A 2Q50A 4MKRA 3U0BA 5JC1A 1MFZA 2GR9A 1GU7A 2HO5A 2FR1A 4CLRB 4OMUA 2CZCA 4EJ6A 2P5YA 3C7AA 3KUXA 8ADHA 3WXBA 4KUEA 4CLRA 3G3EA 3L4SO 3JQAD 2QQ5A 5G4KB 4D3FA 1I30A 4XGNA 3RFVA 1WZEA 2OHXA 1UAYA 2DBZA 1UZMA 4GGPA 4IJVA 1AHIA 3VZRA 3RC9A 1D1TA 2CDAA 2TMDA 4CMKA 3QP9A 2PGJA 4XR9A 3CMMA 1FXSA 4CLEA 5HRUA 1PX0A 1FDVA 4IDAA 1TVEA 4PLYA 3V2UA 1L1FA 1Q0QA 4XQGA 1H2HA 2IE0A 2OO5A 3KYDB 4E5PA 4PRLA 2PLAA 3W4IA 3ZWBA 4BNYA 3DBVO 3KYDA 1U3UA 3GPDG 1R37A 2HMWA 1PL8A 2BFAA 1YH3A 4YPOA 1U28A 4YDRA 4RVHA 5C37A 3RROA 2V7PA 4Z6KA 3I83A 1OFGA 3Q11A 3I5MA 1P1IA 4MVJP 2EHDA 1YB5A 3VH3A 2O7QA 1DC6A 4EZBA 1YBVA 3DFZA 2Y1OA 1FDSA 1O89A 4WPGA 1PR3A 5IJZA 3F47A 1T2CA 2QX7A 5CEFA 2ZTUA 1PGOA 3GT0A 4XEHA 4UVHA 1Q1NA 1NPDA 1PJLA 1BRMA 4E5NA 5HWSA 1MP0A 3DBRB 5BSFA 2DBQA 1AUPA 4UEKA 3HJAA 1KY5A 2PV7A 1WMBA 2WEKA 4BKRA 1EUZA 1PEDA 1PZGA 2WSBA 4FSHA 2O2YA 3RFTA 3EVNA 4RLHA 4BO9A 2O48X 1ZJZA 3CEAA 3RJ5A 1JU9A 5DP2A 3ZHBA 2VRCA 4DMMA 2O3UA 3TZQA 4BGIA 2NU9A 4YAJA 4AJPA 1HDOA 1JVSA 4M1QA 1CRWG 4B4WA 1R0SA 3AUUA 1NP3A 4GWKA 1RM4A 4WGGA 2JD0A 3GF4A 1GQYA 2CF5A 4CM8B 5ICMA 4QEDA 1KC1A 1P44A 4GPD1 5I8ZA 3ZCXA 3KETA 3NV9A 3SEFA 1F06A 4BNIA 4YJHB 2ZB4A 1F17A 4P4NA 1ENOA 3SX2A 2WM3A 4JXKA 2QG4A 1WNTA 4U6SA 3VTZA 1DIGA 4YJHA 3WQQA 1Q7BA 1R12A 3R0IA 5I9LA 4KZPA 4C4OA 3DXFA 1LSOA 1ZNQO 2FR0A 4MVJF 1ID1A 1ONOA 2P9GA 4IIUA 3QWAA 4NFYA 1IHXA 1IB6A 1XELA 2FZEA 1ZJYA 2WYWA 1PZFA 1I3NA 2IXAA 2OL4A 4N5MA 4HUJA 4NBWA 2Q1UA 2VYVD 5HS6A 2VHZA 3U4IA 1YBMA 3ABIA 1N1EA 4IM7A 3OJLA 3U4CA 3MJVA 3NDRA 1F0YA 4PVDA 2UVDA 4RPLA 3AW9A 3D5QA 2Q2WA 1Y9AA 1A9YA 3AOEA 3B1FA 3EY4A 4OXKA 1DFGA 2BELA 3C7DB 5JAZA 1J4AA 3I9JA 1H9BA 2O3RA 4WNIA 3PYXA 1Q0HA 4IDCA 2FPGA 4C7JA 1Z7EA 2OGUA 4U0JA 3RKUA 4KDEA 3TRIA 3W6ZA 4XX0A 3ZHZA 2Q2QA 3VPXA 4CV0A 2ZKLA 3NJ4A 5JAMA 1ZK2A 3ZNQA 1OBFO 5CFZA 3RJ9A 9LDBA 1FDWA 4B8WA 4DIFA 3GN2A 4HNGA 1LA2A 2DT5A 5EESA 1P74A 3K96A 1RM3A 3DR3A 4R51A 1C1XB 1U2GA 1EK6A 2QZ9A 4HFRA 4GAEA 1C1XA 3ZWOA 1ADFA 3QWBA 5K6AA 2Y66A 3K5PA 1K2WA 4FS3A 4BNWA 4XA8A 4CL8A 1ML3A 4WCFB 1DHTA 1H6DA 4MPDA 4UVGA 5CEEA 5L7TA 4E4YA 1L7EA 2OMEA 2W2KA 1GUYA 1M6WA 2FR8A 4I8XA 2Q1WA 3GEGA 5GY7A 1T2EA 4CMBA 4IZHA 1YL7A 3CUKA 5BSGA 1YO6A 2VZ8A 1UDCA 2NQTA 4A7PA 5KJ1A 2PH3A 4DLLA 2PZKA 1BDBA 4LRSB 5THKA 2GO1A 2UYYA 3PJGA 1RJWA 1P0CA 3E8XA 1E0DA 3P2OA 3ASVA 2WE8A 4RVFA 5DF1A 1U1IA 3VPHA 4ZQGA 2RIRA 5K0ZA 4BV9A 1I5RA 3NKLA 2NTJA 4AJEA 3OSUA 4GX5A 4JK3A 3B1JA 4O5OA 5DDIP 4DYVA 4WUVA 1UUFA 4YWJA 4LMPA 2DAPA 3KXDA 4WCDA 3EZYA 5TC4A 2A92A 2BGKA 3DOOA 4A03A 2QW8A 1RM5A 4Q3CA 1W6UA 2DTEA 4KMSA 4RVUA 1PGNA 2CVZA 3DMYA 4Q3BA 5FEUA 2PNFA 4P4LA 3RC7A 3SC4A 4MKZA 4IJUA 4EYEA 3WSVA 5F1PA 1HLDA 4Y67A 1O95A 2AEMA 2XXJA 3PXXA 4DLBA 2JFFA 3RVDA 4RVDA 3RASA 4F46A 1AXGA 3K30A 4UREA 4J9VA 4X54A 3GMSA 2I66A 1IPFA 3IC5A 3OIGA 3DHNA 3TZ6A 4J6FA 2VRBA 3KRTA 3LT0A 3WIEA 2O7SA 1WP4A 3PWKA 2HKIA 3RUDA 1DBVO 1HTBA 3OJ0A 2OFPA 3TWOA 4PG7A 4DPLA 1W73A 5I7EA 1KVUA 1CQJA 4G2NA 4CV1A 2YY7A 3D3WB 2W2LA 3RBVA 1E3IA 2PFGA 3RUCA 5KJEA 3I6QA 2CNBA 3HB4X 2J5QA 3PHLA 3JQ7B 2EG9A 3GDOA 1DIHA 4M49A 3PWZA 3DAGA 1Y9EA 4MVJG 4J91A 1D1SA 4D7AA 3BMCA 1N2SA 2YQ4A 4J2OA 1VL8A 1H94A 3Q1LA 4UEJA 3RUIA 2RH4A 2O2SA 4ZN6A 1QG6A 4PLTA 5IDXA 3PHHA 3K73O 4Y6SA 2FP4A 2GERA 2XOXA 3WFJA 3GPIA 3TZHA 1PQUA 1Y81A 4YEDA 3TN7A 3JYPA 3D1LA 4RQTA 4WEOA 2EP7A 3HDQA 3H7AA 3RC2A 3A1NA 3IKTA 3H5RA 5TJ9A 4EJ0A 1LLDA 4R01A 1KY4A 5COBA 1DPGA 1CWUA 4H16A 1JVBA 1E3JA 1CYDA 1O0SA 3S2FA 2OP1A 3TNLA 4FJ0A 1MV8A 3FCOA 3KSDO 4WASA 4IDEA 1TT7A 3MCVA 4JP2A 3F1KA 4CM4B 2VUTA 4J16A 5EERA 3BMQB 3EW7A 4CMGA 5F3RA 1OI7A 3ZNOA 2NLOA 3ETDA 4BKQA 3BMQA 2YV2A 2X6TA 3PYMA 4PG5A 4ZHSA 2R6JA 4DVJA 3QIVA 4EBFA 4URFA 4P8RA 3BMOB 4D3DA 1VC2A 1ZIDA 3SXPA 3HN7A 4IBOA 3JQBA 4BUCA 4GVXA 4MP6A 5K9ZA 3BMOA 3NRCA 1NPTO 2NQ8A 1K6IA 4NK4A 4RPKA 4LCJA 2AE1A 5ER6A 1I2CA 4N5LA 2EGGA 3V1YA 2CSUA 3I4FA 2NTVA 3JQFC 3PZRA 1SB8A 4HBGA 4LVUA 3WBFA 2H5LA 2WD7B 4QECA 1NHWA 1MC4A 2R00C 2X22A 3GFGA 3WJ7A 4J1SA 4UAGA 1BWSA 3ANLA 1XQ1A 1I10A 4GSLA 3RD5A 2YJZA 2ZK7A 2GZ1A 4FJ2A 4NHEA 1YQDA 5L45A 4R16A 4Z3DA 3GVXA 3JQAB 2VHWA 1B14A 2RAFA 4O63O 5IZCA 4JIGA 1HXHA 3UH1A 1Z75A 3LF1A 4BNMA 2GASA 1HDRA 4IPTA 3IL2A 3G17A 2E6UX 2J5RA 3GLQA 2X0RA 3MZ0A 3ZHXA 1G6KA 3F9IA 1J49A 2XF8A 3DWFA 4AJJA 3JD0A 4PVCA 1O5IA 1Q2XA 1E3WA 1HDYA 4UVDA 8LDHA 3T4EA 2AE2A 2ZB7A 4E2YA 1SNYA 1D4FA 4RF3A 2EP5A 2VHYA 5IN4A 1CIVA 2VN8A 2GN6A 4RPJA 2BHLA 3OA2A 1LDGA 3QSGA 3LC2O 2FZWA 2D1YA 4BVAA 3UCXA 1B16A 1UJMA 4NZ9A 4NBVA 1PIWA 2B0JA 2ZCUA 3E9QA 4KUHA 4U6QA 4JJGA 2PZJA 4AJKA 3GVPA 3GY0A 4OO3A 4RDIA 4XKJA 3ETGA 1X14A 1EQUA 3C3XA 1CF2O 3GQVA 4MVJI 1RYEA 4L4SA 3Q9UA 4OIMA 3L0DA 4MVJH 3FN4A 2BLLA 2D3TA 1UP6A 4P38A 1K5HA 3WNVA 3UICA 3E5RA 2SCUA 4OSPA 3I3OA 5H83A 1XCBA 3FWZA 3CSDA 3FTNA 5A06A 4L76A 2Q46A 1DDOA 4W82A 2NTNA 4IJKA 5IXSA 2X1HA 5AXCA 3IAHA 4BMSA 4ZRMA 4YTEA 1W0CA 3V5NA 4R3NA 1HYGA 4PLHA 4JN6B 1LQUA 4RORA 4Q3DA 3ZWMA 4YAIA 4I5DA 5H82A 2ZATA 3M1AA 4ZA2A 1I3LA 2C2XA 2Y99A 1ZUD1 1KOLA 5T67A 3O26A 4YRDA 1DEHA 4JQCA 5L9AA 3I6IA 2NVUA 3CPSA 3DL2A 4ROSA 2NVBA 2O3TA 3QW2A 2HU2A 4WKGA 1VE9A 1QYCA 2P2SA 4IIVA 4TZKA 1GQ2A 4AJ2A 3C1TA 4RZIA 4BO4A 5I7SA 3H3JA 1PTJA 3I9KA 1GEGA 4CM7A 1PJSA 1GPDG 3WQRA 1YJQA 1DB3A 4A0SA 1JAXA 3GNQA 4CR6A 1YE3A 4GI2A 4ZQBA 4DIBA 1JDJA 3SJ7A 5IFLA 2NSDA 3EK2A 4EEZA 4MIEA 1SBYA 2O3SA 3V1TC 1E1KA 2AEJA 3T7EA 3JD4A 1GYPA 4TKLA 4B7UA 3GC6A 1UZLA 4CQMD 4CM5A 1TB4A 4MIYA 1KYQA 5IDWA 3NDIA 2VYVA 3B20A 4WLEA 4NH4A 3H2ZA 1SOVA 5DNAA 4TVOA 3AJRA 3IS3A 5AVOA 3CZRA 4XR4A 4IQ8A 1FDTA 1LLUA 4E13A 1Z6ZA 1G1AA 1KEUA 2IXBA 5JCJD 1HDCA 1M6HA 1E5QA 2ZTVA 1Y8RB 2W2LD 3H3FA 3L07A 5JDCA 1BW9A 5BT9A 2CFCA 4DL9A 2XPCA 5FI5A 3VTFA 3CZMA 3GZ4A 1Z73A 4O59O 3OMLA 3SLGA 4BO0A 4D79A 4UEOA 3DO5A 4Q3NA 4R9RA 5HBRA 1BTOA 2OBYA 3F5QA 1JWAB 5GZ3A 1DIAA 2GNAA 3V8BA 3OHSX 4PLCA 5J23A 4R1TA 2B36A 1GCUA 5L40A 1SOWA 2PGLA 2NNLD 1NXQA 3B1KA 4DPMA 4FFLA 5KJFA 4LMRA 3BXXA 5KKAA 4OXYA 2AG5A 2HQ1A 1YOVB 2Y1CA 4E0BA 2P4QA 4XDZA 1D8AA 1HE5A 3SJUA 3HDYA 4J43A 3ZGYA 3ZWVA 4DGSA 4BO3A 5CDTA 1GYRA 4RF4A 1Y6JA 4K1LA 2WD8A 3GH3A 2CVQA 3E1KA 4D41A 1H9AA 1YS4A 1I8TA 3AM3A 3HNPA 1UH5A 3WGTA 5DCUA 3P5SA 4CV3A 4BNKA 2D4AA 4DQXA 4WE3A 4IQ0A 1RPNA 4QTZA 3RAJA 1EUCA 5L53A 3PJDA 1SC6A 3RIHA 2G5CA 3RUHA 4WLOA 3LU1A 5U9CA 2GYYA 5FYDA 4ND4A 1QORA 1HE3A 1R66A 2GZ2A 1P1KA 1PJCA 2EXXA 3FD8A 2X4GA 2G1UA 1BVRA 2DU8A 3ZW9A 4XIJA 1Y8QB 4CLOB 1P0FA 1LUAA 3AY3A 4FC7A 1LLQA 4XGIA 5KJ6A 1WDLA 4GBJA 2BFPA 4CL3A 1ZMOA 4W7HA 4XB1A 2C5EA 1E3SA 4YRBA 3U4DA 2GPTA 1ENYA 5JXWA 5JE8A 1HE2A 1KEVA 3JSAA 1NYTA 1PJBA 5ES3A 1X7HA 4EITA 1O9BA 3AY6A 1K3TA 1C0PA 3U49A 1V3TA 4D45A 3TF5A 6ADHA 1PL7A 1ZO8A 4CM9A 2DQ4A 4ALLA 4QXMA 3U09A 2JD1A 2B5VA 3QE3A 1R4NA 3UKOA 3O8QA 3ZV6A 3ST7A 2DTXA 2Y1EA 4PLGA 1R0KA 1T1RA 2HLPA 3H8VA 2Y67A 1LLCA 1X1EA 2AHRA 2ZB8A 3GHHA 2YYYA 2I67A 4FFOA 4XYEA 3E48A 4XJTA 1DXYA 2PD4A 3ADOA 3ITDA 3DZJA 3F46A 1GADO 1EK5A 3WWZA 2I99A 3DTTA 1ZMTA 3WB9A 3OFSA 5A02A 1CDOA 5I9MA 1DSSG 1I2BA 3AU9A 4L75A 1QKIA 3W4KA 4DQUA 5I8WA 1F8FA 5L95A 2W98A 4XJSA 4F6CA 5BQFA 1N7HA 1V35A 4H3VA 5JW6A 3UCFA 2POQX 3HZZA 3RWBA 1QV7A 4FPXA 3QA9A 2YFHA 1K0UA 1E7YA 4AL4A 4J9UE 4BNVA 5ER9A 3S2IA 5KTKA 4XQEA 2ZYDA 3WQSB 1PU2A 3GG9A 2HMSA 1I24A 3QLJA 3TOXA 1NAIA 1N1GA 1WZIA 1HETA 3PZBA 3H9UA 3KO8A 1D7OA 2C54A 5TT1A 3P19A 4HADA 3WICA 1FMCA 4BO1A 4ALJA 2I65A 4XWYA 4O0LA 4MDHA 2IODA 3MJSA 2X8LA 5DN9A 3HB5X 3Q0EA 4HV4A 3G0OA 4BB6A 1NWHA 3NT2A 5EINA 1V9LA 3PFWO 3W6UA 1Z45A 4L8VA 4GKVA 3EAGA 3EUWA 1P1JA 2FSSA 4CUKA 1ZXLA 3KEOA 2EKLA 2X23A 4XYLA 3A9WA 3TL3A 3AWDA 3NTRA 5LDGA 1VPDA 1R6DA 1VJ0A 3E18A 1KBZA 4K28A 5G4LA 1X13A 5A3VA 3W4JA 3ZWWA 4MVJE 1FDUA 3U62A 1JWBB 1ZSNA 2JAPA 1DIRA 2GDZA 4Z9XA 5JMPA 3JD1A 3DZIA 4L9RA 4YT2A 4NU5A 4PZCA 1LI4A 1PS8A 2CD9A 3D4PA 1E1LA 4N5NA 3I9OA 1U4OA 1U5CA 2AW5A 1A5ZA 1W4ZA 1S7CA 2YV3A 2VUUA 1UP7A 3IMFA 3H9GA 1BXGB 2V6FA 1A9ZA 2E37A 4FFPA 3STHA 4LCEA 1BXGA 4GX2A 4CUZA 5CP8A 1Q0LA 2X0IA 3DHEA 1HDXA 1C0LA 4ESOA 2JFGA 5LCXA 1LDBA 2C7GA 1U2DA 1WW8A 1NM5A 3L9WA 1LNQA 2D0IA 4XQ9A 4XCVA 4RJTA 5G0SA 5HA5A 1YDWA 1ZK0A 3OM9A 2VT2A 4H7PA 4R4JA 1F14A 3C85A 3JQ9C 4IY1A 4UVIA 3WGGA 5JS6A 4NR0A 4FBGA 3UGKA 1B2LA 4I9HA 2UUPA 3LVFO 4BNTA 2C2YA 1AHHA 2P5UA 5TQVA 4PIVA 4K26A 2ZCVA 3V2GA 2I3GA 2IYOA 3KEQA 4TRRA 3GUCA 3OA0A 5JSFA 1M66A 1J6UA 1HF3A 2J3IA 4B4UA 2JCXA 3A06A 4CLXA 4IDFA 3QV1A 4LK3A 1HDZA 2C07A 3IDSA 1QYXA 3VKVA 3HDHA 3K31A 4RPGA 4Y6PA 5TSDA 3OF2A 3ANNA 1GDHA 4Z0HO 1CJCA 1K6JA 4BKOA 1YONA 3A28A 4AJ1A 1X15A 2YUTA 4KP7A 1P33A 4CMHA 3DZBA 4OGWA 1EVJA 5EPOA 1M75A 4L74A 3ZI0A 3FPLA 4KWHA 1LQTA 2PD6A 2V6BA 5KOIA 4OYRA 4FB5A 1P31A 3OICA 4J90A 3KYCB 4R1SA 2VWPA 4OAQA 4N54A 4UUPA 3FF4A 2B83A 3KYCA 2W2KB 4H15A 2F00A 4TQGA 3HN2A 2QRKA 1JLLA 4ILKA 4B3HA 5B4VA 2GSDA 3LT4A 4J7UA 4DLAA 5IAAA 3HE3A 1H93A 2B37A 1NTOA 2DPHA 5EQFA 1R4MA 2BMAA 1EVIA 1HWYA 3PJFA 1XG5A 4J0EA 2ZTMA 5CEJA 3N74A 1E3LA 4PLFA 5COAA 1PS0A 4IDGA 1ADCA 3UOGA 4S3MA 3GMDA 2EWMA 3M2TA 5B12A 1ZVMA 4BO2A 1ZFNA 1VL6A 1MX3A 4OH1A 3VPFA 4IJWA 5BSHA 5FI3A 4TVBA 5B37A 3H4VA 5KKCA 1VL0A 3VZQA 1K89A 3WBBA 2WYVA 4J2HA 5B4TA 1EBUA 4BL5A 3RUFA 1B15A 3KM0A 4RVGA 4CMEC 1EDOA 4HFNA 3W8DA 1ISFA 1M67A 5T57A 1ZCJA 5CDUA 1IPEA 5H81A 2JHFA 5ADHA 3WR5A 1I2ZA 1A7KA 3BIOA 4EW6A 5IXYA 2QYSA 3PGJA 1VLLA 2IRWA 3E6AA 3GG2A 4AG3A 3PFFA 4WCFC 3ZZNA 1EBFA 1PWXA 1UP4A 1I3KA 2PZMA 3QJ5A 4CR8A 1IL0A 2CY0A 3HDJA 4E2WA 1DAOA 4RF5A 3FR8A 4CQMB 2C7VA 1H6CA 2PKQO 2X5OA 4R9SA 3HADA 4PFJA 2IEDA 4CQMA 4CM9D 7ADHA 3DOJA 5CHEA 2DBRA 4LSWA 1QRRA 4Q3AA 2AQ8A 1ONPA 3ZU3A 3ZNNA 1EDZA 2QYTA 5C7LO 1Z74A 1MUUA 4DTIA 5T64A 3AOGA 3I1JA 9LDTA 2VT3A 1UXHA 1NNUA 1I0ZA 1VJ1A 3WDSA 5A9RA 1ZSVA 2RBEA 3L6OO 1QR6A 4XQCA 4CMJA 4YJFA 5F5LA 1YWGO 4YJGA 5JCJA 5DBFA 1MXHA 1R0LA 4A10A 1KS9A 5ILOA 4W7IA 1T2DA 1VSVA 3PDJA 1JN0A 4WLVA 1LDYA 3I23A 3PIIA 3ZWAA 4EGFA 5JYEA 2ILTA 2HMVA 1ZBQA 2X5JO 4IGFA 5EN4A 4CODB 4C7KA 5A1TA 4FDAA 1ZKMA 2AQKA 3BMCB 4PG6A 1C1DA 3Q9NA 1Q7CA 1BHSA 4ALKA 4PLWA 1PJ2A 3S55A 4NJOA 3I4CA 4CMIA 3QHAA 4ONEA 3NUGA 1F8GA 2Y1GA 3DBLA 4YR9A 2O23A 4B3JA 3F3SA 4YCAA 1QXSA 4B7XA 3BA1A 2VNSA 2VWQA 3GHYA 2X9VA 2HDHA 1R16A 3JQCA 1EMDA 1HE4A 3GGOA 4LVCA 2Q2VA 4G5HA 2CDCA 5L4SA 3UW3A 3IKVA 1U9JA 1GAEO 3MJEA 1HYHA 2GN4A 1O6ZA 5TNXA 1ZEJA 3ROPA 4BOYA 1E7SA 1DC5A 3JQFA 4ND3A 3DHYA 5BNIA 3GN1A 1ZZEA 2R00A 4K9DA 4GVLA 4DC0A 4BO5A 1XKQA 1LEHA 4KQWA 4Z0PA 3OJFA 3NTOA 2EKQA 1WAMA 1HDGO 3FHLA 3GEDA 3PDUA 1EUDA 1ARZA 1T2AA 4II3A 3VAZA 4RVSA 1YB1A 1UXIA 1Q7GA 2FPPA 4HX5A 3WGOA 3FNFA 3OEYA 4JCOA 4ALIA 3OECA 2Q3EA 2PY6A 5HM8A 1B0AA 3LZ6A 3IOYA 4JLWA 3WFIA 3WGYA 5JC8A 2DM6A 3CH6A 1NHGA 2PKQP 3D4OA 1TA4A 1DOHA 1E7MA 2GCGA 3K6JA 3CXRA 4B8ZA 3GRKA 3OQ6A 2JFHA 4ALMA 2LDBA 3T7CA 1YRLA 3AM5A 1Y7TA 1NAHA 1B7GO 3UUWA 4QT0A 2FWMX 1MXFA 4JJFA 4BIIA 3KYBA 5KVVA 1XIVA 4KUGA 2E48A 1MG0A 4O1MA 1XGKA 3ROKA 1KVSA 4RPHA 5EIOA 1LDNA 1Y1PA 4E5KA 3DFUA 2VWGA 3NGLA 1C14A 4OXNA 5T8KC 1E3WB 1P9LA 1JKJA 2FY8A 4D42A 4CMCA 1C3VA 4YT8A 5JAIA 1X1TA 5T6BA 3V2HA 3WOHA 3OQBA 5FF9A 1E6UA 3OBBA 5A3JA 2GD1O 2EERA 2EIHA 3FRJA 2VCYA 4M8SA 5FFFA 1P1HA 3LQFA 5A4DA 4OM8A 1XSEA 2ZIZA 4EI2A 4MIOA 2ZYAA 1ORRA 1X0VA 1NR1A 4YYZA 5C7OO 4GQAA 4LISA 3ZW8A 3Q2KA 4GKBA 3NT5A 2H9IA 3I9NA 3OP4A 3CE6A 4E12A 3IP3A 2VYND 1HZJA 1N9GA 4NIMA 2AG8A 1F12A 1GFSA 4UULA 3AY7A 4A5OA 3L4BC 4ZQEA 4INAA 4ZQHA 4BNXA 1DC3A 3PVZA 3CTMA 1DLIA 1EE9A 5A9SB 1H2BA 3GNTA 4BGVA 3MJCA 5A9TA 5TT0A 2DTDA 4CPDA 5A9SA 1QMGA 1AN9A 2Y68A 1Z82A 2YQ5A 5TGDA 4FIZA 2H1SA 4CLDA 3DTYA 3DDNA 3U4HA 4QQRA 2BD0A 3BTUA 4YAGA 2TMGA 1I32A 3ZHYA 2ZQZA 1N92A 2VTDA 3DEYX 4AJIA 4AJOA 3ZWPA 5JFOA 2NVUB 2P4HX 4OQYA 3CIFA 4CV2A 1G0NA 5DOZA 4JX8A 1IZ9A 4ND1A 3WS7A 4GX1A 3DONA 4ITUA 3Q2IA 4MVJA 3KBOA 3GDFA 3R1IA 4ND5A 4CQLA 2AQHA 3EYWA 1KEWA 3EZLA 3HHPA 5CDSA 2NACA 4PLVA 3MTJA 1HKUA 4M87A 3BTVA 2BH9A 5ITWA 1GY8A 3ZWNA 4DQVA 2UV8A 4Q3EA 3K92A 1GCOA 1ZSYA 5AXDA 2EGHA 1PZHA 1W8DA 2W90A 1ISMA 4BHTA 5L7YA 5C5IA 2ZQYA 3R3JA 4GMFA 3VH1A 2FN7A 3JTMA 1AXEA 2GLXA 3F5SA 3OH8A 4WNCA 3E82A 3G49A 4J7XA 3UXYA 2JCYA 6LDHA 3E03A 1P77A 4WJZA 4XRRA 4TWRA 4HP8A 5L51A 2W8ZA 1LBEA 5F5NA 1YB4A 4BMVA 4CLHA 3PQEA 3FSRA 3DZGA 3QY9A 3FTPA 5DBGA 1V3UA 3GOHA 4J7CA 4ND2A 2RH8A 3PLRA 1LTHR 4ZQFA 5AXBA 4YXFA 1UXGA 3KTDA 4CM3A 3L77A 4IQGA 3K9QO 2Y1FA 4YB8A 1BW9B 3W8EA 2VHVA 4LN1A 3VVCA 3AFMA 1NWCA 2Q1SA 2VNAA 3WG9A 1E6WA 4JJIA 2DFDA 4NPCA 3ENNA 3O9ZA 1JQBA 1NQAO 1NR7A 3AFNA 4I5FA 3PQFA 1NQOA 2C29D 3LDHA 5A05A 3ZV5A 3RU9A 3C1AA 3DMTC 5TLSA 3A14A 3WLFA 4NJMB 1PJQA 1LJ8A 4R69A 1NFFA 4XB2A 4NJMA 3V1UA 4YVFA 5I9NA 3KSZO 4DMLA 3O38A 1GZ6A 2EJVA 3DAFA 4M89A 3TFOA 7MDHA 3HQ4O 3D5TA 1T2FA 2JAHA 3AI1A 5TS3A 5BR7A 5JCXA 3WMWA 4BGUA 3PRJA 1ADBA 1ADGA 1YQXA 3OJOA 3T4XA 4BNJA 1T1SA 1V0JA 1YGYA 2I9PA 3PIDA 5AYVA 2B35A 4NMHA 2E4AA 3U9LA 3ZU4A 1GL3A 5KVQA 2YW9A 3PTZA 1ISIA 2X86A 3ON5A 3DZHA 4B79A 2DLDA 2EJWA 1QYDA 2DKNA 4M86A 1ZK1A 1EEHA 2ZB3A 1JTVA 4P22A 1YQGA 3DC2A 4NK5A 1KVTA 1YBAA 1QYWA 4PCVA 2V65A 2A4KA 2Z95A 3TSCA 1U5AA 4TROA 2O3JA 3LLVA 1O94A 5AXAA 1IE3A 1QLJA 5ITVA 5L4LA 3VH2A 4GH5A 4AJNA 1E1NA 1VRWA 3E9NA 3PHIA 5JDIC 5L7WA 4Z0TA 3DBHA 3GZNA 5A5EA 1I36A 4OKIA 4BQPA 5CG2A 1UDBA 5L4NA 1DRUA 2NU8A 2Q45A 3PQDA 4E2XA 1WDKA 3GR6A 4YJDA 1P45A 3OETA 1X7DA 1VKNA 3S2EA 4G65A 1V8BA 3MEQA 1KETA 2CMDA 3DB2A 3GRPA 5BNTA 3AI2A 1R4NB 3CINA 2WE7A 3O8QB 4XZ3A 3R6DA 5IF3A 3EDMA 2HJRA 1ZK3A 2J3KA 4FD3A 1VJTA 1ULSA 4BMNA 1E5LA 3PHGA 5CDYA 1TLTA 2YDYA 3CKYA 4ZGWA 4UVEA 1GEEA 2A94A 4W9NC 1TT5A 3BHIA 1V3VA 1Z7BA 1MGOA 3WLEA 4CM6A 1HYEA 1DJNA 4Y6RA 4JP3A 1ONNA 1LXCA 1MC5A 3AI3A 3QRWA 3WYEA 4BO8A 3H65A 4IXTA 1CETA 4NBUA 3KB6A 5DULA 3AM4A 1T4DA 2NWQA 2AA3A 3ZWCA 3TFQA 4II2A 2GF2A 2X9NA 1IYZA 3GVIA 3NAQA 1TEHA 5GZ1A 3PK0A 3JQEA 4J0FA 4PLPA 1DRVA 2FPIA 1MB4A 2FRDA 5G4KA 5I7FA 1OMOA 3WTCA 2X0JA 4Q39A 4EJMA 2Y05A 1B8PA 3O4RA 4IDBA 3ZWXA 4QX6A 4TRMA 2DUUA 4DBVO 4XGKA 1QLHA 4R3WA 2HSDA 3WYBA 4AJHA 4OQZA 3LK7A 3LSYA 4DXHA 2QHXA 2E82A 3IIEA 1YL5A 2QRJA 4MP8A 5B4UA 5IG2A 3RC1A 3A4VA 3D3EA 1ISJA 1H0KA 4F45A 3KZVA 1MFPA 4OL9A 4A2CA 1WXDA 4RLSA 4EUEA 2I5PO 4K6CA 2DBVO 5IZ4A 3GGPA 3HSKA 1ZXBA 2GUGA 3F6YA 1SCUA 1LX6A 2EKPA 3C24A 2PH5A 1DFHA 5EL0A 1NBOA 2EF1A 4QFDA 5JO0A 3FNHA 5TF4A 3TZKA 3RKRA 3IUPA 2YHUA 2O4UX 2HK9A 1SMKA 2NM0A 1DO8A 1B8VA 1GZ4A 2YDXA 3VPSA 1ZW1A 3LLSA 2NV6A 3C1OA 2NU7A 2FHSA 3H5NA 1HL3A 3ZH2A 1LRLA 4DYDA 5HTOA 3MJ4A 4YAKA 1X0XA 3ICCA 5BNFA 4NBTA 2I6TA 3DBRA 4MVJD 2IZZA 2V6GA 1DJQA 1LSSA 4D0SA 3INRA 2FSVA 4E3ZA 1EE2A 4UUMA 3JQ9A 1CERA 5F1OA 2EW8A 1BGVA 2IEBA 3PHJA 2C59A 2Y0EA 4BNZA 5JMWA 3ORFA 3JD2A 4ZU3A 1I01A 4GL4A 3U5TA 1EFKA 3KOUA 4FGSA 1NVGA 4XRGA 4D44A 3HWRA 3MWDB 3HG7A 2HJSA 2IZ1A 3H9EO 4Q9NA 4CM8A 5EQDA 1DLJA 4FGWA 3ZU5A 4MO2A 1OOEA 1V6AA 1WVGA 3OIDA 3OIFA 1RYDA 2ZTLA 4IZIA 1GV0A 1EVYA 3KLPX 3C7CB 3PPIA 2JHGA 3K8ZA 1NQ5A 1NFQA 3HFSA 4BNGA 4U8GA 2EV9A 1NFRA 5TJHA 3X2EA 1OC2A 5L3ZA 1P3DA 3OEWA 1K6XA 1XWFA 3QVXA 2B4RO 2PWZA 3ZNPA 2I3AA 3DZKA 3GAZA 4YA6A 3WWYA 4R5HA 1QYVA 5CG1A 3ETEA 1T24A 5CDGA 2PTGA 3JYOA 4P4GA 1N7GA 4E32A 2RCYA 3RI3A 3PWSA 4IS3A 2WWRA 2PA3A 1E7RA 2DPGA 5F21A 1E1MA 1SAYA 4KDFA 2X0NA 4UUOA 3I52A 3OJEA 1T26A 4IDDA 4DPKA 2VYNA 3BZUA 3VH4A 2UAGA 4HY3A 3GA0A 1BVUA 1OZAA 2NUAA 3TJRA 4IGEA 3AUTA 1NQTA 2B69A 3VC7A 4OOFA 4E5MA 1ZK4A 2Y0DA 4RZHA 5TX7A 1IULA 1UXJA 2GRAA 3AOEC 1R4MB 4HXYA 5KWEA 1PQPA 2PD3A 2ZJ0A 1U7TA 4JROA 4D43A 2Z1MA 1SZJG
chains in the Genus database with same CATH superfamily
2HU8A 4K9MA 3FW1A 1QNFA 3QG5A 1JQKA 2QD3A 1YQWA 3A1SA 3OZEA 2LKDA 1KDYA 3VC1A 3ZE1B 4AT1A 5BW5A 4IO1A 1XL1A 5ENVA 2ZI7A 1GV1A 1O8CA 3PJEA 5H9VA 3SHWA 4A73A 4LNUB 1DKRA 3PEEA 4KX5A 4Q12A 5CX1B 5FPKA 2EFYA 2OBNA 4TQUS 5FUYA 1LW6E 2YMMA 2G04A 3FI9A 1CIJA 1H0SA 4R8KA 4ZAZA 3FWNA 4PS1A 3LPLA 5K01A 3KOZA 1NVUQ 2VHXA 3GH1A 2P9EA 1OJLA 1M34E 3F3YA 2O7RA 3TTSA 3WFZA 5CT8A 3QMWA 1NUUA 3F1LA 1G5QA 1O94D 1RXIA 4L28A 3P2KA 1DQSA 1UPFA 4GZLA 4PXYA 4UZEA 4XDYA 4FW8A 1I33A 3GK3A 4NG5A 4NZPA 5AJHA 4EX6A 2YX1A 5K6AC 1KI2A 4CJXA 4BWYA 5G0TA 4EHLA 4PHHA 4F4DA 3KDPA 3THSA 1U3VA 2PUWA 5AJTA 3ZUPA 5JSYA 1IBKB 1KMQA 2VQ3A 4JLBA 4P93A 4QGAA 3TZCA 4BB5A 5KNLA 1VMDA 1I3MA 3EIOA 3KCNA 4KYUA 1PKXA 3I04A 5EP4A 4BB9A 1U4NA 2DFLA 4E21A 1ZH4A 3MJRA 4ZZIA 1A7AA 4X41A 4DEVA 3M4YA 13PKA 1PVOA 3DLBA 4CNQA 2YFQA 2Q4TA 4LW8A 5I51A 2DUMA 3FR7A 4LV6A 4P53A 1P4HA 4F11A 5HF5A 3EFBA 3EVTA 1N3YA 1N25A 3FRIA 4OHBA 3ZH9B 2C5HA 2D5BA 1A9XB 1J00A 3EYAA 1NV9A 1KZYC 4IVNA 3UT5B 4O6VA 1GKLA 4U1RA 4DLKA 3K4QA 4K9OA 4OXRA 1ND5A 3B12A 4RQUA 1DRWA 5FNVA 1DHRA 1FSZA 1KR2A 3FGPA 1ZYUA 4R2LA 4YJFB 1UBEA 1ESEA 4H0CA 4X20A 1T5LA 4QJIA 3B8HA 3GVHA 1I4EB 1KZGB 3AF5A 2O59A 4RV9A 2G17A 4NZMA 3JZDA 4Y2UA 4C4ZA 5EJ6A 4A4DA 2YZNA 1UOQA 1NG9A 2G5TA 1B26A 4HDQB 1PDOA 2FZ5A 2WWXA 1PR9A 2HREA 4F4UA 4HLQB 1M0WA 3FGNA 5EHNA 4BN5A 1XHFA 4UZFA 4QU5A 1B74A 5EJ2A 4C6TB 1THMA 5JANA 2HMAA 3TD6A 1FQWA 1GQQA 4AP5A 4E30A 1T3HA 4GX0A 5L6LB 1Z5VA 1ISGA 2HHHB 1C1DB 1G2OA 3ZGVA 5C35A 2R1VB 5TRTA 1YCDA 1HSZA 2OTCA 2WUFA 3LLMA 4X5OA 4BVKA 2JFOA 4C0LA 1U7HA 4JBHA 5I3CA 1OT3A 2E49A 1G8JA 3UEOA 4L02A 4Y9DA 2X7XA 3QH4A 3RCBA 5U1PA 3SP1A 4MINA 2AC4A 2BDUA 3EDRA 4JKOA 2XMPA 1GU0A 4DWVA 1DX9A 1JG7A 4KG7A 2O2ZA 1CULC 3BA6A 2HAEA 4E2ZA 3ZDCA 2IOFA 3AU8A 1OF1A 1TEXA 4FHGA 4NULA 4FDLA 5EWJA 5AQ1A 1FP2A 4I3GA 2QX8A 3NEJA 3D6TB 5DM4A 1XMJA 1YKGA 3U3XA 3IBSA 4CR7A 2YXNA 3PQ8A 1WETA 4EKDA 1U8CB 2GEBA 4RO0A 1T8YA 3DPUA 3DYIA 4TWBA 1XNJA 5H02A 3DWGA 3I2HA 3KJZA 3MJDA 1GTVA 3DEZA 1RQGA 1HZZA 3GFBA 3PR1A 7AT1A 4E5YA 3SGLA 2I2BA 3ZZ0A 3BMNB 5MGBA 1LDEA 2C9OA 2QRLA 2I4LA 2VDOB 3LT1A 2VUSA 2ZSBA 3NHFA 4LRTB 4P6VF 3THRA 4CCWA 4N18A 5KYXB 1X1RA 1FRZA 4BGEA 4UTRA 5EZ5A 2QTMA 1PFKA 5CPBA 4BKUA 1T5DX 4QM7A 1WXIA 3CVVA 5HQJA 5HK8A 3NXKA 2GCOB 5BP7A 1Q17A 2BW0A 3ANSA 1JKIA 4P80A 5IN5A 1U9ZA 2A9FA 2D62A 1O96B 2HIMA 4BP1A 4NAVA 4Z1MA 2WQ7A 3F6PA 2I1LA 4AXBA 4YRGA 1UBCA 3JQGB 3P2JA 5KCZA 1B73A 5F73A 3CRVA 1GOTA 4R6XA 1E7QA 1WDMA 3BB1A 1A2BA 3C8MA 1PYOA 3DE1X 5EVCA 4CWAA 1C7FA 2QT9A 4NU0A 4PN3A 1DC4A 4QPPA 1HT2E 3V8NA 1NX6A 1CHNA 4D3SA 2P69A 3M2PA 3GLHA 1JFRA 4ZCRA 4YCLA 2BM1A 4N49A 3BTOA 5C34B 1JHDA 3VJKA 3D7LA 4WEQA 3SHFA 1RHMA 3AHEA 1KK0A 4PX3A 5FA8A 4I5IA 2WYIA 4U00A 2CUNA 5DIFA 3V34A 3IDAA 4EYOA 2GJ4A 1TTHA 1X9GA 1YR2A 2LGJA 4BQOA 5IAEA 4CUJA 1EGVB 5CCEA 5JY6A 5T8KA 4DBZA 5I4KA 4K3VA 3FJ1A 4D4LA 4JI2B 3ANXA 4U7WA 2G7MC 4XASA 4P54A 1V6CA 3KXPA 4IINA 3D6UA 4CM1A 4YY3B 3TAUA 2IHZA 2VTEA 4JXJA 3USES 1UJ5A 5FWYB 1NASA 2O07A 3GA7A 4ER3A 1AKVA 2AF4C 4NDZA 2XQVA 4YXWA 1DBQA 3T3HA 3ZWYA 2PUJA 4ZCTA 1SEPA 1XD8A 1EVZA 5HP4A 2V7QA 3H1PA 1V7ZA 4B3CA 3TS1A 1GRNA 2ZSIA 2I54A 3A4MA 4PLZA 1NVMB 1QPBA 1PV2A 2WD7A 3NBKA 5GINE 1W88A 5FJIA 5CT6A 1IMJA 3FZGA 3UKDA 2FF5A 1NF9A 3HJBA 1E77A 2ZAOA 1NBIA 3BX1A 5EA2A 5ADUS 3AUXA 5KPJA 4GSKA 5CK4A 4PYIA 2XKJE 2JJYA 4TOIA 2ZWIA 1VJ5A 1PD0A 2QGFA 4CYMA 4UMEA 2PZEA 2WAXA 4KV9A 1P1CA 3A4TA 3CJQA 3NAMA 5FXMA 3LC0A 2DE0X 3T9CA 4E88A 4YT5A 2P9ZA 3JQAA 4WA7A 4OX9B 3F7NA 5E4JA 3N87A 2ZRPA 5MDHA 2GM4A 2C3YA 1QVVA 5EJAA 1BSVA 1C9DB 1LBHA 4IJQA 2ET6A 4P31A 3TQQA 3L4BA 4D4MA 2F48A 4A2PA 3NVDA 3YASA 4L73A 3K9HA 3ZHVA 1IOLA 3HGTA 1YKFA 4UUNA 1GR0A 3CKMA 3COJA 1TF5A 2DUWA 1N8KA 2NO0A 2SECE 3L05A 4PR3A 4QUIA 2XBMA 1YB7A 4IIJF 4EDFA 4L5AA 2R1UA 2LCIA 1RBQA 1VYUA 4KFSA 5JLAA 1D07A 1FYFA 1BXZA 2XNSA 5CLHA 8GPBA 5IDQA 4TV8A 4CETA 2VAPA 4HWKA 3EMKA 4BNNA 1H22A 5JQGA 1CY0A 4KAJA 4AY2A 3IV7A 4MJLA 5I7WA 2IEYA 3PIRA 2I9KA 1Y6FA 1KYTA 1S3IA 4D8YA 3MMNA 1IXYA 1EXNA 3K5IA 1RI5A 1TL7C 1X9IA 2NUBA 1EX9A 3KC2A 3LCMA 4HYEA 5G1NA 1ULTA 3DCNA 4U9HS 4EECA 4D9NA 3VZDA 3SG0A 4MHOA 3IB3A 1Y3HA 4DA9A 3C8DA 2BFCB 2O50A 2YHIB 1KSFX 1WULS 3MD9A 5J5CA 4HATA 3IDZA 1IZZA 2HUNA 2ROQA 1SEVA 2HPVA 2QT1A 3ZHQA 5CDHA 1M2GA 3K1AA 1OAAA 1HRDA 1VKHA 2OCPA 3JYNA 4HFMA 3W9UA 3Q8MA 1KNXA 2PUTA 2VIIA 1PGQA 3OPYI 4ZPJA 2E89A 3AQIA 4OFWA 3RU7A 3SDZA 2XOKD 2BFOA 2BGLA 2GDJA 3ED5A 4IKEA 4D0GA 1KP9A 4EUHA 2QU8A 2ZBEA 5LZ9A 5LMZA 3EODA 3NTVA 4A26A 1QG2A 3FYTA 3KLMX 4OEHA 1PK7A 4N03A 5JJBA 3UO8B 4JNKA 2GVZC 4WADA 3EIXA 2V98A 3AM1A 4PSAA 1ZOOA 2KB0A 2VNKA 1LSJA 1S96A 3CGWA 3K3PA 3Q12A 4HLCA 4M0UA 1C0IA 2CXXA 2QZZA 3MOGA 1H5QA 3Q3CA 5DPMA 1WMAA 4OBXA 4BYMA 2A5YB 5JNLA 1J5PA 1KC3A 4RESA 3SDBA 3KSBC 4V0SA 5EZYA 3RGWS 4ZOAA 3WYCA 4GC5A 1KYZA 3FOCA 1YZUA 1PGPA 3I01A 4ZICA 4GIBA 1W25A 1Y37A 4D9IA 1FFXB 5GONA 4EG5A 2Y93A 1J2UA 3IEIA 4MGEA 1YK1A 1U8ZA 1XCLA 1SIUA 1ZESA 1CJKC 2H06A 3NHPA 2DFTA 3I92A 3KR1A 3HKBA 4BECA 4EG4A 4UTVA 3AZPA 1HC7A 1IY0A 1U31A 4OHUA 4ARSA 2VP5A 4GOJA 3H2SA 5AM2A 5JTUA 1DG1G 2PR2A 3W3AA 2B8NA 1ZD4A 3C6BA 2BHNA 2Z2JA 4CQNA 4M1KA 1MO5A 2FEMA 5JJKA 2ONYA 4NG4A 5JFTA 3EG9B 3LQ1A 4NBRA 3C3YA 4TTIA 4MCAA 4MGYR 3BBLA 5CMLA 1IDN1 4WESA 3SXJA 4X93A 2I8LA 4B2PA 4B9AA 4EPWA 1WCYA 2J6CA 1FTWA 1VSTA 3GEMA 2NYVA 3RSQA 3FETA 1Z0SA 3DZFA 5B58C 2FWJA 2XODA 4KO8A 3P2IA 1G9TA 4Q1BA 1T4CB 3WJAA 5KBYA 3TGWA 1UKZA 4LJAA 4MS1A 3NIWA 2HU7A 2Y2UA 2QX6A 4FJ1A 4JBYA 3M6IA 4IKOA 5FFNA 1QR2A 5AVKA 3FFBA 3UJ9A 1SUCA 3NIBA 4MUAA 1G0OA 3MWKA 5EXTA 4LPSA 5LA6A 3S6JA 3W1WA 2D00A 6Q21A 5KU7A 4L9WA 2GGSA 4I5EA 2ZYGA 1S01A 1SUIA 1Z5UA 2FTKE 4FZ5A 3NYWA 4RKYA 5DV9A 4XSHA 1PL0A 1QFYA 3CHYA 2M6LA 5LLTA 1C7ZA 2BCGY 1ZOLA 1PFWA 3WGJA 5BQXA 4HEA6 2BFFB 4J07A 4N0DA 5AW3A 5CBPA 4HGOA 3L7NA 1DOAA 1KJWA 3LYAA 3KWFA 4H59A 3S68A 4BO7A 5TGZA 3LC7O 4N5HX 2HQOA 3UYKA 1EXWA 3NX4A 3BCUA 2NUPA 3L1UA 4B47A 4YP6A 4JOSA 4BJ5A 5G0VA 1GYQA 1Y5RA 3COSA 3OE5A 1Y8RA 2D1FA 3P9QA 2H5JA 2GD2A 3PGKA 3X44A 1UK6A 3STYA 5I7VA 2MR5A 1AGRA 5DIZA 2ORVA 1ZPDA 4ZZ2A 2DLCX 4D4JA 4FFMA 3PXGA 5A04A 2BLNA 1EP2B 3OCZA 1D2MA 4FXOA 1ECCA 1MA3A 4XWKA 5KTNA 1G63A 4WGFA 4QU9A 1M6VB 5A5GA 2G1AA 3CWCA 4RUKA 1XCOA 4YIHA 2XKBA 5EUBA 1HLPA 2BEKA 5EE0A 1UC9A 3CN9A 1D2GA 2V3VA 1LF0A 5BN4A 2BI7A 3LYLA 3L9XA 2Q6VA 1RT9A 2IXFA 2P9CA 1MT0A 4TMXA 4NYIR 1VA4A 1Y82A 3K71B 5KNDA 4UC0A 3DV0A 1PR0A 3L1HA 2M6SA 4NMMA 4DADA 2YTZA 3H75A 4Q7QA 2Q62A 3QYFA 1UK7A 2QUZA 3B3AA 1JIXA 1WCWA 3I58A 2P2GA 3PC2A 4OQEA 5FJJA 1L5GB 3UZUA 2IOQA 3A1WA 4RDHA 3K0CA 4EVSA 4UOEA 1T1GA 2XUHA 2F3PA 1SUAA 1R0BA 1JDBB 3D7MA 2B4KA 3Q3HA 1L4NA 2G83A 1T9AA 4JVLA 4OLFA 5DW0A 3SDSA 3WLAA 4A16A 4ZEWA 1H2EA 5TVKA 3QVSA 4DLZA 1DTSA 5SICE 4WK6A 5LD2B 1XJQA 2RGXA 1FB5A 1G18A 3HTXA 3SFTA 3UK2A 4N7BA 1MZVA 2IUEA 4LBYA 3QYPA 4W9NA 2J1LA 3K4HA 4FVTA 1QTIA 3RSLA 3D4BA 1T8TA 1BFUA 3SQLA 2VDPB 4UM9D 1AG9A 4MQMA 4P36A 1C4OA 1S0UA 1W4RA 2PRJA 2Y3IA 4EI9A 3HMQA 5DX8A 2AEEA 4B35A 3ONFA 4LWQA 1YQTA 3AL3A 2C5AA 2J5XA 2HF2A 4E31A 5FA5A 3X43A 2BFDB 4ZVVA 4YCSA 1HG0A 2WSIA 2WAAA 2ICAA 3OJWA 3RT9A 2IHBA 1VI2A 3FPCA 1TJNA 4RY2A 4Z49A 4ZJUA 2O8CA 1RWVA 4G41A 4NVRA 3G1TA 3TSYA 2VDUE 4EYKA 4DCPA 1G64A 1Z56C 2BFNA 4KWIA 3OO0A 3HB0A 5D6NA 3RH0A 4ERNA 3A8TA 1HPLA 1KYWA 1LFDB 2ZE7A 2V7QD 2QMOA 3K2EA 4TMZA 4B6OA 4A8JA 2JHPA 3IP1A 2ZI4A 3P0FA 3HUDA 3LT2A 5E6SA 4TUYB 2OYRA 5J3JA 4DBLC 1OXMA 1NN1A 3T0IA 1ULHA 1MC1A 4RETA 5CK5A 1T9GS 4O4LB 4OSOA 2NADA 4C0AC 4TX1A 4YMWA 2G1JA 3REOA 3ORQA 4O33A 1MFZA 3ABZA 1GLGA 3AHFA 5HOQA 1F2VA 2FR1A 3WO1A 4O4IA 2CZCA 4EJ6A 1LH0A 3OFNA 2ZS7A 5JD4A 3VTZA 2PMFA 1R0RE 2FPIB 4INJA 3N5CA 3JQAD 4OLHA 1J33A 1Z0KA 2IPNA 2QQ5A 2AI1A 1PR5A 2J09A 5G4KB 1YUMA 5BN5B 3TUZC 1WCIA 2HK6A 4ZJYA 4G4IA 5D5PA 3P27A 4XGNA 1EK1A 2R1ZA 1VPTA 2W2XA 1CJUC 1NYRA 4B74A 4WBNF 1UZMA 4BPRA 3ANTA 2V8BA 2P79A 3RC9A 3OAAD 1J9ZA 5HRUA 2EW1A 2YHBA 1UPCA 3A3PA 2WG1A 1NXOA 4JWTA 4U2GA 4MI9A 4A0QA 4L2IA 4MVCA 4PLYA 1U6IA 3JARA 3O5AA 3QKUA 5CXSA 3WLQA 1SN7A 5KQPA 2LCFA 4B6GA 3I0NA 2IE0A 2R5WA 4AG5A 3GP8A 3RRJA 3W4IA 1OPRA 3PFNA 1QIGA 2FMKA 3NP9A 3KYDA 3PGVA 3RTCA 1U3UA 4E5VA 2GCIA 4JA0A 1UWKA 2BFAA 4YPOA 1SCUB 1NZFA 2JGDA 3G2NA 4UCFA 4YDRA 2JLYA 1BKDR 4FHFA 2E87A 3AR4A 2JIPA 2JCGA 1KK2A 3KUUA 3FKJA 1LBSA 4MVJP 3I5MA 2H0AA 3RVPA 1QVRA 4DDHA 2F8MA 3L1JA 4E1AA 3KJHA 1G21B 1E2LA 4UKDA 1NVDA 3DFZA 3N2GA 3EW9A 1FDSA 1LW7A 1NU6A 2XADA 5K0CA 3HU5A 3I2FA 4MPRA 4CDGA 4BXOA 1DDIA 4S24A 1KJ8A 2G67A 2ZIUB 5CT9A 1NMZA 1XHEA 1PGOA 4L27A 1S2NA 3OP1A 2WG0A 4QGHA 3VU9A 4P98A 2VHCA 5BQOA 4B31A 2M6KA 2FYTA 2G09A 5BSFA 2DBQA 5J43A 4KLZA 1RYZA 1YRWA 1A8QA 1SCIA 4MX8A 2WSBA 2XDWA 4KWEA 2O2HA 4EHBA 3A1CA 2HO4A 2O2YA 3L8MA 4Y6QA 1JIKA 4TYQA 5KDOA 4RLHA 4Q6BA 4BO9A 1ZJZA 2YWXA 3DDOA 4IFEA 3SX0A 4C1NA 4CG1A 3ND6A 1CTQA 4DMMA 2C7BA 1ACMA 5FLKA 4URXR 1O0CA 3LL4A 5DWDA 3DAYA 4MGIR 4M1QA 1WB4A 2DPLA 4XM0A 4A1FA 1R0SA 1AN0A 3DQZA 3ZK7A 421PA 1NP3A 1RM4A 1TADA 2AZ4A 4WGGA 2ODAA 4LDPA 2R6AA 1VQ1A 2ZBQA 1SXJC 5ALHA 1SVWA 4CM8B 2BTEA 1PWYE 1P44A 5ABPA 4GPD1 1ECGA 2QN7A 4JD5A 5I8ZA 3B2NA 3BT7A 3T3GA 3W3AD 1HI9A 2HM7A 1MNQA 3RBAA 1VRVA 3GLIA 4BP3A 4AMVA 4KOEC 2VHUA 4MR8B 2ZB4A 1F17A 1NUSA 1R6BX 2ANBA 3LFTA 4OB8A 3SZUA 5C1PA 1QF7A 4U6SA 1M6YA 1WNTA 1ZUIA 1WPRA 2P1DA 3AT1A 4YCJA 1R12A 2NZJA 4HUQA 1O03A 5AI8A 1V8DA 3LOQA 3HUTA 1NDQA 1FP4B 2LTAA 3CR3C 4PFQA 3DCYA 3M6AA 5DSZA 5HDBB 1P7VA 1NMQA 3FVWA 1LSOA 2GFQA 1ZNQO 2BCEA 4OU5A 1L7BA 3A3OA 3VAYA 3WNCA 4BLTA 3MRXA 2V54A 2SKEA 1ONOA 1QE3A 2P9GA 4IIUA 4BLRA 4DMFA 3DCJA 1XDDA 4DABA 1ZJYA 2IC5A 1PZFA 3I04M 2Z0MA 4WKOA 4YALA 4M6WB 2AJBA 1HRKA 3O92A 5I7AA 5BW4A 3HYRA 1X19A 2VHZA 2H59A 3L5OA 3OJLA 3OQMA 3MJVA 4QODA 4PVDA 2SKCA 1RFLA 3AW9A 3SZ3A 2F64A 5CU7A 4YROA 1DKQA 3WNDA 3T9DA 3PC8C 1MW8X 4OXKA 1DFGA 1U0LA 3C7DB 4MW0A 3I9JA 2O3RA 4GE0A 1W4BA 3HVJA 4IDCA 2ZZNA 1YUNA 1M3SA 5AFSA 4C7JA 2IHVA 3EIQA 3PC6A 4V0NA 4U0JA 4Q66C 1S2OA 3VR1A 1P75A 1E5DA 5FQOA 2Y8EA 4LG1A 4XX0A 3W6ZA 3ZHZA 5DWVA 2EL7A 4KQ2A 1E3DA 4QOJA 3NJ4A 4KE9A 5JAMA 1R6AA 1JLMA 4PS0A 2BSQA 5TEWA 1QZ3A 3ZNQA 1GRVA 3CLSC 2VCHA 2OKCA 5IW8A 3RJ9A 1FDWA 4NEHB 1XA4A 1ZC4A 3KKKA 4IFTA 3SR3A 3TBKA 5J2UA 1P74A 2I6QA 3K96A 4A6DA 4U2FA 1C1XB 1R5JA 4MKHA 2WHQA 5ECWA 1J25A 1TFUA 3EBLA 1YVUA 4HFRA 3W79A 3VX3A 2W2VA 3LP5A 4HDCA 3V1KA 5LNK6 1E5TA 3K5PA 1KQGA 3FSGA 2D7JA 2GBIA 4R2WA 4UPDA 5LQSA 4CL8A 4XFKA 3K09A 1E4EA 1DHTA 1H6DA 5L7TA 3MBOA 3QLTA 2A30A 4P3YA 4E4YA 2OMEA 2ECOA 2PL3A 2W2KA 1GUYA 1H85A 1M6WA 4HDMB 3SXUB 5K8JB 4QG7A 1L8OA 4KK3A 5KNDD 1XTVA 3U9TA 3FNIA 3CR8A 1YL7A 5BSGA 1YO6A 2VZ8A 3KJEA 3P9ZA 2ZU0C 2HV8A 2QZPA 1UDCA 2NQTA 5H4HA 4A7PA 1UMDA 5KJ1A 4EA9A 1YVPA 2PQ2A 3M89A 4NNPA 5P21A 1YFZA 2BFBA 1V39A 2UYYA 1JRLA 2O2CA 2R96A 4BTEA 1JEDA 2IYNA 1RYMA 5EYPA 3P2OA 4JU9A 4O29A 3RS8A 3CA8A 3RG2A 3ASVA 1CE8A 1N5RA 1P17A 4ED9A 4X64B 3FMIA 4XTCS 1ILWA 5AW5A 2W6OA 1QVAA 2VR1A 2WI8A 4DBLE 1PG5A 3VPHA 5BR8B 4G5RA 1T0BA 1USUA 3F8TA 2B6NA 3MIIA 4GPEA 2VPQA 2WMOB 4O4JF 4YRCA 3LRTA 3IT3A 1FFWA 3UAZA 2FEPA 5ALYA 1RYHA 4AWXA 5L6MB 3A6PC 2NTJA 4N0EA 4ITVA 3OMWA 2I78A 1VIYA 5I6DA 3B1JA 4UBNA 4NESA 3OJCA 5AHWA 4WUVA 3I2KA 1DBWA 1E20A 2GS9A 1UZAA 2DAPA 2QV0A 3BJIC 3KXDA 4FFDA 5ALDA 3QYJA 2R5FA 3QELA 2AMLA 1XF1A 3TW0A 3V4SA 3KYIB 4A03A 5M29A 4Q3CA 1W6UA 5FEUA 1Z28A 1M10A 5ESRA 4FCVA 5JARA 3C6MA 1Z8FA 3DTVB 1M72A 3U6KA 2ACKA 2IS1A 2WKRA 3HJGA 4IJUA 5AI4A 2E7ZA 1IATA 3A31A 3WSVA 5KYTA 4ZOBA 1QP4A 3QITA 3A27A 3ZE8A 2ZRLA 4DLBA 2JFFA 2QVLA 2X40A 2Z6VA 2CNNA 3EOZA 3LDFA 3RVDA 3RASA 3S2YA 4F46A 4HNAB 1QH8B 2VP6A 4YV2A 4LRUA 3BWEA 3GMSA 1YAJA 1XZ8A 2UUCB 1LWOA 1CR6A 2MTBA 4PZPA 2AUTA 4D2IA 4N5DA 4J6FA 2JZOA 2F3TA 3MWFA 2QX4A 1N6LA 2QOEA 2O8DA 2NPOA 4LGCA 3BZBA 3PWKA 4OL0A 4PY2A 2IYAA 3WQHA 3E2MA 3UJBA 2D0DA 3MQ4A 3OJ0A 4JKIA 5JS7A 5ICFA 1X8LA 5JMOA 3T7RA 2OFPA 3KQLA 1EJBA 3DNPA 3LGAA 1NC1A 3TKAA 5LSAA 4DPLA 1W73A 5I7EA 2QORA 3K1ZA 4BLPA 1KVUA 4X92A 3WL7A 1GGHA 4G2NA 1L5LA 4CV1A 3D3WB 2W2LA 3BGSA 3RBVA 2O0JA 5IANA 1F7UA 2HBQA 4YASA 5PNTA 3O95A 1MOQA 1C41A 3NKVA 4F3RA 1S4MA 5DYTA 1ONSA 3GDOA 3TCNA 4DANA 2BBOA 1K2VN 1VLMA 4ZV7A 1Q6YA 3WOVA 4BMDA 3PWZA 4RPCA 5L3QB 4E08A 4I50A 3RNLA 2PAAA 4MVJG 2WJ3A 4EFNA 3GJSA 4J91A 1RJFA 1AH2A 4NMLA 1N2SA 3KJQA 2Y1XA 4MA4A 4B17A 1AMOA 5I7OA 3P0JA 3NBYC 4HI0E 4TUYF 4GOND 1GZUA 3LNTA 3OIWA 4AXXA 4O4LF 1QG6A 4DWOA 3PHHA 4ERXA 3Q7PA 4K6OA 4TKUA 3NQ41 3Q7RA 2JC3A 2XOXA 4O2AA 3UAXA 3WFJA 5HUQA 5JSQA 4NP6A 5TE9A 5LWQA 5B7QA 1DKPA 1UJ6A 4G4JA 1PHPA 3JYPA 3ZY4A 1AMNA 3E7WA 3WMGA 4EY5A 3VKHA 3EF0A 4WEOA 2IF2A 1OLUB 4FFBB 1A9TA 2GZRA 3LIIA 1RBMA 2MMCA 3H5RA 3INNA 3RC2A 1LLDA 3TIFA 2XAUA 1CNFA 1SXJE 4MUEA 4R01A 3H05A 1A8HA 2CE2X 2PZAA 4WFJA 1DKMA 4M36A 1E3JA 2RGAA 3QTTA 3IR5A 4B3XA 3A6KA 1WSDA 2RARA 3N0TA 1XP8A 3R9KA 3KSDO 4AZSA 2PS3A 3LOUA 4IDEA 1TT7A 3UXEA 2ZEJA 4CM4B 1EFVA 3P9RA 1JFFB 1SCKA 3GJ6A 4IYRA 3ZNOA 3GUZA 3AF1A 2NLOA 5EGNA 1P18A 1QH0A 2X6TA 3PYMA 5EUQB 4B6JA 3U60B 4PG5A 1N1MA 2R6JA 4ZHSA 4ZJPA 2GN1A 4JI5B 4GZ3A 5ALSA 4KVGA 4UJ5A 4P8RA 4D3DA 5IBPA 1L0BA 2PZ8A 1Z0ZA 4G3XA 4H4EA 4IBOA 5K9ZA 3KQHA 4OJMX 1E2MA 2ETVA 2WTAA 2AE1A 3ZBTA 4RHFA 2AMVA 2DQZA 3EQ9A 2UVPB 5G53C 3LUBA 3WV4A 5LQUA 2F1OA 1HLFA 2QYOA 2C77A 4FX2A 4HBGA 2R2AA 4K2AA 2R00C 3IJ5A 4N41A 1T0IA 2MYNA 4QXRA 2CD7A 1QC5A 1ZS9A 3VSAA 3WJ7A 4KR3A 3IUYA 4J1SA 1PDVA 2PMDA 3AONB 3L40A 1BWSA 2WNIA 2DB3A 3NAGA 1KU0A 3G82C 1EFPB 3RD5A 4DY4A 1W0KA 2WWTA 2YJZA 4NSNA 1EWRA 3C3PA 4ZCIA 3ZJTA 2QRVA 3A1TA 5HRAA 3HKDB 4P84A 3I01M 3FDZA 1B14A 1FNNA 4B5LA 4O63O 2IZ6A 2WUWE 1HXHA 2OHOA 5IJAA 3UH1A 1AQ6A 4QELA 1NBMA 3NPAA 4BNMA 2GASA 4JBWA 3IODA 4OHYA 1GGKA 1GT6A 1KORA 2DPYA 2QTNA 1Y3DE 4LI3X 3SLRA 2FAXA 3ZHXA 4RFSB 1SVMA 3F9IA 2IS2A 3R7AA 1UT8A 1CYEA 4UFOA 3CLSD 1NW8A 1AZWA 2X15A 2XF8A 4AJJA 4HVLA 4PVCA 3HA3A 1O5IA 3O9VA 1E3WA 4GXRA 1W2WB 3UTDA 3A4YA 5BMVF 4MV5A 4E2YA 1NOKA 3QXXA 1SC1A 1JJIA 1D4FA 1SNYA 1SUPA 4RF3A 1K9VF 2B3TA 3EHDA 1CIVA 4ZVQA 4MROA 1ZNYA 3QSGA 3SYLA 3UB3A 2UXCB 3LC2O 3N2EA 4BVAA 1LCIA 1JSCA 2WB2A 5AR1A 4NBVA 3ESCA 2ZCUA 2O14A 1Q44A 1DX4A 2A1UB 4FT2A 4KBFA 4BFUA 1WU8A 2PZJA 2VHQA 4WUTA 3T1TA 4GE3A 2EBHX 3QKWA 5DYIA 1JPVA 2A0WA 3ZGXA 3GVPA 2AKAB 2JI6A 1MX1A 3ETGA 3PDWA 2BV3A 2O8VA 4D80A 2H17A 1RAIA 4MVJI 4NCBA 1FFDA 2QTVA 4L4SA 3Q9UA 4ZDJA 4J0GA 2PXHA 3EQ8A 2B1IA 3GLSA 2AZXA 1BDIA 1P5HA 3WKEA 4AC9A 4P38A 3WNVA 2HSWA 5CXQA 3UICA 3E5RA 4QTXA 5JASA 2FDCA 1E2BA 2W22A 5EEHA 2HB6A 4NICA 1XZQA 5CXXA 4UTPA 1X8KA 2IYUA 4DAOA 3E4CA 4MAMA 2HCRA 4EAQA 4UATA 4CIWA 4DCGA 2EQAA 4DLRA 4MYSA 2VBGA 1SQFA 1FQKA 2GX6A 4J0IA 4ZZ0A 4KXQA 2QTZA 1H2YA 3OCJA 3VU8A 5A06A 2DEUA 2QTRA 1YE8A 2XUIA 2Q46A 1DDOA 1TK3A 5BPFA 2AJLI 2NTNA 4IJKA 3IXQA 3O2JA 2BI4A 2J0UB 3OWHA 3LI2A 1P80A 4Q7EA 3TLZA 1W0CA 3V5NA 3DMGA 2W0SA 3D6NB 5ELLA 3T94A 3F8WA 3PC7A 5HKLA 2P11A 2FSUA 3OX2A 4FNGA 3P4UA 3RTGA 4Q3DA 1Y1TA 4M9CA 3ZWMA 4YAIA 5DNYB 1U1EA 4BQFA 3B6JA 2ZATA 4ZA2A 3DVLA 1KARA 1ODFA 4K8OA 2C2XA 3I9V6 4RZSA 3LTNC 1OH5A 1IVNA 1V43A 3B3JA 2J33A 4PZ9A 4YRDA 3UJNA 3B6MA 4DJEC 3KJIA 3TOSA 3C6QA 2NVUA 3CPSA 4ROSA 2DZDA 1VE9A 1QYCA 2P2SA 4IIVA 2XUZA 1BGWA 4ON9A 1JIJA 4JP5A 4R6WA 4O08A 4DIUA 3C1TA 5KC8A 5I7SA 1E3QA 3H3JA 4Q48A 2XUPA 3BJMA 4EO9A 3UMCA 4URVR 1M54A 3HCEA 1SBNE 1MABB 3LKZA 1N36B 2QI9F 1EK2A 3VO8A 3RVSA 4MCHA 2O7VA 4H0NA 2VDLB 1U0NA 1RP1A 1JAXA 4QTUB 3AVUA 1X1AA 1IXKA 5ALVA 1FNSA 3FPEA 5ALUA 1KFKB 4GLBA 5BVHB 2JZCA 1EX7A 4GEGA 3FDXA 3PNSA 4NV1A 1YULA 2HI0A 2JJ8A 1UKYA 3EK2A 1UFRA 3JWPA 2PRIA 1S02A 2O3SA 4I6EA 4MIEA 2AEJA 2QNIA 2YJ5A 1XZEA 3JD4A 1UBFA 1G7TA 1UZLA 3RANA 4CQMD 4CM5A 2HBYA 2XMRA 1LBIA 4MIKA 2QSJA 2CUZA 2BEWA 2HJGA 4MIYA 4QWWA 4HB4A 4LXGA 5IDWA 4X7MA 1GDTA 2FU5C 3D2AA 1SOVA 2O6HA 4AF7A 3AJRA 4DMHA 4QBFA 3IS3A 1XFAA 3HVRA 3HZHA 2DP4E 4OBEA 3WRXA 4BEBA 3GPBA 3HKEA 4XR4A 1GGFA 1GPLA 1PV4A 5K0TA 2OXFA 3RVOA 3J81k 1DKLA 1KQOA 2ZJBA 1FX0B 4LZWA 1I2AA 1MORA 1P9OA 3FKSA 3AKDA 3RO7A 1GKIA 3PITA 1CLEA 1NXVA 3JR3A 3JXEA 5LNK1 1TM2A 1OIXA 2ZTVA 2W2LD 2IOHA 3MG9A 2QRNA 4NZZA 5J4HA 5JDCA 3FUXA 3FUUA 3QKIA 2XTJA 2QDXA 1DXQA 1BW9A 2EFCB 4ENRA 4PAGA 3E9CA 1JFSA 2D74A 3NU1A 3HR8A 2HJWA 3GJQA 3OMLA 3SLGA 4D79A 2P6UA 3DO5A 5EIBC 3ANYB 3WQBA 3CQ9A 1L7QA 2JA1A 3MS4A 3U3RA 4XSVA 5HIJA 2YOFA 4G5XA 5IDVA 3PXBA 1PZXA 3OHSX 4ML3A 1YS6A 4PLCA 3THYA 1CVLA 5J23A 4R1TA 2BMWA 2IKQA 1EFRA 2FPKA 2PGLA 4OK6A 4PTLA 1Q77A 3R6WA 3ZUGA 3G6KA 3B1KA 3KP1A 1KEKA 4DDUA 1D6SA 5CT4A 9ATCA 3ECAA 3C4QA 2AG5A 2FSIA 2Q8QA 1H1LA 3LBAA 3CZ9A 2Y1CA 3EA5A 4KYTA 1YACA 2A9OA 4JHXA 4PINA 5KKNB 3O8CA 3TLCA 4H1WA 4PQEA 4BO3A 3C8UA 1E4OA 1NJ8A 4NCHA 2C78A 1M2JA 2P9TA 4RF4A 1Y6JA 4RW0A 1JG6A 1WXXA 1QZXA 2OFXA 3GH3A 2CVQA 1N32B 2XB2A 3CZAA 1EH5A 1YIDA 3AM3A 1NGSA 3NRBA 3RS5A 3HJTA 4HN2A 2BP7B 1M34A 2OHGA 2PKWA 3KQSA 3PQ4A 1N2ZA 4CV3A 3K7EA 2VF7A 5CX4A 1XVAA 1TU3A 2CVPA 3RAJA 4HT3B 1R3DA 1CFZA 2A5FA 4M9XA 3ZXYA 3C6XA 3RIHA 1V25A 4WLOA 4V1CI 1GQRA 3OLWA 5U9CA 1QAMA 2ECKA 3FVQA 5DTQA 1FQJA 4QFMA 1QORA 1YZYA 5CAEB 1LPNA 1SHKA 1I3OA 5B3KA 1XRNA 5DNVA 3FD8A 4HO1X 3TBHA 2X4GA 3HMKA 4DCUA 5BUCA 3RVQA 1L6IA 2ZUTA 1ZIXA 4AX4A 4CFSA 1PVVA 4XIJA 3FTFA 2XA1A 2CFSA 1LUAA 3AY3A 4XGIA 3WJ2A 4A3SA 5ERGB 4YUWA 2BGGA 4F5WA 3NOVA 4F84A 1H3NA 2J48A 3M6WA 3PXUA 3L46A 3W5VA 3U4DA 4BE9A 5AMXA 4L9AA 4I1PA 1YS1X 4ZYVA 2ZIGA 3MB5A 4PZLA 1KGSA 4QA9A 3NHYA 2J5BA 3HP7A 3E9RA 4HDNB 4K87A 4UE6A 4GI3A 5IASA 4GEKA 3DXZA 4HB3A 4TTAA 1V3TA 2F1HA 2P6PA 3G2MA 4ZZ3A 5KOHA 4W8HA 1UBOS 2P4SA 2XR1A 1O97C 2XUAA 3UT0A 1CZRA 1YI8A 4G24A 4ALLA 3WLMA 3EGDB 5DYNA 3U09A 1J8MF 3UKOA 1ZD1A 3O8QA 5JXHA 3ST7A 2Y1EA 5DYWA 5AKGA 3PHBE 1T1RA 2XGJA 1GL9B 1BCSA 3H8VA 1AXRA 2Y67A 5BV7A 5DMXA 4MQEB 1UMKA 1E2DA 4MB2A 4UMVA 5LD2C 1E8NA 1RVV1 1XK6A 2AHRA 1NBMD 2FB9A 2OBLA 1MTOA 4FFOA 4XYEA 3UJ8A 5JOQA 4EHJA 1SBQA 3HCRA 3UAOA 3ZQUA 3ADOA 3EXHB 3DZJA 4ZGBA 2IHKA 3R7BA 2PU7A 2COKA 3JWIA 4YMHA 1M6EX 4NBNA 5KMGA 1KZ4A 3MMPA 3R9XB 2C58A 1MB3A 5KAPA 1TCVA 1XXLA 1IOVA 4F4IA 4F1WA 4X6XA 4QAQA 5I9MA 5IMSA 4MMXB 4K88A 3VHLB 1DADA 2QMQA 3MA0A 4I1OA 2C1EA 4MV7A 3C3JA 3GO4A 3HCAA 3PFIA 2A0YA 4OP3A 3W4KA 5ICEA 4QD3A 5JSZA 3QNMA 4EHFA 2X8BA 3DHVA 3G0DA 4A9AA 4Q4CA 2W98A 3TINA 2UZ4A 2IK8A 2INGX 3T41A 1IBCA 2NW6A 3A05A 4RTLA 1RI4A 1NULA 1SOAA 4UM5A 5TEVA 2NP6A 5KNBH 2Q3LA 4GPIB 1LNZA 2XHZA 4FPXA 4KLNA 3QA9A 5ALNA 3QX3A 1E7YA 4JITA 1XNQB 5ER9A 4XQEA 3RYTC 2ZRAA 3EEQA 4C2BA 5FV4A 3IEMA 1WZIA 1NW6A 1HETA 1W46A 5LQKA 1UMCB 3AVVA 4X85A 4BAGA 2XKAA 4JI4B 4HADA 4G1UC 1Z8HA 5DLYA 4F56A 4OQ4A 2AYZA 3EFEA 3M9LA 1EUQA 2QBYA 1NP7A 3Q5EA 2EX1A 1DKNA 3HCWA 4HMOA 5FBQB 4HV4A 3GFOA 3ELYA 1QIJA 4TV9B 4G09A 4LDNA 1VHWA 3NT2A 5EINA 4J76A 1Z45A 4FGJA 4L8VA 4MR7A 3EAGA 4WK4B 4HEHA 2C61A 2AK2A 3PE6A 1ZXLA 4IFIA 2X23A 3TL3A 4CXMA 1A9QA 1JU4A 3ADDA 3N86A 2PUAA 3ET4A 1TU0A 4WXRA 3WA7A 3E18A 4DJDC 1YCHA 5B3JA 3H0EA 4K28A 1D0SA 1X13A 3ZWWA 5CB8A 4WN9B 1MIOA 5K05A 2ORIA 2JAPA 1CD5A 3CRQA 1U3CA 3WV5A 3UV6A 3ZD7A 1DRKA 1VKJA 4HXEB 4UBMA 4Z9XA 5JMPA 3VO1A 4UQPA 5ALJA 3P0RA 4YMGA 3WB1A 4UARA 2WFLA 2CD9A 2GMWA 3KXIA 4G2TA 4LE0A 5HFNA 4IH1A 3H7IA 2AW5A 3HGMA 3I8OA 1G20A 2C3PA 1NRIA 1ZY2A 2VUUA 1X7ZB 1UFVA 2FFRA 3QNWA 4M0FA 2VDWA 1D2EA 1H8HA 2ZT5A 3K8OE 3VU3A 2Q6IA 4Q1AA 1HYBA 4ARAA 5J2TB 1BXGA 3UA3A 4CUZA 1V96A 5CP8A 1GRCA 3RLFA 3DHEA 3SD7A 4G5SA 4R71A 3T7JA 4ESOA 1CUGA