1Y1PA

X-ray structure of aldehyde reductase with nadph
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde reductase II
publication title X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
pubmed doi rcsb
source organism Sporidiobolus salmonicolor
molecule tags Oxidoreductase
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y1pA01
3BXXA 3EVTA 1TB4A 4FW8A 1U3UA 1HZJA 3RI3A 1WLYA 2UUOA 2HO5A 1GPJA 2ZB8A 1GU7A 1ZK2A 1QYVA 4K9DA 2D2IA 3H2ZA 1NFFA 1QSGA 3C3XA 4GX0A 4EGFA 1HKUA 1WWKA 4HWKA 4CMIB 3MCVA 2QRJA 2PH3A 3W4JA 5A04A 4R68A 4E5YA 5C7IO 1HEUA 3SBOA 2RH4A 4D3FA 4D3SA 3JQ6A 4R9RA 1AUPA 4MDHA 1T2CA 2YDXA 3NEPX 1PEDA 1GQYA 1BSVA 2BFOA 1HT0A 4U7WA 4YR9A 1DSSG 3UICA 2DLDA 3RUCA 2BGMA 1F0YA 3AU9A 5KJ6A 5TQVA 1P0CA 2HKIA 1YB4A 2FP4A 3PP8A 3DR3A 1FDVA 1PZGA 2A35A 2WYWA 3GQVA 1LDMA 3PLRA 3WOHA 5T5QA 4EI2A 3IKVA 3HQ4O 5AQ1A 2NQ8A 4P22A 1BW9A 1PJ2A 4RPKA 1MA0A 4BNLA 1R66A 3H5AA 4J1TA 2E6UX 2NUAA 3F4LA 3G79A 4KTTE 4INAA 3ROKA 3OECA 4OSPA 1PS9A 4GLLA 4O1MA 5I9MA 2VWHA 1KY5A 1YS4A 4OL9A 1GUZA 1Z82A 4CM8B 1I8TA 5L3ZA 1YQGA 4XYMA 3Q6IA 4HFNA 5B37A 4E21A 3ZWXA 2ILTA 4M89A 1EK5A 1GYQA 2HK9A 3Q0EA 3SXPA 1WMAA 1YXMA 2HCTA 3RIHA 1LJ8A 3ICCA 4GH5A 3VZSA 4BNJA 1ENOA 2BI8A 2IEBA 4BQPA 4BO6A 5TGDA 4B7XA 4ZD6A 1ENZA 4TKMA 1SBYA 4U8GA 4GVXA 1LC0A 2X1HA 3GC6A 3KXDA 2EW8A 5DP2A 4WGGA 5B4TA 4CUKA 2FZWA 3JYLA 1H9BA 4YT8A 3MEQA 4ALJA 4E5PA 1UDCA 4M8SA 4BO8A 3HNPA 5F5LA 4AJ4A 2YV3A 4J4TA 2ZIZA 1ZJZA 2AQKA 1PJBA 1XWFA 2VQ3A 1A9YA 1UJMA 4BO3A 3ST7A 4FFLA 2CUKA 4PVCA 2Z1NA 1RM4A 1EE9A 3QA9A 3VOSA 1BTOA 4MVJE 4RZIA 1B15A 4CJXA 3JD4A 3PQDA 4WLFA 1WNTA 1W73A 5DCYA 1O0SA 3CZRA 3ASUA 3X2EA 3L0DA 5LDGA 4RF2A 1VC2A 5TC4A 3OEYA 1QMGA 1VL6A 2HMVA 5F21A 3ZU5A 2O48X 2FPIA 2O50A 4CM4A 5T6BA 1ZEJA 1H0KA 1BXGB 3H9JA 2IXAA 2BI7A 1F14A 1Z7EA 3OIGA 1UP7A 3WQQA 2Q50A 2AEFA 1ISGA 4YRBA 3VKUA 4CMCA 4B3HA 4I1IA 4J90A 4BNKA 4YT5A 3JQEA 3D3WB 4TZKA 5JNLA 4CM5A 4BKPA 4E4YA 4RF4A 3PHLA 3QE3A 3PQFA 4G5HA 4UVHA 4PZEA 4B4WA 3INTA 2W98A 3GFBA 2I3AA 5JE8A 1IZ9A 3I9LA 1LDNA 3FCOA 3JQAA 3FWZA 1PR9A 5ENDA 8ADHA 4CM9D 4BIIA 3ROQA 3P19A 4ZHSA 2I76A 1I33A 4D7AA 3F46A 3ZV5A 5JSFA 3O4RA 5AXBA 1BRMA 2EJVA 4H3VA 4F46A 3CPSA 2UYYA 1CDOA 4E5NA 1C1DB 2I66A 4XIYA 3W6ZA 3LK7A 3HWRA 4IQGA 4KWHA 1ZH8A 2Z1MA 4MOWA 4EITA 1NFQA 3WGIA 2VHWA 1R4NB 3KTDA 1PGOA 2A92A 4FJ2A 3ZWPA 4M55A 4DTIA 3B1KA 4GX5A 4PLFA 2CDAA 3W4KA 1CQJA 4CPDA 4IDGA 1NQ5A 4OIMA 3WQSB 3MWEB 4YAEA 4S1VA 1RYDA 4PLYA 5CEFA 4MVJI 4PVDA 2O3UA 1L1FA 3OHSX 2VNSA 1UXGA 3CEAA 4B79A 5EIOA 4BNMA 4YYZA 3DZGA 1ZEMA 2CF5A 3WMWA 1BVUA 4L4RA 3NTRA 2P4QA 2GUGA 1XELA 4MO2A 3PZRA 3V1TC 3GRPA 1IY8A 1AHIA 1N1EA 2IZ0A 4MVJA 3VZPA 3TFOA 2GN8A 2I67A 5A5EA 2WD7B 3ZV6A 1A27A 3FNHA 3WSWA 1C0KA 1EZ4A 2WJPA 4FFOA 1HE3A 5HBRA 1HE2A 4PRLA 4Q3BA 4DRYA 3NT2A 2Q1WA 3QSGA 1GPDG 1N7HA 1XLTA 4OKNA 1J5PA 2BD0A 2NVWA 2NSDA 2VYVA 2X58A 3BHMA 3PYXA 5KOIA 1X14A 1SB9A 3M2TA 1A7KA 3A28A 4BNGA 4UUMA 2YYYA 3F47A 3PHHA 3OJLA 3PJFA 4W6ZA 1M2WA 4QEDA 3DB2A 1E92A 3PYMA 3R0IA 1Y9EA 4NIMA 3JYOA 3QVOA 4N5NA 4NDNE 4UVEA 4W99A 4ZQHA 3UAGA 2J3IA 4IPTA 1T2AA 3V1UA 4CUJA 2VTDA 5MDHA 4BNZA 4ND2A 3ZHXA 2YHIB 4DQVA 1XEAA 3MJSA 1N5DA 1T2EA 2P5YA 2FR8A 3GZ4A 3VVBA 1PJ3A 3KM0A 3TJRA 1BWSA 3TQHA 1D3AA 4NK4A 3U4HA 1X0VA 1T2DA 4Z0TA 3HE3A 3PDUA 1IULA 1IHYA 2AMFA 4MIYA 4PG6A 2PD6A 2V6MA 1ID1A 1R0LA 4CL8A 4NI5A 4MKZA 3K73O 4XJTA 2YDYA 4QXMA 4CMKA 5B12A 3JQDA 4O6VA 4NK5A 3DBLA 4L73A 3ITDA 3P2OA 1E3SA 1W6UA 3AY7A 1P0FA 3Q1LA 3DBRA 1IHXA 4DMLA 2DBRA 2AQHA 2PH5A 3TZKA 4CM7A 2R2GA 4PLHA 4BNIA 1HDXA 4PG4A 5DULA 3BMQA 3HDQA 1PS0A 2HMUA 1I3NA 2BFMA 1PQPA 3RUEA 1GCUA 4IDCA 2Y1OA 2HAEA 4R1NA 1I36A 1VI2A 1KC1A 1RWBA 3WB9A 2D3TA 3H9QA 4OYRA 3TZQA 2PGLA 3DBHA 5A9TA 2QHXA 2RIRA 3NDIA 3F5SA 4R1UA 2YQ5A 4CQMA 2YW9A 4C7KA 3TZCA 3VH2A 1KERA 2BGLA 1E6UA 1ULSA 4I9HA 4BNUA 1E3LA 1D1TA 4I5EA 3H9GA 1HL3A 1WMBA 3JQFA 4BNVA 4CLEA 1ZXBA 5BR7A 3ONEA 4YAJA 1IYZA 2X0JA 4E2ZA 3ADPA 3WTBA 1BG6A 4A10A 2W4QA 1ZW1A 3H65A 4OJNA 2JCVA 4PZCA 3P2YA 2E49A 5KJFA 3UN1A 1I32A 3UF0A 4J49A 5THKA 2C5AA 1KVRA 2OBYA 4PG5A 1PIWA 2QRKA 4NBRA 4E2YA 1ZK3A 2EP7A 2NTJA 4B7CA 3O8QA 3LT1A 1RJWA 4NFSA 4LCEA 5DCUA 1V35A 4L4XA 5DF1A 2YJZA 1MUUA 1HDYA 1LA2A 2NVUA 1LDBA 4E5KA 2GF2A 3BMOB 3WGQA 4CLRB 4C4OA 4PG8A 4ALKA 1VL8A 2C5EA 5CAEA 5KNLA 4FGWA 5J23A 3H2SA 3RFVA 1ZK4A 3WJAA 2GO1A 3BMNB 5DOVA 1P44A 2H5LA 2BFPA 1JDJA 1I01A 3Q9NA 3QW2A 5F1PA 3BTVA 1NQOA 3LSYA 5IDXA 2Q4EA 2O3SA 1LNQA 4LMRA 1IPEA 2B5WA 4JIGA 3TRIA 3NGXA 4YQYA 4Q3AA 4AJEA 2ZYAA 3GGOA 1JN0A 4M1QA 1QYWA 4EUHA 5F5NA 3U4IA 4CM6A 5ADHA 5IXYA 1P3DA 4XCVA 3FTPA 1Q0HA 2W2LD 2WEKA 3WQRA 2IE0A 4D41A 4E6PA 1IB6A 2BHLA 4HADA 2VT3A 4L8VA 5FYDA 2XAAA 4YAIA 4LSMA 1DPGA 5BT9A 3ZDFA 1IE3A 1MG0A 2ZCUA 1U8XX 3EYWA 4XDZA 1A9ZA 4KQXA 3GFGA 2IZ1A 4F6CA 3SC4A 3TNLA 3G17A 2HSDA 3K9QO 2PFGA 4JBHA 2W2KB 3AFMA 1UXIA 3GZNB 1VJ1A 4MVJD 1KVSA 5ER6A 4CR8A 3E5MA 3I3OA 3EVNA 3COSA 3QWBA 2BH9A 4B4OA 3IAHA 1C14A 1SPXA 4DGSA 1HLDA 5EESA 5KVSA 1P9LA 4Z0HO 3EZYA 3A1NA 3B70A 5TT0A 1MGOA 2ZTVA 5JO0A 1X7HA 4Y67A 1QKIA 1MB4A 4FC7A 3UVEA 4JROA 2Q3EA 4EW6A 1HDGO 4ZVVA 2O4UX 3WNQA 4BO7A 4YRDA 3HB4X 1O5IA 3R6DA 3D5QA 3QLJA 1QYCA 2WYUA 2FZEA 3F6YA 2FSSA 1OMOA 1Y8RB 4G81A 5DBFA 2IXBA 3C85A 1P33A 3WS7A 5FEUA 3GA0A 5IF3A 4JJIA 3VH4A 4XGIA 1JA9A 3PXXA 3IP1A 4CQLA 3WMXA 3ZWWA 4YXFA 4J91A 3OQ1A 1LSJA 5G2OA 5DNAA 4R9SA 4Q39A 2SCUA 3OJOA 3E1KA 4XR9A 4GPD1 4F45A 3MJEA 3I1JA 3GK3A 5CPBA 1LDEA 4XQEA 3QJ5A 1ADGA 2X8LA 3BYZA 4JP3A 3FTNA 2GD1O 1DB3A 1WVGA 3TL3A 4XYEA 3WR5A 2Q2QA 4TVOA 1ZK1A 1FDWA 1UAYA 3B1JA 5G0WA 3KLPX 1MFZA 5ITWA 5JDCA 3W8FA 4IGEA 4YDRA 2DUUA 1YQXA 2DTEA 1T4BA 2VWPA 1DFGA 4J0EA 3DZHA 5JDIC 5A4DA 2VYNA 3DAFA 3O9ZA 3ZW8A 1XCBA 4DA9A 1MLDA 2BLLA 3I9JA 2J3HA 4XRRA 3STHA 3GEDA 2FMUA 2P2SA 2ZB3A 3PJGA 3DWFA 3CMCO 4RF3A 3RJ9A 5GZ6A 3WIDA 4LSWA 4L4SA 1ONNA 1EUZA 5TT1A 3IC5A 1HZZA 4MVJM 3VDRA 2YY7A 4OQZA 2IYOA 4OO3A 3DZBA 5U4QA 4B4VA 3LF1A 4W7HA 2WYVA 4BNTA 1YVEI 1EQ2A 3GUCA 4KUHA 4WJZA 5DP1A 2I65A 3GDGA 5T57A 3FN4A 4CMJA 1Y8QB 3IUSA 1L7DA 2ZCVA 5H82A 1FDSA 2HMSA 4NZ9A 4YRAA 4AJHA 4EJ0A 2DFVA 4GSKA 1FDUA 3AY6A 1EEHA 3VPFA 4U5QA 4IDEA 1P45A 4B4UA 1H6AA 1PL8A 1NR1A 1Q7BA 2AW5A 3H8VA 3TZHA 5L4NA 1R6DA 2D5AA 3AUUA 1PZEA 4R41A 5A05A 3I5MA 5I7VA 3L6DA 4UULA 4DPMA 5KVVA 3JQGB 2NU6A 1OZAA 4TRMA 2AQ8A 1PWXA 2PD4A 1K5HA 3L4SO 2Q45A 4YJHB 3Q2KA 3M6IA 5EQDA 3IUPA 2DC1A 1LUAA 1JAYA 1RKXA 1U1IA 2FR0A 2P9EA 5HWSA 4YAGA 1Z45A 4HFRA 3ZWOA 1KOLA 2ZTMA 3I4FA 4RQTA 4URFA 3RFXA 2PTGA 4BUCA 4IJKA 3NTOA 1YWGO 4JBGA 2OZPA 1E7RA 2X0RA 2PWZA 3OIFA 4FJ0A 1LLUA 5JDCC 5JY6A 4YB8A 2ZYDA 4NU6A 5I8WA 3TL2A 1FMCA 1B16A 4Z9YA 1B8PA 1EQUA 4L75A 2LDBA 3KZVA 1PQUA 2TMDA 4HFJA 5U1PA 4OMUA 1NR7A 3BIOA 2NLOA 3MJ4A 3GT0A 1VPDA 2Q99A 4FBGA 1I3MA 5A9SA 4DIBA 1BXKA 1R4MA 1XGKA 2IZZA 1EBUA 4EEZA 1N8KA 2CF6A 1SEVA 3FF4A 4Q3CA 2O3RA 3JD3A 1YKFA 1Y9AA 1DIGA 3PLNA 4BMNA 3PFWO 3NDRA 3MJVA 4UUOA 1ZBQA 3TFQA 1G6KA 4LVUA 4EBFA 1GAEO 1R0SA 2DKNA 4R4JA 2AEMA 3V2GA 4B8WA 3MOGA 4ZRMA 1Y5MA 5L53A 3DAGA 3HHPA 3JQ7B 1NX6A 3NKLA 3WTCA 5JCJD 5L95A 1YBAA 4BNXA 4WPGA 1H9AA 3SJUA 2V7PA 1VL0A 3WGOA 1E3JA 2GZ1A 4CMEC 3U09A 1K6IA 2EEZA 1E7SA 2CNBA 1NFRA 4J6FA 4JJGA 4AJIA 4BNFA 3I52A 5EMHA 1UZLA 3VDQA 1VRWA 1E6WA 1LLDA 3ZU2A 1N2SA 2WWRA 1DFIA 2G76A 4K1LA 2W8ZA 4LMPA 4NPCA 1GV1A 1YDWA 4RVHA 1M6HA 4HNGA 2C0CA 2BGKA 2PKQO 3RU9A 2E37A 1MFPA 3MJTA 2C2YA 1ZO8A 3UCFA 4YTEA 4XEHA 4BNNA 2UDPA 3K5PA 2YZ7A 5ILOA 3KBOA 4RQUA 1F17A 2TMGA 3B20A 2Y1EA 5CEEA 2NM0A 1YBVA 4OH1A 1ONPA 2B83A 4MKRA 4N5LA 3A06A 4YJGB 1RYEA 1G1AA 2C82A 3GDOA 2C20A 4J1NA 1EVYA 2X5KO 4R51A 4IBOA 3FRJA 5TIIA 3CZMA 1T1SA 4DBVO 1Y5RA 3JYQA 4TVBA 3S2GA 3UKOA 1R4NA 3PHJA 1DIBA 4G65A 4GBJA 1NYTA 3L6EA 5JAQA 1KC3A 4Z9XA 2POQX 5CDGA 2GN9A 1X0XA 3ICPA 3U62A 2Q1TA 4I8XA 2G1UA 4OQYA 3RD5A 3GF4A 2DBQA 4UEKA 4B7UA 4EUEA 4L74A 5ICMA 3NJ4A 4KDFA 2FR1A 5KTKA 1K0UA 2R00C 3LT4A 3HZZA 2HMWA 2WM3A 3VH3A 1DFHA 4RPJA 4II2A 3GVHA 3DTYA 2J3KA 4U6SA 1CETA 4DXHA 4A03A 1WXDA 3TZ6A 5C3MA 1F8GA 3JD0A 3KO8A 1O9BA 4XQCA 4YT4A 1ZMTA 1EUDA 3E9MA 4H7PA 3I9KA 1D8AA 1DC3A 3IDSA 2Z5LA 1EE2A 3BHIA 2VYND 3SC6A 1T26A 1TXGA 4GWKA 2EF1A 1HYHA 2B4RO 2UAGA 3V5NA 1EFLA 4J4HA 1HSOA 1GCOA 2O3JA 4J1QA 5AVOA 4GQAA 5G4KB 1EUCA 3ZW9A 5JW6A 4G2NA 1WZEA 1LRJA 2PZKA 4GI2A 3PQEA 2J5RA 3T4XA 5L7WA 3HG7A 3HN7A 3GG2A 4JX8A 1GUFA 3IJPA 3RU7A 2YFQA 3NYWA 1UZNA 2VOEA 3D3EA 3ZNQA 4K28A 1ENYA 5LC1A 2JL1A 3WGTA 4M54A 5JC8A 3KYDB 1GQ2A 5FI3A 5H81A 5CFZA 3IMFA 3H5RA 4FN4A 1LSSA 1I2CA 1HDRA 4FQ8A 4WK6A 4XIJA 1AE1A 2CVZA 3UUWA 1ISHA 1DIRA 1U4OA 2D8AA 4PLVA 4TRNA 1VJ0A 4WCDA 3LLSA 4UVGA 5DBGA 1MC5A 1Q7CA 4FS3A 4OHUA 3QHAA 2GN4A 2DU8A 1MC4A 1NBOA 1V3UA 3ENKA 4ZICA 3AJRA 3LT2A 4IQ0A 1OAAA 2PA3A 2EKLA 1Y1PA 1K89A 3WYBA 1ARZA 3W6UA 2X4GA 1XU9A 3H6KA 4RDHA 1LDYA 2NNLD 4XZ3A 1C0PA 3DMYA 1U2DA 3G1UA 3ABIA 2I9PA 3KYBA 3W8DA 1TI7A 5C7LO 4IXWA 1V0JA 1XKQA 4RVUA 3BMCA 4A5OA 4CLDA 1TT5A 5IN4A 2GZ2A 2C7VA 5HS6A 1GL3A 4P4LA 5DT9A 2HU2A 2X22A 1XHLA 4RDIA 3FHLA 2NU7A 1NXQA 4CUZA 3ZN2A 3LT0A 3EW7A 1CERA 1LQTA 1ORRA 1GEGA 2F1KA 2I3GA 2Y67A 5TF4A 3D0OA 1ADFA 3ZGYA 3KV3O 4R1TA 3GRKA 1QXSA 5TX7A 3JD1A 3EDMA 3D7LA 3EHEA 4FB5A 3QY9A 5IZ4A 1HE5A 2HLPA 2V65A 3E18A 3EGOA 1A72A 5COAA 4ZQEA 5HTOA 1ENPA 5G0TA 3DHYA 6LDHA 1PJCA 4WLUA 1RM5A 1E6EA 5AXAA 2PZMA 3SVTA 4LRTB 4JCOA 5DOZA 2X5OA 1UXKA 3NAQA 4RGBA 5EQFA 1U28A 3TSCA 3KHUA 4BVAA 4FOOA 2AG8A 3C8MA 2YQ4A 3V1YA 1RM3A 1PTJA 4WE3A 3VAZA 3LF2A 4JXKA 5L45A 4DLLA 4DIOA 3Q3CA 2HRZA 3VZQA 3F3SA 4R1SA 1QR6A 3KVOA 3OIDA 3OQBA 3NT5A 1FJHA 2JHGA 4MINA 2JHFA 4EDFA 5IN5A 3NX4A 3HDYA 1K6XA 4W7IA 3BTOA 3GGPA 1CJCA 1N9GA 3ZNNA 5BQFA 3PJEA 1YDEA 2C59A 1EDOA 2Y99A 4KZPA 1TT7A 2V6BA 4TRRA 4I9UA 3LC7O 4WOKA 3RBZA 1FF9A 1PL6A 4IIVA 2QW8A 3GVPA 1CYDA 2DAPA 4P4NA 4KWIA 4CODB 2VT2A 4IINA 4RLHA 5KCZA 2NTNA 1QYDA 3ZU4A 1PR3A 2IEDA 1U8FO 5IZCA 3SEFA 1OOEA 3ZWCA 3KEQA 4ND4A 3WBFA 3WSVA 5I7SA 3E9NA 5KJCA 1JTVA 4CLOA 4IM7A 1FDTA 3N74A 4JN6B 3JQ8A 4BNYA 1NAIA 3ZU3A 3IP3A 4K6CA 4YVFA 1P1FA 1E3WA 2JCXA 1DLIA 2BF7A 1SMKA 3S55A 1Q7GA 1ZIDA 2PKQP 1S6YA 2DM6A 1P77A 4IDAA 1X1TA 3FBTA 5GZ1A 5TLSA 4U0JA 3K6JA 1ZJYA 4XB2A 5FI5A 1HTBA 1PJLA 1JKJA 3AU8A 1D1SA 3GHYA 3NDJA 3KSZO 1I2BA 1AHHA 4YJFA 4BV8A 4CM4B 5B1YA 1IUKA 2VCYA 1B8UA 3FR7A 4E33A 1WDKA 1ZUD1 3WYCA 3ANLA 1YOVB 3RBVA 2H6EA 3C7DB 5FFFA 4TMFA 3ETEA 4CV3A 5IFLA 5HM8A 4NJMA 3QVWA 3AOEA 2CY0A 2HK7A 3EC7A 3DOCA 2D5CA 3CKYA 4A26A 4TKLA 1CF2O 3RUAA 1KBZA 1AGNA 4BO4A 2CDCA 4XDYA 4BL5A 5CDSA 3WIEA 2FHSA 2O4CA 3JQAB 2P9CA 3DC2A 2P9GA 1GZ4A 2JAPA 1J6UA 2OBNA 3PHGA 1C1XA 3ZWYA 5KKCA 1E3EA 1PZHA 2V6GA 2ZTLA 3K8ZA 4PCVA 3QIVA 4ND3A 3MJCA 4NR0A 4IUYA 5JAIA 2QZ9A 2WSBA 2YUTA 5F1OA 5JC1A 2ZQYA 1XYGA 2J3JA 1E1LA 5A03A 1HDOA 3EUWA 1DDOA 4H15A 5ITVA 4W9NA 1ZSVA 5EINA 1LI4A 2HJRA 1V6AA 4YBZA 5TNXA 1Q1NA 2OO5A 2CVQA 5IZCC 3GG9A 3MTJA 2DTDA 3GUYA 3FBGA 1F12A 1YB1A 1H6DA 3W4IA 3I83A 2AE1A 1GY8A 5CP8A 1PGNA 4NH4A 4E2XA 1DRWA 1DIHA 2RH8A 3JQBA 4AL4A 4J2OA 1GADO 3P5SA 2JFHA 3U4DA 1E1KA 2DFDA 3ZNPA 4J1SA 3JSAA 4IS3A 4U0KA 1P1IA 1YONA 2X0IA 1DC6A 2VZ0A 4KP7A 3ROPA 4WCFA 2DBVO 5TS3A 3FPCA 1ISFA 1QRRA 3JQAD 3TOZA 3E9QA 1I2ZA 3QWAA 4ZQFA 3OA0A 2VRBA 4GX2A 1GYRA 3RCBA 4AJPA 2Y0DA 3WGYA 4Y98A 3F1KA 4BGUA 2H1SA 3TPCA 1QLHA 3KSDO 3AM4A 3O26A 1PX0A 1NM5A 2CD9A 1DIAA 2WMDA 3DO5A 2FOIA 4M49A 2FN7A 4DPLA 2Q2VA 3WGHA 3GY0A 3AOEC 4GKBA 1HWYA 3ORFA 4OXYA 4GMFA 2A94A 4QFCA 1FXSA 4W4TA 5JCXA 4O5OA 5C7OO 1XIVA 5IDQA 2HJSA 4XYLA 1OC2A 3U9LA 1LSUA 1Z75A 2YV2A 3GN2A 4BB5A 4YPOA 3C1TA 2O2YA 3ZV3A 3L4BA 3KYCB 1P1JA 3IKTA 3JQFC 1VJTA 1GDHA 2NVBA 3UCXA 2J8ZA 1P1HA 5L40A 3S2FA 4DLAA 3UCEA 2Y1GA 3PRJA 4P8RA 1NVTA 3T7CA 3NJ8A 4R54A 2ZTUA 1KVQA 4DLBA 1U5AA 4W9NC 1DRVA 1NTOA 2JFFA 2BKAA 5EN4A 4N5MA 4ZJUA 1MX3A 1XG5A 2WTBA 4IJVA 3K96A 3RKRA 5CDYA 4PRKA 4RVSA 3GR6A 1WPQA 1ZSYA 2HQ1A 1Z74A 3QVXA 3DOJA 4P38A 2H9IA 3JTMA 4ZN6A 1YJ8A 4FOSA 3ZV4A 3DBLB 2CZCA 4DL9A 3RJ5A 4FCCA 2VYVD 4Y6SA 3UH1A 3AM5A 2BMAA 1DAOA 2QYSA 3DBRB 4FFMA 5LCXA 3HFSA 3PEFA 4CMAA 2EW2A 4JJFA 3BMQB 4WCFC 3NT4A 2J5QA 3W8EA 4FR5A 4HXYA 1B8VA 2RHRA 3E48A 3IQDB 2G5CA 3UGKA 5JO9A 3B1FA 3JD2A 2CVOA 3DZJA 3ZHBA 1A5ZA 1UP6A 1PWZA 5U9CA 4BGEA 3WGGA 2PV7A 3K92A 3B6ZA 2VUUA 3CIFA 4UUNA 1DHTA 1U5CA 3VTZA 2GASA 4DC0A 3L07A 3IJRA 5CG1A 9LDTA 1HXHA 3DBHB 4NG5A 1P1KA 4XRGA 3RWBA 1JVSA 1PJQA 1Y6JA 1JWAB 4D79A 4XYBA 3JQ7A 4D43A 1W8DA 5HA5A 5BNIA 5ICSA 3GPIA 3OEWA 3H9UA 1GZ3A 2EJWA 5A5FA 2PZJA 4MP3A 4KQWA 5COBA 2EG9A 2OUIA 2W90A 5A02A 4YCAA 1A4IA 4FFNA 5G0SA 3VVCA 4NU5A 3RC7A 3A4VA 3QWHA 5TSDA 3KUXA 3OJFA 2PZLA 1S7CA 3BTSA 4R3WA 5ENVA 1ADCA 5FWNA 1E77A 2VZ8A 4TQGA 3DMTA 3RVDA 1OBFO 2PKRA 4CMIA 1H94A 4OXKA 2GNAA 1SC6A 5EJ2A 3WWZA 1HDZA 4QO7A 2Q46A 3LVFO 3D1LA 2PR2A 4CV1A 1WW8A 4D45A 2Y93A 4D46A 3N58A 3O8QB 5H83A 1ZZEA 2GERA 2Q1SA 1ZCJA 3DFUA 2JD2A 4E3ZA 4MVJF 1DHRA 4OM8A 3SLKA 1EK6A 1T2FA 2JD1A 4IQ8A 5JBIA 2J6IA 3PVZA 4BNWA 5I9LA 2VNAA 2NVUB 1E7WA 3X2FA 4EEXA 3DAPA 4DQUA 4UEOA 3G1TA 2C7GA 3WGZA 4MVJG 1BDBA 4I5FA 1K3TA 1H2BA 4K6FA 4YAKA 5B4UA 4BGVA 4ESOA 3LQFA 4QQRA 4CQMD 3M1AA 3WBBA 1KEVA 3ZWVA 4XB1A 3DZFA 1ZXLA 4NFHA 3GNTA 1X15A 4YQZA 4WKGA 3ITKA 4LW8A 2PK3A 3JQ9A 3F1LA 4FPXA 3OSUA 1I24A 3WFJA 3WICA 4F3YA 1KEUA 3CXRA 1A71A 3L6OO 3WFIA 1H2HA 1MV8A 4CM3A 3U49A 4WEOA 2QIOA 5T8KA 4WNIA 3ZWNA 1DJQA 4IXTA 4IMPA 4CM8A 1DLJA 1DAPA 3QQPA 3GMSA 3PJDA 4LK3A 4TZTA 3BHJA 4WLNA 1F06A 4H16A 1X13A 4JLWA 4AJ2A 5DN9A 3G3EA 3ZWBA 2OFPA 4NBUA 5A3VA 4NBTA 4J3FA 1KYQA 1NVMB 2XOXA 3OF2A 2ET6A 2GSDA 3U0BA 4I5GA 4E2WA 4PG7A 4RF5A 1M6WA 2OL4A 3S1LA 4IDFA 2PGJA 1R37A 3HFGA 5FF9A 2Y1CA 3TWOA 5JYEA 4GAEA 4D44A 2PD3A 4Y6RA 3FPLA 2VHYA 1DRUA 2EGHA 4ID9A 4I9NA 1E1MA 3EK2A 4OSOA 1YGYA 4WUVA 5L7YA 1JKFA 1I5RA 3AWDA 5GY7A 1EMDA 4FIZA 2D4AA 1LSOA 3AUAA 4R16A 2O23A 5L7TA 3DQPA 1IZ0A 1QV6A 4YJDA 4A27A 1U3VA 4R3NA 5CDUA 4KOAA 5C5IA 4CM9A 1PGPA 3BAZA 4ND5A 1NPTO 2EP5A 4Q3EA 1W4ZA 4IGFA 5ILGA 1HYGA 3OJ0A 4IMRA 2OORA 3OICA 1NHGA 3INGA 2B0JA 3U4CA 5JMWA 3WDSA 2UVDA 7MDHA 2ZJ0A 5DCWA 5KJEA 4UAGA 5DBIA 1H6CA 1YL7A 1SO8A 2C54A 1LDGA 4JQCA 2EKQA 3AI1A 5MGBA 1NQTA 2NWQA 2NADA 3VKVA 2O3TA 4DWVA 4ALLA 1BXGA 1O6ZA 4CQLB 5JY1A 4XQ9A 4WEQA 4JBIA 1DJNA 2Y0CA 3VC7A 4JP2A 2DPHA 3UXYA 2CSUA 3D3WA 5BNFA 5T8KC 1NASA 3WX0A 3QWFA 1UP4A 3QWIA 2GGSA 4QECA 4Q3DA 1PS8A 4DPKA 1L7EA 3F9IA 4A73A 3KETA 2I99A 4RVDA 4XX0A 4R5MA 1ONOA 1U3TA 3ASVA 3AUSA 5KKAA 5IXSA 1DC4A 3BA1A 1KVTA 1GEEA 1NNUA 1ZSNA 3OA2A 3WLEA 2I6TA 1BHSA 3H3FA 3LU1A 4AICA 3NUGA 3RSHA 8LDHA 1K2WA 2EXXA 3FWNA 1KEWA 2IRWA 3G49A 4II3A 2JJYA 2NU9A 4MVJP 1GR0A 3G0OA 1C1DA 2ZATA 3Q9UA 4DUPA 1E0DA 1M67A 2VHXA 4EJMA 5IDWA 3GHHA 1Q0LA 3GNSA 3LZ6A 2D1YA 4X54A 2OXIA 2FY8A 1HF3A 4GWGA 5JPIA 4AJLA 2ZB4A 3HDHA 5CHEA 3PZBA 3D4OA 2WD8A 4FFRA 1V3VA 4GKVA 4NBVA 3GH3A 5CDTA 4E13A 3RC1A 1RM0A 3ETGA 2FWMX 4ALMA 1XQ6A 2B4TO 5GZ3A 3S8MA 2X9NA 4RJTA 2NQTA 3LC2O 2OMEA 4CMGA 4DQXA 2UV8A 3ULKA 2R6JA 4RVGA 3WJ7A 4E12A 3PTZA 4P4GA 4A7PA 2DBZA 3GLQA 4NFYA 3DHNA 3ZH2A 3BZUA 3K2EA 4JNKA 2GPTA 5G4LA 4AJOA 3GVIA 2DPGA 4TROA 4YEDA 3P7MA 4M87A 3ZZNA 2CMDA 4RORA 2FPPA 1Z6ZA 2GCGA 4IZHA 2RAFA 5I8ZA 2WD7A 3ETDA 1M66A 3RUHA 1OI7A 4CMBA 1N1GA 5IAAA 4XJSA 2PGDA 3QP9A 1VKOA 4XYGA 1SAYA 3R3SA 4NBWA 1TVEA 2Y68A 3D4PA 5I9NA 5AOVA 4RVFA 3VPGA 2EKPA 1NP3A 1GYPA 4ROSA 2JD0A 4HNHA 1HETA 1XR3A 3CUKA 3DONA 3KSUA 4OOFA 4HX5A 5JMPA 4RV9A 2AA3A 2WDZA 4W82A 4B3JA 3GNQA 1SZJG 1PL7A 4QT0A 4BV9A 3OFSA 3ZI0A 2GZ3A 5TJHA 1W0CA 4RCVA 4Y6PA 3RUFA 3AI2A 3U5TA 5KIAA 3I23A 1LRKA 1ISIA 2Q1UA 5AXDA 2GN6A 3HDJA 2YHIA 3WLFA 4E31A 3PWSA 1U7TA 2WE8A 5A06A 3EMKA 4FFPA 3E03A 4FDAA 4DIFA 5BSGA 4ZQGA 5CEJA 5A9SB 1UUFA 5HS4A 1R4MB 4ZQBA 1E5QA 4ALNA 2B69A 3BTUA 1KETA 3LYLA 2F00A 1DC5A 2D0IA 4PLTA 1X7GA 2PLAA 2EWMA 3DDNA 4R69A 4EJ6A 4ITUA 4LN1A 3N7UA 1PU2A 3KOUA 2Y0EA 4L0QA 1WDLA 4JGBA 3OH8A 2VWQA 2VRCA 5AXCA 4XKJA 1DEHA 2P4HX 3D5TA 2AQIA 3TN7A 1YRLA 1JWBB 3VPXA 5L51A 3NV9A 1ZFNA 3RBXA 3AK4A 5CPFA 1JAXA 5ER9A 1WAMA 1ZMOA 1V3TA 2RHCA 1YOVA 4ZRNA 3PIDA 3S2IA 3GAZA 1C0LA 1NPYA 5K9ZA 4BGIA 2B4QA 1YO6A 1P31A 1PJTA 4ILKA 4E0BA 1B26A 3QVTA 5B4VA 1JVBA 3W1VA 1TEHA 1JLLA 1HSZA 1D4FA 1NPDA 3E6AA 3PPIA 3UHAA 4NMHA 4QSMA 1E3IA 5JLAA 2DUWA 4KUEA 5T67A 3ZNOA 3ZWMA 4AJKA 2EERA 3D64A 1C3VA 4XR4A 1X7DA 4RPGA 3GEGA 4O0LA 2A4KA 1O94A 3V2UA 4Z0PA 1UXJA 1BW9B 1DXYA 3F5QA 3VPHA 3FI9A 2FRDA 1EFKA 3MOIA 3SLGA 1BVRA 1BGVA 4IDDA 4LGVA 5C37A 3L77A 3ENNA 4J9VA 4DVJA 2HK8A 1Y81A 2JCYA 4NHEA 1A4UA 2W2LA 1V8BA 3ZHYA 4UVDA 4WNCA 1JU9A 1NWHA 2VUTA 2X9GA 2GDZA 3IS3A 2Z95A 1U7HA 1OC4A 2P5UA 4GL4A 3BMOA 2G17A 4PLGA 5I7EA 1O89A 3A14A 5BNTA 4CLRA 1E1NA 3I6QA 4LRSB 4Z6KA 1YL6A 1SB8A 5I7FA 1P1RA 1SOWA 4OKIA 4MP8A 1E7YA 1WZIA 3AI3A 4S3MA 3ANNA 2ZB7A 4AFNA 1FK8A 1I10A 1HRDA 4QUKA 4QO8A 5TRTA 4PN3A 3RUIA 4MJLA 1R16A 2OP0A 1AXEA 3BMNA 4E30A 1UR5A 1JKIA 2DVMA 1LC3A 3PK0A 1N7GA 3CMMA 3WG9A 1T24A 1XQ1A 4PIVA 1PSDA 3GVCA 3UFXA 2EHDA 4Q9NA 3PYLA 2Q4BA 3O38A 2WE7A 4CR7A 2OP1A 3E5RA 4R5HA 3OETA 4O59O 3D4NA 2OGUA 2EV9A 1GV0A 2H63A 3GOHA 3KYCA 3Q11A 4BOYA 3KB6A 2JFGA 4IJUA 4WLOA 4IS2A 1LU9A 2IODA 3LDHA 4GSLA 3WXBA 1BMDA 2OHXA 3C1AA 3ZCXA 2I5PO 1EDZA 1ZKMA 4C7JA 3PIIA 5JAZA 3H5NA 1IL0A 1EVJA 2W2KA 4DBZA 2FSVA 1AN9A 5AYVA 3GZNA 4WLEA 4GGOA 4IY1A 3VTFA 2CDBA 4GVLA 2QRLA 5ES3A 3CINA 2C29D 5JFOA 1R15A 2BELA 2Y1FA 2B37A 3I6IA 1GTMA 2E48A 5L9AA 4ZA2A 3UW3A 4DYVA 1X1EA 4WECA 1UZMA 2AEJA 3RC9A 4ALIA 4FC6A 1QLJA 2IYPA 4PFJA 4HV4A 1LTHR 2E4AA 3ZWAA 3BMCB 3H9EO 1ZNQO 2RCYA 1PJSA 1TT5B 1B0AA 1CIVA 3S2EA 4BKUA 4CL3A 5L4SA 1J49A 1Y8RA 4B8ZA 4AJNA 5L4LA 3GDFA 1VSVA 2XXJA 3OP4A 3FNGA 1H93A 1UXHA 4UUPA 1KVUA 3CTMA 1T25A 1P74A 4ZGWA 4PLCA 1OFGA 5A9RA 3HSKA 4J0FA 5KVCA 3NTQA 5A3JA 3Q2IA 1XSEA 1ADBA 5F1KA 1J4AA 3JV7A 4XD2A 4BKOA 1GQQA 1I30A 4CLXA 1JW9B 1H5QA 4MIEA 2PY6A 4L9RA 1M76A 1O95A 1QV7A 3AOGA 3AW9A 1VLLA 2BFAA 3ONFA 4BO2A 5EL0A 3MWDB 3SJ7A 1TA4A 1MXFA 3C7AA 1UAGA 3OBBA 5CG2A 4R01A 3DTTA 5DDIP 2GRAA 1B7GO 3DZIA 2VRCD 3KLMX 4OGWA 3H4VA 3C1OA 4J7CA 2Y05A 4CM1A 3L9WA 4PGFA 2VWGA 2P91A 1VE9A 2OOSA 1U4SA 3QV1A 4LCJA 5IG2A 1IOLA 4Q3NA 3E82A 2VUSA 4HY3A 3M1LA 2JKVA 3JYPA 5GMOA 4LISA 7ADHA 3TOXA 3ONDA 4D42A 1PGQA 3TF5A 1YL5A 1ISMA 1Q2XA 1QORA 2X23A 1PGJA 4BO1A 4BO9A 4BB6A 3TDKA 4RPHA 4O63O 1LLQA 4J7UA 3VPSA 5IDYA 2GR9A 1HE4A 1Y8QA 1B2LA 4J7XA 3IL2A 1H6BA 1N9GB 3OQ6A 1E7QA 1ISJA 3LLVA 2NACA 3UOGA 3EZLA 2GYYA 5A1TA 2D59A 2Y66A 4RPLA 1A7AA 1MG5A 2NU8A 2XPCA 4DMMA 3RC2A 1WDMA 4TSKA 1B3BA 1YJQA 5COQA 4FD3A 1TLTA 3PHIA 2NTVA 1LEHA 4AVYA 4DYDA 3PI7A 1YB5A 2HDHA 3JQGA 4IJWA 4BO0A 4YJHA 3RUDA 4A0SA 4BMVA 3EAGA 4BO5A 3OM9A 2YV1A 2A9FA 3PGJA 4UREA 4D0SA 1QP8A 1QG6A 2O3QA 1HLPA 2RBEA 3E8XA 1JQBA 2J5KA 4CLOB 3GGGA 5JCJA 4EZBA 3JQ8B 3ROMA 1NHWA 3R3JA 4PLWA 1GUYA 3T7EA 4BMSA 1R12A 2HMTA 4Z3DA 1E3WB 4J16A 1E5LA 2BRUA 2NV6A 4E5MA 2FPGA 1PJ4A 3JCZA 5JDIA 3AUTA 4LVCA 1GZ6A 2UUPA 1C0IA 2QX7A 2ZK7A 4YWJA 4TWRA 4Y9DA 3K2BA 2QG4A 5KVQA 5T64A 1Q0QA 3HJAA 2AXQA 4CMHA 4HUJA 4N18A 3JQBC 6ADHA 3DL2A 3A9WA 3I4CA 4HFMA 3RFTA 5JXWA 1CWUA 2X7HA 3GN1A 4Y8VA 4YJFB 4E32A 5JS6A 4RL6A 4XGKA 1G0NA 1UDBA 1R0KA 1WP4A 3CSDA 3F4BA 4J43A 3DFZA 4PLZA 4ONEA 1O8CA 1IPFA 1LQUA 2ZYGA 1SCUA 5THQA 3DOOA 1G0OA 1ZVMA 3C7CB 4YACA 1I3KA 1DBVO 2VN8A 3PDJA 3PWKA 4NJMB 4OAQA 4HBGA 1B14A 4NJOA 3ZHZA 4PLPA 2HUNA 1V9LA 2X86A 5LDHA 1Y7TA 1VM6A 4CR6A 4HKTA 4CV2A 4U6QA 5BSFA 3HUDA 3AM3A 4CQMB 4FJ1A 2V6FA 4QFDA 2VZ9A 3RAJA 4IIUA 5K6AA 2G82A 1VSUA 3FSRA 4YA6A 1C1XB 1LX6A 2Q49A 4OOEA 1YQDA 2DT5A 3L4BC 1EBFA 4KTVE 1YH3A 4RZHA 4CLHA 2B5VA 4UEJA 4DREA 2X6TA 4BKRA 4J4BA 1B3RA 3FNFA 4GGPA 1DO8A 4ZU3A 1M75A 2X0NA 4NQZA 1VKNA 2VOJA 3VZRA 3K30A 1LRLA 3NGLA 3GMDA 3PFFA 4N54A 3AY3A 4BHTA 4KMSA 4K26A 4WOJA 4OXNA 3AFNA 1HYEA 1T4DA 1EVIA 1UDAA 1KY4A 3KEOA 4CV0A 4D0RA 4KUGA 2X9VA 3GEMA 5BSHA 3T4EA 1NAHA 2QYTA 1XU7A 3ANMA 4TRJA 4BNHA 2Y1DA 1F8FA 3V8BA 2Q2WA 3VH1A 2B35A 2IDZA 1J0XO 4F6LA 2AE2A 4MVJH 5KJ1A 3CE6A 1MP0A 4WCFB 1XA0A 3H7AA 4J9UE 4YJGA 4PZDA 4QX6A 4XQGA 2E82A 2ZJ1A 3HN2A 3OJEA 1RPNA 4DC1A 5JAMA 4EYEA 4IDBA 4AG3A 3I9MA 3C24A 2ZKLA 1KIFA 2X5JO 4GLOA 5TJ9A 3INRA 1QYXA 3PWZA 4XGNA 1U2GA 1CEQA 1AXGA 1KEPA 5JYDA 1ZK0A 1Z7BA 3H3JA 3GAFA 5KWEA 1U3WA 1D7OA 5HRUA 4AJJA 1K6JA 4GX1A 4N7RA 1T1RA 1EVZA 1GFSA 4RLSA 2HRBA 5EPOA 4B3IA 2DQ4A 3RQSA 4BQRA 4MPDA 4RO0A 1I0ZA 3M2PA 2O7QA 2ZQZA 4CMEA 1XDWA 4GMGA 3SX2A 3DBVO 4FGSA 5G0UA 3WYEA 5K6AC 3L9XA 4KDEA 2B36A 1SOVA 1NWCA 1KS9A 1CRWG 3RROA 3JYNA 1YE3A 4MP6A 4BKQA 1N92A 3HB5X 4WLVA 2VHVA 3VHRA 4UVIA 3LC1O 4L76A 2XXBA 1BDMA 4FSHA 1LXCA 3QVSA 5G0VA 1YBMA 2AG5A 2XF8A 2GLXA 3DEYX 3DMTC 3ON5A 4J2HA 5EERA 5G4KA 3U3XA 2AHRA 3WNVA 2CFCA 3DHEA 4I08A 1Z73A 2O2SA 3HADA 3KRTA 3EY4A 3IOYA 1UH5A 3R1IA 2DTXA 3I9OA 3OMLA 3O03A 4A2CA 5BSEA 4NNJA 3FNEA 2QQ5A 1PQWA 3GVXA 1SEPA 3MTGA 3ADOA 4Z9FA 1BXZA 4MKXA 3K31A 2QZZA 3I9NA 5IJZA 3KYDA 3PGXA 2G0TA 2VTEA 4YT2A 4M86A 4ND1A 1NQAO 4XA8A 3RKUA 3IIEA 2YFHA 1HDCA 2C2XA 3QRWA 2JAHA 2LDXA 3FD8A 4D3DA 3MZ0A 1PZFA 3V2HA 3DXFA 9LDBA 3NRCA 4IZIA 1ULUA 2PNFA 3CH6A 4XWYA 3JQ9C 3DZKA 1LLCA 1NVGA 4MIOA 1DOHA 1E7MA 1ML3A 2P68A 3JQCA 3RASA 2C07A 4WASA 1I3LA 2R00A 4EUFA 1GD1O 3GPDG 4QTZA 4HP8A 5K0ZA 5F3RA 2EGGA 3FR8A 4JK3A 4Z3KA 5DZSA 3WWYA 1CQIA 2EIHA 1U9JA 4I5DA 1SNYA 2YHUA 4BS9A 2O7SA 4AJ1A 1MXHA 1LBEA 2VHZA
chains in the Genus database with same CATH superfamily
5AQEA 1HG1A 3RI3A 3ZGXA 1WLYA 1P18A 3LHIA 1ZMRA 1WCXA 3NPMA 4IIFA 4DANA 3QX7A 3PFCA 1S02A 3EXG1 3ILHA 3IOEA 3E22B 3EWSA 1H2RS 1NFFA 1LK0A 1QSGA 1EP3B 3H2ZA 3HV0A 1HKUA 3NJRA 4EGFA 4MW5A 3DM5A 2QRJA 5H59A 3UIEA 4CMIB 4RTMA 2AR9A 3HV2A 4R68A 1QKKA 3U0VA 1IVNA 4AB1A 2C9OA 4QTUB 5C7IO 1HEUA 1N6OA 4AYXA 3AY0A 3LLCA 3OAAA 2ZSJA 4KACA 4MW1A 4D3SA 4R9RA 4DQLA 4X94A 1N0IA 3B6IA 1E99A 4X6XA 2M6KA 1GQYA 1BSVA 2CCGA 1HT0A 3NHAA 4PXSA 3S1AB 1DSSG 4FCTA 1Z4KA 2OHOA 4YRPA 4D8VA 5ALJA 3AU9A 2YWGA 4DZRA 3B53X 3VC3A 3QXSA 1SXGA 1XT6A 3H1FA 4HTFA 1GRCA 3HJFA 1Y4SA 1V8DA 3KQWA 2XCUA 5IRCD 4RSMA 5JXGA 3NXSA 3GBVA 3WOHA 1FMJA 2FI1A 4NVRA 1UM9B 4L07A 3IP7A 3PITA 3HRKA 3BS4A 1UPCA 3I64A 3LL4A 5BN3A 5JQWA 3NALA 3TRJA 2HNKA 3IUNA 5BV2P 5JZSA 3DF9A 4ZMRA 3LDFA 1L5HB 4LBWA 2DPXA 2E6UX 4X84A 1MOPA 2ZZNA 2F1OA 2WQ6A 1GP2A 1GU1A 1K7CA 4INAA 1HQCA 2XT0A 1SOUA 4HDKA 4X66B 4JI2B 5AW8A 3ZJUA 1M7HA 4GLLA 5I9MA 3VSCA 1ULBA 3TSWA 1KY5A 1MH1A 1YS4A 5K7SA 3T61A 1I8TA 5DMXA 4XH9B 5L3ZA 4DR2B 5KO2A 5KX5B 2AKYA 4INOA 3ZWXA 4E21A 1TCAA 4KXXA 1KI9A 2HK9A 3Q0EA 2VUIB 5CIWA 3SXPA 2HCTA 4QG7A 2WBLC 4GH5A 1T8WA 4OQNA 2FWNA 1UQRA 2XE7A 1BROA 4FSXA 3NC1C 4G9GA 4E70A 4BQPA 1PVDA 3A9RA 3SI7A 4BO6A 4EYKA 3IELA 3TLXA 4B7XA 5AKJA 5K20A 3F9RA 4A5SA 1YGPA 1EXWA 2X1HA 2EW8A 4IX1A 5LMCA 2EARA 4WGGA 1CUHA 1W29A 5B4TA 1QRSA 4CUKA 4G2TA 4DLXA 5B7PA 1Z7GA 5BQXA 4F3KA 2YY5A 4IRXA 4NOJA 2AXEA 4YT8A 2J3MA 5FJIA 5AW3A 3W5SA 2I4LA 1XQWA 4D4IA 1EFDN 1UDCA 2FQ1A 3N0VA 4H7EA 4M8SA 4BO8A 1X7YB 1ACJA 3R4VA 2XUGA 3TGPA 1NVXQ 2AQKA 2WWGA 1PJBA 1XWFA 3GAMA 4KIWA 1H85A 1O77A 2ONKA 4HXGA 4RJJA 5TPWB 4Z49A 3KOWA 1Z0SA 2HLNA 2AC4A 3KWJA 5FPYA 1AB5A 1EWKA 4PVCA 3CLRC 4FHCA 3CT6A 3VR6D 3ZQKA 1QHHB 1XJQA 2EJCA 1RM4A 3IBFA 2NYVA 1EE9A 2EBWA 2WZCA 4HG2A 3FPJA 3T1YB 1J9EA 4WX2B 1Q84A 2BZ1A 1BH2A 2PBRA 2A86A 1FTYA 2E6KA 3IOBA 3ONNA 2RI0A 3JD4A 3ZXYA 3TGLA 3HCDA 1A50B 3X1WA 5B64A 1WNTA 4D74A 4Q12A 1YU6A 1W73A 1H4TA 3BCUA 3B5IA 4JLDA 4OUDB 4NKRA 4RCZA 1KQNA 5TQ0A 3ASUA 2HUPA 3CXUA 3WAGA 4BLOA 2HPZA 4EKYA 2R4TA 2HV8A 3P9SA 5F21A 2R6AA 5HRAA 2GCOB 3LDUA 3IJ5A 1Y7IA 1H0KA 5AJUA 2IXAA 2BI7A 1PDVA 2IOHA 4FEGA 4PIMA 5TXGA 3T9AA 2UZ0A 3WQQA 4KO4S 4P0TA 3FOEC 3H1AA 1XV5A 2YBDA 3CN7A 4C0SA 3EQZA 2FEKA 1IZ8A 2JW5A 4I5IA 1R9NA 5JFGA 2HWKA 3VKUA 2QDXA 4CMCA 3N5KA 3M5CA 2GFIA 2W00A 4ZAVA 2VPTA 3VI4B 1KI3A 1UT6A 3JQEA 3K09A 4L0MA 1F2DA 2ZE7A 4TZKA 1OXSC 2FFRA 5JNLA 4E4YA 3ROZA 3G6WA 2I2XB 4X20A 3DTVA 2RBKA 3BUSA 1QO0D 3PQFA 2M32A 4G5HA 1C41A 1JBQA 2ZPAA 2W98A 3NEYA 1M1NA 3OPMA 4MSUA 1Z13A 3GFBA 4RH3A 2XGSA 3AHGA 5B1IA 5MFZA 3K70D 2VP9A 3FCOA 2H2DA 1JJAA 3CZCA 4CKWB 2WUFA 2XCLA 3NBFA 4HUQA 2UUBB 1GZDA 2OXTA 3DA8A 3CGGA 3STUA 4JLPA 8ADHA 1II0A 2YN4A 3MK31 3ROQA 7REQA 3H5IA 4B9AA 4B85A 1WD7A 4IL5A 3F46A 3H5OA 4ZC8A 2QTNA 2ZAMA 2R6CA 3OESA 1AO3A 3PDWA 1VLJA 4H3VA 2NU9B 2GF9A 1I2MA 3H19A 4QUIA 2UYYA 1C1DB 3TTWA 3T5PA 1BE6A 3KB2A 3LK7A 4KWHA 4A15A 2Z1MA 1FFAA 1SCAA 4XJVA 1YT5A 3KVRA 5EP1A 1NFQA 2FPRA 4LGMA 4UUBA 1U5BB 2VHWA 3KTDA 3MTQA 4G4IA 4DUZB 4KKVA 1E94E 3M6MD 3RS3A 4D6YA 4M55A 2Y3IA 3B1KA 4O5AA 3OZRA 3PUWA 1HE8B 4PLFA 3WL5A 3PNMA 2XQGA 1ZICA 3B6JA 3OJXA 1NQ5A 2VSNA 2ZWAA 3DDOA 5EE0A 3MB5A 5EJIA 3MQFA 3QU2A 5HQ3A 1K6EA 3LKVA 2Z04A 3UJDA 3ZDYB 1Q15A 3C3WA 5KOJA 2O05A 2VATA 2VNSA 1Z47A 4DAEA 3R23A 4MK4A 3DZGA 1P1CA 3FHCB 3QKSB 4M1TA 4EVSA 3SHTA 4TMYA 2EL7A 3WL6A 2HFKA 3LTNC 4C2AA 5LBTA 5FTMA 3TVTA 2GUGA 1XELA 2HRQA 3WGNA 4MO2A 1NMYA 2RHWA 3DZCA 1E69A 2ZSKA 1IY8A 3LNTA 3IXLA 3V1TC 1T8TA 3TIFA 3Q10A 2AZDA 3A1DA 2ZREA 1E5XA 4M22A 3ELYA 4B34A 5I7UA 3JX9A 4MA0A 5A3QA 1A27A 3HP7A 1C0KA 1EZ4A 2QY9A 1HE3A 1KWKA 3GFVA 3V9AA 4OFWA 3FPBA 5BRNA 5HBRA 5EZYF 4HMPA 1RIFA 4DRYA 3F5MA 1OVMA 1X7WB 2Q1WA 5T3YA 3USES 3DW3X 1N7HA 1G8GA 1XLTA 2I0FA 1J5PA 2BD0A 2NVWA 3BHMA 2QLMA 2C1XA 4ZXPA 1NLFA 4Q0MA 2PCJA 3O21A 1W5EA 3MB8A 5FBQB 2IF0A 1E9DA 2P1RA 4HDNB 3A28A 4F04A 3JAMA 3H2GA 5JJCA 1NYRA 3PHHA 3OJLA 3PJFA 1P5RA 2R48A 4W6ZA 5DFAA 5ALPA 1JYSA 4OYYA 2BKLA 1K68A 3OQJA 1LZKA 1Y9ZA 2EFGA 1ISPA 1P5HA 3PYMA 4GT1A 4N5NA 3O0DA 4Q7EA 3THXB 4W99A 1NY5A 2AJBA 3ACDA 4KB5A 3UAGA 1QBGA 3IUEA 2PX0A 1HPLA 4KR6A 3V1UA 2GPSA 2VTDA 4BNZA 2A5YB 3W77A 2CXNA 2RJNA 5MDHA 4PAMA 1M8PA 3LJKA 4DQVA 2C2ZA 2QBYA 1T2EA 2FR8A 3VVBA 2QVZX 1PJ3A 3DC7A 3H75A 1H2ZA 4D8TA 4D82A 4EMBA 3LCMA 5ED0A 3SDSA 3H7IA 2DOKA 4I9FA 4A8TA 5AI5A 2ORED 1VP9A 3A6JA 4EG7A 3TQHA 1O96B 3CRRA 2XWBF 1ULHA 2LCIA 5J40A 1J0EA 4NK4A 4LDAA 3IDFA 1JHXA 5E3JA 1U3GA 2W6CX 2AMLA 1KS2A 4RELA 2AKEA 1XEFA 2AMFA 2ZI5A 3L8ZA 4MIYA 4PG6A 4OFZA 1IIRA 1ID1A 5JI3E 1XF9A 2XZPA 3K73O 4XJTA 1ZYUA 4IF4A 2P2NA 4GWLA 4WD3A 3HYCA 4L73A 2FP3A 2AYZA 3FZYA 4C05A 3U9TA 2W6QA 3KLBA 1Z8HA 4XASA 1E2HA 3RNOA 3TCKA 5EIHA 4HN2A 4DXDA 1IHXA 1YQ9A 4DMLA 2AQHA 4MB6A 4OJQA 5J4KA 1P75A 2R2GA 2YWCA 4PG4A 1N0UA 3Q85A 1NSYA 3HDQA 3W5BA 5GV7A 1PS0A 2RC6A 4D9HA 1IONA 1YVDA 3O4HA 5LWHA 1XJ0A 2HDNB 2HY7A 3H05A 5KYTA 3G13A 2HAEA 1P5FA 1PR2A 2PL3A 2VLIA 4F38A 2EQBA 3LQKA 1AH2A 5CNMA 1GCAA 2WAMA 2G1KA 4E4TA 4OYRA 3WDKA 2FWAA 1SUAA 2GB4A 5CYFA 1QK5A 3FCXA 2ERCA 4GBMA 1V1MA 4MR8A 5HIJA 3RR2A 3FMFA 5IT5A 2RIRA 1JLLB 1G5IA 4E15A 4KI0A 3NDIA 3T8YA 3EUEA 2AFIB 2WMYA 2ON6A 2WWHA 4KNVA 1L5NA 2GJ4A 4ZI7F 1R5JA 3ZDDA 4ZP1A 1ULSA 2CBXA 2FJPA 3QEBZ 1P6UA 4BNUA 1E3LA 4ARBA 3P71T 4KQIA 1JU3A 4QXQA 4BNVA 4F2PA 1EGVB 4DN6A 3RS7A 1JILA 5KQRA 2WKWA 3OF5A 2Z08A 1XZAA 2X0JA 2JVIA 2HHCA 3HWSA 5C0OE 3C48A 4O2BF 5ALZA 2O1EA 1XTPA 2VPXA 4JB0A 5CA0F 3FYUC 5K0NA 3OTQA 2P3LA 3FPHA 4O02B 4BJ5A 1ZW1A 2ZDQA 4KGVA 4AMYA 3SZUA 3RTBA 1N8TA 4AF6A 3KQLA 2QD2A 2JC3A 3C39A 3LP6A 2E49A 3GLFE 4HNSA 4C03A 1GZVA 4EBBA 3IAM6 4ER7A 1G6Q1 1VMKA 5J59A 1UODA 4S1PA 4P32A 3AL2A 3RSSA 3ORYA 4LVOA 4ER6A 1XRQA 4XJXA 3DQQA 4HAIA 4U7FA 2QRKA 2BONA 1F5SA 4RD0A 3FTCA 4Y1FA 5JSKA 4C14A 5EJ6A 4FILA 2EP7A 4B7CA 3IRUA 1DBWA 2WMOB 1XTIA 5DCUA 5SZKB 3M9WA 2NVOA 5DF1A 4DBLC 1BS9A 1NNLA 2YJZA 4WNAA 3OZXA 4F9FA 1LDBA 2XJ9A 1XNJA 2IOQA 3BWDD 4JS0A 5MN4A 2B1JA 2GF2A 4ZJZA 2NXJA 4B0OA 3WYFA 4CLRB 4M7RA 1F1JA 2FX3A 1YR8A 4ALKA 2ZAOA 4U7GA 1RRPA 3ICVA 5BMVA 3R3UA 5KNLA 2RGUA 3NAZA 3H2SA 4HN4B 1JQEA 1N9KA 3AHEA 1V4NA 2W2OA 3ZX5A 2G4VA 2RHMA 3TQOA 2PUGA 3O6VA 3WJAA 1SXJC 4P98A 3BM5A 3RSLA 3L0SA 2Q5QA 3DV9A 1OTYA 3ZDXB 4ACAA 4PZAA 4X90A 4ZEOA 3Q9NA 1JDJA 1I01A 3HS3A 4I4TF 4PGGA 4RAQA 5ADVA 5LN1A 4PQYA 3PT9A 4JAVC 3PJRA 2ATIA 1NQOA 5HK8A 3FGOA 2VPQA 4QYIB 2ZUTA 3MD9A 3AKZA 3IV6A 5IDXA 1FTWA 4ZANA 2GEBA 2O8NA 3E3OA 1R0XA 4AX4A 1AD2A 4JIGA 3NGXA 4UHFA 4LF8B 4AJEA 1E0KA 3GUVA 3DD1A 1QYWA 4B5LA 4CT5A 5F5NA 1ACLA 2B3DA 3PL1A 2Y4NA 1J1ZA 4AW9A 4CG1A 1JFSA 1GSAA 5DPMA 2IU3A 2PDAA 5SYAA 2X13A 2Z3ZA 3LAWA 3KR9A 2VEDA 4AQ7A 2W2LD 3QVKA 4HWGA 2IE0A 2UZ3A 1KZYC 2Y1LA 3PC7A 3IILA 1K63A 2XRMA 4QDXA 3ZDFA 1PDOA 4KHPB 5L6MB 3AFGA 1MG0A 5ECDA 2AUNA 4XDZA 1QYIA 1XDDA 2XE6A 4K1XA 4DWWA 4F6CA 3IODA 3P20A 2MTBA 1T8UA 4G9BA 4MVYA 2PFGA 3ZD7A 1EWVA 2W2KB 4TTAA 1DPFA 3HO6A 3B38A 1X2EA 1C3EA 1KVSA 4CR8A 3E5MA 3SZLA 3EVNA 2ST1A 2BGJA 3COSA 3IAHA 1C14A 1SPXA 4DGSA 1HLDA 4F7WA 3EZYA 3NVDA 1ZESA 2ZAGA 3CVVA 1NBEA 1NXTA 4DCGA 3DDCA 1MGOA 4KYTA 4HDCA 4OLBA 2BMDA 4R6XA 3BXPA 2C5BA 3N59A 4Y67A 3K0CA 1ZH4A 1VLVA 2PO7A 1UC4B 1WSAA 4LDQA 3IR7A 4LHWA 1A96A 1NONA 3UVEA 3P0EA 3W2TA 2Q3EA 3A9CA 4ZVVA 1CQZA 1JB1A 1KBQA 2AJTA 2O4UX 2XBLA 4JJ7A 4IHAA 1B73A 5JARA 1R27A 1XEXA 2XVMA 3L7BA 4G5SA 2Z2YA 3SR0A 1QO9A 3GFRA 4HVTA 2V54A 2RK6A 5K0EA 2IBTA 1RBYA 1G7TA 2FSSA 2QVYX 4XIFA 3NP9A 5KYXB 4L4ZA 1D4ZA 2YJNA 3WDLA 3A10A 3VH4A 1R6AA 2PSJA 3PXXA 4YMSA 2JG3A 5FNVF 3EULA 3PS9A 4D2IA 3X1YA 4YXFA 1KQ3A 1RACA 1UBEA 2H5EA 5H3HA 4HXFB 2WJAA 3GA7A 2WWFA 1ZI8A 3IVMA 2X3FA 1PQYA 2CVFA 5CPBA 1LDEA 2QQFA 1SVOA 2X8LA 4JP3A 4G0NA 3BORA 2PQ2A 2PKYX 2HA5A 3EJ6A 1KNXA 1UADA 3MT9A 1WVGA 1AGXA 1MX1A 5AO9A 3TL3A 2FEPA 3VU9B 4Q37A 4DCCA 4XYEA 4MDEA 2BM1A 2POCA 3WR5A 4QOGA 4F56A 3M9XA 5ELLA 4JENA 5B2EA 5JDCA 1D2EA 1KYTA 2ATVA 2XQVA 1E5TA 2REXB 4IGEA 2DUUA 4YDRA 3W8FA 1N9ZA 1X2BA 4FE4A 1CJTC 2HCFA 4KXLA 2M6LA 4C0KA 1KAHA 4BKMA 2VYNA 1QKJA 1NVDA 2X42A 2WIFA 4N01A 1XVTA 4J0HA 3SHQA 1XCBA 4IKOA 4MS1A 4K8RB 2J3HA 3QITA 3EPLA 2QL5A 2ZB3A 3PJGA 2Q5IA 2Q3CA 4TT8A 3WIDA 2H4HA 1N8SA 3PQ2A 4L4SA 4LSWA 5IP5A 1RWKA 5EIXA 2O8EA 1M54A 2E89A 3IC5A 4KSYA 4MVJM 1BU8A 4D57A 2IYWA 3NTUA 5KNCD 2BMJA 4IHJB 1M8FA 1U8AA 4GLJA 1M2OB 5CX4A 4AI6A 3RFFA 1CCWA 3LF1A 2WYVA 3EF1A 3B2EA 1SD5A 3FN4A 1IU9A 1HV8A 2CFOA 3PPYA 4IYJA 3PUYA 1Y8QB 3UPTA 3HKCA 1L7DA 4B3BA 4ZOLA 1E5VA 4KPFC 1FDSA 2QJWA 2UYOA 4NZ9A 1N5KA 2CUTA 2DFVA 2R5WA 4W8GA 4EHDA 1R00A 4QA9A 2BSAA 3H42B 2V7EA 4EDHA 2VF4X 4U5QA 5EHXA 3IIMA 4IDEA 4KLRA 4XM0A 4B4UA 1DT5A 5JNSA 1OAKA 2IHJA 2ZJYA 5JWRA 1NR1A 1Q7BA 3V80A 1A2BA 4TQUS 4LXYA 2YNMD 4GXRA 5FOTA 1PZEA 1JJFA 5A05A 3DKRA 4DFDA 3QU9A 2MIIA 5KZMB 4S2UA 5EPUA 2CC2A 3JQGB 2NU6A 2Q5LA 3WNZA 1UMDB 3PI6A 2PD4A 2PPVA 3Q2KA 5IJ9B 2AN3A 4BP8A 2FPUA 5IJ0A 1TE2A 3STWA 2FR0A 5DNUA 2BZ0A 5HWSA 3SHWA 3W2IA 1KKMA 2C2BA 4HFRA 1EK1A 4O4HB 5T6MA 1K7SN 1EFTA 1E4EA 1RI2A 2C9ZA 3KQQA 2FWRA 1KOLA 3OPVA 3CNNA 4RQTA 4Y1RA 1YWGO 4URYR 1G7RA 2JRLA 2P0AA 2G36A 2PWZA 2X0RA 3LW8A 3OIFA 4FJ0A 4KLNA 4CF3A 2IX3A 2I22A 1O4WA 2BISA 2QRGA 2ZYDA 3CYFA 5IVKA 2E4WA 5I8WA 3H1TA 2JKZA 5EJAA 5FBRB 4LXGA 1QQBA 1US8A 2O07A 1WCWA 4G36A 4L75A 1F6DA 2H7YA 4JJEA 1NR7A 4M0MA 2NV2B 1TTHA 1VKHA 4I36A 3BIOA 3MJ4A 5CB6A 1T9KA 3GT0A 1VPDA 4YV1A 1SVWA 2VP3A 4UMFA 5A4IS 4ZVKA 1XGKA 3C3EA 4M9RA 2GAIA 4D9BA 2GJ8A 4P34A 3MIIA 4QUHA 4EEZA 1HZZC 1W9MA 4G4GA 3JWHA 2WD9A 1L7XA 3SAJA 1IEVA 2AW3A 3H5VA 5KAMA 4BMNA 1OWPA 1YDGA 4UBOA 3NDRA 1TEVA 3LL7A 4UUOA 1ZBQA 3WBJA 3AETB 1TM1E 3P4XA 5EC8A 4QBFA 1R0SA 5DGDA 3L0BA 4N1AA 3SSNA 3GXOA 2AEMA 3LWNA 4B8WA 2CK3D 2C2MA 3KQKA 4W5HA 3ZBTA 1YQUA 2F1JA 1ZVJA 4QJ3A 1WUIS 3HHPA 2DWPA 3NKLA 4ZYTA 3TLEA 5A06A 2QN9A 5CBPA 5LJLA 1FYDA 4BNXA 4WPGA 4E09A 3D4IA 3P0FA 1ZR4A 4H7HA 2V7PA 1VL0A 1E3JA 4BMOB 1G5HA 1FE8A 3IAAA 3RSGA 2EFDB 3P52A 3TIIA 1NFRA 2OHIA 1PBTA 3DULA 4CTJA 3USCS 1Q5PA 3AHHA 2B78A 5B7GA 2QJTA 3CNEA 4CFZA 1GG8A 2MR6A 4JJGA 5HDQA 3VDQA 4A8PA 4AJIA 4BVGA 1AOXA 1VRWA 4H9GA 1T6ZA 4EY8A 2IT1A 4S0XA 4ZV9A 1DFIA 2OB2A 3JALB 4JJZA 3P26A 4F5ZA 1OV6A 2FFHA 1YE8A 3TD6A 5JWOA 8ATCA 1FMFA 2VHQA 2BGKA 3UAWA 3W5IA 3DL7A 2OCBA 4I4IA 4HXEB 2N47A 1B4DA 2CWDA 3RYHB 5FBZA 3QELA 3E81A 4XEHA 3K5PA 3R7WA 3J7AC 2AOTB 4PCAA 3KBOA 1LKZA 3OM1A 2LW7A 3E23A 4R31A 4RQUA 3NLLA 1SBQA 4M9QA 4BX0A 2TMGA 3X1XA 2GCNA 3HTXA 3QNMA 3BE5A 3T5MA 2NM0A 2OY0A 4HK4A 3B78A 3OZTA 3P96A 2ZJ6A 4O4LB 1ONPA 1PP4A 3F74A 5EGSA 4G0ZA 1JFTA 1T43A 4JUDX 4B75A 5CLFA 4N41A 1BE1A 1G1AA 4HWSA 4J1NA 3FPGA 5BYJA 4F12A 1XALA 4JGGA 4IBOA 5DK4A 4MQBA 2YCLA 4FGZA 4DBVO 1CNFA 1PVVA 2I2AA 4JP1A 3ZJYA 1F5NA 2ROQA 3L6EA 1JUDA 1VBFA 4ZC1A 2E1RA 2JLXA 4Z9XA 2POQX 5CDGA 5KB3A 1FP2A 3U62A 1ID8A 2Q1TA 3CZ4A 3IMEA 1E9AA 4L5CA 2VHTA 2F64A 4HAZA 1CF4A 3NKVA 3B7GA 1H1DA 1EAYA 2JIPA 2O1WA 4A92A 3LT4A 3CUVA 2FXIA 2GK7A 3VOBA 1RYBA 3EXIB 2A14A 3MYRA 4YLYA 3F3KA 5JPCA 1CG6A 1G9XA 4EF5A 3DTYA 2VF5X 5EXEA 3VOAA 3FUCA 1DVRA 2I3ZA 1RWQA 1T34A 1O9BA 3TTTA 1KEEA 1KZ1A 4YT4A 1ZMTA 4H7PA 4ME6A 4IO1A 4B3CA 1DC3A 2ZG6A 4RY8A 5LIPA 2Z5LA 3ISTA 3BHIA 3IMGA 4MPRA 3M1IA 4BVLA 2BFFB 3VXKA 2EF1A 2YJGA 1XZNA 1HYHA 2G08A 2GD2A 4IIBA 4KSCA 2UAGA 5PGMA 1EFLA 3V5NA 1EHYA 5B57C 3U5ZB 3RS8A 4G1EB 4D4KA 4ZDKA 5CD1A 1X94A 3SM9A 4BMPB 1EUCA 1N1MA 2PBFA 4YRGA 3B2NA 1C8KA 1UMCA 3KOYA 2BEVA 2JLQA 3BFPA 3PQEA 3DZDA 5L7WA 1CJSA 5DHQA 4KFCA 3K70B 4XW2A 3IJPA 3RU7A 2YFQA 3NYWA 4RHXA 4ENWA 4B82A 3JTEA 2UKDA 3ZQ4A 3HKDB 5LC1A 2QOEA 3ROGA 1J7JA 3HC7A 3NVAA 1Q1QA 4ER0A 4Q93A 1ZQ1A 2MYUA 1NXVA 1L4FA 1I9GA 2JL1A 4M54A 5JC8A 1P17A 2OXEA 3BWCA 3KYDB 3QNUA 4IIYA 5H81A 1UK6A 5LXTF 5TEVA 4DCPA 3G2QA 1LSSA 2P27A 2VJMB 3CPJB 4FN4A 2REOA 4FQ8A 4RMJA 4WK6A 5JNWA 4QE3A 3HJTA 4DSZA 4NZNA 2ZGVA 2JBHA 1FFGA 2C58A 1Q7RA 4TRNA 3EDCA 4UVGA 3GJ6A 2DSTA 1Q57A 4FS3A 3C2QA 5TLSA 3DE0X 3S28A 1OW3B 1J22A 2GN4A 3M89A 5EMKA 1D04A 4ZI5A 3A25A 4X44A 4KR9A 5KSZA 1NBOA 4J1TC 4I1RA 4J3NA 5HJ2A 3VNSA 4AX8A 3W79A 5ALLA 3ZOZA 1MORA 3GL9A 2MSNA 1Y1PA 5CXSA 5DIZA 1K89A 1KO5A 2WIJA 3BSWA 3OG9A 1S89A 3HKEB 4WK0B 5DXFA 3P9PA 3VI3B 2PQ0A 3W6UA 2ZYRA 2ZUEA 3QHQA 5I7AA 1LDYA 1P4GA 2P41A 4RVOA 4WBNF 2WJ3A 3HJUA 3DMYA 2Q6KA 2I9PA 2PXHA 2EKDA 5JYCA 2V7BA 1USUA 2AN9A 4OGKA 1YJXA 3P8ZA 4HWTA 4YS6A 4IXWA 4PFQA 3U13A 2XKKA 2D8MA 2LD4A 3BMCA 4MS4B 4UNNA 4CKCB 5CB0A 5IN4A 2GLUA 1V95A 3L0PA 2VPIA 3RRXA 4RHFA 1G4AE 3QG5A 1XHLA 3LECA 1VHJA 1T5OA 4WY8A 4YRMA 2NU7A 4AXXA 1E32A 2I2BA 3W5VA 2G5GX 1QPBA 3UXEA 3C5EA 3EW7A 3GLTA 1Q95A 3QTTA 1LQTA 4XE5A 1KA9H 3DR5A 3NI2A 4FZVA 3LUKA 3H1GA 3I5AA 1D0IA 4I19A 5ERYA 1JYEA 2I3GA 3WLIA 2Y67A 5TF4A 3W78A 4ZARA 2PVSA 2Z98A 1OLOA 4D9MA 3KR1A 3KV3O 1WDWB 1Y8AA 3I76A 4OQQA 3S5UA 2VK8A 2HI0A 4RV5A 5DXJA 2HLPA 4JLSA 1F9EA 3S7ZA 3D3JA 2NPOA 5HTOA 5G0TA 3OUUA 6LDHA 5IVDA 5DW3A 2HZ7A 1J90A 1B42A 2X40A 5FA8A 4D9CA 9MHTA 1KJWA 5AXAA 3WWEA 1QIKA 2IYNA 2R8EA 5ISMA 3WWCA 1DCMA 4OBXA 4CBVA 4NZYA 5EXSA 2O7RA 2QW1A 2QTCA 2FAXA 5FUQA 3ND7A 3NCHA 4RGBA 4BJHB 4CU2A 1W5SA 1LY1A 3LCJA 3LRTA 3KQOA 3W6PA 1BDIA 2X3YA 4BVAA 2DPYA 3QOFA 1WB4A 4FMCF 2VJCA 4K5QA 2IV2X 2OKGA 3V55A 2XQFA 3KUDA 3UXMA 3CO0S 1NNEA 3LF2A 2AD1A 2XMZA 3KEFA 3SBDA 4DLLA 3BQ9A 3WI7A 3EG9B 4FHDA 5EWJB 1T5LA 4JJKA 2HRZA 2VTVA 2Q6VA 1J2UA 2BVNA 4KE7A 4R1SA 2WTXA 3HK2A 3NO4A 3OIDA 4UXJA 3OQBA 3NT5A 2OG2A 1FJHA 4DXAA 4IEIA 3IV7A 3KDSE 2CLIB 4MINA 4UHCA 3RIXA 4D8XA 2P8JA 4G24A 4HSEA 1YDMA 1XXLA 5ERGB 4S1WA 4CEHB 4LY0A 1NR5A 2AHOA 4REOA 1TTQB 3CCCA 5EJEA 3OAAD 1IMJA 3U44B 3UB2A 4MRAA 3ZBQA 3CLUD 1CJCA 5F78A 4Q03A 3ZNNA 1EA5A 3WIVA 4QRDA 3SGLA 1XRPA 1W5AA 1YDEA 1YUMA 2GO7A 4UQLA 1JIXA 3O2SB 2G0AA 4XWOA 1TT7A 3M70A 2FPWA 1Y9DA 4WOKA 1WMEA 3H0CA 4I14A 2NYUA 2ZYSA 4RMGA 3WNCA 5CIYA 2NPIA 4D6XA 2Q5FA 4IIVA 3GVPA 1V11B 1C4KA 1DAGA 2DAPA 4ZQIA 2MSCB 4KWIA 2D1TA 4CODB 4RMIA 4V0NA 2V1UA 1NJGA 1QYDA 4I3FA 3MJHA 4BX8A 2IEDA 7GPBA 5A2GA 2CJXA 5IZCA 2BR3A 4XUGB 4AURA 2ZXEA 2ZU0C 2CHGA 2TYSB 3EBLA 1FS4A 2GTPA 1L3BA 4Z4HA 1OXVA 3RUPA 3WBFA 3IQIX 4O2LA 4DYHA 1QAOA 3CX4A 4B6RA 5DNDA 5KJCA 1FDTA 3N74A 3D7NA 3MAAC 2JI9A 3GJ4A 4WL0A 3UA4A 4YVFA 1FFXA 1XZIA 3DLHA 1P1FA 1KK0A 2BF7A 2LPMA 2PX5A 1V4VA 1S6YA 1T3ZA 2DM6A 3I8XA 5BP7A 5C46F 2WWTA 1RAIA 4LMAA 5GZ1A 1WPRA 4KXMA 5TEWA 5CA1A 1I4OA 2HIHA 4KG7A 1M0WA 4L6IA 4U0JA 3PEEA 3NAGA 2QVGA 3WZLA 3K6JA 3ZQUA 5KI6A 5FI5A 3TAXA 3EEFA 1UBGA 5MHTA 3BRWA 4HR7A 3OLZA 1U6IA 3FF1A 3S2SA 1FTNA 1CB0A 3DWEX 5CU7A 1I2BA 2FSIA 3FWPA 2XQJA 4YJFA 4CM4B 4BQOA 1IUKA 1JSRA 4PPFA 1PK7A 2XA1A 4F1JA 1MQ9A 1CP3A 4PBTA 4AO7A 3RO7A 1AQUA 2VJPA 4HAXA 5AW1A 2JVKA 3DLPX 3RBVA 3EB9A 3GJ0A 5KYKA 4EKNB 2CKMA 2HSWA 5F98A 4DLKA 1KY3A 4UM9D 3REQA 2Y2UA 5K01A 1YRQA 2WIBA 2QF7A 3JS5A 4CV3A 3I9FA 1L8QA 1UMKA 1B6GA 2PGXA 3NCTA 4FYIA 3C14C 2HK7A 4MNTA 3RAPR 3TH5A 3VSAA 1G8YA 4EATA 2R7NA 1WA5A 1ECCA 2C2OA 2OHJA 3HGQA 3JW8A 4TKLA 4X45A 3AIIA 3T7JA 1XRJA 1XZJA 5TS2A 1AGNA 1AF4A 4XDYA 5CDSA 1SFRA 1M2GA 2FHSA 2O4CA 3JQAB 4K6GA 2P9GA 2JATA 4JR0A 2BFEA 2QD4A 4L50A 1GZ4A 1TNDA 2JAPA 2OBNA 2WV7A 3NC0C 4MHOA 4RD3A 5C3UA 1E3EA 1AXRA 2V6GA 3ZWYA 4C3ZA 1JDBC 3E70C 4ND3A 4IRUB 3QF4A 2RCNA 2HW8A 3AR5A 4CF6A 2WSBA 3SP1A 1M2JA 3BDVA 4N0DA 5F1OA 4ACBA 4YCLA 3DO6A 3NYQA 3PQ7A 4D4MA 4Z53A 5D3ZA 1HDOA 2A1TS 4TTVA 2VT6A 4DA8A 5FR2A 3CIOA 3K0BA 4ZCRA 1L4NA 4NYMR 4BX9A 2KPOA 2QGZA 3DLTA 4PQRA 1T8PA 1SBTA 2XKAA 1CRLA 2GTIA 3NS7A 1N3IA 3Q1KA 3RJZA 3TTUA 2VH2A 3VR4A 1QK4A 4O8CA 5AKIA 1PFUA 2BHSA 3MLBA 4UOQA 5TDHA 3C5WP 2A5DA 1F12A 1YB1A 1Z25A 3BD7A 4NNOA 1E9FA 2EX0A 2VXBA 5FWXB 3W4IA 1WXXA 1O5TA 4X1KB 3VSEA 2IOFK 5DEOA 3UUGA 1ZJ4A 5EWLB 1FP4B 3ABSB 2QKYA 2WYIA 1QH8A 2OCYC 1P2SA 3IHTA 3PD1A 5M3BA 4JYZA 4LFBB 1JSLA 4MWOA 5BWLA 5JH7F 4AL4A 3LT5A 2P62A 3QFHA 4XPZA 1U90A 3Q2OA 1W19A 4BZQA 2X19A 3U4DA 2QP4A 2C5FA 3DTVD 3OOJA 5A4JA 1U2SA 1XRSB 4RMHA 5AVRA 4RC9A 1M6VA 1YONA 4ODIA 3HZRA 4KP7A 1KKUA 4PHTA 2XOKA 3ND9A 5AHKA 4AP9A 4AYTA 3MHPA 1WXWA 1M73E 3E9QA 3BZBA 5C8YF 4IOJA 3DF7A 2ZE6A 3HJHA 4KU4A 2YL2A 3ZC3A 4BLPA 1EA7A 3S0JA 4X63A 5EIAA 3U39A 3RFCA 3T3NA 4Q9IA 1PLJA 2VDOB 3G7SA 4C6RA 3STYA 3NAMA 2QN2A 3TW6A 4XUCA 1KH2A 1QLHA 4P84A 5TMBA 1UBSB 4WW0A 3WLHA 1C4OA 1PX0A 2CD9A 2W0SA 1DIAA 2JARA 4M49A 2FOIA 3KWLA 3A4NA 2FN7A 4TMZA 1G9TA 4A8HA 4DPLA 3B85A 5GJWC 4GKBA 3ESXA 1TZJA 3QU5A 1F4VA 3JASB 2KE5A 4GMFA 1P0MA 4MQEB 4QFCA 5JCXA 3TQIA 2IYUA 4O5OA 5C7OO 2HSZA 4S24A 2RGDA 1LSUA 2O6HA 3GLSA 2QV0A 3GN2A 3CY6A 3O75A 3V8PA 5CX1B 1YIDA 1IRXA 4MGYR 2CD7A 3EN0A 4MGEA 1BGXT 2NT4A 2NUPA 3FAZA 4YNBA 3IKTA 1VHQA 1AN0A 5DLYA 5EKTA 3VR0A 2NVBA 1G291 3V7NA 3OU6A 1P1HA 4AZVA 1RYMA 2NO5A 1RQGA 3O8LA 2Q2OA 1QGUB 3BXGA 3I6BA 4DLAA 1VCNA 3AB3A 1E62A 4FLMA 4P8RA 3ZXXA 3T7CA 4DNFA 2IY9A 2Y9MB 4BCCA 1F2TB 5CJJA 4Z4QA 2E4ZA 4UEQA 4W9NC 3FYTA 3LY7A 2JJQA 3PHCA 4P6VF 1WVMA 4QGBA 2FCRA 4M38A 1ML4A 4FMBB 4KR0A 5BSMA 5CDYA 2OV1A 2Q6LA 4PRKA 4HH1A 4LFCB 1Q50A 3GR6A 3VR3A 2BFDB 1Z74A 2D13A 3NYRA 2H8GA 3DPIA 4UXHA 3VU3A 2H9IA 4LV5B 3JTMA 3SKVA 4ZN6A 1D0SA 3GV0A 1O54A 2PH7A 3DBLB 5IANA 3Q3IA 1KARA 2CJWB 2G72A 4DL9A 1AQIA 2ZAIA 5LLSA 1GT6A 2BMAA 3N2EA 2P8SA 3DBRB 4C6TB 3K1YA 2PANA 3ASZA 5A7HA 3PEFA 4UXIA 3WO0A 3A37A 5CM2Z 1RE0A 4JJFA 2XGOA 2A59A 4LBYA 3ZG6A 2Q5HA 1B8VA 3NWJA 3R5SA 2Z1DA 3IQDB 4UKDA 5G3YA 5C80A 3LX8A 5DTIA 2X8WA 4PO1A 1C7RA 2G71A 1L4BA 4GSYA 4P3YA 1YA6A 1QU2A 1UP6A 3EXAA 3JRWA 4M6WA 2D7CA 4BRWA 4ECEA 1R74A 3K92A 1XN1A 1NBAA 3LHKA 3ZPXA 3CIFA 4PZ9A 1U5CA 1Y34E 4MYTA 1OAOC 3IJRA 5ECGC 5CG1A 4X65B 3DBHB 1VKJA 4XRGA 1EI9A 3GRZA 3TE7A 3DWIA 1G2IA 4D79A 5BUZA 2CV0A 3WRXC 1JNXX 1T2UA 3OLWA 1JDSA 3NIBA 4FDUA 5KHOC 4W5NA 1CNEA 3GPIA 1JL3A 3OEWA 3H9UA 1K5GA 1U7UA 5A5FA 4GC9A 4ZJYA 2RJOA 3MAGA 2PUVA 2PXAA 2FZLA 4MV4A 3V1LA 3W90A 4NMXB 4R05A 5G0SA 4NU5A 3Q7PA 4O4IB 3A4VA 4RSRA 5TSDA 1S3FA 1S7CA 2B5OA 2BW0A 2HV9A 2ATXA 3FPAA 3QMMA 1Y1SA 4KFSA 4YRTA 3U5TA 3DMTA 1IOVA 2GEJA 1QH9A 4GEKA 5KHLB 4KQ6A 5IKPA 1H94A 3MS2A 4BVJA 4BQEA 4MAMA 4PHFA 4KODA 5IH3A 3EVEA 3DTNA 3F8WA 5EJ2A 3WWZA 2H9YA 4ZVPA 2XI4A 1UFKA 2ZP1A 2PR2A 3FCUB 4KAJA 1CY7A 3L8MA 2Y93A 1JIVA 4D46A 3GWZA 4ZZ3A 3BJMA 1H2WA 4X41A 2ENWA 3HWX1 3DFUA 5HIAA 3FRHA 3M83A 5AWFC 4C08A 4QDTA 1DHRA 3SLKA 1T2FA 2IQ5A 2Z2XA 4MYDA 1ODLA 1Z8DA 2J6IA 3TNFA 3VYSB 5JBIA 4OGLA 5ALXA 1WNFA 2VNAA 3KFVA 4JWTA 4HRAA 1AKMA 1LV7A 4MVJG 5ALGA 2C8JA 4I5FA 4IQFA 4EZEA 4ZIRA 1EFPB 1VHWA 4KDRA 4K6FA 2MCFA 2FLKA 2J9FA 1U04A 4ESOA 2GNOA 3U48A 4JI4B 4QQRA 1GRQA 1KEVA 5K5EA 2XWQA 1U99A 1ZJJA 1AM4D 5DLDA 2IU0A 2GUWA 3DZFA 4K9QA 3BJEA 4FGUA 1X15A 4I1PA 5E4FA 2Q0HA 3D6VA 3QI2A 4Q4LA 4ZZIA 3JQ9A 5HQJA 2NU8B 1KEZA 1WTCA 1A98A 1P5ZB 3R5JA 5DO9A 4ZVQA 1REQA 2X1LA 4HGRA 4BN4A 1NV8A 3REFA 3PL5A 3OY2A 7ABPA 2QR5A 3TPFA 4MDFA 4F3YA 3HXQA 5B7NA 1KEUA 2RH9B 3H9CA 4LHXA 1IB0A 3WFIA 1V5IA 5GONF 4U7HA 4TYYA 4M8LA 4WEOA 1IRIA 1QHIA 2BFCA 3HH8A 4WNIA 2C00A 3ZWNA 1DJQA 3NOXA 4IXTA 5ESRA 1PLLA 3L8HA 1CLUA 3P27A 5DLQC 1UKYA 5IKMA 4TZTA 3A05A 3N2NA 2QQ0A 3TGWA 2IUFA 1QC5B 3HRHA 4REQA 4JLWA 3LDAA 3MPOA 3ZWBA 2OFPA 4NBUA 1WY5A 2HMYB 1KYQA 1XEWX 4I1VA 3P9KA 3UA3A 5C35A 5HIKA 3ICWA 3NTXA 3A3KA 4MWEA 1P2GA 1SU8A 2I4NA 2VNKA 4I5GA 2OD2A 4YJ3B 4ZDIA 5EZYA 5C4MA 4R1OA 4EG0A 4I50F 5HOEA 4RF5A 1M6WA 1V1RA 2OL4A 1SUBA 1B76A 2DBYA 4MCIA 5HOQA 3OZEA 4YAOA 1WXEA 3TWOA 5JYEA