1Y1PA

X-ray structure of aldehyde reductase with nadph
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
AKIDNAVLPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDMLKQGAYDEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKRFVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELAAWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYYVSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDLSKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldehyde reductase II
publication title X-ray Structures of NADPH-dependent Carbonyl Reductase from Sporobolomyces salmonicolor Provide Insights into Stereoselective Reductions of Carbonyl Compounds
pubmed doi rcsb
source organism Sporidiobolus salmonicolor
molecule tags Oxidoreductase
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1y1pA01
5DBFA 4MJLA 3VH2A 3GC6A 3ICPA 3JQ6A 5CAEA 3EY4A 3KBOA 3NAQA 4PRLA 5IZCC 1BDMA 3GVHA 3FI9A 1ULUA 3PVZA 1F06A 3KM0A 4GSKA 3JD3A 4H16A 1IB6A 3U5TA 4DBZA 1LA2A 1QLHA 2OORA 3VKUA 3KB6A 3ITDA 3LC1O 4E32A 3EK2A 1X0XA 5KJCA 4OMUA 4LVUA 3T7EA 5L40A 1DAPA 2YV3A 1Q7GA 3G1UA 5JE8A 3Q11A 5COQA 4YJFA 4CMEC 4B7CA 3PZRA 5C3MA 2X5OA 4HXYA 4Q3AA 4Z9YA 4J4BA 1SZJG 3H2SA 3E8XA 1DFGA 2PKQO 3OJFA 1RPNA 4TWRA 3DBHA 5A4DA 1PQPA 1IY8A 1I3MA 5A1TA 1Y7TA 3ZV6A 1DJNA 2JHGA 3IAHA 4NFYA 4RGBA 4HV4A 5L53A 2C7GA 2Q2VA 5JDCC 2Q4EA 3E18A 3B70A 5L4NA 4ZICA 1EFLA 1Y8QB 3W8FA 5H83A 2AQIA 3KYCB 2ZQZA 1SNYA 2AHRA 5I8ZA 2LDXA 1WLYA 2QRJA 4TRMA 5IXYA 1EVJA 3I6QA 3OA0A 1ISMA 5TNXA 4YJGA 1WDKA 1ZK2A 3ZW8A 1QYWA 4BO7A 4DTIA 3IIEA 3HHPA 3H6KA 1VLLA 2FR8A 5AVOA 4R9RA 3RSHA 1NQAO 3KTDA 4L74A 5KJEA 1XDWA 5KJ1A 5HS6A 3JQFC 3W1VA 4GLOA 1P1IA 3FTNA 4YJHA 4YEDA 3ANLA 2LDBA 5L7YA 4DBVO 4DPKA 1B2LA 2X22A 4IQGA 1UAYA 2P9GA 4IDBA 1YRLA 1IPEA 1CERA 1NHGA 4YYZA 1SOVA 2NU9A 3GH3A 2HLPA 4MVJI 1I10A 4WOJA 2VNSA 4PLTA 2W4QA 3HUDA 2IXAA 2OFPA 5F1KA 3V8BA 3R0IA 4C7KA 4A10A 3ZW9A 2FRDA 4Q3CA 5DOVA 4U0JA 4D7AA 3P19A 1E7SA 3MJCA 2AE2A 4FFRA 4J1SA 4FW8A 1H93A 2B36A 1YL5A 3COSA 3TZCA 4J91A 4TMFA 5CDGA 1HETA 4GPD1 4B79A 2CDCA 5TRTA 5G2OA 2JHFA 3WQRA 5A05A 5U9CA 3W6UA 5FF9A 3GPDG 2VRBA 4KWIA 3OH8A 3OJ0A 4P38A 2GNAA 4YAIA 4YAKA 1NHWA 3DHYA 5T67A 2A4KA 2Q50A 4DPMA 1YB4A 3ZDFA 1NAHA 3DZKA 3L77A 1DIHA 1V3TA 2PR2A 4R01A 3H8VA 3JQ7A 2DAPA 3DEYX 3ULKA 1Q0QA 5KJ6A 3DOCA 4OKNA 4ND3A 2E4AA 2YV2A 4BNZA 2A92A 4XDYA 4QEDA 2I66A 1ZFNA 1WP4A 1OZAA 1UXGA 2V6FA 4KUEA 1DHTA 1FXSA 1HEUA 2X0JA 2CUKA 2ZB3A 3FBGA 3L6EA 3ROQA 1ZEJA 3UAGA 1HE5A 4YTEA 4UAGA 5ICSA 1XLTA 2HK7A 3TL2A 3ZHBA 1GFSA 5FI3A 3ZU2A 4U5QA 3K31A 1LLUA 2A35A 5EIOA 3U3XA 1VE9A 3AJRA 4P8RA 4GKVA 4A7PA 2WYVA 5IDWA 1T2DA 3GN1A 1GY8A 5LDHA 1MUUA 2VWGA 1TB4A 2BI7A 4E5KA 4IQ0A 4EJ0A 3PEFA 5JCXA 3ZNOA 3GK3A 3ZWXA 2Q1SA 3UCFA 2E37A 3LYLA 1PGOA 1YJ8A 1U2GA 4IM7A 5HRUA 1ENYA 3WGOA 4PZDA 4OH1A 4NJMB 2GPTA 3SJUA 2EKQA 2X9NA 5U4QA 1PL6A 4BKRA 3BMNA 3GGGA 4HFNA 4J2OA 3RBVA 3H2ZA 4DWVA 3K30A 2V6BA 2HK9A 4I1IA 4FD3A 4W9NA 1I3LA 1TEHA 3BTUA 3LC7O 1QYDA 3NX4A 4RVFA 4RF5A 1KYQA 1LQTA 4FN4A 3MJEA 1PWXA 3QIVA 3TQHA 3PTZA 5MGBA 1O0SA 3C1TA 2I6TA 4W4TA 5ICMA 2Z1MA 3DOJA 2VHXA 2FZEA 5A9SB 3CH6A 4RPHA 1DC3A 3WGTA 2IZ1A 4NBWA 4BNFA 4LMRA 1LLDA 2GN6A 4TQGA 2IEBA 4L4SA 3ROMA 3IUSA 4Q9NA 1PJLA 4HFMA 3C3XA 2IXBA 5JAQA 3JYNA 3N58A 4BNUA 2Y67A 5H82A 8LDHA 5DBIA 1XU7A 4E2ZA 1VM6A 4YT5A 3RIHA 3JQ8B 1EVZA 1JKFA 4BL5A 1G0OA 7ADHA 1HSZA 3DHEA 3BMCB 1L7DA 1LRJA 1GEEA 5U1PA 2G0TA 4DQXA 1EDZA 4UUMA 1N92A 3NT2A 1OI7A 3WGIA 1MV8A 1C1DA 3IKVA 3P7MA 3AOGA 1UXIA 4CV1A 3C7DB 2RCYA 4XKJA 3NYWA 1OFGA 2DTXA 2HDHA 5L7WA 5BT9A 4DMMA 3W6ZA 1EMDA 4XQEA 1PX0A 3I52A 2YDYA 4Q39A 4PZCA 2O3SA 3JYLA 2RH4A 4JJGA 4YAEA 4XR9A 4HP8A 4E2WA 1GZ6A 1C0IA 3TWOA 1MFZA 1E7WA 2FSSA 3RFVA 4L73A 1EUDA 5F1OA 2O48X 3HN7A 4QQRA 3KZVA 4TZKA 5EESA 4WCDA 1YB1A 3TNLA 4PG8A 3F1LA 3I23A 4CMCA 1EK6A 3PHJA 3ZGYA 4B7UA 4CQLA 1LXCA 4A0SA 1VI2A 4BVAA 3DZHA 1PZHA 3FWNA 4R16A 3TZKA 1OBFO 3R6DA 1BXGB 5T57A 2OXIA 3DAFA 2FHSA 3R3JA 1CRWG 2OOSA 5KIAA 1LLQA 2NQTA 4CMGA 4GGOA 4BMVA 3D5TA 5GZ6A 1KVSA 4ZRNA 1XYGA 2UUPA 4FGWA 4DUPA 5L9AA 1E77A 3EZYA 3WLFA 2ZQYA 1P77A 3QHAA 4RVHA 2WDZA 3FSRA 3I4FA 1W73A 1VKOA 4AL4A 3CKYA 4D46A 1PJ4A 3EAGA 3PDUA 3LLSA 2A94A 3GNTA 4BNVA 2WEKA 3VVCA 4ALLA 1GPDG 4Y6RA 4CLRB 4N54A 1I8TA 1ZW1A 4LW8A 2DBZA 5L3ZA 1N1EA 1ZSVA 3I9NA 1GYRA 3LQFA 5KTKA 4Q3EA 3MOGA 4AJNA 1ZCJA 4EITA 3OA2A 1A4UA 4CM4A 4ZRMA 3C7CB 4L8VA 2I65A 3I4CA 2OBYA 3QY9A 1VL0A 4Y9DA 3F3SA 3C1AA 3RFTA 5BSGA 4GWKA 1DIBA 2NU8A 1X0VA 1FDWA 3NRCA 2C20A 2DBRA 4BNHA 4BO9A 2AA3A 2ZB4A 5JDIA 3RUDA 2AMFA 1MP0A 2VUTA 3TFQA 1D1SA 3D0OA 3QP9A 2VT2A 1ZEMA 4FJ1A 3STHA 1GADO 3F4BA 1E6EA 3H9EO 4N5LA 4R9SA 3RUAA 2FPGA 1ZJZA 3RC1A 4B3HA 1M66A 5C7OO 1GU7A 1PGJA 1H0KA 1K5HA 4L4RA 4MVJM 5JMPA 3DXFA 2NV6A 3K9QO 4XRGA 5A03A 4BNJA 4RVSA 3U4CA 1ZSNA 3K2BA 4FS3A 1X7GA 4HUJA 4XQ9A 4J0FA 4NR0A 2VT3A 4BNXA 2GR9A 2BGKA 1ZMOA 1BDBA 1FDVA 2DUWA 4DYVA 1DIRA 3SLKA 5CDUA 1T4DA 1NVGA 2NLOA 1O9BA 4MPDA 3SX2A 3VPFA 1BXZA 1JTVA 1K2WA 2C7VA 2DFVA 1E6UA 3KSZO 5BQFA 1QSGA 1GR0A 2D5CA 4YR9A 2YZ7A 1B8PA 3A14A 2I3GA 4D3SA 1T2EA 3F47A 2Q4BA 3PWKA 4LRSB 4MVJA 3NKLA 5EN4A 1JDJA 1A71A 1YOVB 4UVHA 5IF3A 4FJ2A 3L6OO 3WGYA 4B3IA 1E92A 5I7SA 1TT5B 4MP8A 3K8ZA 3DMYA 1PEDA 3ZWYA 2AE1A 2D1YA 2FR0A 3JQ9C 1P1KA 3ONEA 2X8LA 3DAPA 4ZVVA 2V6MA 3W8DA 1DC4A 4UEKA 4Z9FA 4DL9A 4E5YA 1HZJA 5JS6A 1XR3A 3P2OA 1A5ZA 3GHYA 4A73A 5CDTA 1TXGA 3QVXA 2P5YA 1ULSA 4OOEA 1E5QA 2WD7B 3KSUA 4B4WA 4CLEA 4CUKA 1BVUA 3LDHA 1GAEO 1C1XB 4IIUA 4QO7A 2Q2WA 3PHGA 4PZEA 1RKXA 3D3WA 4RQUA 5L4LA 4ZQHA 4D45A 1Q0LA 1E3WB 3PDJA 3JQEA 2QYTA 4BNLA 3JSAA 1P74A 4HFJA 5DBGA 4IBOA 2J3JA 3ZWWA 1UZNA 3RUIA 2POQX 3GEMA 3ZWVA 1IOLA 2B35A 2QW8A 1YL7A 5ILGA 4RDIA 1DJQA 4GL4A 3H9QA 3WXBA 1TT7A 1XIVA 1PL8A 2ZKLA 3PIIA 5JC8A 1ZJYA 2IZZA 4BGIA 1DRUA 3OF2A 1JWAB 4G5HA 3ENNA 3L07A 2UDPA 4R1UA 5T5QA 3TF5A 2I3AA 2VUSA 3D1LA 4JP3A 1ML3A 4LRTB 4WLOA 1Z75A 1Z6ZA 3CEAA 5TQVA 4IDCA 1BXKA 4DC1A 5A3VA 2ZATA 3ZHZA 4WNIA 3WS7A 4DA9A 4Y6SA 4PCVA 1A4IA 1O6ZA 1UXKA 4U8GA 5CEJA 3CZRA 3HDHA 2EJWA 2Q1TA 4FIZA 3GMDA 3K96A 2EKLA 5C5IA 3JQAD 1UR5A 3TN7A 5DP2A 4XIJA 4YBZA 3GGOA 1BSVA 4ROSA 3V1YA 1P1RA 2HRZA 1IUKA 3M6IA 3U62A 1LI4A 4FSHA 4H3VA 1VL8A 2JCVA 2OO5A 1N2SA 1JVSA 4P4GA 5I7FA 2D0IA 5A06A 4NNJA 1RM4A 2D3TA 3ETGA 3JTMA 3HDYA 4IY1A 4WLFA 2PD3A 3BMQA 4BKQA 5JAZA 1LLCA 2VYVA 1J4AA 4Y6PA 3DQPA 1M2WA 1NWCA 4J9UE 3ZWNA 1L7EA 4WNCA 4IDGA 4XQGA 5DP1A 3U9LA 4E5MA 1ZH8A 1VPDA 1U3VA 2DU8A 3GFBA 5BSEA 1I01A 3QVSA 1N9GA 4J1TA 5I9MA 3HG7A 4GAEA 4YPOA 1N5DA 1E1NA 3ZNPA 4IINA 3SC4A 5L7TA 4RF4A 5B4TA 1HTBA 2WYUA 1BW9B 1EBFA 2YV1A 2JD1A 1NFQA 3MEQA 4NBRA 1IHYA 2XPCA 5ITVA 1IE3A 4GVXA 4CM5A 1GQYA 2Y1CA 2OZPA 5I7EA 3AM3A 5COAA 5AQ1A 2NADA 4BNIA 4OXNA 3B6ZA 4W9NC 1EBUA 2YFQA 1N8KA 3DZBA 5EQFA 4F46A 5JW6A 1CDOA 4EUFA 5JNLA 1GZ4A 4FDAA 4NH4A 3VPSA 1NFFA 1T24A 4XGKA 5JO9A 3FPLA 1NXQA 4K1LA 5DZSA 4IXWA 3BMOA 2EEZA 3WJAA 5F21A 1BHSA 5EMHA 3D7LA 4CQMA 3LF2A 3PK0A 4XA8A 2GERA 3OECA 1DHRA 3S2IA 1L1FA 3GZ4A 4R68A 2OL4A 2I9PA 3KUXA 4QX6A 3BTSA 3N74A 4W99A 3AI1A 4S1VA 5EPOA 4Z0TA 3JQGA 1U28A 2NVUB 3MOIA 5ENDA 3HE3A 1Z74A 1MX3A 2WWRA 4EJMA 3TSCA 2ZYAA 4B7XA 3GNSA 3HZZA 3QRWA 1U3TA 1A9ZA 3AU9A 3HWRA 4IMRA 4NJOA 5JBIA 2BF7A 1GYPA 3SLGA 1QYVA 5KKCA 4PLGA 1DFHA 2VZ0A 1JW9B 3PQFA 4GH5A 1JKJA 5ITWA 2PK3A 5I7VA 1GZ3A 1YVEI 1GQQA 3WWZA 5EJ2A 2AG8A 2DUUA 4NQZA 3RAJA 4CR8A 4BB5A 2FY8A 1EDOA 1ZMTA 4E5PA 4AFNA 3QV1A 1HDXA 3LU1A 2E6UX 2YHIB 2J3KA 4DLBA 1NTOA 3FNGA 5TJHA 1QLJA 1YBMA 4R54A 3ZN2A 2O3TA 2EV9A 3WIEA 3GEDA 2JKVA 3RU7A 3LT4A 1LSUA 3DONA 2HK8A 2IODA 2EG9A 1M75A 1B7GO 3O26A 2DC1A 1B3BA 1H9AA 2X1HA 2W90A 3GHHA 3MWDB 4TVOA 4BQPA 3LK7A 1EVIA 1KC1A 1AN9A 4OJNA 1LBEA 2I99A 4JBHA 4KUHA 2Y1EA 1V35A 2O23A 3S8MA 4YRDA 1E3LA 3GY0A 4CMIA 1ISHA 1NR7A 2PGLA 5BR7A 3VZRA 4HNHA 4JBIA 5CG1A 4WCFC 3QQPA 2ZIZA 3PLRA 4Z6KA 3O9ZA 1JVBA 2R2GA 4YT8A 2ZTLA 5LCXA 4D3FA 4FFLA 2BGLA 4ALJA 1E7QA 1S6YA 1N7GA 2AW5A 1EUZA 4FCCA 2YDXA 3AUTA 3MTGA 2GUGA 1BWSA 3OP4A 4NHEA 3RU9A 3TOXA 1DXYA 4AICA 2JAPA 3IJPA 3PI7A 3QVTA 4RF3A 5CEFA 1KEVA 4GX1A 1D8AA 3Q9UA 5G0SA 1HWYA 4IMPA 3WYCA 1Z7EA 4PG5A 4FOOA 2NVBA 4FBGA 3VZPA 4AJ1A 5CHEA 2Z95A 1HSOA 3A1NA 4J1QA 4LK3A 4NG5A 5G4KA 3JQAB 4YVFA 1E7RA 1SAYA 5GZ3A 4FJ0A 1KOLA 3QA9A 1O89A 4OQYA 5TT0A 1WDMA 3K5PA 3DBHB 2BHLA 2O3JA 3BHIA 1CQIA 2TMGA 4I08A 2Y68A 4IS3A 2WYWA 4YRBA 1QMGA 1KEUA 3OJLA 2BFOA 1BMDA 2DBVO 2ZYGA 1B16A 1IULA 4J90A 4PLPA 1P0FA 1NVTA 1T2FA 5JPIA 5JDIC 1UP4A 4DLLA 3A06A 4EEZA 4EBFA 4TZTA 1O95A 4J7XA 1NPTO 3U4DA 3WOHA 5KVVA 3BHMA 3GUYA 5JCJA 3I9LA 1YONA 3FR7A 4TRJA 5ER6A 2DTDA 4RLHA 2ILTA 1I33A 3WICA 1B0AA 1GUZA 1P33A 4X54A 2VOJA 3DBLB 4MVJP 3KRTA 1HLDA 3OIDA 3PQEA 5A04A 3W4KA 3ORFA 4JBGA 4M55A 3GFGA 4XCVA 3B1JA 1YDWA 5TJ9A 4I9UA 3QWIA 5JFOA 1Y8QA 4QFCA 3WTCA 5JC1A 2NUAA 1KS9A 2BMAA 2C29D 1UP6A 1Y9EA 2V6GA 1F17A 3NV9A 5A02A 1PJSA 1JAXA 1KC3A 2J8ZA 2X5KO 3I9KA 3I3OA 4WPGA 2HMWA 1HDYA 1PL7A 4CL3A 4CR6A 5KJFA 4I9NA 2C82A 3PHLA 1A27A 2I76A 5BSFA 4D44A 3UXYA 4BGUA 2FZWA 3M2PA 3NTRA 3VTFA 4A2CA 1K0UA 1RJWA 4A26A 2Q49A 2Q2QA 1XU9A 4K6FA 1MC5A 4NIMA 2ZTMA 5ILOA 9LDTA 1JQBA 1B8VA 1VL6A 1P3DA 2B5WA 4GWGA 2X5JO 3K73O 1R15A 2BKAA 2Y05A 3PWZA 4TSKA 3KOUA 2ZCUA 4DGSA 5GZ1A 4OM8A 2HQ1A 4NFSA 3PWSA 1FF9A 4CUZA 4JP2A 1DPGA 1U9JA 3W4IA 1CYDA 2SCUA 3VKVA 3FRJA 1R4MA 1SOWA 3GN2A 3UFXA 1C14A 3EVTA 3FWZA 1WZIA 3GAZA 5KCZA 1ONOA 5GY7A 1WAMA 2DBQA 3ZNNA 2ZB8A 3D4OA 4ND5A 4CODB 3HADA 3GT0A 2P9EA 3LT2A 1QR6A 4GMGA 3HSKA 1K89A 4JXKA 3TRIA 5TS3A 4RPKA 2PD4A 4RL6A 5JAIA 4JQCA 3DTTA 2AG5A 1LTHR 2G76A 4XB2A 3AM5A 3O8QB 4MIOA 4CM7A 1ZK0A 1PJ3A 1GL3A 3I5MA 3IP3A 2GASA 3Q3CA 3NT4A 2GGSA 1KEWA 1JLLA 4R1TA 1LU9A 2FR1A 4I5GA 4LN1A 2X6TA 4PVDA 1U8FO 4E0BA 2CVZA 1ADFA 5CFZA 5A5FA 3ASUA 4E3ZA 4GI2A 1SC6A 4IIVA 2PGDA 5AOVA 3ZCXA 3G79A 3QVOA 5IN4A 3ZWCA 2PV7A 3INGA 4J0EA 5LDGA 3EDMA 1ONPA 4I5EA 1OMOA 2VOEA 1A72A 3HFGA 4GX5A 3VHRA 4RPLA 1LC3A 3ZV5A 3GF4A 3LVFO 2EHDA 1FK8A 4M49A 2DTEA 2UUOA 4J4HA 4AG3A 1J6UA 4XB1A 3ST7A 4C4OA 4S3MA 3SEFA 5G0WA 3DOOA 3WTBA 3RUFA 1AGNA 4BGVA 2H6EA 3BZUA 4MVJD 1H6BA 1PGNA 4G81A 3AUSA 1AXEA 4ZQGA 1XCBA 4RORA 1ENPA 1BTOA 1W6UA 2E48A 3I1JA 4WEOA 4XIYA 1G1AA 1A7AA 1PZFA 3FNFA 3UOGA 2O2SA 4WGGA 5KOIA 4QFDA 1SBYA 2Q1UA 3RBZA 2AQ8A 1IYZA 1OOEA 1Q1NA 2Y99A 5L4SA 4E13A 4CLOA 1PGQA 3AOEA 4GMFA 2IYOA 3LZ6A 1GEGA 2O3RA 2PZJA 4BNGA 3PGJA 1E3JA 2PA3A 1E5LA 1C1DB 4KOAA 1QRRA 2G1UA 5DT9A 2ZB7A 5CDSA 5JYEA 1MXFA 4O63O 5JLAA 3L6DA 2R00A 3IS3A 5HBRA 2Q1WA 1XA0A 1I2CA 3UICA 3GA0A 3KEQA 3WWYA 3SVTA 4GX2A 4KWHA 4G65A 2VUUA 3FD8A 4YWJA 3DBRB 3OQBA 4KZPA 3GQVA 4L76A 4AJPA 4YT4A 1PIWA 3JQ8A 5TF4A 5K9ZA 3BMCA 2Y1GA 5F5LA 3DC2A 1BRMA 3WB9A 3WBFA 2YYYA 4HY3A 4P4LA 1UJMA 3HJAA 4UREA 4TRRA 4CQLB 2CVOA 2XOXA 4IJVA 3RUEA 4WOKA 1P9LA 1F8FA 1M76A 4CUJA 4BO5A 1UUFA 4QXMA 2O4UX 2QZ9A 4WCFB 2Y1DA 3EW7A 4YQZA 1XSEA 2AEJA 5JMWA 3RJ9A 4TVBA 3INRA 1PJ2A 1ZXBA 1AHIA 2QHXA 3VZSA 4L0QA 2HJRA 1EZ4A 4DC0A 2H5LA 2Z5LA 4RVDA 3AY7A 5B4UA 4O6VA 5CEEA 1JA9A 4IPTA 1R4NB 3PYMA 5K6AC 2CF5A 5EERA 3SC6A 1UZMA 2NACA 4MINA 2JCYA 4NK4A 1QXSA 1Y5MA 1Q7CA 2PGJA 5TGDA 1R66A 3FBTA 5C7LO 1CQJA 1IZ9A 4BUCA 2RHRA 3WG9A 3MJVA 1ISJA 3H4VA 4YAGA 2VYVD 1I5RA 5IDYA 4BKOA 4LCJA 4K9DA 4KMSA 5JAMA 1F8GA 3ITKA 3F5QA 2GRAA 4XYMA 2CD9A 3DO5A 1LJ8A 1IHXA 4AJIA 1WDLA 1U5AA 1HRDA 2PKRA 4YT2A 1I3KA 4ID9A 1PS0A 3HB4X 4CM9D 1ZO8A 2B4RO 1HDCA 3PGXA 4R51A 2YFHA 5K0ZA 1D3AA 3IL2A 4EJ6A 3HFSA 3E82A 2YQ4A 5HM8A 1RYDA 4QUKA 3VZQA 4WLUA 1LSOA 3HNPA 4AVYA 1NM5A 2J5QA 1E7MA 4HNGA 5FYDA 1VSVA 4OSOA 1J5PA 2B5VA 3RKUA 3ONDA 2P4QA 1SCUA 4Z3KA 1ZNQO 1H5QA 4RV9A 1X13A 4PG4A 2UYYA 4Y67A 1XG5A 5B1YA 4IJUA 4AJOA 1Y5RA 3WX0A 2IE0A 5HWSA 2IRWA 3NDJA 4HWKA 4FQ8A 5IJZA 3GR6A 5TX7A 5B12A 2YW9A 5CPBA 4XYLA 4TRNA 1ID1A 1WZEA 2WSBA 1DRVA 5BNFA 2OGUA 3WQQA 4CM3A 5C37A 3PLNA 1EE9A 2W2KB 4ONEA 1DDOA 3PXXA 2QG4A 4AJHA 2FP4A 2HO5A 4JJIA 4LSWA 5B4VA 4J7CA 1NPYA 1Z73A 3KYDB 4LVCA 4PFJA 3ROPA 3AFNA 3JD1A 4P22A 3ZU5A 1LEHA 4RF2A 5L95A 2BI8A 3KSDO 4ZGWA 1E3SA 3E48A 2ZTUA 1FMCA 1AE1A 2EP5A 1BG6A 3EZLA 3JQFA 3RQSA 3OMLA 2NNLD 4R3WA 3ANMA 3G3EA 1ISGA 1G0NA 1T1SA 1VRWA 1PSDA 3E5MA 3AUAA 3F4LA 1Y8RB 2NTJA 2AEMA 4M1QA 4Q3DA 4IDFA 1FJHA 1Y81A 2PNFA 1NFRA 4UULA 1WW8A 5T8KA 4YAJA 3OIGA 1NNUA 1UP7A 3WFJA 1Z82A 4LGVA 1NQOA 5KNLA 1IZ0A 4MP3A 3I83A 3EUWA 1D4FA 4XRRA 5TSDA 4JLWA 4BMNA 3IUPA 3C24A 2VHYA 4CM8B 5FFFA 3V2GA 2EP7A 3TOZA 4WUVA 1VKNA 1ONNA 2GCGA 4DQUA 4JNKA 4OIMA 1DAOA 5COBA 2JCXA 1C3VA 3VH3A 1I0ZA 1MLDA 3QWFA 4OSPA 4RVGA 1K6XA 2GN9A 3A9WA 3GVXA 1ADBA 4M8SA 2WMDA 5C7IO 1UXJA 1U7TA 2B0JA 1E0DA 4E4YA 2JL1A 2OHXA 3NEPX 2B83A 1EVYA 4BKPA 4MVJH 4PN3A 3OJEA 2WD7A 3QE3A 4P4NA 4RDHA 5THKA 5IXSA 3RBXA 2JJYA 3EGOA 2PZLA 3L4BA 4HKTA 5THQA 1E3WA 2B4QA 4DIBA 4E33A 4R5MA 2PY6A 1DOHA 4URFA 5CDYA 3KEOA 1WMBA 5MDHA 1EUCA 4CMBA 4W6ZA 2X0IA 4YRAA 3HN2A 1O8CA 2VTEA 4PLFA 1JN0A 4FC7A 2VZ8A 4L9RA 4D43A 2VZ9A 5ENVA 1SO8A 1YE3A 4L4XA 4F45A 1I24A 1XELA 2IEDA 4QECA 1R37A 3OIFA 5J23A 2GF2A 4JN6B 3WYEA 2GLXA 3JD2A 1QV7A 1JAYA 5FWNA 4EW6A 2D5AA 3JQCA 2X4GA 4ILKA 4MVJF 3LF1A 2O7QA 4II3A 1S7CA 2VRCA 2BH9A 2YUTA 4B3JA 2HMVA 3RC2A 1PQWA 3LT1A 1K3TA 4BNTA 3OSUA 1N9GB 4MP6A 4D41A 3PRJA 3IJRA 1WVGA 2J3IA 3E9MA 3H3FA 3M1AA 4F3YA 3ONFA 4NBVA 4D0SA 1RM5A 2JAHA 4BO6A 1ZK3A 4PIVA 4NDNE 4XGIA 4ALIA 3HB5X 3VPHA 4B4VA 1YWGO 2YHUA 1CEQA 4AJ4A 3NUGA 4KQWA 3GPIA 3GUCA 3UW3A 4O0LA 1XHLA 2PTGA 3EC7A 1EQUA 4WLNA 2OP0A 1M6WA 3NDRA 3B20A 4U7WA 1VJ1A 4OXYA 4KDFA 4PG7A 3OHSX 2CSUA 2C59A 2EGGA 3PPIA 4JK3A 1E1LA 2GN8A 4B4OA 1YGYA 2E82A 3BMOB 2X0NA 3CMMA 4BO8A 1IPFA 2ZJ0A 1GUFA 5EQDA 1RM0A 1PR3A 1BW9A 3DDNA 4XDZA 4XD2A 1KY5A 5IN5A 5IFLA 3CXRA 1UZLA 2C0CA 3JD0A 1VJTA 2QIOA 5L51A 1Y6JA 2HCTA 2D2IA 3UCXA 1MA0A 1SEPA 5DDIP 3MJ4A 3ZZNA 3S2GA 4CPDA 4UUNA 1BVRA 3G17A 4XQCA 3AOEC 3AWDA 2EKPA 3DZGA 3AI3A 5F1PA 1XQ6A 1E1MA 2C2YA 2QRKA 2J3HA 1K6IA 2GO1A 2ZTVA 4EYEA 3SXPA 2AXQA 2FPIA 4RLSA 1I3NA 1CJCA 3ASVA 3AM4A 2B37A 3D64A 1JWBB 4R4JA 3RCBA 3C8MA 4E2YA 1CF2O 4EI2A 3EMKA 3KLPX 4GSLA 1ZVMA 3VH4A 4JGBA 2R00C 2Z1NA 3OM9A 4IUYA 1ORRA 4D42A 3CMCO 3RD5A 2P5UA 3HDQA 2VYNA 3A28A 4KTTE 4DIOA 4IJWA 4Y8VA 3OETA 3F5SA 1KVUA 3AFMA 5JY1A 3DHNA 4XWYA 3CE6A 3EVNA 3GZNB 5DULA 3Q6IA 3ZNQA 5GMOA 2X0RA 2Y93A 1GTMA 1P45A 3WLEA 3ZHYA 4RQTA 4R5HA 4LMPA 3QW2A 1GYQA 2VCYA 3FTPA 1EFKA 1Q7BA 5FI5A 3WJ7A 1EK5A 3OQ1A 5F3RA 1V6AA 4CR7A 3RC7A 4U0KA 3VH1A 1T26A 2PH3A 1O94A 1D1TA 3GG9A 2BLLA 2F00A 1DO8A 4XYBA 3TFOA 4ZQBA 1F14A 3H5RA 3LC2O 4ITUA 3BXXA 3JD4A 1I30A 2GZ1A 2OBNA 3T4EA 3O38A 4RPGA 5T64A 1JKIA 2OMEA 3F46A 4FR5A 3V2HA 3DBVO 1AHHA 4J43A 3RFXA 4N7RA 1NASA 4IDEA 3TL3A 3I9OA 3MZ0A 3UHAA 1KIFA 1QKIA 3ABIA 2FWMX 1A9YA 1UDCA 3BTVA 2NM0A 1FDUA 3INTA 4JCOA 1ISIA 3KHUA 4YJFB 4R41A 3F6YA 1IL0A 2GZ2A 3C7AA 4J3FA 4O59O 1FDSA 4XZ3A 4XJTA 4CV2A 4DREA 5ADHA 4R3NA 1ADCA 3E1KA 4ND4A 1F12A 2VHWA 4AJ2A 3ZI0A 1YO6A 1X7HA 2HSDA 5IDXA 2WTBA 3GLQA 2G82A 3ICCA 2DFDA 3KXDA 8ADHA 4ALKA 1W4ZA 2CDBA 4BB6A 3CUKA 2DKNA 3EHEA 3E9QA 3AUUA 2D8AA 1LDNA 3OEWA 4FFPA 3OBBA 3PQDA 4TROA 3GRKA 3P5SA 4PG6A 1ZK4A 1C0PA 2RHCA 1UH5A 4D3DA 2JFFA 2HUNA 2Q45A 3JQAA 3ZHXA 4BMSA 3H3JA 1E1KA 3PJDA 1NPDA 4K6CA 4F6LA 1BGVA 4INAA 4PVCA 4YJGB 2W2LA 1LSSA 2DM6A 1P1HA 4ZJUA 2O2YA 1QP8A 1NR1A 2X23A 4O1MA 4YJHB 3L0DA 2VNAA 3NTOA 2Y66A 1KVTA 4JX8A 1RYEA 3AK4A 1J0XO 1HDOA 4K28A 2EW2A 1N7HA 1U2DA 3P2YA 4J9VA 5ER9A 3WMXA 7MDHA 5JYDA 1V8BA 4MVJG 2ZK7A 5CPFA 3KYCA 4MOWA 5I9NA 5FEUA 4HADA 2VHVA 3V5NA 3JQ9A 4U6SA 2OP1A 3E5RA 4XEHA 3JQBA 5BNTA 4W82A 1HZZA 5EINA 2PZKA 1HYGA 4AJLA 3K92A 3DAGA 4WECA 3IKTA 3UGKA 3D5QA 1DRWA 2JFGA 3U4HA 1NVMB 3I9JA 3DBLA 3WBBA 4BO1A 3UKOA 4BV9A 3E6AA 4OOFA 2X7HA 3DTYA 4YXFA 1T25A 3NJ4A 3SJ7A 4MO2A 2HMSA 3MWEB 3M2TA 4H7PA 5H81A 2FSVA 1U7HA 5T8KC 3AY6A 4UVEA 1LDYA 2NQ8A 1GDHA 1WNTA 3OFSA 4E21A 3AW9A 3N7UA 3Q0EA 4ND1A 2NU7A 3QJ5A 1R4MB 2EIHA 4ZQEA 2GD1O 3OEYA 1N1GA 1GPJA 3DMTA 2QYSA 2CNBA 4RZHA 2QZZA 1PJCA 1KERA 2Y1OA 1MFPA 1WXDA 4DMLA 1HDGO 3JQ7B 3JYQA 4E31A 1I36A 1VSUA 3PZBA 5JXWA 3JYPA 3ZU3A 4NBTA 5AXBA 1LDEA 3MCVA 1E6WA 3R3SA 3ZWOA 4UVDA 4XGNA 4E30A 4CLDA 2Y0CA 1YH3A 1U4SA 4RPJA 4B8WA 4J2HA 4WEQA 1PQUA 3C85A 1R0KA 3WDSA 4B4UA 4BKUA 3VOSA 2EERA 3JCZA 2PD6A 4AJKA 1DFIA 1T2AA 1TVEA 3QWHA 2IZ0A 5ES3A 1NX6A 5L45A 2BFPA 4OAQA 1PJTA 2HMTA 3RKRA 1B3RA 1M6HA 2WJPA 3FF4A 4B8ZA 3L4BC 1YKFA 3ROKA 5IZ4A 1HDRA 1QORA 4UVGA 2CFCA 3UUWA 2Q3EA 3KYBA 4GBJA 2J5KA 1LSJA 4RJTA 4CL8A 2DPHA 4ZQFA 3KETA 3QSGA 2ET6A 1U5CA 3BMNB 3WGGA 2XAAA 3WNVA 1YDEA 4FFOA 5A9RA 1DB3A 4I8XA 3GVCA 1AXGA 4JJFA 3WYBA 3A4VA 1I2BA 3UVEA 4BHTA 5A9TA 1MG0A 3GGPA 4N5NA 3O8QA 4PLVA 1ZZEA 6LDHA 3BA1A 3WGZA 4DYDA 5AXAA 1U1IA 3GOHA 4GQAA 1H2BA 2Y0EA 1T4BA 4AJJA 3X2EA 2O7SA 1Z45A 2DPGA 1LDMA 5BNIA 2HU2A 3IDSA 5TLSA 3H5AA 4I5DA 3KLMX 4CV3A 2XXJA 3VPGA 3ZWBA 4L75A 2ZCVA 3S55A 4D79A 1ZXLA 4NJMA 4EZBA 4EDFA 4CLOB 1WWKA 1ZK1A 3WSVA 1H6AA 1PJBA 3PFWO 2C07A 4Y98A 3VPXA 4BO3A 1MB4A 3I9MA 3OJOA 4M89A 4NPCA 4DLAA 1XQ1A 2X9GA 4UUPA 4YJDA 4OL9A 4IS2A 1MXHA 1SEVA 2O3QA 3ADOA 1J49A 1WMAA 5A5EA 2WM3A 1X15A 1YQGA 4MVJE 3PJEA 1C0LA 4R1NA 5IAAA 3K2EA 3TZHA 4E2XA 3Q1LA 1TA4A 1CWUA 4MDHA 3CSDA 4OQZA 2NSDA 5A9SA 5CG2A 3NT5A 3GDOA 4N18A 1LX6A 3V1TC 3U4IA 1YQXA 1O5IA 3ON5A 2BELA 2PKQP 4FFMA 5JSFA 3RROA 3CPSA 1PS9A 2ZYDA 4ESOA 4Q3NA 1LRKA 3S2EA 4F6CA 3ETDA 1NBOA 1DLIA 3C1OA 2YY7A 3BTOA 4IGEA 3RUHA 4AJEA 5B37A 1CETA 4YACA 2X58A 1RM3A 3B1FA 3S1LA 1XEAA 3SBOA 5IG2A 1X14A 3D4PA 2O50A 3O4RA 3L9XA 4XYGA 1V3VA 4OXKA 4CJXA 1HDZA 2TMDA 2CDAA 1E3EA 4ZN6A 3LT0A 2RH8A 3PJFA 1H9BA 4BNKA 1HLPA 2P68A 2H1SA 4XR4A 1PZEA 1C0KA 2F1KA 1PS8A 1XGKA 2H63A 2WD8A 3GNQA 3E03A 3O03A 4NU5A 4DVJA 4FFNA 1X7DA 3PIDA 4IDDA 1NQTA 3DBRA 3QLJA 5AYVA 2VWPA 1YB5A 4IZIA 3RC9A 2DVMA 4Z0PA 1LNQA 2HMUA 5TT1A 4J7UA 3G1TA 1OAAA 1TI7A 2CF6A 4CV0A 4ZHSA 2Y1FA 1ZSYA 1P31A 2NU6A 4MKRA 2X86A 1SB9A 4NK5A 1PTJA 3T4XA 4M86A 9LDBA 2GN4A 1DC5A 3WQSB 4N5MA 4WCFA 2B69A 1B26A 1H94A 4BS9A 2VWQA 4I9HA 3RJ5A 1Z7BA 2VRCD 3GDFA 1KVQA 1BXGA 3TJRA 1MC4A 4BNNA 1EE2A 5G0VA 4PLZA 5IZCA 4BO2A 4CM4B 4BNYA 2EF1A 1M67A 1LDBA 2AQHA 3PFFA 2VHZA 4IJKA 4Q3BA 1PU2A 4XX0A 5HS4A 5KVSA 1R4NA 4WLVA 4YA6A 3GDGA 1EEHA 2RBEA 1EQ2A 1X1TA 1DC6A 1H6DA 2WE8A 1E3IA 4BGEA 4EUEA 1KVRA 4MKZA 4OHUA 1GCOA 3TZ6A 4DIFA 3MJSA 3QWAA 4C7JA 2GSDA 4CLRA 3PYXA 2J5RA 2Y0DA 3ZV4A 3T7CA 2JD2A 3UCEA 4CMEA 3KO8A 1R0LA 5BSHA 1UXHA 1U3UA 1T1RA 1RWBA 1R6DA 4CM1A 4OGWA 2G5CA 3BHJA 3JV7A 2H9IA 2VWHA 3CIFA 4E6PA 4IZHA 2AEFA 5DCUA 1TLTA 2BRUA 3VTZA 4CQMD 4ALMA 4J6FA 4BO0A 2QQ5A 1HYHA 4ALNA 2YJZA 3NGLA 1G6KA 3G0OA 3NJ8A 6ADHA 1ZKMA 3V1UA 5JDCA 2V65A 4Z0HO 3D3EA 3VDQA 3KVOA 3WGQA 1ENOA 4R1SA 1UDAA 1YBVA 4J49A 1MGOA 2PWZA 4CMKA 3LSYA 4EEXA 2HAEA 1SB8A 3ADPA 1X1EA 4BV8A 1LUAA 1W0CA 4A5OA 1T2CA 4J16A 4GLLA 4O5OA 1FDTA 3E9NA 2C54A 1P1JA 2BGMA 4UEOA 1CIVA 1ISFA 1W8DA 3ANNA 4FC6A 3BYZA 2EW8A 2NWQA 3PHIA 3DR3A 1QV6A 3ZH2A 4LISA 1KETA 1YL6A 4BNMA 2EJVA 2W2KA 3H7AA 1AUPA 1HL3A 5DOZA 2VYND 3WR5A 1YXMA 5JO0A 3IMFA 1U3WA 2NTVA 1PJQA 5DCWA 4UUOA 4QO8A 3KYDA 3NGXA 1DEHA 1H2HA 1NWHA 3HQ4O 3QWBA 5AXDA 3VAZA 3JQDA 1WPQA 1U8XX 3PJGA 4IGFA 1D7OA 4IXTA 2EXXA 4DXHA 4LCEA 1DIAA 4CLXA 2EGHA 3D3WB 3DWFA 5TC4A 2C2XA 2QX7A 1PGPA 1YS4A 1YOVA 4TKMA 3RI3A 1HYEA 4GVLA 4WKGA 3DL2A 4RCVA 5DCYA 1B14A 1Y9AA 1VJ0A 3Q2IA 3CINA 4PLYA 1TT5A 3JQBC 1PZGA 3LLVA 4KUGA 2D59A 4CMAA 1Y8RA 1LRLA 4KP7A 3U09A 4K26A 4A27A 3IP1A 1QYXA 2UVDA 2CY0A 4HBGA 1HKUA 3FN4A 4PLCA 2YQ5A 2A9FA 1LDGA 3D4NA 2BFMA 4W7IA 1HE3A 3DB2A 2FPPA 4QSMA 1GQ2A 1JU9A 4MKXA 4KDEA 4H15A 1ENZA 2BFAA 4NMHA 4PLWA 1QYCA 3DZFA 4CM8A 1B15A 1K6JA 1ZIDA 5G4LA 3DZIA 4CLHA 3ZWPA 1LQUA 1OC2A 3GEGA 4EUHA 1C1XA 2C5AA 3Q9NA 3S2FA 3PHHA 4XYEA 1HE4A 2QRLA 3AU8A 3VDRA 4R69A 1P1FA 5F5NA 2VN8A 2OUIA 2FN7A 3NDIA 4MIYA 2NTNA 1DIGA 5KWEA 1GV0A 2HJSA 1PR9A 3DMTC 3UF0A 4PLHA 1GV1A 1SPXA 3I6IA 4W7HA 3VC7A 1LC0A 2PZMA 2HRBA 2V7PA 1QG6A 3WMWA 2BD0A 3M1LA 4FPXA 4E5NA 2D4AA 5EL0A 2DQ4A 4NU6A 2HKIA 2CVQA 5T6BA 2P4HX 3H9UA 1HT0A 4DPLA 3G49A 4E12A 4UVIA 5IDQA 1V3UA 5I9LA 4CMJA 3ZWAA 3U49A 1HE2A 2VQ3A 3BMQB 4M54A 2P2SA 3FHLA 2W8ZA 1I32A 4NFHA 4II2A 2FOIA 4GX0A 4Z9XA 3FNEA 1ADGA 1HF3A 2JFHA 1GCUA 2B4TO 2R6JA 5JCJD 1F0YA 3UH1A 1R0SA 3DFUA 2NVWA 2W2LD 1Q2XA 2UAGA 3OQ6A 4WASA 4NI5A 3JYOA 3GRPA 4IQ8A 5LC1A 3AI2A 4XJSA 4IDAA 3AY3A 5G0UA 4BQRA 1NAIA 2UV8A 3FCOA 3ZV3A 3ZWMA 3IOYA 1VC2A 4ZA2A 1NP3A 2I5PO 4FGSA 1NQ5A 2C5EA 2W98A 2GYYA 3PYLA 3HDJA 3CTMA 4LSMA 3W4JA 2E49A 3B1KA 5A3JA 4UEJA 4YQYA 4DRYA 2ZJ1A 1P44A 3W8EA 4U6QA 4DQVA 3L9WA 4CMHA 4BNWA 3U0BA 1E7YA 4RO0A 4JROA 1KEPA 2G17A 3OICA 4J1NA 2EWMA 4QT0A 1ZUD1 3RUCA 1R12A 2DT5A 2P9CA 4CQMB 2IDZA 3H9GA 3GMSA 5DNAA 4YDRA 3ENKA 4Z3DA 3UN1A 4J4TA 4A03A 4OKIA 3RWBA 2Q99A 1NYTA 3GG2A 3L4SO 4YB8A 2AQKA 4KQXA 2PLAA 3WFIA 3WNQA 3JQGB 3TPCA 2DLDA 4RZIA 4CM9A 3QVWA 3WSWA 1B8UA 3BAZA 5I8WA 3GAFA 1PWZA 3V2UA 1H6CA 1OC4A 3CZMA 3RASA 4JIGA 3DZJA 1Y1PA 1KY4A 3DFZA 3PP8A 5CP8A 1A7KA 4PRKA 3BIOA 1XWFA 4NZ9A 4ND2A 5KKAA 3RVDA 5KVCA 3MTJA 4TKLA 2FMUA 3H5NA 5G0TA 5TIIA 5KVQA 2GZ3A 4EGFA 4NBUA 1DSSG 1MG5A 2O3UA 3EYWA 1YJQA 2WE7A 4WJZA 2PH5A 4CM6A 4FOSA 2J6IA 4MIEA 2P91A 2NVUA 4BOYA 3Q2KA 2PFGA 1GD1O 1YBAA 3VVBA 1P0CA 1YQDA 4FB5A 3WIDA 5JY6A 5AXCA 3TDKA 1XKQA 4RVUA 1R16A 5DF1A 2RAFA 1UDBA 3F9IA 5K6AA 1I2ZA 4CMIB 3F1KA 3FR8A 3KV3O 1U4OA 2X9VA 4M87A 2JD0A 4OYRA 2O4CA 3FPCA 4BO4A 3MJTA 5DN9A 3WGHA 4PGFA 3ZU4A 4QTZA 1HXHA 3X2FA 1GUYA 2GDZA 4YCAA 4HX5A 2RIRA 2VTDA 2YHIA 3GVPA 2XF8A 3R1IA 3K6JA 4G2NA 4GGPA 5HTOA 3GZNA 3TZQA 2CMDA 3H65A 4ZU3A 2XXBA 4GKBA 1SMKA 4HFRA 4WK6A 3GVIA 5HA5A 4BIIA 1DBVO 1V0JA 1UAGA 4OO3A 3IQDB 3ETEA 3IC5A 4D0RA 4KTVE 2I67A 1DLJA 3FNHA 2CZCA 4WE3A 1ARZA 1KBZA 3NTQA 5G4KB 4WLEA 1ZBQA 4ZD6A 3H9JA 4I5FA 2IYPA 1Q0HA 1V9LA 2Q46A
chains in the Genus database with same CATH superfamily
3EYAA 1B76A 4MJLA 1Z83A 3GCXA 4I4CA 2IW1A 2P41A 3EY4A 3IAAA 2A5FA 3KBOA 1JQAA 3PC3A 1XVAA 3PQCA 4PRLA 3SYTA 4F72A 1J8DA 2O0KA 4OMFG 4DSOA 2QMHA 5I48A 3FI9A 4W5JA 1SC3A 3KM0A 3BGIA 4URWR 4OM7A 4YGYA 1T8UA 1BAPA 1ACLA 1GKIA 1PNTA 2O8NA 2VPZA 3U5TA 4DBZA 2CV1A 3C4QA 2OORA 3LLUA 1RAAA 4LJYA 3E53A 3VKUA 4AN0A 4BMZA 1N33B 1JA1A 1ATZA 1P62B 1YMQA 2QAJA 3F7MA 2DGDA 4QG7A 3RAGA 3AUJB 3IQFA 5IWAB 2JI7A 3WB2A 2ZDQA 3G8BA 3KE9A 2NSLA 5FT9A 4ZT6A 2XZLA 3ORHA 2N1MA 5BMVA 4G5SA 3FYUB 4GI1A 5T4HA 3G1UA 4S12A 4AKIA 5JE8A 4YJFA 4B7CA 4MV4A 2OGTA 4HXYA 2IWHA 4Q3AA 1FSSA 3AFHA 4J4BA 4KMMA 5FFNA 4F2DA 3H2SA 3CG4A 3GLVA 4QBIA 3E8XA 2PKQO 3OG9A 4BXOA 1RPNA 1Q3HA 1TCVA 1IY8A 1Z3CA 2BRUC 2XE7A 3RT7A 2B3DA 3DT9A 1Y7TA 3E3LA 4DHWA 4NFYA 4HV4A 2WWVD 4RXUA 4G2TA 1I3CA 2C7GA 4M0FA 3TNYA 1CQZA 1V41E 4B73A 3HCEA 2PE5A 3E18A 5IMBA 5L4NA 2ZAMA 4LQDA 4JXZA 4JLBA 4KC0A 5F73A 3UAYA 2NUAB 3TTVA 3W8FA 4EGCB 5KYYB 3FNBA 2XXAB 2XH8A 1Q6YA 1SNYA 1F5SA 1JGTA 3NVDA 5I8ZA 2NO7A 3R9XA 1AZTA 3PKZA 2QRJA 3R3XA 3VR4D 3ZLTA 2G67A 3KALA 1V8OA 2IZ7A 1EVJA 4GZLA 1ISMA 5TNXA 2LCFA 4J16C 1ZK2A 3ZW8A 3NH6A 4BO7A 3W5DA 4EHBA 2A9QA 1P3Y1 3LWNA 3ND8A 3H6KA 1VLLA 2FR8A 2GTHA 3H1EA 4UPVA 4ZI5A 3TOVA 4BN0A 1NQAO 3PDIB 3TLGB 5GJVC 3UAVA 1IBCA 1LZKA 5HS6A 3JQFC 4ENTA 3E9EA 1RMQA 1Y3FE 1ZH0A 5B1IA 1OI3A 3L8EA 4JLUA 1P91A 5ELXA 1BWRA 6REQB 3T12A 3EA0A 2QMZA 2XRYA 4ZOLB 4LHWA 3EZ6A 2ZSUA 2HV9A 4XOUA 4QBFA 5JARA 2BEKA 2WPNA 5BVGA 3MA0A 1Z0JA 4IQGA 2XD9A 3GLIE 1C7JA 1UAYA 4QPZA 1GG5A 1IY1A 1WMDA 5F3DA 1VE1A 2ZGVA 2YIDA 3UJ7A 5IWCA 3UA3A 3ZIAD 2BVNA 2XW6A 3GH3A 1NVKA 1YI8A 4CG1A 1SZCA 4X65B 1I10A 2ECOA 1RVV1 1O03A 3KU4A 2YZMA 3KX2A 3JWHA 1JE0A 3QBVA 4PLTA 2IXAA 3WKBA 1EK1A 1VP9A 3MGKA 1JDZA 5IKOA 4EB6A 3UMYA 4C7KA 2YQZA 2VDKB 3D43A 3X43A 2HPAA 1TVCA 2ERYA 4CZ2A 4UHFA 2WQZA 4O5AA 1NF9A 3CNQS 4UJ3A 3OZRA 1E7SA 3MJCA 1L5ZA 4YUAA 4ZOEA 2AE2A 3PFBA 4FFRA 4FW8A 1H93A 1YL5A 3OUZA 2QTBA 4RA9B 2CK3D 2PGIA 3NHJA 2Y0PA 1VKRA 1Z88A 3RSGA 4DJJA 3EXFB 1SHKA 1UPFA 2MINA 4IHQA 2CDCA 3E2PA 2P69A 1XMXA 2O7RA 3JU3A 1RYMA 5G2OA 5TF0A 3R0QA 2JHFA 3WQRA 3HCRA 3HA2A 1G8SA 2Z8YA 5LB2A 1I0IA 4CKCA 3OH8A 4CTJA 1AMUA 2CYCA 4MUJA 4DFDA 3BCHA 2MSNA 1F1JA 3Q7SA 1XZKA 5GIPE 4HT3B 1FX0B 3KD2A 2IXDA 1S3FA 3OFNA 4K1XA 3IBTA 2LCQA 1U3CA 3EVEA 3HSYA 3L77A 4YCLA 3OIYA 3T7TA 5FOQA 2NZUG 2I78A 3N6RA 3ULKA 3DEYX 2O2CA 3FX2A 4LC9A 3K5WA 1JPVA 2JGMA 3A37A 1QTNA 3HZOA 3OOWA 4RX1A 2G71A 2JGNA 1XNJA 3L0YA 2VJLA 1NW7A 2JEOA 3UAGA 1II9A 4YTEA 1P7VA 2IA5A 1EH5A 1XLTA 2HK7A 4G5QA 2NO4A 4P93A 3PVSA 5FI3A 2G40A 5I3ZA 1QX4A 1NG1A 3FHTA 5MFPA 2X0EA 1LLUA 2I1LA 5ERGB 5LA6B 5TPZD 3U3XA 3UPDA 3OWXA 3DBIA 3ZTTA 1Z8FA 2JEZA 4EPVA 2RG7A 3N0WA 3WKDA 2QAGB 1KIMA 1NUUA 3U7QA 4UTOA 4B6EA 1KL7A 1NNLA 2VWGA 1TB4A 2BI7A 2YMLA 1P7ZA 3BORA 2IEGA 3KOMA 1S1CA 3LBHA 4IQ0A 1X9HA 1Y8CA 4NYMR 1VG9B 1AKQA 2Q1SA 3AUXA 3ZWXA 3LYLA 2Z43A 1K0FA 4RKWA 4DMKA 3B89A 1CK4A 1EGHA 1RC0A 2P2DA 4EQ6A 5HRUA 1W0KA 5EE3A 3WGOA 1SK9A 1QS0A 2VDRB 1XKTA 1XQVA 2DPMA 1C9MA 5JNUA 1KZHA 2QRZA 1GVNB 1PL6A 3BMNA 1I6WA 1DJLA 3OPMA 5TQ2A 3SQNA 3NUQA 4ZOLF 3NG1A 3OU2A 2CFSA 3OLCX 3SS9X 4W9NA 1I3LA 4BEJA 3LC7O 4MAAA 2IV2X 4BIMA 5K5EA 2FETA 3FFTA 2VEDA 4FN4A 9ATCA 1PWXA 4UFPA 3SD7A 5MGBA 1Z2DA 1SWVA 4KGDA 2XMBA 4UM9D 1UPUA 2VPPA 1E9EA 2I6TA 3DVRX 5DV9A 3I4LA 4OHYA 5ALQA 3L4EA 3V9PA 4RTMA 5ICMA 1NKTA 1C80A 1S89A 3OHMA 3DOJA 1RJEA 4C4AA 2XRZA 4JAVC 3CH6A 4AZ3B 5LKRA 3HDVA 2PT7A 3WGTA 1H2WA 3IT0A 4NBWA 1NVWQ 5AKIA 5KTOA 1ZMBA 3BJZA 1PNVA 4DSUA 4QGBA 4TQGA 1QFXA 1UBHS 2GCEA 2IEBA 4L4SA 3U17A 3ZGVA 4DQDA 3ROMA 2YINC 1PJLA 4Q9NA 3Q0TA 3GARA 5CT8A 1WUKS 4M0LA 3LX4A 5ALUA 2IXBA 1NVUQ 3JYNA 5JAQA 2W2TA 3B6JA 3COJA 2A5DA 3WP0A 3L6CA 4X41A 5DBIA 3GB9A 4DMRA 3JAWA 3RIHA 2DWUA 1KI7A 3MAAC 1GOTA 2JCGA 2B61A 1BH2A 1KJQA 2G0TA 1IB0A 4OY3A 4FVTA 4ZAYA 1MV8A 4HQLA 3IR5A 5GOZA 1E4EA 1U9IA 1WUHS 3CUYA 3KR0A 3ZHVA 1N5LA 1UXIA 3OI7A 4Q66C 3C7DB 1ZVKA 4RSMA 1II8B 3RBAA 2DCUA 5JSHA 3ORQA 2HDHA 3EIEA 3G1WA 3SFVA 3LUGA 1Y3HA 4P98A 2MSCB 1EMDA 3BD6A 1PX0A 2VJMA 3I52A 2YDYA 1HT3A 2ZPAA 4B7XA 3W3ZB 2RH4A 4G0MA 4TMKA 4E2WA 1L7AA 4G67A 2UUAB 1KMHB 1MFZA 1YA8A 2H7CA 2YW2A 2FSSA 3FROA 4FTWA 3E9DA 4QNMA 5TQJA 3RFVA 4DV4B 3WGVA 1EUDA 3IQIX 3ZXSA 4WACA 1IWPB 2KWIA 5F64A 2EKBA 2ANBA 4C21A 3ZCPA 5DGCA 1QHHB 1SU6A 4MW9A 3GLHB 2IC5A 4QRHA 3LA8A 4WWHA 2Q6OA 5EESA 2PU5A 4WCDA 3F5MA 2WAMA 2V6IA 4X8OA 4GYKA 1NSTA 4MB6A 4CMCA 3AJEA 4OX9B 2RCNA 2ZRHA 3EY9A 5KYXB 4A0SA 4PO8A 4BVAA 1CE8A 1G4UR 3DZHA 1UQRA 1PZHA 4OH7A 1J56A 3AHJA 2UU9B 5A2QA 1UK7A 1KDOA 3TZKA 2NMVA 4BLVA 4URZR 5E1OA 3WLKX 5KIAA 1XN4A 1LPOA 1CRWG 2FHSA 2OOSA 3NP7A 2WWYA 2NQTA 2DKOA 4I1UA 4GGOA 3EGXA 4Q1CA 2X5XA 2CNDA 1J06A 3AR7A 1ZVVA 1V1RB 1X9IA 1XYGA 1TZKA 2UUPA 3NDBB 1AGRA 1QV9A 2A0YA 1E77A 3DUFA 4KX3A 2ZQYA 3MTIA 1P77A 2MJLA 4RVHA 2BDEA 3DWIA 2WWIA 3FSRA 4LY9A 2NXEA 1YQQA 3FTCA 4AL4A 4X1OA 2I2AA 3EH2A 5DHSA 5EIEA 5HCNA 3FPGA 3PDUA 4YO8A 2A94A 2VP3A 1UBEA 3D7SA 1UFOA 4BNVA 1E9SA 4HUQB 4GEGA 4MK4A 3BCRA 4RMIA 3RQIA 4B2IA 5K0CA 3MT9A 4XGQA 1RQRA 4FS8A 3HBAA 2OHIA 1T8RA 2DBZA 4NDAA 3TSWA 1SCUB 1ZSVA 1HNXB 2NO5A 1CTQA 1GYRA 2HGSA 3JPWA 3LQFA 3QUTA 4DS3A 3PNMA 2B6NA 4QLAA 4UBIA 4DA6A 1GGVA 4AO8A 2QG9A 2WHPB 4AJNA 3L4JA 3OA2A 1G59A 4CM4A 4U7JA 1UBRS 1JSRA 4L8VA 3I4CA 3TEMA 2NXNA 2Q3HA 3SE0A 5I7HA 2PS3A 1SOMA 3K09A 1XHEA 2WFMA 2NU8A 3IVMA 2AXEA 1X0VA 1FDWA 3W8RA 4BZQA 5YASA 3AF5A 1C0EA 4BO9A 2F48A 2GFQA 3RSOA 4F92B 2AA3A 2ZB4A 3B9QA 3BS4A 5JDIA 3RUDA 5CITA 2XA2A 1N0UA 2B1QA 1LVGA 3UMBA 2ZXUA 2H31A 5LBTA 5D3MB 3HKCB 2VT2A 4Q01A 3T5PA 2QE6A 1T5IA 4H6PA 3FVQA 3R7LA 4UUAA 4R9SA 1JMKC 1ZJZA 1W5TA 1T4CA 2C0PA 2NZVG 2WKPA 1K5HA 4PICA 4MVJM 5SY4A 4LG1A 5J2UF 2OORC 1AG9A 5ALXA 3ZKAA 4GL2A 4E46A 5HFJA 2BFCA 2OLKA 3HO1A 1W25A 3WGUA 5A03A 4E70A 3M7IA 4E5VA 5JISA 3B48A 4DSNA 1XD9A 1KYVA 4RVSA 3NUZA 1G9TA 2O2DA 1M72A 2EX0A 4JVOA 5FB3A 2C2OA 4J0FA 4JYMA 5FRDA 2F8SA 2GR9A 1ODKA 5I9SA 4P5DA 2DUWA 5TE9A 1DIRA 1E1RA 4O3FA 1F4LA 2J67A 3WHLA 3HYRA 1NVGA 5CDUA 3QE2A 1DG3A 3E05A 4BVHA 4MPDA 5K8LA 4KR2A 3O21A 4G4SO 2XNHA 2DFVA 2IDKA 4Q7LA 4JLDA 3NGMA 1IM2A 5JZVA 4V0QA 1GR0A 2AOUB 2YZ7A 4NS4A 4YMUA 4WINA 1F6BA 3PWKA 2QL6A 4O33A 4QJ4A 2GZHA 3VHXB 1CEYA 5FHQA 4DNPA 5GM2A 1JDJA 1A71A 1RIFA 1YOVB 1L4FA 1YR6A 4UNQA 2KBFA 2AF3C 3DLHA 4MW1A 1P8JA 1BVHA 5I7SA 4X61A 2GYVA 1TT5B 3P32A 3UATA 1PEDA 2OAP1 2FR0A 1RADA 5FV7A 3JQ9C 2WAAA 3L7IA 1SCDA 1UJ4A 2P90A 1P1KA 5A4KA 2X8LA 1J33A 1E6LA 5H68A 3IA2A 4UEKA 3JWPA 4HLDA 4AYTA 1T9KA 2FR8C 1M2VA 3R9KA 1OFTA 5DBOA 4KO8A 1A5ZA 3GHYA 4QBTA 3SF8A 4NCNA 4A73A 2M98A 3OQPA 1ZI8A 5HKKA 1DV2A 3CVVA 2WD7B 1OTHA 3N70A 3NBUA 4G9GA 3H19A 4TT3A 3SR4A 2JLWA 2PBFA 1WCIB 4WN3A 1Z8NA 2QGNA 3VI3B 3G82C 5DNWA 2Q2WA 4R6XA 4RQUA 1RKXA 5L4LA 1S8OA 3IV6A 3U7FB 3MMZA 1Q0LA 1E3WB 4NLLA 2RI6A 2G6BA 2GK7A 2QYTA 1WD7A 4BNLA 4B43A 5EMJA 3DE6X 4HFJA 2JARA 4YLYA 1QFJA 4DLRA 1RZUA 3DT6A 3TNJA 4DRZA 5CFQA 3G0DA 3GLGE 1C4OA 3FOBA 2EWWA 4FEEA 1IOLA 2B35A 3GJRA 4JLOA 4KN6A 2XF2A 2WSYB 2XB6A 4GP7A 1J2TA 2AXNA 2R84A 3DDCA 2ISQA 1XIVA 3QVJA 4FMPA 2J08A 1QIJA 3PIIA 4HATA 4TTTS 2IZZA 3ESCA 1YJCA 5REQB 2MWMA 4DG9A 3TF5A 5K0FA 1DCMA 4LPKA 4LRTB 3EXG2 1ML3A 2QN3A 2FFQA 3KQLA 1HDIA 2I4IA 1DDGA 2GEDA 4IDCA 1KU6A 2PWPA 2XCIA 2R8BA 3ZZ1A 3L5KA 1JRLA 2H1CA 2I4RA 2ZATA 1G8GA 3ZHZA 5AUNB 3MUOA 1V45E 3QFCA 4OQEA 4E07A 2CXRA 4KI0A 3F73A 4MZDA 4PCVA 4L50A 1O6ZA 4BU0A 1AV6A 2YICA 4IH4A 5B2FA 1TTPB 1XK7A 2EJWA 2Q1TA 4NARA 3ZI4A 1RXVA 2PRIA 4B6RA 2DHCA 4TTVA 3C3PA 5I9TA 2EKLA 2AFHE 3BRCA 3JQAD 2XVZA 5K0EA 4Z5XA 3GGOA 5J40A 5DX8A 4BFVA 5LLDA 5EWJB 2G6TA 2G28A 2HRZA 3FSEA 4YALA 4EABA 2C9ZA 1Z2OX 1XNGA 1V96A 4LXXA 1L4KA 1LI4A 3WBJA 2WTUA 3JWEA 1UKEA 2JCVA 5LU9A 1BMFA 2A84A 1RQLA 2YWRA 4P4GA 3SBXA 4AG6A 5I7FA 1ZCAA 3RF7A 4TSFA 1RJDA 1JIKA 3PTLA 1RM4A 2H8KA 3HB9A 5JADA 3ETGA 3Q3EA 3PNBA 4IY1A 2PD3A 3OCXA 1INLA 3BMQA 4BKQA 1M5UA 4KJXA 3C6XA 5JAZA 1XLTC 1X7WA 1CP2A 1JEYB 1J4AA 1WV0A 2AFIA 3EQ8A 5AP9A 2JATA 3H7IA 3V4ZA 3ZWNA 5CA1B 1L7EA 3TSAA 1QF6A 1SM4A 4H1HA 1VPDA 1U3VA 1SQ5A 3GFBA 1LV7A 3CT6A 3JVIA 3RWMB 2JW5A 1SKQA 2LPMA 5EZYA 1ZITA 3D6MA 3UGJA 2BHNA 2WA1A 3BQ9A 4KE7A 4O25A 3JATA 1N1MA 5TQ0A 4G9EA 3SC4A 5L7TA 2C1EA 1G66A 1HTBA 2WYUA 3D6NB 1BW9B 3R3ZA 2MSWA 1ESDA 4KAFA 4FFBB 4MS4A 1E4VA 2NZWA 4RHEA 4XVRA 1ZH6A 2VC2B 4X93A 3RYTC 3V7UA 2Y1CA 5C35A 3AONB 1QG0A 3AM3A 2PRZA 4BJ1A 1Q0ZA 3ZDDA 4OHRA 4Q1AA 1ZOSA 4FBLA 4QDTA 4W9NC 2ZJAA 4FDMA 5F51A 1CUDA 5JNLA 2UZ1B 5D7NA 2Z08A 1JLHA 5DX0A 3VPSA 1H4SA 2ZIXB 1T24A 4HXGA 4Q3OA 2C99A 4MWEA 5DTMA 1FSPA 4IHAA 3FPLA 4PYMA 3DL7A 3IAM6 2QUHA 4E22A 3BMOA 3QKRB 5HHTA 3AILA 1X80B 2BZ0A 5F7ZA 4BQSA 2JLAA 5DTEA 3SIXA 3AUFA 4X66B 1LVHA 4XOIA 5AR1A 5K8JB 2XT9A 5KYUB 4KQ1A 4ZPXA 4BQEA 3GZ4A 4EMBA 2V8OA 4V39A 1NIPA 4EPTA 5JMTA 2HLDA 1QAMA 1XTIA 2HFJA 4MWCA 5JSQA 3KUXA 4GM0A 1I3OA 1P61B 1YR3A 3JSXA 1O58A 4W99A 5DK4A 3AI1A 1QVVA 5EPOA 3AERB 1RWPA 4OGKA 5EXXA 4BX3A 3NETA 1PZMA 2ZT5A 1WZNA 4KVFA 3HA5A 2INGX 2O8CA 2FG7C 4HYEA 1Z74A 221PA 2VYFA 3B1WA 5T4FA 1B6GA 3WL8A 5FO0A 4EJMA 2YY5A 3EDOA 3PUVA 4MTLA 3B85A 2P79A 1E79A 3C7KA 3GNSA 3HCDA 3OFND 5DWVA 1NNI1 3AGQA 3VPAA 4C6TA 1A9ZA 2AJDA 3HKEA 2MOKA 4IMRA 4ISCA 5JBIA 2IP4A 3NAMA 4F7DA 5FD8A 1U9IC 1FP4B 2N1BA 1I51A 3GJTA 3NIGB 4GOLD 4H1VA 1B4DA 2YRFA 2WU4A 4PLGA 5EGNA 5ADWA 3N1UA 1JKJA 2K5UA 1X7ZA 3MRXA 1AA6A 1P2GA 2A0XA 3JVEA 4S1WA 4HDNB 5I7VA 2R47A 3ISTA 2AG8A 4I1YA 1MO3A 4X90A 3WFZA 5EFOA 3M9WA 2HK6A 1QZTA 3R6TA 2RJNA 4H7EA 4UU0A 4CR8A 1EDOA 2QTWB 3K1ZA 8MHTA 1MDBA 1XD2B 2C98A 2W2OA 1XRJA 1HDXA 1KZ1A 3LU1A 2E6UX 2YHIB 1WZ2A 4N0PA 1NTOA 3BFJA 2CUZA 2CDRA 3RYCB 2ZBRA 2O3TA 3KR2A 3WIEA 2PX0A 2JKVA 5HF9A 4UMEA 1II0A 3KCQA 5SZJA 3LT4A 4XSVA 3AVYA 3DFIA 5ENZA 2B7LA 3N0VA 3U31A 1YRWA 2DC1A 2VSXA 3GHHA 4TVOA 2W90A 4BQPA 4DNFA 3LL7A 4R2JA 3UOWA 1N8NA 1WUTA 1KC1A 2ZBEA 4OJNA 3U1TA 4N76A 2ZR7A 4C1BA 4L8FA 4C7OA 4N0QA 3V4LA 1JG3A 3OT1A 1MD9A 2Y1EA 4ZFNA 4ZVQA 1JV2B 4JUDX 1KYTA 1ZI6A 3PSAA 2YOGA 4CMIA 4IIJA 5BR7A 3KQOA 2VPYA 5CG1A 4X3PA 4M1WA 4NNPA 4WCFC 1W0KD 2ZIZA 3AQIA 3D02A 2NQ2C 2X14A 3K1YA 4YI5A 1U2TA 3M83A 3A6GA 1IBKB 2W43A 3VOTA 2FQQA 1DAIA 2EZ8A 4ALJA 1N7GA 3KFXA 1EUZA 4FCCA 3RU9A 2C9MA 3U4AA 5E3HA 4KB5A 3AHEA 4L6CA 4OJMX 3G2LA 1GU1A 3ZW7A 1ECFA 5IBQA 2WJ4A 3LUHA 4AIIA 1RCFA 2P40A 2A14A 4GX1A 4JR1A 3R0ZA 4TXNA 3KFVA 2Z6QA 2F8LA 1T4GA 5ALLA 1HWYA 1Z7EA 1JDSA 3J80A 2A59A 1OLUA 4D57A 3K0EA 1BDIA 2XKJE 3VR6H 3LXXA 4XD7A 3R9IA 4AJ1A 4IWYA 1EHIA 2PQ6A 5BMVB 2Z95A 3I2HA 2ZYHA 5AKGA 3QPCA 1OXKB 4KJZA 2AFHA 4NG5A 1M7BA 4US0R 2ODWA 3JQAB 5CTJA 4YVFA 2OMKA 4FONA 4N3CA 3WMRA 1O89A 3SZMA 4GIBA 1WDMA 2W22A 2WVAA 3LHDA 4QGFA 3VR0A 2WWGA 1A8IA 4PQFA 2AXPA 2H9YA 2O3JA 2XMSA 5ALNA 5E6UB 5IH3A 5MN4A 2JLZA 5IK2A 1H69A 3K70C 3K09C 4J2TA 1PRYA 5H3HA 2B8EA 4YAFA 4TN5A 2CBGA 1G16A 2BFOA 2IU0A 2DBVO 1E59A 2P75A 5AJHA 2FQYA 2HHHB 3V48A 1RACA 3NVAA 4ZVRA 1ZUNA 2BR3A 2O7NA 3QX7A 2KE5A 4DLLA 4KPUA 5JDIC 3L7BA 2XQVA 1NXXA 3UYKA 4KN9S 2YWJA 4TZTA 2QMUA 1CKEA 4JIMA 1NPTO 3T3EA 1C9YA 2WILA 1JXAA 4UBMA 1ETHA 1ZRHA 4ZAGA 4C2TA 2Q0HA 5ESRA 3SSNA 4JUCA 1NJ8A 4HO1X 1SCBA 2ILTA 2MR5A 2AHOA 2GBLA 5DSXA 3GLFE 3IBYA 3GJQA 5E2BA 1EWRA 1RLOA 3V46A 2F62A 3BMXA 4EX7A 3AL0C 3T7DA 1GARA 2FZ5A 1JTFA 1P33A 4RTPA 3QEOA 2A57A 5B55A 3VRHA 4O4JA 2ECFA 4FQ5A 2P3SA 3KRTA 3R5FA 4H77A 1HLDA 5A04A 4LFBB 2KW5A 3ORFA 4JBGA 3RDPA 4HNTA 2Z8XA 4Q5IA 4C7XA 4M55A 5DGIA 5BVGB 4RD1A 3N8IA 1Z68A 3WGNA 2FPRA 4I9UA 4LF7B 5JFOA 4PWZA 4QFCA 2KI5A 3FDJA 2Q7OE 4JI2B 2Y9MB 4GO1A 1KS9A 2C29D 2AWNA 4XLLA 4F1JA 4KGXA 3UWSA 3NV9A 5A02A 1TCAA 1F17A 2I71A 1BA2A 1JAXA 3P9IA 4MAFA 1ULHA 3I9KA 3QG1A 4CL3A 3CVUA 4HDSA 4X7BA 1JI3A 2VF4X 3NIWA 1ACJA 5CLJA 4EB6B 1OQAA 1P60A 5BN4A 1A5SB 3VAYA 2YZ2A 4D44A 1CFJA 1DU4A 4H6WA 3K8YA 3UXYA 2Z3VA 3M5DA 3LUPA 4U9IS 3QTTA 3VTFA 1K0UA 2ZWOA 2Q49A 3C5CA 1VHWA 1UXOA 3T4UA 4D74A 2ZTMA 1GITA 3CSSA 3IULA 1XNRB 1D1QA 1JQBA 2QUAA 1G8JA 2X5JO 1J90A 3T9EA 1ESZA 4EZIA 1EI9A 3BQMB 3TCXB 4G01B 3UY4A 3VU1A 2ZCUA 4R8RA 4DGSA 4CKCB 1EWQA 3TW8B 3QEKA 3VOAA 2VQFB 3AEXA 2Q5EA 4UASA 1JYFA 3FYHA 4CUZA 3C3MA 5D5QA 1OYVA 1DPGA 2OCIA 3AI7A 3GBVA 5E1DA 5JHHB 1CYDA 4YIKA 5BMVF 4Z49A 5JNRA 2SCUA 5FPSA 4UTZA 1SD5A 3CEPB 1SOWA 3GWGA 3JR7A 2ODNA 3EVTA 3FWZA 4PNZA 3GAZA 1IHUA 1ONOA 2IDMA 3O82A 2DBQA 3PIRA 4S1PA 3K70D 2ZB8A 1EWTA 1FXWF 3KEFA 1YZLA 1P6UA 4CODB 2H2GA 1RBMA 1W4LA 2AJTA 3SHVA 3U40A 1J2UA 2P9EA 4FSXA 3UKJA 4C5BA 3DXZA 4BNDA 3DH0A 1QHFA 3QZUA 1GLVA 2ZIWB 1YR2A 4F4JA 1A5BB 2WUEA 3COZA 1Z17A 2AB0A 3AF1A 4JXKA 1O87A 2WW8A 1IAVA 3K9CA 2DQYA 2R4TA 3DDZX 1DBWA 4R6WA 5BYJA 1M34E 5C2JB 1QVWA 2X7JA 3ACDA 1P75A 2E89A 3DTTA 2G76A 4FYHA 2KS6A 3MQFA 3O8QB 4MIOA 1ZK0A 2WSSA 2B3TA 3I5MA 1JFTA 3PT5A 4PAQA 3P9YA 3L0SA 4GRAA 1E9DA 1H5NA 4YGXB 3U7QB 4R1TA 1OB2A 4N48A 1XV5A 4LFCB 2JC3A 2AW3A 3BFXA 3KNZA 4KKVA 1TO2E 4J03A 1P2SA 1CVLA 3OAAD 3T5TA 3NONA 3TDNA 3ZEAA 3I5XA 4WW0A 1A96A 1WF3A 2FPSA 3PWTA 1KBQA 2CVZA 4X5OA 5AJWA 5A5FA 3FJ1A 1U0OC 2CBZA 1RI1A 1QS0B 2ESRA 2GYUA 2PGDA 2PMDA 5AOVA 3QVOA 5EIFA 1EGQA 2OXCA 3ZWCA 1IK4A 2VBFA 5LDGA 1FEZA 1E1RD 2QM0A 3CLUD 3N2ZB 2GJ4A 1NLMA 3P27A 5KYWA 421PA 3HFGA 4GX5A 3WNZA 3NKFA 4RPLA 3ER8A 3VAAA 4N41A 3LVFO 3HGQA 4DWOA 2BGGA 4M49A 3BK2A 5I4KA 2UUOA 1QPBA 4J4HA 2QNIA 3D2LA 4P3OA 3GRAA 3B78A 3ST7A 1OSNA 5G0WA 3SEFA 1TZCA 3UAWA 4R31A 1R5OA 2WMYA 3TBFA 2KLHA 3BZUA 4HYYA 4JJKA 3CRRA 4ZO9A 1Q3TA 2E6KA 4Q6BA 1XCBA 3R8XA 1V71A 2OFOA 4RORA 1KE1A 1BTOA 3QPUA 4YJ2B 2QL9A 4AK9A 3EFOB 1PZFA 5EFZA 4BPBA 1NJ1A 4HDOB 4JC8A 3DHWC 4EO4A 4WXEA 3REOA 3RBZA 3CN7A 4O1HA 1Y4AE 1IYZA 2OM6A 3CB2A 4Y2PA 1Q1NA 2BR5A 5L4SA 3FAZA 2GD0A 4DCMA 1D9ZA 1Z4KA 1PGQA 2F4NA 3JAWB 3BICA 3AF6A 1PLJA 3LZ6A 4FLMA 4KDRA 4R0MA 5HE8A 1LF0A 4Z7QB 2FG5A 5HKKD 2V45A 5JJKA 5AKZA 3PNOA 5P8WA 2IVZA 5AW2A 4IFTA 4HVCA 5PNTA 4TT3D 4GOMD 1Q95A 3PD7A 4WRRA 1E4EB 2O5VA 3WRWA 3IR6A 2WM8A 3O84A 3TOSA 1SRQA 4JNCA 4MKFA 4GP6A 3U3OA 1TF5A 5JYEA 3K0FA 1Z6PA 2R00A 1LVUA 1BH6A 1KR2A 2VF2A 4JC0A 4PNPA 2RB4A 3LXUX 3CG0A 1ODIA 5HBRA 3OURA 5KAMA 1H5UA 4FEAA 3SZ3A 2Q5HA 4U9HS 2RAUA 2EJUA 1S3GA 3D9QX 1KORA 1Y48E 4DEVA 1AX9A 1HQKA 1EESA 3KJNA 2MCFA 3DBRB 2ZSBA 3QXGA 4Q21A 4OFBA 5EP2A 3ZVKA 5TF4A 3FPJA 1IG3A 3RARA 1QTIA 1DQYA 1X1SA 4UJ5A 4ZYXA 4H7DA 2VDJA 1KU0A 4MYRA 3ONVA 521PA 3WP1B 5JV5A 4ZVKA 3WB9A 3WBFA 4TQ9A 2YYYA 5B3KA 1WB9A 3AF0A 4HY3A 2JA1A 3IUJA 4AKHA 3H13A 5AIBA 1F7VA 1SR8A 4TRRA 2O2IA 4F3KA 2Q9CA 3BT7A 4EHFA 1X7XA 2OPBA 4CUJA 4BO5A 5K4GA 2R6GA 3CONA 4JUBA 5J2TF 2C96A 1USIA 1Q6ZA 4WCFB 4F56A 2GMWA 4M8LA 4MIKA 5E6SA 2DPLA 4TVBA 3INRA 1C9JA 1ZXBA 3WIOA 5AVZA 2HJRA 4AX8A 5EOVA 4I46A 1HV8A 4DC0A 4KRGA 3RVKA 2RK4A 4JVSB 4OA8A 4HRVA 4OFWA 2P0AA 1JA9A 1JLRA 2QP4A 3G6KA 3PPWA 4GXNA 5G02A 4IPTA 1YMVA 3ZY5A 1R4NB 1WV1A 4ZALA 4B74A 5IKXA 1ZIXA 5K6AC 1F2VA 1BMFD 2HJHA 3QUCA 1U8EA 2CF5A 2GEKA 3G5AA 4MINA 4TSFD 3VR5D 1C3EA 1DL5A 1ZNXA 4BWVA 1Y5MA 3B2QA 4IJQA 4TLAA 1Q7CA 4HF7A 3FBTA 4GRDA 3AMVA 1KARA 4MDYA 3S68A 4XFKA 1CQJA 3SVZA 3VU3A 5C7LO 4KWEA 4PZAA 5KYNA 3G9ZA 4R8MA 5CT4A 4OI0A 3WG9A 1U0BB 1GTG1 3LRPA 3UANA 2ASEA 1ISJA 1WPRA 2WKRA 3C5WP 4IFBA 3U3JA 3SBDA 2P7IA 4YAGA 4KMSA 2EFYA 1YIOA 4L4YA 1F8GA 2ONZA 3EEBA 3EOAI 4EFMA 1J0DA 1E1CB 1NQVA 2D2EA 2ZUCA 3NHYA 4HEA6 2GRAA 3GCZA 4NG4A 1Q17A 3DO5A 4ZDKA 2GWHA 4M8KA 4NONA 4IHJA 4AJIA 4IJ5A 4MW4A 5K3EA 4ZKEA 2JBWA 2FZ4A 3VDMA 3PQ8A 1GZDA 4INJA 2GFHA 4ID9A 3RSZA 2B4RO 1TD9A 4HCJA 2VKTA 4OXQA 4R51A 2CLHB 5HIMA 3SEQA 2YCLA 4RTNA 1KJ9A 2C2KA 3HFSA 4K87A 1SQGA 1KKUA 2AVNA 2YQ4A 1C7RA 3VZQA 4ML3A 2F1JA 3TSCA 3HNPA 5GOTA 3U1VA 3HZRA 1XPRA 4CQNA 2J5QA 1E7MA 4C4PA 5FYDA 4OSOA 1J5PA 2OBXA 4K9OA 2IHUA 2O2JA 3M3HA 2P4QA 3ONDA 4O4LA 1M2HA 1SU4A 2AVDA 4PG4A 3I6YA 6AT1A 1DMRA 1REQB 2QM3A 1U31A 4AJOA 1B0ZA 1M3SA 1VB3A 1S8FA 1Y5RA 3L1IA 3OX2A 4QC2A 2IRWA 2P2ZA 5CVUA 5HWSA 1XPUA 4A0GA 1LFAA 2BM1A 5HUQA 1IBSA 2X8AA 1JR6A 2OG1A 5IJZA 1CY0A 2H2DA 4FKBA 4JT4A 4BB9A 3EGWA 3R3VA 2C4KA 5TX7A 4EKEA 5CPBA 5CD1A 1FPQA 1WZEA 2WSBA 5ALFA 1DRVA 3VPCA 5BNFA 1O6CA 2FOLA 5KINB 1C8VB 2HLDD 4ZMRA 2F3RA 5KOJB 1OH8A 1EE9A 2N0SA 4ONEA 2ODAA 5FUBA 3U39A 3PXXA 3Q15C 5CIQA 3RYFA 5BYAA 2FP4A 4OGGA 1N0HA 1RWNA 2A1UA 2H5EA 2C95A 3HXTA 1Z73A 3A3YA 2XE4A 4NBSA 4IHKA 4YS6A 3HUTA 1QCDA 1QF7A 4H3KB 1GCGA 1QGAA 3AFNA 1UFRA 3EG9B 3ROPA 4F5WA 4UUQA 2L82A 3PNPA 4P22A 4YP5A 1W59A 5CFLA 1J2JA 2FXVA 1E79D 1K5DA 4DDWA 2XCQA 2XCUA 5U4XA 3RRFA 2ZTUA 3OZDA 4F96A 2R8XA 2EP5A 3EZLA 1JHOA 2NNLD 1EWVA 1OWNA 2Q3FA 4H7HA 4R3WA 1NL3A 5EE0A 1K3FA 3ANMA 1J00A 1XDSA 2A0FA 1ISGA 1XCGB 2FEXA 3AKYA 1G0NA 1V47A 3T3DA 2HB6A 1U6KA 1O1YA 2V6JA 2LRHA 2C42A 2GBLC 2WIDA 5C81A 2FGKA 4IDFA 3ZGOA 1NFRA 5T8KA 1WW8A 1M2VB 1G3UA 5KOYA 1XALA 2Q1XA 1UP7A 3EIUA 4ZOAA 3KTAA 3U16A 5IUNC 1HOXA 2VTKA 1KZYC 1IZ0A 3Q85A 3SF8B 2ODPA 5KHOC 3EUWA 3DFKA 5TSDA 5HF5A 1GTRA 2WSMA 2ZSJA 2IGBA 3LSTA 4IX1A 3PS9A 4LOAA 5E38A 2VHYA 1I2MA 3Q9SA 3V2GA 3X1JA 3LO5A 1Y7IA 4Y6QA 1B0PA 4WUVA 4DN6A 3LLMA 2XGJA 4AMZA 5KNDA 3S7ZA 1ANKA 1JB9A 2OZLB 2V3VA 1ONNA 2GCGA 2PZAA 3BM5A 3C8DA 3NBYC 4JSTA 4JUIA 4AROA 4UHJA 1PZXA 2IEIA 5JSZA 3QMVA 4EKGA 1MLDA 3QWFA 5H4GA 3EVZA 3ZY6A 4ZJPA 4AZSA 2B9VA 3OIWA 2F3QA 3QYPA 5FOWA 1S02A 2XTAA 4M4SA 3G7NA 3O75A 4QOGA 3WGLA 4POAA 1U7TA 2AX3A 3L1KA 3KG2A 3CKMA 4F91B 1TAQA 1VA5A 2B83A 2XWQA 5KNBA 3ELDA 1UMCA 5CYOA 5J63A 5GM1A 1AF7A 1QHEA 4PN3A 4YCMA 4YDQA 3UMFA 4RDHA 4YP6A 3OMXA 5THKA 1DADA 1BCRA 2CXXA 1LB1B 3KT8A 3RBXA 3MB8A 1JG7A 3CX7A 4Q9AA 4KV7A 1JSCA 1T3LA 4HN2A 4LJLA 1KZ6A 4Q02A 3SWWA 3T94A 3FUUA 4R5MA 1DOHA 2G08A 2WHXA 5IAJA 3ZQ6A 4URFA 4BFLA 4DMHA 2H4HA 3HLKA 1TUEA 3DAOA 4I4NA 5K4HA 1EHYA 4CMBA 4DLWA 4W6ZA 1G60A 5EI5A 1Q21A 1WTAA 4GLJA 4UTRA 1A1VA 5GADl 4UOQA 2C3MA 2VTEA 4YV2A 4NECA 3QLVA 4YR7A 2I6GA 2VZ8A 5IK2D 4K0KB 4FYKA 2AI2A 1GNLA 2VZ9A 4KAAA 4BE4A 1A50B 3KQTA 2IV3A 4L4XA 5AW7A 2NZYA 3AF2A 2IEDA 1SURA 3G88A 3A6DA 3DD1A 2D7CA 2DR2A 3T15A 2GF2A 2GLXA 2G25A 1JNXX 2AN4A 2YWBA 4I4TB 4UTPA 1UAAA 2QI9C 2FMHA 3PNLA 4EI7A 4DR6B 2QM8A 2AFIB 2R7LA 4ILKA 4DUYB 3LF1A 1SBQA 4EZEA 3A32A 5IBPA 5LXTA 3DV9A 4II3A 3TIIA 3QNMA 1N0VC 4LRWA 3MG9A 1OV4A 5FADA 5AW4A 1K8ZB 4H59A 5H16A 4JI6B 3VV2A 2D6FA 5EIHA 1PBTA 3AFGA 3RC2A 4K9NA 4QPPA 5CIYA 4DLUA 3OSUA 3UJCA 1DX6A 4MP6A 2J3IA 1BEZA 5MF6A 5T7BA 4F3YA 2WIKA 1U9YA 1FJ2A 3JATB 2H1VA 3VYUB 1G5TA 4YCSA 3B8HA 4GKAA 5K4AA 2JAHA 1OGJA 3FKSA 1QU3A 4RQAA 5KMGB 1U2RA 1KK3A 4XGIA 2COEA 2AOVA 3HB5X 4B4VA 2CXQA 4W5WA 1JG1A 3OHPA 1TQDA 3EG5A 2ZU6A 1TK9A 3GPIA 3KJZA 3DLBA 5KSZA 3QF4B 4MMYB 1SBNE 3T3PB 2FPKA 2OP0A 3THWA 1M6WA 2JIDA 2XNDA 2IT1A 2Z5GA 1E2LA 4OXYA 1UWVA 3OHSX 3B9BA 3M70A 1ULAA 4WADA 1MEEA 2PBRA 1Z3IX 2XE8A 3UJ3X 1KP2A 2PS0A 2HQRA 1YGYA 2OXRA 4YASA 3BMOB 1NOKA 1UEJA 4O08A 2CEAA 4Y7CA 3RV3A 4TQAA 4P4TA 1YJ5A 3BH6A 3QTBA 4Y6OA 2I0FA 1W75A 1GUFA 1Y63A 2XQJA 4D56A 2D1RA 1GQSA 1RM0A 2XNKA 3DDNA 3LX8A 3CX4A 3MOSA 4XDZA 5IN5A 3SR3A 3E15A 3CXRA 5ED0A 1E69A 2Y4OA 4KE9A 3ZZMA 2R9VA 2UVPA 3GBSA 1VJTA 1AK2A 1JS1X 1VLVA 4YUVA 4DLYA 3PR1A 1RBYA 1U8UA 2EWVA 2AJ8A 3ESYA 4L08A 3ETCA 5DDIP 3KDAA 3MJ4A 2Y2UA 2JI4A 1OHHD 1U0NA 4MPPA 4W8OA 3S2GA 3DUWA 3G17A 4S1TA 3VISA 4UXIA 2O8CB 2EKPA 2OK8A 3EIQA 4Q4DA 2R8YA 2VLBA 1DRJA 3AI3A 4PYOA 3TYXA 1K6IA 1WSAA 2ZTVA 1Q57A 5K8CA 3ANXA 4ZYZA 1TJ4A 3F4KA 3SXPA 4TXJA 3HKEB 1N2EA 3NOXA 3S40A 4EFKA 2DJ5A 4X97A 3AM4A 1PQ4A 3IHTA 2QZ4A