2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
3SNHA 1Z6TA 4M9XA 1NKTA 2ZJ2A 2FN4A 4F7WA 3EPKA 5LD2B 4M1SA 4LY6A 4IOJA 3AVUA 4ZKDA 5DI3B 2CHGA 4RD2A 1Q22A 1LNZA 1S0UA 1XD2A 2R62A 4Q18A 3WNBA 4LJ6A 1RYHA 1ZNYA 3B82A 4DCNA 3FE2A 1XB2A 4B48A 4Q9IA 2JLSA 3GPLA 2C78A 1NVVQ 2IL1A 4EPWA 2OXRA 3GJ0A 5GJVC 2O8BA 4LI0A 1MV5A 1OKKA 3LX8A 4CYMA 1EXMA 3ADCA 5CYOA 2C9OA 3KZ1E 2DFLA 1NG9A 1P9NA 4IEIA 1W0KD 4L5BA 4U00A 2WAYA 1CR0A 3R8CA 1YRBA 2WMNB 1VIAA 2XSZA 1Z6AA 2P5SA 4JLBA 2UZ3A 2W6JD 1G3IA 2ZUDA 2AWOA 3GJ6A 3KL4A 2CJWB 1Q3TA 3SBEA 2IHYA 2JIZA 2ORIA 2P5TB 2V9PA 4QHSA 4UJ5A 3QEOA 1IN5A 4Q4JB 1XCGB 2YWHA 4P4SA 1KDTA 2BMEA 2JDIA 3LA6A 3AV0B 1KI9A 3B7GA 1DARA 4GMDA 3FGNA 1Z2CA 2Z4RA 3KDSE 2CL0X 2UKDA 4D0LB 4LYJA 2P6NA 2XB4A 5SZJA 1YZUA 2DB3A 3OE7D 4GI7A 4DSTA 4MGIR 1G17A 5FOTA 1XFAA 3TW8B 2EYQA 2IYRA 2GXSA 2XOKA 4KYIB 2IYTA 2C95A 1NG1A 5DSZA 1UDWA 1HEIA 3M4YA 4JLMA 4B3GA 1KGDA 1QRAA 1E9BA 4U7DA 3LW7A 2GWHA 2Q9CA 1C4OA 1AA9A 2RAPA 4HAUA 4OI1A 2HCBA 2QP9X 3Q7PA 1RE0A 3SZRA 1OH7A 3ZS9A 4UJ3A 2G1JA 1XRJA 1QHNA 2ZJYA 3T15A 4WVFA 3K9GA 2DR3A 1MABB 4MRPA 1UBEA 1ESMA 1W36C 4LHZA 3I8XA 2D2EA 4I99A 1CP2A 4Z54A 1N6IA 4LK2A 4RZ2A 5EQTA 1R7RA 4HUQB 3EPLA 4G5SA 2J0SA 3P1JA 4ERNA 3NKVA 1DVRA 2EFHB 1V43A 1ZAKA 3DDCA 2D7DA 4Q4AB 1OHHD 3T34A 2R6GA 1S9HA 2CL7X 3HP1A 4MGYR 4NU0A 2IS1A 4E03A 5KPJA 2GBLC 3KJGA 3QEJA 2MSCB 4ASUA 4Q4LA 3J81k 1DS6A 4NBSA 1DPFA 5FTNA 3BD9A 2BDTA 1XEFA 1I2MA 2ODEA 4NL4H 3ONWA 1G291 3K0AA 4PQYA 4JL6A 5AUOB 3U60B 3W3AA 4IXMA 2ZI7A 5DE3A 5CB8A 3SHWA 2IEYA 2V3CC 4OK3A 5DLQC 1TTTA 4PC7A 2HEIA 1NN3A 1WBBA 1D9XA 5DIFA 3BORA 1EWQA 5BN5A 1CKEA 4B71A 4DSOA 1E1RD 2B92A 4BLOA 4D4MA 3H0KA 4RSGA 1EX7A 4ZCLA 1P2TA 4IFEA 3BB1A 1DG3A 3GFPA 2JASA 4OBEA 4G5QA 1WA5A 4RD4A 1UPTA 1J8MF 1GM5A 3KJHA 2WWWA 4O3MA 1W7AA 2ZJOA 4Q9JA 1EK0A 3F8TA 1BOFA 2ZJZA 4ACAA 4EIWA 1F3OA 3BB3A 1OFTA 3KB1A 1J2JA 1S8FA 1KDRA 5C2JB 2J9RA 4GZLA 5JCZA 1E99A 2QMUA 1Q0UA 5GJBA 4KFRA 4EQ6B 2X2FA 2MSDB 5EUQB 1E6CA 2Z0MA 2QT0A 2WSSA 1SVWA 3TNFA 2F6RA 1E2HA 3LV8A 3CZPA 2QENA 2YHSA 4QFMA 5BN4A 2CE7A 1YU9A 3EG5A 1LFDB 1UBGA 2NO6A 3TBKA 2PBRA 2I1VB 4DUGD 2ZJAA 1OYYA 1A2BA 1Z0DA 3K70C 1E79A 4KLNA 3CPHA 2REOA 3SS8A 5FBVB 2ZROA 1NBMA 1OPXA 3HU1A 4IDOA 1Z2AA 3RLFA 2GXAA 4NONA 5FBWB 1MRNA 4M9ZA 2WMOB 3KKOA 1YE8A 3CF0A 1E9RA 5JEEA 4BFYA 3IEVA 5FUXA 2ZYUX 3VX3A 4QOSA 3GLIB 4JZKA 5C4GB 3ZQJA 2IYUA 3WXMA 2GVZC 2F3RA 4ACBA 3LW8A 5J4VA 2E9SA 3CR8A 3KKMA 4WAUA 4LUCA 4A92A 3ZD7A 3AGQA 1G3UA 5FR1A 1YRAA 1T0JB 4PAOA 1IOZA 5CB6A 1FL9A 3K0EA 1XDBA 1P9RA 2QUZA 4ZDWA 2ZUBA 5FOUA 1ELOA 3CW2A 4WBSA 4TYPA 2EYUA 2CDNA 2OZEA 5FFMA 4E09A 3F0TA 1OSNA 5JZVA 4MA4A 4Q4AA 2J0QA 5KSOA 2KJQA 2ANBA 2W83A 3K9NA 4Q00A 3HU3A 3LH5A 3QPUA 1DAFA 4DDUA 3TAUA 4YMUA 5FBRB 4F4CA 3I5YA 1DAKA 2DFNA 1GILA 2F1JA 4MKFA 3A36A 2IWRA 3S1AA 1ZIPA 5TDHA 2QPTA 4LV6A 1OH5A 2PMKA 4PR0A 3KTAA 1XEWY 1ZBDA 1Y3AA 3WMEA 2RHMA 5FBQB 2WAXA 3L2OB 1RFLA 4CVNA 4UNQA 1II8A 2QRZA 4C3ZA 5JRJA 1QBKC 1FZQA 4B3XA 4Q1DA 4M53A 2A5JA 2VSOA 4XWKA 1CEEA 4W5JA 2BVNA 1GKYA 4BFVA 2WWFA 4PPNA 4FW9A 4FWIB 1IN4A 4WXPA 4NCKA 1OIWA 5KSZA 1KY2A 2PX3A 1RC8A 1D2MA 3F3YA 2G1KA 3K70D 1CR1A 4OHWA 3B78A 3W5JA 4LJ7A 2P2LA 5DN6D 3D31A 2IS4A 2FNAA 3VHXA 3A37A 1SVLA 1E0SA 2WOOA 1US8B 2Q3HA 2OFXA 1G19A 1QVAA 3AVWA 4IRUB 2OCBA 2MMGA 3CRW1 3HR8A 3FFBA 1UJ2A 3BFXA 3Q8XB 4CZ2A 1BS1A 1XWIA 2ZRKA 2ODNA 2XB2A 4YMSA 3A4LA 4CEJA 3RNLA 2WWYA 4NTZA 4CRWB 3ZZUA 5K8LA 5E7MA 2F3TA 1ONBA 3K0FB 4QJ4A 4LX0A 1E9CA 2IHBA 1FQKA 4M9QA 2G77B 1XU4A 2BKEA 3HDTA 2WV9A 3I1FA 3REGA 5KNDA 4E07A 3MJHA 5AUPB 1P62B 1SVIA 2D3WA 2N46A 1W4RA 1CIPA 1NJFA 1BH2A 1GFIA 4C0JA 1FX0A 1TQ6A 1Z3IX 3PEWA 2H1LA 3HJNA 3GP8A 1IONA 3FKSA 2BIFA 4M1OA 4O0MA 4TZ0A 2Z83A 4TMZA 4TYQA 5J4YA 4GNKA 3DO6A 2R9VA 3D3QA 4KITB 1VYTA 2NG1A 2Z43A 5F9FA 2Y8EA 3C5HA 4Q02A 1JEEA 5J4HA 5JBQA 2FPLA 2J7PA 1OH6A 2EVWX 3ADDA 4B3BA 2PLFA 2JDID 1UKEA 2FSFA 1RVDA 2VP5A 4KXFB 2FFQA 2VF7A 4EPTA 4FMCB 3VU9B 1P5ZB 1XMIA 2VHQA 2XNDD 5EE5B 1YZTA 1G3RA 1SHKA 2DWOA 2D7CA 3VR5A 3U2QA 1N6NA 2V6JA 1Z0KA 3ASYA 4OI0A 4E22A 3K09A 2PEZA 4CGZA 4RFSB 2PJZA 1XTSA 5L3QB 2AWNA 5HE9A 2C9CA 3W6OA 1ZC4A 3JVVA 1TL7C 3QQ5A 3L8ZA 4LPSA 4JBWA 2QT1A 4KSBA 2WWXA 1W36D 4R98A 2VPPA 2RGCA 2XEXA 4DC9A 1QHXA 2WVJA 3T1QA 1T5LA 1Q1QA 3FMOB 4I1OA 1U2RA 4D2IA 3A8TA 3G82C 3IQXA 2H17A 1ZU5A 1IXZA 1L4YA 4PANA 1FMJA 2Q3FA 2GEDA 1MO5A 4DZZA 1KSFX 3TE6A 4PQRA 1L2TA 3WYFA 2FGJA 1KKMA 4HZUA 2J0UB 2VSFA 4TMKA 2ZM5A 2O8EB 3QNUA 4NKRA 4WOPA 2IXFA 2D74A 4LBVA 4NYMQ 4M9SA 4CT4B 2IX3A 1W4AA 2ZRGA 2WWHA 4WA7A 2G83A 1QHGA 3SQWA 1TAGA 3X1DA 5KSYA 4TLBA 2Q9AA 2WJGA 4US2R 4FMBB 3AUXA 3OFNA 4C0KA 4Z8XA 1GDDA 1KDPA 2C96A 1FPMA 3IO5A 5FH9A 4AYXA 2QE7A 1XD9A 5FI0B 1D9ZA 3SJAA 1PZNA 5DI3A 3K0FA 1XD2B 1HA3A 3QG1A 4Q7KA 4GP6A 4NP6A 1RIFA 2HCJB 5DNYB 1HTWA 4B43A 4QG7A 4QHTA 1OFHA 2BMFA 3GJ5A 1N6RA 2FSHA 3THWB 1E96A 2NQ2C 3IBYA 3SFVA 2GILA 4Q19A 5CJPA 3T5DA 4AKGA 2ATXA 3FVQA 1M2OB 1NLYA 2EFDB 3NDPA 2CMKA 2FA9A 2XITA 1Z0AA 2KBFA 3IDQA 4KVAA 4URUR 1XXHB 5FPKA 4IFBA 2XJ9A 2ZRDA 4EJSA 1VG9B 2ORVA 1E79D 1BYUA 2ZRBA 4AKHA 4I1VA 3OAAA 1X86B 1VYVA 2RGEA 1LS1A 2P3SA 1KJWA 2GCPA 3NVAA 4NZYA 5BXQC 2F1IA 1JEDA 3KJEA 3SYLA 5JMTA 4Q4JA 5FTKA 5JJIA 3CB4A 2IUSA 2QU8A 3EIHA 1AKEA 4ARZA 1UADA 1I2DA 1FFHA 3QUSA 2H18A 2CLCX 4TQAA 3P4XA 3BS4A 1Z0FA 1TADA 3CX6A 5EP2A 3W8NA 2HF9A 1OXXK 2J3EA 2YWFA 1EGAA 2QTVB 4OQLA 5FR2A 3EIQA 3KQKA 3W3ZB 4HLCA 1OYWA 5EE1A 2HV8A 1NBMD 5LB2A 4AC9A 1ZYUA 4V0KA 1FUKA 4HB0A 4BASA 1NN1A 2WHXA 4IOMA 3SE0A 3JVUA 2GJSA 4C30A 2Z4SA 5L3QA 1YZNA 3EW9A 3PEYA 2RGGA 3BH0A 2G9NA 1WBDA 1NVVR 2XX3A 4HI0E 4YXWA 2QNRA 2DCUA 5EP3A 1N6HA 4MQBA 2WSSD 1Z8FA 2ZRIA 3OESA 1AQYA 3B5JA 4LJ8A 3I3SR 4FCWA 1Z22A 2J46A 1W4CA 4Q4HB 3RS7A 3GJ4A 1VCNA 3CNNA 2IUTA 2ODWA 5KO2A 3U7GA 3ZVNA 4ZCMA 4MUAA 2JGNA 2L0XA 4DEYA 2IC5A 3QXSA 2QY9A 3ZVRA 1WRBA 3Q5DA 4AK9A 2O8EA 3U7FB 2F1RA 2Q21A 5E4FA 4TSFA 3FB4A 1P7CA 2OESA 5CK4A 3DKVA 2ZSBA 5FBLB 2BM0A 2HLDD 4IOLA 2G88A 1E1RA 4NYIQ 1JB1A 4F93B 3QI2A 3E1SA 1I4TD 3ECCA 3TUZC 1WF3A 5KHOC 2CL6X 3LBNA 1VDZA 4IKEA 4EFNA 1Q20A 4LC0A 2Z6VA 2R6AA 4PZZA 1NVXQ 3IIJA 3WYAA 1PVOA 2H5EA 1G8YA 3BFKA 1VYUA 2IT1A 2AK3A 1LW7A 2JJ1D 2FEMA 2ZQ5A 5L8VA 1E98A 1KMHA 2J59A 4A0HA 1LV7A 5BYJA 5JCPA 1ODFA 2IUUA 1AJEA 3T61A 4R9UC 3CRQA 1XEXA 2QI9C 4NCIA 3U6BA 1Z0JA 3I72A 4H1VA 4C0SA 2CXXA 3AQ4A 4LJAA 2VTKA 1BKDR 3THWA 4ZIRB 2DWQA 3Q5EA 3FDIA 1HQCA 2MSEB 3QOFA 4TL9A 3PQCA 1Q12A 5BN3A 5L3RA 3LX5A 1T6NA 4JBYA 2IBMA 4PQFA 4DRZA 2QRNA 1IJEA 2NO1A 1YR6A 1E0KA 5AR1A 2WJVA 1SKYB 1ZW6A 2IK8A 4GT1A 4KBFA 2P6UA 3SYKA 3NH6A 3WNDA 3UPUA 3DHWC 1P9WA 4XTRA 2FZ4A 1KO1A 1OW3B 1ZUNB 3L0SA 4HDQB 4II7A 4TTPA 4IDQA 1KI7A 3OEHA 2ZYVX 4PC6A 1DELA 2EW1A 2GAAA 1U94A 5TXGA 3LY5A 3ZIAA 4QBHA 2RGDA 4DLVA 2O52A 3LVQE 4AIIA 3GJXC 4EQ6A 4XVUA 2V54A 1GL6A 1H8EA 1KK3A 4RKEA 1KMQA 2FE4A 3FMPB 4G1UC 5FTJA 1NRJB 4OHZA 3RS3A 2CCKA 2ZSEA 2X2EA 1FW6A 5B30A 1GSIA 2DHRA 3CX8A 3OEEA 1S3SA 2A5YB 2PL3A 1N2CE 4OQXA 4URYR 2QZ4A 2RH5A 3BRWD 1WCV1 2R44A 3DZ8A 2H8KA 5EUMA 5J4KA 5EJEA 3U3KA 1YR9A 4IOKA 5CDFA 1GKIA 4QGGA 1IY1A 3T1OA 1N3BA 3GLIA 2BOVA 121PA 3SJBA 5C46F 3NBXX 3QF4A 2VBCA 3QBVA 3B1XA 4QNRA 3T06B 3X1ZA 3KUCA 1E9AA 1CJVC 5EE3A 3V00A 3LLMA 2IF2A 2FPKA 3VKWA 8OHMA 3RYTC 3IBGA 2PT5A 4JMPA 2WPDD 3WHKA 1LVGA 4LYAA 3REFA 4JLJA 4DLXA 2HT1A 3ZLJA 4OKSA 2JA1A 4BRWA 4TWZA 4C7OB 3X1XA 4Q1EA 4JS0A 5EXXA 3QIAA 1S4QA 1XTJA 2ZIAA 2ZJBA 1OXVA 4HLUC 4TMVA 5JS7A 4AKIA 3KKQA 3K9LA 5C18A 2D06A 3TUJC 3ETLA 1R0XA 2A3RA 1M1YE 4TT3A 1OKKD 1MO3A 1P2SA 3MD0A 4W9MC 1IAQA 4GRAA 2C03A 1NIPA 3IHWA 4CW7A 1Z6GA 3P20A 2GJKA 4PHHA 4G5RA 1E3MA 1T3HA 3OIVA 4RZUA 3THXB 1R0ZA 4LJ9A 4Y0AA 1QHHA 3CR7A 3NHBA 1VCMA 2ZAOA 3DZDA 2ANCA 1N6KA 2W00A 1O3YA 3EZFA 1JPNA 5DHFA 5BQ5A 4B2LA 5HZHA 1PLKA 2O8CB 4MKHA 4OL0A 2AHOA 4JLAA 1GRNA 4OYHA 1GL7A 3SI7A 4JVLA 2VH5R 1TNDA 3VR4A 2FFHA 2O0KA 4DCTA 5G41A 5LB4A 4B32A 2GNOA 4XIGS 4DT1A 2IS6A 4Q1FA 3VQTA 2A5FA 1WB9A 1JALA 4YXWD 3TQCA 4U02A 3A1SA 4QKQA 1M6NA 1UDXA 2GCOA 2GAOA 3KFVA 2OUKA 4TL8A 3HPQA 3GCGA 2JLXA 1COWA 1TF7A 4DLRA 1SXJA 1ZNXA 2AKYA 2ZAMA 3NWJA 4IVPA 4EAQA 4GOXA 1GL9B 4BFSA 3FHTA 3H1TA 2QGZA 4MRSA 1WE2A 3NG1A 3PUWA 1KO7A 4KI0A 4WIAA 2GJ8A 2JLRA 5E95A 3NBYC 3THOA 4D81A 3T12A 2IYXA 4AG6A 1N6LA 2XTMA 4HDOB 3KX2A 4PTLA 2J45A 1N6OA 4RD6A 2BC9A 4L9SA 1R10A 1KZGB 2H57A 2HF8A 4JBXA 1Z28A 4TMTA 2R8RA 4HSEA 1XNJA 2AN9A 2JIZD 3FOZA 2ZRJA 1N6PA 1KI4A 3BWDD 4R7ZA 4IDNA 1ZP6A 4TLCA 1V5WA 1G1MA 2Q0HA 1TMKA 4RJLA 3RWOA 5EE0A 1W0JD 1Z6YA 3RRZA 5JI2E 2F7SA 3GLGE 2ZE8A 3WP1B 4FN5A 4G01B 3GLHE 5J4LA 1YZQA 2ORWA 3FHCB 4YONB 4OHXA 4EPRA 2GZAA 1KI2A 3QKSB 2A30A 2F43B 4JVNA 5CYPA 3W6PA 3WP0A 1S96A 1YZLA 3EX7C 4YC7A 6Q21A 2WSMA 3PUVA 4BFWA 1XCMA 4YDSA 2RMKA 5CIWA 2JJ2D 4MGZR 2O8FA 1E2QA 3UIEA 4CEHA 1KK2A 1TU4A 3A6PC 4FIDA 3AF1A 3PCRB 3WHLA 5C1BA 3U7HB 1KIMA 1IN7A 1IXRC 2B7BA 1ZM7A 2WWGA 3AGPA 3L8YA 4M1TA 3MRSA 1T0HB 4KFSA 3RS5A 3DMDA 2DFTA 2FF7A 1JAHA 5K8TA 1NIJA 1AM4D 3U3MA 1JECA 1MOZA 3DPUA 3OHMA 4GPTA 5AJWA 4MDFA 1DO2A 4MYUA 4BRUA 4P0TA 4EJSC 1E2GA 1XPOA 1NY5A 3PUXA 3VTKA 2GK6A 4ZKEA 2IYVA 2QAJA 4IEEA 4IHQA 4Q5IA 4QGHA 1XEWX 2IF0A 2VQSA 4DVGA 1Y63A 3HU2A 3R9WA 3VKGA 2OG2A 1JJ7A 1U0LA 2CVFA 3MGCA 1XBTA 1MR3F 1OXTA 4PPGA 3CUEF 5JWOA 1GP2A 1PLJA 4HAWA 1J99A 1DTSA 4Z51A 5J40A 1VHTA 3W8RA 2W2XA 2WZQA 4DDWA 4IJMA 3RAPR 1ZM3A 4PZYA 4MITA 3WMFA 2JJ8A 3MWYW 4B3DA 3E5HA 3W5IA 2JJ2A 3BIFA 3AKEA 1JR3A 2BJVA 2WJJA 3GJ7A 3UANA 1ZMXA 4QXAA 2KBEA 3BE4A 2R2AA 4G5OA 5H68A 4CIDA 4DT1B 2FZLA 4C0BA 1HY3A 2QGNA 4FCTA 2GEVA 2W0MA 4PPFA 4C9BA 1AS3A 4DCSA 4PFSA 2QMOA 4A6PA 3HPRA 5DYGA 5F2EA 2NIPA 4OHVA 2G0NA 2ZSAA 3A1VA 4JVSB 4BLPA 1F6BA 3Q7QA 3R9IA 3IPXA 2ZREA 5F9HA 4A36A 3GLFA 3EC2A 3EZ7A 4TN1A 3UXMA 3KQNA 3BBPA 3GEIA 4JLKA 4P3YA 4V03A 4TZ6A 2IWHA 5FPSA 1P2UA 1IXSB 5JLJA 4UNRA 4LDJA 4PO1A 2EWWA 2NO9A 1W47A 2XXAB 1QHYA 1ANKA 1G4UR 1W46A 4HEJA 2J7PD 4DB2A 3CM0A 2RGBA 1FQJA 2BCJQ 3ZVLA 4KO8A 1TPZA 1AK2A 1ZUIA 3QXCA 3OZXA 2WJIA 3U4QB 1GRRA 1UBFA 4BZQA 2BBSA 2RGAA 1HQYE 3BERA 4MRNA 1NNEA 1CRPA 3FPAA 3MFYA 1G3MA 5FOXA 3QVVA 5TY0A 1BMFA 3NEYA 2R6DA 1CLUA 2OAQ1 4MYCA 1MH1A 2HUPA 3PFIA 4D4LA 1DO0A 1U0HC 3ZS8A 2QL6A 4G3XA 3EXAA 4HLQB 1JQJC 3U3RA 5J47A 1NL3A 5E7IA 4JLPA 4Q9LA 5KNCA 1GRQA 2ZRHA 4C0QC 3F5FA 2YJTD 4R71A 2OHFA 3R7WA 1EFTA 1XMVA 1E2DA 1G7CA 4Q7MB 1XJ0A 5TB5A 4Q03A 1GNQA 2A78A 2XAUA 1XMSA 5HZKA 3BFVA 2BV3A 4PC2A 3RABA 3B1YA 3BOSA 2GZDA 1IM2A 3A1UA 1TQDA 1EFCA 2X19A 2ZS7A 3L82B 2AR7A 4WZ6A 2R65A 1C1YA 1M74A 3O8DA 2YZ2A 2QBYB 4IVQA 4Z1MD 2OM2A 4TTQA 4M2LA 3MCAA 4D0NA 4NPHA 5ANRB 1JXMA 2IYQA 2CLDX 2REBA 4LV5B 1O87A 1ZM2A 4JLNA 3KB2A 3K0SA 3VKHA 4KU4A 2VLIA 2QORA 2JLUA 4C0LA 3ZGXA 2HDNB 3PITA 3CWZA 2ZRMA 1R6BX 3NH9A 2WICA 2B8WA 4TL7A 1JR6A 2BBWA 3AP1A 3DOEA 2V6IA 4V0MA 1JR3D 1VCOA 1IBRA 5H1YA 2PT7A 3SQXA 2JLQA 5JJLA 1R2QA 1T8UA 2ZYWX 1HV8A 3LRPA 4PHFA 2H16A 1E2IA 4EDHA 1XJQA 3FMIA 4EUNA 1F2TB 1BO6A 4N0EA 4UXHA 4BZPA 3RC3A 3GQBA 1E2EA 2NPFA 2DPXA 5GADl 1RJ9A 1NMYA 4BLSA 2GKSA 4G5GA 3NBFA 3WMGA 4FMDF 4R2IA 2LCFA 3AUYA 3LQRA 4XH9B 3AKCA 3VHLB 1KI6A 3CH5A 3UATA 4P32A 5JRZA 4A1FA 4D80A 2IYSA 2IW3A 4CDGA 2ATVA 1U9IC 2GBLA 2WM9B 4URXR 2Q3MA 2WKRA 3CF2A 1H65A 2YOGA 1NSTA 4RCZA 3SR0A 3OIYA 3BH7A 1E9FA 4JT2A 1G41A 3H84A 4B75A 2N42A 2W6ID 5CIQA 1KJZA 1IN6A 2PLRA 4BE7B 5HE8A 3ZJYA 2Q9BA 3PUZA 1KMHB 3PV0A 1RPZA 3EZ2A 3SFZA 4KSCA 3A58B 2OSBA 3DL0A 3KKNA 2J7KA 1YR8A 4HAVA 5DH9A 4HZIA 3CX7A 4D4JA 4L9WA 4Q9KA 4JJZA 1IY2A 2FFBA 1EFRA 4CEIB 2PZGA 3NEJA 5H8WA 1N25A 2ZS9A 2C2HA 3U7EB 5JI3E 4HLUA 1KSJA 3SC3A 4M8NE 1MO6A 4C0HA 3RC8A 2WOJA 1OIXA 1VG1A 2RB4A 5E3HA 1Q1ZA 3TMKA 1GITA 1BIFA 1BMFD 4ZO4A 3QKUA 1IY0A 1E0JA 1OV4A 1P73A 2ERXA 2RGNA 2F1HA 3QJYA 3FYHA 2QQ0A 521PA 1UAAA 2FMXA 3AH8A 1G7SA 2FDCA 2A2ZA 3GLIE 4DLWA 1NBME 2MMCA 2QAGB 4F4IA 2CVHA 4FMCF 2CJWA 3CNLA 2JLWA 3CBQA 1H8HD 1R5OA 1DG1G 3H86A 4LJ5A 5CLLA 2YWEA 4F92B 1E2NA 3DM9B 5CITA 2ZTSA 1NSFA 2H92A 4LOAA 1ZC3A 4DCVA 1K5GA 2QROA 1E94E 3MWLA 3C15C 4L4UA 2ECKA 4YQFA 1B23P 2B8TA 1G6OA 2O8DA 4DLTA 2IYWA 3K0CC 1M8PA 1EFUA 1EG7A 1OFUX 4LHWA 1U98A 3Q72A 1VPLA 2CK3D 2GA8A 1N0VC 4JL5A 4PPQA 4URZR 3ZH9B 4LGMA 2QBYA 4UNPA 3KXIA 2NZ8A 3RRYA 2PJRA 2VHUA 4TQUS 3MWJA 2OV2A 4TMXA 1KO5A 2AXPA 4B6FA 4LYFA 2LWIA 4NMMA 1OB5A 2N1BA 3SOPA 3NXSA 4D0GA 5IK2A 4AYWA 4OI2A 4LSGA 4V02A 4A15A 1M7BA 1YVDA 1XTIA 2HLDA 1VG0B 1E2KA 1SKYE 3EA5A 1P4SA 4TLEA 3U6KA 3NC1C 2VP9A 1CULC 4DWJA 2YC2C 3VFDA 4XWAA 1OF1A 1G3QA 3RRNA 2V8OA 1RZ3A 1T5IA 2OLKA 4HB2A 2ZR7A 3BK7A 1SZPA 3M6AA 1M7GA 3SN6A 3C5CA 4M1MA 1DBSA 3TR5A 4C0AC 2ERYA 3DOFA 3AVOA 1G5TA 1S9DA 3AKDA 4HUQA 2HYDA 5SZIA 3NC0C 2YWGA 1F2TA 2HT6A 3TUIC 4ABYA 1WXQA 2FEOA 3CRRA 1NLZA 1P61B 2XTNA 1FP7A 1KAOA 4MKGA 2OBNA 1J7KA 5KDDA 4MYTA 1GKUB 3VNUA 1KO4A 2B21A 3TW4A 3RANA 3I62A 1W2GA 2YV5A 5G40A 1UEIA 4YMWA 2QM8A 4MRVA 2E87A 1S3GA 2ZRFA 1K5DA 3A4NA 2ZI9A 2QEQA 3CONA 4H1UA 4KAXA 3Q85A 4PZLA 4A8JB 1LTQA 1UKZA 1DAIA 1NY6A 1CBUA 4GBMA 4XJXA 5CM9C 4H9GA 2BHRA 3K0AB 3W90A 3GEEA 4TYWA 2TMKA 4BUJA 4ESVA 1E9DA 1UKVY 5ELXA 1DAHA 3Q3JB 4HAXA 3EWAA 1F5NA 1FUUA 4BFTA 2E1RA 2KB0A 3CRVA 1JNYA 1NP6A 3B60A 4JSYA 5DHAA 3M0EA 5M04A 4CEIA 1Z47A 3ASZA 4US1R 2BWJA 1NMXA 4OJKA 5D3MA 2GHIA 1KNXA 3BC1A 4HB4A 4JKIA 3I61A 5GVSA 1X8JA 2ZJ5A 4DDVA 3C41J 3OAAD 3EA0A 1SHZA 5B2ZA 3I4LA 3QPWA 2GCOB 2AFIE 3AM1A 4Q7LA 5IDVA 1VCIA 3T5GA 4IDHA 4DLSA 1KO8A 1XXHA 2QPAA 1Z63A 4DXAA 2VP0A 2CNWA 4DUGA 1UFQA 3DEFA 4IVRA 2YOHA 5FUWA 2NO0A 1U9IA 3CF6R 4M22A 2ZVPX 5A5GA 1Z83A 4NCNA 4OQFA 1JJVA 1NN0A 2NO7A 1DE0A 5G3ZA 4O2LA 3DKPA 5B57C 4ARZB 2O8DB 1LF0A 3RDPA 1Z06A 4PX9A 2NMVA 4NE2A 2RGXA 3FFAA 1SVSA 1OXUA 3UWKA 3TGPA 2FH5B 2VP2A 2QE7D 3KXKA 3RVBA 5JSZB 2KWIA 1VMAA 2Q6TA 4PHTA 3LBIA 2XTZA 1ZNZA 3THYA 1E9SA 4KFTA 2HYIC 4M0LA 1F2UA 4Q66C 3QKRB 4B34A 1T3LA 5EZ5A 4LBYA 4TMWA 4QM7A 5JECA 2W0SA 3UG7A 2CLSA 2WTUA 4C2TA 2OBMA 4R2HA 3BB4A 2ZR9A 3A4MA 4GOKA 2BJWA 2AXNA 2IYYA 4M1KA 4XSGA 3O8RA 1U99A 5FOSA 4PHGA 5FPHA 5LD2C 4DB4A 1W44A 1W49A 2A5DA 2X77A 4LBWA 1II8B 2WKQA 4UNNA 3FMFA 3QKTA 4M1WA 1NI3A 4YMVA 5CK5A 2RCNA 2YINC 1HE1C 3QVUA 1RRFA 2D4HA 2G0TA 1KI8A 2KSQA 2GVDC 4X8HA 3VMFA 4CF7A 5JHHB 1G5RA 3VR2A 3GD7A 4ASUD 1E4YA 3MMPA 1HURA 2ODBA 2X8AA 4B44A 4EPXA 3K1JA 4I4LA 1AS0A 4X8OA 2ZEJA 1XX6A 3I32A 1W48A 1CRQA 5UKDA 2OT3B 1US8A 3KTAB 2IA5A 1CJUC 4NYIR 5JJKA 4RFVA 2CEAA 5JWRA 2VHTA 2BKUA 5FPYA 3OEED 2REXB 3C14C 4BLRA 4BWYA 4LPKA 1VKJA 4URWR 4DSNA 1FOEB 5E7JA 4M1YA 2ZSDA 4QRHA 2GCNA 4ITRC 1XZQA 1W5SA 1DAGA 2AK2A 3U5ZB 1Q44A 3C4JA 1LS6A 1FNNA 5FOWA 4RZ3A 1XEXB 4PSKA 1E2LA 1RYFA 4MGKR 4LHVA 1W36B 4QL3A 3OF5A 1UKYA 4DDTA 2O8BB 1NMZA 2PZEA 4AURA 3QY0A 2IS2A 2C99A 1NF3A 4PSVA 3ND9A 5C4MA 2ZI4A 3GFOA 2A7QA 3LBHA 4AWXA 2BM1A 4FCVA 3CH4B 3W9YA 4LZZA 3CPEA 5GVRA 3GLFB 2H7VA 2I3BA 2JEOA 3AVTA 3C16C 4XD7A 2GXUA 3FWYA 4ZI2A 3RHFA 5L3SA 4LBZA 1LB1B 2CE2X 1RKBA 3KUDA 3AF0A 3GEHA 3B1WA 2QM7A 2AL7A 1FP6A 1KSHA 1N5LA 5SZKB 4AI6A 1H8ED 2J41A 1RRPA 3SU8A 4TL6A 3VAAA 1N5JA 2WWIA 1R8QA 2G3YA 1KOFA 1G5PA 5KDOA 1G8FA 1FX0B 3ICEA 4N1AA 4J0QA 5HKKD 2VO1A 2K5UA 1F60A 2FPMA 3OEHD 3VR3A 3TIFA 3B1VA 2GEUA 4ZI3A 2OXCA 3X2SA 1N5IA 1Z0IA 1GUAA 1K8RA 1WMSA 1D5CA 3LWNA 3KJIA 2CCGA 4Q48A 3THYB 1KYIA 2ZRPA 3HYRA 3TVTA 1F2UB 2VL7A 2GJAA 2QP4A 4BFUA 821PA 3PJRA 2ZETA 1XPUA 1HT2E 4TYNA 3LXRA 5DN6A 1OH8A 5JWHA 2V1XA 5BYKA 2WBLC 1AZTA 5F98A 2DWPA 5IRCD 3HR7A 3ZD6A 1GIAA 3NDBB 4OHYA 4A0GA 2JLVA 3AVVA 2B7CA 5AJXA 2QA5A 4HDCA 3U61B 5TARA 1PV4A 2AFHE 2NTYC 4BLTA 1R5BA 2YNMA 4LC1A 1GVNB 3IPYA 3VNVA 3TQFA 3UK6A 4P4UA 4KVGA 3PUYA 1ESNA 4PSAA 4ZPXA 4NYMR 4KLZA 4AYTA 2PX0A 1TEXA 1J90A 4A82A 5KTYA 3QE0A 5BWMA 4XD7D 4WW0A 3ZVMA 2GF0A 4ON9A 3KQLA 3AVYA 1IHUA 2UZIR 3DM5A 4BEBA 1J8YF 3QXHA 4DCUA 421PA 4C7OA 1GNRA 4RFSA 4AG5A 4JYCA 4KYUA 1X1SA 2RGNC 2J1LA 1P75A 2GXQA 2GJ9A 2OCYC 4DEXA 2PZFA 3EZ6A 2HXSA 3NTUA 4D4KA 5L3VA 3K70B 3L43A 2F9LA 2V7QD 3ZDQA 4OJQA 3TRFA 5B58C 1QG4A 3SBDA 3JZAA 1KY3A 4DJTA 4TSFD 2FV8A 1T3SA 3QG5A 3L0OA 2IEZA 4CT5A 2ZRLA 1TQ2A 4XSHA 2RKOA 1SULA 3WNCA 3E2IA 5CJ2A 1JXOA 2CK3A 5AK0A 3LQQA 2BCGY 1L8QA 4PC3A 5A0FA 3V4RA 2KI5A 2O8CA 3OIUA 3IEUA 1RJ9B 1G7RA 4W7SA 3WYGA 4A2QA 1PUJA 2QTFA 3I92A 3TAHA 3WBKA 3I5XA 2BEJA 1CR4A 1SXJE 4RD1A 4F38A 3A1WA 3BXZA 2HJGA 4RCYA 3TH5A 3QSYA 2QG6A 3G0HA 1D2EA 1K6MA 1AIPA 1OLOA 1XZPA 1HUQA 2G6BA 1II0A 1G21E 1XTRA 4JIMA 3UWOA 2WIBA 4BFXA 5J5CA 1T4GA 2GRJA 2OO7A 3L0IB 1SXJB 4UQOA 1TF2A 4EJSB 4MDEA 1ZCBA 1U81A 2ZI5A 3RS0A 3UKDA 2I1QA 3LNCA 5EXSA 2XZOA 1JQLB 3KQUA 1P60A 5P21A 4XWOA 1CJTC 5TMPA 2UVQA 1W5TA 4JLDA 2O0HA 3RWMB 4KHZA 1ZD8A 2F55A 3AF4A 2ZI6A 4G0NA 3CNOA 2EFCB 4D82A 3O8CA 4P4TA 2RHDA 1A2KC 4JJKA 2ONJA 4PO8A 3EAQA 3GLHA 1M34E 2ZE5A 3MUFA 3IGFA 1Q21A 4NCHA 4K46A 3B8HA 3ZQ6A 1G18A 1Z5ZA 2ZRNA 3PENA 4L8GA 1SXJD 4F4JA 2NGRA 2LKDA 4QJ5A 4ESHA 3IILA 3G5UA 4Y0VA 2Z5FA 1VIYA 3ADBA 3UMFA 4JLVA 4QM6A 4B76A 4OI4A 2QAGA 2QQEA 3GLGB 5FOVA 3QKSA 1YR7A 4GDFA 4FWTA 4TYYA 4PXAA 4D26A 1CR2A 4I1SA 4WZBE 1TX4B 1OB2A 1D6JA 1T9HA 4NHOA 2ZE7A 1KNQA 3B85A 3PEVA 3FKQA 3PVSA 3MWKA 4S35A 5G53C 5DYIA 4CEHB 4JT4A 1SKQA 4HAYA 3FTQA 1AS2A 5LDDC 2AD1A 1T8TA 1ZM9A 1KI1A 1AZSC 4JSTA 1ZINA 4L16A 4QGFA 3UMRA 1GAJA 2B6HA 5TV2A 1E4VA 1S2MA 1E2FA 2CNWD 2XSZD 2R6CA 4TLDA 1G9XA 2AD5A 1YZKA 3ADKA 1AGPA 4A0FA 1OIVA 4Q7JB 3DVLA 2CHQA 1A7JA 1Z6XA 1Q3HA 5K8UA 3TSOA 1GOTA 4UXJA 2P6RA 3K8YA 1OFIA 3PG5A 2ASEA 2GK7A 1OXSC 1JI0A 2QMHA 3IHLA 1R4AA 1Z29A 2BMJA 1VHLA 4GOJA 2DFKB 1TUIA 4RY2A 1E32A 1SVKA 1QZXA 1II9A 2GZHA 4Q4HA 1UBCA 3IKJA 2FOLA 3QPVA 5EZ6B 1T91A 4GSYA 5EXPA 4EPVA 4QNMA 1QG2A 4Z1MA 2WPDA 1KDOA 2JJ1A 2BBOA 2QN6A 4XOIA 5JFGA 1E2PA 1L7VC 2JATA 2W58A 3PIRA 2GDJA 5FL3A 5HTKA 3UMSA 2VIIA 3IQWA 2XZPA 1KSGA 5IF9A 3TVDA 1G7TA 2DBYA 3U3OA 3EPJA 2VEDA 4B3FX 1DADA 2V7QA 4KBGA 5HPYB 1A82A 2C8VA 3GLFE 1KAGA 1XJCA 4YLGA 3U44B 1KKLA 1XF9A 1AN0A 3IIKA 4O25A 5FTLA 4JL8A 3LD9A 4QBGB 3CO5A 1QDEA 1XXHE 2GTPA 4FMDB 3U3JA 2EU8A 1I4DD 1ZM4A 4LV8B 1EX6A 3BH6A 4A8JA 4ZDIA 2ZSFA 3D6TB 3O8BA 1NN5A 1YQTA 3E70C 2WJHA 2FG5A 1XPRA 1N0UA 3AB3A 4OK5A 1G6HA 3KFXA 1G8HA 1QF9A 4KFUA 1KHTA 1RRCA 1Z08A 4FI3C 4FINA 4JVMA 2XXAA 1U8ZA 1Q1EA 3QF7A 4PO9A 1W4BA 2ZRAA 3GMTA 3NIBA 3V9PA 1P6XA 4PC1A 4ZIRA 3BAFA 2OFOA 4V0OA 2FSGA 1SGWA 2PMDA 4ZV4A 1CF4A 2FWRA 5A4JA 1H8HA 1E9EA 1X3SA 1KJYA 3U4QA 3P26A 1E69A 4NYJR 1LY1A 2AKAB 3A1TA 4W5HA 4HATA 4HUTA 4LJYA 3EC1A 1W0KA 2AX4A 3NBZC 1UF9A 2CCJA 3TKLA 2WIAA 1W0JA 4AKEA 1VECA 3CZQA 1TEVA 4P33A 1E1QD 2VP4A 3QENA 1FTSA 5SZHB 4B6EA 1SXJC 3GLGA 1ZIOA 3RRMA 2ZANA 2W2VA 1TQ4A 1VG8A 4QC2A 3CLVA 5CM8B 1HYQA 1TF5A 1R8SA 2CBZA 1I4LD 2YYZA 3I73A 3W6NA 4UNSA 3ND8A 3WBJA 1MABA 3RS2A 3TSZA 3AKYA 3SJCA 5AJZA 4YMTA 1JBKA 2EWVA 4TTRA 3KQHA 1DAEA 5B64A 2D62A 2V1UA 2W2TA 1AQUA 4N3NA 4BZXA 2NZJA 1X1RA 3QXJA 5JSZA 4B2IA 1X8KA 1CJMA 3VR6A 5FTMA 4HYYA 4XVRA 2ZR0A 2I4IA 4K8OA 1C9KA 2EFGA 2FFAA 3AP3A 4O2RA 3K53A 4V0ME 3QKRA 1L4UA 1QHIA 1A1VA 3AVXA 4AY2A 4BEJA 3B9QA 3QXXA 1B0UA 3Q9LA 1MKYA 1G20E 4QBIA 1NVWQ 4A9AA 1EFHA 2VP6A 3SYNA 4GP7A 4A2PA 1EESA 4X8MA 3D8BA 5IHPA 3D7MA 5KDLA 3CWQA 4LJ4A 3THXA 2P65A 2PEYA 1GZSA 1X8LA 3EARA 1U8AA 3B1ZA 221PA 1LF5A 4JYBA 3CIOA 4Q47A 1G8GA 4RVCA 2J0UA 1D8TA 3O47A 4LHYA 5GJWC 5KUTA 2F9MA 4B74A 3ICQB 1ZNWA 4HB3A 2PH1A 1NLFA 4I81A 4B2PA 3IUYA 1M7HA 1ZVQA 4YDHB 1JR3E 3X1WA 2IXGA 3U44A 1JPJA 3JZMA 4TT3D 3P32A 4URVR 4LYHA 4WZAE 3L0PA 4W5WA 4EFMA 2ZU6A 3T35A 4DLUA 2V4ZA 4EPYA 3MG9A 5EE9A 4DLYA 2XGJA 3K09C 2IXEA 1XD8A 3AF2A 4POAA 4LWZA 1CS4C 4V0NA 1OHHA 5KSPA 1NJGA 1FNMA 2GESA 5FL7A 3H2YA 3X1YA 4GZMA 2P0EA 3CKLA 4MKIA 1NKSA 3IIMA 3TJZA 1QHHB 2DY1A 2WKPA 4QHYA 2IYLD 4Z8YA 2FU5C 4E5UA 3PR1A 1WQ1R 5HKKA 4MRRA 5LBIA 2YVUA 1Q1BA 4RZXA 4Q9HA 3P4YA 1RRGA 2GETA 3LAWA 3VR1A 3SEAA 1GWNA 4ZDJA 1WP9A 4OQMA 4TQ9A 1U90A 5G3YA 1ZJ6A 3AVQA 2P67A 2VRWA 1ZCAA 2ZJ8A 3KKPA 4NH0A 4A0RA 1SVOA 3LO5A 3N5CA 4BECA 1AKYA 2QP3A 4V0LA 1JAIA 1Q57A 2ZPTX 5D3QA 1S1CA 2OCAA 2ZITA 2OE2A 1E1QA 2BBTA 1A4RA 5GJCA 4F91B 1COWD 5HCNA 3SDZA 4C4PA 1AGRA 3GFTA 3NHAA 5KOYA 4GMXA 5L3SB 3EASA 3EPHA 2NOAA 3LXXA 1KI3A 2F43A 3MAAC 5CLQA 5FUVA 3N70A 3HWSA 3DMNA 4MUBA 5FPTA 5BW8A 1HE8B 1EFRD 1FTNA 2FGKA 2VSXA 2BMDA 5AUQA 4MYHA 1FMLA 2C77A 2ZRCA 1A5TA 2O8FB 3MLEA 3B9PA 5DO9A 1GG2A 3HYTA 1E2MA 4L15A 4DIDA 2HJVA 4KV9A 1KK1A 2W6IA 2W6JA 1HT1E 2C5LA 4DHEA 4A4DA 3H4MA 4GFDA 1MRSA 5DGXA 1U8YA 3VX4A 4KODA 4B33A 2ZUCA 4S2EA 2IYZA 621PA 2GF9A 3TK1A 3MJRA 5CDFE 3WY9A 2ZI3A 2QMEA 4NYJQ 1P2VA 4US0R 1ETUA 3GJ3A 3MSXA 3SJZA 2FJUA 4QBFA 1F48A 4AD8A 1GNPA 3C7KA 1SQ5A 3K9HA 3S1AB 3BJIC 1OJLA 1TU3A 1DEKA 1OE0A 4B73A 1HH4A 2JCSA 2OBLA 5TVKA 2ONKA 1YJ5A 1VTKA 4P31A 4UXIA 4GL2A 4DIEA 721PA 4LRWA 2D2FA 4JKYA 4DLZA 4BFZA 2PCJA 1GTVA 3KXLA 1MO4A 2ZS8A 4C2UA 1ZD9A 3R8FA 2VHJA 4XVQA 4BPBA 1UEJA 1R0YA 1XTQA 5KU1A 1J70A 4OK6A 2YKGA 5EP1A 3PXGA 5K8IA 1TUEA 1ZD1A 2WJYA 4Q1CA 2J5XA 1YHNA 2X1VA 3AEZA 3RSOA 4LHXA 3ZZTA 4DKXA 2XNSA 3OIWA 1QVRA 4Q1AA 2QAGC 4PAQA 1EWRA 1P3JA 3UG6A 4ZCIA 3WRYC 1UM8A 5DISB 2OAP1 1Z07A 1DAMA 5JS8A 1G16A 3ZYCA 3SHFA 4X8LA 1CJKC 2QSYA 1R0WA 2OILA 3TR0A 2C98A 1PUIA 4CEJB 1XP8A 1U0JA 4RKFA 2XNDA 3PEUA 4IW3B 4RD0A 5KYKA 4A2WA 3ZZ0A 3C8UA 5FI1B 5H70A 4OQNA 3RS4A 2YC4C 1W2HA 2FSIA 2ZE6A 4EFLA 4WXRA 2A5GA 3AP2A 4Q01A 2YOFA 2VYFA 3EIEA 1S1MA 3V4FA 4IXNA 4QGAA 5F3WB 5IT5A 5AWFC 1G4AE 4IDPA 1IN8A 2LKCA 1SVMA 1YKSA 3ZIAD 5D3MB 2CHVA 2QPOA 1NVUQ 2FX3A 5EP4A 4ZDKA 1W1WA 1KZ7B 2ZYTX 2PCLA 4KCGA 4JLOA 1XTKA 1IQPA 4MH0R 4NDZA 4B35A 2ZXUA 5AJVB 2J87A 5DI9A 4BLQA 1XCPA 3FKSD 2BEKA 4EKDA 5KNBA 5AUNB 2XOKD 2O0JA 1D2NA 5EXTA 1N5KA 3EWSA 2QTHA 3OE7A 3FHOA 4HAZA 2ZU0C 3WRXC 4DSUA 3B13B 1OT3A 3R20A 4K81B 4NCJA 4D25A 4LCBA 4P4SB 4RD3A 1RW4A 3R7WB 4D6PA 3RSLA 4BQSA 3B2EA 1XMJA 2JAQA 1G8PA 4KJZA 4N0DA 1CXZA 3CRMA 4B3CA 3GLHB 3VU9A 4M4SA 4HLDA 3N2IA 2C04A 2J0VA 2ZVQX 5LPNA 1PJRA 2VF8A 4A6XA 3QBTA 1CU1A 5HR5A 1N0WA 4BGDA 2JLYA 5HCIA 5FL7D 1G64A 3LFUA 3LLUA 4Q21A 1E2JA 2C9YA 5AJYA 4XTCS 4A8JC 1ZRHA 3IO3A 4Q1BA 2OLJA 1WDTA 2XJ4A 1KK0A 3EZ9A 3M1IA 2KE5A 3R9XA 1CTQA 3T1TA 1BYIA 3LVRE 1ZU4A 5KPDA 1E0AA 1MT0A 3N2EA 4DBLC 3QF4B 1P72A 2VHCA 3GJ8A 4B47A 2NPIA 5JEDA 1KTVA 3AVPA 2JLZA 3AF3A 2A9KA 4TLAA 1DOAA 2OEPA 4QJ3A 2SHKA 3K0CA 4I1UA 2OFWA 2V55B 3W34A 3BGWA 1ZUHA 3CPJB 4FD2A 4HZUB 3TSWA 3P27A 4ILEA 1QHSA 2QSZA 1PLLA 3OFND 3I8SA 2OCPA 1X6VA 4PAMA 1KI6B 1R5NA 5FUYA 3B6EA 4UKDA 2EQBA 2R6FA 3T1VA 5IK2D 2O5VA 3LDAA 4FXPA 2XZLA 1YZGA 2HXYA 4U5XA 5JHGB 4M21A 2VA8A 2DYKA 1IJFA 2EFEB 3TLXA
chains in the Genus database with same CATH superfamily
3SNHA 1Z6TA 1RP7A 3JAWA 4DIMA 4EMSA 2XTJA 2ZB4A 5CDSA 4IAOA 5FQOA 1Q74A 3KOOA 4I50F 5DF1A 3EPKA 3AVUA 2DRIA 1N2GA 4KIFA 3OZTA 3GT0A 4RD2A 4RL6A 1V1MA 1Q0TA 1PJZA 1V9CA 3KPYA 1EB9A 1ZNYA 3HZHA 3MQFA 2J5RA 1YU6A 1DCKA 1XB2A 3LP5A 4QPJC 4ZO6A 3U9TA 3IVXA 2ZFUA 3HCNA 2Y2UA 3OQIA 3RBVA 4EPWA 5GJVC 2O8BA 4NWIA 2DBZA 3AQIA 4H35A 3LTNC 4XWTA 4LF6B 4ZI7F 3ADCA 5LOVB 3I1YA 5CYOA 1HL7A 3FPHA 4DQDA 3K9QO 2WG2A 3GNLA 3R5XA 2DFLA 5A2GA 1AO0A 9LDBA 3Q0EA 2BTOA 1P9NA 1VE3A 5K6AC 4ZV9A 4WCFB 1TDJA 3K4PA 1W0KD 5J23A 2ZVJA 3DZGA 1K5HA 2WAYA 3Q3IA 4FEGA 1A50B 1CR0A 3I4CA 5FB3A 1B16A 1VIAA 5ALFA 4JLBA 3ONNA 1G3IA 4KW7A 3ELBA 3RO7A 4BNVA 1YIOA 1JR2A 4J2HA 4RVNA 3TLAA 3D7NA 3T9DA 2GO7A 4Z0HO 1A96A 3SBEA 3VUFA 2C4WA 2JIZA 3LO8A 5K0GA 1NF8A 4GOND 4O4LA 4QHSA 1VHWA 3A2NA 1RWNA 3IQIX 2HFJA 1C9EA 1WSDA 4P4SA 2ZRQA 1V3VA 4MW4A 1C7FA 1L5GB 3LA6A 1AN9A 1KI9A 2ODPA 3QLUC 3FGNA 4P3PA 3KUXA 1HOTA 2CL0X 1JDTA 1YFLA 4LYJA 2OHJA 5SZJA 1SD5A 1P9OA 4GI7A 3C4QA 3V1TC 1G17A 2E4YA 5FOTA 4N48A 3PFWO 1E1DA 1MQSA 4IGAA 5BXYA 2NU7A 2J6BA 2VQDA 1NG1A 5GZ6A 1EGQA 4NPAA 1UDWA 3TKAA 2BZGA 2OYCA 1HEIA 3M4YA 3FMVA 4P80A 5ICCA 1QYXA 2EG5A 4LAFA 4B3GA 3WAGA 2YXLA 1E9BA 3NVDA 1YKGA 1Z6PA 2IYEA 3DTVB 4R7TA 5KTMA 2NU9A 1RNLA 4I36A 4OI1A 2RAPA 4Q16A 1OWMA 3SZOA 2E4AA 2C4KA 3F3SA 3TR6A 5EHXA 1EA5A 1P31A 1XRJA 5EG5A 4FKBA 4O4JB 1GFWA 3TIIA 1G5HA 1T1SA 2YMPA 4PXSA 4WVFA 3UQYS 13PKA 1KJJA 2O2XA 3A3YA 4ZHSA 3WTBA 4IMIB 4RA6A 4HFJA 4QUDA 1W36C 3ERCA 3I8XA 1PUXA 2D2EA 2MR6A 3PRHA 4Z54A 2VPYA 2OGUA 4YRKA 4RZ2A 4YYZA 4HUQB 4DV2B 1EXWA 4C4ZA 1JJBA 2Y05A 1DVRA 2EFHB 1RC1A 3Q8KA 3MPUA 3FLEA 1OHHD 1EQ2A 3G0OA 4R31A 4RADA 4MS3B 2R87A 4EECA 3BMQB 5KEIA 4MGYR 2CL7X 2GT1A 4NU0A 1PEAA 2IS1A 1JEAA 3HCFA 4LE0A 3Q41A 2H3EA 4MR9A 2MSCB 3ODPA 3GYBA 4ASUA 3GMIA 4RVUA 3VO8A 1RWKA 1IULA 4LF9B 5H3LA 2XUOA 1JTFA 5FWYA 5JNWA 2L82A 3IV9A 5LBUA 2P6OA 2EHDA 4IIFA 4NBSA 2VDRB 2BDTA 1GAEO 4JUBA 3L6CA 3OPNA 1XEFA 4U7HA 4NL4H 2OZVA 4U8GA 1SCNE 2M6RA 3ONWA 3GA0A 4EG5A 2HQBA 1USWA 1DBIA 3ORYA 4P2GA 4PQYA 4BUCA 1XRLA 3E2PA 1CY7A 1E6WA 3P8ZA 1ISSA 3ZJTA 2QTCA 3GJSA 4IXMA 4BKOA 1H5QA 5KWVA 3FOBA 4H7IA 3A25A 5CU7A 1BN6A 2WT9A 2ZJ0A 4CL3A 4WESA 3GPDG 1DDOA 2HEIA 4D9MA 3MTDA 3ZWWA 3VOSA 5KOIA 1V0JA 3F7NA 5F76A 4B71A 5BQOA 1E1RD 2EZ4A 5IMBA 3SC2A 2EGGA 4B3HA 5IBQA 4R0NA 4QDOA 1EUZA 1P2TA 4IFEA 4CODB 1UQTA 3KYBA 2SCUA 3N07A 3O91A 1DG3A 7GPBA 3MMNA 4RTOA 3R23A 3GFPA 1S7GA 4OBEA 3JTMA 1CUVA 4RD4A 1U2QA 3SSMA 3L5KA 1UPTA 1J8MF 1HDZA 1Q1AA 3AOEA 4L8WB 3RCBA 4C0XA 5FUQA 3WZ2A 1RXVA 2WIJA 4Q9JA 2X6TA 4BU0A 5LIRA 1OB2A 4B09A 2D5AA 3QVSA 1GPWB 2QD2A 4F9TA 4EIWA 4FEAA 3EJ6A 1L4HA 2D8AA 3I45A 3KB1A 4FQ8A 2PE5A 1KAMA 5JR3A 3WK4A 4GZLA 4UFOA 1I0ZA 4CCAA 1IBMB 5DHQA 1W581 4EQ6B 2X2FA 1S3FA 1UPFA 2MSDB 3N0RA 1YXMA 3ZNOA 4F6RB 5EA2A 1HRDA 4TWAA 3VKVA 3OFVA 5JNRA 2WSSA 4UUOA 1KP3A 3C6KA 4EL0A 2YHSA 4QFMA 1B93A 1OROA 1P2DA 1UFVA 3MOGA 1HF3A 1W9MA 2ZJFA 4S12A 3SF8B 3T9FA 4AICA 4ALKA 3GJYA 4KN9S 1U7UA 2XD4A 4ZVKA 3SD7A 1IM8A 1KVRA 2I4LA 3RR2A 4LZJA 3TBKA 3AF6A 1DP4A 3W06A 1QZZA 3DZCA 4H3VA 1E79A 4GQIA 3CLRD 3ECSA 3MQ4A 3SS8A 5A0VA 1NBMA 1W87A 3Q7SA 4ED9A 2X4GA 3OLVA 5HKOA 1Z2AA 3KQSA 4FFNA 2EIXA 2Y0PA 1GGFA 3DTVA 1J4AA 1E9RA 3CF0A 2QUBA 2UZ1A 1SQ0A 3JARA 5D3ZA 3EXHB 4D96A 1E5TA 3GVIA 3TOZA 5KQPA 1GY8A 3OI7A 4JZKA 5C4GB 3T3IA 4F96A 3WXMA 2F3RA 3HVUA 4NU8X 4LF5B 1VB5A 5BV1A 1JE0A 1U5BB 1KFCB 4C4XA 4ZRDA 3GWGA 1GYPA 3CR8A 2HNKA 2VBGA 1I6KA 4JQSA 4LYDA 4A92A 2Z5GA 4PLHA 1ADFA 2CSXA 2IIPA 3QSGA 1NQAO 3L7DA 5AKLA 1YRAA 1T0JB 1PT6A 4PAOA 2CXPA 1IOZA 3C24A 4MRAA 2NV0A 1XDBA 3RW9A 3SZMA 4NMWA 1E7WA 1DQSA 1Z5PA 4AF7A 4TYPA 1A5AB 3F6CA 1J8QA 5A6SB 4ZQGA 2OZEA 4E09A 2HNBA 4AO8A 1JLLA 4J9VA 1LTHR 1BN7A 3WJ1A 2J0QA 5ICFA 2ZT8A 5KSOA 1LLUA 1IOLA 5MN6A 4QVGA 2ANBA 2W83A 3BMQA 2B4YA 3LH5A 1T4MA 3O3NB 4J0DA 1XTZA 1EK5A 1POXA 2WZBA 4JCCA 4YMUA 5FBRB 2EX0A 4X63A 3E3MA 3VJLA 5A2QA 2DFNA 3OLYA 2F1JA 3EB9A 4RSRA 3ZU3A 3S1AA 2DKOA 3A2MA 1U63A 3P9YA 5LQRA 5TDHA 2Y0DA 5HUHA 2G76A 1UP4A 1ZBDA 3KTAA 5DJ5A 4F60A 2FPPA 3OCXA 3PFHA 1Y8RA 3ZHBA 3R7BA 1IOVA 1PSDA 3PTZA 3KC2A 4S0XA 1QBKC 3MM4A 3DVQX 5CX1B 5AW9A 4B3XA 5I4KA 2ES4A 1FVFA 2JBAA 2XECA 4LJSA 1CEEA 3LCCA 2P4SA 3RIXA 3W77A 2PZMA 2WWFA 3NAGA 4FW9A 2F64A 2JI7A 4WXPA 4YUAA 3E3LA 4GWGA 2XODA 4NCKA 3U7QB 4GQBA 5HJ7A 1D2MA 3DWEX 3L01A 3RJZA 2HJHA 2PA3A 3O82A 4JEIA 3E0XA 2IE8A 2QTZA 3K70D 1CR1A 3A1FA 3LBFA 2EDAA 4JLSA 5ERYA 3W5JA 5KVAA 5MGNA 4TLLB 4BJ3A 5DN6D 2IS4A 3F46A 4WCDA 3HKBA 3V1YA 1H05A 1SVLA 2PX5A 3P0JA 1E0SA 3BX1A 3LZDA 2AEFA 1US8B 2Q3HA 3LYUA 4OHPA 1QVAA 4AZSA 1VPEA 5CDTA 1VRWA 2VAMA 3CZCA 4ZPJA 4MUYA 4MMXB 1EVQA 1RLOA 2K7ZA 1JFFA 4EYEA 3O4RA 1EE2A 1ONBA 4QJ4A 4LX0A 1RYBA 4YRLA 2ID7A 3S3TA 1SCKA 2X1MA 4CNBA 3EBOA 4M9QA 3OT1A 1DRKA 2X7JA 4QE3A 4EB0A 2CZQA 3LYAA 2WZCA 1YBVA 4H7EA 4CCYA 1X87A 3H05A 3ZWCA 4BMPB 1SRQA 1CERA 2AMJA 2N46A 1O6CA 1YVPA 2H4YA 3NTLA 1BH2A 3TEMA 1HPLA 3BT7A 1TQ6A 1JAYA 1LLDA 1VMEA 2HA7A 2YJZA 4IZOA 3KJXA 2QOEA 1OZHA 3W6ZA 3CW8X 5ARBA 1SOAA 5JSQA 3PEWA 4JFAA 4L8LA 5DM2A 1QIHA 2OD9A 4HLNA 4OLJA 1IONA 1GPNA 1RYDA 3ISTA 4UDNA 4YN3A 1PS9A 2AG8A 1WXHA 4M1OA 1EGVB 1KBZA 2YX1A 3PKZA 4H2DA 3KM0A 4MWGA 5LN1A 4TYQA 1WETA 4IH4A 3CU5A 2YHIA 1T36B 4JI7B 3GT7A 1Y5NA 3C6MA 1EUCB 2W22A 3D3QA 3SG0A 1BCSA 2B2XA 2HV9A 3HJCA 1LVHA 1OWNA 5CHEA 2NG1A 4IHJB 3V8VA 1XZGA 4ZICA 4B6SA 1JWAB 2PMEA 2HW8A 2VRCA 3C74A 4XB2A 4UFPA 5J4HA 5JBQA 3NV9A 4BCBA 4UAUA 3COZA 4OGWA 2EVWX 5K0EA 2GHQA 4X6YA 3VZPA 3ADDA 1KGSA 2CMFA 3T1NA 1OBVA 4CL8A 2YXEA 5IDWA 3OTQA 1QAOA 3GOHA 2NP7A 1ZK1A 3AF5A 2VP5A 3F9RA 3HGQA 2DKNA 2DR0A 3A9TA 4GUDA 4OHMA 4CT0A 3FX2A 2FKNA 1XAGA 2QLLA 4Q9AA 2VHQA 5EYPB 4AP6A 3C6QA 1YZTA 3IQHX 4EA9A 4N0MA 2QTTA 4N9QA 4ZVOA 1MHTA 3ET5A 1YTLA 2DWOA 3B5IA 2D7CA 4KVZA 3VR5A 3OZIA 3K94A 1JDBC 2WU0A 4OI0A 4ROSA 4E22A 3PPXA 3SIXA 3M3DA 1BFUA 2FCAA 3K09A 1RMYA 2PJZA 3JYHA 3MGAA 2R66A 3LC0A 2BR3A 3H8WA 4F71A 1GZ4A 1M5TA 2IOFA 1WUYA 2WUWE 5F33A 1NDQA 1WB4A 1GEGA 1TL7C 2OCDA 3L8ZA 3EDYA 1ZX1A 3CNQS 1HYEA 4QNNA 4BIMA 1UOPA 3KWFA 1SPXA 3OD1A 4EX6A 2D5IA 4RGYA 4URHA 4R98A 1LLCA 2RGCA 2XEXA 1Q1QA 2FPPB 3FMOB 3GEDA 5GIOE 4YV2A 3DBRB 3G82C 4MTCA 1O54A 3H6GA 5JZ9A 1IXZA 4HTFB 4K6KA 5K0FA 1FMJA 3KQTA 2VUTA 2GEDA 1MO5A 3A9UA 1HMYA 1L2TA 1ODTC 2VHZA 1N7JA 2FGJA 1KKMA 2GN0A 2JBAB 2QN8A 4X24A 2VF5X 1K7XB 3SBXA 1L3IA 1ST3A 2E2WA 3QNUA 5HFAA 3UT5B 2BSXA 3AM4A 2IXFA 2WTXA 4ZP1A 3U5TA 2R1ZA 1Q0ZA 3BQMB 3IEXA 3HUDA 4NFYA 1O6BA 4TGLA 1C1HA 2WWHA 2YCLA 4UBLA 4WA7A 5KHAA 3B8EA 1EFAA 3PQ6A 3WO1A 5CD1A 3OJXA 1M1ZA 2GARA 1DEHA 3R3ZA 4NF2A 2WVAA 3P0HA 4FMBB 2AGVA 1IZZA 1S8AA 1MVOA 2PKQP 2CFCA 4OJMX 1OD6A 3OFNA 4YJ3F 4M88A 5DWQA 1GG5A 1HE2A 2VDNB 1TW2A 4Z8XA 1I1QB 4BO4A 4RK1A 4U7WA 4YCMA 5KAMA 1C30A 4GRDA 4FOTA 3M82A 2PYDA 3WLLA 4ESEA 1PDOA 4KK3A 4K0RA 3EA4A 3AW8A 4UC0A 5LBTA 5M29A 5DI3A 5DSTA 2WM8A 4JJIA 2J9FA 1I0IA 4OV6B 5SY6A 3CVXA 4PGGA 4E46A 2I8CA 3QG1A 2QL7A 2NU6B 2HBRA 2V0CA 1RIFA 4DLAA 1I2BA 2CJFA 4EUKA 3EIFA 5K8CA 5KYUA 3TL6A 1YCHA 4QHTA 4B43A 1OFHA 2BMFA 3BD8A 4GLFA 1N6RA 3A3NA 5C8VA 3NUZA 5LUAA 2NQ2C 4ZEWA 3THWB 4EF5A 3N6VA 5TVGA 3S0JA 3ZGZA 2VH2A 4ZYZA 3M34A 2UAGA 1U11A 1I4EB 3T5DA 4D8TA 3E27A 3PVCA 1NLYA 3H2BA 3NDPA 3RFXA 1YOVB 3M6UA 2QD4A 1MPXA 2FCRA 1Z0AA 2KBFA 3JQ7A 3D64A 2GEBA 1FJXA 3H18A 2ZRDA 1L5SA 4OQPA 4RDIA 1UAGA 4L78A 4KEAA 5KJEA 2CMDA 3T9EA 3VPHA 5FOQA 1AA6A 3HCOA 1L7RA 2RGEA 4C2BA 1BHJA 2GCPA 3PHGA 3LBAA 1JEDA 3O4HA 3KJEA 5JMTA 4BE4A 3C5WP 3AFIA 4JI0B 3Q8MA 3V6MA 4LFAB 4R81A 3CTPA 2CLCX 4HY3A 1TM4E 2Q6KA 1XC7A 2X0DA 4FHEA 3FCUB 4ZC1A 4MXDA 3TBHA 1S2IA 3C45A 2QTVB 5I7OA 2GN9A 3BHNA 2NU7B 4KHPB 1JQ3A 2FW8A 2R96A 3I2KA 2I71A 1ZJYA 1LW6E 5E6SA 2HV8A 1U8FO 3D4PA 5G2OA 4EATA 1ZYUA 1ODIA 3NTVA 1FUKA 2DUMA 2UV8A 3SE0A 1WJGA 2WHXA 5G4LA 5E38A 2GCIA 5A9SA 3L6UA 4RNCA 3CXUA 2OHGA 1PVDA 1YZNA 3AKZA 1H2ZA 3AOEC 3PEYA 5KHLB 1CY6A 5K3CA 3IAFA 1WBDA 4Y2RA 2WUGA 5EJ6A 2VNHA 1P4AA 1R5JA 3F6EX 3I3OA 4OAPA 4TTTS 1CUXA 1N6HA 4CKWB 2OQ2A 5GONF 3JQ9A 2PO7A 4X7BA 3EY9A 2ZRIA 3OESA 1SOMA 4BFCA 5ALEA 4HC4A 2IPXA 2J08A 3B5JA 4LJ8A 3I3SR 4FCWA 1GN9A 1Z22A 4EFDA 5I7WA 2X0IA 1A9XA 1Y8ZA 8MHTA 4V38A 4EI2A 2HIAA 4G26A 4G5YA 3HDVA 3BMOB 5J63A 2PQ2A 2XNCA 3S70A 4F06A 2V65A 2CN1A 1Z56C 4F9GA 1XKXA 1MVLA 4HFNA 1UBHS 1M0WA 5KYTA 4GM1A 2IJGX 3H83A 3TI7A 2HH9A 1M9NA 5AI0A 3FPEA 3J7AC 1DEOA 2Q21A 1GGHA 5KQLA 5ALPA 5IAKA 2CVQA 5CK4A 2V7BA 1BJTA 4X1OA 4DNXA 4DQUA 4RQAA 1MA0A 1JB1A 1T9DA 4N3AA 1O0SA 3WWPA 1I4TD 1PGQA 4QYMA 1U9ZA 2GLXA 2YUTA 5D51S 5T6BA 3HMKA 3NC4A 4L85A 3TUZC 1WF3A 5F77A 1L1EA 3LBNA 1VDZA 1YZFA 4EFNA 3NMUF 2BGTA 2HUNA 2BFOA 1R50A 3DWIA 3NM6B 3O26A 2UXDB 3BKWA 1KEEB 3GT4A 4OKIA 4KQFA 1U65A 3WYAA 3E05A 5KWEA 2H5EA 2V7PA 3HEBA 1OTYA 1QE3A 1VYUA 3C43A 4EGJA 2K7FA 1PSWA 1LW7A 3NPAA 4DDKA 5BV2P 4B6OA 5L8VA 3PGA1 3GXOA 3QZUA 5IBCA 1NQ5A 1USGA 3FI9A 5C3UA 4YH1A 2IUUA 3HNRA 1I6WA 3T61A 4R9UC 4Y6RA 3UUFA 2EZTA 3GG2A 1QYVA 3CRQA 4WJZA 5AHWA 3I2JA 4HYQA 5JJ5A 1NXTA 4BS9A 1SPBS 3AQ4A 3T7IA 4BO6A 5HYVA 1BKDR 2WM3A 3ANLA 3C3DA 5COQA 4ZIRB 3ZWMA 4CM7A 3SQNA 3W9SA 2PSEA 2MSEB 3UAOA 1W96A 5EMLA 3SQDA 1Q12A 4PYNA 3OJCA 5L3RA 5BN3A 4UOZA 4PQFA 3KQVA 3KQYA 3IEVA 4DRZA 4CUJA 1YR6A 3W8EA 2RARA 3K8OE 4BO5A 1JQDA 4MCHA 2WJVA 2IK8A 3SYKA 1KAEA 1QFJA 3T9CA 1OW3B 4II7A 1ZUNB 3IB3A 4TTPA 5IAEA 3RKRA 2ZAYA 3PEFA 2WHEA 1U94A 1YKFA 2FP4A 1ORWA 3KKZA 3OETA 1Z0SA 4LDZA 4NVRA 4UZSA 5AI8A 2LE0A 3E9QA 1C0KA 1IEQA 1A9RA 1FVHA 2XMQA 2XQGA 3RKSA 4DLVA 1KIFA 3I5MA 3P0RA 1I4WA 3GJXC 4G0PA 3U1TA 4EQ6A 5JZOA 1WHSA 4TWBA 1EVJA 3DMFA 1VPDA 4CMIA 1E9VA 3JD1A 2EKBA 5IVPA 1ML3A 3CSDA 1EDDA 4COKA 1RQRA 5GIPE 5JW6A 4S3MA 3ZE6A 2FE4A 2M6KA 4ZVVA 1RWQA 4G1UC 2ILVA 2J0EA 4HMQA 4Y2TA 4IIDA 3BD6A 3L4SO 5FTJA 4ALNA 2A1IA 3HUUA 1FJHA 2CCKA 5SY9A 1OBCA 2IE0A 1L0BA 1U1CA 5AIBA 3PD0A 2WNIA 2DHRA 3I28A 2PL3A 1XZAA 2GOYA 1D1SA 3X2EA 5I8WA 2UUAB 5BVGB 3DV0B 1JMVA 3UK7A 1P2BA 2NV6A 2Z5LA 4E31A 1PR2A 2RH5A 3FUUA 3Q87B 3VAYA 3HH8A 1VZ2A 4Z4HA 3FLMA 3GFBA 5J4KA 1MJFA 2ZUUA 3WJAA 3U3KA 5CDFA 3DXZA 3M2TA 4GVXA 3DLTA 3T1OA 4PLGA 3TXAA 1O5IA 4O6VA 2ZJ7A 5T41A 5A03A 1DXYA 3D8UA 5ALDA 2BOVA 5JZMA 2LPMA 3DAYA 1QJCA 4CQNA 5C46F 1ZIDA 4YGXB 4C7BA 3CUKA 3QBVA 3B1XA 3U4MA 2IU3A 1WHTB 4YP5A 4QNRA 1J42A 6REQB 1E9AA 1FC0A 2R6R1 1G66A 1WMDA 3FYSA 3LLMA 3RJ5A 4XGRA 5BNZA 1MTOA 2GH1A 3A6GA 2AI2A 2YJGA 4LYAA 3REFA 1YBMA 1QRTA 1WQ3A 8GPBA 4J7UA 4Q1EA 3D2CA 3H1AA 3QIAA 5AVVA 3NYWA 4HCJA 2COUA 4HLUC 3RAFC 4HD8A 3KKQA 3WLIA 3K9LA 5C18A 2D06A 4WXEA 5K0LA 4LQ4A 3ETLA 2XE6A 2G8LA 3RC7A 1TO1E 1ZPDA 4ZCTA 3NV7A 4QATA 1IAQA 1FUYB 4GRAA 5A4MS 3TRHA 5BSHA 3KZVA 3C5VA 5KYXA 4DBLE 3BWVA 4LXGA 4PHHA 3P20A 2FXVA 2GJKA 4CIAA 4RF5A 4AS1A 4O02B 3OIVA 4DR6B 4C87A 4RF2A 7MHTA 1ESZA 4DJEC 1B00A 2DHEA 2OOKA 4FHDA 1XCLA 4GBJA 4NU5A 1AMUA 1MFPA 2TMDA 2Y1CA 2ANCA 1X7ZA 3MCZA 3SY8A 3N1UA 3R77A 4BNJA 1PLKA 2I6SA 3HN2A 5ITVA 2AHOA 1U3GA 2AXEA 2HCTA 5K2MA 4BHTA 1AKMA 4OYHA 1FFSA 1NE7A 4WK0B 3WK8A 4RTPA 1GL7A 1PR1A 4Q4DA 5AM2A 2VH5R 1TNDA 2YW2A 4DCTA 1GTG1 3JZIA 2DGDA 2IKQA 3NLLA 1BU5A 2H00A 4ZWNA 5BSTA 2I2BA 3FJYA 3PNSA 1OXMA 4MLCA 3TQCA 1Z7BA 2DC1A 1L7XA 2ZZKA 4QTZA 4L51A 4QKQA 2N3ZA 2R2GA 2QSUA 2L42A 3BAZA 1MCZA 4UUMA 1HEYA 1ZOSA 1TW3A 3KFVA 3PC4A 4A8PA 2X7HA 3BE5A 1KL7A 5JAOA 5ALSA 4DV4B 2DQ4A 3PK0A 1T34A 1TF7A 1TUBA 2H2HA 1XDDA 4JX8A 3DFUA 1OA1A 2AKYA 2ZAMA 3NWJA 2OKCA 4IVPA 3VU1A 4EAQA 4GOXA 5HQTA 3FBWA 3H1TA 4FBMA 1G8MA 1A3CA 1XZMA 3CISA 3IPRA 2WIFA 3JYLA 3IUSA 4KI0A 4WIAA 3NBYC 5E95A 3THOA 3E22B 3WTCA 1I30A 3LUGA 4XUEA 1HBJA 4RD6A 2AUTA 3CQ9A 3WDMA 2C5GA 1DRJA 3AFNA 4RIGA 1JHZA 2CV2A 1KZGB 2H57A 4IF6A 2VZ9A 2UYGA 4YWJA 4EGFA 2E55A 2X42A 4LX8A 2G80A 3FOZA 4BZZA 1PJ8A 1MJNA 5D3KA 1JG6A 1GFSA 1ZGGA 4KR9A 3V1LA 5M2QA 1BW9A 1NMEA 1C3VA 3OOYA 3H04A 2FR8A 1G1MA 2V7VA 1HSZA 3RWOA 2V3WA 1NLUA 1QVVA 3ZHCA 5H9VA 2I1LA 3RRZA 1Z17A 4UTNA 2P4UA 2Q4TA 5DYWA 3GLGE 3WWZA 1RHJA 4JA2A 2PGNA 3WP1B 4BQPA 4YJ3B 1YL6A 1ZEJA 1OU0A 1PNRA 1MAWA 1SCJA 3FHCB 1U2GA 2GZAA 1KI2A 1NV8A 3KDPA 3P0EA 2A30A 3OU7A 3W6PA 1S96A 3EX7C 4DLLA 2A6PA 4YC7A 4DSZA 6Q21A 3EUFA 1J7JA 2HU2A 4Z3KA 2RMKA 4RF3A 4MGZR 4IG4A 3VSDA 2BZ0A 3UIEA 4CEHA 4FIDA 2NVBA 4L07A 5JANA 5HUQA 3PKJA 4P86A 3SJUA 4KPUA 1A27A 2XY4A 3C8HA 1FNBA 3KLOA 5DNAA 4F1KA 1CQWA 1POWA 1GTSA 3DEKA 3IMEA 3IDSA 2CJXA 3E9NA 3E9RA 3JWHA 3W2TA 4NECA 1JECA 2H2GA 4IILA 3LE8A 3HJGA 4XAQA 1QR2A 4Y0NA 4C5BA 1KJNA 5HF9A 4ZTUB 3KAPA 1IEXA 4L4ZA 1M75A 4MYUA 4BNTA 4BRUA 3V80A 4P0TA 2R5FA 5FYDA 2PZKA 1NY5A 1JHYA 1PYDA 3PUXA 3LYLA 4IJVA 4YI3A 4DA7A 1DQPA 2VDWA 3ROQA 4Q5IA 4QGHA 1WTAA 4BNXA 2M1ZA 4H4EA 4QUIA 4DVGA 3K6JA 3HU2A 4D98A 3T7AA 2OG2A 5B3JA 1RAIA 1Q0RA 2CVOA 5BSVA 1M5RA 4QDZA 1N32B 4HADA 1K8XB 5DLEA 3TPZA 1VCHA 3DOIA 4PPGA 2B25A 3CUEF 1P0PA 3L7CA 5I7UA 4AY5A 3OT4A 2HDOA 5DMHA 4Q0MA 5AD1A 1DTSA 1BX0A 1XLTC 4IJMA 1JG1A 1N7HA 5KU7A 1FDIA 3OIFA 4MITA 1D0IA 2R25B 4ZEOA 1GLNA 1K98A 4HF7A 1GJRA 2GK3A 1N1EA 2JJ2A 4FGJA 5CP8A 2BJVA 2PXCA 4FNOA 3HNOA 3QFTA 3R44A 2WJJA 4G4SO 2VDOB 3ROXA 1SBQA 2VPZA 2OHOA 1ZMXA 1JLMA 2BGLA 2KBEA 1YAHA 2P6PA 4MV4A 4QXAA 1ZGCA 3RHSA 3S8YA 4M1QA 3NEAA 2H07A 1LSUA 1X7XB 1JKFA 1HY3A 1T9KA 3T7CA 4LVUA 2O50A 4C9BA 1KQNA 2MT9A 1AS3A 4DCSA 3QPCA 2GPYA 3HPRA 5CFOA 5DYGA 5ALKA 3G9TA 2J09A 1WZIA 4JP3A 3Q7QA 1SQGA 3QNMA 5SYAA 2FRDA 4K9OA 4MVXA 2P78A 2QRVB 2EC5A 2VSNA 4Y9DA 3MJCA 4DL9A 2MOKA 3WMXA 3GUZA 4WN9A 2IWHA 5FHQA 2R84A 3ZCTA 4BLVA 4Z7JA 3B52X 5B5SA 2FPGA 4XVCA 2ISCA 1I33A 4OOFA 2BGJA 4PO1A 1P4GA 1UBMS 5BW4A 2ZJ4A 4JUAA 4M98A 1SBHA 2HSGA 4DS3A 4E08A 1HMPA 1TEZA 4QDKA 3DC2A 4DMMA 3F7MA 4RMHA 4DB2A 5M5BA 2W2LD 1ZUIA 4FFRA 3DWFA 3B1FA 4ZU1X 1IZ0A 1KETA 2CDRA 2WJIA 3SF8A 4JIGA 3UMVA 2VAVA 3AEKB 3U4QB 4BZQA 2OC4A 3KZOA 1REQB 2BBSA 2RGAA 3FYCA 4E15A 2QX8A 4J0JA 5B1DA 2CVPA 1G3MA 4MMZB 4TQGA 1PP4A 5FOXA 3QVVA 5TY0A 4D43A 2EGHA 4MYCA 4RCVA 1CLUA 2HUPA 1GGVA 3I0NA 3PFIA 1F5SA 4FGLA 1AG9A 5LU9A 1OOEA 1SD2A 4HLQB 4HWOA 3ZS8A 4AUEA 2YCBA 3BF8A 4CCSA 2IKSA 4KXYA 4D56A 4GEKA 1T3TA 4MR8B 1B26A 2JF0A 4YRBA 5EINA 1SIBE 2EX4A 4R71A 2I65A 1U5BA 1XMVA 1M72A 3TL3A 5JS2A 3DUFA 2IIQA 2IXDA 2V7XA 3G79A 4Q03A 1T6YA 1NZJA 2A78A 1RI4A 3HJHA 3KCQA 2KS6A 4I2VA 4IIGA 4E11A 4PC2A 4ZYUA 3C8ZA 2CSUA 1F9EA 1TQDA 3A0RB 2M9MA 1LSSA 2ZS7A 3A1UA 3GB9A 3E18A 1DXQA 2DQZA 1ZQ9A 2R65A 2XBUA 3O8DA 4XYEA 2GYWA 5ED4A 3JWPA 4RVGA 2CHUA 2O5EA 1R0CA 4QSHA 2V7GA 3K0SA 1XN1A 3VKHA 2GQ0A 4Z9XA 2QORA 3ITEA 1QMGA 3VM6A 2JLUA 1WDLA 4C0LA 3PYLA 3WLHA 2ZT5A 2G5PA 4YCAA 5B6IA 3O75A 5CFMA 5CG2A 4UEKA 2X2PA 3CWZA 2HK7A 3E61A 4FP9A 1J2YA 3NH9A 4PICA 2NUBA 3DBOB 2XVAA 3QU7A 4OOEA 3RVJA 5LNK6 1L5WA 1JR6A 4ECEA 2BBWA 1NU6A 4E5PA 1ZD2P 3FDJA 1K7EB 3MYRA 4OCZA 4MR7A 1U6KA 4V0MA 4YJ2F 4L02A 1VCOA 3OQPA 3UAXA 1RLMA 1EEXB 1DDIA 3NVKI 1Z2PX 5H1YA 2PT7A 4AJ2A 3ABZA 2CDCA 3BMOA 2ZYWX 3QE2A 4P2BA 5F23A 4EDHA 2IOQA 1WNFA 4AY6A 3IJRA 3UWPA 4E5MA 4ZODA 4QAJA 4UXHA 5A05A 2BP7B 4D02A 1J5PA 2QD5A 2YN4A 4HWTA 2UUCB 5J5AA 2GKSA 1IIRA 1BWPA 1AUOA 3BTUA 3AHCA 3DFIA 3R5JA 4D9EA 4XH9B 3AUYA 4NENB 3GL9A 1QWSA 1DCMA 2WNHA 3AKCA 3VHLB 3NM4A 4P32A 1CUUA 3ZH2A 4TXLA 3V3TA 4A1FA 4AQDA 3KEFA 4TTSA 1RYMA 2NVUA 4AY4A 4TOIA 3ICWA 2Q3MA 3EIWA 1GZ3A 3IRUA 5CLIA 1VKHA 2JGLA 2NQ8A 1J06A 4JT2A 4EG8A 1XOIA 3H84A 3L0CA 1C9JA 1MX3A 1PL0A 5JFOA 2W6ID 2CV1A 1KJZA 1IN6A 3QVTA 3OJOA 3ZJYA 2Q9BA 10MHA 1KMHB 1G59A 3WL6A 3TTYA 4CLRB 3A58B 1WWKA 1T0UA 2OSBA 1YRYE 2W2LA 1NOJA 3K32A 4UAVA 2GUWA 1C3JA 1YR8A 5DH9A 1EBFA 4CCYB 5AVYA 1ZDMA 5C5CA 4L9WA 4Q9KA 3B1KA 4JJGA 1IY2A 1NQVA 2FFBA 4K9PA 2I7DA 1KC3A 3UHPA 5M7EA 2NAFA 1UXJA 4J29A 1MX9A 1TO2E 5GZ1A 2W6MA 4RU1A 5H5JA 2YMMA 3AUUA 4JQYA 4D5EA 1HYBA 4HLUA 3PPIA 1ZAYA 3AEKA 1GT91 3RC8A 1XAIA 1YI0A 3EVZA 2AC7A 3ZKAA 4HXFB 5E3HA 1AH2A 1Z4OA 1BIFA 3FIJA 4KJXA 5F4ZA 1IY0A 1P73A 1KEUA 2HC9A 2ERXA 2MYUA 521PA 3FYHA 3BWEA 1A71A 4GD3Q 3VPXA 1BA3A 2FMXA 1DJNA 3AERB 1KYXA 3AH8A 2A2ZA 3CJRA 4OQYA 3GLIE 3T7SA 1FNSA 2QAGB 1GQOA 2CVHA 2Q1YA 1H8HD 3EEIA 4MR8A 4LJ5A 1EP9A 2VNSA 3PI7A 1WU8A 2YWEA 1E2NA 5C80A 5CITA 4OVKA 3DXXA 4KQWA 4L5AA 2RDMA 2V6MA 1EHYA 2WILA 2H92A 4LOAA 3CVJA 3K16A 3MMXA 4ROTA 2QROA 4MS1A 4YQFA 2ECKA 1G6OA 4HQ6A 4MW9A 6CHYA 3E5NA 1I1HA 1M8PA 1EFUA 2KM1A 3EVEA 3OO0A 5ALGA 5CAEB 1U98A 2W90A 4PVCA 1OAOA 3STVA 2MWMA 4PPQA 2CT8A 2GA8A 4JL5A 1QPZA 5C1PA 1B0ZA 1I6MA 2HZ7A 3GBPA 2CF6A 2D1YA 2I3GA 4FYIA 4RUKA 1PL8A 2NZ8A 1GZDA 2F4VB 4IIVA 4RPCA 3R7NA 4TQUS 3G8AA 4UEQA 3MWEB 2OV2A 1Y81A 3FTPA 3U3ZA 1T6XA 1I5EA 2X58A 3KYCB 5BR4A 1SCUB 2FFRA 4W9RA 3G88A 4KRXA 2JRCA 4L73A 4FZRA 4IIUA 4FYYA 3RVDA 4D0GA 5DBIA 4DN6A 4IWYA 1EFLA 3OWXA 4HQOA 4HV4A 4OI2A 4V02A 1FFCA 5DT9A 3TIVA 1JLSA 4D0RA 1E2KA 1P4SA 1E3SA 5EMHA 1U4SA 5EKDA 3NC1C 2VP9A 1WG8A 1CULC 3VPDA 2BFEA 4R2JA 3X3HA 3AJEA 1T2AA 4EZIA 2X2OA 1ZR4A 4XWAA 1OF1A 4RZSA 5U4QA 3VI4B 4HN4B 4A26A 2Q5QA 2V8OA 3UANA 1IRIA 6REQA 3N74A 4BMOB 1U0OC 3I37X 4BEVA 4JKOA 1Y7PA 1M7GA 2Q4DA 3N28A 4I0WB 4GGOA 4RK6A 2ERYA 3DOFA 2IITA 3AVOA 1G5TA 1ORIA 1S9DA 3AKDA 3OF2A 4HUQA 4PFQA 5SZIA 2YWGA 2HT6A 3RK0A 1UK8A 3TUIC 3KJZA 4UE2A 2QE6A 2GRAA 2E4ZA 3DO8A 2BDEA 1AZLA 1QYCA 3F97A 2DTDA 2D5LA 3PPYA 4RAOA 4U2EA 5K3SA 3OM0A 3VISA 5KMGA 3QEAZ 4OHBA 3D6NB 5DX1A 4MWBA 5AW4A 4OPMA 3TW4A 3ND7A 1HDGO 4OLHA 3I62A 4K28A 4XM2A 5H4HA 3EXEB 2PYZA 1UEIA 2P5YA 1FSSA 4KQJA 1PR3A 4MRVA 5EXEA 1J39A 4LDPA 4WH0A 1K5DA 1CVRA 1OGIA 2ZI9A 3ABIA 4HRAA 3USCS 3IT3A 2IV3A 5JJCA 3CZRA 3IR6A 2F3QA 4M46A 4UULA 5HZGA 1DUIA 5IKMA 1CBUA 5C7IO 1ZJZA 4WWHA 1ISHA 3ASUA 4JELA 3RGGA 2L69A 3W90A 4EHFA 2V58A 1W75A 4BUJA 5CB4F 4ESVA 5AK3A 2R79A 2ACKA 1L8LA 2NU6A 3M7IA 3B6KA 3CLSC 1FUUA 1UBTS 3JYQA 4OAQA 3ZV5A 2BKLA 2WSLA 4HO1X 1JNYA 1GUYA 4QQNA 5DCWA 4GWKA 4CTNA 5I01A 3F7TA 2HNAA 1AHNA 1EBBA 3M0EA 4A0QA 2G06A 4KH1A 2PGDA 3KUUA 4FJ0A 1V1JA 2H7CA 4QFDA 3WK6A 2GHIA 1OMOA 3A6JA 1NVAA 2SNIE 4DDVA 3C41J 1L5NA 4YJGB 1GYRA 5KTRA 1GGEA 2IDJA 1I94B 1FP1D