2W2TA

Rac2 (g12v) in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
QAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
total genus 58
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2tA00
3C41J 4GOJA 4F4JA 2H92A 4V0LA 2WTUA 3T06B 1JPJA 1UADA 1QHHB 4TQUS 2VHJA 3AF1A 5FUVA 4ZV4A 2OXCA 4DUGD 2PX0A 4URZR 1UJ2A 4A8JB 2ODBA 1IBRA 1L4UA 1NLFA 4RKEA 4RZ2A 4QM6A 3QE0A 4PX9A 1UBFA 1CF4A 2IW3A 5J5CA 1JQJC 5DO9A 4FMCB 1KAOA 4PPFA 3R8CA 1WMSA 3C14C 1Z0KA 1XZPA 4F92B 4TYNA 2AWOA 2MMGA 4NDZA 4P4TA 3SOPA 4QBFA 3NBFA 4Q9IA 1C4OA 1HT1E 1OJLA 1ZU5A 4PSAA 4JBWA 2PX3A 1FP7A 1Y3AA 2OBMA 3RS4A 1SQ5A 1TEXA 4IDHA 4G5OA 3BRWD 4KI0A 1HE1C 4XJXA 3U3MA 2YKGA 4A8JC 2ZVPX 3ZD7A 1JR3A 1VCIA 4A92A 2ZRKA 4Q1BA 4EJSB 1P7CA 3BERA 4BPBA 1SVWA 3LX8A 3IIMA 4BFYA 1TF5A 3U44A 3FGNA 4C0BA 1E4VA 1GILA 1M74A 5GJCA 2WJGA 5FR2A 1VIYA 1LF5A 4URWR 2ZPTX 2VTKA 1MRSA 1GTVA 3U7FB 2A30A 2ZRHA 2NO9A 4QXAA 3DMNA 3IO5A 2WWIA 5EE1A 2AX4A 2H18A 4B6EA 2P67A 4IVPA 2QP4A 3DOEA 4JL6A 5LB4A 1TX4B 3MFYA 1NN5A 2O8CB 2CCJA 4BASA 2C99A 1A82A 4MH0R 4X8HA 5FUWA 2FE4A 1XTSA 2C96A 4JLKA 5BN4A 1R4AA 3DZ8A 3RDPA 3WNCA 4L9SA 4B3XA 2GETA 4G0NA 3M4YA 3ADDA 4TT3A 3I4LA 4D4KA 1GRRA 1ZM7A 2ERXA 2JLYA 1YRAA 4EFLA 2QTHA 4YXWA 1Z2CA 1XD9A 1P4SA 3DVLA 3TSWA 3V4FA 1YZNA 3BOSA 1G8GA 2WMNB 5EE0A 2GEDA 5JECA 5CYPA 1KK0A 3UG6A 4A0RA 1S1CA 4ABYA 3GJ7A 2J46A 2XNDD 3KKMA 4NYIQ 3LQQA 2F1IA 3K70B 1Q12A 4TYWA 2YOHA 2YWHA 1KDRA 2IYRA 2WBLC 4B3GA 3WMGA 1LS6A 5DYGA 1YRBA 3CBQA 1E0AA 3B78A 1ETUA 4PFSA 3QKRB 4IRUB 4UNRA 3UATA 4Q9HA 1ZNWA 1OKKD 1IHUA 3KKOA 4K8OA 5K8TA 1OXTA 1KJWA 5P21A 2AD1A 3LBHA 4DCNA 1II0A 4IJMA 1L8QA 1OFTA 4TQ9A 3TKLA 2GK7A 3IIJA 3OE7D 4UXIA 4TN1A 5ELXA 4TLEA 3P4YA 1KI7A 4JJKA 4FI3C 3CX6A 1F60A 1G6HA 2XAUA 1P2VA 3ZS8A 2V7QA 2B21A 3CWQA 4US0R 5FBQB 1XMJA 4GBMA 2JLWA 1E9AA 2XB2A 4IDPA 3G82C 4MRSA 4M1MA 2JLSA 4AWXA 5A0FA 2JLRA 5JWHA 4JL5A 3GLFA 1XRJA 4PO9A 5JI2E 3QOFA 2AR7A 2DFLA 3W9YA 4LBYA 2FA9A 5LD2B 1P73A 2B92A 4D0NA 3EIHA 1MR3F 3PR1A 1OXSC 2O52A 4EQ6A 1BS1A 2VEDA 3KXIA 3UWOA 4DDVA 2N46A 2ZRLA 1OH8A 4B75A 1ZD1A 1KO8A 3DHWC 2JLXA 1R7RA 3CNNA 2IT1A 1RJ9B 3K0AA 1TQ4A 2W0MA 1R10A 4FWIB 1F2UA 1WCV1 4CF7A 2O8BB 3J81k 4M4SA 1Y63A 3SQXA 4DIEA 5FTMA 3GJ4A 1IY2A 3T5DA 1BKDR 4HSEA 1GL6A 4RZUA 3VNVA 1CR1A 4RFVA 1E2MA 2G88A 4TLCA 1QBKC 1N6HA 1CP2A 1G1MA 2HCBA 2G77B 1CLUA 1KI8A 3VKHA 2IC5A 3PJRA 3UIEA 3PUVA 4OI1A 2PZGA 4AI6A 3U4QA 1OIVA 1XX6A 2FPLA 4DCSA 3CRMA 3A1WA 3HDTA 2WSSD 3QVVA 2WICA 4GNKA 4OJKA 4DLSA 2WJJA 2FFBA 4ON9A 1ZCBA 2AN9A 2W58A 1CJUC 3MJRA 2Q0HA 4FMCF 1V43A 1VYTA 3QBTA 4QHTA 3QKTA 3I72A 1XTQA 3RAPR 4BLTA 2KB0A 3C5CA 4DLZA 1KDPA 3H1TA 3SJBA 4LDJA 5H1YA 2IWHA 4UNNA 4M2LA 1GNPA 4B2IA 2ZS7A 2QENA 5TARA 3E70C 3FHCB 3OEHD 4V0KA 3VHLB 5LPNA 2ZYWX 3O8RA 5SZIA 1W2GA 2VHCA 1E1QA 2XZLA 1MOZA 1ZUHA 1NP6A 4GPTA 4M1SA 2ZI4A 1AZTA 1L2TA 2ANBA 4MGIR 4BEJA 1GM5A 3T35A 3TLXA 1OYWA 1U8ZA 2YYZA 3OESA 1VMAA 3P26A 1GSIA 4AIIA 1AQUA 1HV8A 1UBGA 3UANA 3GEIA 5EXTA 1KK1A 2OHFA 4PC6A 4LJAA 4PHHA 3BK7A 1XCPA 2WAXA 1T8UA 1WDTA 3AVUA 2QN6A 1E2DA 4LBVA 2V6IA 3TW4A 4US1R 5L3SB 1OF1A 2JJ8A 3QKRA 2OCAA 3GMTA 4OQMA 4PTLA 3R7WA 3SJAA 5CYOA 3ZDQA 3SU8A 1UEIA 4CEJA 3A1VA 2GWHA 3REFA 4TLDA 3LO5A 421PA 3CONA 4F93B 3VHXA 2IUUA 3T1QA 4HUQB 2DY1A 3CRVA 4URVR 5BXQC 4DSNA 2GXAA 2A5FA 1QZXA 1DARA 4GP7A 5EXSA 3FHTA 1E9SA 3MLEA 1VECA 1Z07A 4FCTA 4RD0A 3IHLA 1NBMA 2OLKA 2QP3A 5JWOA 1DE0A 4US2R 4D26A 3KB1A 3WY9A 4A1FA 5KTYA 1KI6B 3M1IA 4LYJA 2CCKA 2XTMA 4WA7A 5F9HA 1HT2E 4WVFA 3T5GA 2GVDC 2YZ2A 4HLCA 4ARZB 2CL0X 4XTCS 2BM0A 5AUQA 2VLIA 2PMDA 3QSYA 1NVVQ 1FPMA 2WMOB 2GA8A 5AJWA 5GADl 1CTQA 4DBLC 2DWQA 3EPKA 4HZIA 4MA4A 4BLQA 3O47A 1TQ2A 3KTAA 3ZYCA 2YOGA 3VTKA 3SHWA 3R9WA 3IIKA 1R0WA 5CITA 4QRHA 2FV8A 4FCWA 1JALA 1Z63A 4B71A 2ZRNA 4LHVA 2PCLA 2IA5A 4NCIA 1KI4A 5SZHB 2A9KA 2H17A 2JJ1D 3R8FA 2VSFA 5FTJA 1K6MA 4D2IA 4PAOA 5L3QA 2ZR9A 3BWDD 3OIUA 2GDJA 3PUXA 4M1OA 2GBLC 1OXVA 1HUQA 1N5LA 1VTKA 1M2OB 4KSBA 4FWTA 3NBXX 1ZM2A 1UBEA 1HQCA 3RRNA 5LB2A 3BFXA 3SFVA 3M0EA 1VCMA 1TEVA 4PZLA 4BLSA 1G41A 1N6IA 3Q5EA 2JDIA 2WPDD 2W6JA 5EE9A 3GFPA 1U0LA 4OHXA 5JSZB 1KMQA 1AA9A 1O87A 4G5RA 2GXQA 5B64A 2A5DA 4RSGA 4ZKEA 3B1VA 1J2JA 3HJNA 3DOFA 1T4GA 4KVAA 1P2TA 4JYBA 1MO5A 5FI1B 4B3DA 5CK5A 3QVUA 3B85A 5J40A 1D6JA 1II8B 2R2AA 5CB8A 4CEHB 1G8FA 2QAGC 3GLIE 1P62B 3AUYA 3KJEA 3Q3JB 3KXLA 5BWMA 2ZQ5A 3NC1C 4JLMA 3V00A 3K0SA 2Z4SA 4CGZA 1XTKA 2YV5A 4C9BA 3ZQJA 1W0KA 5KDLA 1P3JA 4DLXA 1E9EA 1JECA 2RGNA 4CDGA 4DT1B 2VP5A 3SYLA 3EPJA 2WKRA 4BFSA 4EQ6B 2J5XA 4ZKDA 3LW8A 3OEEA 1OSNA 4JL8A 4O2RA 2GESA 1OE0A 1A2KC 4B34A 2VP2A 4LI0A 1CKEA 3IPXA 3GJ6A 4OBEA 1SVOA 1JB1A 2D7DA 4X8OA 4OI2A 2ZRBA 1W4BA 2DYKA 2IYYA 1PZNA 1O3YA 2WVJA 4BGDA 3AQ4A 4HUQA 3UMRA 2HYIC 2CL6X 2JA1A 1KSGA 1EFUA 2WIAA 4W5WA 4V0ME 1JXMA 4C2TA 3DO6A 2RB4A 1PVOA 2CLCX 3B6EA 3U61B 2CEAA 2XX3A 2BKUA 2JLZA 1CJTC 1ZIPA 2G83A 3R7WB 1YHNA 2IYQA 5FL7A 3RWOA 1GIAA 3A36A 2QSYA 4BLRA 1X1SA 3AM1A 3I32A 4Q66C 3CH4B 4OHWA 3DZDA 3TGPA 3LXRA 4GT1A 1D2EA 3L8ZA 1NMXA 1Q1ZA 121PA 2O8CA 1OB5A 2FFAA 4V0NA 1U9IA 5AJZA 5JEDA 1EFRA 1DS6A 2H5EA 2OEPA 3FB4A 4Y0AA 1Z28A 4TYPA 4PQRA 3KJGA 1QF9A 5AUOB 1XXHA 5IF9A 1LVGA 3VU9A 4HAWA 1MH1A 1P9WA 1G3QA 3ND9A 3BB1A 3QG1A 1IXRC 3RABA 3H2YA 3HU2A 5D3MA 1W5TA 5UKDA 2JCSA 2GVZC 2PLFA 5FOUA 5H70A 2C95A 3EWSA 1XMVA 2A5JA 2DPXA 4DCVA 4KAXA 2Q9AA 1LTQA 1PLKA 2QAGA 4XWOA 3QF4A 1NVVR 4MKHA 5JRJA 1EFTA 5J4KA 5J4LA 1K8RA 3KQKA 4CYMA 2JEOA 2QM7A 3B1XA 1CJVC 2BMDA 4HDQB 4TL8A 3U4QB 1QG2A 2W2TA 2KI5A 1GVNB 1I2MA 2O8EA 4V02A 1YVDA 4GRAA 3TK1A 4PHGA 4Z54A 2D62A 4PQYA 2ATXA 5K8IA 4OI0A 2WSSA 5GJBA 2ZYUX 2OAP1 3BGWA 3LWNA 4M9QA 3AKYA 4E07A 2BBTA 2QY9A 4Q00A 4P32A 2W6JD 2WM9B 3IEVA 5AK0A 4R98A 4D81A 2QRZA 4L9WA 2BHRA 3KDSE 1P60A 3EIQA 4HAUA 4MITA 3FKSD 3IUYA 4Q1FA 2WWHA 5DIFA 4GZLA 1P72A 2C03A 1XTJA 1ZBDA 3BBPA 2EFEB 1DO0A 1B0UA 1C1YA 3TNFA 1Z6AA 4DEXA 2PJRA 2VPPA 2XITA 1RE0A 4DLWA 3KXKA 4OHVA 3KUCA 4IEEA 1FNMA 4KV9A 4B3CA 2ZS9A 4V03A 3MJHA 4PAMA 2WWXA 3AVOA 4TSFD 2IHYA 4HEJA 2ORWA 3FMPB 5E7JA 5BQ5A 3DKVA 5E7MA 2I1VB 2C9CA 3ADBA 1M7HA 3NH9A 3KB2A 1AS2A 4LPSA 1N5JA 1WXQA 3AF0A 5JJKA 4CRWB 2FZLA 3K9LA 4LC1A 4M1KA 4A4DA 4A9AA 1ZNZA 1NIPA 1RRPA 3CF0A 4B35A 1AQYA 1GNQA 3FMIA 3CR7A 3LY5A 4WXRA 2LCFA 1HQYE 1NKSA 1QHIA 2VH5R 4QFMA 5FH9A 1OH6A 4I99A 2RGNC 4S35A 4YLGA 1JEDA 2ANCA 2ECKA 4S2EA 4EPXA 2Z5FA 2ZRGA 3PEYA 1RRGA 1T0JB 5DYIA 1QHHA 4LYFA 1KHTA 5KU1A 3AVQA 3MUFA 2XSZD 3AV0B 4M53A 4I1UA 1ELOA 1RYFA 4E09A 4BFWA 3THOA 1NSTA 2OESA 3PUYA 5FOWA 1NN1A 4IFBA 3TIFA 3PQCA 2RGEA 3ZQ6A 2QI9C 1E3MA 5FBLB 1RVDA 1ZJ6A 3CX7A 3KKPA 5K8LA 3F3YA 3B5JA 1DAGA 1Z2AA 1R8SA 2OZEA 1G3MA 4PR0A 5G3ZA 1BYIA 4AYWA 1OIXA 4NCNA 5JEEA 3T1TA 1P75A 1XTRA 3B8HA 3K70D 1M7GA 1ZYUA 3PIRA 1BOFA 4UNSA 3KJHA 4BZPA 4DT1A 5M04A 4IOKA 4D4LA 1P2UA 3ZZUA 1TF7A 3CNOA 4JKYA 3R9IA 2WJHA 1W4AA 2PZFA 2ZAMA 3N2EA 3WBJA 4C3ZA 2X2FA 3BH6A 1J90A 3AF4A 1N6OA 3OF5A 4Q7JB 3X1WA 3THWA 2RGXA 1HY3A 5EJEA 2JJ2A 2N1BA 5C18A 3QF7A 2OILA 4YMVA 3ECCA 3VNUA 2QT1A 3QBVA 1XWIA 3MD0A 4ESVA 5FPYA 4UQOA 1NG9A 1IONA 4MYCA 3KQUA 3PEWA 4UKDA 1F3OA 3ADCA 2IF0A 3BB3A 4XSHA 4LCBA 2WZQA 2GZDA 1G17A 1Z6XA 3GLGE 3VR4A 5F3WB 5JSZA 4YQFA 1ZMXA 1E2PA 2BEKA 1NSFA 3DL0A 3EPHA 1MKYA 4Y0VA 4Z1MA 2WOJA 3BE4A 1B23P 4LZZA 1SXJE 1XF9A 3QXCA 4A82A 1N2CE 2ZR0A 1U94A 3VKWA 2X2EA 3SFZA 2H1LA 2UZIR 3PENA 4JLVA 4B32A 5DN6D 2IS2A 2ODEA 4MQBA 4UNPA 2JJ2D 2LWIA 1XD8A 2Z43A 2CJWA 4Z8XA 4Z8YA 2CXXA 4WBSA 5SZKB 3U3RA 4MUAA 4LHYA 1OH5A 1JPNA 3K1JA 5JBQA 1XEFA 3OFND 3SC3A 2QUZA 4DRZA 3BORA 4Q47A 3KKQA 2AFHE 1KMHB 2BMFA 3CR8A 4DUGA 821PA 1DAFA 2NPIA 1G8YA 2RH5A 2ZI7A 2CNWD 4PPQA 3JVUA 3KTAB 5FTNA 3KFVA 3QXXA 2FZ4A 3CZPA 1QHSA 4JT2A 2PEZA 3AVXA 5CM9C 3TW8B 3IBYA 5FBRB 3SJZA 3I5XA 3HU3A 1T3LA 4V0OA 3ZD6A 4JT4A 2VA8A 4PC2A 2HXYA 4DLYA 1MABA 2I3BA 4TL6A 2CK3D 3ND8A 4P31A 4ZCIA 4LUCA 3THWB 1E79A 3WHLA 3IGFA 2PT7A 3LH5A 1JEEA 3BAFA 5TV2A 1TUEA 1G291 1XEXA 3D7MA 3QPWA 3U6KA 1MV5A 1CS4C 2FWRA 1M7BA 3GQBA 1YJ5A 2ZRFA 3ASYA 1NMYA 2QM8A 1KK3A 1JAIA 3FWYA 1XCGB 1SVLA 2ZYTX 5EUMA 1H8HD 3VU9B 5B57C 1DTSA 3HYTA 1WB9A 3LRPA 1AKYA 1AZSC 1NVWQ 4EIWA 1JR3E 4CEJB 4HAYA 1OHHD 4EFMA 1ZD8A 3C5HA 2WJYA 1NL3A 2ZE7A 2QROA 5HTKA 5BYJA 4TYYA 4OK6A 2OFWA 5G40A 1QHNA 1S96A 3ADKA 2ZSBA 1H8HA 1XEWY 1XEWX 2OCPA 2WAYA 4WIAA 4ZDJA 3K0EA 4N0EA 2BEJA 2DB3A 4IVQA 2QPTA 1KOFA 1E9BA 3LV8A 1DVRA 1XMIA 3I8SA 1N6KA 3MMPA 3G0HA 2QZ4A 4MGYR 3FKQA 6Q21A 3K70C 3T1VA 2V3CC 3VX4A 1ZUNB 5JRZA 2ZSFA 1YZGA 3DDCA 4Q9JA 2QP9X 3QKSB 4A8JA 3CLVA 1KI9A 3AP1A 4KSCA 3CF6R 2BM1A 2OAQ1 5CK4A 1XEXB 2ZSEA 2G1KA 4NTZA 1A1VA 4CIDA 4ZDWA 3RYTC 2RCNA 1ZCAA 4KLNA 3SE0A 1VG9B 1ZM9A 2D06A 1UPTA 2FEMA 2GRJA 4JLAA 2J0UA 2KE5A 4FCVA 1G64A 2C98A 1YZTA 2BDTA 1TADA 1FW6A 1SZPA 3U60B 3NHAA 5DGXA 2QEQA 2CNWA 4KVGA 2E9SA 3W6NA 4KFRA 1ZNXA 4P4SB 1JJVA 3PUWA 1U98A 2GJ9A 3S1AA 2CE7A 5B30A 1NG1A 4RCZA 1U99A 4OI4A 4XSGA 2ZJ2A 3QXHA 4ESHA 5FTLA 2R6GA 1KO5A 4LX0A 2CK3A 4WZBE 2CJWB 2ATVA 3GEEA 2XSZA 4BRWA 1D9XA 4W9MC 1YZLA 1E32A 4JLNA 3AF3A 2XJ9A 4A6PA 1VCOA 5E7IA 3KJIA 1OH7A 4TLAA 2RHMA 2MSEB 3WP0A 1OIWA 3CO5A 5CJ2A 4HDOB 5HE9A 4F38A 4TMZA 1I4LD 4DCTA 3TVDA 1KMHA 1R5NA 1SXJA 4D4JA 1P6XA 2KBEA 5B58C 1XP8A 1G4AE 3AEZA 3GLFB 1E0SA 2GK6A 3D6TB 4PO8A 1H8EA 1HEIA 5CDFE 1IJFA 4CT4B 1J70A 4D0GA 4DHEA 2KBFA 3RS0A 3HU1A 4HZUA 5DLQC 4B43A 4MRNA 221PA 1KO7A 4QJ5A 1G7SA 1W2HA 1SGWA 4QJ3A 2DWPA 4PC1A 5GJVC 4Q9LA 5EZ5A 1IQPA 4IOJA 4RY2A 2GZHA 2F1HA 3AF2A 4QJ4A 1T3HA 2YC2C 5DI3B 3P1JA 4LV5B 2Q3FA 3Q85A 5BW8A 3ICQB 2A7QA 4AYTA 3THXB 4JLDA 3MCAA 1YR7A 4GMXA 4KITB 3NBZC 4TTRA 4C0LA 3AKCA 5DN6A 1G3UA 4OK5A 4HAVA 1AIPA 4JBXA 4EPYA 1E0KA 1W47A 4YMTA 3QUSA 3AKEA 1R0XA 2FSIA 2QMUA 4NP6A 5DNYB 4QGHA 4ZIRB 4YDHB 2FMXA 1IOZA 3ZVLA 4BQSA 5JWRA 5TB5A 2ZE8A 4B76A 2P6RA 3LA6A 3N5CA 2IBMA 1ZNYA 4TMKA 3EA5A 1OV4A 2O0KA 3HPRA 1X1RA 3SI7A 3V4RA 2W2XA 2W83A 1TPZA 1BYUA 1G4UR 3HPQA 4MDEA 1DOAA 3EZ7A 1VDZA 3CZQA 3NBYC 3QY0A 1D9ZA 3TQCA 3QXJA 3MG9A 1R8QA 2FU5C 1E2EA 1ODFA 1VPLA 4Q1EA 1OFHA 4TMXA 2PCJA 4ZI3A 4UJ5A 1QVRA 2NPFA 2X19A 5AJXA 3W6OA 4LJ8A 3T61A 1E1QD 1N25A 4A2PA 3IEUA 4LJ7A 5KNDA 1M1YE 4AURA 1Q22A 5FL7D 1E9CA 1YE8A 1J99A 4HLUC 1XPUA 5K8UA 1IN5A 3FYHA 2HCJB 1IAQA 3CPHA 3EPLA 1SXJC 3EZ2A 3TUJC 3MWJA 3K0CA 2JGNA 1DADA 2FPKA 3QG5A 2QMHA 4TL9A 2J7KA 3QF4B 2GCPA 2OCBA 1QHXA 1HYQA 2DR3A 2YJTD 4TTPA 4XVRA 2EWVA 3B9QA 4Q1DA 2O8DA 2XJ4A 4O25A 1S9HA 3MWLA 1EX6A 3EW9A 3FFBA 2D2FA 4Q19A 5AJYA 1OHHA 1ZM4A 4MDFA 2WJIA 5F98A 4KLZA 1XPOA 3MWKA 4JVNA 3GP8A 1UF9A 2Z4RA 1FNNA 5H8WA 4D4MA 1Q1BA 2FH5B 1KSFX 3QXSA 2OXRA 3C15C 4WZ6A 3T12A 4DLVA 1KNQA 4G01B 3A4MA 5FBWB 1G21E 1TNDA 4IEIA 3K53A 4LYAA 1E2JA 2HUPA 2DFNA 3BB4A 3GLGA 4M1YA 1RW4A 2AKYA 1UDWA 4DKXA 3OHMA 3LVRE 2DWOA 4JS0A 4Q18A 3L0PA 3CRRA 1U8YA 1FTNA 3FMOB 2HT6A 3K9GA 4KO8A 4NU0A 2GCNA 2R65A 2VYFA 2C78A 2QSZA 4PPNA 4LHWA 2XZOA 4LJ4A 3VMFA 1DG1G 1QHYA 2ZYVX 2DFKB 1Z83A 3QI2A 1S9DA 1Z8FA 1R0YA 2F55A 1YR6A 3FKSA 4NKRA 4N1AA 2QBYA 1N6RA 2R6FA 4B3FX 2ZRPA 2D2EA 4U7DA 1SKYB 1W0JD 2C9OA 5D3QA 4ASUD 4UJ3A 1D2MA 1KI3A 3GLHB 1FFHA 4LPKA 4EPWA 3AH8A 4B6FA 1JJ7A 1NN0A 3RRZA 4I1VA 1CEEA 2FGJA 1DAEA 4MKIA 3A1SA 5KPDA 4RD3A 5JJLA 2C5LA 2ZUCA 4KCGA 1J8MF 1EFCA 2WWFA 2R44A 5G41A 4AG6A 2W0SA 2PBRA 1Z29A 4G5SA 5C4MA 2QAGB 4Q21A 3G5UA 4AKEA 4BE7B 4YC7A 1A5TA 4N0DA 5KSOA 3O8BA 5TXGA 4QKQA 2HT1A 3GEHA 4C0HA 5E4FA 4F4CA 2HEIA 1KAGA 1Z3IX 4GZMA 1N6PA 2BBOA 2GTPA 4DLUA 5E95A 3BS4A 1XCMA 2CLSA 3TAHA 2KSQA 3TR0A 4DDTA 4B2PA 1YZUA 3PXGA 2OV2A 3QPUA 2IYUA 1EG7A 2NIPA 1U81A 2QU8A 1Q44A 1M34E 1ZIOA 2N42A 3ETLA 1YU9A 4PC3A 1OPXA 3GJ0A 4R9UC 4GDFA 1QHGA 4NYJR 5CIWA 2NG1A 2XTNA 2J3EA 1VG8A 1Z22A 3JZAA 3AUXA 2XB4A 4PO1A 2FPMA 4HLDA 1JAHA 1ZRHA 2P5TB 4IDQA 1VHLA 3RC3A 5J4VA 2PEYA 2J87A 3GLHE 2JLVA 2BV3A 3W3ZB 2BIFA 5HR5A 1FZQA 2EFCB 1SKYE 2W6IA 1E2QA 1E6CA 1ONBA 4B3BA 1UAAA 1RYHA 1XTIA 3LAWA 1HURA 4XWKA 1KJYA 4P4UA 5IK2D 4DB2A 3C7KA 4JBYA 4W5JA 1GUAA 2EFDB 3C4JA 3OIWA 1S1MA 1N6LA 1N0VC 1T3SA 3PG5A 4XVQA 3FTQA 1US8B 4Q4JB 4A15A 3VR3A 2RKOA 3TE6A 4JVLA 3B13B 3TQFA 3CB4A 1DAMA 1EX7A 5DHFA 2P0EA 3QNUA 4LV8B 5IK2A 2YWGA 5C4GB 1DPFA 1ESMA 2IXGA 5KUTA 2V8OA 1W7AA 3E5HA 3PITA 1NBMD 4ACAA 4Q4HB 5IT5A 1DAHA 3L0SA 5L8VA 1RC8A 1HTWA 2B6HA 4OHZA 3TAUA 1HE8B 5EP3A 2WKQA 1YZKA 1G3RA 3R20A 2GXUA 4RVCA 1E98A 2R6DA 1OW3B 3K09C 4DLRA 4K81B 1W44A 3K0FB 2CLDX 4D0LB 2F43A 2PT5A 1NKTA 2IL1A 2IXEA 3VAAA 5J47A 3BXZA 1AJEA 5IDVA 4B74A 2GJKA 5DI3A 3IQWA 2YVUA 5HPYB 5JJIA 1AK2A 5FR1A 1US8A 2IS6A 4PXAA 4HB3A 1W4RA 4AYXA 1HA3A 4F91B 5IRCD 1QRAA 1FQKA 2HJVA 2ZJ8A 1SHZA 4QBGB 3D3QA 1OXXK 1Z6GA 2JLQA 4NHOA 2GKSA 4R2HA 4NYJQ 2X8AA 4OJQA 2XEXA 4KODA 4GP6A 5DH9A 5HE8A 1RIFA 3GJ5A 1T91A 3T1OA 3KQNA 1XPRA 3W3AA 5FFMA 3EC1A 3QENA 4HB4A 3DM5A 3ZLJA 1GRNA 1EK0A 3NVAA 2PLRA 4BFXA 1Q57A 3K9HA 1DAKA 4WW0A 3EZ9A 4AY2A 3DPUA 2OE2A 1ZU4A 3SJCA 3ZJYA 3WMFA 3VFDA 2J0VA 2R62A 2V9PA 1KKLA 4M1WA 2QG6A 1G20E 1Q3TA 4QHYA 4QNMA 3U5ZB 2ODNA 1OFIA 1XU4A 4LHXA 2YOFA 1FTSA 2DCUA 2ERYA 3I73A 2VQSA 3BJIC 3WBKA 1XFAA 2ZJAA 4URUR 1E2LA 4ZPXA 5HZKA 3H84A 2RGGA 1U0JA 3BC1A 2UVQA 4B33A 1UBCA 3WYAA 1E94E 3RANA 3WYFA 4ZDKA 4CT5A 3KZ1E 4F4IA 2ZI6A 3RS5A 1XJ0A 5C2JB 1TL7C 4HYYA 4OKSA 4HLUA 4NBSA 1KIMA 4F7WA 1NY5A 2RGDA 3EARA 3AVTA 1UKZA 4AD8A 3CIOA 3CNLA 3EAQA 4U02A 4ZI2A 3U7GA 1IN6A 1GG2A 1II8A 3IPYA 3QPVA 2EU8A 1FX0A 3VR6A 4OL0A 2G3YA 2P6NA 1LS1A 4NCKA 5AWFC 4DJTA 5JMTA 1W48A 1IXSB 1JNYA 1YZQA 3N70A 1SKQA 4E22A 2CDNA 1ZD9A 4H1VA 1YQTA 3NTUA 2EWWA 3RRMA 1OKKA 3RS3A 2OO7A 4CVNA 2AXPA 3F8TA 2BJVA 5KDDA 5KNBA 3HR7A 4PPGA 3L82B 4AC9A 3I61A 521PA 1T9HA 3PEUA 3KX2A 4IKEA 3U44B 3DEFA 1AGRA 3ZGXA 5J4YA 2VRWA 1NLYA 3SS8A 2ZRAA 2OFOA 2EVWX 4QL3A 3ZH9B 1SXJD 1UEJA 5DSZA 3W34A 4HZUB 4E03A 3WRXC 4CZ2A 1X3SA 2ZITA 2QTVB 4IXMA 4KFUA 4C7OB 1KDTA 2EW1A 3SEAA 1E9FA 4POAA 4MGZR 2AL7A 2ORIA 1S0UA 3TUZC 3M6AA 4ZCMA 3DKPA 1QG4A 3TBKA 3U2QA 3F5FA 1TQDA 2FDCA 3GLHA 1Z5ZA 4B44A 4FINA 3Q72A 2F3TA 5TDHA 4RD4A 4JSTA 1RKBA 1SVKA 4R7ZA 4C0KA 4PAQA 4LHZA 4NYMR 2UKDA 1G5RA 1G5TA 4W5HA 3RNLA 2G1JA 1IJEA 3A1UA 1K5DA 2V1XA 2ZE5A 3EG5A 2ZRMA 1DO2A 4PHTA 2R9VA 2MSCB 1MRNA 4P3YA 3D31A 3PV0A 1F48A 1F5NA 3NWJA 3I5YA 1MABB 2O0HA 2VSXA 3EZ6A 4ARZA 4BLOA 3SBEA 2O8BA 4PSVA 4TMWA 2BMJA 4QGGA 5FPHA 4DSOA 4Q4HA 2NGRA 2A78A 2ZRCA 4X8MA 4YXWD 1ZINA 1E96A 5EE5B 1IN7A 2NZJA 5GVRA 1F2TB 1E9DA 1NBME 1Q0UA 3DMDA 3W5IA 4D6PA 1BMFA 1KZGB 5H68A 1IY1A 3CUEF 2WWGA 4JIMA 1Q3HA 1N5IA 4MRRA 1SVSA 1VCNA 2J1LA 4G1UC 3PUZA 3IKJA 3F0TA 1K5GA 2PH1A 1G16A 1WRBA 2FSGA 1LF0A 4X8LA 3TH5A 4DSUA 1G7TA 2DFTA 3CRQA 1N5KA 3QKSA 5HKKA 5D3MB 1RRFA 4JMPA 2G0TA 2FF7A 4NCJA 1XMSA 1H65A 2RMKA 4Q9KA 2B8WA 3UXMA 5JS7A 3UPUA 1J8YF 4M21A 4MYTA 2BMEA 3MWYW 4OYHA 2YHSA 4ZIRA 1TTTA 2RAPA 2QORA 3D8BA 1P5ZB 2C8VA 1AN0A 4PZYA 2ZRIA 1L7VC 3DM9B 1KK2A 4IXNA 4EFNA 3AVPA 1ZM3A 3B7GA 3HYRA 4OHYA 4FIDA 4LSGA 2IYLD 2JIZD 1BMFD 5LBIA 1GITA 4BECA 3R9XA 2J7PD 1CBUA 5JI3E 5FUYA 4XOIA 4DWJA 4WXPA 3NC0C 4D80A 2CBZA 3QEJA 2IYSA 2QAJA 1XZQA 4GFDA 2BJWA 3ZZ0A 3JVVA 4HATA 1Z6TA 1VHTA 3Q8XB 2YWFA 2ODWA 3SZRA 3GFTA 4D82A 1KI1A 3EASA 4HB0A 5JCZA 2R6AA 4Q03A 2JIZA 2IEYA 2R6CA 1G9XA 2FX3A 4IOMA 2Z6VA 4KYUA 4RJLA 4ZDIA 1EESA 2W2VA 3RS2A 3GLFE 1NVUQ 1T5IA 5EUQB 3LFUA 5DE3A 2EFHB 1GWNA 3X1YA 4PANA 4JZKA 1NN3A 1GFIA 2OM2A 3Q7QA 2AHOA 3IHWA 1LNZA 1E2FA 1XDBA 1GKYA 4QOSA 3ZIAD 4UXHA 2ZJZA 1N0WA 1TAGA 1QVAA 3NH6A 4QM7A 1FUKA 3FMFA 2VIIA 2VHTA 4GMDA 3ZVMA 1S3GA 4XD7A 1EXMA 4P4SA 2F1JA 3A8TA 3A1TA 4YONB 3PFIA 3NEYA 1XD2A 4RZ3A 2RHDA 4TQAA 3ZZTA 3KL4A 2QPAA 1GZSA 2GBLA 5FI0B 1X8JA 1FL9A 2FG5A 4LBWA 4RKFA 4A0HA 3A58B 4NYIR 2GZAA 4EPTA 2V1UA 3WYGA 2E87A 4W7SA 2WJVA 2OCYC 2GCOB 3BH0A 2E1RA 4E5UA 2V55B 5EZ6B 3AGQA 4MKFA 1G19A 2B7BA 3JZMA 4TL7A 2NQ2C 2HDNB 3LD9A 3L43A 1D5CA 4MRVA 4TT3D 1T6NA 3W6PA 3KQHA 2HJGA 3QEOA 1EFHA 2V6JA 2IXFA 3NDPA 2QMEA 2J0QA 4EJSA 4NYMQ 4RFSB 1LV7A 4BZQA 2JDID 2WPDA 3OEHA 4D25A 1COWA 2X77A 4FN5A 2J9RA 2OUKA 2V7QD 1KJZA 1S8FA 3FHOA 3AP3A 3PCRB 1U0HC 4DIDA 1SULA 1S2MA 1Z08A 3IILA 4DLTA 1QDEA 1ZUIA 3CPEA 5L3RA 2NO6A 2P6UA 5FPTA 1A4RA 5CM8B 5EXXA 4HB2A 4A2QA 3VKGA 4XTRA 2I4IA 4QNRA 5AJVB 2JATA 1BIFA 1M8PA 2Q21A 4H9GA 4XH9B 5C46F 1WQ1R 1ANKA 3B1WA 1OYYA 1IM2A 5FTKA 2TMKA 4LBZA 2J41A 1JR3D 2NO7A 2IX3A 3RLFA 4C0QC 5FPKA 4KXFB 1UKYA 1KI6A 1CXZA 2J0UB 1NLZA 3GJ8A 1XBTA 5KSPA 4DC9A 4BUJA 5F2EA 2QGZA 4LJ6A 4BFZA 2MMCA 1SHKA 2CVHA 2AXNA 1CIPA 3NIBA 3EC2A 1Z0AA 5KO2A 2XNSA 1X6VA 2UZ3A 5KDOA 5LDDC 4FXPA 1Q21A 2IF2A 4GI7A 1VYUA 4C2UA 2IS1A 1W36B 4DEYA 1TU4A 4K46A 3OFNA 2F6RA 3OEED 1SVMA 1N0UA 1W4CA 3K8YA 2LKDA 5G3YA 4B47A 3O8CA 2O8FB 2Q6TA 5GJWC 4RZXA 2ZSDA 4Q4AB 3L0IB 4NZYA 2VP6A 1ZP6A 1X8LA 2HYDA 4ASUA 2WIBA 1R0ZA 2VL7A 3RSOA 2FJUA 3KFXA 1IXZA 1PJRA 1TQ6A 1KY2A 4NPHA 1E2KA 1UM8A 1WF3A 4IOLA 3IQXA 4DVGA 2ZE6A 1CR2A 4MKGA 4RD6A 5L3VA 2NMVA 2AFIE 1ZVQA 1RPZA 1E2GA 2ZR7A 2WHXA 4B73A 4GSYA 4L8GA 2VO1A 3E2IA 4LK2A 3SYNA 2O0JA 3UMSA 1U9IC 2ASEA 3PEVA 1LB1B 4PZZA 4BRUA 1UFQA 4IFEA 4Q5IA 2ZI9A 1W49A 4MRPA 4O3MA 1KKMA 4TZ6A 4WZAE 4FMBB 2C2HA 1A2BA 5ANRB 3ZVRA 2DHRA 2J45A 1OB2A 2ZJYA 3WXMA 4BWYA 1R6BX 1UKVY 4ZO4A 2OBNA 1BH2A 1G6OA 2H8KA 3C16C 3WMEA 3X2SA 1GNRA 1Z0JA 4M9SA 3T34A 3A37A 3CX8A 2NTYC 2QQEA 1E69A 2NOAA 4G3XA 4EPVA 2QPOA 5BN3A 2K5UA 1BO6A 3GLIA 1G18A 1GDDA 4JKIA 4LWZA 1CJKC 1YKSA 5HKKD 3MGCA 5CDFA 1NVXQ 2GNOA 3LW7A 1G3IA 1S4QA 2D4HA 2F1RA 2P5SA 4KU4A 4Q48A 2Q3HA 5EXPA 4Z51A 2Q3MA 2VBCA 1OLOA 4G5GA 1V5WA 5CLLA 621PA 1DBSA 4A0FA 3O8DA 1T5LA 1VYVA 4LJ9A 4Q4JA 2QGNA 5E3HA 5AUPB 1Z06A 5SZJA 4I1OA 1VKJA 2QMOA 3EZFA 2ZI3A 1FMLA 1NY6A 4QC2A 1U8AA 4ILEA 4IDOA 1JXOA 1TF2A 3L0OA 4O2LA 1P2SA 4PSKA 5EQTA 4EKDA 4WAUA 4XIGS 4OQLA 1F2UB 5FOSA 1IN8A 2WOOA 4KBGA 1TU3A 4TYQA 3E1SA 2NZ8A 1DELA 2GEUA 3THYA 4ERNA 3NEJA 2CHQA 3RS7A 3UKDA 4R71A 5CLQA 3H86A 1I4TD 3LLMA 2X1VA 3NXSA 4MYHA 4KHZA 4Q7KA 5BYKA 4JYCA 1G7RA 1SVIA 2F3RA 3B1ZA 4MGKR 2AKAB 2ONJA 4C7OA 2QA5A 1C9KA 1CULC 2Y8EA 1E9RA 4G5QA 4KFSA 4MUBA 4H1UA 4JVMA 5G53C 4HDCA 3CPJB 2ZRDA 4QGAA 2HXSA 1MO3A 4FD2A 1W46A 4EJSC 2WWYA 4AG5A 2ZS8A 3FVQA 2OT3B 3B9PA 2A3RA 3A4NA 3UK6A 2C04A 1OXUA 5KPJA 2VF7A 3UMFA 3AB3A 1N3BA 2PZEA 3PVSA 3QJYA 2ZJBA 2GAAA 1YR8A 2VHQA 4JLOA 4M22A 3TSZA 4AK9A 4BZXA 2OBLA 3HP1A 1W1WA 1VG0B 2AWNA 2HLDA 3IBGA 3RVBA 1NRJB 3KUDA 3LLUA 3MRSA 1XNJA 1XXHE 4TMVA 3N2IA 1E1RA 1Z0IA 2HF8A 3V9PA 3X1XA 3ONWA 4FW9A 2FEOA 3LQRA 2C77A 3HWSA 3RSLA 1AM4D 1IN4A 2BWJA 3P32A 2O5VA 3Q7PA 4C0JA 4LV6A 1GP2A 2VHUA 4M0LA 3C8UA 1DG3A 1L4YA 2GCOA 3I3SR 3CW2A 4IDNA 5EE3A 5A5GA 3EXAA 4QHSA 2IYTA 2VF8A 3B60A 2BBSA 2F43B 5FL3A 3W8NA 2ZUBA 1D8TA 3LNCA 3CF2A 4FMDF 2D74A 1JBKA 4L4UA 3MAAC 2F9MA 2ZRJA 3LBNA 1KY3A 4JLPA 3VX3A 2CVFA 1FX0B 2PJZA 4DDUA 1FOEB 1LFDB 2ZUDA 1VIAA 1XD2B 2PMKA 4Q02A 4ITRC 4A2WA 2OFXA 4Q4LA 2OLJA 1EWQA 2ZJOA 1E1RD 1U2RA 1WE2A 2ZROA 3Q5DA 3SHFA 1EGAA 1KNXA 3WNBA 3SDZA 4NMMA 2BKEA 4HUTA 1NJFA 1NNEA 2IS4A 1DEKA 2AK2A 2O8EB 2QL6A 4TLBA 2ZAOA 1JQLB 5FOXA 4BFVA 3LBIA 4EDHA 3W90A 4DB4A 3BFVA 2BBWA 3BIFA 2D3WA 2BC9A 3ICEA 2XNDA 4M8NE 4KYIB 4C0AC 4Z1MD 3U7EB 2A5YB 2GHIA 2ZTSA 4EAQA 2F9LA 2XTZA 1M6NA 3X1ZA 4HAZA 3SBDA 3AGPA 1CJMA 3U3JA 4GOXA 1AS0A 2B8TA 4J0QA 4QGFA 1OFUX 3SNHA 2ZI5A 1NJGA 3U6BA 4CW7A 3H4MA 4BFUA 3WP1B 4GOKA 2FOLA 3VR2A 1P61B 4LJ5A 2IYXA 4RD1A 2FN4A 3NDBB 1MO4A 2DBYA 2F7SA 2P2LA 1FMJA 2IYZA 5JLJA 2GJSA 2BVNA 2H7VA 4A0GA 5LD2C 1GKUB 2V54A 5JCPA 2JJ1A 4QBHA 4Q7MB 4Q4AA 1I2DA 2HLDD 3RC8A 1HH4A 1JR6A 2YINC 1CR0A 5HZHA 3LXXA 4XD7D 2ZU6A 3RRYA 2WKPA 3K0CC 4QG7A 3CKLA 4Q1AA 2ZSAA 1Q1EA 3FE2A 4I81A 5TVKA 3TJZA 3NHBA 3P4XA 4QBIA 4N3NA 3OZXA 3K09A 3GPLA 1E79D 2KWIA 4PQFA 2IK8A 2GXSA 3Q9LA 1KI2A 2XOKA 4V0MA 1I4DD 2IYWA 1RFLA 3OIYA 4M1TA 5L3SA 1PUIA 3P27A 3ASZA 4C4PA 5J4HA 1ESNA 4BLPA 2Z83A 1R5OA 2G6BA 4ACBA 2ORVA 2FNAA 1WP9A 4M9XA 1GAJA 3ZS9A 1CRQA 3U3KA 4JVSB 3GLIB 2HF9A 3VR1A 4LGMA 1P9RA 2H57A 2XOKD 1COWD 3MSXA 1KYIA 5FUXA 5CJPA 5EP2A 4YMSA 3CWZA 2QQ0A 3THXA 4P0TA 2QE7D 4LC0A 3UG7A 3NG1A 2FFQA 2FGKA 1G7CA 1Z6YA 2GF0A 4NE2A 2D7CA 2WSMA 3OAAD 5DI9A 3GLGB 4IVRA 5JZVA 2G9NA 2B7CA 2OSBA 4IW3B 5A4JA 3VR5A 3L2OB 3U3OA 1T8TA 4KBFA 3GCGA 2GF9A 3TUIC 3A4LA 1XB2A 5L3QB 4TMTA 3OE7A 4A36A 3VQTA 2BCGY 4Q01A 1J7KA 5JFGA 1NMZA 2GAOA 3LVQE 4AKHA 2JASA 1R2QA 2IUSA 3EWAA 4RFSA 1LW7A 2Q9BA 3AKDA 4JSYA 3TVTA 3U7HB 3P20A 5BN5A 4URXR 3TRFA 2QE7A 5JHGB 1E4YA 5CB6A 2J59A 2IEZA 2CE2X 1GL7A 2CMKA 2ZEJA 5HCNA 2Q9CA 2GEVA 3K9NA 2GJ8A 5IHPA 1WA5A 2SHKA 1KDOA 4P33A 4AKGA 4C0SA 4OQNA 3QKUA 1E2IA 2EFGA 1N6NA 1Z47A 2VP0A 3K0FA 3OIVA 2EYQA 4L5BA 1X86B 2RGCA 3SQWA 2QTFA 1AS3A 2XGJA 1KZ7B 3B2EA 2RGAA 2FSHA 3TSOA 1P9NA 3KQLA 1Q20A 3LDAA 3SR0A 1NI3A 4NCHA 3QIAA 4NL4H 5EP4A 2W6ID 2A5GA 1CU1A 2ZU0C 5FOTA 3W5JA 3BFKA 3THYB 2QBYB 2GILA 2P65A 4DXAA 2GJAA 4XWAA 2AK3A 2QT0A 3B82A 5KHOC 3I8XA 3BH7A 2J0SA 3I92A 2ONKA 2ZJ5A 4BEBA 4DCUA 3TMKA 2VP4A 1IY0A 1TUIA 1EWRA 5KSYA 4TWZA 1KTVA 1OT3A 2ZANA 5AUNB 2QNRA 2OG2A 4KJZA 5FBVB 3IO3A 1AKEA 2O8DB 1KO1A 4UNQA 4BFTA 1XXHB 2NO0A 4RD2A 1KGDA 3UWKA 1D2NA 3QQ5A 3GD7A 4UXJA 3W8RA 5F9FA 3A6PC 3AVYA 4A6XA 4YDSA 4NONA 2XXAB 4R2IA 1KO4A 5FOVA 1X8KA 3ZIAA 1YR9A 2BOVA 4JLJA 2NO1A 2JLUA 2PL3A 2FFHA 2WV9A 2CHGA 1ZW6A 3ZVNA 1FP6A 4IHQA 4OQFA 4LY6A 4RCYA 3I1FA 1G8PA 2HV8A 3SYKA 1NF3A 4YMUA 3L8YA 1W5SA 3EIEA 2YC4C 3RWMB 3CRW1 1TMKA 4DZZA 721PA 4TSFA 2KJQA 2CHVA 3HR8A 4WOPA 1WBDA 1ZC3A 4HLQB 2Z0MA 1LY1A 4OQXA 4B48A 2L0XA 4LYHA 2ZIAA 1A7JA 4LRWA 4L15A 1VG1A 1RZ3A 2FSFA 1F2TA 4CEIB 3GJXC 3OAAA 1PLJA 2MSDB 2CCGA 1GL9B 4Q1CA 5GVSA 2ZM5A 2IYVA 5TMPA 3EX7C 3AVVA 2XZPA 3GFOA 2ZVQX 4TZ0A 4AKIA 1Z0DA 3NKVA 3H0KA 2RGBA 1FUUA 2G0NA 2ZXUA 1AGPA 3GJ3A 4YMWA 5KSZA 1XJQA 1KSJA 1JI0A 3S1AB 5KOYA 5EP1A 1Q1QA 2LKCA 4KFTA 5JHHB 2I1QA 2H16A 3AP2A 5CIQA 1RRCA 2EQBA 2O8FA 4CEIA 1G8HA 5HCIA 5DISB 2P3SA 1H8ED 2REBA 1UDXA 3LX5A 4CEHA 4FMDB 1FQJA 3FOZA 1W36C 1E99A 1W0JA 3K0AB 1DAIA 1U90A 2REOA 3X1DA 4LJYA 4I4LA 3WRYC 2J7PA 3CM0A 1Z0FA 1ZAKA 2EYUA 4JLBA 5DHAA 1UKEA 2VSOA 3RHFA 2IWRA 3CH5A 4M9ZA 2BCJQ 1RJ9A 2REXB 1PLLA 5KNCA 4JJZA 3WNDA 2YWEA 5TY0A 2VP9A 1KSHA 5KYKA 2R8RA 4MYUA 3FDIA 4I1SA 8OHMA 3AVWA 1PUJA 1SXJB 5FPSA 3WHKA 2XXAA 4EUNA 3I62A 2AD5A 4TTQA 2CL7X 4EPRA 4L16A 3B1YA 4PC7A 4PHFA 2IUTA 1GRQA 4C30A 4II7A 3SN6A 5C1BA 3EA0A 1F6BA 1XJCA 4LOAA 1WBBA 4GL2A 1W36D 1MO6A 2ZETA 4O0MA 2C9YA 4URYR 1E2HA 5AR1A 2A2ZA 1G5PA 2JAQA 5B2ZA 2QRNA 4U00A 2ZREA 1T0HB 1ZC4A 1EFRD 2YNMA 4HI0E 3FFAA 3FPAA 1PV4A 3BD9A 4DDWA 3T15A 1GOTA 4DSTA 4OK3A 4B2LA 1CRPA 2WWWA 4XVUA 1S3SA 1E0JA 4ZCLA 3IDQA 4HAXA 2W00A 4NH0A 4Q7LA 3REGA 1MT0A 1E2NA 1CR4A 1NIJA 1R5BA 1II9A 4U5XA 2V4ZA 3TR5A 3KKNA 5JS8A 1GKIA 1W0KD 2IHBA
chains in the Genus database with same CATH superfamily
1PYDA 3LYHA 1WD5A 3D64A 5IC6A 4F4UA 2WTUA 3I42A 4FJ2A 3UK7A 1JPJA 3DPSA 1QHHB 1XVUA 4PSDA 3AF1A 4QDXA 4ZV4A 5CBKA 4C0XA 4DUGD 1PN3A 4NARA 1OBCA 1DJPA 2ZOSA 4WINA 1HNWB 1UJ2A 3LP6A 5K20A 4RZ2A 4DTCA 1KMIY 1VSTA 4QM6A 1LKZA 4EFKA 1JLLA 5T41A 4PX9A 1BE0A 3VYWA 2IW3A 1CF4A 1JFTA 1M0SA 2V45A 3R3ZA 4RADA 2WP8J 4RL6A 5EQDA 5J5CA 1PJSA 3TLEA 2RHOA 2QTNA 1GKLA 2Y77A 3QE3A 4PPFA 4TS1A 4QFBA 3R8CA 5CT9A 3QVOA 1RAIA 4QT0A 5IWAB 4ZTZB 3MYRA 4YAWA 2MMGA 2FG6C 3GP5A 4R1OA 4P4TA 1HNZB 5COAA 8AT1A 1DKPA 3CZAA 3ESQA 2QRVA 1HT1E 4IF6A 1OJLA 1ZU5A 2D0PB 1KEUA 4UVEA 2TMYA 4C0WA 3EGCA 4PSAA 3SXJA 1MXHA 3ORSA 5G0TA 2PX3A 4C78A 4YHBA 1TD1A 1WNTA 3WIBA 3R4VA 1LDEA 1NVGA 1E60A 1SHJA 3RS4A 3WIVA 3HJUA 1TEXA 2KYRA 4IDHA 4U63A 5DX8A 5LR6A 4HN2A 4JHXA 4RA6B 4QPJC 4XJXA 1SIBE 4TROA 4YAOA 3U3MA 2VNSA 5K09A 2GTHA 4ARCA 2ZVPX 5JFOA 1P7PA 2P3LA 1PT9A 3IOYA 4EZEA 5ILQA 1GQSA 4OQ4A 3V8NA 4PPYA 3WGMA 1U6IA 3IIMA 4JJAA 1GGNA 2OO5A 1T2EA 2YTZA 2GFIA 3OQVA 2YHBA 3DVSX 4ID3A 1GILA 3LY7A 1M74A 3ZQ4A 4D3SA 5CB0A 2FWBA 3A2KA 2M2IA 3AHIA 4R8SA 1SKBA 4E30A 5K8CA 4URWR 5FIUA 3BFPA 4KQFA 4IHJF 1FUEA 4B0OA 5I45A 4L28A 3W7BA 5J23A 3OVMA 1LBTA 1KPGA 2A30A 3R0ZA 2WWIA 1ONNA 1AQ6A 1GPLA 1NQXA 2H18A 1YS9A 1QV7A 4UBNA 2NXJA 1E3DA 5EMMA 3UY4A 5COBA 4EARA 4CETA 1J00A 1XUOA 1TAHA 1TLLA 1NN5A 2CMHA 2DSTA 4XM0A 2CCJA 2DJ5A 2CEKA 2ZBPA 2C99A 4WLNA 5EIBC 4ZVOA 1N5OX 2K87A 4FFVA 5JTUA 2WTMA 1JDBC 2FE4A 5DWQA 1A8HA 5FUWA 4WNIA 4AB1A 2C96A 4C43A 1T6YA 1ZXXA 4GHWA 1BVYF 5DB4A 4A8TA 4CR8A 3LFTA 1Z34A 3OICA 1TJNA 2PXXA 2GETA 4G0NA 3ADDA 1D4ZA 2GHTA 2XWPA 1H3FA 3V32A 4BLWA 5LLTA 1QQ6A 2JLYA 4IXTA 3VPAA 4EFLA 1QTNA 2Q6LA 1NVKA 2O23A 1C7RA 2WU3A 2JK0A 2GK4A 1XD9A 4ZHQA 4WUVA 3UB4A 3FD8A 2QL9A 3DVLA 4YQZA 3TSWA 4YQEA 1XOIA 2ZYGA 3UMCA 4ER6A 1G8GA 2J30A 3ESRA 3TECE 2QSJA 4Y2QA 2LR0A 1T2DA 1VLHA 2O7RA 4A0RA 4YCMA 1JEOA 2P4EA 3GJ7A 2J3HA 3HLYA 4NYIQ 3LQQA 4U3JB 2F1IA 1R9GA 1Q12A 1LK7A 3UOGA 4GOOD 2YWHA 4HD8A 3F3MA 3NHMA 3K1AA 4K7JA 5THKA 2VTBB 5DYGA 4WESB 1YRBA 3KC2A 1KY4A 3UKJA 4BB6A 3EIOA 4DIFA 4HHEA 2R751 3RHZA 3OPYA 1G8JA 1SXGA 3UATA 1KBQA 2DMRA 3V5NA 1V25A 1DC6A 3KKOA 5EMNA 5K8TA 3FPHA 5D5PA 1V7CA 2XI4A 3PX3A 1FLNA 5D84A 2B3TA 5P21A 2C2XA 5FAXA 4IJMA 2QU7A 4ODIA 5EIFA 2DPHA 2P4SA 3GT0A 3EGWA 4MHOA 4Q4CA 2O59A 3KXDA 2LRHA 4TN1A 3FJ1A 3P4YA 4KDFA 2DTXA 1AHNA 4RH1A 4D9GA 4FI3C 4YCNA 4UFNA 1F60A 3PGXA 1OBVA 4JXKA 1GADO 1D2CA 2B21A 2OXFA 5ESRA 4RU1A 2ZWVA 3ETHA 3STVA 2FPIB 3QBJA 4R40A 3SKVA 4C3OB 3Q1LA 5T3YA 2XDQB 3JWIA 4MW2A 4D42A 5CDUA 3HKDA 3LG2A 4R9RA 4YJKA 4KE7A 4KDCA 5L6MB 2OXTA 2GBCA 2JLSA 2V7BA 5A0FA 1FF9A 2JLRA 5JWHA 3PYLA 4JL5A 5FNVA 4D8VA 1AD2A 3FAZA 3DWFA 2EARA 2AR7A 3LS2A 4EYQA 3BF8A 4R4JA 2IP4A 3PT9A 5LD2B 1GV0A 3Q15C 4UUOA 5HQJA 2EW2A 3O8QA 3RYCA 1XMOB 3EIHA 1K7CA 2DBZA 3LE8A 4PG7A 2ZZNA 1HRKA 1KS2A 4LJRA 2NXCA 3AR5A 1HMYA 4MJLA 3GG9A 1DRKA 1BS1A 2VEDA 4LTDA 2HAEA 2PKQP 5BQOA 3UWOA 4KO3S 4JC8A 3PX2A 2OWDA 3SC4A 5A3QA 3HXMA 2AH5A 1XXLA 3CNNA 4TZKA 1B6TA 3K0AA 5FRDA 2WWTA 3GZTB 3GRCA 4FWIB 1F2UA 1L7XA 1WCV1 4CF7A 4M4SA 1YS1X 3EXHC 2BGNA 3K16A 2J31A 2X8JA 1N2OA 3NOXA 3PC8A 4L6IA 4HTAA 1NPDA 3T5DA 3UJ9A 3DOIA 4BRZA 4XB6B 4HSEA 1GL6A 5AKGA 5BR7A 3SF0A 4ZJYA 2J0EA 4RFVA 3B3JA 1W5BA 2PVSA 3A11A 1E2MA 4NZNA 2VDOB 2G88A 4AY3A 4KN5A 2VJYA 3WHPA 1UT6A 2ORYA 3Q9UA 3L8MA 3R7LA 3JYQA 5FBHA 5EIEA 3T5MA 5KVAA 1NQTA 3DEAA 2C9DA 4ALIA 2R85A 3E3LA 5JARA 1KR2A 4CUZA 2W5UA 4DJDC 4E1BA 4KTTE 4OI1A 1PDVA 3IAM1 4LFCB 4WOKA 3U4QA 1ODIA 1HF3A 1Q14A 1XX6A 2PA3A 1Z88A 2YW2A 4JQYA 3BJEA 3A1WA 3UQZA 1QC5B 2PV7A 2ATIA 1QCCA 5EJ5A 4IUDS 4GNKA 2GN4A 1I13A 1RMYA 1M2EA 2GHRA 3AIKA 5BT9A 5A03A 1ZCBA 1OWNA 2VUTA 4WFKA 3EF3A 5HX7A 1S5PA 1NRXA 1T15A 3AHDA 3EVGA 1V43A 5FNVB 5JNWA 4P5EA 3QBTA 2ZSUA 4QHTA 3QKTA 4EGSA 4BLTA 5A3VA 1GQQA 1ONSA 4M2LA 1BVHA 2PXAA 2XA1A 4JQCA 3ABZA 1XU7A 3FGOA 4RW0A 2ZS7A 4B2IA 1UIMA 2GLTA 4G56A 2IOYA 5LPNA 3BZWA 2B2NA 4HMQA 5AMXA 3AU9A 1ZUHA 1CETA 4RE6A 4M1SA 2OD2A 4GRDA 3EGIA 1AZTA 4CG0A 3OG9A 5HKOA 1THZA 2NPFA 3GN1A 5M2QA 2HJSA 1U8ZA 3CRNA 1XLUA 1C0KA 3OZBA 3T7SA 1GSIA 1XHFA 5JALA 1CDDA 4C21A 1X7YB 4D5GA 3UANA 3GEIA 1FK8A 1H94A 1PS0A 3C4QA 5AM4A 4BNGA 1PR0A 2QD1A 3JX9A 4ISCA 4LJAA 3TOZA 1XCPA 2WAXA 1T8UA 1WDTA 4TXJA 3AVUA 1Z6PA 2X3UA 2V6IA 7REQA 2OYSA 3ZD8A 1BE8A 1DJMA 3E9DA 4WZAB 4CMEA 4PTLA 4IDGA 4WKOA 1UEIA 4CEJA 3A1VA 2DT8A 2PV0A 5DU2A 4JJ7A 1R8YA 4NLLA 5AW5A 2IUUA 3HRKA 4HUQB 5C3UA 3L7AA 4EMUA 4MVJE 3IMGA 3JALB 3ORHA 1FU4A 2BFOA 2P3QA 1QZXA 1YOVB 2YWRA 1DARA 3ABIA 3I0NA 1I2ZA 1E9SA 1HT0A 2XDAA 3MLEA 4UZFA 2UUOA 4GPIB 3C6XA 4G9BA 2B1RA 1B3BA 1JDPA 2NNWB 3IHLA 3C5VA 4KZPA 3ZE1B 1HLPA 4F1WA 3C8DA 1K88A 3GH1A 4ER7A 2EGGA 4HY3A 1KI6B 1Q7RA 1K98A 2CCKA 2XTMA 2B37A 3WMRA 1TZBA 1QIEA 4EG8A 1J9ZA 1JHZA 1NDUA 5A6VA 5IM4A 2F67A 3PDWA 2UU9B 1NW3A 5ICGA 2QTTA 5JISA 1NXQA 3DP7A 2VLIA 4P58A 3QSYA 3KQYA 1UJMA 4JU9A 4OQPA 4EKNB 2C00A 3O83A 4I66A 3BHMA 4DBLC 1QVVA 1X7YA 2DWQA 3K5PA 2PUVA 1KDZA 1VLJA 4N5DA 5DIZA 3BTSA 2UYYA 3O47A 9LDBA 5FAKA 2H29A 4M0UA 4EB8A 3R9WA 1JVSA 1NXOA 1QXSA 1R0WA 1WXXA 4N5LA 3LLSA 3RC1A 2W8ZA 5IYZA 1K6XA 1QKJA 4F6RB 3R24A 3B48A 2F1OA 1TZ2A 2ZRNA 1N9KA 1NBIA 4J90A 4PYNA 4X84A 4NCIA 5BW6B 4D44A 4D8WA 1KI4A 5SZHB 2A35A 3G9ZA 4C88A 1PJ3A 5L3QA 4NQZA 5CG1A 1XVAA 2IBTA 5KOHB 2ZR9A 4TRNA 4V2UA 3O2JA 4LOKA 2NUTA 3R8XA 1E7WA 2OBFA 1QGAA 3CLKA 2IZ1A 5AK4A 2PUDA 5H80A 1D07A 3BXFA 4DW8A 1YU6A 1VTKA 4QYWA 5KJ6A 1R4MA 4BO9A 5LXTA 5IG2A 4YP1A 4ZO6A 1DGQA 3E5NA 1HQCA 1TCAA 1K2VN 3SFVA 4WFQA 4BVLA 3CSDA 4IEFB 1VCMA 3NHLA 4M55A 4ZVRA 5TPZA 1CIJA 4MVJH 1Y4AE 3ZGYA 1N6IA 3A14A 1WEKA 2JDIA 2CVOA 2WPDD 1N2XA 2HSJA 3Q5EA 5DBEX 4ZMBA 1SQ0A 3COWA 1JPVA 2X9GA 3VYVA 3MTGA 3ZEAA 5JSZB 4P7BA 1UODA 1HGXA 2GXQA 5B64A 3IMFA 4R54A 1KFJB 1TM4E 4NCAA 1D04A 2W6QA 1E0DA 1YCFA 1SXIA 3DOFA 1T4GA 4KVAA 1N7JA 5AT1A 5DASA 1B8VA 4NEGA 4B3DA 2TSYB 1AX9A 1NUAA 4RK7A 4CQLA 2ES4A 1D6JA 5E6UA 2EL7A 4FE7A 4CEHB 2DG2A 1T5DX 2C4UA 1DIAA 2QLFA 2QAGC 4ZAFA 3JATB 2BSAA 4EA8A 1UQUA 3W7AA 3EULA 8ATCA 5KWSA 3AUKA 1GZUA 1SBHA 4H77A 4DANA 4EG1A 3NFRA 5HIIA 5LQJA 4ZYXA 1VKNA 3SGLA 4RMHA 5F2OA 3I0ZA 1A9TA 1BD4A 1YO6A 1EB9A 2VP5A 5BSKA 1U3FA 1I7QB 2WKRA 1T13A 2J5XA 4ZKDA 1JKXA 3LW8A 4Y2TA 1ZAYA 3BAZA 1OE0A 1ULUA 4YRJA 4CF3A 1BA3A 1FJGB 4UUMA 1J24A 3G9UA 3BDVA 1SVOA 1AV6A 4EKGA 1RYZA 2IYYA 1C7QA 3Q2KA 3AQ4A 3PJFA 3ZKWA 3UMRA 5K6TA 2WV7A 4WL0A 1YMUA 2WIAA 3H87A 4W5WA 3UV3A 4F9FA 4C2TA 1I80A 2I29A 2QVYX 1NW9B 1D4AA 4FYVA 2CEAA 1KYXA 4EHKA 3WLSA 3JASB 4U1RA 2G83A 1PL7A 2IYQA 2FW7A 4ZQEA 3RWOA 1KH2A 2SECE 1GIAA 3A36A 2B83A 2R8PA 2CV0A 5JW6A 3I32A 3T7TA 4WGFA 3CH4B 4OHWA 5EPEA 3TGPA 3T1YB 3O8OB 3LXRA 1YIDA 1U8FO 4D8YA 1NMXA 1NQWA 2JA2A 2O9JA 4E0BA 1OB5A 1Q1NA 2FFAA 3IAAA 4V0NA 5AJZA 1HYBA 5THQA 5JEDA 4IH9A 4DR3B 4EA9A 4Y0AA 1IPEA 4H7IA 1ZCFA 2IXDA 1N3YA 3AR3A 2HH9A 4PQRA 3G13A 1QF9A 1E5VA 5AUOB 5EJGA 4TV8B 4JBLA 3U16A 4FU0A 3VU9A 2C1ZA 2R68A 2RBEA 1MH1A 1Z16A 2GEBA 1P9WA 1G3QA 2RGWA 2C7PA 3EQ6A 1UOQA 2GSDA 3L7DA 5IDXA 3HU2A 1V8BA 3OX1A 5UKDA 2PLFA 3L92A 4GLFA 4V1CA 4JEUA 1CZUA 5F52A 1JHQA 2C95A 2PMCA 2XA2A 3VAYA 2DPXA 1VA5A 3PQ3A 5BUQA 3K94A 1A8UA 1Z2NX 4FFDA 1STOA 3NAZA 4ZAWA 4L27A 4GXTA 4WBNB 1O0BA 3N6XA 4HGNA 3R7NA 5JRJA 1UZMA 3P9XA 1IHOA 1XTZA 1D7AA 1E6LA 1HSZA 1VKZA 4FDMA 4Q37A 5J4KA 2ZB8A 1PT8A 3I9MA 4Z86A 2JEOA 2ZTHA 5TQ0A 1AZLA 3U4QB 1ZVJA 2IPMA 2W2TA 2DBRA 3LC0A 4F3RA 4XPZA 1V1RB 5CFZA 2O8EA 3WK5A 5HW0A 4HC4A 2P0AA 3TK1A 1QANA 1QZUA 1TCCA 4PHGA 4PQYA 2Y71A 3FNIA 5K8IA 1U1CA 4N41A 5HS4A 4ZOLF 2OAP1 3G0DA 4RLHA 1J8QA 3AKYA 5CNJA 1NM5C 2BBTA 2QY9A 4YR9A 3H5IA 4CFSA 5D5QA 5A5FA 2DUWA 2IE0A 3IEVA 1RPAA 4Z53A 3ECSA 1RWKA 4L9WA 5DX1A 5K6RA 3IE0A 5KQGA 4OB8A 3U80A 4DQKA 3FKSD 1FUIA 2WF8A 3WAGA 4GZLA 5TPWA 1XTJA 3F96A 3MLBA 4O08A 1QM5A 2OCIA 4XUGB 4U8GA 3TNFA 4DEXA 2XA9A 2Y1EA 2VPPA 3ESBA 1MP0A 1RJDA 3OTWA 2WFZA 5ABPA 1N78A 4UHBA 3ZE7A 1ZISA 3KKEA 4W6QA 4V03A 3MJHA 1DZ3A 2CXOA 2VRCA 4Z9BA 4ZZ1A 4LFAB 1Y3BE 2I6UA 4I19A 3GL9A 3OJ0A 5BR1A 5K6AC 4C07A 3DLCA 1EUYA 2G4VA 3EYWA 4CG3A 5BQ5A 5DJ5A 3G2MA 5E7MA 1U63A 4TOIA 1Y5NA 4L50A 2C9CA 2YVKA 2O7VA 1AS2A 4N7RA 2XOXA 1Q50A 1DV2A 1QC5A 4L1KA 1MFPA 3I1JA 3UH0A 2W4QA 4M1KA 4A9AA 1YQ9A 1F17A 5IVHA 1JFLA 5AW2A 1GNQA 1Z13A 3FMIA 3L1UA 3OFSA 3GPBA 3CR7A 1X1TA 2W4MA 3LY5A 2LCFA 3EIXA 3QKWA 3WB1A 5FH9A 4RV5A 4YLGA 2RGNC 4CIBA 1PFQA 4H3HB 3PEYA 4C06A 1XWWA 4NNOA 3I3OA 4RTKA 10MHA 1G5IA 1PJAA 1QHHA 2QN1A 4LYFA 1SC4A 3KTDA 4EZIA 1DX4A 2CHEA 3AV0B 5AI8A 3KNZA 4NJEA 1U2DC 3THOA 1DIGA 2ZJFA 3QLVC 1F0PA 1JQEA 2RGEA 1LA2A 2QI9C 4UBJA 4ZQCB 5FBLB 1RVDA 2JHFA 2OYRA 3KKPA 5K8LA 5WRFA 1USWA 3BE8A 2VZ0A 3PFGA 1VBKA 1K7EB 5D1HA 1TC1A 2OZEA 4PR0A 2VRBA 5G3ZA 1BYIA 4QYTA 4ZVQA 4AYWA 3VNRA 2VCHA 1JH9A 3DD5A 4G2TA 1P75A 1JBQA 2A0YA 1XTRA 2LPMA 3WBBA 1Z5OA 3T1TA 1ZYUA 3RAFC 5M04A 4K0KB 3PICA 2E55A 4CMEC 3M70A 2XTAA 4KQHA 3OJOA 2AR9A 2HV9A 2RHTA 3DZFA 4JKYA 3R9IA 3OPXA 2AE1A 1SBZA 5LUBA 1Z68A 1ZRSA 3BULA 5EWMB 5BV0A 3THWA 2I6TA 3JQ6A 5I7HA 2RGXA 1XZDA 2HSZA 3WGHA 3C1UA 1Z5NA 4W63A 4WOBA 2JJ2A 5C18A 2CVPA 2OILA 4ZVUA 4EGCB 4ES6A 1N77A 4CR7A 2CHUA 4CXMA 4GYJA 5LFAA 1N9GB 2E85A 4ESVA 4RXTA 4MKRA 4XXHA 2BH9A 4AJPA 3VBCA 1WJGA 4YA6A 1Z2EA 5FPYA 3UB3A 4EENA 3AUAA 1NG9A 3L7NA 1WXDA 4MYCA 2PKYX 3AFGA 3FNHA 4GGOA 3PEWA 3E5RA 3ADCA 2A14A 3KQUA 2ECOA 2FMUA 4LCBA 3GLGE 4H6VA 5L6LB 3A2MA 3VR4A 2AOVA 3HJGA 3QEAZ 3GGPA 3CURA 1GSOA 1SC6A 3I28A 1NSFA 4N03A 2FN9A 3DL0A 1P4RA 2CDBA 1YQGA 4BHTA 1YRHA 2H2GA 2WOJA 1CRZA 4IXDA 1C0LA 3SKYA 3DE2X 1N2CB 2XUDA 3GUHA 2EGUA 5DHQA 1UJBA 1Q7EA 1L6RA 1UZAA 3HC7A 3S40A 4YH1A 1M2OA 5JVDF 4ZOLA 1G60A 2ONCA 4LYDA 3C7CB 5DN6D 2FEPA 4B32A 2ODEA 4DLPA 4X71A 2YJ4A 3F2IA 4UNPA 2FP3A 4ECAA 2JJ2D 1SCNE 2Q4OA 3D81A 1PGNA 4FGLA 4PLYA 4Z8YA 4W9NC 3X1KA 2R1TB 5LZ4A 1YQQA 2ZBVA 5KKCA 1ODKA 4LDPA 4LHYA 4JJ6A 1KU6A 1OH5A 1C5KA 5SYAA 1MZVA 2UUPA 2BMWA 3SC3A 3UA3A 4DRZA 4P4LA 2E5WA 5DDIP 3KKQA 2ZXEA 2BMFA 3CR8A 2QW1A 5LLSA 1PVVA 3OJWA 3OZCA 1XGKA 3ITKA 1G8YA 1BCSA 3OCUA 3EF0A 1BRTA 4AZ0A 3NVKI 4EMBA 2O4CA 5BP7A 3GC6A 4MS1A 2DY0A 3NDRA 3TRDA 3UYLA 3TW8B 1ST3A 4UD6A 7ADHA 8MHTA 3UGKA 2H1WA 3HJHA 3HR4A 3OOJA 1N9GA 4FILA 4IJ5A 2WPNA 1EK1A 4Q93A 4UAGA 3S29A 5GM2A 5BV2P 4RACA 5JXWA 1E1NA 1FLVA 3OZIA 1DJNA 3KAKA 4G1MB 3FXAA 4JBGA 2ZSIA 2I3BA 2WG0A 2QVGA 3QTLA 3THWB 4KPGA 3T9DA 2GPSA 3B6KA 5BN3B 1O5TA 3TW6A 2PA0A 3BAFA 3MB5A 1UPXA 5GIPE 3BRWA 1JF8A 4H0NA 1G291 3T3MB 3D7MA 4CKBB 1MV5A 4N4AA 3NM4A 1CPYA 2Y0CA 5I7SA 4JC4A 5M7EA 2AB0A 3V3TA 2CLEB 1PUXA 5GAJA 2VQDA 2WW8A 4IM7A 3RUFA 3TM5A 2C07A 1A04A 2Y76A 3WKEA 4YRDA 1DTSA 1WB9A 3CE9A 1AKYA 1THMA 3LRPA 4KQMA 4RVDA 2NZUG 2NSLA 3L1VA 4DR5B 4EFMA 5JXHA 3C5WP 3G2QA 5L4NA 1J1UA 3C5HA 3PC4A 2ZE7A 4D6YA 4DDKA 4D4IA 3CT6A 3VRHA 3OLQA 4TYYA 2B1GA 2AOUA 2OFWA 4ZT2A 4X7RA 5G40A 5AVUA 2B69A 4HH0A 2ZSBA 3DSRA 2OCPA 4AWBA 4WIAA 5AKXA 3K0EA 3A9VA 1YDWA 1P74A 3TI7A 4LF6B 1YB2A 5FBKA 3S2SA 3IQEA 3DL7A 4IVQA 3TW0A 1E9BA 3LV8A 5BWCA 5I7VA 1L4FA 1XMIA 1X8XA 2W42A 3TJMA 5HKAA 1V9CA 2I67A 3B12A 3O7MA 1D6NA 3NP7A 3GPDG 6Q21A 2ZPUA 3OLXA 2IZ7A 5E6RB 3VX4A 5JRZA 1XZAA 4AJ4A 5LYJB 4HVAA 3EVAA 1NPYA 3LY8A 3QKSB 4BQFA 3DS8A 5BQXA 3NHPA 2QXYA 3K9BA 1I4OA 1KI9A 1WDWB 3AP1A 3GA5A 4N3BA 1FY2A 4BNZA 2OAQ1 5BV1A 1TO2E 4LRQA 4XJTA 4WNYA 3BE6A 5JVDB 1B26A 4JVOA 5HVNA 4H4DA 3RYTC 3HCNA 1ZCAA 3D2BA 1ZL2A 4BIMA 4ZAXA 2D06A 1M54A 1ZM9A 2UVPB 4MR7A 1EP1B 1V3TA 5JD6A 2JIDA 2YZNA 1C50A 3PT5A 3RD5A 4BVAA 3KQVA 4GKBA 1AKUA 4RENA 1Y80A 1JDUA 3IJPA 1EZ1A 1G64A 2C98A 3IAEA 2CFOA 4CTKA 2BDTA 3INYA 2WAAA 5FYQA 1SZPA 1O4VA 1EFKA 3DR5A 3WOHA 2PYZA 3PD0A 3ZHOA 1C9MA 4Q9AA 5CP8A 2EG9A 2MIIA 3AHGA 4IAOA 4PZ0A 4W8HA 2J9ZB 5DGXA 5FB3A 3IQHX 1BN7A 4DV1B 2DTDA 4R68A 2CNWA 2JJMA 2IPNA 4OUDA 3CVJA 1U98A 4Q16A 1N7IA 2PWPA 3RYFA 3TDKA 2FCRA 2LUOA 1H85A 2W8BA 5AW0A 5L7TA 3ZHVA 5A02A 3CA8A 1TYEB 5DSXA 2RJNA 2R97A 3L5KA 3M6LA 4K87A 4L0QA 3RRFA 4BO8A 4ESHA 5BMVA 3HCWA 3WWZA 1C3VA 3RTAA 1KO5A 1AKVA 3I01M 4LX0A 2X1MA 1UMCA 2AYYA 4QYMA 2XNCA 4DPMA 2A9JA 1YMVA 2A6PA 4CMAA 4W9MC 4JLNA 4DNXA 3AF3A 2XJ9A 4F2GA 4D3ZA 3PHCA 3KJIA 2VPIA 2J3KA 2D7JA 1U0OC 2WF7A 3HY3A 3KPUA 3CO5A 3LQ4A 4W9RA 1N32B 1P33A 5HE9A 1QX3A 3ZHXA 1E2BA 1I4LD 3DQQA 1F6WA 1QV9A 1YB1A 1R5NA 1P6XA 4K86A 2IITA 1GVHA 5MF6A 1O96A 3AEZA 2CBGA 3ER6A 4KR7A 2WNIA 4DBZA 3ZYZA 3GLFB 1E0SA 2HJWA 4RABA 3LXUX 1WCIB 1IJFA 3EEBA 4HPJB 3A32A 4CT4B 1K08A 4CM4A 4KUEA 4HZUA 3K72B 4PONA 4FQ7A 3N0TA 2P4UA 3SHOA 3AI1A 3RSGA 1UM9B 1EJBA 3BXXA 1MX9A 3HKBA 2FX5A 1G7SA 1W2HA 1YS4A 5EQJB 3ZXYA 1GR1A 2EQAA 1P1FA 1HG1A 4PC1A 3H5AA 1ISSA 5ER6A 4G5FA 3SVTA 3LLCA 2GH1A 4FX5A 5F33A 3VJKA 1OGYA 5DHFA 4D0RA 4UVDA 5T6BA 4MW5A 2L19A 3ICQB 4JYZA 1ORIA 3RLIA 4JLDA 4S2UA 1U6KA 4JP3A 1XZBA 4UQPA 2PL5A 5CH3A 2R8OA 5TE9A 4CM6A 1G3UA 2XMQA 4J7CA 4I5IA 3KB8A 1I2CA 5CB4A 3R5FA 1NXTA 1E0KA 1W47A 1Z73A 2E5FA 3QUSA 2O48X 3WDKA 3PL1A 5DNYB 1EWVA 4NBWA 4L3WA 5KQMA 1L7NA 3AHCA 2BTQA 4TQGA 1X7GA 4XX0B 3MCWA 4OHFA 1ZD3A 2QN7A 3RKRA 3ZVLA 4BQSA 2NUPA 5JWRA 4OXKA 3T52A 5L53A 3G7NA 2X7XA 3TLXA 1G6Q1 4IGKA 2P6RA 3P0IA 1C0IA 5FEMA 1KORA 3OQNA 3V4RA 2W83A 1TPZA 3B3QA 1G4UR 1VI2A 3WGTA 1J0BA 3KR9A 2BFDB 3LPLA 4GM0A 2EGHA 4FYHA 3T4PA 3EXFB 3NBYC 2GUWA 3QY0A 4BX8A 3RJ5A 4Q9DA 1QP7A 1OU4A 1QFSA 4MEJA 1FNCA 3MG9A 1KP9A 2CV2A 1VPLA 4E2XA 4Q1EA 4TTSA 4CQNA 5LKAA 4H0CA 1OI7A 4DUPA 3B1JA 2BEWB 1WZIA 4GGMX 3MPUA 2YHAA 5CPBA 2A0WA 2VCYA 5T4BA 3T61A 3N07A 3FUUA 3SIPA 4LF7B 3FTDA 1HDOA 3L0DA 3OF2A 4M49A 1CQIA 4AURA 5FL7D 3LT4A 2L2QA 5CFMA 3IMKA 4EMTA 5DNAA 1XPUA 2P30A 2RC6A 5FULA 4C87A 4LNUB 4F72A 2VR1A 3STWA 5JH7F 3EPLA 1SXJC 2QG9A 3FVWA 1X94A 3R5SA 1Z8DA 1ENZA 2GMWA 3K0CA 5EKXA 2DQ4A 4IHKA 1DADA 4TRJA 2DKNA 3ZY5A 3QG5A 2RE8A 1IM8A 2J7KA 2REQB 3FX2A 3QF4B 1I6WA 1QSGA 1QHXA 1M6VA 2TYSB 1QWOA 3QQPA 2DR3A 1CSEE 3WGYA 3EH1A 3D43A 3B9QA 3VDXA 3WQRA 4XFJA 1S9HA 1U7TA 1GZ6A 1DP4A 2NU9A 3KQTA 3MWLA 4BN0A 4RA9B 3K32A 3ZY4A 5KQLA 4E4YA 2WYIA 1J8FA 1YKGA 4UTNA 4YP0A 5F98A 2FQYA 3OJFA 1E4OA 1MG0A 1XPOA 2LDBA 4MQUA 4E14A 5AI0A 1OCEA 1VB5A 3T95A 4ZICA 3F9CA 4RULA 1VQ1A 3T12A 1M5TA 4J1NA 3LTNC 2H7XA 2V9CA 4XEUA 1KNQA 4EO7A 3A4MA 3CNEA 2OHXA 4ARUA 5K3CA 3R6LA 3HBFA 5K2MA 3K53A 1K8QA 3BWEA 4LYAA 1ORDA 4DMFA 4QU8A 2I6GA 1SQGA 1TJ3A 3GLGA 1WTCA 1L5OA 1XI2A 3HYLA 4DM7A 3IP7A 4A2CA 1UDWA 3GNSA 3UA4A 4CG1A 1PP4A 3LVRE 4I9FA 1EUDA 4II2A 1M2NA 2QLNA 3L0PA 3VKUA 4UTVA 2GLXA 3H4VA 3CRRA 3QUTA 3LDHA 4BV8A 2HT6A 2VK2A 1BVRA 5AOCA 2R65A 1D2AA 2VYFA 4KRFA 4PPNA 3R4CA 4LHWA 3HCOA 1SHLA 4KN9S 4LXHA 3QLUA 2BMAA 2UVDA 1M1NA 1HK7A 1TE2A 1CUCA 4CMIA 4Z4QA 1EWTA 4GO1A 3UN1A 2ZYVX 3TEMA 5IWCA 2O19A 2YMLA 2AJLI 3KOZA 2WZBA 2Q29A 3QFTA 4IS2A 3A1NA 4RO0A 3C3YA 3VR4H 2EZ4A 3A70A 2QBYA 2OK8A 3GRRA 2QUAA 4CR6A 1T9GR 1VJ1A 2FYTA 1SUSA 1XLTC 2BHTA 3JQFC 2C5HA 4FKMA 1QGYA 5D3QA 4UJ3A 3P9IA 1KI3A 1R00A 4OHBA 2O05A 3WFJA 1GAWA 3FA2A 2QQGA 2F2TA 4B6FA 1JJ7A 1L3CA 3A6HA 3RRZA 4I1VA 1MC4A 1CEEA 1KJ9A 3G7SA 1DAEA 3B20A 3FG9A 3H3XA 5CDGA 3A1SA 3P9QA 4RVSA 4A8HA 4BNYA 4B85A 4IIYA 4TSKA 3RVMA 1CY2A 5JJLA 1TUGA 3CNHA 3NOOA 1L5QA 3QU5A 1U5AA 1OX5A 3RM3A 2IIVA 5C4MA 2OZKA 3N0RA 2CFRA 2H59A 5KSOA 4LVCA 4QQKA 4U7JA 4WXEA 5DCYA 3E9RA 4HH1A 4A3SA 4C4RA 3O8BA 2OV4A 1ZZGA 3PC8C 4JP1A 3UJ7A 1KEPA 2YV1A 1E63A 5A4KA 2NU9B 3UWMA 4GZMA 1R12A 2M98A 3TD6A 1IZ8A 1TI7A 2FOXA 1RCFA 2GTPA 2O2YA 1PL6A 1XCMA 3AV3A 3EC7A 5F5LA 4L9AA 4BO7A 4NX2A 3TR0A 4UTPA 3Q41A 1WVGA 2OV2A 2VZ9A 5AK5A 5IJ9A 1M6YA 1VGVA 3N0XA 1ZIOA 2N42A 5C37A 4FC6A 3GJ0A 2I54A 4LGCA 3DBHB 1MD9A 4W99A 4HVLA 1RZRA 4BMCA 1T2AA 2H5IA 2P75A 3TZLA 3P2JA 3SF8A 3NVDA 1Z22A 2Q4EA 8GPBA 3PRYA 3AUXA 4QXMA 3WS7A 2XB4A 3MT8A 4PO1A 1T4CB 3VYTB 2C5BA 1JAHA 2K7ZA 3VU8A 2FSPA 2NVBA 3RC3A 4FFBB 5CW1A 2J87A 3GLHE 3S27A 2FPOA 3H42B 2EZTA 4K6CA 4O3FA 1SKYE 2W6IA 4P1ZA 1V5FA 4G41A 3ZE9A 2GN2A 1ONBA 4B3BA 5JNTA 4PGAA 1JHOA 1RYHA 4FGJA 1PKXA 1KJYA 4MAMA 4CIYA 1L4LA 4DB2A 3ICCA 4JBYA 1MQ9A 4W5JA 4X62B 1QU2A 3GF4A 3DFUA 4N47A 1GUAA 1D0IA 3C4JA 2PUAA 1K5HA 3FSGA 3QRWA 4ZYLA 1GFSA 3O3CA 4J6EA 1LC0A 3AJDA 3CX4A 1LI5A 4EG5A 1US8B 5ALDA 1N36B 2RKWA 3H7AA 4BO5A 4HO1X 4JVLA 4DYVA 4HFMA 5JHHB 3OTQA 2UDPA 3AFMA 2G9UA 4RIFA 4UBMA 3PRKE 3GRUA 3DBRB 4X90A 5D01A 5C4GB 2IXGA 3GNLA 4QDOA 2NN3C 3KLBA 1COZA 1FTGA 3HGMA 2ZWMA 1NBMD 2PZBA 4Q4HB 1HL7A 2YFHA 1DAHA 3L0SA 4OHZA 5JXGA 4ENTA 3R20A 3DNFA 1SD5A 1MB3A 1RXYA 2PFGA 1E98A 2L17A 2GM9A 2PFKA 3N7TA 4RVCA 4WZZA 2UVPA 4MR7B 1OW3B 1Y7PA 2IYEA 2A9QA 2HHAA 4K81B 2C2BA 2RK3A 2QXTA 4TV9B 1XHLA 3OQHA 2IXEA 3VAAA 3AHEA 1AJEA 2D2XA 4WQMA 1YJQA 4B74A 4RA9A 2AOXA 1F12A 4XZ3A 4HB3A 2OV3A 1HA3A 4WK0B 3UAXA 5ICSA 5IRCD 1QRAA 1AO3A 4TWAA 4GRIA 3CUWA 1OXXK 2JLQA 3KB6A 4NHOA 4X3CA 3G8DA 2YHIA 2Q3EA 3FRIA 4Q1VA 1CJSA 4MQ6A 5J1TB 3TL3A 2ZBGA 1K66A 1JSLA 3G88A 3AIIA 1W96A 5KINB 4C6RA 1KU0A 2JGJA 4KMSA 4BDTA 4Z4HA 3FF1A 3GG2A 4AS3A 4N3GA 3KQNA 3ZR4B 2IQIA 3JTEA 4WECA 2WJPA 1UBMS 5FFMA 5LQRA 3SZUA 1C8LA 1EEHA 2PL9A 1EK0A 1QWSA 2X2OA 4OJNA 1WY7A 4P4NA 3FI0A 4BFXA 1DAKA 4E7OA 2IHZA 1HZJA 4RANA 4AY2A 4MICA 1DMRA 1F4VA 2OE2A 2LZ0A 5DBFA 4EKYA 3SJCA 9MHTA 2BUCA 3DPIA 4KWEA 1TXGA 4BYGA 1A9XA 2XV1A 1DFGA 1RKXA 1NT4A 3A9RA 4EHAA 1UDCA 3GRVA 1RJWA 2KM1A 1ISPA 4QNMA 1GPDG 1JU9A 1UBOS 2A9PA 4RSRA 4FOSA 3LT1A 3U5TA 2ODNA 2ZB2A 3ML1A 3RSQA 4ETMA 1U5BB 1UXOA 3C97A 3IYLW 3CW9A 2DCUA 4ZVLA 1SG9A 2PMWB 2VQSA 4OXXA 1BHSA 2PAFA 2GYWA 4N48A 4L8YA 4A73A 4CKEA 1GA1A 1BX3A 3TKAA 4ZPXA 4PWZA 3K5WA 3HB5X 5EWLA 1FSGA 3SX2A 1U0JA 2KW5A 4MV0A 4S1OA 2Q6IA 1UBCA 3WYAA 4QLOA 4CM5A 5JDCA 1J9EA 3WYFA 2H9IA 1JEJA 4CT5A 1RPJA 1U3DA 5I7AA 3RS5A 4CCAA 1XJ0A 2CY0A 4MGEA 3ZLBA 4R1TA 2VC2B 3BIOA 3CT4A 3ZUGA 2ZWPA 1CJCA 5C80A 1NGSA 3SMQA 1NY5A 4UHEA 4D5EA 2N9UA 3BIJA 2V5UA 4EF6A 4F12A 1UC8A 5CNKA 4AD8A 4ZI2A 1M0EA 1KVSA 3VYSB 2WG1A 4CQMB 1II8A 1W34A 3WDSA 1FX0A 5HJ5A 3AF6A 5BORA 2G3YA 2JZCA 5MDHA 1V5GA 3F7NA 1EJ0A 1PGQA 3ELBA 3QBEA 4QLBA 5HIKA 4KGXA