2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
3REGA 3T06B 2IUSA 4R9UC 2Z6VA 3EASA 4JBYA 4BLQA 3TQCA 3X1YA 2V7QD 4RY2A 4M1KA 4EQ6B 1QHIA 5J47A 3KQLA 4UJ5A 4KODA 2ZI9A 3UK6A 2PX3A 3CRQA 1Z0IA 3U6KA 2JLUA 1OXSC 2DCUA 3UANA 1KI6A 3C14C 4RFSA 3DDCA 3WBKA 3A1WA 4B3BA 3C16C 4BASA 3K0FA 1GL9B 4CGZA 1DAFA 2C95A 2RGCA 3TVDA 4A8JA 1E9BA 1E9SA 2VP4A 3RRNA 4L4UA 3ZQJA 2G83A 1GITA 4XVQA 2PL3A 3THXA 1RIFA 3AUXA 5CDFA 3A4MA 1ZVQA 3LV8A 3K8YA 4AY2A 4XH9B 5E3HA 3TNFA 1RW4A 4KV9A 2AK3A 1MO6A 4ZKEA 4D4KA 4IRUB 3EIQA 4A2WA 4DDVA 1F2UA 3GFPA 3R20A 1JALA 1WB9A 1AGPA 1N0WA 4YXWA 4DIEA 4BLPA 5J4KA 1G8GA 3GLIB 4NDZA 521PA 2QRNA 2DR3A 3OHMA 2EVWX 2F3RA 4ACAA 3GJ6A 3EARA 1NMXA 2F6RA 4LBZA 2WPDA 4TQUS 3I62A 3FE2A 4B6EA 1YR9A 4HATA 4NYMQ 4AYWA 1TEVA 4UNQA 4LJ5A 4Q4LA 2BM0A 2ORVA 1N5JA 1N3BA 3OEHA 1JNYA 1FPMA 2J59A 1KO4A 1G3UA 1Z0DA 4LYFA 1S4QA 4XWOA 1YR6A 2WJVA 2RH5A 4PO9A 4V0ME 3KKQA 3DL0A 2GNOA 1HE1C 2XGJA 3RAPR 3LWNA 1I2DA 3RS3A 4C2TA 3QBTA 2GZHA 3U7FB 2XTZA 2QMUA 2PH1A 3P4XA 3AF1A 1OT3A 2A5JA 2ZETA 3R8CA 1RKBA 1XTJA 4ACBA 4JBXA 2A5YB 2J0QA 3OZXA 1E96A 1NP6A 4TZ0A 3ZZ0A 1W0JD 1KJYA 3SHFA 3S1AA 4LHZA 1JBKA 2CE2X 5TY0A 3RSLA 2C77A 3SYKA 2BDTA 5JMTA 2IYVA 3K09A 1VDZA 1SXJB 1IJFA 1ZNWA 2GCPA 3QF7A 3ZGXA 3RANA 3FMFA 3TUZC 1SHKA 2YINC 2G1JA 3IDQA 2QA5A 3AEZA 3FGNA 3SNHA 3GFTA 5SZKB 2JASA 2ZR0A 4ZCIA 4Z1MA 2VP6A 2IYYA 2XTMA 1RRFA 2A78A 5G3YA 2WSMA 2DFTA 2GWHA 4GT1A 1KY3A 3AKYA 3TLXA 3BB3A 3SJZA 2C2HA 3BXZA 2IBMA 2CCKA 1GRRA 2PJZA 4FINA 1DPFA 3I61A 1P60A 2OHFA 4MRPA 5B2ZA 5B30A 3NEYA 3JZAA 2ZI3A 2TMKA 3K0AA 3J81k 3A8TA 1G8PA 3IQXA 1ZU4A 4IEEA 2ZI7A 4B3XA 1SULA 4J0QA 3BD9A 3VX3A 4A0GA 2IS6A 4QC2A 1G64A 2WBLC 3AH8A 4TMTA 4TL8A 2FG5A 2Q9BA 2P5TB 2V4ZA 3FKSD 4URYR 5KSPA 2GCNA 3LW8A 1I4LD 1NIPA 3U44A 5SZJA 4DLRA 1F3OA 2ZRBA 3L0PA 1C1YA 4Q9KA 3TIFA 3NDPA 2PCJA 2PT7A 1AZTA 2J0UB 2QAGA 4JLBA 3FHCB 4B75A 4EKDA 2GCOB 1P2SA 4PX9A 2CCGA 3R9XA 1CU1A 4M1SA 4CEIB 4FCWA 3RHFA 2JLVA 4S35A 1R2QA 3H1TA 2FEMA 5AJVB 2W2XA 4PANA 1VCMA 2IS4A 4P33A 4MYUA 2F43A 4M1OA 3DMDA 1MO5A 2F9MA 4FN5A 5JCPA 2O8DA 3E70C 3NH6A 3GEEA 3GLHA 3NBFA 3OAAD 4M53A 5A4JA 1OH5A 1UFQA 5J5CA 1SVOA 1VTKA 2P0EA 1EGAA 1KI8A 1T3SA 1E1QA 2IYRA 5TDHA 4ASUA 1ZD1A 3CUEF 1KO8A 2NGRA 2FEOA 1K6MA 3SJAA 4ZPXA 1ZM3A 4Q9IA 4F91B 4Q9LA 1KI1A 3JVVA 2MSEB 3KTAB 4FMBB 5EE0A 2OSBA 2O8FA 5E7JA 5GVSA 3SYNA 1ODFA 2V7QA 4DCUA 1BKDR 3U3RA 3C5HA 1CIPA 1OF1A 3EA5A 2O0KA 4B35A 2WAXA 1E0KA 1RPZA 2ONJA 2ZS9A 3AVYA 2BEKA 1T5IA 4B47A 2GXUA 1FUUA 1V43A 4MRSA 3X2SA 1Q3TA 5JZVA 1Z08A 2GEVA 1Z3IX 2C9YA 4ZV4A 1NN5A 1F2TA 4IEIA 3CWQA 2WJYA 1G21E 4B33A 1ESMA 4XTRA 5CM9C 1ZMXA 3EWAA 3QG1A 3AP3A 4D80A 1OFTA 1HY3A 5M04A 4A15A 2VTKA 2XOKA 2J3EA 1T0HB 3T5DA 3WYAA 4DLVA 2O8BB 1SVSA 1NY5A 2DY1A 1O87A 2RAPA 4CF7A 2EFGA 2XEXA 3HYTA 2DWOA 1RVDA 3K0CC 3AKDA 1CF4A 1RZ3A 2E87A 1VG9B 1XB2A 1MOZA 3SBDA 4B2IA 4QOSA 1KI9A 1R0XA 2CL7X 1WXQA 4TTPA 5L3SB 2IS1A 1IXRC 1Q12A 3GJ0A 2QL6A 4HAUA 2G0NA 2ZE7A 1KOFA 3HPRA 2ZVQX 4HB4A 2IUUA 1TQ4A 3ECCA 2JLSA 2KJQA 1U8ZA 4QGFA 3A4LA 4MGKR 5TVKA 2ORIA 2RGNA 2ZSBA 3QKUA 4UJ3A 3KTAA 1B0UA 1DE0A 2J7PA 3QXXA 2MSCB 3VR1A 3EPLA 3K53A 4IFEA 3K70C 1COWD 1SKQA 1W5SA 2CHQA 3L2OB 2J0SA 3KFXA 3UG7A 4D2IA 1AS0A 1BS1A 4Z51A 4G5QA 3L8YA 4I4LA 3BOSA 3GLGE 2D3WA 2UKDA 4PO8A 4MRVA 4URXR 5KNDA 3EZ2A 1JPJA 1PV4A 4M1YA 3I8SA 2AXPA 1PZNA 2E1RA 4ITRC 4GOJA 4U5XA 4OL0A 2FJUA 2V1UA 1BYIA 3TBKA 3THYB 1XXHE 2ZVPX 4CT4B 2YNMA 3GMTA 1N5LA 1N6PA 1U0JA 3IEUA 1EFRA 4FIDA 4N0DA 1S0UA 1DADA 4EPWA 4LY6A 1TF5A 4QBHA 2IK8A 1ZM9A 4RD4A 4US2R 1A2KC 1S9DA 2CDNA 3D6TB 5JJKA 4HAXA 3I4LA 3MRSA 2VQSA 4I1SA 1KDRA 3GD7A 2JJ8A 2FFHA 1M6NA 4U00A 5KPDA 4UXHA 2CXXA 1FX0A 4BZPA 4DLXA 1Z63A 2EWVA 1G5RA 5FPTA 3Q9LA 4M1MA 5DHAA 4CDGA 1E9DA 1Z6XA 4TLEA 4JLDA 1E3MA 2R65A 4MKHA 4QFMA 4LZZA 3GLFA 1E2IA 4ZKDA 3BWDD 1ZNXA 4MA4A 3TAHA 4DDTA 3ZJYA 4JLNA 1DG1G 2Y8EA 4FI3C 4NYIR 2P6RA 1LW7A 1RRPA 4EPRA 5IRCD 1G20E 2I1QA 5GVRA 4BEBA 1LS1A 1XFAA 3T1VA 5B58C 4Q01A 3UKDA 2ZSFA 1LB1B 3VAAA 1S8FA 3S1AB 4HUTA 1VPLA 2HLDD 4LJYA 2HT6A 4U02A 2EFDB 4TTQA 3A36A 3OIYA 4HLUA 3LNCA 4BGDA 1J70A 4MQBA 4K46A 4YQFA 3GLIE 1XMJA 3O8CA 2XAUA 3ZVMA 4P32A 2WWYA 2V1XA 4RD2A 4PZLA 4QJ5A 1QG4A 3PUZA 4GBMA 5G53C 2REXB 2J1LA 5DI3A 3TQFA 4EJSC 1EFHA 1ONBA 3NEJA 2RGGA 5BWMA 4LUCA 4DCSA 3QNUA 2ZS8A 5IDVA 3MWYW 3QF4A 4A2QA 2UZ3A 4D4LA 4KU4A 3MD0A 1RRCA 4FD2A 4TYYA 3DVLA 3IQWA 4PC7A 2EFHB 1YU9A 3KQNA 1I2MA 2GBLA 2ZRNA 1XEXA 3ONWA 4EAQA 4IOJA 1JR3E 1SKYB 2REBA 4TLBA 3DOFA 5KSOA 4EUNA 3HR8A 1PJRA 3P4YA 4KYIB 1OIVA 2BWJA 1Q0UA 3Q7QA 1T0JB 3U3KA 4TYPA 2AHOA 2IEYA 4R2HA 5KO2A 1H65A 4DT1A 2LKDA 2REOA 1TU4A 4HI0E 4WZBE 1JR3D 2ZYVX 3U44B 1ZIPA 2JJ1D 1X6VA 3PCRB 4POAA 4MGYR 4P3YA 4W9MC 3G82C 1E79D 3BFKA 1D6JA 1QRAA 2J0UA 1W46A 4WW0A 4KHZA 5AUQA 2RCNA 5J4YA 2JAQA 1NLZA 4NU0A 4K8OA 2WKRA 4D4JA 1XNJA 3BH6A 3NHAA 5JS7A 5BQ5A 2F1RA 2OESA 1ZUIA 3AP2A 1FW6A 1DARA 5KDDA 2HUPA 5CB8A 4XD7A 1GZSA 3JVUA 4IDNA 1XCMA 2HJVA 1T6NA 2RGXA 2ODWA 3M6AA 1XMIA 1XXHA 2GESA 2MSDB 4KVAA 3O47A 4PQRA 4EPTA 1X86B 4OBEA 4HLDA 1E98A 2VSXA 2ZM5A 4IJMA 1CR4A 1Z22A 4Q4AA 3VTKA 2IT1A 4A4DA 3WP0A 4AYXA 2P3SA 2ZJ2A 3ND9A 5AWFC 2WKQA 1E1QD 4AC9A 5BN4A 3ADKA 1FMLA 4O3MA 2H7VA 1N6LA 1VIYA 1CJMA 2ZR9A 4M4SA 1M74A 2ASEA 2FH5B 4QBFA 5DYGA 1P7CA 2OO7A 1US8B 2HDNB 4LV6A 2G9NA 1SVWA 3MAAC 3VQTA 3RRZA 5P21A 5UKDA 1G5PA 4LPKA 4LYHA 3C4JA 3PR1A 3CPJB 4MUBA 3TJZA 4JVMA 1OHHD 4N1AA 1W0JA 2YOHA 1P2TA 1QVRA 1JEEA 1WBBA 1DS6A 4BPBA 1JAHA 3NXSA 3KX2A 2RGAA 4IKEA 1GM5A 1UKEA 4DC9A 3HU3A 4LHYA 2Q21A 3R9IA 2PLRA 4HAYA 1VG8A 4OQNA 3THOA 1YZUA 1KIMA 4ESHA 3AF2A 3PVSA 1KSFX 4GL2A 1OYWA 4G5RA 4EPYA 4ON9A 3BGWA 3QKSB 5FL7D 4ABYA 1VIAA 1AM4D 1XTKA 4PXAA 3EXAA 4RZ2A 3G0HA 2O8FB 2HXSA 4Z1MD 3CNNA 3DO6A 1QF9A 3SZRA 1NVXQ 3KJGA 5HKKD 4PC1A 2VP0A 4LJ7A 3B8HA 4EDHA 2CEAA 4C7OB 2VYFA 4JJKA 4AK9A 2QE7A 4AKHA 1CP2A 3AVTA 4F93B 5HKKA 2C5LA 4MYHA 5J4LA 2BKUA 1OH8A 3IHWA 1E2LA 2CLSA 3LAWA 2ZTSA 4OHZA 3CZPA 5LD2B 1JQLB 3OE7D 5GJBA 3L0IB 5K8TA 5CB6A 2BCJQ 1NY6A 3ZS9A 1B23P 2IF0A 4CW7A 1Y3AA 1UJ2A 2FA9A 3UG6A 2EYQA 3LW7A 4FMDB 5FOSA 4A2PA 4A0RA 4DT1B 5HPYB 3U7GA 3K1JA 3A37A 3EX7C 1VYTA 2VBCA 1FZQA 3OFND 3I32A 1GP2A 2HXYA 3A4NA 2L0XA 1SXJD 5KHOC 3KKOA 1WF3A 4IOMA 1F5NA 3NKVA 3WYGA 4X8OA 4MKGA 5AJZA 5CIQA 2QZ4A 4E07A 4JLAA 1VG1A 2J7KA 2PMDA 1EFTA 1NIJA 1QHYA 2ZI6A 4QGAA 5EZ5A 2ONKA 2C03A 2W6JD 1FNNA 2IXFA 1FOEB 1ZP6A 2F7SA 4PPFA 1NMZA 2PBRA 2DYKA 3QXCA 2IUTA 3KUCA 2ZSAA 3UMSA 3VR3A 3H2YA 3VNUA 2FGJA 2WIBA 2YWHA 4DJTA 2ZJZA 4CRWB 1G7CA 1G7TA 1E99A 2IS2A 1G3MA 4OI1A 2GBLC 4BZXA 1W4CA 3EZ9A 4LSGA 1FQJA 3WY9A 2QENA 621PA 2CE7A 2O52A 4NKRA 1EWQA 2FSIA 1Q22A 4C0BA 1X8KA 2XNDD 2QP9X 4NCJA 2ODEA 1AZSC 3LA6A 4RKFA 1NKSA 4JLJA 4HDOB 5BXQC 5CLLA 4C7OA 2W2TA 1UBFA 5FBRB 3TMKA 1XF9A 1S1CA 3SS8A 4HDQB 4PC2A 4Q1CA 2FU5C 3LFUA 3TUIC 3NBYC 2FV8A 3FFAA 3LQRA 4XSHA 3WMFA 4KI0A 2AD1A 1WMSA 5EXXA 3D7MA 2W0SA 1QHHB 1R8SA 1NG1A 2C99A 3PUVA 2DFNA 5KNBA 3SJBA 4OHYA 2PZFA 3WMEA 4P4SA 4MDEA 1NNEA 721PA 4JLPA 4NCHA 4Q02A 2VHUA 3CONA 5JWHA 4TZ6A 1E79A 1TADA 1EFUA 1G291 2ORWA 4B32A 1C4OA 2QSYA 3OIUA 1VCOA 2BBWA 3GLHE 4MYTA 3U5ZB 2BIFA 4B3DA 3W5JA 1W48A 1JEDA 1W47A 2IYUA 2GJ8A 4UXIA 2R62A 3BIFA 1XXHB 2GVDC 2GJKA 2QAGC 5C46F 3QEJA 1DEKA 4ZDJA 1DAGA 2CJWB 5EE9A 4KFSA 5HCNA 2WJIA 2YZ2A 3X1WA 3QXHA 5FTLA 4RSGA 3B60A 1PLKA 3N70A 2RKOA 1KI3A 4H1VA 2RHMA 4JIMA 4TSFA 2ZAMA 1OV4A 3KXIA 1BOFA 1S1MA 1E2NA 4KAXA 4Y0AA 3RVBA 1SQ5A 4ZI3A 4LV5B 3IIMA 1P2VA 2VO1A 1XDBA 4KXFB 3SR0A 2KB0A 3DHWC 2FPKA 1R5OA 1JB1A 3B1VA 3HR7A 4Y0VA 3ZQ6A 4BFZA 1KDOA 1M7HA 3LXRA 2QBYA 221PA 3DM5A 1XX6A 3I73A 1Z8FA 3FOZA 3BERA 5TB5A 2WWGA 2QPAA 3SI7A 1NMYA 4FCTA 2JIZA 1E2PA 2ZAOA 3IGFA 4WIAA 4YONB 1J2JA 4IVQA 1BMFA 3RWMB 4DLSA 1CJVC 2DWQA 4JLVA 1KAOA 2BOVA 3R9WA 4XTCS 1U9IC 2QUZA 2QT0A 4M1TA 2FX3A 2GAAA 1BMFD 1UKZA 2YWGA 2C9CA 5BN5A 2C98A 4GPTA 2NPFA 3WNCA 4LJ4A 5EUQB 2YVUA 1XP8A 3TAUA 5BW8A 5FH9A 3VU9B 4Q21A 8OHMA 4OKSA 1NJGA 2BMJA 3CX7A 2PEYA 1XTRA 2OBLA 2WM9B 2DWPA 3B1ZA 3K0AB 5HCIA 4D6PA 1DAKA 1NN3A 3D31A 3M0EA 3FHOA 2B92A 4HB2A 3NWJA 4IVPA 3PIRA 2CK3D 2QP3A 1OH6A 4WVFA 1JQJC 2IC5A 4OJKA 2V3CC 2EFEB 5G40A 5H68A 5DYIA 2GVZC 3RLFA 4V03A 3TR5A 5DLQC 2CL0X 2ZRCA 4DDWA 2CK3A 1DAHA 1FTNA 4CVNA 1E2DA 1F2TB 4KBGA 2WMOB 3OE7A 4LYJA 2ZI5A 2KI5A 3AGQA 3OFNA 3GLFB 1N25A 4Q47A 2N46A 3QUSA 4Q4JB 4C0HA 4M9XA 4OK6A 3DEFA 4LOAA 1US8A 2KBEA 1SKYE 3D8BA 1AQYA 1YRBA 5FOVA 4TT3D 1Z83A 3TW8B 4LC1A 1MH1A 1XJCA 2ZYWX 4PHGA 2VSFA 2ZE8A 4PHTA 3QKRB 3U4QA 3U7EB 4TT3A 3Q8XB 2Q3HA 1P9NA 1FP7A 1LS6A 2A5GA 5J40A 2IWRA 1T4GA 1G4UR 4RD1A 3H0KA 1PUJA 1W44A 2BC9A 1N6IA 4QGHA 5TXGA 1N6RA 2CL6X 4EPXA 4CEJB 1WCV1 3EW9A 4DLYA 2QT1A 3C8UA 1EG7A 4IDQA 4OHVA 4CEIA 1XD8A 1GTVA 3KB2A 4TMVA 1T91A 5AUPB 2ZQ5A 3PUXA 4ZCMA 1T8TA 1G4AE 3IBYA 2H1LA 3ZLJA 1Z2CA 4TMXA 2R6AA 4IOLA 1AKYA 1GOTA 3QKTA 4OHXA 2VF8A 1GKIA 5DISB 1FX0B 5BYKA 3CNOA 4A36A 1SVIA 1UADA 2P67A 2EW1A 4AKEA 2QBYB 1U8AA 2O8EB 3AM1A 3DM9B 1OYYA 2ECKA 1H8HD 2D06A 2XITA 2FMXA 2ZROA 3W90A 4B76A 1CKEA 2OUKA 4D0GA 2GDJA 1JR6A 3GEHA 4XOIA 2AFIE 1HQYE 2NQ2C 2WOOA 2R44A 2ZJOA 1S9HA 2JA1A 3CR7A 3P32A 3AV0B 2P2LA 3IO3A 1A7JA 2QTHA 2QGNA 3REFA 5FL3A 4D82A 1YRAA 4Q03A 2W83A 1XPRA 1KO1A 4WZAE 4PSKA 3QKSA 4JVLA 5K8LA 1IXSB 2V54A 5GADl 3U7HB 4DIDA 3FDIA 2OM2A 3HJNA 4A92A 3FMPB 1X1RA 3CRW1 1GNQA 3SDZA 4QG7A 3L8ZA 4JL8A 4PHFA 421PA 4CEJA 1ZRHA 4BRUA 3QXSA 2PMKA 2GJSA 5CJPA 5FPYA 2FNAA 2WKPA 4JVSB 2CLCX 4LJ8A 2IA5A 4I99A 2OG2A 4QHYA 1MABA 1DG3A 4TL9A 3CKLA 1KTVA 5FBLB 4NBSA 1Z47A 2IXGA 4QJ4A 4RJLA 1R10A 3W6OA 3NDBB 4F38A 4C9BA 2J7PD 4KO8A 1EESA 1KI6B 1P3JA 1TL7C 3CWZA 5CIWA 3O8BA 1W36B 3ZH9B 1Z07A 3M4YA 4R2IA 4MKIA 3RS5A 2BKEA 2GEDA 1F48A 2OCPA 1MRNA 1YHNA 5SZHB 1KAGA 3T1QA 5JHGB 2YV5A 1G1MA 5KNCA 4HUQA 4LI0A 5D3MB 2ZE5A 4BFTA 1D5CA 3T61A 1H8ED 4MUAA 5F98A 5E7MA 1U2RA 5JWRA 3UATA 3LBNA 5IK2D 5SZIA 1GL6A 4PZYA 5F9FA 1Z2AA 3X1ZA 2QQ0A 1BIFA 1CRQA 4P31A 4TL7A 3ADDA 1OHHA 3TW4A 2EU8A 2H16A 1WDTA 3LBHA 5LBIA 5KPJA 3VNVA 5IT5A 1U99A 3EC1A 2H17A 2MMGA 4HB3A 3VU9A 2FPMA 4CYMA 1N6OA 1CRPA 1E1RA 2ANBA 2W2VA 1VKJA 2F43B 4PC3A 3T1TA 2NO6A 4DLZA 3W6PA 4LPSA 2UVQA 2OXRA 5BN3A 2BM1A 5FL7A 2BEJA 2CVFA 1AA9A 3KXKA 4TTRA 4B2PA 4YMUA 1LF5A 1YQTA 3MLEA 3GFOA 1YZTA 3KZ1E 3Q7PA 4URWR 1Q44A 4FWTA 3BB1A 4KVGA 2ZRGA 5CYOA 3QQ5A 3HYRA 4G01B 2CBZA 1HUQA 5EP3A 3SOPA 3CPEA 1E2KA 2XZLA 3BFVA 3BORA 1IJEA 2AFHE 3K9LA 2O5VA 1E69A 1S2MA 4NPHA 4PAQA 4NYJQ 3RWOA 3K0FB 2R9VA 4TQ9A 1WRBA 3X1XA 4BLOA 1GL7A 4DWJA 4FMDF 4P4UA 4KYUA 5LPNA 2VA8A 2QAGB 4PO1A 2QQEA 3RRYA 3GJ4A 3QF4B 2AD5A 2QEQA 2WJJA 4JBWA 1UDWA 2F1HA 3GJXC 1I4TD 3AP1A 3PFIA 4NHOA 3SE0A 1UDXA 1NSTA 1P9WA 1XEFA 1XZQA 2X8AA 5FUXA 1M7GA 1FTSA 3U4QB 3IKJA 2Q3FA 5B64A 1TX4B 1M7BA 1MRSA 2ZRIA 4L8GA 3Q72A 3K9HA 1BYUA 1GDDA 2R2AA 2Q9CA 4L5BA 1F2UB 3QJYA 4TYQA 2D62A 2PX0A 2GJ9A 1HYQA 1A2BA 1GFIA 1R5NA 4MITA 1L8QA 2ZREA 2DFKB 2ZSEA 3AB3A 4LJ6A 4MRRA 2JIZD 4LV8B 3QG5A 5FBQB 1RJ9B 4DCVA 5E4FA 5JI3E 2NMVA 1BO6A 2OV2A 2HYIC 3KQHA 1FP6A 4URUR 3A1SA 4QNMA 4WOPA 1GIAA 4UNRA 5GJCA 3KQKA 5AJYA 2ZI4A 4W5WA 2JDIA 3N2EA 4DKXA 1OXXK 4GRAA 4PSAA 1OFIA 5H70A 4A6PA 3CX6A 4X8HA 3WNDA 3W5IA 1T3LA 1W36C 4US1R 1D9ZA 4YMSA 1HV8A 2AKYA 2RB4A 2W58A 2ZJYA 1AQUA 3EZFA 4GP6A 3B9QA 5FR1A 3C7KA 1QHGA 3HU1A 3FMIA 3IPXA 4M0LA 1KSGA 4TL6A 3KXLA 4V02A 1NF3A 3OEEA 4B48A 2GXAA 2FZ4A 1RJ9A 1E2GA 4F4CA 3AVWA 1ELOA 3CF0A 4G5SA 3U60B 2ZITA 3IHLA 2BCGY 4V0KA 2HF8A 5FPSA 2FPLA 3W9YA 4PPNA 3AKEA 4YXWD 5L3QB 1V5WA 1XTQA 2X2EA 4HLQB 4DCNA 5FUWA 3MWKA 4B3CA 1W4RA 3UIEA 5AR1A 5F3WB 1E0AA 1R0YA 4JL6A 4KFUA 3TVTA 2SHKA 3HP1A 1OSNA 1XCGB 3JZMA 1G3QA 4JJZA 4NYIQ 5A5GA 1OIWA 1UBEA 1MO3A 4PPQA 4OI2A 1ZD9A 1OXVA 2AL7A 2AR7A 2ZRFA 4YMWA 4BUJA 5TMPA 3B78A 3LQQA 4HB0A 3MCAA 3GEIA 4GOXA 1XD2A 1ZD8A 1Q1QA 4A1FA 3BJIC 1E32A 3PITA 3GP8A 3WRYC 3RS0A 2PLFA 3V4FA 5DNYB 3PJRA 2VSOA 1A4RA 1II8B 5CITA 2Q0HA 5IF9A 1KJZA 1NVVQ 3WMGA 2GRJA 3R7WA 1CR0A 2ZRHA 3M1IA 1XJQA 4ARZB 2IWHA 2RGBA 1ZIOA 1KZGB 2JLQA 3ZYCA 3MJRA 1U81A 1ZINA 4US0R 1YZKA 4KSCA 5FI0B 4AYTA 1R6BX 2WICA 3B82A 2WWWA 3GLFE 1KKMA 3T12A 4GDFA 1P73A 1D2EA 1ZC3A 1GG2A 1ZUNB 2OILA 4IDPA 3EC2A 2ZYUX 5FPKA 3NBZC 2N42A 4XJXA 2Z5FA 1XTIA 3SFVA 2G6BA 1A5TA 1KKLA 2R6GA 5FBWB 1KNQA 2WWHA 2KE5A 3CB4A 3EIHA 4I1VA 3KUDA 3GLGA 4II7A 4Q4HB 2G88A 3KKPA 3I3SR 5LDDC 4CEHA 1RFLA 4QGGA 4GSYA 1OXUA 3BAFA 4OHWA 2JLRA 3C5CA 5DI9A 4ZDWA 5EXPA 2JCSA 1CBUA 1XEWY 1YVDA 2YWFA 4O25A 1KGDA 2ZRJA 2IHYA 1NL3A 1KDPA 2W0MA 4YDHB 3BRWD 2V6JA 1VHTA 2GHIA 2CLDX 2GKSA 1PUIA 3QENA 5LB2A 3CZQA 1YZLA 1EXMA 4UKDA 4URZR 3BS4A 4JLOA 1XEWX 2FSGA 4HSEA 1G19A 2O0HA 5JS8A 2GETA 3LY5A 3OEHD 1CEEA 4G0NA 4V0LA 4KITB 3BB4A 1GAJA 1N0UA 1IY2A 2QG6A 2ZUDA 4UNPA 1P5ZB 5FOUA 2H57A 4C0JA 4XVRA 3TSOA 1E4YA 2HLDA 1KDTA 1J8YF 3GQBA 2ZYTX 1NVWQ 2FOLA 3F0TA 2W6ID 1IOZA 2C96A 3THYA 1R5BA 4BFVA 2ZXUA 5ANRB 4M8NE 4BFUA 1IN7A 3CF6R 2A7QA 3AVQA 1WE2A 4WA7A 3UWOA 1KMQA 3L0OA 3AF3A 1IN5A 1J90A 821PA 121PA 1YZNA 1NRJB 1G8YA 1E2EA 1JECA 1CJKC 2OFOA 1IY0A 2NO0A 4JVNA 4BLSA 3C41J 2IYSA 1NVVR 2AK2A 2GZAA 2ZJ5A 1Y63A 4HAWA 2BMDA 1GVNB 2F1IA 2QM8A 5DO9A 4QJ3A 5ELXA 1XPUA 1JAIA 3MJHA 2A30A 2VIIA 3DKPA 5C1BA 3H84A 2P65A 3U2QA 2OE2A 4IVRA 5JWOA 3PV0A 1QVAA 5DE3A 3WHKA 5EJEA 2IYXA 2QTVB 2AN9A 1S3SA 5FUYA 4M2LA 2IXEA 3ASYA 4OK5A 1G6HA 1RE0A 4KFRA 4YMTA 4RFSB 1H8HA 1NBMA 2V8OA 1IBRA 5AUOB 3AF4A 2ANCA 2JJ1A 4DB4A 1T3HA 3RDPA 4BFYA 2QTFA 4HYYA 1E2JA 2BJVA 4TMKA 4OQXA 2DPXA 1XEXB 1Q3HA 2F3TA 5FFMA 4BECA 4Q00A 4A8JB 1J7KA 3NIBA 4OQFA 1UAAA 1UPTA 4JS0A 3BH7A 3V9PA 3ND8A 5L3QA 3C15C 5CJ2A 5FUVA 2N1BA 4OQLA 3ETLA 4DEYA 2D7DA 1XJ0A 2LKCA 4DDUA 1CULC 1SVMA 4DSTA 5FOWA 3VX4A 2W00A 1ANKA 2J0VA 1Q20A 2FE4A 2RGDA 1JXOA 3ZVNA 1NVUQ 3A1TA 3MSXA 1LY1A 3L43A 3TR0A 2O8BA 3E5HA 1EFCA 2BMEA 2IYLD 5EP1A 4AIIA 1Q57A 2ZRKA 1D2MA 1FMJA 2XJ9A 4BZQA 2D7CA 3GJ5A 3E1SA 4L9SA 4RFVA 1TMKA 4V0OA 5L3RA 3Q3JB 1IN4A 2AKAB 1W36D 3P20A 3TGPA 1GILA 4FXPA 2OXCA 3A58B 1Q21A 1GNPA 1ZU5A 5DHFA 1AS3A 1U0HC 4OI4A 3Q5EA 3GJ7A 3QXJA 4LYAA 1LFDB 2LCFA 3RNLA 2EYUA 1VECA 1G3IA 1UKYA 2J45A 2X1VA 4X8MA 4QBGB 3CNLA 1TU3A 4LHXA 2A3RA 5IK2A 3R8FA 3Q5DA 3FKQA 3SJCA 3SHWA 1S96A 2CNWA 3CBQA 3CPHA 3SN6A 5HZKA 2ZJ8A 3PEUA 4BQSA 2HF9A 3ZZUA 3THWA 4LJ9A 4C3ZA 3P27A 4PSVA 4Z8YA 3LD9A 3ZDQA 3DMNA 1QHSA 2VHTA 5GJWC 3VKWA 4EFNA 1PVOA 1H8EA 4EJSA 1ZW6A 2YC2C 4HLCA 2FSHA 1ZYUA 1CJTC 4YC7A 2GA8A 4Q1FA 1CR2A 4MYCA 1W0KA 2WSSA 3VR6A 3GCGA 1OKKD 3NBXX 4TN1A 5K8UA 2X77A 4CEHB 5DSZA 2GXQA 3K70B 2PT5A 2QPTA 2O8EA 3EPKA 1MKYA 1E2MA 1FL9A 4HZUA 4GZMA 2CHGA 4Q7KA 1IY1A 3B1XA 5JHHB 3QVUA 4JT4A 1OPXA 1G5TA 1NN1A 5FOTA 1YZQA 3FWYA 1GKYA 3PQCA 5JRJA 1UBGA 3SQXA 1TEXA 1L2TA 2EQBA 4D0LB 1R4AA 4KLNA 3RS7A 2YWEA 3W3AA 2QE7D 1E9FA 3ASZA 4QHTA 1ZC4A 1O3YA 4I1UA 1WBDA 1F60A 2PZGA 1KI2A 3ZD6A 3HDTA 4C0LA 1T5LA 4C2UA 1G8FA 1KMHB 4JKYA 1FUKA 4JSTA 2P6NA 1DO0A 1A1VA 4I81A 1COWA 2PCLA 5FR2A 1UKVY 2VHCA 1KI4A 5EXSA 4RVCA 2VHQA 3I8XA 3A1UA 5JECA 1Z6GA 2AWNA 4HZIA 2I4IA 3RC8A 3HWSA 2AXNA 3MG9A 3OESA 4A9AA 3IPYA 2JEOA 3GJ8A 3TSWA 2IX3A 3ZVRA 4KFTA 5KSZA 1YE8A 4DLWA 3W3ZB 2Q3MA 2WAYA 2ZJAA 3I92A 1EFRD 4JMPA 4PAMA 2FZLA 3BBPA 3FTQA 4P4SB 2ZIAA 4A82A 5C4GB 5FTNA 1XBTA 2HYDA 1E9RA 1M1YE 2OAQ1 4KBFA 4LX0A 3VHLB 1C9KA 3MMPA 4L16A 4FWIB 5JSZB 2RGEA 2GILA 1P4SA 4BE7B 1P9RA 1W49A 4NCKA 2GF0A 4Q7MB 4PZZA 4B44A 3VR4A 2FFBA 1R8QA 4DBLC 3SFZA 2BV3A 2IW3A 3OIVA 1QBKC 4ZCLA 4ZDKA 3H4MA 1UEIA 4WAUA 3LBIA 1ZM7A 1W4BA 2ZE6A 2QN6A 4G5OA 4WBSA 3RS4A 2QY9A 2ATXA 1Z29A 2RGNC 1JR3A 3K70D 2QU8A 4JL5A 4BWYA 3CRRA 1ZJ6A 4TLDA 4G5GA 1Z06A 3WP1B 4U7DA 4E5UA 1Z28A 1NBME 1ZM2A 4DHEA 2WJHA 1EK0A 3IIKA 4GNKA 3VR2A 4Q4HA 2XSZD 3IUYA 2DB3A 3W34A 2NG1A 1XMVA 1R7RA 4C30A 1NN0A 1HT1E 1JI0A 3U3MA 2X19A 4NP6A 2XSZA 4ILEA 4PPGA 3VKGA 1GUAA 3O8RA 2WWXA 3BFXA 3B6EA 3I72A 3RRMA 1K5GA 2G1KA 4QXAA 4TSFD 1P72A 3B2EA 4NE2A 4BFSA 1G7SA 3PUYA 4A8JC 1M34E 4RD0A 1DTSA 5EZ6B 2IF2A 4FMCB 1N0VC 2ODBA 3ADCA 1XZPA 1WP9A 3LXXA 4LC0A 3VKHA 1UBCA 1M8PA 1PLLA 5DH9A 4ASUD 4UXJA 1WQ1R 1CS4C 2CJWA 3K0CA 3UMFA 4B73A 2J87A 4EQ6A 4NCIA 2R8RA 1CR1A 4D26A 4CZ2A 2GEUA 5HR5A 2D74A 4Z8XA 5KDLA 3B9PA 4HUQB 1OFHA 1PLJA 2FF7A 3CLVA 2OBMA 4UNNA 1HURA 1ZCAA 4C0KA 2NZ8A 4R7ZA 1Z5ZA 5DIFA 2NZJA 2F9LA 3EAQA 4IFBA 2GCOA 1CLUA 1N6HA 2O8CB 1Z0FA 1K5DA 1T9HA 2YOGA 4EJSB 1YJ5A 1KK3A 1KK1A 1NJFA 1E9EA 5JLJA 3T1OA 4F4IA 1NBMD 3QIAA 4LBVA 1EX7A 4Q1DA 4MRNA 1DBSA 2E9SA 2WHXA 4E09A 3KKMA 5KU1A 2I3BA 4B71A 4GZLA 2ZEJA 4P4TA 4PAOA 4M1WA 4M9ZA 1II9A 3W6NA 4TYWA 1AGRA 1HE8B 2QMOA 2QORA 4V0MA 5FI1B 3IBGA 2GK6A 5B57C 1DAEA 1KSHA 4FMCF 1L7VC 3CF2A 4XD7D 4O2LA 3NC1C 2ZRPA 3VR5A 1OKKA 2F55A 2QPOA 3U3OA 3EPHA 3ZZTA 4XWKA 3Q85A 4O2RA 1ZM4A 2EWWA 4GMXA 1QDEA 2WPDD 4KSBA 4DSNA 2ZR7A 4N3NA 2ZU0C 1XRJA 2FFAA 3I5YA 4GMDA 4LDJA 4HAZA 3WXMA 4DLUA 1GNRA 3FYHA 1NI3A 1SGWA 3W8RA 4EFLA 5KUTA 2A5FA 2VL7A 1YR7A 4XSGA 2QROA 2XB4A 5AJWA 1ZNZA 1QZXA 4HAVA 3TRFA 3DZ8A 2ZANA 4JYCA 4PC6A 2W6IA 5CYPA 5TV2A 2QRZA 3K09C 3R7WB 4NYJR 2XXAA 3MFYA 3B7GA 5CDFE 1KNXA 4OYHA 4WXRA 3PENA 1I4DD 1E0SA 4Q9HA 3T35A 1P2UA 1N5KA 1FFHA 1E94E 4LJAA 5FBVB 2MMCA 2W6JA 4LRWA 4F7WA 1K8RA 4DSUA 2VRWA 1LNZA 4A0FA 5EQTA 3BK7A 2O0JA 5KTYA 1W2HA 1WA5A 3ICEA 2P6UA 4BFXA 2BBOA 3THXB 1KO5A 4HLUC 3AVVA 5LD2C 4XWAA 4DB2A 1OH7A 1EX6A 5HZHA 3N5CA 2J46A 2J9RA 3LVRE 3GLGB 3A6PC 2G3YA 3CO5A 3QSYA 1KO7A 1TF2A 1II0A 2FSFA 4E03A 5H8WA 3AF0A 3SYLA 4GFDA 2GXSA 2X2FA 2ZUCA 4G1UC 2GJAA 3AKCA 4NH0A 4JLKA 2OLKA 4Q7JB 3F3YA 4RKEA 2XXAB 2AWOA 1UM8A 5EE1A 4TLCA 3CRVA 5KSYA 2FFQA 4HZUB 4KJZA 4UQOA 1GKUB 1R0WA 2NO7A 3EIEA 3K0SA 1LF0A 4DCTA 3IILA 2FWRA 3IIJA 2OCYC 1E2QA 3UPUA 5F9HA 3PG5A 4M9QA 3K9GA 1J99A 5FOXA 3WHLA 3OEED 4LWZA 1KK0A 1YZGA 1II8A 4LHVA 2R6CA 4NMMA 2OCBA 2NO1A 3CW2A 1OLOA 3V00A 5HE9A 1HTWA 2BBSA 1TUEA 3B85A 2HCJB 1W5TA 1VMAA 4YMVA 1OXTA 4K81B 4QHSA 3PUWA 4Q7LA 1F6BA 1HA3A 1RYFA 2R6DA 2BVNA 3FKSA 3QPUA 1E6CA 3IO5A 2NTYC 2XB2A 1CTQA 1N5IA 1AJEA 4IDOA 1AS2A 2JJ2A 1ZAKA 5JJIA 3LX5A 2UZIR 2HCBA 3ICQB 3AUYA 1R0ZA 3CR8A 5CK4A 2H5EA 1Z0JA 4DXAA 1FQKA 1HQCA 1TQDA 2WZQA 2V55B 4AKIA 1E2FA 2VEDA 4MH0R 2IL1A 5G41A 4Q1AA 4D0NA 2QGZA 3T5GA 2JLWA 3AGPA 1KYIA 1HH4A 3QEOA 2FDCA 2V9PA 2A9KA 1AN0A 1U90A 4ZIRB 4D25A 1TQ2A 4G3XA 3WBJA 1Q1ZA 1XMSA 1LV7A 1Q1EA 2BBTA 4Q4AB 4A6XA 1TPZA 2XNSA 3KB1A 4YLGA 2IEZA 3QOFA 2C04A 4LK2A 4Q1EA 1MABB 2JLZA 2CVHA 4EFMA 2QM7A 5L3VA 5L8VA 4DZZA 2BHRA 2CMKA 3FPAA 2YJTD 3SU8A 3WYFA 1Z6AA 2FGKA 2XNDA 1KY2A 1ESNA 3KKNA 4OI0A 1EWRA 1G8HA 2CNWD 3SQWA 1KMHA 3U3JA 3EPJA 5E7IA 1D2NA 5J4HA 1KHTA 2RHDA 4E22A 5TARA 4DLTA 1W0KD 2WSSD 3KJEA 4A0HA 4B6FA 2A2ZA 2NO9A 1DAIA 2AX4A 1AKEA 1E1RD 1Z0KA 1XCPA 2IYZA 2VP5A 4QL3A 1TAGA 1TTTA 4LGMA 4XVUA 3UWKA 4Q48A 2JGNA 4F92B 3KFVA 4F4JA 3GPLA 1E9AA 2OCAA 4W7SA 1D8TA 4M22A 2QP4A 1XWIA 3DPUA 1IHUA 4MGZR 3AQ4A 3NH9A 4ERNA 4N0EA 1LTQA 2BMFA 1GRNA 3E2IA 4LCBA 3FVQA 3ZIAA 4CT5A 5C18A 5KYKA 1OW3B 1MO4A 3N2IA 4O0MA 4KCGA 4TMWA 3T34A 3PXGA 5JEEA 5DGXA 4EPVA 3P1JA 5K8IA 3GLHB 5H1YA 1VHLA 3O8DA 1AK2A 3U6BA 2P5SA 2PEZA 2OLJA 1Q1BA 3RS2A 2ZS7A 3G5UA 4TMZA 3K0EA 3TKLA 1VYVA 4L9WA 3AVUA 1X8JA 2GK7A 3KJHA 1XU4A 4D4MA 1KI7A 3SEAA 3ZS8A 1DAMA 2YYZA 3X1DA 3B1YA 3VMFA 4Q1BA 2HV8A 3DKVA 3TH5A 1OB2A 1ZUHA 2JATA 5EXTA 1CJUC 2B7BA 1ETUA 1BH2A 4BEJA 2Q9AA 4EIWA 3PEVA 4JLMA 1W7AA 4AKGA 2G77B 1QHHA 4NONA 3CM0A 2ZRDA 5KOYA 4H9GA 2CCJA 5FTJA 4BLTA 4RZUA 2XZOA 3DZDA 1IM2A 1IAQA 1ZNYA 5EP2A 2HT1A 1SZPA 4IHQA 4MGIR 4QRHA 4AWXA 3B13B 4DVGA 5JBQA 4YDSA 1Z6YA 4JSYA 2H18A 5JSZA 2NIPA 1G3RA 2I1VB 1UF9A 4WXPA 1U94A 3RABA 2GF9A 2WJGA 3FFBA 2H92A 2WV9A 2B8TA 2QNRA 5HE8A 4BRWA 3PEWA 5FPHA 2YKGA 3EZ7A 2LWIA 1VCIA 4R98A 4W5HA 1TQ6A 3AVPA 2WTUA 3QE0A 4B3FX 5JI2E 4AI6A 2FN4A 4WZ6A 1G17A 3SBEA 5GJVC 2ZPTX 4IOKA 1NLFA 3LDAA 1Z0AA 2C9OA 1SHZA 4UNSA 1IONA 2QMHA 4DUGA 1U0LA 1OFUX 3MWJA 1E0JA 3QPWA 4GI7A 2WWIA 2DFLA 2OZEA 5JFGA 5HTKA 2J41A 5F2EA 1QHNA 1L4YA 4ZIRA 4Z54A 1TNDA 2ZUBA 4LBWA 1IN8A 1XD2B 3IEVA 1ZCBA 2ZRAA 1J8MF 1W2GA 3B1WA 3B5JA 2Z43A 4AD8A 4RD6A 3CX8A 2ERYA 3KJIA 4HEJA 3QVVA 4FCVA 4KLZA 1SXJE 5FTKA 2VLIA 3RC3A 5C2JB 1MT0A 1KJWA 4S2EA 3TE6A 2B21A 1GSIA 2ERXA 3QI2A 1T8UA 2XZPA 2ZRMA 4MDFA 4PFSA 2O8CA 3GLIA 1OIXA 4TQAA 4PR0A 4JKIA 3EWSA 5J4VA 1XPOA 3W8NA 1CXZA 3U61B 4AG5A 3KDSE 4DRZA 4BFWA 4B43A 1QG2A 4TWZA 2BJWA 1M2OB 4LBYA 2J5XA 3L82B 1KZ7B 1P61B 3NVAA 3GJ3A 3HPQA 4TLAA 4M21A 1VG0B 4NZYA 2GAOA 1SVLA 3HU2A 1E4VA 2OT3B 5JJLA 4QM6A 2Z0MA 1KK2A 1MR3F 1Z6TA 4CIDA 3UMRA 4BLRA 1NSFA 3OAAA 2JLXA 2QMEA 4RD3A 1IQPA 2B8WA 3UXMA 3NG1A 1TUIA 4ARZA 1W1WA 4I1OA 2ATVA 2ZRLA 3TSZA 1E9CA 2YOFA 1MV5A 1N2CE 5JCZA 2Z83A 4RCYA 4IXNA 3V4RA 4XIGS 3LH5A 4B34A 1N6NA 1W4AA 1XTSA 4AG6A 4DEXA 2JLYA 4QKQA 4IW3B 5D3QA 1RC8A 5CLQA 1RRGA 2VP9A 3BH0A 2Z4SA 4QM7A 3PEYA 5EP4A 5EE5B 2KWIA 3LVQE 3MWLA 2XTNA 4C0AC 1SVKA 3LRPA 1KSJA 1P75A 4PQFA 4R71A 1U98A 3LX8A 4P0TA 1U9IA 4LHWA 2B6HA 1X8LA 3BE4A 3NHBA 1L4UA 3BC1A 1DELA 5IHPA 2VH5R 2YC4C 2R6FA 1JXMA 1NG9A 3A1VA 1UEJA 2OEPA 1U8YA 3VHXA 2QI9C 3FB4A 4AURA 1GWNA 5BYJA 3FHTA 3D3QA 4JZKA 4OK3A 4PQYA 1FNMA 2PZEA 3AVXA 2IHBA 2QAJA 1JJVA 4ZO4A 2D2FA 3QPVA 2OBNA 1VCNA 2HJGA 3QY0A 4Q18A 3EG5A 2JJ2D 3OIWA 4B74A 1P62B 2ZSDA 3H86A 4GP7A 2VPPA 2VF7A 3LLMA 1S3GA 2GTPA 4ESVA 1LVGA 1QHXA 2D4HA 4ZDIA 2DHRA 3DOEA 2K5UA 5FTMA 3ADBA 3NC0C 4IXMA 1AIPA 3I5XA 1OJLA 2IYWA 1YR8A 4MKFA 5EUMA 5LB4A 1G41A 2OFXA 1TF7A 2EFCB 5AJXA 3F5FA 4X8LA 2B7CA 2Z4RA 2G0TA 2KBFA 1RYHA 2WMNB 2QSZA 2H8KA 1N6KA 5C4MA 1JPNA 1XD9A 2PJRA 1JJ7A 2KSQA 2NPIA 3K9NA 3LO5A 4Q5IA 1E2HA 5G3ZA 1OE0A 1G9XA 2O8DB 3CH5A 3ZVLA 1G16A 1SXJC 1YKSA 3AVOA 1G6OA 3SC3A 3TUJC 3WRXC 2Q6TA 1VYUA 3CIOA 4H1UA 5EE3A 3I1FA 5CK5A 2OAP1 2WOJA 3CH4B 3T15A 5L3SA 4DUGD 5A0FA 3EA0A 3P26A 4W5JA 4FW9A 2XJ4A 6Q21A 4RCZA 2ZJBA 5DI3B 3RSOA 5AUNB 1NKTA 2VP2A 1DVRA 4JT2A 2IYQA 1NLYA 4Q66C 2D2EA 2RMKA 3KL4A 3NTUA 4C0SA 2CHVA 3QBVA 5KDOA 1IN6A 2JDID 4C4PA 2OFWA 4GOKA 4RZ3A 1HT2E 3MGCA 1OB5A 2ZU6A 1DO2A 2V6IA 1GRQA 4M9SA 3ZIAD 4V0NA 3KQUA 5JRZA 4L15A 2IYTA 4NTZA 4QBIA 1G18A 2XOKD 4NYMR 3RYTC 1P6XA 5D3MA 4NL4H 3WNBA 4HDCA 2XX3A 3QKRA 4RZXA 5JEDA 2ODNA 1X1SA 1IXZA 1D9XA 3FMOB 3MUFA 3VFDA 3CRMA 1A82A 1DOAA 2DBYA 4Q4JA 2WVJA 4TYNA 5DN6D 4OQMA 3THWB 1X3SA 1HEIA 4PTLA 5CM8B 3OF5A 4B3GA 2HEIA 4IDHA 3ZD7A 2GZDA 4Q19A 4Q9JA 4PHHA 5DN6A 2A5DA 2F1JA 3F8TA 4OJQA 1SXJA 2WIAA 3TK1A 3L0SA 4URVR 4C0QC 4B2LA 1G7RA 2C78A 5AK0A 3EZ6A 3LLUA 4JYBA 4ZI2A 4QNRA 2YHSA 5E95A 4D81A 2WWFA 1ZBDA 2NOAA 4DSOA 2VHJA 4NCNA 2C8VA
chains in the Genus database with same CATH superfamily
1MAAA 4F21A 1JA0A 1JLKA 2UUPA 1Y0BA 4G2TA 4XW2A 3ILXA 3T06B 2Z6VA 2OYCA 4JBYA 4BE4A 3SWWA 4F46A 5J2UB 4J7XA 1O77A 4R6XA 3D7KA 2V7QD 4EQ6B 3U0VA 4ER5A 1CVLA 3H87A 3UK6A 2JLUA 2NUAA 1NBAA 1H6BA 3FUWA 3RU7A 3VYVA 1MJGM 3C14C 5DZSA 1J0BA 3A1WA 3ZU6A 3C16C 3KJFA 1ID1A 3MMZA 3SICE 1GL9B 4CGZA 4BMDA 3H2HA 3L7YA 4L27A 2JFVA 4L4UA 4XQ9A 4EI2A 1GITA 2ZUFA 3LLSA 2X9VA 3THXA 2NXCA 3AUXA 3H3FA 5LKAA 3A4MA 2H0AA 2XVYA 3OU6A 3OFJA 4XH9B 5E3HA 2X1HA 4AY2A 1JSLA 3ZNQA 4C01A 5KWSA 4C4RA 3ELUA 1ZIDA 4EGSA 1RPAA 1TM7E 2C5GA 5LXTA 3H75A 1H3FA 3OZVA 4DDVA 3GJZA 3NUGA 4TUYA 1JALA 1LQ2A 2VHEA 1CV2A 4N7MA 1HZZC 3UQYS 2BZ0A 3DAFA 4FHGA 2X3FA 4YXWA 4AF8A 3OT5A 4BLPA 4BNXA 4DIEA 1NW8A 2CLOB 1WHTB 1G8GA 2DC1A 3M6IA 3KJQA 3QX9A 3NTXA 2DR3A 3VA7A 5CA1A 3A3KA 3PXXA 3PEFA 2GO7A 4ACAA 2R1UA 3PS9A 2Z8YM 3EARA 3JV7A 4LBZA 3N8NA 5A7HA 2WPDA 5IAGA 4V1CB 2PM8A 3FE2A 4M99A 5IT4A 1Y8QA 2CXHA 3TMAA 5JZOA 2QVZX 4HATA 3EBLA 4NYMQ 1OA1A 1TEVA 1EXWA 1JSRA 4D8TA 4Q4LA 2AR0A 2ORVA 2ET6A 3DMFA 1N3BA 5CXUA 3TG2A 3VAYA 1FPMA 2J59A 1JFTA 1M66A 4OMDA 3GUCA 1S4QA 5HSGA 2QQGA 2G5GX 1QPBA 4BO7A 3G1TA 3UUFA 1N2SA 4A3SA 5HCUA 2VUHB 3IDSA 5BXYA 5KVCA 2JBAB 3GPDG 3LWNA 5ERYA 1THMA 1ML4A 2X15A 1U3GA 3IBCA 3SEZA 5K0JA 1RE1A 3K1TA 4ECAA 5BYAA 4FXOA 3MQ2A 3MPOA 4HWSA 4TXJA 2C20A 1XLUA 3EZNA 3O91A 2YMQA 3QUQA 2YASA 4MV9A 2A5JA 4GR9A 4ZHQF 3TQRA 3KDAA 2XYVA 4U2EA 4B9AA 4OBBA 2GO1A 1LTKA 3D1LA 3P9QA 3T5CA 3PZBA 3VNRA 4F6RA 3BAZA 1VKOA 4HVAA 5DTRA 5BV8A 2WNHA 3L7JA 4WH0A 4YS6A 3ZZ0A 3UJ6A 1VE9A 2Q50A 2ZFUA 4GGMX 3S1AA 5AW3A 1XQYA 1PK7A 2HJWA 3F3SA 4LHZA 3WI7A 4L72A 4FDVA 1Y8RA 5TY0A 1UOOA 3C4VA 1T5TA 1U3WA 3V1UA 1NU8A 2DM6A 2XDYA 4NBUA 1SZDA 1VDZA 3SCZA 1EVQA 4GYKA 4C6SA 4HNVA 3JRXA 3FMFA 3VDXA 1QS0B 2GEKA 1QX3A 2POCA 3GJTA 1SHKA 3NJ4A 3DSRA 3UBTA 3RC2A 3GT7A 2OBYA 3DXYA 5LZ8A 2VJDA 3KC2A 4MDHA 4C87A 1N33B 1XVLA 3VYRB 4BFCA 2OFFA 2XTMA 4RU1A 4Y2VA 2A67A 1RRFA 5NULA 1BS2A 4HNHA 2A94A 4BP8A 1DMRA 4OATA 3T3OA 1KY3A 2JK0A 3AKYA 3BILA 1MG5A 4YH1A 1WVIA 2CF5A 4ZVQA 2IBMA 3SAJA 2VG8A 1UAYA 3RIMA 3U5TA 4B4DA 5KEIA 4UDNA 5B30A 4WKPA 1RJGA 1E58A 3JZAA 2ZI3A 1BAPA 4QYXA 2PS0A 2TMKA 2VQ6A 4WXMA 3A8TA 2J09A 1G8PA 1NT4A 1RU3A 4J3JA 3U3XA 4G5HA 4J0HA 1ZVVA 2E48A 4ZQBA 4OLAA 4R1NA 3IKLA 4IEEA 1Q6YA 4PYKA 3WGGA 2H3HA 1M1NB 3LE8A 3L05A 2IS6A 3UK0A 1RAEA 4YDRA 1AD2A 2H29A 3FJYA 1P9LA 2MJLA 3KZVA 4Q3EA 2FG5A 2QB5A 4DJFC 4URYR 2P5TB 3FKSD 3W3AH 4CMBA 5IF3A 2YQ4A 1ORVA 3VYSB 1E20A 4MI3A 2OV8A 2R4UA 3KB6A 5CH3A 1NIPA 3U44A 1K4MA 1VB5A 2AFHB 1F3OA 3ZOZA 3C48A 4R54A 1RQGA 4ECEA 1C1YA 3IP6A 4Q9KA 4EEKA 2VNSA 2BEUB 4ZGGA 2PT7A 4LF4B 2OYSA 3NBAA 1LXCA 1MQAA 4KC0A 4ZMSA 1BWSA 3I0NA 3G89A 3MWDB 4JLBA 4Y2UA 2FLWA 1CNMA 1GLVA 3CJTA 3FHCB 3ORFA 5T67A 3BFJA 1ISIA 2VAWA 1CU1A 1FFEA 3DZBA 4CEIB 2JLVA 2ZBQA 2PYDA 1AKTA 3H1TA 3L1UA 3OJXA 5ELMA 2W2XA 1JHZA 2Z2KA 3Q5GA 3V48A 1MH9A 1PZGA 1VCMA 2O8NA 1AKWA 5REQA 1LPBB 2XVZA 3NBUA 3PX3A 4M0KA 3DMDA 3FR8A 2V03A 3WNVA 2F9MA 3L8DA 5JCPA 5JH7F 2RGYA 1FB5A 1VL8A 3P9SA 1OH5A 2ZKLA 4R8KA 2CNKA 2ZAGA 1F1JA 2FB9A 4H3SA 1NYLA 2CUNA 1DQSA 4MUFA 1E63A 2LXNA 2NGRA 3WSVA 1K6MA 1NUTA 3FDZB 3SJAA 3H9CA 1DOHA 4AROA 5C5CA 4Z4FA 2VR1A 1VRVA 1L7AA 3LKBA 3LLCA 3KTAB 3F3KA 4CU2A 4K9NA 1JG7A 2B4AA 2O8FA 2QTWB 4RA6A 3HN2A 4FGKA 1ODFA 2QX6A 2V7QA 3FHLA 4LI3X 4DCUA 4B09A 4H31A 5HQ3A 2XKBA 5BSEA 1U8XX 3GWGA 3EA5A 4GWKA 4XPIB 3AX6A 1ZEJA 3JTEA 5LYYA 2QG4A 3HHEA 1U1IA 1X1TA 2UZAA 4G86A 4B35A 5IT9A 5F1PA 3OFKA 4RQTA 4XB6B 2ONJA 1HQDA 1A5AB 2LDBA 2BEKA 4H60A 4MAAA 4B47A 5I4IA 3AVYA 2OZPA 1DKRA 1FUUA 1QIEA 1YGPA 4LXYA 4CMCA 2GD6A 2GZ3A 3X2SA 4BCDA 1TJPB 2W2OA 1Z08A 5JZVA 1KAHA 2DKOA 2C9YA 4QUIA 3D9QX 4MVWA 4A5OA 1CYDA 5A7GA 1Y6GA 1RWPA 1K8XB 4IEIA 1UH5A 4IG9A 2WJYA 1U7PA 2IU4A 1CLEA 1T1IA 1PDVA 3C6XA 5DEOA 1S8NA 1EP1B 2N9UA 1U2ZA 4NNPA 4A15A 5C53B 2VTKA 2XOKA 3G0DA 3ZE8A 3NAQA 5JYDA 2B8JA 3VNQA 3DGEC 2LIVA 4Y2SA 5U4XA 3WK8A 4DLVA 5T6BA 1KZ9A 1ONPA 1QVVA 2ISCA 3FAZA 4BAUA 3IS3A 9LDBA 1GT91 2XVMA 2HLHA 3H5OA 2EFGA 3W3AD 2XEXA 4DC0A 2DWOA 1RVDA 1FFXA 3K0CC 5CRIA 3AKDA 3PC4A 1MOZA 2E4XA 4J94A 1F8XA 4C4XA 3MUNA 1VE6A 2O7VA 4QOSA 5BURA 1EUDB 1VRCA 3BMCB 3GRZA 4IQ0A 1X70A 5B1DA 2QD1A 1U2GA 5L3SB 3BXXA 3GJ0A 4PY2A 2PQ6A 2ZJ0A 4HAUA 5ALJA 3PXBA 4EG7A 2NUTB 2B1QA 3IAEA 2PQMA 3V4ZA 2HIGA 3BL6A 1JSCA 2I76A 1VLQA 4XR4A 5AVVA 2IUUA 1FP2A 2H2GA 2HN9A 2QQ5A 1A9RA 3ECCA 4QGFA 2OXIA 3A4LA 1P0PA 1NONA 1EQAA 2XYQA 3H8WA 4BNIA 2RGNA 2VAPA 2ZSBA 2B1RA 4WBXC 5A3RA 4OXQA 1JQEA 1ZPDA 2Y1FA 3QYJA 1B0UA 3WB1A 3UC9A 2JB9A 1UMKA 3K5WA 3QXXA 5IEJA 1E6UA 1GGFA 4RQBA 3K53A 4DXDA 5KO2A 3K70C 1IRXA 3C4QA 1VQ1A 2NU7B 3CUUA 1VPVA 4ZV7A 4D3FA 4R1MA 2IDKA 3AIOA 3E61A 4AMYA 2FZGA 3UYLA 3G13A 1ZSYA 4I4LA 4Y2JA 4EABA 4IIGA 3JXEA 1QOPB 3NKFA 5AVOA 1JHAA 2D00A 3EZ2A 5FPQA 4URXR 1QV7A 5F5XA 4M1YA 3I8SA 2AXPA 2NV2B 2HSEA 2WR8A 4GOJA 1KETA 4NENB 4S3MA 3H5VA 4E2FA 5HUJA 3SPXA 2ZIWB 3TBKA 4D8XA 5C1PA 1WKVA 5GZ3A 1FY2A 2ZVPX 3LF2A 1EIZA 1TYAE 2YNMA 3GMTA 3QFHA 3IEUA 4IQGA 2HDWA 3O9ZA 2VKTA 1S0UA 3JD2A 1TF5A 1MDFA 1YV9A 1K6JA 2A0XA 2DBRA 2QRVB 3ANTA 3EB9A 3ITNA 3Q3CA 4GLLA 4D9BA 4AJOA 1XYGA 2CDNA 4NOMA 5JJKA 4F8YA 1UBLS 3BCSA 3VKFA 1M1UA 5JT1A 3F1LA 4HGNA 4ZRNA 1L8OA 5IT0A 2ZTMA 2X6TA 3PC8C 4I1SA 4ZEXA 2YS6A 2RHOA 1M6NA 3JRWA 3L4BA 2XYHA 1C2YA 2H7XA 2XY4A 3NM5A 3OE4A 4U00A 4ZMBA 2HHHB 1FX0A 1Y5MA 2EWVA 4DV2B 3FYCA 3K1ZA 2HDOA 4JOSA 5FPTA 1KBZA 1E4EA 5DV9A 4M1MA 3PFHA 1S3FA 5U4QA 4EATA 4CDGA 1Z6XA 5THXA 4TLMB 4TLEA 1OXKB 2RBKA 4EECA 1NI5A 1USWA 4HXEB 4MKHA 4K0KB 1G42A 1TI7A 1AUOA 1E5QA 4GI2A 4XUDA 4TVSA 1A97A 2B5VA 2QJOA 4ZKDA 3WO1A 1ZNXA 1QP8A 4L28A 4QAQA 3TAHA 1QYWA 2VWQA 3CISA 4FGUA 4J0EA 4JLNA 4PFJA 2D5CA 2Y8EA 4RESA 4ZYYA 4Y2XA 1D1SA 3NVDA 3TIIA 1LW7A 3QWIA 4OX9B 1UKBA 1XK6A 4Z9YA 4J29A 4UVEA 5GVRA 3B20A 4KLCA 1ZH6A 4O4IB 1RHMA 1XA0A 2ZG6A 3TGLA 3AESB 4BC1A 4ZAWA 5I4BA 3VAAA 1JH9A 2JGDB 1NYQA 4HUTA 5I01A 4QLOA 4YXFA 3I9FA 4IZHA 5C34B 1G9SA 2R7LA 3ED1A 2EFDB 3KKZA 3O26A 4HQFA 4I9HA 4XYMA 3ISJA 3A36A 3OIYA 4H7JA 3LNCA 3WIUA 4BGDA 3GBPA 3DKRA 2YS7A 2VJMA 3O4IA 3QJGA 5EJ8A 4L8LA 1O8CA 4YQFA 3H6KA 3GLIE 5K6RA 1XMJA 1FFBA 4MICA 4QVGA 1GR0A 2O07A 2XAUA 4N6NA 3G7NA 3WLAA 5JAMA 2WWYA 2IPLA 4RD2A 2XLBA 3LQ4A 5K7SA 1M2JA 1QG4A 3AERB 4PM4A 4DQXA 2ZGVA 5CIYA 2EFJA 1N1DA 1EFHA 1N9ZA 2QYHA 3GMSA 3NEJA 5BWMA 4JMLA 1Y8CA 1DI0A 3PICA 4K03A 4A2QA 4DQUA 2UZ3A 2ZT5A 4D4LA 4KU4A 2OOSA 3ZJUA 1DXQA 4FD2A 4HGYA 5GIPE 2RGWA 4Y1RA 1NP7A 3IQWA 3B7PA 2EFHB 3C5EA 4WD3A 1T5BA 5DYWA 3RJMA 3W79A 4C5AA 1I2MA 1OX6A 2GBLA 2I6FA 2PBZA 3GEGA 1ULUA 1JTFA 4EX7A 1JR3E 1SKYB 2OGUA 3KSZO 4ZRDA 4EUNA 1YCFA 5ULLA 3F6SA 4CFSA 3IMCA 3RUEA 5CXXA 1IHPA 4JEMA 2AHOA 2IEYA 4O4IF 1ONSA 3ESYA 1L5HA 1OU4A 2FUG1 4QAJA 3B1KA 4OGWA 2LKDA 1ZJJA 1WXDA 2REOA 4HI0E 1BQ4A 1YRQA 3DZGA 1PV1A 4K9OA 2Q5JA 3BKXA 3P9XA 1ZIPA 1XP5A 1X6VA 3FDJA 4POAA 3JAMA 3TRDA 1MD9A 3TNJA 3PPYA 3D02A 2D0PB 3HJBA 3PWKA 1E79D 1TT7A 4OHOA 3IODA 5ES3A 3MCVA 4ZC8A 5KWEA 1QU2A 1Z25A 1W46A 3UGJA 4WW0A 5EKUA 5K3FA 1Z2EA 2FUEA 2VHXA 3WGIA 2JAQA 3K2QA 3CVXA 1RACA 4XM0A 2REQB 4N03A 3BT7A 1M2OA 4YJGB 1RYZA 1V6SA 1GL3A 1WUTA 2CZQA 2Q5QA 1ZUIA 3ANSA 1E61A 1LK0A 4LE2A 5JY1A 4LE1A 4BTLA 4FTWA 3HL4A 5AHXA 1X80B 3EXG2 2I29A 1ECCA 4YP1A 1A2OA 1T6NA 2ZB8A 2ODWA 3ADOA 4CLDA 1XXHA 4X24A 3I2YX 4KVAA 1PBTA 4QQNA 4EPTA 5K3OA 3LC7O 4OBEA 1E98A 4KRFA 2ZM5A 4IJMA 1CR4A 2CKMA 4U7WA 2Q7DA 2DUWA 3CUVA 2YFHA 4IVNA 2IT1A 4J9UE 3AKZA 4DPMA 2PPVA 3ZE2B 3GA0A 1UWCA 3KD2A 3FLBA 1QRTA 4LWPA 5AHRA 2O2XA 3GFQA 4YT2A 3ROQA 2ZR9A 4ZVMA 3NWBA 3PKJA 1M74A 2B2NA 2FH5B 2WIGA 3QY9A 4M4SA 3HDGA 3PI6A 1QYXA 3KQVA 3VC2A 4KFCA 1D7AA 4J3NA 1VIMA 1V26A 4MLDA 4LV6A 2GUWA 3WK5A 1NVKA 2G9NA 3HB4X 2J32A 3UWOA 4BNGA 1QFSA 3N2LA 4DL9A 3BIJA 4DMGA 2DHDA 1U2TA 1DBRA 2YXEA 3FOAA 3W6UA 4GEGA 1XZFA 3QA9A 2ZYGA 4CMGA 1UDRA 3M89A 1P2TA 5LU8A 1WBBA 16PKA 4NBVA 2RGAA 1STOA 4CWAA 4HTAA 3H1FA 3A9RA 3PDUA 3HB0A 3NALA 2V7VA 3VBEA 1YE3A 3A3YA 4J7AA 1Y1SA 1YZUA 3AU9A 3Q7EA 3THOA 1PWEA 3AUJB 1JLLA 4NDNE 1KSFX 2IOQA 4I4TA 3TIVA 4C76A 1CDEA 1V11B 1W1UA 3PVZA 1N9GA 1PK8A 4O4LA 4O2BF 1NJ1A 4OQZA 2OQRA 2V9ZA 5TVGA 2A88A 3BGWA 2TS1A 1AM4D 1DRWA 4RZ2A 3EXAA 1JKJB 4ALLA 5LQSA 2BL4A 3JQEA 1LNSA 3CNNA 1VL1A 3PDWA 3SZRA 3ZV3A 1X80A 2C4WA 1NVMB 4GQAA 4BV8A 2WYUA 1YB6A 3WAGA 3LY7A 3H2ZA 4MWCA 1RCFA 4RH0A 3S1LA 4AK9A 2QXUA 1WPQA 4I3HA 1ZJ4A 1FNSA 1ISPA 1DFGA 4FW8A 4BNJA 3A1NA 2XE4A 3DBRB 4MYHA 2OB2A 2OV1A 2BKUA 2RH4A 5JS1A 3D5EA 1E2LA 3LAWA 4ZA2A 2KM1A 2ZTSA 1C7IA 1JQLB 1TIPA 3W5UA 3L0IB 1FVXA 4C4YA 2BCJQ 3RVDA 2D0DA 2XCUA 1F4PA 4GUAA 1NJSA 2NV6A 2WAOA 3H5LA 1HNXB 2Q45A 5IVKA 1Z75A 3LW7A 4MROA 3CT6A 5ICCA 2FSUA 3WV5A 5I4CA 4OP1A 2AE1A 3ZXIA 1KDYA 4QECA 4BQRA 1E59A 1KZ6A 4LNHA 2HRBA 1THZA 3IUMA 5HGJA 1FZQA 3OFND 1PG5A 1GP2A 1PZEA 1EA5A 2FKAA 3PQ2A 3MXOA 1IRIA 1D8AA 4F5DA 3PHLA 1M8KA 1ZNQO 4B8WA 3NKVA 1FNBA 4F8EA 3I0ZA 4UD2A 4MKGA 1MC8A 3DT8A 5AJZA 5TLSA 3IC5A 4JXXA 1CUYA 3OPYA 3SZOA 4Y1GA 2QRJA 4JLAA 3H3JA 4U9UA 5IMSA 3D2BA 2I2AA 2XVAA 2ZI6A 4II3A 3RFXA 3IX7A 5KVSA 2XZTA 1T9KA 2C03A 1FYEA 3IBTA 2FMUA 2W6JD 4NJMA 1EVYA 3KSRA 5EIWA 5HHTA 2Z6UA 2DPLA 2WU4A 3ILSA 2YRWA 2FETA 3MWEB 4QYMA 4R05A 1WG8A 3BDIA 3KQWA 4MXDA 3TOXA 4JLSA 2JFWA 3UHOA 2WIBA 2Q5FA 2ZJZA 1EFAA 5DK4A 2IYEA 4GE3A 3W5SA 4C1NA 2O2ZA 3WQBA 5H5JA 2C58A 2I2FA 2HKIA 2D8MA 2J9FB 2QENA 3UWDA 3JQAB 4UTXA 3RVPA 2Z4TA 2PVSA 1P1HA 3JWIA 1JWBB 1KARA 2QP9X 1Y5RA 2XQIA 2ODEA 1CJBA 3LA6A 4NCJA 4ZAZA 5B3LA 3KWMA 1YBVA 5KKAA 3E9YA 4URFA 3R7AA 3ZHQA 5CLLA 5BXQC 2BMVA 3B52X 4C7OA 3VPBA 2Q1WA 3L7AA 1E5DA 1NATA 1Y9JA 3H65A 1XF9A 4L4ZA 1VSTA 1TVKA 4HDQB 4N7BA 1Y80A 3IUSA 4DBLE 1AQIA 4JWKA 1HMPA 1OLUA 1QYVA 3NBYC 4I3FA 2VI5A 4R9NA 3K9QO 3OF2A 1O6ZA 4CF5A 1P91A 3H9GA 3AR9A 5EXXA 2WB4A 3K7EA 4PW0A 2XD9A 4DLKA 1GN9A 2YXLA 1U5BB 3SJBA 7AT1A 4OHYA 2X14A 2QYSA 4P4SA 3RO7A 3E03A 3CONA 3MFQA 4H16A 1W9HA 1E79A 2QLBA 4HD8A 4DDKA 2IZ1A 5GM1A 3H2BA 1UFVA 1YB7A 1MXFA 1CQIA 3RAGA 3L07A 2ADOA 1VCOA 3GLHE 1LJUA 2HLNA 4GLFA 4MYTA 5E1DA 1JEAA 1P0MA 4B3DA 1LV8A 1L1QA 5AXDA 4NS1A 1W48A 2H5IA 1AF7A 2W2LA 5B6PA 1DXYA 1QZTA 3C5WP 2SKDA 2GJ8A 2NUPA 5BYBA 3BIFA 1XXHB 2FJ0A 4BVAA 3GIWA 3ZDAA 1DEKA 1XA3A 2C7VA 1EI9A 3AY6A 4H0CA 4M7RA 5EE9A 2YZ2A 5HCNA 2B25A 2X8WA 3G2LA 4JSRA 3TX6A 2G4VA 1JFSA 3R3HA 3DBVO 4RSGA 1PLKA 3MINA 2NVWA 3D8HA 4TSFA 2ZAMA 5B1SA 2ACEA 3P0IA 1BWRA 3KXIA 3MBKA 4KAXA 1E2NA 2WC1A 4ZI3A 5A2GA 1SQ5A 1Q0TA 4EYQA 3TG8A 1DBWA 3L1HA 1XDBA 1C3JA 1XDWA 2KB0A 3OIDA 3KE9A 3MRXA 4GSKA 2FPKA 2OD2A 2QN8A 1CHDA 4QYIA 3EPPA 3LXRA 2GD1O 5DNCA 3NFRA 1ADFA 3DM5A 2HPVA 4ND2A 2P9QA 1EEHA 4L74A 5TB5A 3SI7A 2QPAA 5LXTB 4FCTA 5K2MA 1YS6A 1KC3A 1S4MA 4DWVA 4X61A 1E2PA 2ZAOA 2IY7A 5KMGA 1FS6A 1KFKB 1J2JA 4IVQA 2ZYSA 3ROFA 3E9MA 3RWMB 1JIKA 3JQ7A 4JLVA 4CMJA 4HRVA 1KAOA 1R6DA 3NGLA 1FQOA 1GTJ1 2QUZA 2E4AA 3DCJA 4YO8A 3ROPA 4YMGA 4DV0B 1PEDA 2QT0A 3U40A 1BMFD 3IPRA 1UKZA 2R6HA 4C6TA 3DEZA 1KYZA 1I1QB 3QIVA 2C9CA 5BN5A 1U4NA 4GM0A 1C30A 2H4ZA 2OWEA 3DB2A 2DG2A 4AXBA 1W5FA 2HMUA 5EZYF 3C98A 4R69A 4KWIA 3H04A 4OKSA 2J0EA 4K6HA 4N76A 2JI7A 2VEOA 2D54A 4Q3NA 5IJXA 2DCMA 3I9OA 1S02A 3NRJA 1YS4A 3RHTA 4LXIA 1HEUA 4DEVA 2CMDA 1KYXA 1GU7A 2CVQA 3M0EA 2B92A 2EW2A 4IVPA 1VLJA 3S2IA 4J0JA 2O14A 4NZZA 1VGVA 5DYIA 3JARA 4IUYA 2J6CA 2CL0X 1XIVA 5D7NA 4N41A 1Y5IA 1P7YA 3OY7A 5ALIA 4D42A 1F2TB 1WULS 3FNBA 1NUQA 3GOQA 1PDOA 2P6MA 2ZI5A 4IDAA 4KPUB 4QJBA 5LOVB 3R9XA 4H6XA 3W7BA 2E5WA 3R0IA 4OKNA 4HL6A 1N25A 1ULBA 3GLFB 3KYBA 2XMGA 2I4RA 5EUBA 5T8KC 4ERNA 3BF7A 4PVDA 1WABA 5IG2A 3IHTA 4LOAA 2JFHA 1US8A 5IN5A 2KBEA 3O6VA 1CZNA 4NV1A 1AQYA 5FOVA 1E3WB 4E4YA 3QVTA 3QU7A 1Z83A 1PJ8A 5CNIA 1NBWB 1NLMA 3KOXA 1XJCA 2G17A 5HM8A 3WA6A 2ZB4A 4NMHA 2VSFA 2VC2B 2VAXA 1J0AA 2P8JA 1JWLA 3KQMA 3K1AB 4KRYA 4BB5A 5ICSA 1VJ1A 3U7EB 4NI5A 2Q3HA 3V7FA 4D4HA 3N2KA 3SFTA 1ZZGA 3WLOA 1G8AA 4EY6A 1LS6A 2PX8A 2A5GA 3BN3A 1RJDA 1Y6JA 4HDKA 1ECFA 2AYXA 4WTOA 3A3OA 3UGTA 2O3QA 1T4GA 3BGIA 4MPPA 2XUQA 3H0KA 1J8DA 4CTMA 1LDGA 4QDKA 3TL2A 1NUHA 5T4HA 4CEJB 2P0AA 1N92A 3C8UA 3KD3A 1EG7A 4IDQA 4IAOA 4ML3A 3WSTA 1GHTA 2XNJA 1DPGA 1X1EA 1Q17A 1GTVA 1LVUA 3KB2A 4R8MA 2RB5A 5AUPB 4ZCMA 3HO8A 2V4MA 3IBYA 2WRZA 3O82A 2QN9A 1GNSA 1OPRA 2WJ6A 3BK2A 3JQAA 1X38A 4MCHA 4IOLA 1QTRA 2QUAA 3S6JA 2FK7A 3CY6A 3E2PA 3U39A 2C2OA 5EQFA 1WSBA 5KS2A 3JQBC 3G8AA 5CVUA 2BRUA 1RQNA 4G5XA 1UADA 2GBGA 2P67A 3KP1A 4MW9A 4K05A 1MQSA 1M2VA 3BZBA 2XDAA 1GQYA 3DBHB 3SSNA 4DJAA 4X85A 3EGCA 3EN0A 4MW4A 2GPJA 1C9EA 2D06A 4R1OA 1BRMA 3DEAA 2OUKA 4D0GA 1YS9A 2GDJA 4GECA 4MYRA 1JR6A 3WLQA 5C4IA 4XOIA 2AFIE 1HQYE 1X1DA 5BWBA 1EUCB 3V97A 2ZR8A 3PRKE 2VN8A 2HRRA 2J4CA 5JPDA 2JA1A 2A1TS 2VZ8A 4MS3B 1Q0QA 2KPOA 2X0EA 5BUZA 4H15A 4CQNA 4I50F 4D82A 4R5HA 4YP9A 3KEOA 2GJ4A 3AR4A 5CDGA 1XDDA 4Q7QA 3BA1A 4PSKA 2HPAA 2IUYA 3QKSA 2C4MA 3QMVA 3TZ6A 1E5VA 5K8LA 1K08A 3BXHA 2FHSA 2QUHA 2OM2A 4OFXA 4W1PA 3FMPB 1X1RA 2NW6A 1GNQA 3LCCA 3NM4A 3SDZA 4IHJF 2XUKA 1K4YA 1LX6A 3PE6A 4G1MB 3IAS6 3AR2A 3VO9A 1TMGE 1ZRHA 4BRUA 2GJSA 3OKCA 5CJPA 2C5FA 1SPBS 3RYIA 5AKKA 1ZXXA 2FNAA 1C7FA 2AXQA 2CLCX 2QPLA 3QX7A 4AG3A 1JKMA 2IA5A 3HB1A 1O58A 1SXGA 5JAHA 2QRPA 4LMRA 1EINA 4M7OA 3L46A 4M8KA 4TV9A 1Z47A 1V1RA 2PYIA 3NT2A 2H8GA 1R10A 3RGGA 1YTUA 3R5FA 1RKUA 4C9BA 3R5XA 2J7PD 4Y1FA 1CY6A 4LOIA 1OVMA 1EESA 4TZKA 4URHA 4RY8A 1KI6B 1W76A 3O38A 3E5RA 1Z07A 2D7JA 2ZCVA 3RS5A 2GEDA 3DT9A 4DM7A 1GDTA 1MRNA 1YHNA 3H5IA 5EMLA 5SZHB 4ALIA 1L7QA 1ZD4A 5KNCA 2YV5A 1FVHA 4HWGA 3PT9A 1RYMA 2CZCA 4IYRA 5D3MB 3TTWA 4A10A 4OF4A 4BFTA 3EBOA 4DBVO 2XIQA 3T61A 4OJTA 3C6QA 4R31A 4B3HA 1U2RA 5EL0A 5BWCA 1CUHA 5LQMA 1GL6A 2YW9A 1W87A 4K6FA 3X1ZA 2Y1XA 4AJ9A 1QLWA 2A4MA 1GFSA 3TCXB 1DXOA 1ND5A 1AH2A 3NV7A 2GKOA 4TL7A 1YMQA 5LYJB 4KNYA 2H2DA 4FLFA 1K9VF 5KPJA 3TZQA 3CG4A 5IT5A 2PT6A 1NXQA 3EC1A 2H17A 2MMGA 2R60A 3DV9A 2PZMA 3ZCTA 1SA0B 2G76A 3BE5A 3EE6A 4MLCA 5ESDA 5JJCA 4LE0A 4NECA 2JJMA 1E1RA 1UFOA 1V3VA 3ETEA 2F43B 2LE0A 3T1TA 2JD0A 3B1FA 4BDSA 4LPSA 2YN4A 5BN3A 2BM1A 2POQX 5FL7A 4TTRA 2OCGA 2BFPA 3MWGA 3VU0A 3LQ1A 1GTMA 3TL3A 3MLEA 2Q3LA 2IIVA 2Q41A 2WZDA 3U48A 2M1ZA 4TKMA 1ONNA 2GLXA 1M54A 2XWJI 3QQ5A 4RIHA 1IJKA 4ZOEA 4EJ6A 1FJXA 3RVJA 5EP3A 2X0IA 3CPEA 2HREA 3DDZX 3FI0A 1QQTA 4ADSG 1O9HA 3M82A 4PAQA 1XVTA 3COVA 3L4BC 4MR7B 1I13A 1LLFA 3K0FB 3KQYA 3KYDA 5FO1A 1XNQB 3OOSA 2P6OA 2NVUA 1QBGA 4FMDF 4U2GA 3UCEA 2XI4A 3ZDYB 5LPNA 4P0QB 2ECQA 3NLLA 3QF4B 5C7YA 3BWBA 2QEQA 3RFVA 1DX4A 2REQA 3EXHB 1GTG1 4JBWA 3PGMA 5TF4A 3WZ2A 4D4IA 4DC1A 4YPFA 4Y67A 4NHOA 2YL2A 1AGXA 1P9WA 1XEFA 1XZQA 2J3MA 4GI1A 4GHWA 1JDNA 4RCVA 2AKEA 1A9QA 1I0LA 4GZ5A 5DNVA 5EMHA 3RWBA 5JADA 2HU5A 4L8GA 5EJIA 4DRXA 5LOVF 3Q72A 5CYFA 5L53A 3WRWA 4L5BA 3IVAA 4L4YA 4N8DA 5IYZF 1GAXA 4F3NA 1DRUA 3PFCA 3R2JA 1SY7A 3HMQA 1V16B 2PX0A 1IB0A 3DEJA 1R5NA 3GMIA 4MITA 1L8QA 2ZSJA 1BDHA 1KFEB 2DFKB 2ZSEA 3FMVA 1LLQA 3A6HA 4LV8B 4G56A 1IUNA 4QICA 1BKYA 2B9EA 2NSDA 1R27A 1Y7IA 4YRTA 5DM1A 4B2YA 2UZ4A 1G8SA 1Z4QA 1LLDA 4Z0TA 5JVDF 3KVVA 5LYJA 3VH2A 2BSQA 2WU0A 4HMOA 3H11A 3KQHA 3AU8A 3CEAA 3UJ7A 3ZY6A 2ZUEA 3A11A 3UF0A 1I5RA 1H1LA 4Q3OA 3T3PB 2PGIA 2UAGA 3FSRA 4LSMA 2IPOA 3KQKA 5AJYA 4ZT6A 1JVSA 3LFHA 1I3LA 4P92A 1PFKA 1WEHA 1WW8A 2NXNA 4RMHA 2QT9A 4X8HA 1WY7A 1WXGA 3OY2A 3WNDA 1Y3CE 1T3LA 1R4ZA 2HMTA 3MM4A 4OXYA 3EULA 4YMSA 1U2GC 1C8KA 2EGUA 1HV8A 2AKYA 2YIMA 2H1CA 1AQUA 3EZFA 5FR1A 2NP6A 4FE7A 3FMIA 3HN6A 4DABA 2H1RA 3NHFA 2CXTA 5JS2A 4CQLB 1IIRA 1YB2A 1CP3A 5DTIA 4V02A 5B7GA 1LPSA 4EA7A 2B20A 1FRNA 1PYGA 4NQZA 3EZGA 1HX7A 1UMDB 1EZ4A 2RI6A 1Q0HA 3TDMA 4ER0A 4O1IA 5E9JA 4V0KA 5FPSA 2IPAB 3C97A 2FPLA 1PGOA 3OA0A 4O4JA 1P0QA 1QIDA 3BTOA 3CLTC 1L5ZA 2LDXA 5KNBD 4ENVA 3VSBA 2WFZA 1AF4A 2OORC 2EZ8A 4FKMA 4HDRB 1Z12A 4HLQB 4UHEA 1JZQA 4HPXB 4B3CA 4MQEA 2DOKA 3HZRA 5JFOA 1MVNA 1MA0A 3MA0A 4ID9A 4JXZA 3T94A 1Z74A 4KOAA 4OHMA 3SDSA 4JL6A 5JMWA 1SUIA 2K7ZA 3HVHA 3HP1A 4KFUA 4R3NA 5DXFA 1G3QA 3L92A 3A6FA 4RVGA 1QKKA 4WN9B 1DRKA 4UM5A 2CLIB 1X2EA 3K6JA 4JJAA 4IG4A 4PPQA 5CHYA 4W5TA 4E6EA 5IJWA 4OI2A 2PX2A 2V58A 2YYAA 2ZBGA 4CUZA 1ZD9A 2AL7A 2AR7A 2CWWA 2ZRFA 3DZIA 2W2MA 4AQYB 2O7QA 3I9V6 4JP2A 2GNPA 1YS2X 3S55A 1Q1QA 4A1FA 1DCKA 3DCNA 2QXTA 2YFYA 1PK9A 3RS0A 1PJLA 1QO7A 3GBVA 1II8B 4QBKA 1QDUA 4CBVA 1KJZA 3R7WA 2ZRHA 1HDOA 3KOOA 3CZAA 3I0MA 5D86A 5ARDA 1E1YA 2O4UX 3PQEA 4MI6A 1K9SA 2VNIA 4US0R 3D3JA 3UHJA 2YIJA 3HP7A 4KSCA 4Z2YA 3TTSA 2G4CA 1VZ2A 3FSJX 1HDXA 1HYBA 2DTXA 4HX5A 4AYTA 5CA0B 4MVJE 1KKMA 3PR3A 3CXUA 1D2EA 3EXIA 2JFXA 4IDPA 5A7FA 3EC2A 1U04A 3BRCA 2WP8J 2NXJA 3DE4X 1EAYA 2B5WA 3FBTA 3H9EO 3NBZC 2WA2A 2Q3JA 3SFVA 1ODTC 3KVYA 1NVAA 1KNQA 3EJWA 4GDMA 4P82A 2KE5A 4LG1A 1P1CA 4OB7A 4WVLA 3RFTA 4EG4A 1L9KA 3GLGA 2C9BA 4I1PA 1UXKA 1AQ6A 3TLAA 3JWPA 2IITA 2G07A 2XQVA 5T4EA 2PU5A 1I14A 1ZIYA 4CEHA 5JAPA 3PC2A 2GF2A 1V5GA 4QGGA 1OXUA 3GDFA 3FBGA 3PCTA 4LN1A 4OP2A 4WDRA 3VU3A 1BGVA 1EGVB 3BREA 3T9AA 4GKKB 1I5EA 1IXKA 1XEWY 1YVDA 3JR3A 4JB0A 5EXPA 4O25A 5I9MA 1KGDA 3UT6A 4YDHB 1NL3A 1GA1A 1K06A 1L0BA 4MQEB 4WLOA 4X44A 5COBA 3HWX1 3BRWD 1HFJA 2P78A 3NHSA 2GHIA 1XLTC 3HKEB 4XWYA 5CM2Z 3GP3A 1YZLA 1DHTA 1Z82A 5LNK1 3LF1A 2DT5A 1DV2A 4LZPA 4NOLA 4DLPA 1XEWX 3EVBA 4HSEA 1Q1AA 4U9IS 5I9NA 2BTEA 4YYEA 2R86A 4JQYA 2BFBA 4INZA 3LY5A 1YR3A 4BNVA 2AUMA 5JSHA 3AC0A 5KOJB 3R7SA 1IUPA 4U7FA 3IPLA 1WXXA 2MYUA 3SS9X 2O0LA 1EJBA 1ZK2A 4GR5A 1PSDA 3GDOA 1CUXA 2PJUA 5TJ9A 1IZZA 2G5TA 4C7MA 4C0JA 3EIFA 4XVRA 2HK9A 3TSOA 4QT4A 2AW5A 4H4EA 1J8YF 4ZGBA 2OV3A 4DMHA 3EWNA 1UINA 3CKMA 5I3ZA 2HA5A 1QH1A 4P53A 3IESA 5HRAA 5KSWB 3H8VA 3D3NA 1HOXA 3W2IA 5K9ZA 4G89A 2O7NA 2QV7A 2Y1OA 3AVQA 3L0OA 3QFFA 1EK2A 1J90A 3AF3A 4KRXA 5FKJA 3SJ7A 121PA 4LSZA 5JY6A 2HA0A 5KNCD 4DWWA 4NJMB 2OFOA 1CJKC 4JEHA 1N7GA 3C41J 1CFJA 2AK2A 2G72A 4I14A 4FX5A 4IIVA 1L3CA 3AI1A 1Y63A 4FUQA 4HHEA 1UM9B 2BMDA 1R0BA 4BXOB 4CM4A 2QM8A 2ZDGA 1YFKA 3UAXA 3N8DA 4NRDA 1WW3A 4UC0A 4D8YA 1JAIA 2CMFA 1KYVA