2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
4XSGA 1DAKA 3FKSA 1NVXQ 2V4ZA 1G20E 4GOKA 4Q1EA 1UDXA 2VH5R 4FW9A 4RKEA 4OK6A 2FZ4A 4PO1A 3N70A 4NYJR 5K8TA 2G1JA 2ZUDA 5B64A 4TMTA 1SXJC 2XZLA 3W9YA 2FSGA 4A6PA 1DAMA 3MCAA 3E2IA 4AKEA 2A5YB 4LV6A 1G4AE 3PEVA 1QRAA 3K0AB 2Q6TA 3S1AA 3QUSA 2KBEA 1KNQA 5DH9A 4MQBA 3NIBA 5GJBA 1R0ZA 2VEDA 3ZYCA 4HB3A 3U7GA 1F2UA 1P61B 3ND8A 1T6NA 3OESA 3N5CA 2J0UA 2W00A 3L8YA 2QE7A 1E2HA 3RABA 1E2JA 3E1SA 3GJ5A 4ZCLA 4DIEA 3LQRA 3LX5A 4LJ9A 3GCGA 4JLNA 2GXAA 4IVQA 1XTRA 4LHYA 3B1YA 2LKCA 3F5FA 2P2LA 2BKUA 3ONWA 2FOLA 4FMBB 2JCSA 5L3SA 1PZNA 3IPYA 3REFA 2ZANA 3DPUA 1EX6A 3K9HA 1NJFA 5DI3A 5E7MA 2YHSA 1YZKA 2A2ZA 2P3SA 1OH8A 4EFMA 1KI6A 4NMMA 5JEDA 2FFBA 5BYJA 3HU1A 4JYCA 2C04A 3LAWA 2IS6A 1I4TD 2ZE5A 1EXMA 5FL7D 4TTPA 2YWFA 5IRCD 4BE7B 2BIFA 1Z07A 3VR1A 1J8YF 3R20A 2XZOA 1ODFA 3EG5A 2ANBA 1RRPA 1JI0A 3AGQA 5JZVA 5SZHB 4LC1A 2BBSA 1G7TA 2FH5B 1E99A 2ZR0A 3FMIA 4K46A 5DGXA 3SQWA 4CEIA 4I81A 2OCPA 1X6VA 4Q9HA 5A5GA 4Z54A 2ZSAA 2QZ4A 3TUJC 4D4LA 1XEWY 2RGCA 3WBJA 3DOFA 1QHGA 3HP1A 3OEED 3F8TA 4JVNA 3RRZA 5EP2A 2ODWA 4DRZA 5DE3A 2VF8A 2YWHA 4YQFA 4IW3B 1VPLA 3PCRB 4B48A 3THXA 5HZHA 4A8JB 1XTSA 3ZQJA 2GF0A 3C14C 2AWNA 1D9ZA 2VP5A 3QEOA 4Q1DA 1IOZA 3M6AA 5E7JA 2QM8A 2G0NA 2QN6A 1K5DA 5E7IA 3SHFA 2J0SA 1K6MA 2C98A 2PT7A 2FFAA 2ORIA 2A30A 1ZCBA 4PC6A 3MFYA 5B2ZA 3ZVNA 1WCV1 1P9NA 1TPZA 5JJLA 1OKKD 3LBNA 3SC3A 3A1SA 2BM0A 2QM7A 3U3KA 721PA 3DKPA 2CHGA 4KJZA 3RRNA 4ZKDA 3BFKA 1E79A 3EPKA 4Q7JB 1KI4A 1W44A 2Z4RA 3PUZA 4L16A 3OAAD 1SHKA 5IF9A 1KZ7B 3Q8XB 1GSIA 4CF7A 1OH7A 2PX0A 4E09A 3BH0A 3BH7A 2PZEA 3ADCA 4RD1A 5HKKA 2PCJA 4X8MA 4AG5A 4EPVA 4JSTA 2FF7A 4M0LA 2JLSA 3WXMA 3WP1B 4M1WA 4A2PA 1MR3F 1VIYA 1YU9A 2ZRLA 5TARA 4OHYA 2IYZA 1EFCA 1FFHA 1M1YE 3EASA 3QIAA 4TLCA 4KFTA 4US0R 4WBSA 5EE5B 5J4KA 4RZXA 1KI9A 3EPLA 5HKKD 3GLIE 3LW8A 4IDHA 4POAA 4U02A 2ERYA 2ZVPX 3EC1A 3VX4A 1JR3A 1Z83A 4Q9IA 2BJWA 3O47A 4PC7A 1XU4A 1XPUA 4BECA 4II7A 4JMPA 3QI2A 2OLJA 3TSOA 5KSPA 1H65A 4M1KA 1VMAA 4V0OA 1GRNA 2HUPA 1R7RA 2UZIR 4ESHA 3TQCA 3GFTA 5JWRA 3I8XA 2OBLA 1CJMA 2ZJOA 2QT1A 1S1CA 4Q4HA 1T9HA 4MKIA 3C41J 1FX0B 2QU8A 1G5RA 4AG6A 4JLJA 2IS1A 2B92A 2J45A 3T12A 2ORWA 4QBGB 5JJIA 2J59A 2X2FA 3VR3A 4LOAA 4LHZA 5SZJA 3KFVA 2MSEB 1N0UA 2G77B 2ZRDA 5FTMA 3KTAB 2ZI3A 2ONJA 5HZKA 1WBDA 2WWFA 4PAOA 1P60A 1T0JB 3GJ8A 4LRWA 2CEAA 4S35A 3SYNA 4IDNA 2CXXA 3NHBA 3QBTA 4N0DA 4MRNA 2HCBA 3U61B 5TY0A 1E0KA 1RRGA 2LCFA 1QHIA 1UJ2A 1US8B 1XWIA 4A8JA 1EESA 2WJVA 3O8BA 3FKQA 5BYKA 2GILA 4NZYA 2FG5A 2WVJA 4K81B 4BLTA 1KO5A 2DCUA 2XOKD 3U3JA 2N46A 4EPYA 3PUVA 1U81A 4MYHA 2ZJ8A 1Z2AA 2OCYC 2O52A 4NCNA 5B30A 3W6PA 1UADA 1W5SA 1AM4D 3BC1A 4X8OA 1OHHA 5E3HA 2AXNA 3T06B 5H68A 221PA 4NCJA 4RZUA 3ZIAA 1X8KA 4EJSA 4O25A 4PHFA 2GCNA 3TH5A 1PLJA 3BAFA 2RH5A 4B6EA 1WXQA 3T61A 4A4DA 2WOOA 1ZM3A 3SU8A 4V0MA 1TX4B 4FMDF 3G0HA 3I3SR 1E4YA 1R2QA 4RVCA 1M7BA 1SVOA 1HEIA 2VSFA 3HR8A 1ZINA 2R6AA 5C4GB 4FWIB 5TB5A 4B3XA 3EA5A 2O0JA 1ZD8A 1DG3A 3DVLA 3QG1A 2DWPA 1G3IA 2WJYA 4JYBA 3DL0A 3NG1A 4Q7MB 4ZCIA 1KI6B 4QJ3A 3U4QB 3GLGB 4MGKR 1R5BA 4AURA 3KX2A 1ETUA 2BKEA 2J5XA 3BGWA 1E2MA 4OJQA 4A0HA 1TADA 1IXRC 1R0WA 2AR7A 2FFHA 3HU2A 4JZKA 4L8GA 3B1ZA 4TQAA 4WZBE 4XD7D 3E5HA 3ADBA 1E1QD 2CHVA 1JEDA 4XIGS 5DSZA 5EXPA 1BYIA 4PC3A 1KMHA 1D2MA 1DS6A 2EU8A 3TVTA 3U44A 1VCMA 3LXRA 3WP0A 1KYIA 2DFKB 3CX8A 4R98A 1T5IA 4TMXA 5EZ5A 2FZLA 2G3YA 2QAJA 3GFPA 2RGAA 1E2NA 2OV2A 4A15A 4QNMA 5FL7A 2A9KA 4DWJA 1KKLA 2BBOA 3V00A 4RFSB 2IW3A 5IHPA 5LB2A 3WRXC 3NTUA 3ASYA 4A8JC 5EQTA 4WXPA 1N6OA 3IBYA 1EFTA 1KSHA 4KSBA 3CPHA 4LYFA 3R9XA 1W4BA 1V43A 3LVRE 3TBKA 4BEBA 1SXJD 2REBA 3B5JA 1W0JA 1TL7C 4JLAA 4RZ2A 4HLDA 4URVR 5KTYA 1KSGA 1TUEA 4RCYA 1UBFA 4DZZA 5FH9A 2O8FB 4EPXA 1LTQA 4Q9KA 1W36B 2ZR9A 4URZR 2ZYVX 1H8HA 2X77A 2P6NA 4LHWA 4NBSA 3GLFB 1CR1A 5FBQB 4MGZR 3M1IA 2ZIAA 1U2RA 3A58B 1HH4A 4BFXA 1E9BA 2IYQA 3F0TA 2FMXA 2WKQA 3WMFA 1Z63A 1Z8FA 3Q7PA 3C15C 4NL4H 5L3SB 4B35A 5BN5A 1G4UR 5DYGA 3TSZA 4KYIB 2OO7A 2W6IA 3D6TB 4LK2A 1QG2A 2QORA 3TIFA 2I1VB 4DLTA 1Q20A 1FTSA 1OIXA 3NWJA 1AIPA 4HZUB 4M4SA 4TL9A 1GM5A 1TMKA 4M1SA 4KI0A 1I4DD 4P31A 5LBIA 2C9OA 1U8ZA 3A37A 1KK0A 3CRW1 4DEXA 3RS2A 2AWOA 1G7CA 2B8WA 4OHZA 2IYTA 4ZCMA 1P72A 1P2TA 4EUNA 1OLOA 1U0HC 4BQSA 2AD1A 2ORVA 1XD2B 1ZRHA 4F4CA 1OIVA 4AIIA 1OYWA 3RS5A 1XP8A 2EFDB 4KO8A 1D6JA 3HPQA 3W90A 2F3RA 3X1YA 1GRRA 2GAOA 2WM9B 2Q9AA 4C7OA 4LJ6A 1YZLA 5FBVB 3X1XA 5HPYB 3KXIA 3W3AA 3VR2A 1LW7A 2O8DA 5LDDC 1OIWA 4Q4JB 3DM5A 5FUXA 4A1FA 1Z3IX 2QPAA 2AKAB 3NC0C 3QKTA 4IVPA 5AUNB 3P4YA 3OIWA 4IOKA 3RDPA 2Z43A 2J46A 3V4RA 1NY6A 4LYJA 1FQKA 2ZSEA 4WVFA 4KBFA 1YRAA 3ASZA 4ASUA 1CEEA 4IOJA 1XCPA 1GNPA 1COWA 1F2TA 1NVUQ 4XWKA 1EFRD 4PZLA 4LBVA 1ESNA 1EX7A 4LJ7A 3OHMA 4HEJA 4O3MA 1MH1A 3IQXA 5DHAA 1ZNWA 3BIFA 4DKXA 3QF4A 3HPRA 3M4YA 1MOZA 4BPBA 4TQ9A 4ABYA 4OL0A 4M22A 3R9WA 1Q3HA 1S4QA 1QVRA 1AGRA 2ODNA 2NG1A 4B75A 1L4UA 2H18A 2NO1A 5J4VA 2OLKA 4W7SA 2C99A 5BXQC 4LJAA 3ZVLA 2JLYA 2ZEJA 2A5FA 1QZXA 1Z47A 4OI4A 1P3JA 4YONB 2IT1A 1AGPA 5JSZA 3GJ4A 4M1TA 3PIRA 1UEJA 1NMXA 3AF1A 1DBSA 1IJEA 2RKOA 3CPEA 3Q5EA 1R5OA 3QQ5A 1NMZA 1GL7A 3TNFA 2WJGA 3L0OA 3R7WA 2QE7D 4LX0A 4HAXA 4XOIA 4KBGA 1U0LA 4OYHA 2EFHB 4PPFA 5L3QB 3GEIA 5JI3E 5E4FA 4ZPXA 1PV4A 1IONA 4HATA 2HT6A 2IS4A 2QSYA 4C30A 2IYSA 1F2TB 1IBRA 5KPJA 2AD5A 4LJYA 3W8NA 5FOXA 4C0QC 3TR5A 1Z29A 3QXSA 3QF7A 4JLBA 2QA5A 2ONKA 3CF6R 4BEJA 3C4JA 4M2LA 2F6RA 2XZPA 1T4GA 4Q66C 1MO3A 1E1RA 1CR4A 3NH9A 2W2VA 4QL3A 1DAHA 1X3SA 1KMQA 1P2VA 3WNBA 1E9SA 4UQOA 4LY6A 2ZM5A 3BWDD 4CZ2A 4AKIA 2R44A 2WWHA 4I1VA 3U44B 4AYTA 4PR0A 3V9PA 1ZIOA 4C0KA 5SZIA 1E9EA 4QM7A 4WOPA 1IAQA 3FFBA 3LY5A 4LYHA 2IF0A 4IKEA 1Z6GA 2Y8EA 5EP4A 4D0NA 4JLVA 2FEMA 1T3LA 1SQ5A 2WWXA 3EIHA 3I92A 2PMKA 4HAWA 1W48A 4TMZA 2WMOB 4DCSA 3GLHA 1MKYA 3PFIA 4BLRA 2W0SA 4UJ3A 1LS1A 4IDQA 3LWNA 1KI8A 4LBYA 3KJIA 2OFOA 1AA9A 2JLQA 4PANA 1C4OA 5FI1B 5TDHA 1ZJ6A 3KJGA 4DB2A 2WV9A 4V0ME 1LS6A 2ZSBA 2QENA 3EXAA 3LV8A 3LX8A 1SULA 5FUWA 5SZKB 5KDDA 3BFXA 4BLPA 4LPKA 3A1VA 1WB9A 1D2NA 1SVLA 4MKGA 4JBWA 4ILEA 1ZNZA 4DDTA 4E5UA 2G83A 1RZ3A 1DTSA 2EW1A 1ZUHA 1HQYE 4R2HA 2R6DA 3WY9A 4IVRA 1TQ4A 1C1YA 1T3HA 4H9GA 2EFCB 2AFIE 2REOA 1FX0A 3GJ0A 4LGMA 3KXLA 4R9UC 2PBRA 3L82B 4N0EA 2QMOA 1DARA 3OIVA 2FNAA 3K0CC 4TL8A 3SOPA 4W5WA 4Z1MD 3MGCA 3VR4A 1WP9A 2ZTSA 2ZSFA 3UG6A 1E94E 1Z0AA 1ZC4A 4A82A 4CVNA 1JXMA 2DWQA 4CT4B 2YOFA 2VHUA 2GCOA 1GG2A 3AVTA 4MRVA 1KGDA 1GVNB 4Q48A 2ZJBA 3B1XA 4Q4JA 5FPSA 3K0SA 2ZRCA 3QENA 5FL3A 4UNQA 2FGKA 1W7AA 1LFDB 1E9DA 3THYA 4RD3A 5CM8B 2QNRA 4B3CA 3IEVA 3FHOA 1NKTA 2GCPA 3DO6A 2VYFA 4OHVA 3IO5A 4L9WA 2NO0A 4YLGA 3NDBB 2JLRA 4MUAA 5FBLB 4M9SA 5J4LA 4IXMA 1II8A 4IFEA 1A2BA 2O8CB 2NZJA 2QROA 5B57C 4KV9A 1W5TA 2HJVA 2GBLC 1U0JA 1S3GA 2OHFA 4EPTA 4TN1A 5IT5A 1CF4A 5CYPA 1Q1EA 1TF7A 3RHFA 3L43A 2JASA 2J1LA 1GZSA 3GLHB 4RD4A 5FPTA 2IUUA 3ZZUA 1Q12A 3SFZA 2CLDX 2FWRA 1BMFA 1HY3A 1VHLA 5KNCA 3T34A 4AD8A 5D3MA 4UNRA 2QPTA 2WICA 1G17A 5H70A 2V9PA 3VAAA 5JECA 1Q0UA 3QKSB 2WWIA 1SXJB 3RSLA 1CTQA 4YMTA 3VQTA 4EAQA 4YMWA 5DHFA 4TYQA 3TAUA 2ZI7A 2DB3A 3I72A 4C3ZA 4W9MC 3ECCA 1E2DA 2C78A 2PEZA 2JATA 5J4YA 1XTIA 1E9AA 1XX6A 2MMGA 1XZQA 1IXZA 2ATXA 2AXPA 2DY1A 2F9MA 3KUDA 1WA5A 4HAUA 5IK2A 2FX3A 3JVVA 4B2PA 1P7CA 3U6BA 5EP3A 2ZE7A 3R9IA 2WSSA 2CCJA 3BK7A 1G19A 1ZM9A 5KHOC 2BEJA 4PHTA 2F43B 3THOA 2A3RA 1OT3A 1HV8A 2H57A 3SDZA 4PHGA 1DG1G 1BYUA 4E03A 3O8CA 2GXSA 3SYKA 5AUPB 2V3CC 3ADKA 1KAOA 3L8ZA 2XNSA 2NIPA 1S9DA 2DFNA 4JT4A 3UMFA 3U2QA 1F48A 2GDJA 4AI6A 1UKVY 2BCJQ 4C0BA 2GCOB 2Q9BA 2JLUA 3THYB 4BRWA 2NO7A 4MH0R 3D7MA 1ZUIA 3MJRA 3KQUA 4C0JA 2F1IA 1OF1A 4D26A 1G64A 4P0TA 4IRUB 3K9LA 2VLIA 4PQYA 2QQ0A 5AWFC 1F6BA 4ARZA 1M7HA 1BOFA 1F2UB 3NH6A 3LH5A 4HI0E 1FUKA 5DO9A 2PH1A 2ZJ5A 2B21A 2SHKA 4IJMA 1X1RA 5DI9A 3WNDA 4ZDJA 2HYIC 2W6JA 1NN5A 3QKRB 4C0LA 2QTFA 1OFTA 2F9LA 3B8HA 4R71A 3AM1A 1ZVQA 5FOSA 3UANA 1W4RA 1NNEA 5F9FA 3TR0A 2D3WA 1JEEA 3K8YA 5GADl 3K0CA 1CIPA 4RJLA 2GKSA 1IN6A 3KKMA 4A2WA 3RS4A 3AKDA 2HT1A 3FHCB 3WMGA 1JPNA 4HB0A 1SVMA 5BWMA 3D8BA 4I99A 1TAGA 3AKYA 2AX4A 2BJVA 1KDOA 2GJ9A 4V02A 4DUGA 3KJEA 1JQJC 1XNJA 2KE5A 3RRMA 4AYXA 1SGWA 1NN1A 3AVUA 1X1SA 2J41A 5FUVA 2V6IA 3G5UA 1NMYA 2J7PD 4CRWB 5AJYA 4OI0A 1UM8A 1W4AA 1XB2A 1KY3A 3IIMA 1W0KA 3TLXA 1BKDR 2H92A 5LD2B 1D2EA 1DELA 2YV5A 1AS3A 4DBLC 1M7GA 1SXJA 4M1OA 2F1HA 3Q9LA 4B33A 4MKFA 1JECA 1G8PA 1HT2E 1E0SA 1E9CA 5JCZA 5FTNA 4PSVA 3IDQA 2BBTA 1GFIA 2GBLA 3D3QA 5FOTA 4IEEA 3QXXA 3U7FB 1OB2A 5BN3A 1E9FA 4QGAA 1KY2A 2P0EA 4LPSA 4EPWA 2QAGA 4HAZA 4OQFA 3EW9A 5K8UA 5BW8A 3QEJA 1SVKA 4CGZA 2J0UB 4DUGD 2KSQA 3EZ7A 3U3OA 5JHHB 3THWA 2E1RA 2FEOA 5DISB 1Q57A 2O0HA 1QDEA 3TMKA 5JLJA 3ZVRA 4OBEA 4YDSA 1GDDA 4EFNA 1QVAA 1R8SA 1YJ5A 1P2UA 4OK5A 4DSTA 4NKRA 4AYWA 4UNSA 3RS0A 1NP6A 1X8JA 3CF2A 1NSFA 5F9HA 4Q4LA 1E9RA 2WAXA 3IHWA 5EXTA 2OFXA 1KZGB 2IK8A 1ZM4A 3NBFA 4UKDA 1TNDA 4BZXA 2JIZA 2VA8A 4KHZA 2GF9A 3A1TA 1G5TA 4Q1CA 5HE9A 4I1SA 1ZM7A 4L4UA 1Q22A 2ZRBA 1FZQA 1TU4A 3ICQB 5C2JB 3CNOA 1OKKA 2R62A 5JRZA 3SHWA 5FOVA 1G5PA 1KSFX 2DPXA 2GAAA 3NVAA 5CLLA 3MWKA 3C5HA 5LPNA 3SJBA 4CEHB 4Q7LA 2FE4A 3QY0A 4NP6A 4NONA 1GIAA 1VDZA 2PJZA 4DLUA 4D4MA 3HWSA 1VHTA 4DT1B 4NHOA 4BWYA 4Z51A 5D3MB 1W46A 2IHBA 5AJWA 4YMUA 4N3NA 3UG7A 4DSNA 3QKUA 4M21A 1MV5A 4DLRA 1OFUX 5GVSA 1YZNA 1MABA 3BJIC 3VKWA 3RC3A 3GLHE 3LLUA 1N5KA 2EYUA 4G01B 3R8FA 3WNCA 4CW7A 2BC9A 3LRPA 4B3FX 3ZH9B 1QBKC 5BN4A 2RCNA 2QTHA 1W36C 3GLIA 3CRVA 1KAGA 2W6JD 1QHXA 5EUMA 1G7RA 3QPUA 4P4SB 3RS3A 2ZAMA 1QHNA 2H17A 1U98A 2ZRJA 3AVPA 4PZZA 3LBHA 2QEQA 4YC7A 4F4IA 3ZQ6A 6Q21A 5JS8A 4D4JA 1RPZA 1NLZA 2FSIA 2X1VA 4DC9A 2QUZA 2FA9A 3U3MA 2BMJA 2CCGA 3IEUA 4JVLA 4EDHA 1WMSA 1I4LD 2WTUA 2CCKA 2MSDB 4Y0VA 3RRYA 4EPRA 1IY1A 3SN6A 3ZZ0A 2KWIA 1JXOA 3A1WA 4JLDA 4KXFB 5FR1A 3I62A 1KIMA 3VNUA 3O8DA 3OE7D 4W5JA 4DLYA 3LA6A 1RYFA 3CNNA 4D4KA 1XEXA 1NBMA 2D7CA 4RSGA 1MO6A 2C95A 1TTTA 1UBEA 5FPKA 1CS4C 2HDNB 1IHUA 2WOJA 1HE1C 5GVRA 4IXNA 3L0IB 1OXVA 5J47A 2BM1A 4IDOA 3B60A 2A78A 1U9IC 4Q1BA 1Z08A 4MRRA 3SQXA 3TE6A 1E69A 1OSNA 1NBMD 1G8FA 1L8QA 2ANCA 4G5GA 1CBUA 4RZ3A 4MITA 4TYYA 1D8TA 1EGAA 1J70A 5J40A 1J8MF 3T15A 2RAPA 3QE0A 2UKDA 3A8TA 4HZUA 1P75A 2PLRA 5JSZB 2XOKA 1EFRA 2PX3A 1A82A 3H84A 4CEJA 4C9BA 3LFUA 5DI3B 3QKRA 4CYMA 1K8RA 3I4LA 1KO8A 5AR1A 1EWQA 1XPRA 4JJZA 4PC1A 1S8FA 5DN6A 2B6HA 3VNVA 4C0HA 3DDCA 4TYNA 2I3BA 4LYAA 3EZFA 4YMSA 3KQNA 1YR7A 2B7BA 2CHQA 1N5IA 1OXXK 3EX7C 4TYWA 3UMRA 1NKSA 2GNOA 2GJKA 4HUQA 4PC2A 1AN0A 4B76A 4KYUA 3VTKA 5CYOA 2Z6VA 1RRFA 1YE8A 2ECKA 1MABB 3UWOA 2P67A 1XJCA 2C9YA 1UF9A 1T5LA 1UDWA 5FTLA 3ICEA 1KDTA 3FDIA 5CJ2A 1KNXA 2NO9A 4V03A 3UMSA 4D2IA 1NLFA 1BIFA 1GNRA 2CMKA 1JJVA 1AKEA 3WYAA 1U90A 2OUKA 2ZI9A 5EP1A 1IY0A 2GK7A 5L3VA 3BRWD 3MUFA 2W6ID 3ZD7A 1M6NA 1G6HA 5DN6D 4BFYA 2WWYA 1IN7A 4URWR 2N1BA 1Z6TA 4ON9A 2HLDD 1M34E 1PUJA 4EJSC 3DMNA 2BBWA 3OIYA 1AJEA 3J81k 4TLEA 4CEJB 2D2FA 2HCJB 3K70C 1LF5A 1Z6XA 3AVVA 3TJZA 3WRYC 5KNDA 2GXUA 3EC2A 5KOYA 4IOMA 4LHXA 2QI9C 2PZFA 4JLOA 1G8YA 1E4VA 4QXAA 1OJLA 1CJVC 1VG1A 3TGPA 5EJEA 3CH5A 3QVUA 3K09A 4HLUA 2AKYA 5AK0A 1GOTA 2YKGA 1XEXB 4LJ8A 1N5JA 1WE2A 2BCGY 4PXAA 1H8HD 5FR2A 2R65A 4HAYA 1DOAA 1XEFA 4B3GA 1AQYA 2ATVA 1U8YA 2PMDA 4P32A 1XFAA 4Q1FA 2IYUA 2YOHA 3NKVA 5K8IA 2HF9A 4NYMQ 4PQRA 2JIZD 3SJAA 2OT3B 4G0NA 3RNLA 3SZRA 2J3EA 4DHEA 3RS7A 2OEPA 4P3YA 1Z6YA 4V0LA 1IXSB 1R10A 1VYVA 1SHZA 3E70C 3OEHA 5EE0A 3DZDA 1KJYA 1W0KD 3T1QA 4F38A 4JKIA 1E2IA 3KUCA 3B2EA 1XD2A 4Q21A 2HXSA 3GQBA 2OAP1 4MUBA 4V0KA 3TAHA 1AZSC 1F3OA 3TUIC 3ZGXA 4ZIRB 2D7DA 4XD7A 5G53C 3IILA 1RYHA 1YR9A 1E6CA 2P65A 3PJRA 3CR7A 3UATA 4DIDA 1J90A 1PJRA 4DT1A 1WF3A 5HE8A 1YQTA 1JPJA 4D80A 4KCGA 1AS0A 5CITA 1KJWA 4DLZA 4QNRA 2JLZA 4E07A 1N6LA 4I1UA 2Z4SA 5JS7A 1G8GA 1UKYA 2B7CA 1UAAA 4G5RA 4NCKA 5EZ6B 2WJJA 3BORA 2ZS7A 2RHDA 1WQ1R 4IEIA 4JBXA 4H1UA 621PA 2ZXUA 5BQ5A 5FBWB 2J0VA 1SKYE 2XTZA 4TLDA 1CXZA 5AJZA 4JT2A 4A6XA 3K0EA 5FBRB 1D9XA 2BEKA 3A4NA 4G1UC 1J7KA 4LZZA 1CLUA 3KB2A 2BV3A 3AV0B 4MYCA 4LC0A 2OSBA 5UKDA 4N1AA 1KOFA 4L15A 5KUTA 2JDID 3N2IA 4P4TA 1QHHA 2ZRAA 2O8EB 2IS2A 3W3ZB 1E3MA 3A6PC 4ERNA 5KNBA 2GJ8A 2YNMA 2VIIA 2ZI6A 3OAAA 1GL6A 2F1RA 3BOSA 1NIJA 1NF3A 4QBFA 2C5LA 4Q01A 4QFMA 4RD6A 2CVHA 4M1MA 2Z0MA 1E2QA 5C1BA 1BS1A 1LVGA 2CVFA 2C8VA 2ZR7A 4M9XA 1PLLA 1KK3A 4MDEA 1XD8A 3HR7A 1CJUC 1ZCAA 2ZRIA 4BZPA 3U4QA 2QP3A 3PG5A 5KSZA 2VHJA 1CRQA 3B82A 3EZ9A 2QAGC 1ONBA 2P5SA 3K70B 3PUWA 2VHTA 2WJHA 3HDTA 1T3SA 2QQEA 2YC2C 8OHMA 4JJKA 5G3YA 1VIAA 3DMDA 3GEEA 4JS0A 1LB1B 1CR2A 2ZYUX 1HT1E 1U8AA 3G82C 3X1DA 2IC5A 3QKSA 1DO2A 2CNWA 2IUSA 4C2TA 4LWZA 3GLGA 2CLSA 3AUYA 2D62A 1FL9A 1G18A 1G1MA 5FFMA 4YXWA 4XSHA 5KSOA 3U60B 1W2GA 4FCVA 5JJKA 1Z28A 5HR5A 2IBMA 4HYYA 4PPNA 3GP8A 3OFNA 2V8OA 4URUR 4ZO4A 3VR6A 2OFWA 4GZMA 2IWRA 3AP2A 4D0LB 1DVRA 3MSXA 2QPOA 2JAQA 4PX9A 4RKFA 3KQLA 1OXSC 1N0WA 4LBWA 1TQ2A 3KKNA 3IO3A 2R6FA 5CK5A 4XWAA 3VU9A 3OZXA 2VRWA 1B0UA 3IGFA 4TZ0A 2NQ2C 1E96A 4JL5A 2O8BA 2HXYA 1Y3AA 5L8VA 2QBYB 2GVDC 1DEKA 1PLKA 3WBKA 4P33A 2Q0HA 4EIWA 4ZI2A 2RHMA 3W5JA 2O8FA 4P4UA 2PL3A 3ZS8A 3EARA 1W1WA 2GETA 2IYLD 1RKBA 4E22A 3QXJA 1GP2A 1E79D 2EFGA 3K70D 1HUQA 4DSOA 4DVGA 4AY2A 4JBYA 2OCBA 2CL7X 3FVQA 2EQBA 2WWGA 4TMKA 3I32A 1TU3A 1S0UA 3SEAA 2WIBA 4Q5IA 2Q21A 1TUIA 1JR3D 2ZS9A 5J5CA 5KPDA 4GL2A 4D25A 1E1QA 1RIFA 1US8A 2YYZA 5GJWC 1SVIA 1NVVQ 1QHHB 2K5UA 1M8PA 4LJ5A 2QMUA 1VG9B 2RGDA 2VQSA 3NEJA 2KJQA 4MA4A 2ERXA 2WSMA 1XDBA 2YC4C 1JB1A 1PUIA 2ZRMA 3T5DA 3MWLA 1XMJA 2VP0A 3IBGA 4BZQA 3BS4A 3NHAA 1ZUNB 1KO4A 3EAQA 3Q3JB 5CIQA 2QGZA 5K8LA 4FIDA 2RGNA 3UWKA 4QG7A 3Q7QA 2OAQ1 2ZRPA 4MGYR 2IA5A 1KI1A 1MO5A 1VG0B 3TRFA 2F3TA 4M53A 4BFTA 4NDZA 1N25A 1VTKA 2D4HA 2XTMA 2ZRHA 3KB1A 5EE3A 5JWOA 1XJQA 3CZQA 5EE1A 1T91A 2DHRA 4FCWA 4XVUA 1T8UA 2VHCA 3C16C 3CWQA 2ZRNA 4HDOB 4I1OA 4TMWA 2QT0A 4QHTA 2ZQ5A 2EVWX 1X86B 4HB4A 3I61A 3CWZA 4WIAA 2O0KA 4Q4HB 3FHTA 1E0AA 2WHXA 1RJ9B 3PV0A 4BLSA 1DAFA 2JLVA 2JJ2D 1R8QA 1Z0IA 3BD9A 5JCPA 5KDOA 3T1VA 3DOEA 4B44A 1EFHA 2IUTA 5CB8A 1YVDA 2REXB 3BB4A 4O2RA 2FN4A 3T1TA 3EIQA 3AF0A 4ZIRA 1U99A 1WDTA 4OK3A 1W49A 3B85A 3H0KA 1ZMXA 3U3RA 2GZDA 4U5XA 4JL6A 2UZ3A 4YDHB 4B43A 2AK2A 3RAPR 1U9IA 3B9PA 3QBVA 5CJPA 1Q1BA 3TKLA 1ZIPA 1UPTA 4NPHA 2XJ4A 1SVWA 3WMEA 4QHYA 2GJAA 2ZJZA 3BXZA 2FPKA 3CR8A 5C46F 1H8ED 2VP6A 1TEXA 2G1KA 3AGPA 1II8B 3IQWA 2O8CA 2OBNA 4LCBA 4EQ6B 2IXGA 4PHHA 1NIPA 3ZLJA 2ZU6A 2GZHA 2EWWA 2CNWD 3OEHD 4JLMA 4QM6A 4OQXA 2VF7A 4LJ4A 4YMVA 1W47A 2BWJA 3FPAA 2BDTA 3VX3A 4S2EA 2QTVB 3REGA 3TSWA 3PUYA 5B58C 2ZAOA 5CIWA 4U7DA 1U94A 1VCOA 2YWEA 4Y0AA 3KKOA 5KSYA 1VCNA 2H5EA 4GP7A 4TLAA 5CDFE 2D74A 1M2OB 1S96A 4PTLA 3UK6A 4TSFD 1FNMA 1XTQA 4RD2A 2W2TA 2YVUA 1OW3B 2PZGA 4RFVA 2PJRA 5A0FA 3FGNA 3MRSA 1XTJA 1FPMA 2GEDA 2GEVA 2A5JA 1AS2A 3AVQA 4KVGA 4PPQA 1RE0A 2V1XA 1ZU4A 2HV8A 4ITRC 2Q3HA 4Z8XA 3GFOA 3MMPA 2HLDA 3SFVA 3AP3A 1XEWX 1XZPA 3MAAC 2H8KA 4FMDB 3DM9B 2F43A 4IHQA 1GRQA 1CR0A 2UVQA 4CEHA 4GI7A 1B23P 1KK2A 1YR6A 3THXB 1YZTA 4XJXA 2IYYA 1QF9A 3QJYA 4KLZA 2ZRKA 1J2JA 4NH0A 3UPUA 1DO0A 3ND9A 3LVQE 1DPFA 5DNYB 1RFLA 4Q47A 3AKEA 2C77A 2CDNA 4XTCS 2P6RA 2ZRFA 2VSOA 1AK2A 3D31A 3GLIB 3NEYA 4B73A 1VYUA 1L7VC 2V1UA 2VSXA 1ZYUA 5L3RA 3LNCA 4UNNA 4HDCA 1FUUA 1EFUA 3SS8A 4GPTA 2ZUCA 3FYHA 3RANA 4Q4AA 3CPJB 2W0MA 1FTNA 3I1FA 1J99A 4GZLA 3SBDA 1N6RA 4DDUA 2GA8A 2ODEA 2JEOA 3PVSA 4CDGA 4ACAA 3LD9A 4J0QA 4OHXA 2DR3A 3EZ6A 4LBZA 4TTRA 2DWOA 3TW8B 3JZMA 4M9ZA 2JGNA 4MGIR 2QP4A 1HTWA 2IXFA 1XMIA 1YKSA 3EIEA 1OXTA 1G21E 1GTVA 4TMVA 2BMFA 3DZ8A 1R4AA 2ZVQX 3BFVA 3A4LA 3NBXX 2KBFA 4MYUA 4YXWD 3QF4B 4LSGA 5GJCA 2NPIA 4OQNA 1A2KC 3FMOB 4F93B 4OQLA 4KSCA 3OEEA 4DCTA 4ZKEA 1M74A 1E98A 2MMCA 1RVDA 3CX6A 4EKDA 1MRNA 1MT0A 2CE7A 1FMJA 4MRPA 2FU5C 2ZE6A 1ESMA 3SE0A 4C7OB 3PITA 4F4JA 4KAXA 1XPOA 4HUTA 2PCLA 4KFUA 1XMVA 1OE0A 5KO2A 4TQUS 3OE7A 3DHWC 1Z6AA 2XSZA 4DLXA 3AF4A 1G3MA 1TEVA 5C4MA 2ZU0C 5H1YA 3R7WB 2AN9A 1JNYA 1I2DA 1IY2A 3CLVA 1FOEB 1CJKC 2WMNB 3U7EB 4TL6A 3BB3A 2R8RA 1T0HB 3T35A 2DFLA 4B71A 1CJTC 2FV8A 2JJ1A 2VO1A 4FN5A 3LO5A 2EFEB 4HLQB 2W2XA 1UEIA 2ZE8A 3MJHA 1VCIA 3AUXA 4LDJA 1OPXA 4Q9LA 3H4MA 3RYTC 3GMTA 1Z2CA 4A0GA 5LD2C 2CK3A 1RJ9A 3VR5A 2XJ9A 3WHLA 3ADDA 4F91B 3ZJYA 3BERA 4NYIQ 4URYR 1Q44A 1ZAKA 2OG2A 1TF2A 3TW4A 1A1VA 2BMEA 5DLQC 4FWTA 1ZW6A 5FPYA 1CU1A 2ZPTX 5C18A 3JZAA 2ZREA 2G0TA 1Z0DA 2QG6A 3W5IA 1JJ7A 1FMLA 4Z8YA 4W5HA 3ETLA 1KI2A 2XTNA 4MRSA 2ZJ2A 2FSFA 2QL6A 1P62B 3EWAA 4RFSA 3B6EA 3B1VA 4ZDIA 1SKQA 1UKEA 3CRMA 1BH2A 5JHGB 1Q1QA 2ZYTX 2FFQA 4JVSB 4ZDWA 3B78A 2IX3A 1N2CE 4KFRA 2XGJA 4Q19A 3FFAA 4XWOA 3FMPB 4AWXA 2ZRGA 4Z1MA 2XXAB 3L0SA 3VHLB 4ZI3A 2C9CA 4ESVA 1G3RA 1K5GA 2BVNA 3HYRA 3SBEA 5FTKA 1E1RD 1F60A 2AK3A 4QOSA 4PO9A 3CRQA 2A7QA 3I5YA 2D06A 4OHWA 1MRSA 2XEXA 4NCIA 1LNZA 1FW6A 1Z06A 2R6GA 3N2EA 1NG1A 1HYQA 2OZEA 2NPFA 3OIUA 3GJ3A 4R7ZA 1KDRA 4ARZB 4TT3D 1PVOA 3QXHA 4BLQA 2WWWA 3QOFA 4PPGA 4C0SA 1P4SA 1ZNXA 2FGJA 2GZAA 2DYKA 1GILA 2DFTA 1JR3E 5EUQB 3TQFA 4G5QA 2VL7A 1E2KA 3AB3A 4I4LA 3AQ4A 3SJZA 3OFND 1Z0JA 2G9NA 1O3YA 3C7KA 2ASEA 3IHLA 1SKYB 4B47A 2QGNA 2V7QD 4ASUD 3Q72A 2VP4A 4C2UA 4TL7A 4XTRA 1N6HA 1O87A 1N6IA 1NVWQ 4PQFA 4TTQA 1E32A 1W0JD 5ANRB 5CB6A 3ZVMA 3B7GA 1XMSA 1RW4A 1VKJA 1NG9A 4US1R 2VTKA 1KI3A 2JLXA 2I1QA 3RSOA 4AC9A 3EPJA 2QSZA 2XB4A 1GWNA 1II9A 3K09C 4MKHA 2FJUA 4TYPA 3U6KA 2IYWA 1IN4A 3GEHA 3CB4A 3LLMA 3RVBA 1JQLB 4P4SA 5HCIA 1IN5A 3K1JA 3HU3A 2X2EA 3IIKA 5JRJA 3FB4A 1OV4A 2IYRA 1XCGB 2ODBA 1ZU5A 4OKSA 5KDLA 1XBTA 3CONA 3LW7A 1EWRA 2GTPA 3QPVA 4G3XA 1DE0A 1L2TA 5TMPA 1N0VC 4B3BA 2CBZA 3AP1A 1NN0A 3FMFA 3BBPA 3HJNA 3WHKA 2XITA 3RC8A 2LWIA 1YRBA 2QRZA 2GXQA 2IYVA 2WIAA 3X1WA 2GK6A 3WYGA 3GLFA 4FD2A 4NYJQ 3PENA 3O8RA 1G9XA 4QJ4A 3SJCA 3TK1A 1N6NA 4DLWA 1Q3TA 2OXRA 1R6BX 4PO8A 4R2IA 2ZITA 1BO6A 3CKLA 1Z5ZA 3Q85A 1Y63A 3U5ZB 2QAGB 4US2R 4BASA 1G16A 5JBQA 3TVDA 3IKJA 5AJVB 3K0FB 3THWB 5F3WB 2HF8A 2V54A 1JR6A 1G8HA 4RD0A 1UKZA 1XF9A 4AKGA 3CW2A 3TUZC 2ZROA 2AFHE 4DCUA 3L0PA 1MO4A 4L5BA 4PSAA 2RMKA 2VP2A 3IPXA 3PEYA 2F1JA 2WPDA 1NN3A 3DKVA 3UKDA 4XVRA 5AJXA 1OH6A 2GHIA 2HEIA 1AQUA 2B8TA 2J0QA 4OI2A 4GMDA 3RWOA 3P26A 1X8LA 3HYTA 4BFVA 1G3QA 2GEUA 2H16A 4GSYA 3ZZTA 1IJFA 4H1VA 1KK1A 4F7WA 5JEEA 3NC1C 3QNUA 1L4YA 1TF5A 1XXHA 2QBYA 4L9SA 1NBME 2V55B 3T5GA 1A4RA 1LY1A 1E2EA 1GUAA 4DLVA 4DCNA 2J7PA 5P21A 4PZYA 1VECA 4K8OA 5FPHA 3B1WA 2IWHA 3I73A 4IFBA 4GP6A 1ZC3A 4OJKA 3MWJA 5CM9C 4DDVA 2O8BB 1G41A 1NVVR 3KJHA 4Q9JA 3CF0A 3KQKA 4A36A 1N3BA 1ZD1A 2J87A 4QC2A 3LBIA 4HLCA 2ZI4A 3KTAA 4PSKA 1AKYA 1P6XA 2BMDA 3ZS9A 4LUCA 4LV5B 5F98A 5F2EA 1LF0A 2RGXA 2A5DA 2D2EA 4LV8B 2KB0A 3W34A 3CX7A 4JL8A 4GOJA 5FTJA 3BH6A 4QBIA 2GJSA 1ZBDA 4KU4A 4B2IA 1RC8A 2XB2A 3AH8A 4MDFA 4EQ6A 2NGRA 3MG9A 1WBBA 5AUQA 2OXCA 4Q7KA 4XVQA 3P4XA 4GT1A 4WZAE 1KMHB 4O0MA 1E2GA 1JALA 2OM2A 2Z83A 1CKEA 3I8SA 1IN8A 3LXXA 1E2PA 3P32A 1FP6A 4JLPA 1W36D 4G5OA 1RRCA 5DYIA 1XRJA 3PR1A 1N6PA 1OFIA 3VFDA 2PT5A 1Z0FA 3CRRA 4PAMA 3FOZA 5ELXA 3PUXA 4HLUC 4GBMA 1AZTA 1ZD9A 4DDWA 4DB4A 2YINC 2FPMA 2C03A 2X8AA 1E0JA 3P1JA 3QSYA 4FMCF 4EJSB 3SYLA 1BMFD 2RB4A 3L2OB 5FUYA 3WYFA 2FPLA 4ACBA 2GWHA 4URXR 4FCTA 2R2AA 4B6FA 4QGGA 5L3QA 1OHHD 4HAVA 5G3ZA 4DLSA 3KKQA 1P2SA 1UFQA 2OILA 2WKPA 4JSYA 5G41A 3EA0A 2IXEA 4B34A 2DBYA 2PLFA 4Q00A 1GKUB 1QHSA 2ZETA 4D81A 1XCMA 1FNNA 3QPWA 4F92B 1HE8B 2EYQA 2QP9X 3K9NA 2R6CA 3K0FA 5LB4A 4B74A 2RGEA 1DAIA 1D5CA 4O2LA 1G291 3CNLA 1YR8A 3M0EA 3X1ZA 1W4CA 3MLEA 2RGBA 1ZP6A 1R5NA 2R9VA 3FKSD 1Q21A 4RCZA 2CK3D 1XXHB 1JBKA 1P9WA 1HA3A 4QGFA 1NRJB 4WW0A 3B9QA 4TSFA 3LQQA 2JJ8A 4Q03A 4OI1A 1GL9B 3VHXA 2CL6X 2N42A 3AEZA 5IK2D 2VHQA 1KTVA 3C5CA 3GJ6A 4GOXA 3H86A 4A0FA 2GESA 3P27A 4M8NE 5FI0B 1NY5A 3K9GA 5E95A 1Z0KA 1ELOA 2GVZC 1OYYA 1UBCA 4KODA 1FP7A 4B2LA 1KO1A 2IEZA 2CLCX 4A2QA 3K0AA 1T8TA 2OESA 2JA1A 2RGGA 2O5VA 2C2HA 3FTQA 4DSUA 1GNQA 4IDPA 4BFWA 1NL3A 4FINA 4ZV4A 2VP9A 3W8RA 3LDAA 1GITA 1E2FA 3AF3A 1E2LA 3KXKA 5JI2E 4QJ5A 3KL4A 2I4IA 4GFDA 1NI3A 4UJ5A 4PFSA 2JDIA 1DAEA 3IUYA 521PA 3NBZC 3QXCA 4NU0A 5DIFA 1LV7A 1KSJA 5EXSA 1KHTA 4AK9A 4GNKA 1Q1ZA 2QMHA 1I2MA 2G6BA 1CP2A 4TLBA 1EG7A 3AKCA 2WSSD 4CIDA 1FQJA 3GLFE 1XXHE 2Q3FA 2NOAA 1QG4A 2W58A 1DADA 1SVSA 5J4HA 3BE4A 2J7KA 3H2YA 2WAYA 1HQCA 4A0RA 3EWSA 2H1LA 2ZSDA 3NDPA 4BFUA 1C9KA 3AVXA 2Q9CA 5TVKA 2A5GA 4XH9B 4NYMR 4G5SA 1HURA 4GMXA 4X8HA 4QRHA 3K53A 3I5XA 2BHRA 4CEIB 2TMKA 5EE9A 1R0YA 4DEYA 1OFHA 3VKHA 1EK0A 3MWYW 3NBYC 3EPHA 3VMFA 1NLYA 4WA7A 1S3SA 5CLQA 5KU1A 3GJXC 2ZI5A 1CULC 1V5WA 4Q1AA 4QHSA 4TT3A 3RWMB 5FOWA 4B3DA 2XAUA 2YZ2A 4Q4AB 3W6NA 4HB2A 2WBLC 4KVAA 4M9QA 2ZUBA 1JAHA 3KDSE 4JVMA 2NZ8A 4HZIA 1TQDA 3FWYA 2J9RA 3GPLA 5AUOB 1KKMA 2L0XA 1KDPA 2QRNA 4JKYA 3ZDQA 2KI5A 4HUQB 1ANKA 1P73A 4M1YA 4LI0A 1JAIA 2CJWA 5HTKA 4HDQB 2V7QA 1II0A 5CK4A 4GDFA 1XTKA 4FI3C 3GLGE 3CM0A 3VU9B 3PXGA 1NJGA 4UXIA 5A4JA 4MYTA 1Z22A 2ZS8A 3CIOA 1F5NA 1SZPA 4NTZA 2CL0X 4OQMA 3AVWA 2G88A 3C8UA 3GJ7A 421PA 1VYTA 2WZQA 3KKPA 4WXRA 2NO6A 2IEYA 5GJVC 2W83A 3NXSA 5JWHA 1R0XA 4RY2A 5FOUA 4BFSA 2F55A 2O8EA 4BLOA 1S9HA 3FE2A 5H8WA 2AHOA 2E9SA 1UBGA 4X8LA 2YJTD 3MD0A 4C4PA 1A7JA 3T1OA 3CO5A 1XD9A 3Q5DA 4B32A 3A1UA 4A92A 2IYXA 3AVYA 1VG8A 1GKIA 1ZNYA 2ZJYA 4TWZA 3JVUA 1NSTA 1QHYA 1S1MA 2XX3A 2WPDD 4CT5A 2QY9A 2OE2A 2AL7A 2JLWA 5TXGA 1YZQA 1CRPA 2XNDD 1H8EA 2YWGA 2IL1A 5G40A 3KZ1E 5JFGA 4KITB 2VPPA 1KO7A 821PA 3ZD6A 1OH5A 4C0AC 2XSZD 4DCVA 2OCAA 4BFZA 1KJZA 3A4MA 4Q02A 1TQ6A 3GD7A 2OBMA 4ZDKA 4UXJA 2F7SA 4U00A 2C96A 3H1TA 1YZUA 5EXXA 1S2MA 3RLFA 4FMCB 5M04A 2IF2A 5HCNA 4DXAA 4TZ6A 3X2SA 3U7HB 4D0GA 2FSHA 4KLNA 4FXPA 2XXAA 2O8DB 4GRAA 4LHVA 3CZPA 3UXMA 2JJ1D 2GRJA 1WRBA 1IM2A 3W6OA 1OXUA 1G7SA 3CUEF 3PEUA 3V4FA 1SXJE 3IIJA 4JIMA 1ZM2A 3KFXA 1KI7A 2PEYA 1YHNA 2CJWB 4AKHA 2WJIA 1DAGA 3OF5A 3VKGA 1G3UA 2WKRA 3EZ2A 3A36A 4JLKA 2FDCA 2RGNC 1N5LA 2H7VA 4PAQA 3ZIAD 1GAJA 1N6KA 4Q18A 4WAUA 4NYIR 4BGDA 3PQCA 2LKDA 2ZJAA 4QKQA 2NMVA 2Q3MA 4NCHA 2EWVA 4IOLA 2VBCA 1W2HA 1COWD 3S1AB 2YOGA 2V6JA 5JMTA 2X19A 4WZ6A 3DEFA 3SNHA 4UNPA 3SR0A 4UXHA 1GKYA 1IQPA 4HSEA 3PEWA 3QVVA 1P9RA 2MSCB 3B13B 1XJ0A 1G6OA 5TV2A 5IDVA 3P20A 3CBQA 3R8CA 4A9AA 4DJTA 3KQHA 4D82A 4KFSA 2NTYC 3SI7A 1A5TA 5KYKA 3UIEA 2P5TB 3CH4B 1YZGA 4D6PA 2CE2X 3AVOA 4NE2A 121PA 3AF2A 4QBHA 4QGHA 2XNDA 2JJ2A 2ZYWX 2IHYA 5D3QA 3QG5A 3BB1A 2HYDA 2BOVA 2Z5FA 3F3YA 1OB5A 5CDFA 4BRUA 4BUJA 2HJGA 2QMEA 1P5ZB 2E87A 2P6UA 4V0NA 4EFLA
chains in the Genus database with same CATH superfamily
4RPKA 4YAWA 4YTEA 1IM5A 1H5QA 2V4ZA 5HJ5A 1F1BA 2A33A 2AHRA 5IBRA 1QB7A 1G20E 4CHGA 2GEFA 2QRVB 3OQMA 1NXTA 1E59A 2ILVA 4I4TF 3N70A 4MPRA 3R7NA 4CMEC 2G1JA 2ZUDA 2BUBA 2C9ZA 3DE6X 4XGNA 3A32A 4DCOA 1T5HX 2P2GA 3W9YA 1SC4A 5DT9A 3AFNA 1DAMA 1SIUA 3RIMA 4J75A 2A5YB 2PT6A 1B6TA 1X39A 3O2JA 4GEKA 1HLGA 2B8NA 2QVGA 2YXLA 2XE8A 3EOZA 4K9DA 1QRAA 1C9EA 2Q6TA 4MR8B 4RVFA 4BQQA 2V0GA 2WINI 5JCJD 1KNQA 5DH9A 1ORIA 3N6RA 3OLYA 2VEDA 3RBZA 3MINA 3ZYCA 1P0PA 1HNWB 1VZ2A 3NKLA 3N5CA 2H51A 2W00A 4IICA 1RAHA 4BN4A 2QE7A 2G71A 1W6RA 2CEKA 2Z8XA 1E2JA 2C5GA 3G9QA 3R7DA 4D6XA 4L0MA 2FMKA 3GCGA 3Q12A 1B76A 2FRDA 5K7SA 3OSZA 1P2FA 1XTRA 5HUQA 5JASA 2WUDA 3O95A 2LKCA 4LHYA 5IZCA 3RAFC 1FS6A 2FK7A 3PT9A 3UK2A 1Z17A 5I9LA 1PZNA 1MQ8B 2OZPA 2ZBGA 3AHJA 4B79A 3REFA 3R24A 3DPUA 5AI8A 4X62B 2XWPA 2CSXA 1NNSA 4UTXA 3FPGA 3FUUA 3KDAA 4EMBA 1VGQA 2O8NA 1YZKA 2A2ZA 2AF3C 2P3SA 3S40A 4CTOA 2I22A 4F0JA 4NMMA 4L6IA 1LUAA 5J2TA 3RYHA 4D8YA 1M73E 2GFIA 1I4TD 1U9YA 3LAWA 3V3KA 2IS6A 1EZ1A 1OZGA 1EXMA 3DLCA 3EG9B 3BILA 3NFYA 4JWKA 4M37A 4TTPA 5FL7D 5H9VA 1KDVA 1U7TA 5LKRA 3R20A 1T3GA 5KYUA 1ODFA 3VC7A 3I83A 1IZYA 2PQMA 3FFWA 4UAGA 4ZAXA 5ALUA 2AJDA 3H1PA 5SZHB 1PE0A 2YBEA 5HKBA 3T3MB 5EHQA 2PMCA 2FH5B 4AJIA 4Q3LA 2W2NA 4UPVA 5CVEA 3D8RA 4D6YA 4E4RA 5CLJA 3AJRA 4QA9A 1VMKA 3UV3A 2VDPB 4CTNA 3HCEA 4YRTA 2FRVA 4XYEA 4Z54A 1HORA 4D4LA 1ZCZA 2XKKA 2RGCA 3D4OA 3KEOA 3OHPA 1T4BA 3DOFA 1VKRA 1HSOA 3AR5A 3OEED 4IEFB 3WBJA 4AUKA 5EP2A 5D51S 2ODWA 5DE3A 2Q3JA 1EDOA 1JG1A 1G9SA 1J4AA 4IDDA 3GLSA 2NPOA 4M99A 4BVBA 4R9RA 1XHEA 1C9MA 4HSGA 4WE3A 4UARA 1L8XA 1Y1KE 1O77A 1D3AA 3EZNA 4KUGA 4NDNE 4MTLA 3THXA 2C82A 1TZKA 2GF0A 5FADA 4L85A 1FQOA 2ZB3A 2ZG6A 1L5YA 4FEGA 3MPUA 1NZDA 2FWNA 2JC3A 3L0ZA 1XL1A 2OL4A 3M6AA 2VATA 4KQWA 3TZ6A 3WL6A 3SHFA 1K6MA 5E4YA 1K6IA 3OC0A 1FYFA 4QDOA 1ZCBA 3M5PA 4PC6A 3LQFA 1E5LA 4J90A 3UK1A 1VJ5A 4JOQA 2VJAA 5C5EA 3MFYA 1NQVA 3VTFA 1ZCJA 1LPNA 4CTKA 2FDXA 3ZU4A 1CQPA 1P9NA 1T43A 1TPZA 1OKKD 1U7ZA 1Z5WA 3LBNA 3A1SA 1DBRA 2BM0A 3R7LA 3RPEA 2VUSA 3ONFA 3V46A 4LF4B 4X5OA 5KIAA 3RUPA 4YRNA 3F5QA 1E79A 2XMRA 3MUNA 4GM0A 1W44A 1QIIA 5AK6A 3N3AC 2IKQA 2Q6IA 3OAAD 1OBCA 2IV2X 4NX2A 3OJXA 5IEBA 5IF9A 2DE0X 4L5IA 1M0WA 2ZIZA 5K0LA 2YVAA 4GD3Q 3IDZA 4H0CA 1CETA 4PX2A 4ARVA 1NNUA 1K97A 3BH0A 3BH7A 5C1OA 3ADCA 4RD1A 1EVJA 4D8UA 4X8MA 1NR5A 4PBRA 5ALQA 3R0ZA 4BQOA 4P36A 2FF7A 4MPJA 3WXMA 2RJ3A 4AECA 2Y9PB 5IWCA 1EP1B 2PK3A 3D0RA 2J3LA 4IS3A 2R5NA 3P7MA 1O95C 4US0R 3NBQA 1NBIA 3BX1A 1KI9A 4GI1A 5KNLA 1T3TA 1T26A 5ENVA 3LW8A 5JSQA 5JD5A 1NVMB 2CLOB 4HLNA 4JKOA 4F12A 2C8KA 1SK8A 4YPFA 3ZTWA 2Y77A 1N2XA 1KEWA 2VSQA 4II7A 1Z8HA 3VR4H 1TIPA 3JWHA 1VMAA 2X0IA 3FYDA 4V0OA 3DE3X 3TO5A 1FUIA 3TS1A 4ENWA 5MGNA 1DGQA 4WOJA 1H5NA 3TQCA 3KALA 5JWRA 1QKJA 1XZKA 1RI2A 4R41A 1XLTC 3FCOA 4BO2A 4YJFB 2QT1A 1T9HA 4MKIA 2AJCA 1H5UA 1BDJA 1EX1A 1HF3A 3F49S 1L4BA 2ORYA 1N5MA 3MT8A 4AG6A 4R2LA 2J45A 2ORWA 4QBGB 1UMDB 2VBFA 3OIFA 5LLSA 3VR3A 2X2FA 4BGEA 3TLZA 3NAZA 1Y48E 5KX5A 1EFAA 2MSEB 2ZRDA 5FTMA 3DOJA 1T8RA 3OA2A 3UJ8A 1UMBB 3PQ3A 3K6RA 4HDKB 5HZKA 5GZ1A 2I7VA 4HQFA 4L0CA 1DFHA 1T0JB 2DUMA 3GJ8A 4JD5A 2C8JA 1HQKA 3E3NA 3NHBA 3CFYA 1MAWA 2PZLA 4MRNA 1QWSA 1UMBA 3QTBA 2LCFA 4F84A 1J21A 1T9GS 1EESA 2MYPA 2WJVA 4LJLA 2HJRA 3EEIA 1XFDA 3H7AA 4OAOA 4D56A 5LYYA 1DWUA 2N0SA 3RF7A 2YMMA 3U3JA 4EENA 3UAWA 4EX7A 1GA6A 1TM2A 3UUEA 4P4NA 2FW7A 2N46A 3FB1A 1V8FA 4AN0A 5KYWA 1FLVA 1U81A 1I0ZA 3GP5A 4A3SA 3E23A 2PKRA 1PT8A 2ZJ8A 4F71A 5GINE 4GX1A 3N74A 3W6PA 3ZIDA 1JQKA 1Q1GA 1SG6A 1AM4D 4TM8A 3N7UA 3RJ5A 4E21A 4TTJA 1Q7TA 2OHIA 1NI4A 3FYCA 5TE9A 1T35A 5EI5A 3S2YA 2H3EA 3TPFA 2DUNA 1A97A 1POXA 1O54A 2C57A 4X54A 2WQ7A 5T67A 4O25A 4ZO9A 4DJ5X 4EJSA 3AF6A 1LTHR 1P77A 4OGLA 4S1OA 3TH5A 4PEVA 3CURA 1WXQA 4F85A 1ZM3A 1EBFA 4LCJA 2R8PA 4QAQA 2XGMA 4UCFA 1MNQA 3VO1A 1YJCA 3GYBA 3TYXA 2VZLA 3MCWA 4AMYA 3S3TA 3CPSA 3AI1A 3HR8A 1ZINA 1MU0A 1HE5A 2DM6A 4FWIB 5C4GB 2YCBA 3DAYA 1UXOA 4Q12A 4BN0A 1EM6A 5B1EA 5JBNA 2PL1A 4OBEA 3H13A 2Z9BA 3DVLA 3QG1A 1G3IA 1R16A 1WPGA 2O2YA 2OV3A 1OGJA 4IH4A 4NJEA 3L8HA 3RKUA 3GLGB 1A7KA 3BJMA 5A5DA 1KWGA 4FQ5A 2PKQP 1WMFA 4AURA 1N33B 1ETUA 2BKEA 4WQMA 3BGWA 4EARA 2AG6A 4RF5A 2EJWA 4OJQA 4A0HA 4CJXA 2ODAA 2FFHA 1P0QA 3NS7A 4K7JA 5EIEA 1ZRMA 2PDAA 4RHUA 1SFRA 3L3BA 3B9BA 2DGDA 4TQAA 3P0IA 3W4JA 3ADBA 1GLNA 2CHVA 4XIGS 3JU3A 2WSYB 3T4EA 4P0PB 1QCYA 3KKKA 2QW8A 1H1LB 5AYVA 1OWNA 2RH9B 4YAIA 2PS3A 1X38A 3TVTA 5KJFA 4I2VA 4GR5A 3KP1A 3OBBA 4G4GA 3WP0A 3GB9A 1FFSA 3PQ2A 1QRRA 4WWHA 2MR6A 2DFKB 1IK6A 1T5IA 3OEWA 4TM7A 2M1ZA 1I5RA 3I5UA 4TMXA 5ARDA 3U7QB 1IE3A 4MA0A 4OAPA 4B3MB 3WLOA 2RGAA 2OV2A 1EWKA 1Z4LA 1W34A 4MQ4A 3PZBA 4X41A 2H2IA 3B6JA 4A15A 1HDXA 1HI9A 3FNFA 4E12A 1DT3A 4H4CA 1XO1A 1LVHA 3Q0TA 4N6NA 3ASYA 4R51A 3OC6A 4TGLA 2I9PA 5AW5A 3QEMB 4A8JC 4D97A 2IDJA 5EGNA 1HNXB 2W70A 1W4BA 3HCNA 1SXJD 4RZ2A 1AXEA 1DC8A 1N2JA 1W0JA 4JLAA 5F21A 1T36A 4URVR 5KTYA 3NI2A 4NJMA 2C2XA 4ZI7A 4E5DA 4OUKX 4EG1A 2OZLB 5L4LA 1RYYA 2G9UA 1TT5A 3MHPA 4F3KA 1MJGA 2JCBA 1Y1RA 3ESCA 2X77A 2P6NA 1HZZA 2XD4A 4R54A 5FBQB 4ZZIA 3I62A 1YOVA 2QL7A 4S0ZA 5KQGA 4J4HA 3A58B 2EZTA 4RV4A 1L5VA 1V3TA 3OZSA 4FSDA 3WWOA 3IE2A 3H04A 4WCDA 2A4KA 2R1VB 1Z63A 3Q7PA 1K8QA 2HRRA 3WWZA 3TRKA 3BXGA 3GRPA 5BN5A 4OKIA 3TSZA 4Q39A 3H5OA 1QB8A 4KXXA 1D07A 4RZSA 3E6AA 4G4SO 2AYXA 4TT8A 1W52X 3DLHA 1UPAA 1Q20A 3AUSA 1RBYA 2VNAA 4M4SA 3QEKA 3LSTA 4M1SA 3IJRA 4EW2A 3L8DA 4GXTA 5KOJB 5LQSA 5A3JA 4DEXA 3GGGA 2AWOA 3RU9A 3GRRA 4FHGA 3MWFA 2EQ5A 3IVGA 4BKOA 1P2TA 1U0GA 1ZESA 4ZGGA 1J2RA 4BGIA 1Y6ZA 2RE8A 2VDNB 2ORVA 1RPNA 1U04A 4LNHA 4BWGA 1QK5A 1HWYA 1NLMA 2FXVA 3SSAA 4KNVA 3G2MA 4LXTA 3ZCXA 1HG0A 1TAHA 1WXDA 2EFDB 2Z30A 3LY9A 2CLLB 2GEKA 1QUFA 3K9QO 1GRRA 4MPPA 5LA6B 4B0OA 1LPAB 5KWVA 5KYGA 2EJBA 4GUDA 3FZNA 3X1XA 3ZGVA 2WT4A 1I8TA 1VA5A 3QXGA 3MMZA 4G8DA 2JAOA 4HH0A 4R40A 2A0UA 3DZGA 4P98A 4ZZ2A 1SBYA 3UY4A 3TB4A 5LDDC 3NZEA 2QKYA 3DM5A 4C4AA 5IKPA 1VI2A 1RHKA 2EP7A 2QPAA 4Y1RA 4MVYA 4JP1A 3DQQA 5AUNB 3RBVA 1LBSA 3H6KA 3COVA 3P4YA 4NU5A 3LM8A 1WQ4A 3OIWA 4IOKA 5DXFA 3ELYA 3V4RA 5KQLA 3LHKA 4WVFA 2LRHA 3H3JA 3I2IA 4K26A 3I30X 3RS9A 1XZJA 3H05A 3D4BA 2R47A 4FN4A 4HKTA 1NVUQ 2DR0A 3NDJA 2JGDB 2WAAA 3FUVA 4C4OA 3T1YB 2ZJ7A 3L0CA 1ESNA 2P27A 4NOKA 4KAJA 3TG8A 5IC5A 3K31A 5LQDA 1QCDA 3FPJA 3BIFA 5DHAA 2CNNA 1A5AB 3HPRA 5BOSA 3KO8A 3ZD6A 5THKA 1MW9X 2P3LA 2JI9A 4MWTA 4TQ9A 3A11A 4LHEA 4OL0A 2FZWA 3D6FA 1B6RA 3RUHA 3U1TA 1S4QA 3BMQA 3R9WA 1QVRA 3B53X 4U7TB 3UAOA 2A9QA 3AEUB 4F56A 1THZA 1A8IA 3ROPA 1SZDA 4M36A 2PLWA 4F9GA 4J7CA 5BWNA 5BXQC 3ZVLA 5KAPA 2WB4A 5J3JA 2Z6QA 1NBHA 4BVEA 2ZXFA 4OI4A 1P3JA 4Y6SA 4DY6A 1EGMB 3D6HA 2IT1A 3INNA 1UBLS 1RJWA 4WZBA 3X43A 1W9MA 2ON6A 3GJ4A 4MVJH 5HDQA 2X8BA 1X7XA 3RVOA 3DOUA 2PD4A 4WXHA 2FR8C 1HM5A 4BMYA 2BJHA 4R9SA 4M7OA 2COEA 1GL7A 2H07A 2J07A 3TNFA 4XVHA 4OM7A 4RULA 3ZJ4A 5KYUB 3OKCA 2Q4DA 5FI3A 1FS4A 1U0LA 2BONA 2XB9A 3AFGA 4YT4A 4PPFA 5L3QB 2CC2A 5BP7A 5E4FA 1UP7A 2VC2B 4WECA 3GGJA 1Z2PX 4OM8A 4ZPXA 4ZYYA 1IYZA 1TECE 4GSLA 1DAOA 4D9EA 2UXDB 1U2PA 1LNSA 4HH4A 1A04A 1L4KA 4AO6A 2ZW9A 5KPJA 1U65A 3R5SA 2D59A 4X20B 3I6IA 4C0QC 4CM3A 4DG5A 3TR5A 3T5AA 1JJAA 1Z29A 3ESDA 1ZH2A 3HI6A 3OPYA 4JLBA 1EM8A 3KHSA 2ZBFA 4I0WB 2A94A 2OGUA 2QA5A 3K96A 3L6DA 1KA9H 3BTVA 3QY9A 4ZHSA 3CF6R 4TKUA 3OURA 4BEJA 3KV1A 4R84A 3PFHA 1HETA 5E4JA 1T4GA 1Z13A 2QT9A 4NZ9A 5EIXA 1E1RA 1WVGA 3N2LA 4QL3A 1RXWA 3D54D 4WCFC 1NVBA 2BR5A 3BQNB 4UU0A 1WUYA 2PGOA 1K8ZB 4CUZA 1E9SA 5DU2A 1VZ3A 4I1VA 4AYTA 3WFIA 1ZIOA 2ZYIA 5SZIA 1E9EA 1T36B 1T1IA 2FQQA 3MLAA 1JU4A 3R3XA 4FS8A 1PEDA 2Z5VA 3FFBA 3H1BA 4ITVA 5E0OA 5ERYA 4D3DA 4QQ8A 3A26A 2HK7A 4L4SA 1M9NA 2Y8EA 3UXHA 4D0NA 5MN4A 2BHSA 2JD0A 1KEEA 4Z2AA 3P97A 1CQXA 5FOQA 2WWXA 1QS0B 3EIHA 3AEYA 1BD4A 3SHTA 1Q16A 8LDHA 2PGAA 3AV3A 1BEZA 1XVVA 3EVFA 3W8EA 4DM4A 1DJPA 3ZE9A 3M6IA 2Y0PA 4BLRA 4WDRA 3DR5A 4UJ3A 5FORA 4FT4A 3DAHA 2IPNA 3LWNA 2A0XA 4Z4HA 2GN4A 2OFOA 1JMYA 2V97A 5LP6B 2Q2NA 4HV4A 4RTMA 3Q3HA 3M6XA 3DDHA 4MVWA 1QOZA 3FVTA 1QIHA 1XA0A 3I6QA 3JQGA 3O9ZA 2WM2A 4ILKA 4M8KA 4QTUB 2CBGA 2EP5A 2WV9A 1KS2A 1SBHA 4V0ME 1LS6A 3LX8A 2QENA 3DNFA 3LV8A 5SZKB 1SULA 1OX4A 1RXSA 3E7DA 4D99A 4G0XA 1GEEA 1NJSA 4JOCA 3QV1A 1SUAA 3MM4A 4JBWA 4DDTA 1WUHS 3VYUB 5GZ3A 5J2UF 2QI9F 4LVCA 3KDPA 2QYOA 3Q3VA 4DABA 3K35A 4HMOA 1DTSA 3KTFA 4LTDA 3H5VA 3RAJA 1JHDA 2WI8A 1TI7A 3AY3A 3NHPA 4R2HA 2NVWA 4H9GA 4Y9UA 2PIDA 2IY9A 3PYLA 2REOA 4R1QA 4D3XA 1M6VB 2E82A 5K09A 1CUHA 4D7AA 4UHFA 4WNCA 3W7AA 4S0XA 5EZYF 3F6YA 2R5FA 3OQ6A 4H77A 2Y1KA 2Y68A 4AIRA 4E5YA 3EF1A 1JDVA 1DARA 3K0CC 3OT1B 3EJ6A 3RSZA 4Z1MD 1PCXA 3UG6A 5IJXA 3Q7RA 1CUSA 3H0EA 4IGIA 1Z0AA 4PFJA 4MV0A 1ZC4A 3WL5A 2ZBUA 4OBXA 4MV5A 5EERA 3TINA 4BV9A 3SQMA 2H5JA 3AERA 2FEXA 2VHUA 3MA0A 4YAJA 5BUQA 2GCOA 1YXMA 2H4WA 4JUFA 1GG2A 2V7GA 3C6BA 4MOWA 5EINA 3K4HA 5GONA 5IAGA 4CG3A 4KYTA 3ZDDA 3BUSA 1KVUA 2PKQO 1DJQA 1NXQA 4Q48A 3WA6A 4COOA 5B6JA 2ZJBA 4A1OA 4Z0PA 5CIYA 5EIWA 2Q5QA 1ILWA 2BYTA 5FL3A 3I4FA 3A9SA 4YWHA 4UNQA 4P5DA 4CM6A 3LUCA 1ND6A 1W7AA 3IAS1 3WRYA 4O4LB 1XZGA 3U31A 3IEVA 1UZNA 3LXMA 2XQJA 2WC1A 4OHVA 3V97A 2VYFA 4L9WA 1U2QA 2H8GA 4P93A 3IIIA 1DTWB 1F2VA 1Z4OA 4MUAA 3IVMA 4GWGA 4M9SA 5J4LA 1I01A 3ZWDA 2G4LA 4EWLA 1HFWA 4X6XA 1II8A 2G80A 1W93A 3OCZA 3P45A 4TLLB 1R88A 4N5MA 4JBHA 1BX3A 4OYRA 3LKVA 4WK0B 4UHHA 5B57C 1WXIA 1F7VA 1FJXA 2QVXX 1GA4A 4RHXA 2P79A 2KYRA 1U0JA 4WBNB 1H0HA 3I6MA 2WR8A 3NYWA 4X97A 2JCVA 3SC2A 4YROA 3ZZMA 5KOHA 1NUHA 5K20A 4LEIA 4RM3A 1Q1EA 3HBJA 2CN1A 3CEHA 3WBFA 3F6RA 1P5RA 1GZSA 4Y18A 4G8CA 2ZSHA 2BZGA 3CNHA 4KPUA 4MYDA 4RD4A 4RZQA 2CKDA 4HVLA 3PLAE 4R2JA 3VH1A 1HY3A 3OTWA 5KNCA 3T34A 3AR6A 4HNAA 1RLIA 4KQGA 5ER9A 3IUBA 4CM8B 1G17A 1I0IA 3A1FA 3BRCA 1TK2A 1X7YB 4MUIA 1VQ1A 5GM2A 3QKSB 2CJXA 4UCXA 2WWIA 4GBJA 3DCIA 2PL9A 3TNLA 2MSWA 1CTQA 1F12A 4UEWA 3EZLA 4YMTA 1I7LA 1OY1A 2AN3A 2J5BA 3VQTA 3IR5A 5HQTA 1IEWA 3OTIA 4YMWA 3E2PA 2ZCUA 4TYQA 3VM6A 4Q93A 2DB3A 4ZA2A 3OSUA 2ZUVA 3FUWA 2BZ1A 4ECAA 3SEZA 3ELDA 4RW0A 2PEZA 5B7NA 5J4YA 1GQYA 1XX6A 2Z9CA 3IQEA 1NDUA 2ATXA 1IXZA 1D0SA 1MZVA 2AXPA 2F9MA 3DBIA 5B58T 3IHKA 5A7HA 3HKCA 4TWRA 3TVYA 3G59A 5BQXA 1F8XA 5BSWA 4CQMD 2WSSA 2CCJA 4OX9Y 1Q7CA 3PJGA 1G19A 1ODJA 4N7JA 3V1LA 4JJ6A 1ZM9A 2XZTA 4PHTA 4KDCA 2HA4A 3ZU6A 1HX7A 3OPQA 3SJ7A 1LI4A 1OT3A 3ZV4A 4BTVA 2P75A 4CV2A 1DG1G 3CT4A 3HCWA 4D42A 4ENRA 4EECA 2G7MC 1KAOA 2WU8A 5TPWA 3PHHA 2PRIA 4QWWA 5CLIA 5CCBA 3EA4A 1ZHFA 3D4NA 2CFIA 1S9DA 2G1AA 2JGFA 4RMIA 2DVMA 4N0QA 1F3LA 2EC5A 3E9ZA 4RYDA 3RC2A 5LVAA 1FW8A 3B6KA 2REQA 4OFBA 4MW7A 3COYA 4Z9AA 2D0DA 1ONNA 2NO7A 4MH0R 1G66A 2VDWB 4YFVA 4ZEWA 1GO2A 4V2UA 3VR3D 3ZI7A 1OTHA 4YX9A 3WSWA 4RXMA 4XDHA 4ZOEA 4CU2A 2NSJA 4UEKA 1DJMA 2DBRA 4BMCA 1EAMA 1T8PA 1AXGA 3P0FA 3R4VA 5D85A 5GGYA 2ERCA 3H3FA 3IUNA 1V6AA 4TRNA 1EXWA 1NU6A 4OHOA 2H6EA 2FKAA 1WMDA 4MVXA 3TIVA 5CEFA 3TCXB 4EZBA 5LFAA 1CUUA 1IJKA 2PTGA 1BOFA 1F2UB 4O0LA 3NH6A 3SEAA 4HI0E 2PS0A 1ECJA 1FUKA 2VQDA 4G63A 2ZKLA 3WNDA 3WVNA 1SOAA 4D9KA 4ZDJA 4WACA 5IZ4A 1YULA 2XVYA 2QTFA 3WKCA 4C0LA 5DNCA 1M67A 4HPJB 1MTZA 3CLUC 1ZVQA 5ERXA 1FLDA 5FOSA 1OD6A 3UANA 4MWBA 2M6RA 2P4EA 3H5NA 3UW3A 1NNEA 3HUDA 2R7NA 1JEEA 4KPGA 3K8YA 1TJNA 3KQQA 3ZV7A 2AUNA 1CIPA 4YRMA 4TMYA 4EABA 1YZFA 2GKSA 5EIHA 3ZGOA 4B17A 4R0VA 2E7ZA 1DKQA 3RS4A 2Y93A 3IV9A 1PJZA 1WDWB 2AUMA 1JPNA 1QAOA 3KT3A 4L0DA 4ZU1X 5ENDA 5LSAA 3HO1A 3D8BA 1ZX1A 1PFYA 1TAGA 5KU7A 4K6KA 3BZBA 4ATNA 1MOPA 1NQUA 1P6UA 4PBTA 4WD3A 5D3KA 5KVQA 1I6LA 3KJEA 2PUTA 5ITSA 3IV7A 5BRNA 4CL0A 1CV2A 2HBRA 2JNWA 4ZCRA 1TVMA 1X1SA 2J41A 1MF7A 2NX2A 2V6IA 1GYQA 4LZNA 4EUFA 5I8WA 1H2ZA 1A4IA 1P91A 3C7AA 5CVUA 1RU3A 1W4AA 2QN9A 2AI3A 3IEMA 3D3WB 1W0KA 3TLXA 1RZRA 4QTZA 1DUVG 1X9HA 1BKDR 3HV0A 3ZK8A 5LD2B 2YV5A 5CXSA 2IOHA 3OT4A 3H2IA 4B33A 3AQIA 3JX9A 5C53B 4DS3A 4RQBA 3SYMA 1M34A 1E0SA 1E9CA 1SBCA 4G0PA 3TZKA 3ZHSA 1O94D 3EDRA 1YTLA 4PSVA 2X3UA 1I4EB 4INAA 2BBTA 1GFIA 2OR3A 3D3QA 3HG7A 3OF2A 3OIDA 4IEEA 4WCFB 1HFKA 2BCEA 3FFTA 3KQTA 5K0GA 1E9FA 1VRVA 4LOHA 3LY7A 4HR7A 2GAJA 4HAZA 4OQFA 3W6ZA 4ZV9A 5K8UA 3TTTA 1SVKA 3AR8A 5B36A 1FVOA 3EZ7A 5C8YF 5JHHB 4JLSA 4WKBA 1Q57A 5WRFA 3TMKA 2WE8A 1XJWA 2WD7B 3HR4A 3PJEA 4U2CA 4QG3A 2IHUA 3CF4A 5DHTA 4EFNA 2FMFA 1P2UA 4H3HB 3RTBA 1T2VA 4NQRA 4ZAVA 1AN9A 1NDQA 4LMBA 1ONSA 3T5MA 1X8JA 2C4KA 2XXJA 2Q46A 3R6TA 1AUPA 1X8XA 3V2UA 4EX6A 3QWIA 4LDRA 5JZOA 1YL6A 2GN0A 3FPBA 4ALIA 1WZCA 2IK8A 1ZM4A 3R6DA 4CF3A 1LV8A 1TNDA 3BSYA 4Q1CA 1FRNA 1G5TA 4I1SA 5IH3A 1I24A 1Q22A 4L4UA 2ZUUA 2CZGA 4J07A 1SN7A 2ZRBA 1PJAA 2R1UA 3M8KA 1K98A 5KCZA 2PVCA 3DPIA 3SHWA 3ZDFA 1LKZA 5I01A 2JAWA 1KSFX 5FAXA 3KSRA 1UT6A 2DPXA 2GR9A 3C3KA 3NVAA 4REOA 4YHBA 4YV1A 1U0BB 3SJBA 5ABPA 3KPWA 1EJBA 2FE4A 2OK8A 5I9IA 3I23A 3PX2A 3L4JA 1GIAA 1ONOA 2PJZA 4GECA 4D4MA 4DT1B 1DSSG 1VHTA 3INGA 3PGMA 4R83A 4L8YA 4DWOA 4Z51A 1U0NA 2O4CA 1W46A 3H7IA 4LYGA 5IC4A 4X90A 1JW9B 4N3NA 2I3GA 3FDJA 3KR1A 5HQJA 1PQYA 1RLUA 3D0KA 1MA0A 1Q2UA 5C7OO 1ZPDA 2WJ6A 4N3AA 3VVCA 4EKGA 5EN4A 1MABA 5GVSA 1RC0A 1LSSA 2QB5A 2OOSA 4P6VF 4WH0A 4Y2QA 5JYBA 2WV7A 1ULAA 5B6PA 1HE2A 4CW7A 3S27A 2C2OA 1MAHA 2RCNA 1TMOA 4NENB 1J56A 4OJNA 5KWSA 2RHGB 3E3AA 1E61A 3QLVC 4NG4A 2ICAA 3A6LA 4UZFA 1UWKA 4P4SB 1O4WA 4AUNA 9ABPA 4F4IA 3C3YA 5J23A 4PZZA 1X1EA 1KVTA 3LBHA 3R3ZA 4J0FA 3TLEA 1EM8B 3ZQ6A 2JRLA 5FTWA 3ZY5A 4CG1A 1KFEB 4PLPA 1X94A 4D4JA 4EKYA 1RPZA 4M6WA 4BRSA 3LPLA 2X1VA 2QUZA 3RQIA 3VSBA 2HK6A 1X9GA 3GVCA 4G5FA 4C43A 5GTDA 1UC9A 2JFGA 1N4AA 1I4LD 4KLCA 5DM0A 1IY1A 2IGBA 1ECLA 4JLDA 2VI5A 1YD7A 1XQXA 1YB5A 3BF7A 4N9WA 4WESA 1EUQA 1XEXA 5BR7A 4D4HA 2C95A 1MO6A 1N0IA 1YACA 2ZP1A 4C87A 5JBIA 3G02A 3SEFA 1IHUA 2WOJA 4PIPA 1HE1C 3D59A 4NFSA 1KZHA 5BVGB 4RMJA 1H3EA 4IXNA 4AI6A 3IKVA 4JC0A 1PJ4A 4FFOA 1JDBB 4AW9A 3B60A 3L84A 1U9IC 4Q1BA 3CVVA 4MRRA 3TE6A 1H22A 1E69A 1OSNA 4WZBB 1G8FA 1L8QA 3K94A 2QM3A 3C85A 4M89A 5CT8A 3IALA 1K86A 5ESXA 3EDCA 3JRNA 1EGAA 1HSZA 5KI6A 1UDRA 5KQPA 3T15A 5F3RA 3OLCX 4AF6A 3FYSA 4HZUA 3MUOA 1P75A 2XUIA 4LYEA 2PLRA 4M88A 1YRWA 2XOKA 5DLPA 1EFRA 5FBKA 3SZGA 1UZUA 1A82A 5HRCA 2XBUA 3GLTA 1JPUA 3NLLA 4EO4A 3BYZA 3NHJA 3UN1A 1O94C 4OQYA 3GAFA 5AR1A 1LQ2A 3N76A 4H16A 4OLFA 2O2JA 3LKDA 1NVKA 4WZAB 1XPRA 4IZ6A 4NJOA 1SB9A 4PC1A 2OFFA 1BVHA 2WU1A 1E3EA 4K0KB 4FB4A 3RU7A 5PNTA 4FDAA 4JYMA 1MW8X 1Z36A 2HA0A 9LDBA 3EMBA 5AQEA 4ZTZB 2CHFA 3FZQA 2I80A 1BX1A 2PKWA 1N5IA 2XMPA 1ULHA 3KQPA 3ZK7A 4D0SA 4LXUA 4NNOA 5BSHA 4B76A 1BJRE 5AKEA 4KYUA 3VTKA 3EXFA 2Z6VA 1RRFA 3K8ZA 3DT9A 1MABB 2IV7A 1ARZA 1TRHA 3FJOA 4RO0A 2H08A 3RE1A 5K6AA 3Q6NA 1T5LA 1CY1A 1ODTC 1U1GA 1Q83A 2FPSA 2OD9A 3AU9A 1J8FA 1JHXA 1ZK2A 1NLFA 5H0IA 3RC9A 5KTTA 2CMKA 1JJVA 3KSMA 1IPHA 4COKA 2OUKA 1ZIYA 5EP1A 1FZTA 2PE5A 3HJCA 4R1PA 1M8GA 2F59A 4G1MB 2BI7A 3BRWD 2G4VA 4F7DA 5FEMA 2UUAB 1P1RA 1B0PA 1G6HA 3FHLA 4BVGA 3TB6A 1KQPA 2AN5A 4URWR 1HK7A 4RLHA 1ZMBA 1JZSA 3Q9NA 1M34E 4EJSC 1FDOA 2PWYA 3OIYA 4WRRA 2R68A 2Z57A 3J81k 1AJEA 3X0DA 2HCJB 1WHTB 5EJ6A 1JVNA 5ALDA 3K70C 1LF5A 1Z6XA 3AVVA 3WRYC 4D41A 4ZCTA 1AQNA 3TX2A 3SX2A 5KOYA 1O9HA 2RDMA 4N12A 4WSOA 1G8YA 1GADO 2OHVA 3BWYA 1GCAA 4RABA 1M2EA 1QR2A 3ILXA 1QRUA 1WB4A 3DC2A 1P17A 3PC3A 4NMWA 4H0NA 1TPYA 3PWZA 3QVUA 2Y0EA 3EXEA 3N28A 3C4QA 4P5PA 5AK0A 5EL0A 2CVZA 4PF1A 1XEXB 4MR9A 1WE2A 1F38A 3CJRA 1C1XB 2VH1A 5FR2A 4BO3A 2FPGA 5IVDA 3RIXA 1CPYA 1DOAA 3DMTC 2QTMA 4FNAA 1F0NA 3ND6A 5I4CA 4BBJA 1AQYA 4GDMA 4AS3A 4FE4A 4Q1FA 3WOVA 4XWTA 3NKVA 3QWFA 1PX0A 6PFKA 4XYLA 2HF9A 2FPGB 3RR2A 4CPDA 4DHEA 2J3EA 1NWHA 4J2OA 2F9FA 2OEPA 3HM9A 4V0LA 3E70C 1R10A 1VYVA 4HDRB 4ESEA 2X5KO 1K08A 1RCUA 2DQKA 4C4ZA 5JMWA 4KPEC 3PFWO 2FG6C 3Q41A 4P7FA 2HSZA 1E5XA 1SCDA 1XD2A 3B2EA 3GEBA 4NBWA 1B3RA 4Q21A 4B8YA 1YRYE 2BTOA 4MUBA 3RVMA 4I7EA 2WVAA 5EFOA 5GP1A 4ZIRB 3PS9A 3DC7A 4XD7A 4BX2A 4Z1OA 3PFBA 4MVJF 4BU1A 1E6CA 2PUBA 3LUBA 2B34A 3CR7A 3LT2A 4R0MA 4YV2A 1XTZA 2IGTA 4RTLA 4GH5A 1I1QB 1TK9A 4BMVA 1U5BB 5IBCA 1ECPA 3BD7A 3LUKA 4P84A 4BNLA 2P4SA 2F17A 2PQ6A 3OZFA 2VDQB 5GGXA 1I5OA 2VWPA 3WJ7A 4DLZA 4ZI7F 3U7QA 2MOKA 1N6LA 1RLJA 2ZBPA 4I1UA 1XZBA 1SNYA 1JFSA 3HSSA 2Z4SA 2X1MA 2XBLA 5IT9A 2I7XA 3QVJA 3A70A 3ZLBA 4QQRA 3BXOA 3SZLA 1A77A 1RBMA 2ZS7A 3BORA 3E22A 3FN4A 2ZXUA 4H1UA 4TS9A 2WG0A 2VZ8A 1X80B 2J0VA 1SKYE 3P9SA 3ZLTA 5B2FA 2XTZA 1L7QA 1PHPA 2YFHA 3DTVA 4JT2A 3IAM6 1KQ3A 3DJYA 4TLDA 4ER5A 1NJ1A 3L18A 3F3MA 1J7KA 5EJ5A 3KB2A 5DK6A 4HS9A 1PEYA 1T0BA 4PZCA 1QKKA 2AEEA 2GD6A 3N0WA 1KOFA 4L15A 2IPXA 4X24A 3EFEA 3ZWNA 3BG5A 2IS2A 1DXHA 2YR0A 3TLKA 3A6PC 1C3OA 1YWGO 3T94A 3IUMA 4ERNA 5KZMB 1DIOB 2YNMA 4PZPA 1M3SA 2VIIA 2Q5LA 1MB9A 1GL6A 4QGBA 4QXPA 3TD9A 3NRBA 3U7RA 4JGGA 2C5LA 3VR5H 4RD6A 1C1DA 4Z4EA 4O2AB 4OLHA 4M1MA 3G8DA 1L1EA 1LVGA 4RTKA 1A9RA 3LF1A 4W99A 5F77A 2ZR7A 2QR2A 4X00A 2GQ0A 5LUBA 1QH1A 2J6CA 3NIDB 3OZWA 4G97A 4F4FA 4K1LA 3IE1A 3QPBA 4ZARA 2XWBF 1CRQA 4EVIA 1L5FA 2VEOA 3ZWWA 2GI4A 2VJBA 4HN2A 3PUWA 3HDTA 4QPNA 6AT1A 3K9CA 2QQEA 4IQFA 5KINB 4JJKA 2APJA 5IU6A 5EJ9A 1VIAA 2V7VA 3DMDA 1FFXB 3FGOA 4X45A 1LB1B 3U4IA 2NO5A 2VLBA 2WYUA 4LMRA 1QMPA 2SBTA 3DE5X 2XYPA 1PK9A 1DO2A 3R6WA 1ICEA 2X7JA 2IUSA 4RLFA 2Y1EA 1PBNA 3DZJA 3E1GA 2J5KA 4LGVA 4WT7A 1ZH8A 1YI1A 3IOEA 1FL9A 4RJTA 1FYWA 4TV9A 2JGJA 3DBOB 4FCVA 3B3AA 3EAGA 3HKCB 1NXXA 1Z28A 3RU2A 5KJ1A 3E22B 5H16A 3Q3GE 2IBMA 3CJQA 4PPNA 1EZ4A 4ZO4A 2V8OA 3G0GA 3VR6A 1RPAA 1SD1A 2OFWA 4GZMA 3KZMA 4ZV7A 1D6NA 3WBBA 5CXUA 3F7OA 2JAQA 3F90A 3HZRA 4ANFA 1X77A 5LNK6 3EY4A 3IBTA 1T2CA 1TQ2A 5AICA 2B9EA 5M5BA 1SQ6A 3IO3A 3C6ZA 3QVOA 2QD2A 3OF3A 2PJDA 2PX6A 1DQZA 3CIFA 3RVNA 2VRCD 1JEQA 5TEWA 2O19A 4GYJA 3MGBA 4YAGA 2NQ2C 2I91A 1E96A 4JL5A 1HO3A 3UF0A 3UCXA 5HP4A 1OFUA 4H4DA 4MUKA 4E5PA 2A9PA 4EFDA 1DEKA 1PLKA 2FW6A 2OXIA 2Q0HA 4BX0A 4RFLA 4OREX 5T4HA 2RHMA 2I3AA 3NCHA 1ML3A 1A96A 4P4UA 4BP8A 2PL3A 1X0VA 4GOND 5C5DA 1BMTA 3RT1A 1Z34A 1P3DA 2VWGA