2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
5DYGA 3AB3A 2OBNA 1OJLA 2FWRA 4QKQA 2VQSA 5G3ZA 2FOLA 4LV6A 1W47A 1HT2E 1N5IA 3KJEA 5JWRA 3G0HA 3VKHA 5EZ5A 4L4UA 1TNDA 2C96A 2HF8A 2G83A 4TYWA 1E2KA 3MGCA 3EZ9A 4LRWA 5EXTA 1NRJB 1IAQA 5TV2A 4FMCB 3UK6A 2NG1A 2BBTA 4M1SA 3RSOA 2WJYA 5DI3B 1A4RA 3ADDA 4XJXA 5J40A 3W3AA 3W6PA 1N0UA 4CDGA 1D9XA 1E9BA 1VCIA 3JZAA 4D2IA 2JLVA 1E9CA 2WICA 2C77A 3QF4A 4UJ3A 1SXJE 3I8XA 2Q6TA 1F3OA 1E2PA 1DELA 3MJHA 4MITA 3V4RA 3MSXA 4WA7A 2Z4SA 3KXKA 5C4MA 1VCOA 2G88A 5LPNA 3U2QA 1AS2A 2Z4RA 3U4QB 3IHLA 2BEKA 3SBEA 1BO6A 1NJFA 2D4HA 5EP2A 1UKYA 1N0WA 4TMZA 4Q4JB 3K53A 5FTMA 4DDVA 3TGPA 3BH6A 4B34A 4OHZA 4ZDKA 1X86B 2QE7A 3BFKA 5AUPB 4LBZA 1M7GA 3L82B 1Z29A 1OHHA 3GFTA 3LRPA 2WZQA 2OESA 3SU8A 1G7TA 2GA8A 3KDSE 2VF7A 3RRNA 3CX6A 1U8AA 2RAPA 5KPJA 2ERXA 4B35A 1ZVQA 2EFHB 2QTFA 3BOSA 2IS2A 1II8A 5IK2D 3U3MA 3QG5A 4Q47A 5HE9A 2OLKA 1G8HA 2QTHA 1RYFA 2XZPA 2PT5A 4X8MA 1XXHB 2CEAA 4ON9A 1Q1ZA 1CR0A 2KE5A 3NG1A 4NKRA 3Q3JB 3HU3A 1UF9A 3EWAA 2IF2A 3K1JA 1SVLA 1W4AA 4Q4AB 4RD3A 3THOA 4F7WA 1FZQA 2GVDC 2FPMA 3IBYA 2VP6A 5D3QA 4ZI3A 2HJVA 1VPLA 1QVRA 4B43A 5K8UA 5AK0A 5TXGA 1QHSA 4OK5A 2ZRIA 3TAUA 2V1UA 4PQRA 3CR7A 3GLIA 4JKIA 3CNNA 1A1VA 3WYGA 2HLDD 1G20E 2D74A 2ZI6A 2FG5A 2J46A 1NBMA 2X1VA 3K09A 2CCJA 4JLJA 1S9HA 3WNDA 5JJKA 1E4YA 3CH4B 3OE7D 1AK2A 2AX4A 1IJFA 4BASA 2ZI9A 1DO0A 1SKYB 4D26A 1QHHA 1KZGB 4M8NE 4WW0A 1M7BA 1Z0AA 2OBLA 3ADCA 2DFTA 2WKPA 2DY1A 4V0NA 4WXPA 2FPKA 3M6AA 4EJSC 4U7DA 5EE5B 2IYVA 5KSPA 4ZKEA 3OIWA 4LZZA 2B92A 2ZYVX 2ZREA 3GPLA 2J0VA 2F9LA 1E2IA 2VPPA 2Z43A 3NHAA 1OXSC 4FIDA 2IUUA 5FPYA 2XXAA 3MJRA 2XTZA 3KTAA 1KI6B 1XCMA 2O8DA 3Q85A 4KBGA 1I2MA 2JLWA 3A1WA 4RFSA 1MO3A 4LYAA 1JI0A 2NO7A 3UG7A 1CJMA 4V02A 1DAIA 4NDZA 1P2SA 1R10A 2E9SA 2QP9X 2ZRGA 2F1JA 4HLUC 4KLZA 1LW7A 5UKDA 2CNWD 4V0MA 1KI8A 1Z6GA 3EG5A 5J4HA 3LX5A 2F1HA 2RHMA 2O8BB 2OFXA 3SHWA 2RH5A 4PO8A 3DM9B 1E99A 2QGZA 3MWYW 2ODBA 4TTQA 1W36B 1R5OA 5JECA 1W4BA 3Q5EA 5LB4A 3T1TA 3O8RA 1ZC3A 1F2UB 2W6JD 4IOMA 1VKJA 4KCGA 2BMDA 1EG7A 4MRVA 2YJTD 2P3SA 4UNRA 1W36D 1M74A 1G21E 3P4XA 4GZLA 2GRJA 4EDHA 5KTYA 3AP1A 4KHZA 1OIXA 4TN1A 2MMCA 2J9RA 2YV5A 1DADA 3W9YA 1HY3A 3BFXA 4M1OA 3KQUA 5K8LA 1IY1A 1F5NA 2YC2C 2RGCA 3TBKA 5F98A 1XTJA 2QRZA 4IHQA 3RRYA 4UNQA 1JXMA 1LVGA 5EE1A 4OK3A 1KGDA 1JXOA 4Q02A 4DIDA 1TQ2A 2AFIE 3CKLA 1DS6A 4Q9IA 3KB1A 4L8GA 4W9MC 3K9HA 2WWXA 1GL7A 3B1VA 4PO9A 3CF6R 5FUYA 4A2PA 4G01B 2IS6A 1FUKA 4GP6A 5DISB 1ZU5A 1OH7A 4PZZA 3JVUA 1E2FA 1FNNA 3KL4A 3CPHA 2J7KA 3M4YA 4CEIB 1EWRA 1OKKD 2ZPTX 4LV8B 4MRSA 3C4JA 2XZLA 4DEXA 2ZE5A 1WA5A 2ZRLA 3QKTA 2J7PA 5FBRB 1LF0A 3CPJB 3X1XA 1Z0IA 3DL0A 3B13B 2XAUA 4ASUA 5GADl 4LYJA 4EFNA 8OHMA 4TL9A 1OH5A 4I1OA 5FTJA 3T5DA 3V00A 4A82A 4AY2A 1N0VC 3EAQA 2QP4A 3LY5A 3QENA 1E98A 3I73A 3BJIC 5TY0A 5JJLA 2YZ2A 1JR6A 2ZE7A 4O2RA 1U81A 2J0QA 1T3HA 3WBJA 2ZROA 2ZRAA 3QE0A 2V3CC 4MDEA 2B8WA 1DVRA 2ERYA 2YVUA 1DAEA 4KVAA 4TQUS 4B3FX 1NNEA 3ICQB 4Q19A 2D2EA 5GJBA 5KNBA 3A1SA 4P0TA 1B0UA 4EPWA 4A6PA 4OL0A 1RRPA 1QG2A 4JL5A 4JVLA 4R2HA 4C0BA 1X8JA 2YWEA 2JJ1A 2GETA 4ZIRA 5JI3E 4D4LA 3EC1A 2VP5A 4HAZA 1BYUA 3D31A 3DEFA 1M7HA 2FSIA 4JKYA 4MUAA 4DIEA 2BKEA 2QPOA 2NZ8A 3CM0A 5C2JB 1HUQA 1XXHE 4DLZA 1ZD1A 3GLHA 5SZJA 2PX3A 2AD1A 5KNDA 4J0QA 4LJ8A 1E9DA 2ORWA 4DSUA 3P1JA 2IS4A 4Q5IA 5KNCA 1TAGA 3OAAA 3V4FA 1YQTA 2BVNA 2CJWA 1SHKA 2EFCB 2P0EA 2HXSA 1MRNA 3TRFA 1YZGA 1ZU4A 1UM8A 1N5LA 4XVQA 3RANA 4WAUA 1NIPA 3HYRA 2XB4A 4EJSB 3NKVA 3GJ4A 4QRHA 2RGAA 1EK0A 4NYMQ 3RWMB 3AKEA 3HJNA 3IHWA 3EPKA 3AH8A 3REGA 2YOFA 5DYIA 1NI3A 4MRPA 1FX0B 1YR8A 2HF9A 2W6ID 5BN5A 3KQNA 3U7GA 2CLSA 4JLNA 1W4CA 1OFHA 4NL4H 4WZAE 3K0FA 4TT3D 1OYYA 2R44A 5DSZA 4B3GA 3IBGA 1ZM4A 4OI0A 3U3JA 5DGXA 2IF0A 2QPTA 3FKQA 4RKEA 3SZRA 3W90A 2YOGA 4ZKDA 2JJ2D 1XWIA 4AKEA 5HZKA 5EUMA 3KUDA 1HH4A 3U3OA 4U5XA 4N0EA 3ZS8A 3QJYA 1VG8A 2W2XA 3GD7A 3OZXA 2ZRMA 3PENA 1PUIA 5FPHA 2DFKB 2O0KA 4GSYA 1W4RA 1MKYA 3RABA 2GXQA 2XJ9A 4LPKA 3TUJC 4MQBA 3KKPA 3L2OB 3TQFA 4RCYA 1ZJ6A 1IY2A 3KKOA 3LXXA 1WE2A 4G5OA 1XTQA 3CIOA 1OT3A 1Z3IX 3HR7A 1N6KA 1XB2A 1J8MF 1WBBA 3A1TA 3K0AA 4U00A 1AJEA 4QOSA 4QBHA 2RGNC 1G16A 1QVAA 1CJTC 2CE2X 2Q3HA 5GJWC 2PEYA 4F92B 1GRQA 4O25A 4MDFA 1EFUA 3FPAA 1Z0JA 2PLRA 2C98A 2O8FA 1ANKA 3NEJA 1PVOA 2ZE6A 5JHHB 4WZBE 3GLFA 2GF9A 5G41A 2OAP1 5SZKB 2ZU0C 2A30A 3LLMA 1JECA 1Z0FA 2ZAOA 2O0HA 4OK6A 5CDFE 4ARZA 4OQXA 1N2CE 4L5BA 421PA 2G77B 4DC9A 4I99A 1XD9A 1ZM9A 1R5NA 3NDPA 4FD2A 3UANA 4PC3A 1E9AA 4JIMA 1E1QD 2FA9A 3PUYA 3B9PA 4KI0A 3QPVA 3THYA 1HE1C 4TYPA 4NMMA 1GRNA 4X8LA 5L3SB 5KSYA 2QG6A 1MO4A 3L0IB 1P60A 1H8EA 3KJIA 2VTKA 2LKCA 5CYPA 1P6XA 1PJRA 1XCGB 4Q1FA 4C7OA 3CLVA 1W2HA 4MYUA 1IOZA 1G291 4HSEA 4CEHA 3SS8A 1TF5A 3BGWA 3IIJA 3B78A 4B76A 2V54A 2ZS8A 1OXVA 1XTRA 3OIYA 2GKSA 5FPSA 1KI1A 2YWFA 1KO8A 2BIFA 2JATA 1AQYA 1SKQA 1Q0UA 4I81A 2VSXA 2MSDB 4BZXA 4EPXA 1R0WA 4QL3A 5A0FA 1E0SA 3SFVA 1IXZA 1TADA 3SJZA 2I3BA 5KYKA 3ZD7A 4LJ9A 3KX2A 2IYZA 2JLRA 4HB0A 4C3ZA 2D62A 2VEDA 3AQ4A 2ZU6A 4RY2A 2WV9A 1I4TD 4CRWB 4D6PA 2ZS7A 5EXPA 4AI6A 3PCRB 2XSZA 2DFLA 3B7GA 3LDAA 2KSQA 1IQPA 1YZQA 3AVYA 1AIPA 2X2EA 1W0KD 2AHOA 5IT5A 3ZGXA 1G9XA 1N6OA 2W58A 4C2UA 1P9NA 4TMWA 4YC7A 2GEVA 5EXXA 2YOHA 1KY3A 1S8FA 3WBKA 4RFVA 4MRRA 3D8BA 4M1YA 4QM6A 1ODFA 3B1WA 4LWZA 1KJYA 1YZUA 3VTKA 1JR3A 1C4OA 2HUPA 1X6VA 4BZPA 4D81A 2XNDD 4KSCA 3U3KA 4TLBA 4UQOA 1OF1A 4OKSA 4YMWA 2VHUA 1JB1A 4A1FA 4DLTA 2OXCA 3LBNA 1HTWA 1KMHA 4BZQA 2XTMA 1A2KC 4B3XA 1K8RA 4GL2A 3I32A 1NN5A 4DCVA 4M2LA 5E7JA 1IXRC 2WAXA 4QJ4A 1QRAA 1KAOA 3AVQA 4TMXA 1B23P 2LWIA 4PPGA 1T91A 1UEIA 1XDBA 3P27A 4OQNA 4NYIR 3GLGA 1XTSA 3NBXX 2GESA 3K9LA 3IILA 3W6OA 2LKDA 4BFWA 1F2TB 3ADKA 1CR4A 3A6PC 4XD7D 1P72A 3LBIA 2JAQA 2OILA 1SXJB 3SJBA 5EP4A 4Q4HB 3N5CA 2AFHE 4DUGA 4QJ3A 4IDQA 1E2LA 3DDCA 3MRSA 4EQ6A 4HLCA 4B2PA 4YDSA 1OB5A 1KSHA 3F8TA 1AZSC 5EE0A 3Q72A 2CL6X 2QA5A 1OSNA 1CLUA 4PHTA 4TMTA 2ZI7A 3VX3A 2O8CB 1Y3AA 1AM4D 4G5RA 3UMSA 4A9AA 3PITA 4OJQA 4OHWA 5KO2A 3SQWA 1N5JA 3B1ZA 5FL7D 1E1RA 2J5XA 3FOZA 4XTCS 3DKPA 4BUJA 3R9WA 2F43B 2OCAA 4LBYA 2KJQA 2H18A 3T5GA 2IT1A 4FN5A 4TLCA 2WOOA 3K09C 4IDHA 4Q7JB 3S1AA 2HYIC 3L8ZA 3F5FA 4GZMA 4DRZA 4M21A 3AVUA 1WRBA 2X8AA 4JT4A 3WNCA 5AUQA 1XD2A 4A8JA 3W5IA 2ZXUA 1MABB 1SVOA 4QNRA 1IBRA 2CL7X 3OHMA 2Q21A 3SN6A 3CR8A 4GOXA 1G8PA 4LJ5A 2JLYA 4CT4B 5ANRB 4HUTA 4TSFA 1NSTA 2FZ4A 3IQXA 4HAWA 4Y0AA 3FGNA 3SYNA 3NTUA 1P2VA 2BOVA 3QPUA 1E3MA 4U02A 2OFWA 5FL3A 2JLXA 1S96A 3UATA 3EZ6A 3ZQ6A 5DN6D 3EIEA 2B8TA 3TJZA 4PHHA 2CK3A 3QNUA 4NTZA 1COWD 2ZQ5A 4P32A 1EX7A 1Q1QA 2GNOA 1K5GA 1TQ6A 1E2DA 2K5UA 3SI7A 4C0JA 1VECA 1X8KA 4LJ7A 3ZDQA 3P26A 3VU9A 1S1MA 1D2MA 4A4DA 1GRRA 1XD8A 1KIMA 2FSGA 1YKSA 2GJ8A 3PUWA 6Q21A 3AKCA 2PX0A 4KO8A 4CEJB 3N2EA 3SHFA 3NH9A 1DAFA 2MSEB 1BH2A 5FH9A 2WSMA 2IX3A 2A2ZA 2VP4A 2ECKA 5AWFC 3EW9A 1S4QA 4QM7A 2Q9BA 2C99A 4Q1CA 3UPUA 4PPQA 2CHVA 4JYCA 5JSZA 1W44A 1XFAA 3A36A 1K6MA 2IYYA 3CNOA 2CCGA 5G40A 3KQHA 2OG2A 3KXIA 3QKSA 1DE0A 3BH7A 4FCTA 2UKDA 5JCZA 3JZMA 1MV5A 1R0YA 4BRWA 3AKYA 1IN4A 2FH5B 5F2EA 1LNZA 2VYFA 3OEHD 2WWGA 2G3YA 5KU1A 2VH5R 4AG5A 4MRNA 2IA5A 1BOFA 2PJZA 2W00A 3MD0A 4KFRA 3F0TA 1NVWQ 1NKSA 3NC1C 2IC5A 4A36A 2X19A 1P4SA 3A58B 2O8EB 3C14C 3TQCA 3IPYA 1XPRA 1D8TA 2FE4A 3LQQA 3QF4B 1XEXA 3U3RA 4L9WA 3C41J 5HPYB 1V5WA 3WHLA 3QQ5A 3HDTA 3KKQA 4LHXA 4KXFB 1YJ5A 4GI7A 2H7VA 4D0NA 5JWOA 1XNJA 2ZI4A 3VR5A 3U6KA 3PEWA 4FMBB 1NIJA 5JEDA 3WNBA 4TMKA 3Q7QA 4XWAA 1CR2A 1NMYA 4CF7A 3PEYA 1ZUNB 4KVGA 2AKYA 4C0LA 2CXXA 3RSLA 1UDWA 3KJGA 2RGEA 4ZO4A 3BERA 2QE7D 5D3MA 1Q21A 1TX4B 3K70C 3NDBB 3FHTA 2Z5FA 4LHWA 3TR0A 1BIFA 1OHHD 1WDTA 1NVXQ 4WOPA 3QVUA 1G19A 5DHAA 2QT1A 4C9BA 1GTVA 1M34E 3MLEA 5DLQC 3RYTC 1W7AA 2PCLA 1FTSA 5LB2A 2P67A 5HZHA 4MYHA 1NLFA 1UKZA 1ZD9A 3B2EA 1AN0A 3BXZA 1WB9A 2C04A 3A37A 4M0LA 2QRNA 1EFHA 2VIIA 1HT1E 2ZANA 2IUSA 1QHYA 1KJWA 4QHSA 3CRMA 3WYFA 1G3QA 4YONB 3E70C 3GCGA 4H1VA 4WIAA 4L16A 2REBA 3CH5A 2DB3A 4B2IA 1OE0A 3QVVA 3C16C 4BFTA 1FOEB 3BRWD 1WCV1 3QSYA 5TVKA 3OEEA 1QHHB 2PZFA 2ZVQX 3QBVA 3FB4A 2VF8A 5E4FA 4HZUA 1E0JA 1NBMD 1SVKA 5L3QA 1NSFA 2QAGB 4BRUA 3MFYA 2JLSA 2ZSDA 3DOFA 2VP9A 1GG2A 3SNHA 4XSGA 4NCIA 4B3BA 2BV3A 5B64A 4HZIA 3ZVLA 2ODEA 1T4GA 4KSBA 3VHLB 1D2NA 4HAXA 3AP3A 1C9KA 1VYTA 2WAYA 1XEWX 4M9ZA 2GTPA 1GZSA 3CRVA 1GNRA 2O8DB 3VNVA 2ZUCA 4Q03A 1E0AA 4D4MA 2AWOA 2HEIA 4ESVA 5AUOB 2HT6A 2OXRA 5CK5A 3A4MA 1N6PA 2GK6A 1NMXA 2BEJA 3LVRE 5C4GB 4PTLA 1S9DA 3ZZUA 3A1UA 1TQDA 2YWGA 3ZYCA 1DAKA 1RPZA 2QZ4A 3AGPA 4ZI2A 4IEEA 4LPSA 3EPHA 2HXYA 5FR2A 1D5CA 3I72A 5C18A 1CBUA 1Z5ZA 2ZJOA 4A2QA 2C5LA 2QY9A 4MYCA 2JDIA 2VHCA 4URXR 5CK4A 2WMOB 4WBSA 4DLUA 2EVWX 4CYMA 2WJIA 1XEWY 2ZRBA 2DBYA 2WWWA 2GCOB 4E07A 4L15A 3BE4A 4DHEA 3PFIA 4YXWA 3UWKA 2DWQA 1S0UA 2FSHA 5IHPA 1OIVA 2IUTA 2WWYA 4BLOA 4QGHA 1AZTA 4HAUA 1ONBA 2FFBA 2ZSBA 3AF0A 1U9IA 4US2R 2FF7A 4DCTA 3IUYA 3W5JA 1E9SA 2DPXA 1DARA 1QZXA 1BMFA 1VMAA 1KKMA 2DHRA 3KKNA 2QPAA 4YMVA 3BFVA 5BN4A 2AL7A 3VAAA 1ZM2A 3R9XA 3CZQA 3U4QA 2OEPA 3CO5A 4AYXA 3WHKA 4DVGA 4CW7A 2Z0MA 4M4SA 1IONA 4Q4JA 5JS7A 3ASZA 1K5DA 2R6AA 3BB3A 3FMIA 1DAHA 1EESA 4AURA 2JLQA 4IOJA 4RD0A 3FWYA 4NCKA 3MWJA 2WJHA 4XOIA 1KI3A 1R4AA 3KJHA 1G8YA 4R71A 1HQCA 1OFIA 1X1SA 1SULA 3HWSA 4BFVA 2GHIA 1W49A 4FXPA 3QI2A 4BECA 3EA0A 2D3WA 4BLRA 2CCKA 4XSHA 1R6BX 2YINC 2IYWA 1EFTA 1XJCA 1Z63A 3A1VA 1RE0A 1G4AE 1J90A 2J1LA 2JGNA 5C1BA 2F6RA 3IQWA 1L4YA 1FQJA 3WP0A 1XPOA 2BCJQ 4PANA 4AWXA 5CIQA 5HR5A 4MH0R 2VL7A 1ZP6A 2J7PD 4M1KA 4XIGS 3U7HB 3KFXA 5H70A 1U94A 1E2JA 4I1VA 2L0XA 1FP7A 1UKEA 4ASUD 2XNSA 4KJZA 4IEIA 4IJMA 2CLDX 3CONA 2RHDA 4LSGA 1P61B 4BEBA 3K70D 4PXAA 2FEMA 1KDOA 3AEZA 3ZVRA 2J3EA 4RKFA 3V9PA 2C78A 5AJZA 1XMVA 2GZDA 4DWJA 1MO6A 2P2LA 1KI4A 1QG4A 1VCMA 4ZIRB 2O5VA 3U44B 1LS6A 3CW2A 4W5HA 2WWFA 3B60A 4XVUA 2LCFA 3SR0A 3VHXA 5HKKA 1F60A 3LA6A 1D2EA 4QG7A 3I5YA 3GLHB 1Z2CA 1HV8A 2JJ1D 3EWSA 5C46F 1G1MA 5JLJA 5H8WA 2ZS9A 2QN6A 1GL9B 3QEJA 4PZLA 1KI7A 1KMQA 3HPRA 3HR8A 2QBYA 1VG0B 1T8UA 3OFNA 5FOTA 3AUXA 4KFUA 5KDLA 3AUYA 5JEEA 3GLIE 3CX7A 4LOAA 2F3RA 3OAAD 1KNQA 2OFOA 1PLJA 4NYIQ 1NBME 4RD1A 1YVDA 2H57A 3L0OA 4JBXA 1S1CA 4A0FA 1H8HA 5A5GA 2ZI3A 3NC0C 1T5LA 4ZV4A 2C9OA 2HCJB 3GEEA 4A2WA 1F6BA 2O8BA 2FZLA 1HE8B 2CHQA 2ZUBA 4EIWA 4PC1A 1SGWA 2QSZA 2BJVA 1F2UA 4A0RA 1QDEA 4OYHA 2WSSA 721PA 5L3RA 1US8A 1TEVA 4JJKA 4IRUB 4OBEA 3BS4A 5TB5A 2CHGA 3LFUA 4R9UC 1KTVA 1ZNYA 3NBFA 1AS3A 1R5BA 2BM0A 3AGQA 3EARA 3FDIA 3IO3A 1E2HA 4LGMA 1T0HB 1Z2AA 4HDQB 4Z8XA 4YMUA 1NJGA 1XPUA 1CIPA 4D0GA 1ZCBA 3M0EA 4A8JC 1Q44A 3T61A 2UZIR 1OYWA 4N1AA 4R7ZA 2ZRNA 3R7WB 2WMNB 4V0ME 3Q8XB 4QGGA 3IIKA 1ZBDA 2GDJA 4O2LA 3F3YA 3I1FA 3QPWA 5GVRA 521PA 2O8FB 3C5HA 4TL6A 5FBLB 1JALA 5F9HA 3L43A 3QXJA 2EWWA 2P6RA 1Q22A 1FP6A 1KHTA 3K8YA 3MWLA 1Z6YA 2QQEA 1LF5A 1NN0A 4G5QA 4M53A 3TSOA 1JPNA 2A9KA 4ACAA 3K0CA 1NY6A 3LWNA 2VBCA 3EASA 1W2GA 3I92A 2XOKA 3OESA 4MYTA 2R8RA 3GJ3A 2FGKA 4JLVA 3FTQA 2ZJBA 1P7CA 3PEVA 2Q0HA 2V1XA 1Z08A 1Z47A 3BB1A 4IW3B 1IXSB 3I62A 1EWQA 4Z54A 3I8SA 1L8QA 4PC2A 2A78A 1E4VA 4PHGA 1TTTA 1E2QA 1W5SA 1WQ1R 1G3MA 2WOJA 3CUEF 4URYR 1ZW6A 1G18A 4EPTA 3THYB 3TVTA 1XZPA 1T5IA 1AKEA 3SEAA 1VG9B 2OAQ1 2XITA 2NO1A 3EPJA 2PLFA 4Q1BA 3L0PA 4DCUA 4C7OB 2CL0X 4C0AC 1UDXA 2YHSA 4JLBA 4Q9JA 5EZ6B 4PSAA 2V4ZA 2PBRA 3RDPA 4V0KA 1AGPA 1RRCA 5EP1A 4JLMA 1KYIA 3CF0A 1H8ED 1JAHA 3I4LA 4DLYA 3GQBA 2E1RA 2J0SA 1FMLA 2IBMA 2WJGA 3AKDA 1M2OB 3AVWA 2PCJA 4D0LB 2OO7A 4A92A 4P4SB 4TLAA 1LV7A 4AYTA 3LBHA 4HI0E 5H68A 4C2TA 4UNSA 2HV8A 3PQCA 5F9FA 2TMKA 4C0SA 1YZLA 5J4KA 3BB4A 3FHCB 1KKLA 4KYIB 1ZIOA 2B7BA 3RS0A 1W0JD 1E9RA 1TUIA 4HUQA 1L4UA 3CRQA 5FUWA 1Q57A 3CWZA 4G3XA 4RZ3A 3FKSA 1G41A 3RC8A 4B71A 3AF2A 3RS5A 4KLNA 5E3HA 3WYAA 3EPLA 2A5FA 2IXGA 5FI0B 2BMJA 2B7CA 2XSZD 4RD2A 5E7MA 3QKRB 4LC1A 1NVUQ 4NPHA 4QGFA 4F91B 4LYFA 1RVDA 3H84A 2HJGA 1MT0A 3P20A 3AF3A 4MGYR 3EX7C 2IYQA 3AVTA 2QGNA 2REOA 4R98A 5FOUA 4JLOA 3K0EA 4IFBA 2JIZA 3VR2A 4A6XA 1KDPA 2H5EA 4JL6A 2BC9A 2GK7A 1ETUA 3EZ2A 3MCAA 1DAGA 3J81k 1JR3D 2VP2A 4F38A 4TYQA 1CJUC 4TYYA 3D3QA 3E2IA 2C03A 1ESNA 1FX0A 2OM2A 3PIRA 4MKHA 3ZLJA 5E7IA 1LY1A 5TDHA 1TPZA 3ICEA 3THXB 2VHTA 5JFGA 2GWHA 1T8TA 3CX8A 2C95A 5DO9A 1P2UA 5KSZA 5FUVA 2N42A 1E9FA 3GLHE 4PAQA 4AK9A 1GDDA 1N6NA 2GZHA 1CJKC 2G0TA 2ZIAA 4HEJA 3K0SA 4JLKA 3ZQJA 4QGAA 4JT2A 3TKLA 2ZE8A 1VIAA 2N46A 2C2HA 1HEIA 1UJ2A 2EFGA 3K9NA 1CS4C 5FI1B 1TU3A 4EQ6B 2VLIA 1LB1B 3B5JA 5AR1A 4BLPA 1A2BA 4B6EA 1RJ9B 3H2YA 1YR7A 2J87A 1NP6A 2ZSEA 3WXMA 2IW3A 4Z1MA 3GJ0A 4M9SA 3I61A 2BJWA 1NF3A 2OCYC 4DUGD 3PUVA 2C9YA 4KITB 2HCBA 4FINA 1VIYA 1Z8FA 1E2NA 1HYQA 1GKUB 4TYNA 2BHRA 1E79A 4QJ5A 1N6HA 1G7CA 4PC7A 2BKUA 3T15A 4FCVA 1G6OA 3WP1B 2QEQA 2R9VA 1TF2A 5HCNA 1JJ7A 3T34A 4B6FA 2VSFA 1MH1A 1X1RA 3H4MA 1A7JA 4DB2A 2FPLA 2I1QA 4K8OA 3TUIC 1E1RD 2GBLA 3LNCA 4I1SA 3CRRA 3U6BA 4POAA 1R0ZA 1DPFA 4A8JB 1NY5A 3R9IA 5KDDA 5J5CA 1GIAA 1T0JB 2GVZC 2RMKA 3QIAA 3ZIAA 3IDQA 1KK3A 1T9HA 2J0UB 2ZRCA 3GFOA 5EP3A 1CP2A 2W0MA 4IXNA 4K46A 1GWNA 1KO5A 4X8HA 1TL7C 1RFLA 2ZETA 4BQSA 4PAMA 1OXXK 4P3YA 2J45A 1KSGA 4E5UA 4XH9B 2ZI5A 5DI9A 4LHZA 2IYRA 4JMPA 1TQ4A 3IKJA 4TSFD 4URZR 3TSZA 1KDTA 1Z6AA 5L3SA 1KO1A 2ZR9A 2OBMA 4HDCA 4JL8A 5CITA 4NYJR 3FMPB 5TARA 2RCNA 3GJ6A 2FDCA 5BWMA 2WIBA 3B85A 2C9CA 3TR5A 4D4JA 4ZDIA 5FPKA 1NL3A 1ZAKA 2QM7A 5EUQB 3AM1A 2CK3D 2R2AA 2ODNA 3PV0A 1FPMA 4EUNA 3GLFE 5BYJA 3LW8A 4RZUA 2VRWA 2PMKA 4B74A 2EFDB 2F9MA 4C0KA 4QHYA 5AJVB 4AKIA 1DBSA 2A5YB 3G82C 4TQ9A 3WRXC 1KDRA 1RZ3A 4Q7MB 1KO4A 4US1R 2CE7A 5K8TA 2BDTA 4Q9LA 1R0XA 2YYZA 2O0JA 4R2IA 3H1TA 3X1ZA 1UADA 2OZEA 3FYHA 4CGZA 5JCPA 5FTNA 1UEJA 4G0NA 4OHYA 1CRPA 4L9SA 1TUEA 1OW3B 3Q9LA 4P31A 4WXRA 3AV0B 1T6NA 2HYDA 3VFDA 1FQKA 1NG1A 1SQ5A 4IVRA 4UKDA 1XCPA 4LV5B 1CJVC 1U9IC 2QU8A 1GVNB 1P62B 3C7KA 2PMDA 2QROA 2GILA 4W7SA 2KBFA 1Q20A 3IO5A 3NHBA 4EAQA 1WXQA 3W3ZB 4UNPA 3QXSA 2CDNA 2QMUA 1ZIPA 4TWZA 2W0SA 1KSJA 3SQXA 3CB4A 3HU2A 2WJVA 3CRW1 621PA 1D9ZA 4DT1B 4URUR 3D6TB 2R65A 2AK2A 5IF9A 2AXPA 1JQLB 4JS0A 5FTKA 4AIIA 4ZCMA 4AC9A 2WWIA 1SVSA 5FFMA 4TLEA 4GBMA 4PAOA 4ACBA 1E6CA 1R8QA 1F2TA 3DPUA 4YDHB 4Z8YA 4RD4A 5EE9A 3KKMA 5AJYA 4RJLA 1SXJA 4GMXA 1U0JA 4OQFA 2H16A 1JPJA 1Z0DA 1XRJA 4KODA 1JR3E 1P9RA 3VX4A 4DDTA 2X77A 3MAAC 3ZJYA 4H9GA 3LXRA 4HATA 3HYTA 2GAAA 2IEYA 1N6RA 2NZJA 5FBQB 1Z28A 3FMFA 4FMCF 4EPYA 1CRQA 2R62A 1XJ0A 5CJPA 1T3SA 3RWOA 2ATXA 5J47A 3QEOA 2WTUA 1WP9A 4KFTA 4NCHA 2P6UA 3PVSA 4LI0A 3THWA 3K9GA 3PR1A 3ETLA 1DG1G 1BS1A 2F43A 2F7SA 2P65A 3ZS9A 1SVIA 2GCPA 5CM8B 2BCGY 1OB2A 1EXMA 1Z06A 4JVSB 1S3GA 3GLGE 1YR9A 4A0HA 4FW9A 1F48A 4B47A 3L8YA 5JI2E 2RGNA 1YRBA 1KY2A 1P9WA 1Q3TA 1VCNA 4G5SA 4GRAA 3SFZA 4A15A 3CBQA 2ZEJA 4OHXA 4GDFA 3ZZTA 2IHYA 4LHYA 4C4PA 5FOXA 3KXLA 1G5TA 4IOKA 4DBLC 1J2JA 2WHXA 2EWVA 4NP6A 4HZUB 2R6DA 4NCNA 3RS4A 4B3CA 4LYHA 5L3QB 1IN8A 1SVWA 1YZNA 4ZCIA 2OCPA 1ZNZA 4BLTA 2Z83A 4JLAA 1QHNA 3PEUA 4E09A 4B3DA 2EW1A 3P32A 3OEED 4HLQB 1SHZA 3SDZA 4B73A 5FTLA 3CZPA 3DOEA 1JNYA 3GJ5A 4UXIA 4UXJA 2ONJA 2F3TA 3T06B 3GJXC 4K81B 4LBWA 1X3SA 3DM5A 4TTPA 2QL6A 1II8B 3A4NA 4CEJA 2GJKA 5FBVB 4NCJA 2G6BA 1XTKA 4YMTA 2ZJYA 1D6JA 1NKTA 4B33A 4M22A 5H1YA 1OFUX 3B8HA 3SYLA 1ZMXA 2AD5A 3X1YA 4MGIR 1VHLA 1VYUA 1XU4A 2W83A 1FUUA 3GP8A 1OPXA 5LBIA 5BW8A 5JRZA 1UBFA 3MWKA 2SHKA 2WPDA 4IFEA 4S35A 1Z07A 3AVOA 1Y63A 5J4LA 2QMEA 2P5TB 5M04A 2ZJAA 3D7MA 4EPVA 1R2QA 4CT5A 2EQBA 3GLIB 2XX3A 3LQRA 3RC3A 5CYOA 5IDVA 2Q9CA 4WZ6A 4DEYA 4LUCA 3RS7A 1FTNA 4KV9A 4DLXA 4DLWA 3QBTA 4HB2A 2V7QA 2JDID 3DZDA 1A82A 4GMDA 3EXAA 3IEUA 4ERNA 4DDUA 2HT1A 4DCNA 2Q9AA 4BWYA 4OHVA 1VTKA 2GJ9A 4O0MA 2O8EA 1J7KA 1QBKC 4F4CA 2Z6VA 2R6FA 5JHGB 2B6HA 1EFRA 2KBEA 2IK8A 2PH1A 4YXWD 2OV2A 3NEYA 1N5KA 3QY0A 2XZOA 1Q3HA 2RB4A 4IXMA 2CMKA 121PA 4OJKA 3LW7A 3X1WA 5J4YA 2XXAB 3PG5A 2CVHA 2FNAA 3K0CC 3X1DA 3KTAB 4JVNA 4AD8A 4FWTA 2OT3B 2IXEA 2ZYUX 1ZNWA 1QHXA 4GOJA 1DTSA 1XP8A 1DG3A 4RFSB 1LS1A 1MO5A 4Q4LA 3H86A 4H1UA 1BMFD 4JSTA 4NH0A 1TF7A 5JBQA 3ADBA 3TK1A 1NN1A 4OQLA 2H8KA 1E2GA 3PUZA 5CJ2A 2MSCB 5JS8A 2ZRJA 3LH5A 5FR1A 2JEOA 4DZZA 2REXB 3RS3A 1UBCA 1HQYE 2DCUA 4QHTA 4RZ2A 2G9NA 1KJZA 1JAIA 4UNNA 4BGDA 1GSIA 2QMOA 5J4VA 2VA8A 3RVBA 2I4IA 3PJRA 4BLSA 4X8OA 1CEEA 1W46A 3R20A 3WMEA 4C0HA 1NLZA 4DKXA 4C30A 4PQFA 1U8ZA 5CIWA 3R8CA 1PLKA 5P21A 5DI3A 5IRCD 1PZNA 4DB4A 1P2TA 2A5DA 3T1VA 2D7CA 2ZTSA 4BFXA 1NLYA 1G3RA 4IDPA 4B75A 221PA 4MGZR 1GP2A 2FEOA 1XJQA 4DDWA 2FV8A 2ZRKA 2KWIA 1XF9A 1GM5A 2GEDA 3X2SA 3EIHA 1RRFA 4DSNA 1II0A 4DLSA 1GNQA 4Q9KA 2OE2A 1G7SA 4PR0A 3H0KA 3DKVA 3UG6A 3ECCA 1AS0A 4JBYA 4EFLA 3A8TA 4YLGA 4Z51A 1RW4A 1IY0A 1WBDA 3PUXA 3RAPR 3EZFA 4US0R 2VHJA 3LAWA 1G17A 1LTQA 2FFHA 2B21A 2V8OA 1CR1A 5BN3A 2QAGA 3SOPA 2QT0A 3VMFA 3AF4A 2QSYA 3CF2A 5IK2A 4BFYA 5LDDC 4BPBA 2OSBA 821PA 4Q01A 4DSOA 2ZSAA 3UMRA 2JJ8A 4KYUA 2QBYB 5HKKD 2DR3A 3U5ZB 3TUZC 2R6CA 4D82A 4MKIA 1GKIA 4XVRA 5HCIA 5JWHA 4QNMA 4M1TA 2BM1A 3W6NA 4IDOA 1G5RA 2GXAA 3C15C 1OH6A 1XXHA 2VSOA 4DLRA 1KNXA 4OI4A 4V0OA 3AVXA 4B32A 3BAFA 1ZCAA 2IYSA 3KZ1E 3OFND 5B57C 3VR3A 3TH5A 4LJAA 2NO9A 1DEKA 3K70B 2F1IA 5TMPA 3NXSA 4Q4AA 2DYKA 2HLDA 4W5WA 3BH0A 2ZRPA 3W8NA 2RGDA 2BMFA 1O87A 2ZSFA 3OE7A 3GEIA 1YR6A 1KSFX 1AGRA 4LDJA 4WVFA 3OF5A 1ZINA 1TEXA 3REFA 1Z83A 2ZRDA 1XTIA 2ZR0A 3FHOA 3E1SA 1H8HD 5B58C 2FN4A 3TNFA 2CBZA 4Q1DA 4JSYA 2BMEA 4LK2A 3TSWA 2V55B 1Z22A 2GCOA 5EXSA 1US8B 4HYYA 1PUJA 2ZVPX 3PXGA 5CB8A 3LLUA 4Q1EA 4M9QA 3VR6A 2WSSD 3SBDA 4GP7A 2ASEA 2DWPA 1YZTA 1G8FA 5L8VA 2OLJA 4ILEA 2GBLC 4V0LA 5B2ZA 3TIFA 1UPTA 1XMIA 3N2IA 1RIFA 3SC3A 4F4JA 2ZRHA 1KOFA 2JA1A 4TL8A 2CJWB 2ODWA 1M1YE 2J41A 5KUTA 1KI6A 3DVLA 2H92A 4IVPA 3ZH9B 2PJRA 2NMVA 3AVVA 2CNWA 1Z6TA 2V9PA 2J59A 1KZ7B 1O3YA 4HDOB 1PV4A 2IYLD 4Q9HA 4JZKA 5JMTA 3ONWA 2AWNA 4FCWA 4P4TA 5AJWA 1ESMA 3K0FB 4ITRC 3IGFA 3AVPA 3QXCA 2W6JA 3JVVA 4NYJQ 1EFCA 4NHOA 2ANCA 1MRSA 1DAMA 2W2TA 5AUNB 4F4IA 4NONA 4EFMA 4NU0A 1ZUIA 3FVQA 2QQ0A 2XOKD 3FFAA 1KO7A 4N0DA 2QAJA 3E5HA 2KI5A 1OIWA 2NIPA 4ABYA 2A5JA 1ZM3A 4RZXA 5SZIA 1OXTA 2VO1A 5CDFA 1UBGA 3L0SA 5FPTA 1HA3A 4BE7B 4M9XA 3ZVNA 2IL1A 1NG9A 1G7RA 1HURA 4LHVA 1MR3F 1KK2A 4B44A 4BFSA 5JJIA 1L2TA 2KB0A 4JVMA 4DSTA 1E32A 2G1JA 3K0AB 4ESHA 1IM2A 1J99A 3QUSA 5HTKA 1WF3A 1JJVA 1I4DD 3U7EB 3NBYC 3DMDA 4PX9A 3U44A 1IJEA 2ANBA 1OXUA 4HUQB 1OKKA 2GZAA 4JJZA 1G3IA 4ZDJA 1N6LA 3DO6A 4MA4A 3GLFB 1GUAA 2IYXA 2WVJA 4Q00A 4CEIA 4G5GA 1GITA 1IHUA 1L7VC 1G64A 2QM8A 3OIUA 3BWDD 2WJJA 4ARZB 3ND9A 3FKSD 2FMXA 1ZD8A 4TQAA 2UZ3A 1IN5A 3BORA 3I5XA 3LO5A 2FX3A 1M6NA 2GAOA 3LV8A 4M1WA 2FSFA 1N25A 4BLQA 3SJAA 5CLLA 3VR4A 1IN6A 1JEEA 2I1VB 4P33A 3GMTA 1N3BA 3CPEA 2YNMA 3WMGA 4LJ4A 1G8GA 3OIVA 1T3LA 2JIZD 1SVMA 3B6EA 1SXJC 3T12A 5FOSA 1SKYE 4D80A 4CZ2A 3VQTA 4CEHB 4EKDA 3I3SR 5KPDA 2WKQA 1RC8A 1U90A 4ZDWA 3MUFA 3KB2A 1SZPA 5BXQC 1Z0KA 2XTNA 2O52A 2GJSA 4B2LA 1AQUA 4QBGB 3LD9A 4TLDA 1P5ZB 5DHFA 4PC6A 5K8IA 3M1IA 1TU4A 5L3VA 4II7A 2WIAA 4GNKA 3GFPA 1FL9A 2AXNA 4BFZA 3IEVA 1YE8A 1WMSA 1Z6XA 1QHGA 1E0KA 2OCBA 3RRZA 3FMOB 1LFDB 2ZJ5A 4B48A 3NWJA 1U99A 4TZ0A 2PZEA 3SJCA 1CU1A 5G3YA 2ZUDA 4RD6A 4FWIB 1KI2A 1OV4A 3R7WA 2FFAA 4FI3C 5CLQA 2JASA 2WKRA 4BEJA 4Z1MD 5LD2C 2AK3A 2BBOA 5ELXA 2CVFA 1E2MA 1XX6A 1S3SA 1E94E 2W6IA 1RKBA 2ZYWX 3KFVA 4EJSA 1XMSA 4QXAA 4S2EA 4TT3A 2ZJ8A 1E79D 3TW8B 2X2FA 1KMHB 2IEZA 5A4JA 1YZKA 2FFQA 4DLVA 3G5UA 3QOFA 4Q48A 1OH8A 2RGXA 1UBEA 3QG1A 2P5SA 3Q5DA 2ZJZA 4Y0VA 2W2VA 3UXMA 5GVSA 1NVVQ 2JJ2A 3Q7PA 1R7RA 3U7FB 1A5TA 2PL3A 1CXZA 2GJAA 1W48A 1VDZA 2G0NA 3ZIAD 3GLGB 1ZUHA 5KSOA 4AKGA 1UKVY 5FUXA 3AF1A 3NVAA 3EIQA 4G1UC 4HB3A 4HLUA 4OI2A 1ZNXA 1U0LA 1X8LA 2Q3FA 3WMFA 4AKHA 1OFTA 4UXHA 1Q12A 1XMJA 1KAGA 5FOVA 4P4UA 1OLOA 3VR1A 2EU8A 3NBZC 4GOKA 2MMGA 1M8PA 1KK0A 2IYTA 2AKAB 2Q3MA 4MUBA 4UJ5A 1W0JA 5JZVA 3ZD6A 2RKOA 4Q1AA 4P4SA 3SYKA 2GF0A 1GFIA 2ONKA 3ZVMA 3MG9A 2H17A 2C8VA 3UIEA 3T1OA 4QC2A 3GJ8A 3S1AB 2A3RA 2N1BA 3RRMA 1QHIA 5HE8A 4C0QC 4FMDF 3UKDA 3NH6A 4PPNA 1XD2B 5B30A 1V43A 1GOTA 1VHTA 4IKEA 2D7DA 4MKGA 2WWHA 2QP3A 3TAHA 1JQJC 3VNUA 4MKFA 1E1QA 2PT7A 1P3JA 1GILA 2GXSA 3AP2A 3ND8A 3QKRA 4LC0A 1FNMA 1JEDA 4AYWA 2OHFA 1KK1A 2FJUA 2V6IA 2UVQA 3C5CA 3O8DA 1MOZA 4W5JA 1GNPA 3TVDA 2YC4C 4RCZA 1PLLA 3U60B 3B1YA 3BIFA 3SE0A 2IS1A 4XTRA 1E9EA 2QTVB 2BBWA 3BC1A 1ELOA 3N70A 4RSGA 5DE3A 2XEXA 3WRYC 2OUKA 4HAYA 3EC2A 3UMFA 4URVR 5KHOC 3KQKA 1UAAA 1KI9A 4D25A 3TLXA 4PSKA 3GEHA 4OI1A 4Q21A 4LJYA 3T1QA 3CWQA 2NPIA 5DH9A 3VU9B 1ZRHA 3THXA 1P75A 5F3WB 3EA5A 2QMHA 2AN9A 3O47A 4LY6A 1U8YA 1G4UR 4HLDA 4O3MA 1BYIA 1YU9A 3RNLA 2VHQA 3HP1A 2P6NA 2JLZA 1G3UA 3HU1A 4DXAA 4M1MA 3KUCA 2QNRA 2EFEB 1FFHA 5JSZB 1W5TA 2CLCX 2FU5C 1W0KA 1J8YF 4NE2A 4V03A 3TE6A 2GEUA 2A7QA 1AKYA 3BBPA 3GJ7A 4I4LA 3QKSB 1RJ9A 4QFMA 5AJXA 1SXJD 2AR7A 2WM9B 4F93B 5GJVC 3MMPA 4PZYA 3NIBA 4QBIA 4TL7A 2XNDA 3BK7A 3W34A 1EGAA 2NO0A 1E96A 2E87A 4GT1A 4LCBA 2XJ4A 4HAVA 3THWB 3P4YA 4DCSA 4AG6A 4ZPXA 5JRJA 3RHFA 2YKGA 4HB4A 3TMKA 4PPFA 1W1WA 5E95A 3U61B 2H1LA 2JLUA 2PZGA 1GAJA 2YWHA 3RLFA 1EX6A 3HPQA 2ZJ2A 1VG1A 4E03A 1NMZA 2ATVA 4GFDA 1N6IA 5CB6A 5LD2B 1XEXB 2QORA 2NPFA 2IWHA 2QAGC 4FMDB 2J0UA 3UWOA 1CKEA 4E22A 4XD7A 1U2RA 2QI9C 2RGGA 3IPXA 1Q1EA 4NYMR 1G6HA 5SZHB 2D2FA 3EZ7A 2XB2A 5CM9C 4Q7LA 5BQ5A 1NN3A 3IIMA 2G1KA 5G53C 1XZQA 3DZ8A 4URWR 5KDOA 2ZRFA 4MGKR 2ORVA 2ORIA 2ZYTX 1YHNA 4CIDA 5FBWB 2NOAA 3T35A 2F55A 4Q4HA 2FGJA 4KBFA 3FE2A 1P73A 4LJ6A 4TZ6A 2ZM5A 3B1XA 1GL6A 5FL7A 3QXHA 5D3MB 3DHWC 3TW4A 1FMJA 3R8FA 2RGBA 4PO1A 2ZITA 4PHFA 5KOYA 2O8CA 1XEFA 4XWKA 4NBSA 5DIFA 2QUZA 2BBSA 4BFUA 2BWJA 4JLDA 1ZC4A 2IYUA 1S2MA 2IXFA 1II9A 1R8SA 2ZAMA 3CNLA 1Q1BA 2R6GA 1ZYUA 1G5PA 4TMVA 3VKWA 3W8RA 3O8BA 1FW6A 2DWOA 5EE3A 4GPTA 4PSVA 3LX8A 4ZCLA 2DFNA 3RS2A 1RYHA 3ZZ0A 3O8CA 4PQYA 2IWRA 1E2EA 2NGRA 5FOWA 2V6JA 5EJEA 1I2DA 4Q18A 4KAXA 5DNYB 2NO6A 1MABA 4EPRA 4IDNA 4JLPA 2F1RA 1U98A 2WBLC 3DMNA 3FFBA 1H65A 4OQMA 2EYQA 4PFSA 2WPDD 1UFQA 5DN6A 4XWOA 2GCNA 1BKDR 4CVNA 4IOLA 4LBVA 2GXUA 3LVQE 2JCSA 1ZM7A 1CF4A 4N3NA 3A4LA 1COWA 4Q66C 1RRGA 3WY9A 1J70A 1TMKA 2NQ2C 1DOAA 3C8UA 1VYVA 2HDNB 3QKUA 1JBKA 3KQLA 1NVVR 4QBFA 5BYKA 1U0HC 2EYUA 1I4LD 2V7QD 4JYBA 2QENA 4DT1A 3B82A 2A5GA 1AA9A 1IN7A 4YMSA 4YQFA 1XBTA 3QXXA 4A0GA 4KU4A 3QF7A 4JBWA 1DO2A 4TTRA 1GKYA 4RVCA 2VP0A 4D4KA 1QF9A 1EFRD 2XGJA 3VKGA 4IVQA 3B9QA 4NZYA 1C1YA 2IHBA 3ASYA 5GJCA 2PEZA 1W36C 4I1UA 2Y8EA 3BD9A 2NTYC 1E69A 2D06A 1CULC 2ZR7A 4KFSA 4LX0A 1CTQA 4Q7KA 4DJTA 1YRAA 3OEHA 5EQTA
chains in the Genus database with same CATH superfamily
5DYGA 3NC4A 2FWRA 1XI2A 3FR7A 1I6KA 5G3ZA 1LFAA 3T4PA 2AZDA 2FOLA 3SXPA 4EHAA 5HKBA 1G9SA 1OA0A 1N5IA 3F47A 4BJHB 1R64A 2CXPA 2QTBA 1U9ZA 4MINA 2D2VA 5EZ5A 4ZEXA 3RSFA 5LKRA 1T29A 2LPMA 1C2TA 2HF8A 3Q5GA 1E2KA 1L7RA 2AE1A 3MGCA 2BZGA 5ILQA 4D8VA 2I7VA 3G8BA 3UPDA 3U4MA 1RI3A 3PR3A 4ND3A 2IBTA 5AM1A 1PJLA 3DL4A 4R0MA 1E6LA 3EIFA 1H0HA 4FMCB 1YC5A 3P5SA 4W82A 3UK6A 5KQGA 1VYHA 2H9AA 4M1SA 5LU8A 4IIDA 5B7GA 3V8PA 1USGA 5SY9A 3OBBA 4A27A 3K4PA 1UBLS 1D1SA 3KHSA 4XJXA 4WESA 1OXBB 5J40A 4AW9A 1E9BA 3JZAA 1L5NA 1C0KA 3A6LA 3NHWA 2ZPUA 2C77A 2B9EA 4RDCA 3QF4A 3W9UA 4UJ3A 3S68A 4G0UA 3QEMA 2OGZA 4BV8A 4UHCA 1F3OA 1E2PA 1XCBA 3MJHA 4RK6A 3GN2A 4C22A 1CQZA 1Q14A 5KNDH 2Z4SA 1N2JA 2Y99A 3C3WA 3JQ8B 3UN1A 2QT9A 1Z5VA 3L02A 2VPWA 3PUHA 4E1AA 5BORA 2FKAA 4C5BA 1EA5A 4OAOA 5ALGA 1GR1A 3U2QA 1AS2A 4JUIA 5EN4A 5CW2A 1NFRA 4CM9D 3IHLA 2JFBA 5LN1A 5DHRA 1BO6A 1NJFA 2D4HA 4OAPA 4WK4B 1K8QA 4XUEA 2GUWA 3TMAA 1B00A 1MGOA 2XIQA 5BUCA 5K6AA 2I91A 2UZ1B 4DDVA 5BN3B 4B34A 4BB5A 4QUAA 3KRTA 3BFKA 3C6YA 4LF8B 4ZZ0A 1P2FA 1M7GA 2RHJA 4TV9A 3LRTA 4YRPA 4L4XA 2FZWA 4QWWA 1UAYA 2WZQA 1B3RA 4OHUA 3KDSE 3N8NA 2YJ5A 3D02A 1LBHA 1U8AA 3LUGA 3PNMA 3JR3A 4B35A 4C5CA 2NXCA 1WKCA 2V0CA 4LNUB 1HX7A 1XA0A 2XUJA 3LLCA 2IS2A 3JD2A 1XWFA 3LQ4A 1KZ9A 4HNSA 4OSEA 2YYSA 4MPRA 3O6VA 4Q47A 2BKLA 2JFFA 5IASA 2QTHA 1AQNA 6REQA 1JHRA 2BEUA 4G9GA 4EKNB 2DERA 5GINE 1EGVB 3QKIA 1BGXT 2DBRA 1Q1ZA 2KE5A 1QYIA 4NKRA 4Q3AA 4YCDA 4KLRA 1RDFA 3E1KA 4ZV7A 3TLGA 3K1JA 3HG7A 1SVLA 1W4AA 4Q4AB 2ZSJA 4F7WA 3IBYA 5ECWA 3B2QA 2C2YA 3BMQB 4XPZA 5MF6A 5IJ0A 1EIWA 1QH0A 1B8NA 2YXBA 2AMVA 5J1TB 4BNVA 2EJTA 3IQHX 1XZMA 2FG5A 2J46A 2GBGA 1WW2A 2CCJA 3K09A 4JLJA 1YT5A 4D3ZA 1E4YA 3OE7D 5IHXA 2H5IA 2AX4A 1IJFA 1KZ6A 4CV0A 2DAPA 2EQ5A 3ZY2A 4LZOA 1ZITA 4G2TA 1QHHA 1HE4A 4JJ7A 4TKZA 4WW0A 4GBGA 4R1PA 4H7PA 3DMFA 4EABA 4TTTS 4NCXA 1M7BA 1OLXB 2VNKA 3HY3A 1YA6A 1JKJA 1XQ1A 4CKBA 4QUJA 3GL9A 4XR9A 1GKLA 4EJSC 3BJZA 1XVUA 4GH5A 5KSPA 3CB2A 4OP1A 2FPPA 4IGAA 3F7OA 3PFFA 1GPBA 2X9VA 2YJZA 3WGVA 5KTSA 1XCJA 3OU7A 4EG7A 3GPLA 3DR3A 3NHAA 2FWNA 4Z2YA 1C30B 4FIDA 2IUUA 5FPYA 4HZGA 3MJRA 4F46A 5DM4A 1Q2UA 4KR7A 2B8NA 1KI6B 4I6EA 4REMA 5A5EA 2O8DA 4KBGA 1PDVA 4TMFA 2VRCA 3IOMA 4HX2A 1JFSA 3ZPXA 1LWNA 3OZSA 4LSZA 1BRTA 4RORA 4UTRA 1GNTA 1RAEA 4HDAA 4JXZA 1S8AA 2VKTA 2P9HA 1DAIA 4ZWNA 2QP9X 5FT9A 5UKDA 3DHYA 4KLZA 3ESRA 4B7CA 1KI8A 1WJGA 3EG5A 5TC4A 3TE7A 4WBNA 1YJAA 3CLSC 3LC0A 5AVJA 2B98A 3NBAA 4JOQA 3KVYA 2O8BB 2OFXA 4DSAA 1QHFA 3UAYA 4QA9A 5J43A 1JQ5A 5JC8A 2QGZA 2YN0A 5LZ4A 3AETA 2CC2A 1B93A 4FHFA 4Q3LA 1NVBA 4CM3A 4CMJA 2J85A 1XNQB 4FS3A 1QIHA 2J9FB 2XCSB 3Q5EA 5LB4A 3LPCA 3JWHA 2W6JD 3PD7A 4IOMA 3UUFA 5JAUA 1EG7A 1I7PA 4L5JA 4MRVA 4Q24A 4PQGA 1W36D 4JBLA 3H04A 3OIDA 4EYGA 4ZAVA 4PCUA 3Q2KA 3ZK9A 5DT2A 4AJHA 3D6MA 1OIXA 3O4JA 2A59A 4TN1A 2MMCA 4CMEA 4LQCA 5IUKC 4CMCA 4D99A 2JH9A 1TLLA 5E9AA 3V1YA 4DJFC 1ZIYA 4Z4CA 1P8AA 1MXFA 5CYFA 3WWZA 3BFXA 2AMYA 2FW9A 4I55A 2YC2C 2RGCA 3Q3EA 5FRDA 4E4TA 2UYHA 3OLVA 4QJBA 1EQAA 4DQDA 2O5EA 3W2GA 4UHDA 1RIIA 2WUVA 2X2PA 2FMUA 3M4JA 1LVGA 3OCUA 1X7GA 3N2KB 1Z7EA 1P9OA 3CISA 3R0JA 3AHHA 3MWEB 2RHTA 2H4HA 3KB1A 3BMOB 1N3LA 3K9HA 2QZJA 3LGSA 3F9IA 3DB2A 3ME5A 3N9IA 3PNKA 3ELBA 4J1TC 5FUYA 5GY7A 2PVSA 4A7PA 3CLRC 4Y2JA 1R00A 2NVOA 2IPMA 4GP6A 4R8LA 5DISB 1T4MA 3KT3A 3RBVA 3TBHA 2Q5QA 4IX1A 1E2FA 5JDCA 1PYGA 4EW1A 4RABA 1QFJA 4LTMA 2A0FA 1EWRA 4AZSA 4XOUA 3RQIA 1UC9A 3C4JA 4QOGA 4B85A 4O4HF 1EJBA 5JANA 1F8UA 5HUJA 1UMCB 4NK5A 4MSUA 1XKTA 1UZLA 4JI4B 4RULA 4B6PA 2ZRLA 5DSTA 4R16A 5FBRB 3V1MA 3QWIA 3CPJB 2EWMA 3X1XA 5A4MS 5K51A 3DL0A 4L2IA 3IELA 4PX5A 1ZK0A 1C8VB 2VC2B 3B13B 4LYJA 4A8TA 1J20A 5JD4A 2XUFA 5FTJA 1OH5A 4JUBA 4AY2A 3WA7A 1N92A 1TK9A 3QENA 4C3UA 1B26A 1E98A 2J07A 3BJIC 3H1FA 3I73A 4DQXA 2YZ2A 4DTCA 2F8SA 3VTFA 1CHNA 1EEHA 1QH8A 2ZE7A 4PZPA 1JR6A 4K6HA 1IM8A 3VR4D 2W2MA 1PZEA 3G2OA 5AM0A 3SK0A 3WISA 4EFDA 2VCHA 3WKAA 3K71B 3BUSA 4KVAA 1DVRA 4UEJA 2FJPA 1HSZA 4GC5A 3RSQA 1DKRA 5J2TA 1HXHA 4OQ4A 1P4HA 4XGNA 1C3OB 5FEMA 3TI9A 2ZT5A 5GJBA 5DHPA 1EBBA 2L69A 1B0UA 1MB2A 1RBQA 1XZKA 1XTVA 4IJUA 4X20B 3TSYA 4EPWA 4FNAA 1Y6GA 5F76A 1USVA 1U3VA 4JL5A 4BATA 2PV7A 4XUDA 1JA9A 3EN0A 4YAUA 2GPBA 2JJ1A 2GETA 3C6XA 2O7VA 3UYLA 4UE6A 4D4LA 2PUDA 1NFFA 2FSIA 3TQIA 2QQGA 2FVXA 3ZLBA 3DO8A 4DDMA 1QAOA 5C9ZA 2JH3A 3CM0A 1XXHE 4CF3A 4DLZA 1ZD1A 5JJLA 1FA9A 5A5DA 3AEQB 1JU3A 2HSEA 3HWRA 4BMZA 1NUTA 3D59A 3KPUA 4XX1A 5KNDA 1RJDA 3PA6A 4IJQA 5AW6A 4F6CA 2EZUA 3P1JA 1K2WA 1N2HA 4TM8A 2IS4A 1YQTA 4YT8A 4QU0A 1SHKA 2EFCB 2P0EA 4QUIA 5B1DA 1MRNA 1MO2A 1YZGA 1RHJA 1ZU4A 1M2JA 1ZOSA 4RKQA 4C1NA 4F06A 2W6ZA 4F3NA 1AMOA 1XA3A 8MHTA 1PSDA 4QRHA 4UOZA 1JAZA 3IHWA 4A2CA 1K4KA 3LPAA 3MN1A 4DMKA 4J2TA 3P9RA 4MRPA 3R6GA 2H2FA 1FX0B 4FGWA 4TVKA 3O8QA 3INRA 4LXXA 4NL4H 3A2KA 3K0FA 2R44A 5DSZA 1G0OA 4KR9A 4CHGA 1PL7A 5G1NA 1H69A 3D3KA 2REQA 4Q0MA 3PGXA 4NFLA 3KQWA 5HIKA 2IF0A 1CY7A 1Q17A 3ZIDA 2QPTA 2FR0A 4XIIA 5BSFA 1W1UA 5BWLA 5CCXA 1E1LA 1K3FA 2WFLA 3CSUA 3KUDA 5K0ZA 3ZKAA 1B4DA 1SZDA 2X0KA 2KS6A 4L5IA 1KWKA 3ROEA 3T9EA 1DLJA 1N1GA 1LDGA 2W2XA 1Q7BA 2W71A 2OORA 2QS9A 1ZMOA 2A8YA 5MFZA 4ZYTA 1XRQA 3QBDA 3RREA 3RABA 3MS2A 2JAPA 1QE3A 4CG1A 3WJAA 3KKPA 3L2OB 3TQFA 3CLSD 1ZJ6A 5EJ4A 1ZD4A 4J3FA 4KRFA 3FM9A 3HBJA 1WE2A 4MMXB 4G5OA 3C7AA 1A72A 3CIOA 4M54A 1XE3A 1Z3IX 4RH1A 4BNZA 5IKXA 4TS1A 3FVRA 5AXCA 1AJEA 4QBHA 3R7NA 5JNLA 1G16A 1QVAA 5GJWC 4FCCA 1EK5A 1NVDA 1A8QA 3PRHA 2PEYA 3IT2A 4F92B 4NV3A 4EX7A 2LV8A 4RJJA 2NYVA 4D41A 1AHHA 1Q83A 1T8WA 1KEPA 2R48A 2AG1A 4MDYA 4QYWA 4WHMA 4CWAA 5C1DA 4MDFA 1KXJA 6GPBA 1VMDA 2O8FA 5IUJC 1GAWA 1E6KA 3HCPA 3NEJA 4OO3A 2PKYX 2ZWIA 3REOA 1RAFA 3GLFA 3STWA 3F9RA 2OAP1 3LCUA 5HJ7A 1RPJA 3RSHA 1GQOA 1MX3A 4M8LA 2OP1A 4L4SA 4F86A 3PFCA 4OK6A 5H80A 5CDGA 1MEOA 2XUPA 1N2CE 1TA4A 4L5BA 5EPUA 2LRHA 3CLTC 2H9YA 3I2GA 1ZM9A 4NBTA 4RS3A 3HNPA 5DWVA 1RJGA 1W52X 4PXYA 1PJAA 2FA9A 4WLVA 3ZWAA 4UM5A 4WL0A 3R3XA 4KI0A 3QPBA 4HWOA 1XQWA 4AMVA 2PGAA 5IAJA 3N3AC 1FS5A 4IIVA 2H29A 3PPWA 5KSYA 4EG0A 2QG6A 3CLRD 4R2JA 1H8EA 2GZMA 4OF4A 2VTKA 1P6XA 2IKQA 2X5KO 2QTGA 1HOXA 4ND7A 3OLCX 4FX5A 2R2GA 4MYUA 1ML4A 1UPUA 5TMDA 1IOZA 4C4OA 4AZWA 2GF2A 4OHMA 3MW8A 4X90A 2MT9A 1TF5A 2XEDA 3BGWA 3ZE0B 5FQOA 1OXVA 1R8YA 2VPIA 4FGKA 3SWWA 3QEBZ 5F9MA 5JMPA 3HDGA 1GPNA 2F64A 4B31A 2BIFA 4MWTA 1AQYA 1F0NA 4FNMA 4FZJA 1M2OA 5A0FA 5CLJA 1Z15A 1PNRA 2R97A 1J09A 2IIBA 1SEPA 2ZIXB 1FYDA 3KX2A 1HZZA 1ZZEA 3M3PA 2IYZA 4GLJA 4PR3A 4R9NA 1GCOA 3IXQA 1VB5A 3FDJA 4JXXA 3OOSA 4BQIA 1AHPA 3AHFA 4D6PA 1E61A 2ZS7A 5EXPA 3T54A 4KXMA 3W5DA 3UCFA 4O4LA 4QOHA 3RVRA 4MS3B 2C5HA 1YMQA 1GZ3A 1DC7A 4I1PA 1AIPA 2GK4A 2X2EA 4MVJH 3VJMA 4BNFA 3AVYA 4NAHA 2CVZA 3MUNA 1N6OA 3OQMA 4GM4A 1UPFA 3ZLVA 3EMBA 4TMWA 2J67A 3V33A 2GEVA 3PE3A 4ILKA 5EXXA 1KY3A 4QGBA 5LQRA 1JHAA 1JIQA 1G5QA 1PNTA 4XW2A 1JEYA 4WFQA 4N48A 1BE1A 3BXFA 1AUQA 1ODFA 3MCTA 2EV9A 3NFYA 2HUPA 2NTJA 3LOQA 3PF9A 1Z13A 2I87A 2M9MA 1R0BA 1VBKA 2XNDD 2YWRA 3A04A 3A6HA 4ZEOA 1K2VN 1OF1A 4OKSA 1J0DA 2FZEA 2VHUA 4A1FA 3AR5A 1I4WA 1FYEA 4UCQA 2WMDA 1UXKA 3VYSB 5JIBA 4XCQA 5JTUA 1N9GA 2XTMA 3H4TA 1A2KC 3BGIA 4XPIA 2HPZA 2JHFA 2RG7A 3U48A 3UJPA 4AF7A 1FDOA 4HT3B 3G7UA 1F20A 4ISBA 5G0SA 3TO5A 5E7JA 4GL2A 1KAOA 2C4KA 4OHRA 2BR4A 3WGOA 1WMBA 4HQKA 2YHUA 4MI1A 4TMXA 1DRVA 2ZSKA 1G1AA 4BEWA 3VM6A 2PKQP 4X92A 3R40A 4E7OA 4EZEA 4FFRA 4BO1A 1M0SA 5TPZA 4PG8A 3GUVA 3HVJA 4FYVA 4NYIR 5SV2A 3WQRA 1XTSA 1ZUWA 4RWEA 2B3DA 2AUMA 2GESA 3NBXX 4BFWA 2LKDA 1NJ2A 3OZTA 2PQ2A 3V2GA 3NV9A 4XM0A 4IF6A 1DB3A 1P72A 4ND2A 3LDGA 3EEOA 1U2TA 3OKFA 2PMWB 1SXJB 2XVAA 4TRMA 5EP4A 3RFFA 2VYVD 2D2IA 1SBCA 5J59A 1L4GA 2BL4A 4IMIB 3MJFA 4NARA 5KQSA 2QR5A 1TVMA 4YQZA 1EXDA 3KOYA 2YY5A 4AMZA 1RAIA 1AB5A 2QIOA 7MHTA 1NGSA 4XUGB 4H6VA 4E5NA 1MAWA 1CLUA 2VHWA 2XVMA 1DMRA 4QSHA 1UFRA 3D4PA 4G5RA 4DW8A 5DT9A 3ESAA 3RTDA 5JASA 4B4VA 4OHWA 5AKYA 2R1VA 4EJMA 3AY7A 3OX1A 1YS7A 2P4EA 1KFBB 4JGBA 1HPLA 2GFQA 2Q49A 4R0VA 5DBFA 5DNCA 2J5XA 3FOZA 3DWIA 3DKPA 3IA7A 4JB0A 3V34A 4BC1A 4D6YA 2R79A 3FZNA 2OCAA 1K7YA 3ZY4A 5ICMA 2Q2QA 1IK4A 4LW8A 5LYJB 2H18A 3T5GA 2IT1A 3DTNA 1A9TA 1C3JA 5JS2A 1L5RA 3GPBA 2ZZMA 2OMKA 1EMDA 3KVRA 3L8ZA 3RU9A 3AVUA 2IYAA 2DLDA 1WRBA 4JT4A 3WNCA 2PWZA 5FWYB 1FDWA 4DN6A 1T1RA 3PBKA 4R1QA 2PT6A 2OV1A 1J2YA 1MABB 2A1UA 4EP1A 3ROXA 3CR8A 3Q41A 4CT4B 4OXIA 2IV2X 4LSMA 3FTPA 1P7PA 1HLDA 1WTCA 4TLLB 3DO5A 3ZK8A 4IZ6A 5JSYA 1ZR2A 1MENA 1E3MA 1B8OA 1U80A 1HDRA 1I6MA 1ZICA 5JAQA 4YRZA 2I6XA 4GPBA 5BN1A 2RJ3A 5DN6D 2B2CA 3Q87B 3LZDA 2NSJA 3OZRA 1IVYA 1YFZA 4MQEB 4PHHA 5I7WA 3QNUA 2ZTHA 2XD4A 3BHIA 4G89A 1FCJA 1PFWA 4NTZA 1QYDA 3QYAA 4GQAA 5DYTA 3SI7A 3RKSA 3GZJA 3ZDQA 5BV7A 3NAQA 4DJDC 1D2MA 1XD8A 3LC7O 1KIMA 1Y8CA 3PUWA 1NI4B 1RTKA 2ZULA 5HP4A 1QGAA 3IXMA 5H82A 1I7DA 4G36A 3CLTD 4BGUA 4EKYA 1RCTE 3AUKA 3NH9A 5FUQA 3OIFA 3UICA 2WSMA 1PG5A 5FH9A 1DKMA 2ECKA 5D5PA 4QM7A 1V48A 5KOIA 2DVMA 1RI5A 3KR2A 1WULS 2HK6A 6AT1A 1KQOA 4PPQA 5HUHA 2HA3A 1KJ9A 3K1AB 3P8ZA 1UM9B 2GN8A 1XFAA 3CNOA 4QPPA 2IYYA 4MV0A 3JWIA 1TLTA 2JI4A 5HF6A 4BNGA 1NMQA 1ISMA 2C54A 3VNQA 2GHQA 3WIVA 3JPWA 3T9CA 2UKDA 3LUAA 3ONVA 3JZMA 5BSEA 1YO6A 2MSLA 2W4IA 3AKYA 3FYCA 3N2GB 2HRDA 3MGAA 5F2EA 3QSGA 2VYFA 5DHUA 1IPFA 3BQMB 1RXYA 4M60A 3OEHD 2GAFA 2WWGA 1UKBA 3EXG2 5KU1A 3P9CA 1LX6A 2VH5R 2DSNA 4MA5A 3RTCA 3WFJA 2XKBA 2WA2A 3O95A 4CUJA 1BOFA 1D6MA 2W00A 3BVPA 3FJYA 4D43A 3KJZA 1WBJB 3A9CA 5GONA 1YIAA 3GEPA 4M6WA 1KQNA 3TLBA 2JLCA 4Z9AA 1P4AA 5JXWA 1QYWA 1NKSA 3D8TA 2IC5A 5ILGA 2CXOA 4L51A 1L1EA 5HBGA 3OX3A 5U4XA 4BTLA 4ER3A 1C3VA 5C34B 3A58B 3L4JA 4EI7A 3DGEC 3AFIA 2VK1A 2FE4A 3LQQA 1ZGAA 1BKYA 1BE0A 1T8SA 4OSPA 1N0IA 3S28A 2H63A 4L9WA 5HPYB 3WHLA 4ETMA 4Q3DA 1Y5MA 5SICE 1OFUA 1V37A 3JR7A 4UUQA 5LDHA 4WX2B 1DJNA 2PQ6A 2R6HA 2ZI4A 4OQQA 2QTCA 1NIJA 2OCGA 5JEDA 4IDGA 3OICA 3ED1A 4TMKA 4Q39A 2HRZA 1CR2A 1CUJA 1NMYA 4OXXA 4WADA 4BWFB 5CGQB 3A2NA 1KQGA 4C87A 1ODIA 2NUBA 4C0LA 3IXLA 2CXXA 3M6MD 1ZWLA 3MTBA 5FWXA 3D7NA 1H1DA 2WU8A 1A9YA 4ZO4A 1NTRA 3UENA 4ETWA 3QUQA 2OV6A 1PKXA 3M82A 4TKUA 5JOQA 1ZOOA 3QTBA 3L0YA 4UUOA 5CNMA 5B5SA 5JXHA 1HDGO 1H2RS 4P6VF 1QLJA 4LHWA 3BK2A 1NVXQ 1NT2A 2YFQA 5HILA 3QVUA 4FFBA 4I7EA 4P2GA 2F1OA 3E3OA 4KQIA 4C9BA 1GTVA 3KV1A 2WU4A 3RYTC 1L9KA 2CYAA 1W7AA 3EXEB 1Z17A 1FTSA 3ZGLA 1CZRA 1TIPA 1WXHA 2P67A 1PDOA 5LMUB 4MYHA 1ZD9A 2ISCA 2QL9A 2EX4A 1ACLA 3N8HA 1E9VA 2FQQA 3GNSA 4MVJA 2ZANA 2X8WA 3KJFA 4ARAA 2QG9A 2YVQA 1QJCA 3BG5A 2XHEA 5AVVA 3PJGA 5H5JA 2UYYA 3V2HA 5JAMA 1NNLA 1YE3A 1YRYE 4NY1A 4JEIA 2DB3A 2TSYB 3U37A 3JWJA 4MI3A 5KB3A 1IBKB 1OBCA 4G5FA 1SD2A 3MZ0A 3NBKA 4TMYA 5JO9A 1FMFA 2Y9MB 3BJRA 5AFSA 3PC6A 2A9QA 3WL6A 3VYUB 4RTRA 3PGVA 2ZVQX 4ZAZA 4R9VA 4HZUA 1L7QA 1UBNA 3C1AA 1Y5LA 4X64B 3NT4A 1TYZA 1PW5A 3NYIA 2VP9A 1IRIA 4GPEA 4ER0A 4XSGA 3P9NA 1SA0B 3W2IA 1XZFA 4C20A 1W25A 3CPSA 1T4GA 1FYXA 2IOQA 2QRGA 1U4NA 3GGGA 2J3DA 1AKNA 1YF3A 1JDNA 3HACA 3PYMA 1I30A 4G1MB 1VYTA 2GPSA 3DUFB 4COOA 3GUYA 4M1EA 3SC2A 1XEWX 2VDUE 4M9ZA 5JXIA 1XVTA 1GNRA 1QM5A 3VNVA 1E0AA 3TQHA 1S2NA 3DR5A 3FOEC 2X0IA 1PJ8A 2Z98A 5AUOB 4DV4B 3OU2A 2ST1A 2HT6A 1ECFA 1VL2A 2OXRA 3WLFA 3A4MA 3GFRA 5C8XA 2W8BB 1JG6A 1M2KA 1NMXA 1H2EA 3H6HA 3LVRE 3QBEA 3LP5A 1A3CA 1Q0RA 1HC7A 2A0XA 2QVCA 3O31A 1BXGB 3RUIA 3PDUA 2XQVA 1HT0A 1CUSA 1GKKA 3RE1A 3AGPA 1M1YA 1C9EA 3QTTA 3C5VA 5DVZA 5CDSA 1UQRA 1HQKA 5C18A 2WYOA 3ISJA 4MAFA 3TZKA 1KJIA 4E5PA 2C5LA 3AY0A 3DCNA 3PGA1 4MLDA 4ZI7F 3FIUA 3ZJ4A 4BZZA 5ES3A 5JO0A 4HDSB 4URXR 2Z2IA 5DTIA 4WBSA 3VXKA 3S99A 1LPAB 2EVWX 5ALYA 4G26A 3R9KA 5BRJA 4DNOA 3M3HA 4E07A 1FJHA 3BE4A 4DHEA 2P9YA 2VFAA 5DMXA 4YXWA 2A33A 2DWQA 4MQFB 5H4HA 5CVJA 3KVOA 1S0UA 2XWPA 5IHPA 2PYDA 3UT5A 4KP7A 1EXVA 2GLUA 3OQPA 1GGVA 2Y1FA 4FJ2A 4KQXA 1DQZA 1FP4B 3ZWBA 1E7WA 2YJ6A 2FF7A 1O94C 3C85A 4FX2A 5B7NA 3QFHA 1YQQA 1KU6A 3W5JA 3KHUA 1QZXA 5CCEA 3MAGA 1KKMA 4PLVA 4X54A 2OQVA 1ISPA 4ETNA 2A9RA 3CE6A 3O8OA 4FEYA 4UULA 3EQ7A 4MKXA 4PAWA 5AICA 2M6KA 5IH7A 1U1IA 2QDKA 3KL2A 3CZQA 3P19A 4J0JA 5IN5A 3U4QA 3RCBA 1L8OA 4AYXA 4DVGA 5M29A 4PIVA 1JHOA 2ZTVA 5HDBB 5JS7A 1FNCA 3FMIA 4MV7A 2PMBA 3AIOA 4I5DA 2QW8A 3FWYA 2RHWA 3IOEA 1YACA 4K2AA 4RV9A 4LCJA 1PKEA 5KU7A 1XDWA 2XLBA 1G8YA 1E4EA 2UZ0A 4IH9A 3PLNA 3H9CA 1SULA 3HWSA 1RWBA 2XUHA 4FXPA 1SHJA 3ICWA 1CDEA 2G28A 4BLRA 1CWUA 4LY0A 4WCFC 4YYZA 3D0QA 2C07A 4Q3NA 2GTHA 1UMKA 4JUDX 2HH9A 3C6MA 3EFHA 4Y0NA 2XMQA 1H1LA 2G5PA 2MTBA 4XQEA 2ZBQA 3U1VA 3CINA 1FQJA 2VAMA 4KWCA 4NJMB 3WP0A 5ADUS 5IAAA 5A9SA 2BCJQ 1C8KA 3D8RA 3LHDA 2IEDA 2JFWA 3IAM6 5B12A 1ULSA 2J7PD 3BIOA 4XIGS 4WUTA 4J2OA 3KFXA 3RI3A 3U7HB 3G8YA 3Q7RA 3WX0A 1IZYA 3VV2A 2Q7DA 1WXDA 4JP1A 3A1NA 5LOVA 2JFPA 1D1PA 1C1XB 1UKEA 2XNSA 4LDRA 4N8EA 4KHPB 5FDFA 3D7LA 1RKXA 2CLDX 5HF8A 4EY5A 4ENPA 4PXAA 2P35A 3FJ1A 1T1SA 1DCMA 4N9WA 2NVWA 3KUKA 1DKPA 1N78A 1Y98A 3EOBI 3AEZA 3ZWWA 1XL1A 3ZVRA 2NUPB 1FXUA 1U1CA 1YDHA 5IBCA 1THZA 4ZVLA 3R4VA 3WGQA 1XZAA 4CKCB 4BN5A 3LKVA 4EELA 1FXWA 1JJBA 4YXFA 1QG4A 4AQDA 4DR5B 3V4PB 1VCMA 4JI3B 3GR6A 1QWOA 2AC4A 3G23A 2H65A 1LS6A 4I9NA 5CXSA 4CCYB 2NU9B 2ATIA 3RG8A 1X1CA 5C7LO 4YREA 2HO5A 4FGLA 4W1SA 3U19A 4DCCA 1B16A 3L9XA 3SR0A 3VHXA 3DDSA 4I36A 3ZZ1A 5HKKA 2Q8QA 3A3OA 1D2EA 1L7OA 4ZQBA 1Z2CA 3DXYA 3M6XA 4ND4A 5DNAA 5JCOC 4KDRA 2FMTA 1G1MA 3WKDA 3L8GA 3RBAA 2OO3A 3G85A 2GAJA 1Q19A 1QDLB 4AF8A 4DYHA 3GD5A 4DILA 3OFNA 4IRXA 3GAZA 2CMHA 4W9NA 3S2ZA 4AFNA 1B8VA 3GLIE 1KYZA 3CX7A 4ZU1X 4MK4A 4OGGA 4NAUA 5F5LA 1QTQA 1BRMA 1SIWA 4LXHA 4UOEA 3OPXA 5KYNA 1YVDA 3ELUA 1X39A 1F8YA 3AM3A 3W2TA 3CUSA 5B1HA 1X0VA 2FK8A 1Y3BE 5COAA 1GCGA 3UAZA 3QVGB 1ODTC 5AJUA 4KNWA 5A5GA 4GOMD 4QT0A 1ORTA 1U28C 2C9OA 2C3UA 3CEJA 1Z38A 3P9PA 3HWWA 1F6BA 5BURA 4LC9A 4YI3A 4N41A 2V3VA 4F9EA 2E4ZA 1KE2A 3V32A 5A5FA 4I0WB 5FFNA 3OOHA 1U4OA 1CY8A 1ZIDA 2L17A 3ZHQA 3ZE1B 1F2UA 3C5EA 4NNOA 5E1DA 3WGNA 3TOZA 3ND6A 3UB2A 3EVEA 5L3RA 5CLFA 4RGYA 4JJKA 4MP6A 4EYEA 1FFCA 3WZMA 4IRUB 2VQFB 5TB5A 1M72A 3T7CA 3EXFA 3LFUA 1KH3A 4AUMA 1GGJA 2XE7A 2I9PA 1P5JA 4N5IX 2XI4A 3Q15C 4LGMA 4YMUA 4TKLA 4Y1EA 3EPPA 1XZEA 2E89A 1HBJA 1IATA 1ZCBA 2ZYHA 1ECCA 3AESA 3OCJA 2AJDA 1H85A 2NSLA 4RACA 3H0EA 1KR2A 1Q44A 1SUAA 5E1BA 3T61A 2PSEA 4MS4A 3R7WB 4EOGA 4V0ME 3CVXA 1L5VA 4QGGA 2JFXA 3AZPA 2MU1A 3V97A 2VNSA 3EY4A 1W85B 2GDJA 2NW6A 4O2LA 5GVRA 5I5GA 2Y1GA 3EMVA 1XJ5A 3UYKA 4RGBA 3H0CA 3KSBC 1HTBA 1WG8A 5A5VA 1X7ZA 3GVPA 4TL6A 2HSDA 5LP1A 2E21A 5FBLB 1JALA 2WKWA 3MA0A 1I6WA 4I3GA 1CUWA 3QXJA 3R76A 3U4IA 5B3KA 2Q3JA 3AL3A 3K8YA 3KKKA 4YRCA 3Q3IA 1Z6YA 1VL5A 1VA5A 2VAVA 4RH3A 3TSOA 4H7EA 1H2XA 1JPNA 2YTZA 2I7TA 4ACAA 3OT1A 4HH1A 4EARA 5ALWA 1NY6A 1PV2A 2YWXA 1FE8A 4MYTA 4V2UA 5U4QA 2VJMA 1O94D 3CUUA 1DRJA 3TMYA 3L0ZA 1J5XA 1PGQA 3NHUA 1Z8NA 1FEZA 3PEVA 3X0DA 4EJ6A 2Q0HA 2V98A 3BB1A 1CIVA 4D56A 3I62A 2B94A 1QH1A 3TFQA 4F5WA 3TNLA 4HK4A 2A78A 3SZOA 3CBGA 1G8KA 3GBPA 4PHGA 1W5SA 5HQ3A 2QX4A 4R68A 1KOJA 1FFEA 3KQOA 2Q1YA 1G18A 3KTOA 4Y2TA 3THYB 1PGPA 4XRRA 2NO1A 3LZ6A 1D4ZA 4Q1BA 4AJOA 3NX4A 3O7WA 1YRWA 1U2DA 4JNKA 4QVKA 3L0PA 3ZDAA 3VBCA 2JBWA 4BNDB 2NUAB 3JQRA 5EZ6B 4Q9JA 3A9SA 4OATA 2PBRA 2X41A 1XRMA 2YHAA 3OJ0A 1N8NA 3OLWA 5LOVF 2PSFA 1T9BA 2V3WA 3CF0A 3U0BA 4WJZA 1RYEA 4EYKA 2B3TA 2J0SA 2YVLA 3RC7A 2IBMA 2WJGA 2YXLA 3AU8A 2VTBB 2PCJA 4GPD1 5HOEA 2HJWA 5IXYA 4UE3S 4L72A 3UANA 5T3YA 4TLAA 4AYTA 1HNZB 1OU0A 5H68A 4RADA 4TRJA 4C0SA 5C32A 5I45A 3DOJA 1PNOA 2BUCA 5J4KA 4DV3B 4D3DA 3LUBA 3S2EA 1ZIOA 5C8YF 3QQPA 5FUWA 1ULTA 3DEHA 4TTIA 3CRQA 3B70A 3SBOA 1Q57A 3CWZA 4RZ3A 2RGUA 2L2QA 1DIGA 1WB4A 2W7TA 3N58A 4MGHA 4XR4A 4YUWA 1I8TA 3MJVA 3RC8A 4FOPA 1F4LA 1YB4A 2JFGA 4BEBA 3AF2A 1CJSA 2KX7A 2IV7A 1I5RA 1P0QA 1IH8A 3WR5A 3WYAA 1AD2A 4DV0B 1O89A 4BAZA 3O8LA 3QKRB 1JZTA 5G1PA 4DG8A 4XYEA 1IZ7A 4PTZA 2WWTA 4HNAB 2HJGA 3EX7C 1C41A 2IYQA 3E7DA 1EDBA 1EM6A 4JLOA 2Q46A 4IPTA 5SYNA 1RXVA 4IFBA 2DJIA 4EKGA 2IH2A 4KL8S 3CW9A 5LSAA 4A6XA 2F4VB 4YRSA 4FOOA 1P2BA 3RC2A 2G0AA 3K05A 1CUDA 1JR3D 2VP2A 4J3JA 2H3HA 2HOQA 1XLTC 5ICFA 1XTBA 1PQ4A 5FJIA 5K8CA 5CT4A 4MKHA 4MIYA 3MWDA 5E7IA 3F6PA 3R3WA 2PLNA 1G8SA 1UK8A 1DT5A 2CXTA 1TPZA 1MXHA 2QY6A 3MXOA 5TDHA 1Z0ZA 4U8GA 2AC7A 4O2BB 2CEKA 3NZEA 4CKWB 4OGFA 1Y5NA 3F4BA 3FCEA 3ILYA 2YX1A 1XTUA 4QOEA 4RLFA 1QIKA 3W5SA 3P2EA 4P4LA 3EXG1 3GLHE 1YKGA 1TUBA 2GN6A 2M6SA 1I3LA 4X24A 3NDIA 3W6UA 4D26A 1N6NA 1CJKC 2ZIAA 4WJLA 1X14A 1JVNA 4JLKA 1A9ZA 5KYWB 4YMGA 4AB1A 3TKLA 2ZE8A 1NPYA 1NURA 4UREA 2C2HA 1I80A 2EFGA 3Q7IA 4BUZA 2OV8A 3GDWA 3EOAI 3P7MA 4BLPA 4UHFA 4B6EA 1WZIA 1CYDA 4G8JA 4CKXA 2EX0A 1EFPB 1V39A 1DTWA 1V16A 2V0NA 4KQKA 4O8CA 3PJDA 2OCXA 4YCAA 1BDBA 3I61A 2PUAA 1OGYA 1DWUA 1LSJA 5B1SA 2YDYA 4F2PA 1GTG1 1U3GA 3QLTA 4LISA 1SZJG 3PFKA 1VFPA 1Z8FA 4UDOA 3N0VA 5ILOA 1NUQA 3ZK7A 1N77A 5A7GA 1CK4A 1LKZA 3HP4A 4QJ5A 1G7CA 5GGYA 5T8KA 5REQB 2BKUA 3T15A 2BKXA 3WP1B 1TVKA 4BYGA 5FAXA 2VSFA 3BHJA 4Y30A 1DV2A 3H4MA 4AQYB 1A7JA 1O9HA 2FPLA 2WVAA 3ZDXB 1CV2A 1DP4A 1PJ2A 5G4KB 1E1RD 2BZ1A 2C00A 3ZQUA 1V7PC 4CHTA 1NY5A 5BUQA 4JFAA 1KA9H 1GIAA 3NW9A 3ZGOA 3HJAA 1HDZA 1YDWA 2AIRA 4PINA 4G0VA 2R87A 3IDQA 1KK3A 2C5FA 1WY5A 1EVZA 1KC3A 2J0UB 1IQUA 3LCVB 4R31A 5TE9A 1PGNA 4S1PA 2TYSB 2IW1A 1CP2A 3LPMA 4QECA 4R05A 4ZC1A 2J3LA 3ESDA 4K46A 1JLKA 3SXUB 1KO5A 3ILSA 4WXHA 1QYCA 1RFLA 2ZETA 4PAMA 3OZFA 4HO1X 1HKHA 3WB0A 2JIOA 3LHSA 2FEAA 2FWIA 1SB8A 2O2GA 2RDMA 3WJ2A 5I9MA 4JMPA 5ECGC 4RPKA 5LKAA 2E5LB 1Z6AA 4Q7EA 5L3SA 2ZR9A 5CITA 3KOUA 1YCFA 4II2A 4NR0A 5TARA 3RW9A 3O0DA 3B85A 2Y0DA 2C9CA 3AR9A 4IWYA 1L9XA 3AI3A 5CGZA 3JQ9C 3PWTA 3TPCA 4C1BA 1EP9A 5CAEA 1QV9A 5CEEA 5FPKA 1ZN9A 1I5OA 3AM5A 2COKA 2QM7A 4X71A 2CK3D 1KYQA 1T5HX 3FF1A 1IVNA 1URPA 2QOEA 5FUBA 3RU3A 2ODNA 1GN8A 2ZOSA 4OXYA 3CJQA 5AHRA 2VOEA 4QTXA 1I32A 2VRWA 4H2DA 4C7MA 4YRTA 2EFDB 3NCTA 4KO1S 3A4IA 3T8YA 2QUHA 1CB0A 1DDOA 3LIPA 2R5WA 3N2YA 4MW2A 5LNK1 1PJ4A 3OA2A 1V8BA 3EBPA 1YUMA