2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
1XB2A 2O0JA 3I8SA 3TUJC 2OV2A 3CX6A 4B76A 4XVQA 4FW9A 5CYOA 2JIZA 3UANA 2XTNA 1HTWA 3QKTA 3O8BA 4Z1MD 1P5ZB 1OLOA 3DHWC 2QEQA 3SQWA 2R65A 3SYLA 4D4LA 1G8YA 1MABA 4TTQA 1EFCA 3CNLA 2GZDA 4CIDA 1UDXA 3WRYC 1G7SA 4JMPA 1OKKD 4Q02A 1KK1A 3THOA 3KQNA 3W5IA 1E6CA 3I5YA 2OXRA 3ASZA 2VYFA 5KPDA 4RY2A 2ZEJA 1WA5A 2DFKB 1JAIA 5KSYA 4NYMQ 4MDEA 1N0VC 2C2HA 4UKDA 3P26A 4QM6A 1K6MA 4P0TA 2HXSA 4D82A 1VPLA 4PSKA 3ICQB 4FWTA 1NN0A 2HDNB 3OE7A 2GZHA 3GJ0A 4MYCA 3EIEA 4AKIA 5SZJA 5KSZA 2JJ1A 1VHLA 4EPWA 4W5WA 1HE1C 2FFAA 4MGIR 5IK2D 5JJLA 2C96A 3K9NA 3SU8A 3W6NA 3NHBA 3ZD7A 2O8BB 2JLSA 3ETLA 1N5KA 3LH5A 5C18A 4KFTA 2GRJA 3VKGA 5GJWC 2QMUA 3RRNA 3THWA 1GIAA 4C4PA 2V8OA 2IWHA 1EESA 2CMKA 3SDZA 4BFVA 4ZI3A 5CDFE 1NF3A 2CBZA 3CBQA 5B58C 1J90A 1NKTA 2NQ2C 1DAHA 3NC1C 4WBSA 4A6XA 1VIAA 2VPPA 1Z83A 4LJ9A 3PQCA 3EZ2A 3OF5A 4LV5B 1BIFA 5FL7A 4YXWD 3TSOA 4C3ZA 1P9NA 4HZUB 3EG5A 4ASUA 3DVLA 2WJYA 2HCJB 1AGRA 2O8FB 2IBMA 4B43A 3TK1A 3U44B 1BKDR 2E87A 1N6HA 1NLFA 4V0OA 3H1TA 1IHUA 2P67A 2X2FA 4IXNA 4A9AA 5DYGA 5JJIA 3Q9LA 1NIJA 1OYYA 1TTTA 1HQYE 3SQXA 2ZAOA 3T15A 4OQNA 1KNXA 3A4MA 4PZZA 3WBJA 3H4MA 1DO0A 4NPHA 4AKEA 4RD3A 1CJMA 3C7KA 3PUXA 1QHYA 4IXMA 3GLIA 2WMOB 1GKIA 3K70D 4DLYA 3TW4A 5A5GA 2ANCA 2FX3A 5DHAA 2ZR0A 3I62A 2OE2A 2CL7X 4NONA 2D3WA 2OM2A 3DKVA 2IS4A 3W90A 4KFSA 4ZO4A 1A2KC 2ORVA 3GLGB 1Z22A 2JA1A 2FZLA 4POAA 2PT5A 1WB9A 1WCV1 3TQCA 2KI5A 4WVFA 3GFOA 1X8JA 2HCBA 1A5TA 3V00A 1OE0A 4I1SA 3KFVA 1N6OA 4OKSA 2ZSBA 3NVAA 5AUPB 1Q0UA 3QVUA 2GHIA 1RE0A 2QP3A 2KWIA 3D3QA 1AA9A 4B48A 4UNRA 2VP0A 4KBFA 1GG2A 4A15A 1JQLB 5J4KA 3WP1B 1BMFA 2OO7A 1E79D 3DDCA 3KKPA 3NKVA 3AF3A 1UKEA 2WIBA 5BYKA 5EE9A 1E2IA 1TNDA 1FMJA 3NIBA 1CRPA 1ESNA 2O5VA 3AP1A 3RRZA 2ZRBA 2Q9AA 4II7A 5AJVB 5IK2A 1RC8A 2NO1A 1LS6A 4DKXA 5J4YA 5HCNA 1KO4A 4LJ5A 2QZ4A 2A78A 1HYQA 2QAJA 4MRPA 4PHFA 4B71A 2WBLC 4XD7D 3ZYCA 2HT6A 4EUNA 1RRCA 2V1UA 721PA 3P4YA 1I4LD 1XTQA 4KI0A 2HYDA 1M7BA 4D0LB 1W0JA 1HT1E 2IC5A 3ZVMA 3A58B 4IRUB 3TNFA 3TSWA 3U3RA 3VR1A 1FZQA 3AGPA 2ORWA 3SC3A 5BWMA 4YXWA 1Z08A 2QA5A 4S35A 4JKIA 3U6BA 4DLRA 1VYUA 2QN6A 3KJIA 3KJEA 4OK6A 1CJVC 2AD1A 4CGZA 3A37A 4OI1A 4P4TA 1SXJD 1VTKA 4ZDIA 4LCBA 1OXUA 3LBHA 2IYLD 4JJKA 4R71A 4NH0A 1OIXA 4OQMA 1IY0A 3R20A 2QP9X 8OHMA 4NBSA 1E2JA 1F2UB 4CEIB 3R9IA 5SZIA 2ZUCA 1UBFA 4A2WA 3FWYA 2ODBA 5K8UA 1COWD 3ADDA 1JXOA 4RVCA 1XD8A 4NYJQ 2ZIAA 4JBXA 1PV4A 3G0HA 1XEXB 4DLTA 2N1BA 1HUQA 2JCSA 4CF7A 2GK6A 3UIEA 5C46F 3I73A 4ESVA 2HLDD 1JI0A 2V6IA 2C04A 4QGGA 4DB2A 1UKYA 4A4DA 4TLCA 1W1WA 4RD6A 5M04A 3ZJYA 1DPFA 4BLOA 1HH4A 3CH4B 1Q44A 3ZH9B 4PPQA 5FH9A 2O8CB 4P32A 4EJSC 5J4HA 3GLFA 2W2TA 4OK3A 1XEWY 1CR1A 3MLEA 2FZ4A 4BPBA 4YMTA 1II8A 4HDQB 3UMSA 1Y3AA 2XNDD 1UFQA 4G0NA 1ZP6A 1NMXA 2B92A 2ODEA 3VHXA 2DHRA 3ZZ0A 4FD2A 1WP9A 1OF1A 2YC2C 4DCUA 2OBLA 1XPUA 2AX4A 2BMJA 2JATA 5JWHA 1E79A 4MUAA 3BFVA 3FMPB 3LV8A 4AKGA 3RS2A 2WM9B 1S96A 1RJ9A 3B1VA 1GM5A 1SQ5A 2FF7A 3PUYA 4HLCA 1ZUIA 5L8VA 2IF0A 2F9LA 2P6RA 2VLIA 4NE2A 1CIPA 4QFMA 3TJZA 2I1VB 1U9IA 3ADBA 3VTKA 1P3JA 2NZ8A 3K53A 5FTNA 1AQUA 1KJZA 4EFNA 4EJSB 1MO4A 3M4YA 1DVRA 3LQRA 2R6AA 2XGJA 2RGGA 1RYFA 2J0VA 5B64A 4A0GA 2A7QA 5FTLA 1N5LA 4DCVA 1KI9A 5FPHA 2BBWA 2V55B 4HLUA 1X1RA 3SBDA 3L2OB 1E1QD 3TR5A 5E7IA 4BLQA 2KJQA 3AVXA 4ZCLA 2OLKA 2AK2A 5K8IA 4R9UC 4D4KA 3LNCA 3UMFA 3IQXA 2ERYA 1VCOA 1HT2E 1Z6AA 4V03A 4IOLA 3THXB 1OIVA 3T5DA 1XCGB 4TMVA 2VP4A 3GLHE 4IFBA 3G5UA 3Q3JB 2R9VA 1NVVQ 2GNOA 1SXJA 2AK3A 2Q6TA 2C03A 3TUZC 4RKEA 4TLBA 3ZGXA 4Q9IA 1WE2A 1OV4A 1ZRHA 3F8TA 2BC9A 1EWQA 2R6DA 2ZREA 4DIDA 2QROA 1XMJA 2YV5A 1KIMA 4MRVA 4XTRA 3A1SA 1OXXK 3PG5A 3W8RA 4DDVA 1IAQA 4Z54A 3O8RA 4Q9HA 3ZZUA 4QM7A 4CEJA 3PJRA 4FMBB 1V5WA 4GSYA 1COWA 4RJLA 2EYQA 1WBDA 4MUBA 1VCNA 2L0XA 5KTYA 4LV8B 5CIWA 1ESMA 4AIIA 4HB3A 3AB3A 3ZS9A 3ZVLA 1R0WA 2J0UB 2ZI5A 3OHMA 4QHSA 5SZKB 1NBMD 4IDNA 5IHPA 4B2LA 4DLWA 1GL7A 4HZIA 1CU1A 1XMSA 1FX0B 3CRRA 3CNNA 4M21A 4ZI2A 4H9GA 2HLDA 4LPKA 2FDCA 4XWOA 4A0FA 1GOTA 3KTAA 3T1QA 1F48A 2OFWA 4JLNA 1TU3A 5LD2C 1W5TA 1G16A 1KI1A 4MKFA 3W5JA 1UKZA 3MRSA 4URYR 3TW8B 2WV9A 4IVQA 2EYUA 1W47A 1D2MA 1LY1A 5J4LA 4CEHB 2WPDD 4AYWA 2G3YA 1C1YA 1NSTA 3CF0A 3KQHA 4DC9A 5FR1A 1L4YA 4ESHA 2XNDA 4Q5IA 3GLIE 2RGNA 3N5CA 1U8YA 3GEEA 5TB5A 1R5BA 2J1LA 2W58A 3NHAA 5CK4A 2QUZA 1YZTA 2NZJA 2ZRDA 3C5HA 4Y0AA 4C0SA 1G8GA 2ZS7A 3FHTA 1ETUA 2VTKA 3QPVA 1UEIA 2HXYA 2REBA 2W6JD 2XNSA 1AS3A 3PFIA 3EA5A 4HDCA 2O8EB 2ZYVX 2PL3A 2UZ3A 1ZD9A 4N0EA 1S4QA 2NOAA 1KDOA 2QPAA 3MWJA 5LD2B 3JZMA 1MT0A 3PEUA 3PEVA 4E22A 2R6FA 1E9DA 1Z28A 3DO6A 1UF9A 3AF2A 2ZE5A 1IXRC 1M7GA 2H92A 4PSVA 3PV0A 2AN9A 2YOGA 3BORA 1XZPA 2C78A 1XTIA 4ABYA 1G17A 1TQ6A 2A5DA 5DH9A 3B82A 1DAFA 4JBWA 3EW9A 2JAQA 5FOSA 3K0CC 2ZSAA 1A1VA 3FB4A 5F98A 1CR4A 1G1MA 3K09A 4GRAA 421PA 1UM8A 2YVUA 1E1QA 1Z07A 4TT3D 4XJXA 1KK0A 2NPFA 1IN6A 5UKDA 4BUJA 1TU4A 4WA7A 1TPZA 3QUSA 2ZSFA 5FOXA 3S1AB 2GF0A 4LJAA 3RLFA 1TUEA 5KDDA 4BZQA 1DOAA 4M9XA 4FXPA 3DMNA 4J0QA 2RGDA 4M9QA 2OCAA 3QXXA 821PA 521PA 4NCNA 3VR2A 1JR6A 1QZXA 1YRBA 1ZC3A 5KDOA 5B2ZA 1E99A 2QPTA 3WMFA 3NG1A 3DM9B 4Q4JB 5AJZA 1KO5A 3VU9B 3WXMA 4LBVA 3K9LA 3V4FA 3WY9A 4L9WA 3QKSA 2X2EA 1SVMA 2XOKD 3P32A 3U3JA 3GPLA 3CO5A 3B9PA 2OUKA 1Z6YA 2SHKA 4L16A 1G18A 2RB4A 3A1UA 2WKPA 1KI7A 1J8MF 4Y0VA 5FUXA 2JJ2D 3AKDA 3PUVA 2A5JA 3DEFA 4QOSA 2GWHA 2ZYWX 4K8OA 2WJIA 1JJ7A 1R8QA 1W44A 1EXMA 3CRW1 5EXPA 5AJWA 4HAZA 3VKHA 2J7PD 1W5SA 3GJ7A 4IHQA 2IUTA 2QPOA 2N42A 1RFLA 2F43A 4KCGA 5JS7A 3SJCA 2FH5B 4R2HA 4JKYA 4DLUA 1IXSB 1XTRA 5DI3A 3GCGA 2IYRA 2WVJA 4M1KA 1T0JB 4OYHA 5BYJA 4B6FA 1L7VC 1UBCA 2DFNA 4R7ZA 5K8TA 3D7MA 2LKDA 2WPDA 1EX7A 1VCMA 1P2TA 4PQRA 3QBTA 4DCSA 3CWQA 1T3SA 5DN6D 2ZUDA 2Q3MA 4HB0A 1P2UA 4RFVA 5TV2A 1R0ZA 5B57C 1W7AA 2AHOA 3TMKA 3BB4A 3TKLA 3EASA 5JS8A 2ZS8A 4M9SA 5IDVA 3K9GA 4IVRA 5HE9A 3OIWA 3HYRA 2AWOA 3IILA 3QEOA 3X2SA 3GQBA 1ZAKA 5J5CA 2OG2A 3M0EA 2JIZD 3KDSE 3KKQA 4MGZR 1A82A 2VF8A 1VG0B 1W4BA 4HAUA 4ZPXA 3IIMA 1SZPA 4LYAA 3QXJA 4NCHA 4RFSA 2FU5C 4RZ2A 1OH6A 4LGMA 1RRGA 2XZPA 5EUMA 4ZKEA 3FOZA 3H0KA 2ZITA 4KO8A 1G3RA 2F3RA 4BASA 2NTYC 2IYWA 1EFUA 1OFHA 2PJRA 2PZEA 1QHGA 1UPTA 3L8ZA 3B7GA 1E96A 3BH6A 4TT3A 1CTQA 2WHXA 5KO2A 1YZUA 2ZJ5A 2F3TA 3KL4A 4I4LA 4LYJA 2O52A 2Z5FA 4PFSA 2YKGA 5EXXA 1U90A 4BFWA 1P2SA 2WWHA 1U94A 2WSSD 1KO8A 4Q48A 1G3UA 3W6PA 1WF3A 4US1R 3GJXC 3BOSA 1M2OB 4URWR 5FOVA 1ZVQA 1QBKC 2MSCB 4ARZB 2OZEA 4LC1A 2CJWB 4F93B 3FFBA 1RVDA 1ZUNB 2GK7A 5JCZA 5FUYA 2XOKA 1E2NA 4GFDA 2ONJA 1MKYA 2HYIC 3EPJA 4DEXA 4V0KA 4Q1FA 3OFNA 3BS4A 3KKOA 1T8UA 2EWVA 1QF9A 2HJGA 2ORIA 2JJ2A 1OFTA 1XD2B 4E09A 4GMDA 221PA 1KI6B 1Q20A 2OCYC 2Q0HA 3B9QA 4C0LA 2AL7A 4UNPA 1S8FA 3KB2A 3P4XA 3VNUA 2WJVA 4XOIA 3THYB 1GFIA 5FL7D 1SXJE 3MMPA 5KU1A 1XWIA 2DFLA 2P3SA 2VQSA 2QG6A 5FPTA 2FSIA 2V4ZA 2Z4RA 1MO6A 1ELOA 1W4RA 5F2EA 4ILEA 3UG6A 3KQUA 2I1QA 1G8FA 3KB1A 2GBLA 4AI6A 1M6NA 3U60B 3E5HA 1T3HA 1U81A 3FGNA 1WQ1R 2GESA 1E3MA 4GI7A 4PAMA 2I4IA 3U7EB 2HEIA 2YINC 2W0MA 1FQJA 1GRRA 2RGCA 3CPHA 4IOMA 4B3XA 3EAQA 2PZGA 2PZFA 1Z06A 3HYTA 3F5FA 5DHFA 4DLSA 3BC1A 4PQFA 2YWEA 4I81A 2JLVA 4FCVA 2CHGA 2D7CA 4TMZA 2YWGA 1D8TA 2ZJZA 3GJ6A 2BVNA 2J87A 1Z6XA 2RAPA 4EQ6A 5KNBA 1GTVA 5FPKA 1Q57A 1GUAA 2VH5R 3U3OA 3LWNA 1FMLA 2F1RA 5H70A 1P61B 5KOYA 1T8TA 2GXSA 3EC2A 3HU3A 4XIGS 5E95A 3SNHA 1KHTA 2A30A 2C98A 1NY6A 4B74A 4GPTA 2ZJ2A 2O8FA 4N1AA 1FQKA 5EE5B 1XTKA 4IEIA 3FKSD 3GMTA 3QI2A 3LA6A 4TLAA 1DG3A 2F6RA 3K0AB 1CS4C 4RD4A 1T0HB 2QP4A 3AVQA 5L3SA 4RKFA 2W6IA 2BM0A 2ZRFA 1Q12A 3C41J 3IO5A 5KHOC 1IJEA 2GJ9A 2YHSA 2JJ8A 5KUTA 2EVWX 1BMFD 2JDIA 2Q3HA 4LJ6A 4E5UA 2WSSA 5JI3E 3U4QB 3L82B 5KSPA 4MGKR 5IT5A 2VHUA 2Z4SA 3B1ZA 3I5XA 4DIEA 3RWOA 4LYFA 1KSGA 4FIDA 4URXR 4TL8A 3U3KA 3FDIA 1U98A 4OQFA 2B21A 4M1YA 5DE3A 4D0GA 3LQQA 4F92B 1OIWA 4M8NE 1J8YF 4HAYA 2ZJYA 4Q1CA 3C16C 3ZIAD 1O87A 2FSHA 2NG1A 3CR8A 3KJGA 2WWXA 1W0JD 4LZZA 1UDWA 5FPSA 1E9BA 4C0KA 4DEYA 4TYYA 2VP2A 5FUVA 4DJTA 3UXMA 3CRMA 4LOAA 4Q4AA 2ZRIA 5C2JB 4ZCMA 4M22A 4RZ3A 1DAMA 3SYKA 3W6OA 4DVGA 1GL9B 1KYIA 2DWOA 1ZU4A 1G19A 2KSQA 3T1VA 4CDGA 2WWIA 4A0RA 5KSOA 1UEJA 3FHCB 3CONA 3LXRA 4Q9KA 4LJ4A 3T06B 1XPOA 2JLRA 2GVDC 4A1FA 3PENA 3HU1A 1F2TB 2QGZA 2VHQA 3MJRA 3Q85A 1IJFA 4K46A 5JWOA 5P21A 1DTSA 3VR4A 1DARA 1SKQA 1YU9A 2XZOA 2WWWA 5FTJA 2VIIA 3TE6A 3WRXC 1E9CA 1R0YA 4JIMA 4QGFA 1HEIA 4BGDA 4G3XA 5JCPA 3T35A 2H7VA 3AF4A 1V43A 3SJAA 1NBME 2V9PA 2GJ8A 1KDRA 1E2MA 3BFXA 1MABB 1JNYA 3ADCA 4HB2A 5A0FA 2X1VA 1KK2A 1XJCA 1ZCBA 1KO1A 4TL7A 3EZFA 2N46A 3NH9A 2NMVA 1GRNA 1W4AA 5GJCA 5CYPA 4DSNA 1VG8A 1UBGA 2OCBA 5FPYA 1FTNA 1DAIA 4S2EA 2ZTSA 4V0ME 4QBHA 2CCGA 1YR6A 1Z0IA 2G77B 2ZJ8A 2BV3A 5K8LA 1XPRA 1Q3TA 2A2ZA 2WKQA 3H84A 3OAAD 1E2LA 2VO1A 3FKSA 4PO8A 2FGKA 1BYUA 3RC8A 2IYUA 3I92A 4RD2A 1PUIA 1DAEA 2J45A 3KXLA 2AFHE 1GL6A 1P4SA 3LX8A 2WWGA 4U02A 4GOJA 4TL6A 1X1SA 2Z43A 3UPUA 2CCJA 4XWKA 4ACAA 1IY2A 3N70A 1F2UA 4KYIB 4DCTA 1QHHA 1TAGA 3GLHB 4CEIA 4DDTA 3NBFA 4NKRA 4MYTA 3W34A 4XVRA 1K5DA 3IIKA 5H8WA 3V9PA 4KLZA 4URUR 4A8JA 5JSZA 4GT1A 3U5ZB 3A1TA 3CX7A 4NP6A 1I2MA 3THWB 3R8FA 4NYMR 4JLVA 4CRWB 1XU4A 4TYWA 3I32A 1R7RA 2R44A 2QORA 2BCGY 4IDOA 4NCKA 1XJQA 4B3BA 1T9HA 2FEMA 5DLQC 2ZJBA 4PHGA 1QHXA 3MAAC 2QQ0A 2IEYA 4LK2A 2WOOA 1D2NA 4QBIA 1KTVA 4HI0E 4HLDA 4PX9A 1SVOA 5JEDA 3P20A 1FTSA 1OXVA 4W5JA 3ZIAA 3QG1A 1A7JA 3QIAA 1OPXA 2A3RA 2IXGA 2ZJAA 2RGAA 2IUSA 4MA4A 2EW1A 1NG1A 4HSEA 4TQUS 5HE8A 2ZROA 2Z0MA 5DIFA 2CEAA 1W36D 5CB6A 5BN4A 1JQJC 2WZQA 1Z63A 1Z3IX 1JR3D 4UJ3A 1UADA 2P6NA 5AUNB 1TUIA 1NMYA 4B2IA 3U7GA 3KUCA 4QBFA 1QG4A 5C4GB 1ZIOA 4IVPA 4W5HA 2GAOA 3GLIB 3TBKA 3B1WA 3GEIA 1DO2A 1TX4B 4JLJA 2WJGA 3M6AA 1KY3A 1US8A 3C15C 4NYIQ 4QNRA 4PR0A 2IXEA 2XX3A 1HY3A 4KAXA 4EJSA 2GA8A 1YZLA 3DZDA 2JLWA 4KHZA 4AYTA 3IPXA 5SZHB 4JLOA 2REXB 1GSIA 1H8HA 4ZDKA 2OCPA 5DYIA 1ZJ6A 621PA 1G3QA 4IKEA 1MV5A 1NJGA 1IONA 3B85A 2G9NA 4NCJA 1Z0AA 4RZXA 2QTFA 4AK9A 2B7BA 4GP6A 1YJ5A 2OHFA 4FINA 4TWZA 1AGPA 1H8ED 2HUPA 1ZNYA 1OFIA 2IS1A 3CWZA 1Q1QA 1I4DD 4M4SA 2HF9A 2ZR7A 3CB4A 4C2TA 4UNSA 4I1OA 1XMVA 3EZ7A 5TXGA 5TVKA 2HF8A 4O2LA 4O2RA 3OAAA 4Q4HA 1E2HA 4I1UA 2Z83A 2PEYA 3CF2A 5E7JA 3C5CA 1KKMA 1TF7A 2J41A 4OJQA 1Q22A 3AVOA 1KSJA 1Z47A 3N2IA 4LHYA 4P4UA 1G7RA 4RCZA 3SJZA 4C0AC 1XX6A 2A5FA 2LWIA 3GJ3A 3A36A 1KAOA 4EAQA 4U00A 5E7MA 3T61A 3OEED 1G5TA 1NRJB 1K5GA 5FR2A 4F4IA 3V4RA 1SHKA 1B0UA 3B13B 3NWJA 1Q1ZA 3RYTC 3UG7A 1W4CA 2MMCA 2QSYA 1KMHA 4TMKA 1S3GA 3SFVA 2OT3B 2IYZA 3OESA 1UKVY 3AKEA 3EX7C 2RH5A 2QE7D 1U99A 4OHVA 3AF1A 3EWAA 1U8ZA 3FE2A 5JEEA 1E0SA 2IW3A 4BFXA 1SVSA 1E1RD 2X8AA 1P7CA 2ZR9A 4P31A 4QGHA 3QG5A 1OT3A 4NCIA 1X8LA 1N25A 1GNRA 3WHLA 5HZHA 3K70C 3MG9A 4CYMA 2XB4A 4KSCA 2ZYTX 5EE1A 5FTMA 1ZIPA 3ZQJA 4XH9B 5B30A 1ZNZA 3AVTA 5FBVB 1W49A 2RMKA 2FN4A 2V54A 3OEHD 4LHZA 4P3YA 3BAFA 4M2LA 2ZRMA 4LJ8A 2BMDA 2J0SA 2OESA 2OXCA 3AUXA 5EP2A 5G53C 5JJKA 1LNZA 2QMHA 4MITA 2QNRA 4HEJA 1EFRD 4WZ6A 1IOZA 1XXHA 1JR3A 1LS1A 2MSEB 4RCYA 3NH6A 1E69A 2YWHA 3LDAA 1R4AA 4BWYA 3BH7A 4BEBA 2GCOA 4GBMA 2EFGA 4NZYA 3AV0B 4KVAA 5FUWA 2C8VA 3WNCA 1KZ7B 2XXAA 2QMEA 3K70B 1OFUX 4ON9A 1FW6A 2BBSA 4PPNA 4ZDWA 2BHRA 2NO7A 3QKRA 1S3SA 1MH1A 4QRHA 5CJPA 3VMFA 4D25A 4YDSA 3QPWA 3LAWA 4JYBA 3LBNA 4YC7A 2CE7A 4QHTA 4WZAE 5JECA 4OI0A 3FMFA 2KBEA 1BOFA 1G4AE 2IHYA 4URVR 2GVZC 4UNNA 3RS7A 1U9IC 1P60A 1N6LA 4OQXA 3ECCA 4OHZA 5EZ6B 3HWSA 2YWFA 4MKIA 3L8YA 5CLLA 1QHIA 4PPFA 4Q7MB 4PC7A 3PCRB 5G41A 1H8EA 4PO1A 4NYJR 4JL6A 1M34E 2XITA 2WWFA 3KQKA 1OSNA 2BEJA 1L8QA 1NVXQ 4D4MA 3QF4A 1N0UA 5FOWA 2P2LA 1G41A 2F9MA 3MWLA 3AVWA 2R6CA 1GZSA 3DMDA 1E9RA 4MKHA 3X1DA 5FL3A 4JYCA 1CP2A 4BECA 2IWRA 2QM8A 1D6JA 3K0CA 3OEEA 2ZSEA 1QRAA 5DNYB 4AY2A 5FFMA 3FHOA 4FMCF 1SXJC 1D9ZA 5ANRB 4V0LA 1IY1A 2H5EA 1YR9A 3C14C 1EK0A 4QJ3A 2QL6A 4L5BA 2PCLA 2ZRCA 1LB1B 2G1JA 2GEUA 3B6EA 4UJ5A 2MSDB 2QE7A 1CXZA 4DCNA 5GJVC 1G3IA 1CULC 1IBRA 1T4GA 2CK3D 1E1RA 4AG6A 4L4UA 1AM4D 3BRWD 1TF5A 4TLEA 3L0OA 2ZRAA 1W36B 4KVGA 4DLZA 1KSHA 5EE3A 4P4SB 4PQYA 2CLCX 3R8CA 4B47A 5AWFC 4GOXA 3OEHA 1QVAA 1GITA 1QDEA 2DPXA 3A1WA 1EX6A 2JLYA 1DBSA 1SXJB 4PZLA 1G7TA 4OK5A 4X8OA 2ZM5A 1KGDA 2BEKA 1EFRA 1SKYE 2PH1A 1SHZA 3RNLA 4DT1B 5HKKD 3Q5EA 2IF2A 3CR7A 3LLUA 2JASA 1HA3A 3NDPA 2WTUA 2ZE8A 1GAJA 4PHTA 2OBNA 5JI2E 1PLKA 4BQSA 5IF9A 4H1VA 1WBBA 2F1HA 1II0A 4JT4A 2QAGA 4PANA 5G3YA 4ZV4A 3U2QA 3WP0A 1J7KA 2RGNC 4CVNA 1JPNA 4OHWA 4U5XA 1PLLA 5C4MA 4IDPA 1S9HA 2VSOA 1Z0JA 1KAGA 3A4NA 2XJ4A 3MCAA 3FTQA 1NI3A 3ASYA 3RAPR 4DXAA 3KQLA 3AEZA 2F55A 3DL0A 4NTZA 4NL4H 3P27A 5CDFA 2H1LA 1LV7A 3KTAB 3Q8XB 3OFND 2D2FA 3K0FA 2PLFA 2PX0A 4A36A 4BFYA 3IUYA 3KFXA 3MWKA 1N5IA 2GILA 1LTQA 3T5GA 3AUYA 3VHLB 3N2EA 2YNMA 4MKGA 4WOPA 1E0JA 3L0PA 3F3YA 2IS2A 5JFGA 3I61A 1DG1G 1ANKA 3K09C 2C9OA 1E4VA 4DLVA 4IDQA 4Q7LA 4DUGD 3U7FB 4WIAA 1VMAA 4Q18A 3ADKA 2YOFA 1KO7A 1KDTA 3PUWA 4UNQA 3Q5DA 1QHSA 2X77A 4ARZA 1ZYUA 1N6RA 1VDZA 3PVSA 3QENA 4N3NA 1NJFA 1JB1A 4TYNA 1JEEA 1Z0KA 3SZRA 1KI3A 1X6VA 3IEVA 2DWPA 3B1YA 1CEEA 2GCPA 2EFEB 2QTHA 1F5NA 3LO5A 1NLZA 1DS6A 2QRZA 1G6HA 1CJTC 2AD5A 3X1WA 3SHWA 2Q9BA 2FSGA 5FBWB 2P6UA 4LHWA 4ZIRA 1XD2A 2ZANA 2DWQA 2P65A 3K1JA 5D3MA 4W7SA 3RS5A 1WXQA 4NMMA 4PC1A 1E9FA 4Q7KA 4HYYA 2J3EA 3BJIC 5KPJA 3AH8A 3THYA 1MO3A 2QBYA 1TMKA 2CK3A 3HPRA 2ZU0C 4US0R 5EUQB 3R7WA 3TSZA 4D6PA 4EFLA 3GLFE 3B78A 5L3QA 3I1FA 4LX0A 1R0XA 4Q1EA 2ONKA 3IO3A 1A2BA 1OW3B 2CL6X 2W0SA 1YHNA 1E9SA 4CW7A 4JSYA 4DBLC 2ZRKA 3QXHA 4TSFA 1W46A 4XVUA 4HDOB 3HPQA 4B34A 4C0QC 4JLAA 1AKYA 4EPRA 3PITA 2WMNB 2BCJQ 3C4JA 5L3VA 4MH0R 3QY0A 2BBOA 2RHMA 5KDLA 2VHCA 2W6ID 2J9RA 3C8UA 4O0MA 4TMTA 4M1WA 1AZSC 2NPIA 4JVSB 4FCTA 2AXPA 3D8BA 5HKKA 5LPNA 3QF7A 2QENA 1E0KA 3QKSB 3L0SA 4TL9A 2JDID 3QXCA 3AVVA 1T3LA 3A6PC 4G01B 3EA0A 3NC0C 1XF9A 3TVTA 2OSBA 3AGQA 2IYXA 2QQEA 2FPMA 3GFTA 3EXAA 2GJSA 1G9XA 1G8PA 1UBEA 1ZU5A 1CKEA 4G5OA 2IHBA 2OLJA 4FMCB 5AR1A 3ICEA 3IPYA 3WNDA 5GADl 1X8KA 2CE2X 3QNUA 5EP1A 3WYGA 4GDFA 2KE5A 4B2PA 2UKDA 4HUQB 2ATVA 4RZUA 2O8DB 1PUJA 4F38A 1E9AA 1RZ3A 4TMWA 1Q3HA 2PJZA 3LW7A 1ZM9A 3K0AA 4LHXA 5DI3B 1XXHE 1JR3E 4QKQA 2QY9A 3PR1A 1N6KA 2DY1A 3CPEA 3SR0A 1ZNXA 3LX5A 1YZGA 2JLUA 3RSLA 2IS6A 2C77A 5D3QA 3UKDA 1BYIA 4I1VA 3J81k 5JHHB 2FJUA 2OEPA 1Z0FA 2VF7A 3A8TA 3IGFA 4B3FX 2P0EA 4Q00A 4KSBA 4FN5A 1LFDB 5HTKA 1EWRA 1LF5A 2R8RA 1AK2A 2ZETA 4BFUA 4DUGA 2GDJA 1AS2A 4DSTA 3ND9A 4EPXA 4Z51A 2C9YA 4A6PA 3U4QA 3QOFA 2AFIE 4LUCA 3MWYW 1S1MA 4L9SA 3QPUA 2CDNA 2YYZA 3NEJA 1EG7A 2FEOA 4GL2A 2NGRA 2EFHB 1KNQA 4B6EA 1NN3A 4JLMA 3TAUA 2O8BA 1IXZA 1E2PA 5EXTA 4G5RA 3HU2A 5FOUA 2V7QA 1F3OA 1GILA 1PJRA 4GZMA 2ASEA 4M9ZA 1PZNA 4WW0A 4JL5A 2HT1A 1Z8FA 3SOPA 1W2GA 2ERXA 3CUEF 3FPAA 1Q1BA 2FFHA 1WDTA 2H8KA 2VSXA 4FCWA 5EE0A 5EP3A 5LDDC 1SGWA 2LKCA 2OAQ1 5HR5A 2ZVQX 3BD9A 1AJEA 4L8GA 3M1IA 1FP6A 4KBGA 2PMKA 4HZUA 5DISB 4JSTA 3SJBA 1VG9B 4QGAA 3UMRA 3GJ4A 3BERA 1P73A 4Q01A 4A0HA 5DO9A 4QJ4A 3U44A 3T12A 2UZIR 5F3WB 2BBTA 3EPHA 3ZQ6A 3WBKA 4M1SA 1NMZA 1F2TA 3TIFA 3RDPA 1U0JA 4RD1A 1GDDA 4OQLA 3CLVA 3REFA 1I2DA 3B1XA 4QBGB 2CLSA 4KITB 3T1OA 2P5TB 2CNWD 2H18A 4JL8A 4ZCIA 1XEFA 4B32A 5GVSA 1FOEB 6Q21A 1E2EA 2ZI6A 2GBLC 3PIRA 3MUFA 1MRNA 3LLMA 3VR5A 4GZLA 3OZXA 3Q7PA 5TMPA 2QGNA 4A2QA 4M0LA 2C95A 4D2IA 4LYHA 3K0SA 4K81B 5HCIA 2AKAB 1YZNA 3R9WA 3FMOB 1N6IA 4B3DA 3FYHA 2D06A 1ZM4A 4GP7A 3GLGA 4LJ7A 1Z6TA 3PEWA 3I72A 4BLSA 5HPYB 4YMWA 2IX3A 3CPJB 3ZZTA 4M1TA 2ZRNA 2VL7A 4PZYA 4MYUA 1U2RA 2QRNA 3IIJA 1ZC4A 121PA 4DDWA 2DYKA 1P75A 2OBMA 4TZ6A 4XWAA 2BKEA 2IYTA 3REGA 3VX4A 3WMGA 2GZAA 4C7OB 1X86B 1XEWX 3GLHA 1LVGA 3QQ5A 4B3CA 4OJKA 3MJHA 4WAUA 4O25A 2ZYUX 4EIWA 5F9HA 1ZMXA 4HUTA 1W0KA 1JJVA 1G3MA 2WOJA 1I4TD 3BIFA 5LB2A 3ZVRA 2W2VA 2V1XA 3AVUA 2RHDA 4URZR 5FBRB 2QTVB 4EQ6B 3E70C 3AKYA 1GP2A 5A4JA 3ZLJA 1Z2AA 2K5UA 2FV8A 4OI4A 1CRQA 1KMQA 4DHEA 4LHVA 5TY0A 4KODA 4OBEA 3HJNA 2UVQA 1ZM3A 4GNKA 1F60A 1H8HD 1AN0A 1RYHA 4H1UA 1EFHA 5CM8B 1OH8A 4D80A 3A4LA 1KY2A 2FPLA 2G1KA 5FI1B 4ZKDA 1G64A 1MR3F 2VP6A 3TLXA 1S0UA 2CHQA 2WAYA 1XMIA 4A92A 5HZKA 1KZGB 3IHLA 5EP4A 3UK6A 4BFSA 2IEZA 3WMEA 1Q1EA 1P72A 3ND8A 1P6XA 3RABA 5L3SB 4LV6A 1PVOA 3HR7A 3LVRE 1G5PA 1G20E 2B6HA 1NSFA 5FBLB 2GAAA 4AKHA 4V02A 1FUKA 2BJVA 1ZUHA 2GJKA 2C9CA 5CM9C 1NVWQ 2IXFA 2D2EA 2ZAMA 2OFOA 5FI0B 2NO6A 4KLNA 2IYQA 3DPUA 2CNWA 2ZQ5A 3QKUA 3BWDD 2XZLA 4Z1MA 3BB1A 5JZVA 1TQDA 4KV9A 4KFUA 1KSFX 1GRQA 1E2DA 3QBVA 1MRSA 3K8YA 4PSAA 1VECA 4C0BA 1O3YA 3W9YA 1OKKA 2X19A 3BK7A 1XEXA 2XB2A 3CX8A 2GKSA 2XEXA 4EDHA 2VHJA 2V6JA 1ZCAA 1E9EA 3AQ4A 4F7WA 4Q21A 4Q1DA 3SHFA 3IBYA 4C2UA 2ZI3A 2IK8A 2WJJA 4Q4AB 3RSOA 2BIFA 2ZS9A 4AG5A 2GXQA 2O8CA 4WXPA 5TARA 3DM5A 4N0DA 4QXAA 1YR7A 5J40A 4HAVA 4LY6A 1N6PA 1YVDA 2MMGA 2ANBA 4LBZA 3RHFA 2B7CA 4LBYA 2ZXUA 4TTRA 2D4HA 3VAAA 5FTKA 2NO0A 3TUIC 2CHVA 4ACBA 1JAHA 1XNJA 1G5RA 4E03A 1NN5A 2J0QA 1K8RA 1XZQA 2GXUA 3KXKA 3MGCA 1G8HA 3FMIA 4JVLA 4A82A 4EKDA 4YMVA 3O8CA 4UQOA 1T91A 4IW3B 3GJ5A 4IEEA 3TVDA 4ZDJA 1D2EA 3IEUA 2FE4A 1KJWA 2H16A 1L2TA 3BH0A 3VKWA 1IQPA 4JLBA 1ZD1A 1YZKA 2WKRA 2WSMA 3KUDA 2ZSDA 5FOTA 2ZE7A 4EFMA 5CITA 1KK3A 3BGWA 2Y8EA 4TTPA 2J46A 3G82C 3VFDA 3U7HB 4D4JA 4Q47A 1FUUA 1M7HA 1P2VA 3AKCA 4HAXA 2XTZA 4A8JC 4WXRA 4YQFA 1C9KA 4Z8YA 1FFHA 4HATA 3VNVA 2RGBA 4P33A 3LW8A 3KXIA 3B60A 1OXSC 4EPVA 4PC2A 5JRJA 1DAGA 4Q66C 3X1ZA 2GEDA 4AURA 4PPGA 4CT5A 4R98A 4TLDA 1G21E 1ODFA 4UXIA 3QXSA 2JEOA 3AF0A 3W3ZB 1XD9A 2PEZA 4AWXA 3EARA 3AVPA 1OH7A 2QT0A 3TRFA 3RC3A 4YDHB 2R62A 4IOJA 4I99A 4QHYA 3WYAA 3THXA 5JHGB 2RCNA 4GMXA 1QHHB 5E3HA 1LF0A 2JGNA 1XTJA 1N0WA 1LW7A 4LWZA 2C99A 4FMDF 3BFKA 4TQ9A 5ELXA 4BE7B 2IUUA 3BBPA 3T34A 4A8JB 5JSZB 1GNPA 1TL7C 1FPMA 1HV8A 5KNDA 3K9HA 1FP7A 3KJHA 1SKYB 3LBIA 4Q1BA 2IT1A 3H2YA 1IN5A 1M74A 1VYVA 3RRYA 1P9RA 2O0KA 1G6OA 1JPJA 1KOFA 1JECA 4O3MA 1OJLA 2ZU6A 3LVQE 1X3SA 4MRNA 4JBYA 3W3AA 3FKQA 2QM7A 4JVNA 4L15A 3I4LA 4KJZA 4QNMA 4JVMA 4OHYA 1ZM2A 1NG9A 1XBTA 3F0TA 3QJYA 4OHXA 5EXSA 2F1JA 2D7DA 1EGAA 4YMUA 5JWRA 2J0UA 3L43A 2R2AA 5AK0A 2J59A 1XRJA 1MO5A 4UXHA 1FX0A 5DSZA 1TQ4A 4QC2A 2VBCA 1DELA 1YQTA 1E94E 3KKNA 4C9BA 2BDTA 3KKMA 4Z8XA 3EZ9A 1YKSA 2PCJA 3H86A 4XSGA 4DB4A 1ZINA 2ZRLA 1NL3A 1NIPA 3NBXX 5IRCD 5JRZA 4CEHA 2ZPTX 2JLXA 4NDZA 4LBWA 4NU0A 4BLTA 3TR0A 3UWKA 2ZI4A 4BLRA 2A9KA 2GTPA 3CM0A 4X8HA 2ZUBA 1RPZA 5BW8A 1US8B 2RGEA 3JZAA 4MYHA 2FFBA 4LC0A 2CVHA 1XDBA 4FWIB 5E4FA 2KB0A 3X1YA 3CKLA 1NNEA 4XD7A 3SYNA 5CB8A 4G5GA 3TGPA 2O8EA 1SVWA 1CR2A 3GEHA 3GLGE 1XCPA 3EC1A 2R6GA 2AWNA 4TZ0A 3AP2A 2OILA 2W2XA 2ZI7A 1ZBDA 1TF2A 3AVYA 5G40A 2REOA 3SS8A 2YC4C 3ONWA 4Q03A 4UXJA 3E1SA 4B35A 3UWOA 3T1TA 3PXGA 3B2EA 3ZD6A 2IYYA 4BLPA 2G0NA 3MFYA 1J70A 4BEJA 1B23P 4P4SA 2V3CC 4NYIR 3B5JA 3DOFA 1H65A 1AQYA 2HJVA 4QL3A 3VQTA 3PUZA 2PT7A 1XP8A 1R2QA 1KDPA 1RRPA 4IOKA 4LPSA 4Q4HB 5BN5A 2JLZA 4M53A 4CZ2A 1E2FA 4TQAA 4G1UC 3QVVA 3WYFA 4PC6A 2WICA 2J5XA 2FWRA 2W83A 2ZRPA 3GLFB 1T5LA 1E2GA 5JBQA 1CJKC 2OAP1 1JEDA 2BKUA 4XTCS 5C1BA 1G7CA 3S1AA 1II8B 5KNCA 4DT1A 4TYQA 3RRMA 2BM1A 4PAQA 4D26A 3NXSA 2I3BA 4TMXA 2NIPA 3TQFA 5CJ2A 4HLUC 1G4UR 1RIFA 2G88A 2QSZA 3GP8A 2ATXA 4DWJA 1ZM7A 1YE8A 1RJ9B 1XTSA 1N3BA 1KMHB 2C5LA 2FFQA 4YONB 2Z6VA 1OYWA 3CRQA 1W36C 2GETA 1E98A 2QT1A 4Q4JA 5GVRA 3VU9A 2IA5A 2PLRA 2EU8A 4Q7JB 1II9A 1XCMA 2OFXA 3LY5A 4M1OA 2ZRJA 4B33A 2YOHA 2D74A 1FNMA 3QSYA 1CR0A 3NEYA 5EZ5A 2AXNA 2CLDX 3CW2A 3LFUA 4JLKA 1TEVA 5J47A 3DKPA 1IM2A 4BZPA 1JXMA 2EFCB 1QHNA 1P9WA 1P62B 4MQBA 4X8LA 5AJYA 3VR6A 5J4VA 1HURA 1G291 1GNQA 4PTLA 3LD9A 4G5QA 1HQCA 3JVVA 3JVUA 1RRFA 1AIPA 2O0HA 1R10A 3FFAA 2WAXA 3CF6R 1S2MA 3GD7A 1OB2A 4PC3A 4CT4B 1BH2A 4ITRC 3SFZA 3OIYA 5AJXA 3CRVA 1XXHB 2GF9A 1VYTA 2E9SA 3SI7A 2BJWA 2DR3A 2VSFA 4TSFD 2ZVPX 3SBEA 2GCOB 4PHHA 4YLGA 1KI4A 4Q9LA 4MRSA 1DAKA 2GXAA 2ODNA 3X1XA 1VKJA 3EZ6A 3MSXA 2XXAB 3SE0A 4KYUA 1KI8A 2PX3A 3QKRB 4FMDB 3Q72A 1N2CE 4XSHA 2BMEA 3O8DA 1CBUA 1GVNB 3FVQA 3U3MA 4CEJB 2CL0X 3OIVA 4LDJA 1Z2CA 2PMDA 4MGYR 4LJYA 1C4OA 2EFDB 5JLJA 4JJZA 2YZ2A 2BWJA 4BRWA 4DRZA 2QMOA 1OH5A 5KYKA 2H57A 3EPLA 3ZS8A 1NVVR 2BOVA 1KKLA 3CH5A 3NBZC 1GWNA 2AKYA 2WJHA 2ZRGA 5AUOB 1D9XA 4MDFA 3IHWA 1WRBA 2CVFA 3L0IB 2FA9A 3QF4B 1U0LA 4GOKA 1M8PA 1ZNWA 4F4JA 2G83A 1AS0A 1ONBA 5H68A 3CIOA 3RS4A 4JZKA 4OL0A 5BXQC 2XSZD 1FL9A 3IKJA 2A5YB 1EFTA 2FG5A 2PBRA 3MD0A 4AC9A 3QEJA 2IYSA 4F91B 5JMTA 1D5CA 5F9FA 2ODWA 4HAWA 2FMXA 4Q4LA 3EPKA 1W48A 2WIAA 3U6KA 4Q19A 1QG2A 4EPTA 4JLPA 4LSGA 5TDHA 5CLQA 1OHHD 1SVKA 2AR7A 2CJWA 2LCFA 1NBMA 2VEDA 4AD8A 2GJAA 4US2R 2A5GA 2CXXA 4Q1AA 1R6BX 2VA8A 4X8MA 3R9XA 4HUQA 1GKUB 2V7QD 1N6NA 4FI3C 1VIYA 2O8DA 2EWWA 2QAGC 3B8HA 1NN1A 4G5SA 4D0NA 4V0NA 5AUQA 3TH5A 3O47A 2VP5A 4HB4A 2D62A 2Q9CA 3I3SR 3VX3A 1QVRA 2XJ9A 1S9DA 4B3GA 1TEXA 4D81A 2E1RA 1WMSA 2Q3FA 3P1JA 1KI6A 4LI0A 4RSGA 2TMKA 4V0MA 2JLQA 1J99A 3HP1A 3SEAA 4C0JA 2XAUA 3DZ8A 1FNNA 2QI9C 4OI2A 1Q21A 2ZI9A 3EIHA 1VCIA 1DADA 2XTMA 3IDQA 4B44A 1F6BA 2KBFA 2GEVA 4JLDA 1Z0DA 4BFTA 2QU8A 3GJ8A 1OB5A 4KXFB 5CK5A 3D6TB 2W6JA 4JT2A 1XFAA 1KJYA 2IYVA 4R2IA 2QAGB 3D31A 3UATA 1IN8A 3SN6A 1Z6GA 2ZE6A 3AP3A 1VG1A 4PO9A 2CCKA 2F7SA 1ZD8A 2G0TA 4B73A 3RANA 3EIQA 5EQTA 1E32A 4IDHA 4AYXA 4B75A 2FGJA 3ZDQA 4BFZA 4DZZA 4YMSA 1RKBA 5BN3A 1TADA 3A1VA 5DGXA 4HLQB 2Q21A 1JALA 3CZPA 1M1YE 3K0FB 2IL1A 5G3ZA 3BXZA 2ZJOA 4DDUA 4TYPA 1CF4A 5L3RA 2RKOA 2VRWA 1GKYA 2DB3A 3PEYA 2VHTA 2FSFA 4W9MC 3GFPA 1U8AA 3VR3A 4DSUA 1R5OA 1AZTA 1UJ2A 4EPYA 4JS0A 2WWYA 1NKSA 1DE0A 3KZ1E 2F43B 1BS1A 2FOLA 4TN1A 1OXTA 1Z29A 4BZXA 5EJEA 3WNBA 1HE8B 4C30A 3K0EA 1R5NA 1W2HA 3OE7D 4DLXA 1NP6A 4U7DA 2B8WA 1IN7A 2F1IA 2H17A 3AM1A 2JJ1D 3IBGA 4WZBE 4BRUA 2BMFA 5BQ5A 3IQWA 1S1CA 3KX2A 3LRPA 1NLYA 1NVUQ 2XSZA 5CIQA 4A2PA 3E2IA 5GJBA 4NHOA 1SVIA 3I8XA 1DEKA 3U61B 4C0HA 1CJUC 1R8SA 4KFRA 5FBQB 2GCNA 2P5SA 4QG7A 1W0KD 1CLUA 4M1MA 3BE4A 2DCUA 1AKEA 4ZIRB 3RWMB 1JBKA 1OHHA 5D3MB 1E0AA 3CNOA 3RVBA 4E07A 3BB3A 4PXAA 3CZQA 3HDTA 1J2JA 1N5JA 1T5IA 2B8TA 2J7PA 1YRAA 3OIUA 1L4UA 1Y63A 3LXXA 4QJ5A 1T6NA 4PAOA 5LBIA 3W8NA 2QBYB 2W00A 3R7WB 4IFEA 2J7KA 4DSOA 4LRWA 1TQ2A 2NO9A 4RFSB 4Q9JA 1A4RA 4ASUD 5L3QB 3ZVNA 1E2QA 3EWSA 1U0HC 1YR8A 1RW4A 2YJTD 5H1YA 1Z5ZA 1ZW6A 1VHTA 4MRRA 2EQBA 4KU4A 1E4YA 3HR8A 2G6BA 2HV8A 4C7OA 1BO6A 2ZRHA 3NTUA 4RD0A 1XJ0A 2FNAA 5DN6A 3Q7QA 3WHKA 2FPKA 3DOEA 1E2KA 1NY5A 2RGXA 5DI9A 1SULA 2ECKA 3QE0A 4ERNA 2DFTA 1UAAA 3RS0A 3TAHA 3RS3A 1MOZA 4F4CA 1PLJA 2VP9A 5LB4A 4IJMA 1SVLA 3NBYC 1IN4A 1KI2A 1YZQA 3NDBB 2DBYA
chains in the Genus database with same CATH superfamily
3ISJA 2QX8A 3O3OB 1XB2A 3P9YA 3MT7A 4N5LA 3HE3A 3TUJC 1KAMA 1I2CA 1JDNA 4XVQA 3ZNNA 1BJRE 2HMSA 4WEOA 5ALPA 1Y6JA 5EWJB 4CQMA 3GA7A 3ZJUA 1PR6A 5FYQA 2OHIA 4BQEA 2ZUEA 1UBMS 3H8JA 1G8YA 1MABA 3E23A 1T9GR 2B5WA 5ICGA 3PU6A 4PN7A 1CY2A 4TRRA 1KAHA 2V8BA 3ZQUA 4BLUA 3FPEA 4ZEXA 3OICA 3THOA 1NF2A 4LRSB 4N3AA 3W5IA 2ONCA 1BN6A 1GN9A 1E6CA 3T7EA 5EOVA 4HWKA 3CO0S 4GZ5A 4RY2A 5KPDA 2ZEJA 1Q1NA 2QD1A 5LOVB 1WA5A 3JWJA 3L7BA 4RGYA 4WHMA 3TTYA 3UXYA 1KP9A 2Z2IA 3OTQA 1U2QA 4ETIA 1OGIA 1N0VC 2C2HA 2ORYA 3D1JA 1B26A 1T8WA 4GDMA 4CMIB 4ZGGA 1W73A 3IAAA 3NTVA 1VPLA 3HDQA 5K51A 2REQB 3OE7A 1RYYA 3GJ0A 1QVVA 1TXGA 1RQ7A 3EIEA 3N7TA 4WWHA 5AK5A 2FP4A 5C7LO 4LFBB 4AKIA 2JJ1A 1GGEA 3BG5A 1VHLA 4Q3LA 2JAHA 1HE1C 4W5WA 5ERGB 2FZCA 2PRSA 2C96A 3K9NA 1U2GC 3ZD7A 2O8BB 3ETLA 2QSUA 2NU6A 3ETHA 3LH5A 1E0DA 3VKGA 1V16B 1RWBA 2H7XA 3THWA 1K89A 1L4KA 1IC6A 2X86A 3ZZ1A 3C8DA 5CFQA 3AZQA 4JJIA 2FKAA 2FUG1 4BFVA 1NF3A 3CBQA 3CB2A 2YXPX 5B58C 1J90A 1HRDA 1DAHA 3DBLB 5C1IA 4CG2A 4G0WA 3Q6NA 4WGFA 5WRFA 1EVQA 4LE2A 1DDGA 3TGLA 1S7CA 1TM1E 2QLMA 3TD9A 5DSXA 1M9NA 1BIFA 1WCXA 3NPAA 1W9HA 5FL7A 5HKOA 1WM1A 3BHNA 3K8ZA 3V2IA 4XRGA 1A71A 4A8TA 4KXMA 3V2GA 3M33A 2D2IA 4J9VA 3HN2A 1NQ5A 1R3DA 3G17A 2O8FB 2IBMA 2QRUA 3DT6A 4LE1A 1UBNA 1CFZA 3AYXB 1VL8A 3CEMA 2HPZA 1ZOPA 3QPAA 5JLAA 4V0OA 1NLFA 3IQDB 3VH3A 1E5DA 1JTFA 3DC7A 1NF8A 3H1TA 1R6TA 4O4IF 4OL9A 2YIVX 3A4TA 4JC0A 1RWPA 5JAHA 3F6PA 4IXNA 4J7CA 4P3OA 2ZG6A 1ZSYA 1B8UA 3BUSA 3Q9LA 2O50A 1HT0A 4ZV9A 3UGQA 1SN7A 5JMPA 4ZJUA 1T25A 1BCSA 1C7JA 3SQXA 4PS0A 1OD6A 1WBJB 2ZAOA 4R2KA 1E6LA 3T7TA 4DBLE 4IQGA 5BSKA 1XQVA 2AQKA 7REQA 4ZHQB 3H4MA 5D7NA 3LG2A 3BX1A 5IP5A 1RHMA 4MUHA 2HPVA 4PYNA 5E3IA 4IXMA 1P4AA 4Z7QB 1QKJA 3FNGA 1PKEA 3BJMA 1DJNA 3RJ9A 3K70D 5KNDD 3EFOB 4DLYA 5EVJA 2HTFA 3VRHA 2J3DA 5A5GA 2CLKB 2DMRA 4H59A 2FX3A 5DHAA 3H65A 4KIJA 3EGXA 3A0UA 4L6CA 3I62A 4CKCB 2D3WA 1ISSA 5AI5A 2CLHB 3AM1A 3ND5A 3GRUA 2O0LA 3PFFA 2CVPA 3GJZA 3SC4A 5HSGA 4A5OA 2ORVA 3SS7X 1B3BA 2JA1A 3KAPA 5I47A 2FZLA 3GLGB 4E5VA 1PS8A 4PBTA 4POAA 3SHTA 4Z9BA 4CTNA 1WCV1 3I52A 2KI5A 2RHBA 1FMFA 3TZBA 4CIVA 1Z8HA 3E9QA 2PSJA 4UTZA 3NANA 3JARA 1UPCA 4F96A 1DHTA 1OE0A 2PUTA 3BHIA 4K9PA 1N6OA 3IDAA 3NVAA 3NC4A 4NATA 4QOIA 2FLKA 1PEAA 1CJCA 4PLTA 3V1UA 3N28A 2GHIA 4RTQA 3K73O 1AA9A 1AUOA 3LLSA 1YTLA 1L4LA 4IL5A 1SOAA 2VP0A 2ID9A 3T3PB 3BDAA 1MAUA 1SA0A 5A0VA 2IZ1A 4WV3A 3WP1B 2FP3A 3KR9A 4Y2XA 5TQ0B 3ZHXA 3KKPA 4MI1A 1GDHA 1OR8A 2DUJA 4KDFA 4NE7A 5IMBA 5IBPA 2I2CA 3JSAA 1WABA 2WIBA 5EE9A 1E2IA 5BYKA 1BRMA 4DIBA 2YL2A 1ESNA 5TQJA 2ZWAA 1ML4A 1THZA 3ZG6A 3DBIA 2NO1A 2I4NA 4NENA 1ISJA 3G79A 2W70A 5J4YA 1VBKA 1EVYA 3C4QA 4Z53A 2VDUE 2BFWA 3PNMA 2QAJA 4J0KA 3B9BA 4MRPA 4GYJA 1T1SA 4I1RA 2EZUA 2WBLC 2ZJ0A 3CUKA 3HJTA 4EUNA 2LUOA 4OVKA 4UAJA 721PA 3RC1A 3P4YA 3QU9A 2ZDHA 4ND6A 4XPIB 4BMNA 1HT1E 2I33A 3WK4A 2VYQA 4G8CA 3WYNA 4Z4EA 1VI6A 2IC5A 4KNVA 2R84A 3A58B 2JARA 4YCNA 4YS6A 2XF8A 1T6BY 1TECE 2TRSB 1FZQA 3DPIA 4JKOA 2WD7A 2JCBA 1DXYA 4YR9A 1YQXA 2XDAA 4YXWA 2CVQA 1ND6A 4JKIA 3DXFA 2DLDA 3A6EA 3Q0TA 1JMKC 3TBFA 5DOZA 2DT8A 2V74B 2AD1A 4JXJA 4UE3S 5LMCA 2H1WA 2QJOA 4C4TA 4GLLA 1BRTA 2DKOA 2HBRA 3ESZA 2H1OA 1VTKA 4ZDIA 2CLEB 1KC3A 4TVBA 3E4CA 4LCBA 1ZIXA 3HCAA 1JFSA 1JG1A 2CF6A 1UDRA 5ALLA 4ZVQA 3CJTA 3DYIA 1A76A 3IAFA 3KALA 4OQMA 1IY0A 3IA7A 2Z2KA 1WTCA 2QP9X 4NBSA 5CGZA 4F1KA 1E2JA 2VAMA 1F2UB 1CNEA 4GWGA 3GC6A 4JEUA 4W5QA 5EZQA 5TT0A 4EY4A 2GUGA 1J5XA 3HJAA 3F7NA 1BVYF 4NG4A 1P1IA 2ODBA 1K0UA 2OP0A 2UUOA 4AUEA 4KPEC 5EJ7A 3U19A 2IHTA 4ZGBA 2RGYA 2FMKA 1B73A 3B38A 1PV4A 3ZBUA 3HKBA 3UMMA 4PYIA 3PRYA 1KEEB 4Z4CA 2M6LA 1SUEA 1A4IA 1XK7A 2I9KA 4FGLA 1ZWLA 4E94A 4EZBA 2N1BA 1XL0A 2GK6A 3IXMA 3EGWA 3PNYA 3UIEA 1AB6A 4U7WA 3ZDEA 4YX9A 3EVFA 1RLUA 3SDSA 4Y2TA 4AP9A 5I7HA 4H7DA 4P92A 4O0LA 2BF7A 4QGGA 5EI5A 4EM6A 1YJQA 3FB1A 1W1WA 4RD6A 1U3TA 2FW8A 3V8MA 4CL2A 1W5AA 5IVKA 4XD2A 2HQSA 4R3WA 5EL0A 3R7FA 3K32A 1FJ2A 4CLRA 1CY1A 2BGMA 4RHCA 3P9XA 3GGGA 4LJKA 2NP6A 1XEWY 1CR1A 2P30A 5G1OA 4CFSA 4C01A 4MAFA 1G60A 1L8XA 1Z18A 1K8QA 1Y3AA 1GZUA 3GGPA 2WAOA 3HBNA 4HSGA 5KOJA 4DCUA 4YH1A 4FD2A 2I55A 4ZCPA 3A3YA 3CUVA 2OBLA 5U1PA 2GHQA 1XPUA 4CN8A 4MJLA 1E79A 2RD2A 3FMPB 3RS2A 1FP4A 1ZIYA 1S96A 2WM9B 5AP9A 4G0VA 3DEYX 1ONNA 2FF7A 3VYTB 4HLCA 1WW8A 4DR5B 1UPBA 2I6XA 1UBJS 4TVKA 3F4LA 2Z4TA 1J8QA 1K4YA 3D4NA 3PYLA 3TJZA 2VC2B 3ZOKA 1S6YA 4EEZA 1P3JA 2O2GA 5BR8B 5FTNA 1KJZA 4IJWA 4EFNA 4AX4A 5I9NA 1T2UA 3KWMA 2WZCA 3EBOA 2JJYA 4Z2AA 1T3GA 2A0YA 3FPFA 1DVRA 2B35A 2C83A 2R6AA 1E59A 2I6TA 3LQRA 3NYRA 3U7QA 1O95D 1QIEA 5GTDA 1RYFA 5B64A 2A7QA 3KAKA 4LDQA 1KI9A 3TMAA 4MR7A 1M6YA 4BFCA 2V55B 4Z4FA 2XVYA 1E1QD 3VPXA 4AIRA 4FBMA 1YGPA 2W22A 1WPRA 2Z8XA 4AT1A 1VL5A 5K8IA 3LK6A 4PGFA 2WHYA 4D4KA 2NXCA 4BNYA 1J0CA 1UJ5A 1HT2E 1VCOA 1YB7A 3C3PA 3IUJA 2ILVA 4F4UA 5JXJA 3THXB 1BJTA 4N3GA 3USZA 4C4XA 4X44A 2JIDA 2RK3A 4C9BA 3OU2A 4TMVA 4RIEA 1V1RA 1NR5A 2E49A 2P8JA 1UM9B 2VEOA 3G5UA 3Q3JB 4AJEA 5K0JA 1QVWA 3RV3A 1NVVQ 1SXQA 2DJIA 1HQDA 4DBZA 4JXZA 1OFVA 2MR5A 4M36A 1ID8A 1KZHA 3SMVA 4B6GA 1OCEA 1QDLB 1XCOA 4UE2A 4ZANA 3T8YA 4C7XA 2UZ1A 4DA6A 4DQXA 1ZHOA 3SX2A 1QGYA 3ZGXA 1V41E 3UB4A 1JS1X 1WE2A 2Z8ZA 2VYNA 1OV4A 3F8TA 3KRTA 5SYMA 2ZUTA 4DJAA 3G2HA 4DIDA 4R8MA 2QROA 4XTRA 3IE2A 4DDVA 2J3JA 4FKBA 3PG5A 4WFQA 5BQ3A 1RI5A 1IAQA 5JAMA 5K0TA 4Q9HA 1A8UA 4QM7A 3OECA 1COWA 2WTXA 4GVXA 3E0QA 1WBDA 3R3UA 4ZZ0A 4LV8B 2FSVC 4RBNA 4HB3A 1QH8B 3DQPA 5EUBA 5F73A 1I7NA 2GGSA 1R0WA 5SZKB 2ZI5A 2OCDA 4X3PA 1J8FA 1G55A 1VKRA 2J9ZB 2JIPA 3IQIX 3T3GA 1G4HA 3RJZA 4AJ4A 5IHPA 4ZVSA 1IUOA 3UFBA 4DLWA 3QE4A 1AKNA 1CU1A 5HA5A 4A73A 1UMCA 4D9HA 4ZI2A 5CUQA 2HLDA 2GHTA 3KKEA 1VRWA 2XD4A 3H5IA 4TV9A 1VIDA 3ZXYA 4LAFA 5B6IA 3CUUA 4RMNA 2BUCA 1WMDA 2QGFA 1KR2A 5K3OA 5HUJA 4QYSA 3FSRA 4NDAA 1AUPA 1CVIA 3H19A 2PYDA 1ZR2A 1R6XA 3MRSA 4URYR 2FMTA 1YOBA 4WKNA 1OXKB 4O2AF 1JEQB 1W47A 1LY1A 1KXZA 3WK7A 1KH1A 1VDMA 1WSAA 1NSTA 3KQHA 4JI1B 2H0AA 2QN1A 2TMYA 4C2BA 2ZZMA 1X7ZA 4M7WA 4ESHA 1TYAE 2NYUA 2A1IA 2XNDA 3M6VA 2BGRA 2RHOA 4JJEA 4O4LB 3UHOA 1T1JA 2DGDA 3TLGA 3N5CA 4JNCA 4HPXB 1R5BA 3NHAA 1Y89A 5CK4A 2QUZA 2PIAA 3OZEA 2NZJA 1T0PA 3C5HA 2ICAA 3E9CA 4Y0AA 5BT9A 1G8GA 2R5WA 4HXYA 4WZBB 5E0OA 3CUTA 2F62A 3D6NB 4MLCA 5CCBA 3K1AA 1Y7TA 3P9PA 2JGLA 3UK1A 4JX9A 3RNOA 5AW5A 2AMYA 2XUDA 4J16C 4LMRA 2JLCA 1DP4A 2EG9A 5GQSA 3A11A 1XNRB 1K7XB 3ST7A 5JCOC 5JROA 5DULA 2HHHB 2W4IA 4PSVA 1R0BA 4HDMA 2YVKA 1D4OA 1K98A 1XZPA 3TVTA 1XTIA 3T9BA 1SO8A 4IGEA 1DAFA 1ABFA 1ST3A 4JBWA 4NVRA 3EW9A 3RVJA 3K0CC 4NZNA 4CIAA 4E4RA 3PZRA 4GRAA 1RP1A 1CS0A 2YVUA 4WMLA 4K9NA 3IT2A 1PFYA 1Z07A 4HY3A 4G41A 2C31A 1H23A 3L6CA 1RYNA 3A6HA 3KAJA 5CJJA 1YQDA 1OH6A 4G97A 2BHLA 3ZBPA 5ES4B 1RU3A 1C9DB 4LJAA 4S1VA 3IMGA 4ZI7F 1H1LA 3GOHA 4GYYA 1DOAA 1CY8A 2OZKA 3I6IA 3QVGB 1O0CA 4J0QA 1GNSA 4BPRA 5FA8A 3QXXA 1BW9A 2G80A 1P0QA 4NCNA 3A2MA 3L6UA 3C48A 1E99A 1O94D 2P79A 3WI7A 4NG5A 2YVLA 3NG1A 3WMFA 3LIPA 1GYQA 2YV3A 4RXUA 1G6KA 2E6KA 3VUEA 1KO5A 2GD6A 3VU9B 3WXMA 3G0GA 3ANSA 5CB4A 1KF0A 3V4FA 3WY9A 2B78A 4L9WA 2X2EA 4MUEA 3T9DA 4E7PA 5CIYA 1X19A 3SLGA 4EQZA 4YAIA 3MS7A 2GYYA 3DJFA 2FRDC 2Q3BA 2PMEA 1KI7A 4FE3A 2D3TA 1EDZA 5FUXA 1XU9A 3CEJA 3PUVA 2A5JA 3MMXA 2F4VB 4QOSA 2WJIA 1Z0SA 2CDAA 1EXMA 5SV2A 4RWZA 4MNTA 4MI6A 5AJWA 5DGHA 3VKHA 4IHQA 1KYQA 1ZK2A 1KVTA 2IUTA 4L0MA 4UEKA 4YP5A 3Q7SA 3SM9A 5JS7A 5CDYA 1PO7A 4R2HA 3A3OA 2XKKA 1YB4A 4N7MA 5DM60 4JKYA 5I7VA 1H0RA 1UDCA 1IXSB 3GR6A 1T8SA 2YY5A 2JRCA 1ADCA 2WVJA 5BYJA 4B6FA 1P18A 3WL8A 5HGXA 1L7VC 5KJEA 2XLCA 4C5BA 5K8TA 3CZAA 1RMYA 2DSTA 1TW3A 2I7CA 1TO6A 1P2TA 3DOCA 3VC7A 3VU1A 3LYUA 3FUWA 3QEKA 2R8OA 1YS4A 3OLYA 1QE3A 2ZUDA 1P1RA 1P2UA 5CX4A 3B52X 2VKTA 4YO7A 1CE8B 1R0ZA 1A96A 5AOVA 4QVGA 4KC0A 5EMJA 2PO5A 1BC5A 3HFGA 4RULA 2EIHA 1F06A 2Q2NA 3TMYA 2P6PA 1Z5NA 4REMA 5JDCC 5JO9A 3I04A 4IVRA 4LRUA 4DCOA 1LJUA 3RQSA 3DXZA 5FYDA 3HYRA 1XLTA 1W0CA 2AWOA 3IILA 3X2SA 4H1TA 5J5CA 4WJKB 2OV3A 3OJEA 2OC9A 1THGA 4J7AA 2B7LA 3A28A 3KDSE 3C2QA 3DLBA 2C57A 4GI1A 3LUBA 4HAUA 5DNVA 4CQMD 1PJZA 4L57A 4Y9TA 2V58A 4ZPXA 5JXGA 2X9QA 4NCHA 3QXJA 1PEKE 5DJ5A 3HDJA 4MSUA 2FU5C 3CJQA 1F1BA 1LZKA 2J30A 2TECE 1Q0QA 2XZPA 3JQEA 4NF2A 1SUSA 3I6YA 1UPAA 2G70A 4L8VA 4R6WA 4D45A 2DQKA 4A0SA 5CFRA 4WKPA 2IYWA 1EFUA 2XRFA 2PJRA 1R9NA 1UPTA 3B7GA 2PR7A 4HZGA 4IY1A 4J4HA 4TT3A 1C3JA 3OFKA 2WU4A 2WHXA 3D3WB 1M6HA 3TXAA 4IDEA 2JCVA 3RBAA 1P1BA 4Q15A 2MIIA 1Y1KE 4GMKA 2VUIB 1YZUA 2ZJ5A 4C6TB 4HNRA 4X92A 2VF5X 3OBBA 2VRNA 4JOBA 1TKRA 1UXHA 4ECAA 1VP9A 3HI6A 5DHRA 2R85A 1FFCA 3WAGA 1C50A 1E92A 2HMWA 2PX6A 3IP7A 2XBLA 1KO8A 3QLEA 2V6MA 4Q48A 3WIVA 1RAAA 4AJ1A 5ELMA 4QPZA 3C8MA 1RCFA 4D57A 4PX3A 4DADA 4EUSA 3OJWA 4EMSA 2J6CA 2MSCB 4YCDA 2JIQA 2IUFA 1Z2PX 1UXKA 1JDUA 2K2QB 1RVDA 4BMOB 1F8XA 3L6EA 4RW0A 3EJ6A 2PVPA 3DDOA 5EJIA 3OP1A 2ONJA 4OJYA 1VI5A 1SCIA 1I13A 4XCVA 4ZARA 5HYVA 3LCRA 1F38A 3S5JA 4V0KA 2P9YA 3OFNA 4XYLA 3N75A 4WNAB 3PUKA 2A0KA 2CBGA 5A9SB 1I7PA 1AMUA 2ORIA 1ISFA 4D1YA 2WTBA 1C1DB 4GMDA 3WK9A 1DI0A 1XP5A 1T0IA 2X4GA 3B9QA 4GSLA 5DM70 3ZDAA 3RUAA 3BJRA 3O1HB 2ZRQA 4KDEA 2AL7A 2Q7OE 5L6MB 3ESCA 4ND5A 2VWGA 1BWQA 2O1SA 2R8ZA 3THYB 1DBIA 3KB8A 5FL7D 4DARA 5KU1A 4ZICA 5LMZA 2DFLA 3A10A 2C9BA 1MOQA 2VQSA 4JI7B 2GEBA 2FSIA 4ABTA 1MO6A 1W4RA 1HNZB 2Z1NA 1FXUA 2C7VA 3N3BC 5F2EA 1EEHA 1ZNQO 2BMWA 2PS0A 1NW8A 3MJTA 3ZW8A 2WB2A 2P4SA 1RI2A 3SK0A 3MTDA 3P0JA 2GBLA 1I32A 4B87A 2VJYA 1QQAA 1KQ3A 1L3BA 3U60B 1E3MA 4PAMA 3BCRA 3G2JA 3TECE 4Z3DA 2AOUA 1P8JA 2VKQA 2O06A 3U7EB 4QO8A 1CUVA 1B41A 3RW9A 3HGTA 4RH3A 1TA0A 2RGCA 3HY6A 4M9RA 2W8BB 1J25A 2JLAA 1Z06A 2NVBA 2PZFA 2QTAA 4TS1A 5DGDA 1ZK0A 3AETB 3UV6A 3PR2B 1V9LA 2BEVA 5DP1A 1CW2B 2CHGA 2GN9A 2JZNA 1N2HA 1UK9A 3LZCA 4TMZA 3P0FA 1RHQA 2BFAA 4FEYA 4EQ6A 1B8PA 5KNBA 5CURA 4EY8A 2BYTA 5JY6A 1F7UA 4EF6A 2Y68A 3KKLA 4TKZA 2VQ6A 1WULS 2DRIA 1GUAA 3E9NA 3IPLA 2Z5LA 3LWNA 2F1RA 1CHNA 1GXSB 3K9CA 3TFWA 4EG0A 5KOYA 2C61A 3G0CA 1OU0A 3SNHA 5K99A 3VTAA 2UAGA 3MCVA 1KEUA 3HV2A 3S3TA 2CFIA 1JIKA 4W1PA 2A30A 4RA6A 3RUDA 4ID3A 1L5VA 3GP5A 2YCBA 5DK6A 4B74A 1PFUA 4W63A 1LRLA 3ORSA 3WISA 1MZPA 1HWYA 5EE5B 3QI2A 3GMTA 5BSEA 3EZNA 3I2IA 3PNSA 4KN6A 3FWNA 1Y6FA 2WUVA 1L8LA 1CS4C 3DBRB 4RD4A 1F4LA 5AW7A 3K8OE 1NPTO 1Z74A 1LPOA 3AVQA 4RHXA 5BYAA 2A9VA 1SY7A 2WYHA 2NTVA 4FYJA 1ULBA 2PKQP 2PQMA 3IO5A 1U8XX 2VZ0A 3U4HA 2OQVA 1QU3A 1N1EA 1BDMA 3KPYA 4FYXA 2GJ9A 2YHSA 2J4FA 4G4SO 4FHZA 4H3VA 4RDXA 3PJEA 1A69A 1EDEA 2JDIA 3HG7A 1I4WA 1OZAA 3ZWDA 3KZNA 3FY4A 4OMUA 3ZEAA 2WSSA 2ACKA 4ALNA 5GP1A 1RHUA 4IFIA 4AP5A 4X41A 2VHUA 3R6WA 4DDHA 5KNDH 1Y4ZA 1NUQA 4X66B 2WHPA 4LYFA 3I1IA 4ODIA 2YXDA 4FIDA 3ZWBA 1M67A 2I78A 4OQFA 3V7FA 2VPQA 3IIIA 2GH1A 3BSWA 2G7ZA 3ZNPA 1GFZA 4F92B 2NNLD 1DUIA 1WB6A 5JYEA 2YFQA 1J8YF 1Z56C 5EZYA 3IJEB 2GWRA 2BH9A 1NTRA 2R6R1 3C16C 1O87A 2M6RA 3OMWA 3RVDA 2NG1A 4B46A 1X1TA 1CG6A 4MRMB 1T9CA 3IAUA 1UDWA 1B6RA 2I6QA 5FPSA 3ZDBA 4K1LA 3OTIA 2BP7A 4P93A 4IGKA 1UIMA 1SXIA 2R97A 1YUMA 3HXQA 2PKWA 4ND8B 3UXHA 3IVMA 4OHFA 5EGNA 2F1OA 3RIHA 4ZCMA 1USVA 4O63O 3B3FA 3PDWA 1DAMA 2ID7A 3W6OA 3R3SA 2IY7A 1G19A 1XAJA 4JROA 4V1CA 5KSOA 4PVDA 3FHCB 1YZYA 3P0IA 2HU2A 3GZTB 5CAEA 1LDYA 2FPGB 2JLRA 2Q5IA 4KGZA 2WHEA 3T4XA 4M9CA 1ZMRA 3DVAB 5EAIA 1OBCA 1V25A 3I0NA 3MJRA 2YHIA 5J1SB 1DL5A 3VR4A 1DARA 3I2FA 4EI8A 3LCMA 1GPLA 1RRMA 2FHPA 4NFLA 5FTJA 3WRXC 5JV5A 3E22A 4MUNA 2FE1A 4I1IA 1YO6A 4FOPA 4N0QA 2BTOA 1KDRA 4ZO9A 4TTSA 3MILA 2IUYA 3ADCA 4DR7B 3W77A 2VNIA 4JWTA 2IITA 2VAWA 1NAHA 1PHPA 3BE5A 3E58A 1NRWA 3RYIB 1FXSA 4CMEA 2ZB7A 1GRNA 1W4AA 1OROA 3COWA 3PYMA 1Q11A 4JJFA 5ERYA 3FHLA 3STUA 4YUWA 3ED1A 1VG8A 3K5PA 1S89A 5BR7A 2B8NA 1FTNA 3ZQKA 1MJGM 1O97C 2H63A 1NUSA 3CNHA 4DG8A 4QYIA 1VB3A 3H4IA 2ETVA 2PL9A 4KPGA 3KHUA 5IM4A 1RTTA 1ZISA 5K8LA 2IPLA 2Y1CA 2XVXA 4PZUA 3QA3E 3FKSA 3ZHTA 4EOGA 2Q5JA 2Y0BA 4PO8A 3PHBE 5L4SA 1BYUA 5ECYA 2IYUA 1UDBA 1P29A 3EQ9A 5I4BA 2DHQA 1DAEA 4U5QA 2AFHE 3QX8A 3Q9NA 1G38A 4C22A 4TL6A 1P2GA 1T5TA 1ENYA 1XDSA 3B3AA 4NMLA 4V39A 1SHTX 4XWKA 3M1AA 1GGFA 4X1KA 1RJDA 3N70A 3MIIA 4KYIB 3I3OA 2XBMA 4YMHA 4LX8A 3P7MA 4CEIA 4XEHA 1NI4A 3GELA 3W34A 1L5SA 1QYXA 5H8WA 1XT6A 3EVBA 2JGAA 1CRWG 4GT1A 1QYDA 1EMDA 2ZIWB 3A1TA 5LNK1 2B69A 2WI8A 2IFTA 5JCXA 3ZE2B 1N2CA 3NT5A 1Q50A 4NFHA 4DQDA 2XRMA 3NAMA 4IDOA 1NTOA 1U9JA 4RVFA 1HMPA 1YSCA 3N59A 4GR9A 4DW8A 3EDRA 5TLSA 3V1MA 3EVNA 3MAAC 1BXRA 1E5QA 2QQ0A 2ZATA 3PX3A 4I36A 2Z30A 4LK2A 1XEAA 3M34A 2WFZA 4MV9A 4WOKA 1KTVA 1LX7A 3DE3X 4HI0E 4PX9A 3IJ5A 4B8ZA 4KB5A 5JEDA 5KTPA 3ZIAA 3OOJA 3QIAA 1Y3FE 3DCYA 4YGXB 2JHGA 2V5UA 2ZJAA 1EFAA 2Q41A 4HGZA 4ZT4A 3DQQA 4Z0TA 2EARA 1TM4E 3ZV3A 2ADOA 2IDKA 1PKXA 4HSEA 5HE8A 4ETWA 4G23A 1K68A 4HWOA 5DIFA 3PRKE 2LBPA 3C6YA 2OHJA 3FGOA 4IGAA 5CB6A 3AIMA 4Q3EA 3IEKA 4UJ3A 2P6NA 3MIZA 4O4IA 1P81A 4FW8A 1VZ2A 5HIMA 1DQYA 4B2IA 1TVKB 2GN6A 3KUCA 4QBFA 4WOCA 3VKUA 5C4GB 5CBPA 1ZIOA 1J09A 1TZ2A 3W8FA 5I7FA 2PZ8A 3RRYA 1W30A 4D3FA 3MOIA 6LDHA 1UK6A 1TAQA 1DO2A 3C43A 4JLJA 2WJGA 3A4YA 1KY3A 3IYLW 3DEJA 3M6AA 4NYIQ 5AVJA 4PR0A 1T5HX 2IXEA 2VYND 3DFKA 5ALRA 1XIVA 1QIHA 4OP2A 2AJLI 4EJSA 2JLWA 3E9EA 2LRHA 4KHPB 5A2GA 4DR1B 1NUTA 4AYTA 2I66A 1C8KA 2GYUA 1FSFA 4G8JA 2XNCA 2I71A 1GSIA 1H8HA 1K08A 1W8IA 4I9FA 3RTAA 1UPXA 5E2BA 5EKUA 4DQLA 1E3WA 1MV5A 3VTZA 1NJGA 1IONA 3R4CA 4O2BB 2MCFA 2X3FA 2G9NA 1Z0AA 4RZXA 5AK3A 4GP6A 2OHFA 3AC0A 3IBCA 4ZYWA 1U80A 3WIUA 2HUPA 3NQ41 3DHYA 5AM0A 5F3DA 1OFIA 1WF6A 3CWZA 3DR3A 1I4DD 2YN0A 2ZR7A 3EMBA 1WHTB 3CB4A 2IS1A 4INAA 5TXGA 2QRHA 2PBFA 4V0QA 3VJRA 3OAAA 4YCCA 1TJ4A 1YUNA 2PEYA 1T2FA 2GM3A 5K0ZA 5FAKA 2MYPA 2ODQA 3SHOA 4DCGA 3N2IA 3SJZA 4EGFA 1Z47A 1QU2A 4LHYA 4DY4A 2XA1A 4K9KA 1WEHA 5EWMB 3GFVA 2A5FA 3OPYI 2F3UA 3ILSA 2D59A 3OY7A 5G4KA 1Y5MA 2AT1A 2H4FA 1SD1A 3GEGA 5CX1B 1RKXA 3OEED 1CUZA 4P3NA 5T3YA 4UBMA 5M5BA 5LCXA 1TZJA 3V4RA 1JVNA 3TINA 4BUCA 1W4CA 4A91A 3KT3A 2MMCA 3V7WA 5I01A 4MHTA 4MVJM 4IHAA 3L4BA 3JQAD 2OT3B 3SFVA 4MS4A 2GD1O 3L5KA 4HEHA 4IV0A 4MWZA 2JFYA 2HNBA 4KR0A 1P0CA 5DTQA 5LQSA 2RH5A 4CTMA 1C29B 3ESQA 1E2BA 3CLSC 1CRLA 3FE2A 1U8ZA 3GVPA 1SKUA 2ZW9A 1SVSA 2DWUA 3CF4A 4HGRA 3KHSA 3WHLA 9MHTA 2C1XA 3MG9A 1P0PA 5D7BA 1Z7WA 2JVKA 2Q4TA 2XB4A 5DIZA 5EE1A 2F59A 2FX2A 4Z5XA 2R00A 4YAUA 4ZRDA 4GBGA 2DPYA 1L1RA 2PZJA 2RMKA 3ZDDA 4B84A 4ERXA 4NMXB 1OLSB 4MDYA 2BMDA 2YRFA 4V3CA 2OV8A 4GLOA 4H31A 2J0SA 2OESA 2OXCA 4F3TA 3V7UA 1GTZA 1G0NA 3OZVA 3QLJA 5DN9A 1LNZA 3HNPA 4CMAA 5A62A 4HEJA 2PIDA 4IWXA 5CIQA 5IFKA 2FDXA 3EEBA 1XXHA 1TVMA 1JR3A 1MX9A 3WLOA 1QOZA 1UBOS 2ACEA 3OE5A 2DU8A 3NH6A 3VSBA 3C85A 2P6MA 4BWYA 3GDGA 3FNFA 2OHXA 1UXIA 3GBSA 5C0OE 3V1NA 5J58A 4AS1A 3AV0B 1NQUA 1LV8A 1NDHA 1OLUB 2QIOA 3ITDA 4KVAA 4TV8B 1MB4A 1I7QB 1KZ7B 1WZNA 1T34A 3K70B 3ABIA 1OFUX 1BGXT 2WNHA 1QCDA 3ANYB 4ON9A 3IAHA 3WQHA 2BHRA 1XMPA 3AU9A 4ZVNA 1MH1A 1EGHA 3B7PA 3F47A 1XJWA 4RWEA 1T1IA 3QPWA 3P2EA 1KYYA 1YVPA 3DMPA 3AFNA 3MRVA 4KP7A 4QHTA 4B4UA 5JECA 4YFVA 1ZW1A 2KBEA 1BOFA 2IHYA 3M81A 3X2FA 4URVR 3CEHA 2Y1FA 4BKUA 3DYBA 5K0LA 1I7SB 4OHZA 3ECCA 4Y6GB 3HWSA 4TS3A 3L8YA 3ZV4A 4PPFA 2P40A 1A7KA 1LCIA 1D2GA 1DC6A 4PC7A 4U2CA 2RCYA 5G41A 2BFNA 1F9EA 1R27A 4S04A 1H8EA 5L53A 2O4CA 5J9FA 4GOOD 3RS8A 4DR4B 4FTWA 3UW1A 5DXFA 2QRJA 4C08A 3ROEA 1XHFA 2BGNA 4EMUA 3PPYA 1LKZA 2F9MA 3AVWA 3WGIA 1FNCA 1TJPB 3MMNA 4YV1A 3ZY4A 3ELYA 4NWIA 1YE5A 1XZAA 3GBPA 1BS9A 1YBAA 4JYCA 4BECA 3EXFB 2CY0A 4PTYA 1D6JA 2O5RA 2ZBGA 4ZVLA 4RZQA 3FHOA 3IVXA 1BX1A 4LN1A 2JGKA 1L5GB 1D9ZA 1E1MA 1KH3A 1P1JA 1UWLA 5BPFA 1C4WA 3ONFA 4KIUA 1TTHA 3H9GA 2AEMA 4OF4A 2NU9A 3D3EA 3DFIA 3ZDFA 4L5BA 5LJLA 3G1TA 4KG7A 3B6EA 5JXWA 2G1JA 3WFIA 2GEUA 4NPCA 2BZ0A 2MSDB 3RFCA 2X9NA 1BVHA 5GJVC 4G26A 2JFNA 4H7HA 1YS6A 1JHMA 4C1BA 4AG6A 5K2OA 2SICE 2BR3A 5AKIA 5E6SB 4BY9E 4MX8A 3QVTA 1HK7A 4U2DA 1VJCA 3OQPA 1WXWA 3WLIA 2X41A 4P80A 4NNOA 1JU4A 2N3ZA 2WWTA 3R8CA 2W6NA 3BILA 1QDEA 2X0RA 1IY8A 1JUDA 4MUMA 3QVMA 4UMVA 5BN5B 1EX6A 4RY9A 4XASA 4DGSA 3S44A 4PZLA 1NVAA 3E05A 4RM3A 1JHVA 2XQJA 3RU2A 3WGMA 1QRTA 3FYSA 2UUCB 1SB9A 4XJTA 1YWGO 2JD1A 1EFRA 1DC8A 2PH1A 3K0KA 1Y6QA 2PD6A 3IP3A 3MOGA 4HCJA 4IKPA 4DT1B 2H4ZA 3CR7A 1HLDA 2JASA 4F72A 4P3PA 4ZOAA 3DHNA 4F60A 1GZDA 3QMVA 4BQSA 5IF9A 3C3WA 4H1VA 1EM8A 5DBOA 3W7BA 3W9SA 2FUNB 4RVDA 4YRRA 2C7GA 5G3YA 4WDRA 4HUJA 3U2QA 2JAPA 1J7KA 1YIOA 2R1TB 1O6ZA 3IVCA 4TVOA 1R4MA 4X7MA 1DB3A 5JATA 3QBDA 4HQLA 1AMNA 2IHJA 5AM4A 3JYNA 2H9AA 1I5EA 4ZOLB 3RREA 1PD0A 2BONA 3ZV7A 3MCAA 3FTQA 2WTEA 1P7YA 1UBRS 2YCLA 2ZWMA 3DL0A 1MXHA 1GD1O 4C78A 3P27A 5CDFA 4IUCS 2H1LA 2I91A 4ARCA 3OFND 1QIIA 4EW3A 1HDIA 3ESRA 2TMDA 1LXCA 5BR1A 1TKCA 4LS3A 4A36A 5JS6A 1DX9A 4RLSA 4B7CA 4BFYA 3IUYA 1CF9A 4EUKA 1H2EA 2BEWB 1TYDE 3KDPA 3QPCA 2GILA 5JNVA 3OF3A 1PYGA 2O8NA 5BURA 2AG5A 2XZTA 4F86A 3BMCB 2RC6A 2ZTUA 4NJMB 1DG1G 4O6VA 3GD5A 5ITZB 1IZ7A 1E4VA 4O2AA 1S2IA 3MS2A 4Q7LA 3FMGA 4DUGD 3U7FB 1XVUA 4YAEA 3EXEB 1T3ZA 3ADKA 5BMVF 1KO7A 2PLWA 4A3SA 3Q5DA 1M2OA 1QHSA 3OOSA 4UDYX 5T6MA 3F7OA 4EK9A 1ZYUA 1ZI6A 1CFJA 1N6RA 3ACDA 3PVSA 1XLVA 5DT2A 1M5RA 3OIGA 1WETA 1ZUNA 2Y4NA 3QP9A 3FF4A 1JEEA 1Z0KA 1PTKA 3T7AA 1U5AA 2C1EA 1C80A 1X6VA 3LRTA 1EM6A 1ZLXA 3AR5A 4MJ3A 4UUBA 2H4HA 2EFEB 1I3CA 1F5NA 3K20A 3ASVA 3OZBA 1SU6A 4BNFA 1YDGA 2O05A 4IMIB 4Q93A 2AD5A 4G1EB 3X1WA 3D6UA 3DZFA 2ZCJA 3I8OA 3E53A 2GAFA 1HLFA 4K6CA 1V96A 1XD2A 2DWQA 2P65A 3T95A 1Z5GA 1YL6A 1YQ9A 2WFMA 1THTA 1V95A 4PQEA 1KYWA 3T3EA 4D9EA 1XLWA 3BJIC 1TJ3A 3UYLA 1ZN2A 5KPJA 4JA2A 3A70A 4H16A 4NV1A 1K5PA 4U7TB 2WTNA 4C87A 1TMKA 3DKKA 3HPRA 5EUQB 3ENZA 4N8SA 4BIIA 3EIFA 4EFLA 1QC5B 3I1FA 1BWPA 3H6HA 4Q3CA 3DO5A 4Q1EA 1GFSA 2P4HX 4WD3A 1RZVA 1W4LA 5CT4A 3I2HA 1DCFA 4XVUA 3LKZA 1PJ4A 4PM4A 4B34A 6REQB 3WGZA 1Q15A 3ZHRA 3CZ4A 5EJ8A 2H2AA 1DWOA 3PITA 5JJ5A 4LDPA 2QMQA 4UM5A 4MH0R 3QY0A 3LIIA 1DBWA 4IJVA 1L5HB 2BBOA 2QW8A 4KWHA 4ZI7A 3CH7A 1JAYA 1JHXA 1U6KA 4AY3A