3PGA1

Structural characterization of pseudomonas 7a glutaminase-asparaginase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
330
structure length
310
Chain Sequence
b'KLANVVILATGGGVDKLIAGVPELADLANVRGEQVMQIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLDLTLNTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKSAWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQISSLPQVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRLTPALQTLRKTGTQIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPEKARILVELAMVKTQDSKELQRIFWEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMINASE-ASPARAGINASE
molecule tags Bacterial amidohydrolase
source organism Pseudomonas sp. 7a
publication title Structural characterization of Pseudomonas 7A glutaminase-asparaginase.
pubmed doi rcsb
total genus 110
structure length 310
sequence length 330
chains with identical sequence 2, 3, 4
ec nomenclature ec 3.5.1.38: Glutamin-(asparagin-)ase.
pdb deposition date 1994-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00710 Asparaginase Asparaginase, N-terminal
1 PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3pga102
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 3pga101
4RA6A 1ZCFA 4RA6B 2GVNA 4ECAA 1AGXA 2HIMA 3PGA1 4PGAA 5I4BA 5K45A 1HFWA 2D6FA 5DNCA 1JSRA 2JK0A 3NXKA 1O7JA 1JAZA 5CBPA 1IHDA 4RA9A 4R8LA 2WLTA 4R8KA 3ECAA 2OCDA 1NNSA 2P2NA 5K3OA 2WT4A 1DJPA 1HG1A 1ZQ1A 1HO3A 1WLSA 2P2DA 1HFJA 1HFKA 5DNEA 4RA9B 5I48A 5K4GA 2HLNA 1JJAA 5F52A 1WSAA 4NJEA 5K4HA 3NTXA 5CBPB 5HW0A 1HG0A 1DJOA 5I3ZA 5DNDA 4NJEB 1JSLA 4Q0MA 1WNFA
chains in the Genus database with same CATH superfamily
1WZUA 1A5SB 1DOHA 1DQPA 3KKKA 1YVEI 4J1TA 2AR7A 4I55F 1TAQA 4WN9B 3RC2A 1X86B 4CCYA 3JR3A 2OORC 4DMUB 1PJRA 4IUCS 5DLEA 2HRQA 1ODFA 1TYBE 2CC2A 4JBNA 5J58A 2APJA 2Z4RA 4EABA 4XB2A 4DNFA 1KEEB 4HBZA 4XLZA 3S5JA 3ZJ5A 3TI9A 2ZB7A 2ONCA 4P5PA 4L22A 3GPIA 3VC2A 1NNLA 3GAZA 4E03A 2AOTB 4LC1A 4WUVA 4Y2UA 2ZVDA 1SVIA 1L4NA 1UZAA 4NH0A 4Q7LA 3G0IA 1Z34A 4BNDA 2H3HA 3S2YA 8GPBA 1OH6A 2XE8A 4H6XA 5JISA 3EH1A 5TS2A 2WD8A 4HXEB 2BJWA 2AZTA 2B36A 2NZXA 1VBMA 3CNNA 4H0NA 4UARA 1ZM2A 2ODPA 4DBVO 1MQSA 2XNSA 3UJAA 2PH1A 4ERXA 4G41A 3RS8A 3KXDA 4CTOA 1Y8QB 3USZA 2ZXFA 1USUA 4TL6A 1KVSA 3SJAA 4NIMA 3WMEA 2QNRA 4Y8VA 4C14A 3DMYA 2FK7A 1HDCA 4JXZA 2FETA 3BCSA 1JDSA 4MW0A 2DAPA 1NJSA 1RQ7A 5K01A 1Q57A 2FLKA 3G2JA 3R4VA 1YE5A 3TIGA 4F4IA 1W44A 3P0FA 3N05A 4M7OA 4MYDA 5LIRA 2IELA 1WXQA 2YY6A 3GLHA 1E7WA 1E4YA 4JJIA 3OZGA 3I62A 1UKZA 4KX3A 1RM5A 5M3BA 2QKYA 3R7DA 5AI4A 3DT6A 3JWJA 4JGGA 4FQ5A 4P4NA 4AMBA 5JSQA 4DV7B 4UD2A 3TM5A 1SN7A 3KE9A 5IC4A 4UTOA 5DB4A 5JAIA 2XVMA 1LBQA 3K05A 1ORDA 4ZVKA 3HNPA 3EGDB 1BA2A 2JRCA 6AT1A 4JASB 3R76A 4IDEA 4CFYA 2JJ2D 5B7PA 5LQJA 3UPTA 2Y0PA 3K1JA 2WWTA 4QQRA 4AZVA 3BM5A 2WSMA 3PB3A 4LA4A 3HDYA 2ZBVA 3T9CA 4MMXB 5LP6A 1A71A 1L1EA 2Y3IA 3HLKA 4D0NA 4QNRA 4OYRA 4LXIA 1KDOA 4C4YA 1PSDA 2SKEA 3GLHE 2ZYHA 1XZHA 3OSZA 4GP7A 2TMDA 4ZYUA 3ZVKA 4NZNA 1QR2A 1CHDA 1FMJA 5F1YA 2QW1A 3D6HA 3WYGA 1HNZB 4F4HA 3GPCA 1YKGA 1BHJA 4S0XA 1Y0BA 3LTEA 1UP7A 1Z4QA 2QUHA 2ZSEA 3BUSA 2B4KA 3H9BA 3PXEA 4LN1A 4L2IB 2OQVA 2BMFA 3A9SA 1IVNA 5KYNA 1HMPA 2O5RA 5AP9A 1X74A 3AHHA 4N4AA 1RP7A 1Y3BE 5DX0A 4B3IA 4OP1A 1KAEA 1T0UA 2AEFA 1AKYA 3FPGA 2FEWB 3H4IA 3MRVA 4H6WA 5IXSA 1C3JA 1IQ0A 1D3AA 4LJSA 4POOA 2BBTA 1EK5A 2CNLA 1KFKB 1M33A 3EHDA 1D2AA 3HN7A 2J3MA 1BVYF 1Y4UA 2OZVA 5JNVA 5KNCD 1PS8A 4J7CA 5BSRA 3ZY5A 4Q1EA 5E6RB 4F4UA 1XZJA 2YVAA 2QIOA 2FRVA 3QOYA 2AV6A 4GQIA 3R8XA 2DPHA 2BZ0A 1Z6YA 3C43A 2LPMA 1EU1A 4E2XA 1J1UA 1RW4A 1IONA 3ONDA 1VKRA 2KS6A 4KJZA 1UXJA 5LZ7A 4K0KB 4N5MA 2VO1A 3IMGA 4NBKA 3PD1A 2KX7A 4NH4A 2MMGA 3C45A 4HDQB 1VL0A 1DKQA 1ODJA 3SBDA 3KR0A 2NO7A 5KSPA 3O21A 3SNHA 4E3WA 1ZD9A 3ADOA 1E96A 3OKPA 4CEHA 1TU0A 4O2AF 2C94A 4XH9B 2H2IA 3H6HA 3EG9B 4I4LA 3GJ0A 1NM5A 1W76A 1FFXA 1QIGA 1Z0FA 2P4HX 3DULA 3ETCA 4M9RA 3HC7A 1M3SA 2SICE 2R68A 1CZOA 2OM6A 1P7VA 2ZK7A 1XRLA 3OE7A 4PQGA 5EXTA 2Q9UA 3ACCA 3Q6NA 4ZXPA 3SJ7A 1VCOA 4K6KA 3NX4A 2WJJA 5C1BA 3DTNA 5HILA 1ZBQA 4OTZA 2JFGA 5TPZA 3BG5A 4HNTA 2QPLA 4YRSA 7MHTA 4BC1A 2GPAA 2E48A 1M2VA 1X1QA 3HB1A 4S3MA 1U63A 4DQXA 3FJYA 4R1NA 4PINA 4WXMA 2QORA 3F7NA 2GYUA 3FDFA 3C15C 3PRHA 4G5HA 4Y1GA 4BQQA 2ODAA 1HSOA 5AVYA 1SXIA 5L7WA 1KO7A 1X15A 2DLDA 1N2CA 1YDMA 3HRKA 4UU1A 1PQ4A 4DJAA 4HKTA 1GCUA 2I6UA 1T6YA 2NSHA 5CFOA 3HJFA 3OMWA 1VIVA 2O52A 5TF4A 3AY7A 4RTRA 3S1SA 2Q1WA 1XSEA 1D8AA 1MQAA 4M99A 4XGNA 1JJ7A 2E9SA 5DI3A 1HEIA 3TMAA 3WLKX 3ZUGA 4F21A 4XGQA 5A2QA 3RU9A 2F1JA 4OEHA 1DZIA 4GSLA 4G2NA 2X2OA 3N2LA 3OPMA 2GFQA 2PL3A 1LI5A 1NXPA 3P2OA 5L95A 1SBQA 3GLQA 3OQHA 4JKOA 5ELMA 1PS9A 1XVLA 3B2QA 5G0SA 4QAJA 3TKLA 1TRKA 3KV1A 1G2OA 4GWGA 4DL9A 1I8TA 4KFSA 2BLLA 3DMDA 2W6ID 3O9MA 4PIPA 2Q2NA 1Z4LA 2PQ2A 3L4SO 5BVHB 5LXTA 1MJ5A 2ZQYA 3ZY2A 1KFBB 4P81A 3EVGA 3AUUA 4OLHA 1CB7A 3KQSA 3LHDA 3QNMA 1G1AA 1MJNA 1QHIA 1R6AA 1BOFA 1GNVA 1NHWA 1XP8A 3GHYA 3HU1A 1OWMA 2R11A 3IT1A 2PS0A 2Z9CA 3EWSA 2I1WA 5FPYA 3I2IA 4RSRA 4C04A 1RQRA 4Q48A 4BJ3A 1GKIA 1MAHA 4F38A 1B8VA 3KQPA 1XU7A 2R4UA 3LP8A 1DBIA 4OQFA 1CEXA 4UXIA 4ZI5A 3S70A 3OQMA 2GZMA 3V5NA 3M6IA 5DW3A 2WDPA 3V1UA 1JS1X 5JXIA 2XD4A 2GZ3A 1T13A 2IZ6A 3BMOB 3RAFC 3RVDA 2IEAA 2V7XA 3VDRA 5I7RA 2I2BA 1TEXA 2C8LA 3GFRA 3DBOB 2E55A 3F5SA 4YMHA 4F86A 2Z8YA 1TNDA 5AOAA 5FL3A 2BM8A 1YHYA 1FOEB 4N48A 5ADUS 1I4LD 4MSUA 2AX3A 3V8QA 4O5AA 4WLOA 1E3DA 2E5FA 3ACDA 3GT7A 3Q2KA 1ZRNA 4MKGA 4DCTA 3H5OA 4HPWA 3QJGA 1P19A 5C4IA 2CDNA 2Q3MA 2X8JA 3O4RA 2JHGA 4KQWA 4TLCA 3LZCA 5F2OA 5KC9A 4DV5B 4ME6A 1UBHS 1NNEA 2ZBGA 4GOMD 2XADA 4QSMA 5LYYA 3L6BA 2O59A 1XYGA 3L0IB 4B48A 1OE0A 1E8MA 1O8BA 4K6GA 1OAKA 4CYMA 2XTMA 5HK8A 2ZU0C 4CMCA 2CB0A 3LKZA 1WUHS 2Q1SA 3PXCX 4R0VA 4IDPA 4W1RA 1BOOA 2IYZA 2AFHA 2OXRA 3UB3A 1U6IA 3ZGLA 3A8TA 5KI6A 3UMCA 1OAOA 1R4MA 2GBFA 4P5EA 5TJHA 1N2OA 2FMXA 3KC2A 4NU0A 2XD9A 1VRCA 1H1LB 2GPTA 2GUWA 3UJ7A 1RACA 2R62A 3SK0A 2JLAA 3RBZA 2ZRQA 4JENA 4L85A 4ZRMA 3JY6A 2AG0A 3SE0A 1JYEA 1NBAA 2I3AA 4D3DA 1T9GR 2OBMA 5JJKA 4Q4CA 3T1VA 3KUXA 4B46A 2A86A 1ZK2A 1OLXA 4XFDA 2IV7A 2YWFA 4DMMA 3JZAA 1JP7A 4P7JA 5BR8B 4XUCA 5G2OA 4KRFA 4D9KA 3KEGA 1EZZA 1G20A 3R0ZA 3UW3A 4A16A 2XJ9A 2QTVB 1KDYA 3LDGA 1U1DA 1AMNA 2IHVA 2H1RA 2Y0EA 1PU2A 1U2DC 4PFSA 1SU7A 1R4ZA 2OAQ1 3K09C 1KI8A 2D0IA 1QV7A 2P6MA 2IEYA 4OGKA 4OKIA 3MWFA 2AQKA 3UB4A 1UXKA 1W8DA 3U3XA 4HNVA 3JQAA 1NJ1A 4DY6A 3VV2A 3DDHA 1L3IA 2V4ZA 1W48A 2XITA 3EVDA 4MEBA 4WLVA 2GN9A 2GF2A 3QRWA 1IU9A 3VOAA 5F4BA 4DMFA 4J3NA 1RQLA 1XEXB 1FS6A 2CBZA 3CRNA 3HRIA 4JZKA 4WLFA 1JFFB 3RANA 3EXFB 4HB2A 1V4BA 1VYUA 3PE3A 2FMKA 4G2TA 1DDGA 3NGLA 5A71A 4DTCA 1VGRA 1SIWA 4P3YA 1S4QA 3H2HA 4RZSA 1EE1A 2HPVA 2A0XA 3CR8A 3ONNA 4JBLA 4DC1A 5FV7A 4EZEA 3EXFA 4LF6B 1JR2A 1RC1A 3DFUA 3SYKA 3KFXA 1YI8A 3UGJA 5IX8A 4O4LA 2QZJA 2NYRA 3A1EA 4RF5A 3EZ2A 1W4BA 2R85A 4CT5A 3WHLA 1UWVA 2FEXA 3I9NA 1IM2A 3JQAB 5TV2A 5FUMA 4CIYA 3AFMA 4N3GA 2ODWA 1DC3A 1ZSYA 3HUFA 1ZBDA 2JJ1A 1YA8A 2QJTA 4EI2A 5IG2A 2H1SA 4ENWA 1IAVA 4FQ7A 5T64A 4OX9B 3GT0A 1FVXA 3NTOA 5EFOA 5DGTA 3DAOA 5G41A 5ICFA 3LW7A 1ES9A 1QJCA 3FLEA 3LWDA 3WBKA 3D1JA 2J9GA 2OY0A 4ND6A 1HF3A 1WXGA 1FNNA 1OFUA 2PDAA 2IFTA 3TZ6A 2J3KA 3IJRA 1XI2A 3RRZA 5KVAA 2JB9A 3FYUC 1GO2A 1L4EA 1GG9A 5DM2A 1G2IA 4QBKA 5B3LA 3S8YA 3JCZA 1R4NA 2JAUA 4NG4A 3E9QA 4F85A 3DKKA 3DZGA 3VTAA 5LA6B 5MDHA 3RG2A 2YHIB 2D5LA 4N40A 1KWGA 1Q7GA 5HDQA 1A2OA 1I2BA 2A7QA 3NDPA 3HR4A 4LZNA 2PUCA 2FV8A 4BIIA 3ZW9A 2I03A 1RT9A 4OK5A 2QXYA 3KJIA 3S0JA 4CDNA 3ROQA 4FTWA 2Z2ZA 2O4UX 2B2CA 1NBHA 2ZYWX 3G9ZA 3SIPA 3ST7A 4BX8A 1KMMA 2O0KA 3CRW1 4W82A 1QC5A 3EFOB 3NDRA 2D62A 5AT1A 1W0JD 1R4MB 4MV1A 1YU6A 2R7LA 2X2FA 1X7ZB 2OWDA 2MYPA 1T6BY 2FY8A 4JNCA 3QBVA 3WYAA 4AF8A 3GP8A 4D4JA 1ZK3A 1FU4A 1JNXX 2YHAA 4RPKA 4V2IA 1WVGA 1D4AA 2WU0A 1S2LA 2JBAA 3KPYA 4MRVA 5F2EA 4C4AA 5GWXA 4Q6WA 1ZQ9A 3KJFA 2A9KA 1Z83A 1YC5A 2C2HA 2J59A 4N39A 2UXBB 3VOBA 4PLZA 3DTTA 5JHHB 1WOMA 4KREA 3EPPA 3L0CA 2GO1A 3P0HA 4PYRA 1G7SA 3PFBA 4M0DA 3KCNA 4Z1OA 2VDKB 1PNTA 1U2RA 4C7BA 4LKRA 1DSSG 5PNTA 1W19A 4PGGA 3VJMA 1NZJA 2BFOA 1WXIA 1NOJA 2JEOA 5D2CA 4G5OA 1NXVA 1EBUA 4Y6GB 4N12A 1H2HA 4YQZA 4P3XA 4BLOA 3AZQA 4MW7A 4ZO7A 3KQVA 3ZCVA 2ZVJA 2VA8A 1YUMA 3Q2OA 1PKXA 1A8SA 3P9ZA 4HTAA 1U6KA 3THRA 3ZH2A 3H8JA 3TNFA 4U00A 4UHJA 2GVNA 1L4UA 5ELLA 3PX7A 3D7SA 5SY6A 1YB7A 5KVCA 2EJCA 2JHCA 5LD2B 1SCKA 3JTEA 3THSA 4EARA 2OAGA 3WLPA 1BMTA 1EK0A 1RVV1 2YVLA 2C3UA 3DDWA 3A4IA 3NP9A 2I1VB 4L76A 3WLHA 5DH9A 3E9CA 4AYTA 4C5AA 1VHDA 2IL1A 5BQ3A 2C5BA 4YJ3F 4UHCA 1C9JA 2FHPA 2XTJA 2X58A 3LX8A 4I4IA 4DV4B 3H9JA 2CFSA 3OH8A 2A5GA 4N3NA 3VPHA 4ROTA 3WY9A 4PHTA 4CCWA 1BDBA 1A2QA 1WD7A 3B3GA 4B6PA 1E5TA 4KMRA 1PL8A 3FLBA 4HQLA 5HCNA 4XA8A 5JSUA 3IUBA 4ZALA 3K6SA 2EX4A 3DE7X 1AKTA 2QMOA 3Q3JB 4PZ9A 3NHKA 3SEFA 3VSEA 4M8KA 4TGLA 2VZ0A 4QDZA 5GTDA 4RACA 1QP7A 5DLDA 4WRRA 3PPYA 1L4HA 3AHEA 3IEXA 3WL8A 4O3MA 2F3RA 3OQIA 4IQFA 4RJ2A 5C53B 4O25A 4YP1A 3LYLA 1HLGA 2X5OA 1CJKC 1XD9A 1O54A 5ARBA 3VR5D 1A9ZA 2DM6A 2HC9A 4HADA 4UE2A 2VJMB 4DUGD 2W2QA 4I55A 3ILSA 4AMUA 3N8HA 3A36A 1U2GC 1K66A 2FN9A 4OREX 1UMKA 4G1BA 1G3IA 4LBZA 1I5EA 2A9OA 3VFDA 4AUMA 2DX7A 4ZTUB 2YIDA 3IXQA 3DS8A 1FP4B 2X4GA 4UDNA 3TDMA 3RC3A 4E2FA 5TLSA 1N2BA 1XVAA 2RKBA 1J0XO 1WX1A 2PV0A 2B99A 2VSQA 2B37A 2BGJA 2IY7A 3HNRA 1WY5A 1GXSB 5EZYA 5E3HA 1TFUA 4M49A 5AKJA 5EE3A 5EERA 1H69A 4KR0A 2CLCX 2BKEA 2O2ZA 1AQYA 4TSFA 3TR6A 4C1BA 2R0QC 3BL6A 3I4LA 3R6TA 1WP4A 1QFSA 4PYKA 1Z2PX 5I9LA 1CFZA 4QYXA 5FFFA 4HNAA 4ZAXA 5LXTF 4M1YA 4WUTA 5AKYA 1L4GA 1W46A 3E5HA 5GP1A 3HWWA 3R8CA 3X2FA 1VKOA 4F45A 2J85A 1H9CA 3CZ4A 4BQSA 1ZXLA 4UEJA 3Q1KA 4W1SA 3C2QA 2P6RA 4JYAB 1E92A 4MUEA 4N0QA 3EW9A 3W9SA 3T9DA 4PS1A 3RW9A 2XVYA 4RLSA 1TCBA 3EZ7A 1TM5E 4YRJA 2V45A 2H0AA 1SU8A 2NU9B 1L5MA 4UUNA 2DPYA 1GNQA 4Q15A 1S3SA 5DXAA 3WBJA 4EKDA 3DDZX 4CR8A 1BVHA 4BKRA 3VPXA 4D46A 5CDYA 4TN1A 3AI3A 4A0FA 3ER9A 2VDNB 4CMJA 2FPIA 1Z6GA 1NOKA 2PXXA 2Z1MA 3FPBA 3R5KA 5FI3A 2R66A 1AIPA 2OXEA 3TX6A 3V3TA 1RC8A 4F2DA 4GKJB 1BXRA 2WOOA 2I67A 4MGIR 4GZ3A 3R0QA 4HF7A 2O2EA 3EA0A 2ZB2A 1JN0A 4CIBA 5F52A 4DW8A 3WLTA 2VQFB 1O97C 2BFPA 4M9SA 4R0NA 4U6SA 3LM8A 4M0UA 2UZ3A 4IG4A 3NUQA 4X3CA 1T36B 3TZEA 4ARVA 1EWQA 4KOEC 1ZFNA 3FPEA 3HJRA 3HADA 1DV2A 1GZHB 1VLMA 3HWX1 4QULA 1X1EA 4RADA 4KLCA 1ZL0A 5AM0A 2V1UA 1OAOC 4EPTA 2WSSA 3L8ZA 2HT6A 1IDN1 2D2EA 4ARCA 2FG6C 4BLUA 4G4GA 3QPWA 3U09A 1Q11A 5J4KA 4A0GA 3U17A 3B9QA 1W581 3Q7QA 3LPLA 1NE2A 1PJQA 1S8OA 2O8CB 3E2MA 3SYLA 4KLZA 3UKDA 3CYFA 5TC4A 4LFCB 3OZVA 4AN4A 4KXUA 3AXTA 1YNOA 4L51A 5FQOA 4WBSA 4LHEA 5AHOA 1M1XB 2HNBA 5DO9A 1DVRA 1QHFA 1DAIA 4FJ0A 1EE9A 1DQRA 4CLRB 4UEKA 1TF2A 1LBTA 4URVR 1NRJB 3M1AA 5IF3A 1A82A 2JFHA 2V4MA 4UNSA 1ZVQA 3HKDB 4GM1A 4WCDA 5CX1A 2A9QA 1F14A 5FBHA 3J81A 2ORVA 4D3SA 4MCIA 2QTRA 3UXMA 2F8LA 1R0RE 3DMGA 4R8LA 5CT6A 3AH8A 4IDFA 4I1RA 2HQRA 5I9SA 2NO4A 2EU8A 4Y2QA 4M38A 2H2DA 3FN4A 1DQYA 4RZUA 2ZYGA 3TVTA 3IV9A 2PU7A 2IYFA 3AUFA 3L5KA 2YJ5A 5EFZA 1UP4A 3WTCA 2HWYA 1IN5A 1IOWA 1PK8A 1CY4A 3K2EA 3ZCSA 5IK2D 3ZD7A 1YTUA 1Z5VA 7YASA 3D2LA 2QL6A 4NPCA 3RSLA 1W49A 1QCCA 5JSZA 3UPUA 3PP8A 2ZJZA 2PO7A 4TQUS 5AW7A 3NHSA 1VTKA 4BZZA 2JAHA 1SUCA 4EHLA 1KU6A 3ETGA 4J0CA 3BAZA 1NBOA 2AJCA 2G76A 2XRFA 2NTNA 4ZPJA 3CEMA 4RDCA 1F7VA 5H68A 3NO4A 4OQEA 3KLNA 4I0WB 1TKRA 2WAAA 4IHQA 1N5JA 1Y8QA 4FHCA 2YFKA 3QTTA 3X44A 2B94A 2XMZA 5F7JA 8AT1A 5KJ1A 1JHUA 2C2YA 3O0DA 3QE3A 1QH9A 2P4EA 2QX9A 3EAQA 3EX7C 3WISA 4JS0A 4IRMA 4CIDA 2TMYA 1ADBA 1B00A 2QSUA 1C4OA 1WZ2A 3CFYA 3TNYA 4JCCA 4MS1B 3BRCA 1PQYA 1SK9A 4I5IA 1L6RA 4RQAA 2WVGA 3JALB 1DAPA 4N3AA 5BNZA 2FWMX 3OCZA 4I2VA 5KYXB 4YRTA 1KO8A 1XU4A 2HN9A 4RL6A 2CUKA 3A05A 1K5GA 1I2MA 2C61A 4IMRA 3SEZA 1A7KA 3WKAA 4A27A 1KVTA 2MYUA 1QQ7A 3JYHA 1X77A 1ZA2A 1SXGA 2BI4A 3P32A 3V33A 4F9TA 3T1HB 2CEKA 4E33A 3E70C 3PX3A 4D0RA 1KVUA 4CCYB 3PJGA 2ZYTX 3CR3C 2A92A 4DDMA 4DIMA 1WCIB 1JG1A 2JGJA 1WLYA 3GZJA 4U7PB 4AO6A 2CJWB 5LZ9A 1MB4A 3D8TA 5KJEA 1M2HA 2OB1A 3H9GA 5IFKA 1GRCA 1QQ5A 3RS3A 3TSAA 5LP6F 2IYNA 3AI2A 5C8XA 3H99A 5CA1A 1JG2A 4BQPA 3BZUA 4BNKA 5CA0B 4TKUA 3VZCA 2VH5R 2R9VA 2NSLA 3LT1A 2PNFA 2VAVA 3BMNB 4MQFA 1GFSA 4L5BA 4UMFA 1XMXA 5F12A 3L0PA 4S24A 3I5MA 5JSKA 1USKA 1E1QA 3HMQA 4RJIA 3OWHA 1KMQA 4EB8A 2ARKA 3C6YA 5F2NA 3Q0IA 1NLFA 4MV3A 3C3MA 4J0HA 3W5UA 2C9CA 3STHA 1UDXA 4ZVMA 2CL7X 3WHIA 1DLJA 3W8NA 3D4BA 3DEAA 4DBLC 4U2EA 1EWYA 1VB5A 1NGSA 2FR1A 5LJIA 4WAUA 4HN9A 2J07A 3PGLA 1N7HA 4IF6A 1SXPA 1WHSA 3UZUA 3ZZNA 3K5PA 1HDOA 2LTAA 1NHGA 3N8KA 1GPUA 4L3VA 4Q3AA 4DHEA 1OXKB 1W52X 4EUEA 3NTUA 3VVCA 1SKYB 2CNOA 3EDQA 4F6RA 1INLA 4BHTA 1DQZA 1W87A 2P9BA 4DMCA 2OD2A 5HS6A 1EX6A 2QRHA 4NAVA 4B3GA 3QBEA 5DLPA 4E7PA 1Z06A 3EFEA 3MS4A 3R9WA 3EIUA 3E0XA 3CG0A 2IYEA 3QE0A 4JEUA 1I32A 3DE6X 4K3UA 1I80A 4OL9A 5ULLA 4D2IA 1E7YA 2HNKA 2WJ4A 4MIOA 2CHEA 1U3FA 2I1LA 3N6XA 3T0IA 1PFQA 1E0AA 1D5WA 4KBFA 1DKUA 1DRJA 2DC1A 1YB1A 2R6R1 1N7IA 4FMDF 4V2UA 1EFPB 4BBPA 4OPMA 2FSIA 4H16A 5I01A 1ICEA 3FNGA 1N9GB 2VCYA 3BXEA 3DOUA 3OUUA 2NZ8A 3OZ7A 1YBVA 1KAQA 1NUHA 2WINI 5CUQA 3OKCA 5MFZA 3KETA 2VHVA 3P2IA 5I3CA 2HQBA 2QMQA 2JLZA 4JL5A 1UJ5A 2DG2A 2QRVA 3JD0A 3TQRA 4CPDA 1IBRA 3W5CA 4M54A 2ZT8A 4ZCLA 4ICIA 3N2GA 1DAFA 3RK1A 2O48X 1XLVA 2WR8A 1R37A 1XZQA 3FXAA 5CW1A 2ILVA 3RVNA 1YJBA 1AC5A 4NARA 1UK6A 3IE1A 3V8VA 3R6WA 4RVOA 1EG7A 4KWTA 5GGXA 1ELOA 4AWBA 4MB0A 2VZ9A 3ZK9A 3NBQA 1KZ7B 2DTXA 3OFND 1SVUA 1NSFA 3C1UA 3PNSA 2MSLA 4TT8A 4BNGA 1Q91A 3PC8A 1H0RA 2AYZA 1WUYA 1Z0JA 2OK7A 4REQA 1U2GA 4H3HB 3VOTA 4EHDA 4PYJA 1VLZA 3UG6A 3PYXA 4H27A 4BFWA 2Q4DA 4KXXA 4OB7A 2NLOA 3ZIUA 1T9GS 2X41A 2FF5A 1CUHA 3FNIA 1P0IA 4NBSA 2X0RA 4PNZA 3SJBA 5EXXA 5FTLA 5E3JA 5SYNA 1WCV1 3EZGA 3TXXA 5DCYA 5E0KB 1E7SA 3NLLA 4AMVA 2QUZA 4LW8A 4IIJF 1Z7EA 4F93B 1QNLA 4RKWA 1LQUA 1ZRSA 2RIPA 4G3XA 3W8RA 3GLIA 2CD7A 2GNPA 2NUTB 2YBEA 3DOIA 4RWZA 1D2GA 2OWEA 2YZNA 2QR3A 3HUEA 5TB5A 5F98A 2WB4A 3UAOA 1QTNA 1BS9A 1BZYA 1VMEA 3BBPA 2IHYA 3ZKWB 2WM2A 3D8RA 5I5GA 1H1TA 4BB5A 1YQTA 4IEFB 4DTIA 4GYJA 4FFBB 3CGGA 4JJZA 1BRTA 3CVXA 4D25A 1NL3A 4M1KA 4KIUA 5K0GA 3DW3X 4YWHA 1PFKA 2Q3CA 4DNPA 2SNIE 5I5EA 1KI9A 4MI1A 3RUIA 3ROZA 3OESA 4NVRA 5DI9A 3T5CA 1NC3A 5EVCA 4OUKX 1COZA 4GGMX 2WU3A 3DFMA 3SVZA 4M87A 3LI2A 4DBZA 2PRZA 2DBRA 4YRIA 4EYEA 1CUIA 2Q99A 1Q1BA 3T9BA 1PV4A 2ASEA 3BGOS 3NWPA 4PF1A 3UGTA 1GZ3A 2J8ZA 3GJ4A 4QQFA 3ITKA 3UBTA 4DR1B 1CCWA 1RPAA 1LLDA 1RWPA 4QOGA 2OSBA 1G4UR 2QVZX 1DBRA 1XTZA 3GI1A 3AETA 1JHXA 3LBHA 3G9XA 4DIKA 1O3YA 1OV4A 2X6QA 3MS7A 5KKAA 5TMBA 4CIWA 5KYYA 1JF8A 1GQYA 2N75A 1GTG1 2VI5A 1RLOA 1YB2A 2C9OA 2P9GA 4Y9DA 3TQHA 3VR2A 1WB5A 4YP5A 1KFJB 4TWJA 3RT7A 3GUHA 2PV7A 4G0PA 4RPIA 3VTZA 1R8SA 1M0EA 3TLCA 3TRIA 4UEOA 2VYQA 4J0JA 2B7LA 2DRIA 3DBRB 1RWMA 1U28A 3V8PA 3IKTA 2J6BA 3DL4A 1UEIA 5TQJA 1AGNA 2X13A 2VJDA 3G2NA 2QL9A 2XZPA 2JF0A 3QVKA 4F5WA 1UZUA 3QLVC 5AVXA 3DEYX 2HREA 4QUEA 1JPUA 3FPJA 5F1KA 3GAAA 1NV8A 1SCIA 2EG5A 1VPVA 1ICIA 3CH5A 3DHNA 4P35A 4XB1A 4YJKA 3IAXA 5FWXA 2FFBA 3ZOZA 1PDVA 4P3KA 2IU6A 4BVKA 3W3AD 3WNVA 3ESQA 3CGWA 1YDFA 3GRKA 1GSOA 1Z0SA 1OXUA 3R7WA 4QPPA 5MN5A 1U1CA 3E9YA 3N86A 3ZWXA 1P1FA 2CWDA 3WQBA 2A0FA 4HVAA 4WY5A 3LLVA 4C3ZA 1FTYA 2JIPA 3ZGZA 5FNVA 5E6UA 4LPSA 3TZQA 3WXBA 4UMVA 5LLDA 3LGXA 4PPQA 4IL5A 3QENA 6YASA 3I30X 3TG8A 3U4QA 1R3UA 5AI6A 3NKLA 2C7RA 2HMAA 2RG1A 3CN9A 3OP4A 2DH6A 3VKVA 1DCMA 1AOXA 2H5JA 2WRZA 3H2GA 4FM9A 4BFCA 2BE7A 3QEBZ 1J2TA 4V3BA 1OBVA 2MDTA 1AQUA 2QTGA 1GQRA 4CN8A 5KAPA 2YZKA 1NVDA 1OHHA 2EGGA 2W4QA 4QOJA 2HZBA 2UYOA 3AONB 3VRHA 1UDWA 1NF9A 3HXLA 3HJNA 4KW7A 3FYCA 3ZZ0A 4HMPA 3DCJA 1H8EA 1HQYE 1IBCA 4G09A 2ZWAA 1XALA 2FR0A 1E61A 2FSFA 3MT0A 4Z51A 1W5TA 3BGWA 3H11A 3LOUA 1OZ0A 1E7MA 3GDGA 3I8SA 4TTTS 1KMHA 4MP3A 1JJVA 1RLIA 1U7ZA 1NG1A 2JJYA 3R1IA 3UW1A 4S1PA 4MGYR 3TR0A 2XUJA 1DCTA 2O3SA 1GR0A 4MP8A 2XCLA 3DDNA 1T4CB 1Z0IA 2D5CA 3RS0A 3ZV5A 4UTNA 1I51A 2W83A 3K9CA 1SRQA 4N82A 1KJ9A 2ODBA 5CEJA 3DYVA 1TM1E 1T15A 4KODA 1DGQA 1M2JA 1QHHB 1MTOA 2BM0A 4M1WA 5IDVA 1Z9BA 3FCEA 2ZTVA 1YOBA 1ZC3A 2PX5A 4MB2A 4UE3S 4EIWA 1OHHD 2GPJA 5I7OA 2V1XA 4H18A 4F9GA 5K8LA 1IOVA 2VTKA 3FBTA 4P22A 1FMFA 1UJMA 3HCBA 2WJIA 3PICA 1ZHOA 2DGDA 3TL2A 5G4KA 2QD3A 3RV4A 2YWJA 3TLXA 4JFAA 5KOJB 1Y8RA 4FD2A 4BB0A 4NZMA 4XW2A 2I8AA 4Z1MD 4B83A 3BQNB 1Y1PA 5CITA 4TYPA 4QYTA 5JI3E 2WIKA 4J16A 3BJIC 4J9VA 4AW9A 4DNXA 2WZQA 4PZ0A 2GJKA 3QVJA 1PZGA 4NU5A 4Q9JA 2PRIA 2ZBUA 3ZK8A 1F38A 2IE0A 2I65A 3DOCA 3KNZA 1OWPA 4F8YA 1GJRA 1MJHA 3F74A 4P3OA 5EL0A 2O2DA 3V7UA 1Q3TA 1UK8A 3LQ4A 3M6VA 4UTXA 1B42A 2BIFA 3W5AA 3QEMB 5E1OA 1U2PA 3U7JA 1ND5A 1AKVA 2GZRA 1PR1A 4HG2A 4L74A 3OFVA 4O4JB 4R16A 2Y93A 4F46A 4NMMA 5BN5A 3WGIA 2ZE7A 4ZEWA 3Q41A 4HK4A 4GPZA 2CXRA 5C8YA 1B7GO 2IYOA 3IV7A 3Q3CA 4FLFA 3U37A 2HIAA 4ARIA 3U80A 3ES9A 3PWSA 4KUEA 3PF8A 3AIMA 2E4ZA 5CTAA 2JCBA 5EIOA 4WKOA 1D5CA 5LB4A 1RMQA 1P75A 4K88A 2XZTA 1DBPA 1XTPA 1KYQA 1DEXA 1X7YB 4UVIA 3P52A 5HMMA 2Q0SA 3QV1A 1VBFA 1NULA 2VHZA 4MV6A 1R0BA 3K1YA 5IRCD 1PCXA 1AH2A 2Q2QA 2F17A 4O4JA 3T38A 4ZOAA 5KNDA 4FU0A 2EWMA 2PMWB 3C16C 4GAEA 4ZQGA 1XMQB 1IZ0A 5EXSA 2UZ1B 3DTVA 3N6RA 1F7UA 2I8CA 2ZB4A 1OT5A 3H8SA 2PKRA 5DV9A 1QRRA 2G9QA 4JOBA 2DFTA 4KPUB 4M86A 3M33A 4WPGA 1GGNA 3AP3A 2GEUA 2QTFA 5C0OE 4ER6A 3ZZMA 2XB4A 4DJTA 3GDHA 5BPHA 2QS9A 1IBLB 3ZHTA 3RBAA 2XIQA 4GP9A 3EVTA 1Q95A 1QP0A 2PBZA 4ERNA 2R8RA 3GYBA 3LT4A 1T4DA 2HMWA 4RLHA 3T7EA 2GJSA 3T0GA 4DRXB 5J43A 3BGSA 3OD5A 3EPKA 4MEJA 1QQTA 2WMOB 1L4YA 3SC6A 2HSGA 2PD3A 3HZZA 3JWIA 3GY0A 2IU0A 3V4RA 3PDJA 4TOIA 4Z4QA 2B30A 3GN1A 1QZZA 3MCWA 1V7ZA 4NDAA 4OK3A 3LX4A 4FNOA 3DVAA 1V7PC 1VFPA 4KRYA 5IKEA 1D4OA 3FCOA 1J8QA 1DCKA 1VYTA 3QPUA 4HDAA 3BF8A 4P1ZA 2ZQ5A 4BN4A 2QN2A 4F4FA 4Z54A 3FTEA 3OIYA 1DAGA 2QUJA 2E0IA 1HRDA 1NVWQ 1RRKA 1BXZA 3TZCA 1SMKA 2PANA 4ZOLB 1Z5NA 1RXYA 4LZLA 3OCUA 3AKDA 2HDWA 5DBFA 4J3JA 4W7IA 1Z25A 4BAZA 1X1DA 5AO9A 5LFAA 2O8FA 2F00A 2ESRA 2JIDA 1GUYA 1NASA 3UGKA 3GLRA 1UM8A 4GYKA 2VHXA 4OBXA 5LZ4A 1HZZC 3ESXA 2EP8A 3GZTB 1ONSA 2FWRA 1CR2A 4A1OA 4YT2A 1WBBA 2GWHA 3GFFA 3H1GA 4MQLA 2IUEA 3LCJA 4WOKA 2VEDA 4Q1BA 4Y2RA 3U60B 2I55A 3HLTA 5G1PA 4HHEA 3VPDA 1I24A 4K9SA 2JFFA 4DWJA 4C05A 1MTZA 4PC7A 4D56A 3K53A 3ONVA 3RD5A 1DUIA 4FWIB 4M22A 3PA8A 2HBYA 1AUVA 3GAFA 2O23A 2PSEA 1LVUA 2X8AA 1RJDA 1OFVA 1L7DA 1I0IA 3BB1A 4IV8A 4CM9A 2YUTA 3U4QB 2ST1A 2UUCB 4XWTA 1LZLA 4FFSA 4ANFA 3I58A 2QAIA 4PZDA 3SC3A 1ZNXA 3BWBA 4HEA6 3VKGA 2I2WA 1AS0A 2I71A 3B2NA 4OMDA 1B0UA 2WA2A 4E3ZA 5IJWA 2XMPA 1IE3A 2XOXA 2OV8A 4JT9A 5LPNA 2ZTHA 2AGVA 3ABSB 4ZC8A 2EZ9A 4BMPB 2E21A 1B0ZA 3CLKA 1JEOA 2IH2A 2OCDA 4M3NA 1GG2A 1GNPA 3O75A 1DTWB 1JA0A 3ENZA 3AM5A 2RARA 4KSBA 1HFKA 1ZH4A 4OD0A 2IGTA 1ZUNB 2RH5A 2YYZA 3CMMA 3AHCA 2H7YA 2OV1A 3MGGA 1CC1S 3INTA 1E8NA 4HAWA 4DANA 4WZAB 2WTAA 2ZUSA 1FDUA 3KBOA 3NHLA 4I4TF 3BXZA 4NV0A 3G0HA 4DJDC 3CNOA 1JG6A 4WCFC 4DAEA 2EFJA 1KSHA 1Z47A 3DJYA 3ELUA 3LQQA 2XCSB 3NWEA 2WV7A 2GH1A 2EXXA 5C8VA 2PGJA 5GGYA 5IU6A 4QEKA 3RVJA 4Y3UA 3WIUA 4ZHQF 2GD0A 4CKZA 2J45A 3ND5A 4GEGA 1ENOA 4Z9AA 4GI3A 5HKKD 1F6WA 4YUVA 3WLOA 2P6NA 4ADSG 4OLJA 2PZJA 2NU6A 3DFFA 1QH1B 2SECE 3P5SA 4H4CA 4E6PA 4I8XA 4Z3OA 3LVBA 2QP3A 1WDKA 4I7EA 1TT5B 2Q3BA 3PG5A 4P2GA 3TUZC 5FPTA 4EHJA 4MAAA 1FMTA 1DUSA 5LZ5A 3HS3A 3NTXA 5THQA 4U2BA 2WJGA 1HI9A 4F5ZA 1K2VN 4C5CA 1K98A 5BR1A 5LLTA 2GKOA 4MV7A 1F48A 2FFHA 1IUNA 2ATXA 2PHZA 3C85A 1J70A 5AXAA 5BWOA 1SVSA 2X76A 2HA6A 3A27A 4QO8A 2RI1A 1ZD5A 5CB6A 1Y6FA 4TTRA 1IZYA 4J1SA 1E6LA 3EGVA 3HB7A 3IPRA 1J97A 4TMYA 1XTJA 1WCXA 4JLDA 2NUBA 5FA8A 1P3DA 2QUBA 2FFRA 5CK4A 1S0UA 3H5AA 3QK7A 5AVTA 1C2TA 1U4SA 4V1CA 1EQUA 4MYHA 3UC9A 5WRFA 4DSZA 2DSNA 2C92A 2GEVA 2BR5A 5AQEA 3FVTA 1GPLA 3AIIA 4TTIA 1LBIA 4DA0A 3EPLA 1ONNA 1JSXA 1NLYA 4EG1A 3MWGA 3LKDA 2FPMA 4FT4A 3G9TA 1Q22A 5T4FA 2BDTA 2ZRAA 3L7KA 2Y1GA 4LY6A 1XZIA 2P3SA 3AXSA 3R3HA 1QTIA 1V95A 1LGYA 1TM3E 3FFBA 3HDVA 4I81A 4U7FA 3UBMA 1AA9A 4BQFA 1XNGA 2VK1A 1V7QA 5K0FA 1UBSB 2Y1WA 1SCDA 3QKRB 1I4DD 2AOWA 1A7JA 1NNSA 2VDPB 2XYRA 4YFVA 5A6SA 4BFZA 1FC0A 2QGNA 1NT2A 3IBCA 3ZH9B 2BEUB 1RXEA 1QLJA 2QG9A 3KELA 3LRXA 5CVDA 4B9EA 3QU4A 2X0JA 1G4HA 2AUMA 3K1AB 4X20B 5JZ9A 2WLSA 3NBYC 1XDDA 4TMWA 3LF1A 3R0XA 3FWHA 4QT4A 3H1FA 4EFLA 3DWEX 2VZLA 3OU2A 5FHRA 2PX6A 1GPNA 5JBIA 2K2WA 5FTJA 4CT4B 3O8NA 5KPJA 4XX0B 2RKOA 2ZPAA 1S2OA 2GAJA 3CUEF 3AFHA 3G5TA 2FW6A 4YI3A 3UG7A 4K1XA 5G02A 1SU6A 3X1XA 1P1JA 1MB3A 4BO5A 4EATA 4BNIA 4QXAA 3VPFA 3EXEB 1D6JA 3AY3A 1HOXA 1RJ9B 3IAAA 5BQ5A 1Z6XA 5LQNA 3HZHA 4EUFA 2CVOA 5EG5A 4EK9A 1ZY2A 3I1JA 1LNQA 1JU4A 1HQKA 2IGBA 3LDFA 4OGLA 2ZUUA 6NULA 1NUSA 1J8DA 1VIDA 2I4RA 2HCRA 1UANA 3TNLA 4M36A 2YXEA 1UJCA 1DTSA 5EIBD 1M2NA 2ZUFA 3JQFA 5T4BA 2ID9A 4WBNB 3BMQB 2RIRA 4WEOA 2IF0A 3Q98A 2VHEA 1NKTA 1MLDA 2ZIWB 3OJEA 4GC5A 1PP4A 2GBLC 1R8JA 2Q8PA 2AXQA 2VJPA 3H6KA 4MNTA 3ZK7A 2PGXA 1UL1X 1FJHA 1LI7A 4UTPA 3W77A 5IK2A 3N07A 4D4GA 1II8B 2CLHB 1EVZA 2ZAOA 3FVRA 4Q1AA 2LBPA 1WHSB 2WM9B 1UT8A 3EMVA 4JKYA 4K81B 2G5PA 4KE9A 4NJEA 4V03A 3VR4D 4I9UA 3DUFA 4F5YA 4PONA 1W34A 4F8EA 4F9FA 4LDRA 2JI8A 4W5RA 2R1TA 2ZYRA 3PXDA 1XZFA 4P6VF 5IJXA 1MO4A 4LQCA 1G8PA 2O6HA 3L6OO 1H4TA 2XSZD 2Y27A 1K3FA 5BR4A 1VL8A 5KS2A 1TIPA 4URWR 3AV3A 3P26A 2YICA 2RGCA 5DJ5A 1ENZA 3RROA 4KR2A 3N8NA 2Q62A 4IIJB 5ALFA 3D7MA 5CA0A 1X70A 2W37A 4FGLA 4BIMA 1YE3A 4F0JA 4GICA 4O1IA 4GOLD 1P1KA 1ZU5A 2AS0A 1O6FA 4TL9A 1ZITA 2QROA 1GL3A 2VTVA 3BMQA 1GHTA 4NBVA 4XGRA 1KA9H 1WEKA 4ML3A 4YXWA 4WBNA 1AY0A 1GPH1 3REFA 4RTNA 3NNNA 1LDBA 1WCIA 2JJQA 3PWTA 2EQ5A 4QHYA 4CMIB 1ZJ6A 5K51A 1CNFA 3Q7TA 3GJTA 3MMSA 3IE2A 4B6GA 4V0ME 1N25A 1NC1A 1WF3A 1YS6A 2AI2A 3GNTA 4GOXA 4WFIA 3WMFA 2HLPA 4W8OA 3ZDZB 4GRDA 1BCSB 3QUCA 1CY7A 1G21A 3HACA 4BPBA 1CUEA 2HRZA 3GRFA 3OEED 5JD4A 1TK3A 3GEMA 3MWEB 5CFNA 4NWIA 3EEIA 5KCMA 5IAAA 2AXNA 5M2QA 5COBA 2IQ5A 2I87A 5EKDA 3CM0A 3Q3IA 4D9IA 2CYAA 3HXPA 3T9FA 3N2NA 4MVJA 1XCJA 2CHFA 3K3PA 2IYXA 3Q3HA 3V7WA 5A3JA 5J4LA 1M67A 2PCJA 4Q01A 1FTWA 5I4IA 3RCBA 1VLHA 3RRMA 5JJ5A 1AO3A 7REQB 1UBKS 4RPJA 1Z28A 2BW0A 1P61B 1Z4NA 1M8PA 2VSOA 4MKFA 4PPNA 3HY3A 3ESBA 1IEWA 2B4YA 2GILA 3L93A 4MPTA 4MX8A 4ZQCB 2QBYB 2YXPX 4EO9A 2AH5A 5ICMA 1M7GA 2YWBA 3SQWA 3ZQ4A 4DLTA 4BS9A 5L40A 3HV0A 1VSBA 1PW5A 3A4VA 1A8PA 621PA 1X7GA 2PYZA 4TT3A 1J21A 2JFQA 3C7KA 3PNLA 2GM9A 5I9IA 1HYEA 4H2DA 2BPOA 3G9UA 3ZXSA 3IXLA 4WASA 3WP1B 3OFKA 3AFGA 2BFCB 1UJNA 1IHXA 2J0QA 3GJXC 2NVWA 2XNDA 5CFMA 3PD7A 3LD9A 5KIAA 2ZSFA 3IT2A 4NMXB 4DMGA 5CEEA 3U1TA 5U9CA 3RYCB 4FD3A 3VYSB 5BO5A 5C7YA 5B1YA 2VA9A 1WZEA 5J5VA 3FZYA 3GQVA 3S3TA 3W5JA 2XB8A 1BWPA 3C6XA 4LBVA 2IHJA 3OOHA 3UMMA 3IP5A 1J20A 1YDHA 4M0LA 4X1YA 2Q49A 2PU5A 4ZT3A 5ANRB 3HGMA 5JW6A 5KSWB 4K9PA 4OH1A 5DX8A 1YXMA 4C7OA 2ZSKA 3AI7A 3O38A 2F1KA 4IMIB 4R5MA 3CWQA 1AQNA 3PUJA 2EKPA 2YOHA 3F1KA 4D92A 4KAFA 3PR1A 3QKRA 2AWOA 1KKUA 4JDPA 4OATA 1G5TA 2XWJI 4M4SA 4XJVA 4TVBA 5FPHA 2DBYA 4AX4A 1NW6A 3BTVA 3GVIA 2FH5B 2WAYA 3GNLA 4MIKA 4EY5A 3EZFA 1GUDA 1XAIA 1S1MA 4IDBA 3F6CA 5JNUA 2O2GA 3AJRA 3UJ9A 3D0RA 3O0TA 4DA4A 4BO9A 1J39A 1LDMA 4FOTA 1V8BA 4JLBA 1EI9A 1XNQB 4C07A 2VQEB 1FFDA 1V43A 2I6SA 2YOFA 5KSOA 5EP3A 5DN6A 5HXAA 1ZSVA 5ECYA 4LCBA 3T7JA 2EAUA 1KMCA 1YVRA 2FLWA 1TA0A 1CUWA 3BJZA 5JS1A 4AI6A 3N3AC 4RABA 5FADA 2VQ3A 3H0EA 3FHJA 1XU9A 4DKJA 4JX9A 3F1LA 3QYPA 5EAIA 3L6EA 3AJ8A 4HN4B 3T34A 4BLTA 1KO5A 4NV3A 4PV7A 5LYJF 2BHSA 2MYNA 3GGDA 4TXHA 4OQZA 1KOLA 1WMEA 2AW5A 5DM60 2A0UA 3VGPA 2BM9A 2C57A 1R8YA 4RD2A 4QU8A 4P53A 5KYUB 3RWOA 1E3IA 3VMMA 2Q1TA 3OZRA 5CLGA 1RAEA 1ULAA 1VMDA 2LGJA 1TKBA 2FCRA 3VDMA 4C6TB 3N7UA 1Y6ZA 1N9KA 4M9XA 3L04A 1XZ8A 2OG1A 1E1NA 2X1HA 3GYGA 4JT4A 5BOVA 5KHAA 4MWCA 1T1GA 3ROPA 3HK2A 4ILEA 3K9BA 4N49A 1N57A 3WJ2A 4BP8A 4FOSA 3C5CA 1V25A 1Z2EA 3FPSA 2Q1YA 1XMVA 3DQZA 3ET4A 3CQ9A 4IHJB 3T41A 5I7SA 2C5HA 4L7VA 3O93A 2WWYA 2PKQP 1OBOA 2R47A 8LDHA 4CV3A 5K4HA 3ZD9A 5K03A 1M8GA 1LS1A 1M34B 1PWEA 2IPMA 3HXKA 4H3VA 4URXR 3KAPA 3I9JA 2R6CA 1L5ZA 2CMKA 5DXJA 3WHKA 2ACKA 4BVHA 3L1IA 4CKWB 3ERCA 3CMCO 2IYVA 4ZMSA 4Q3OA 1SKUA 1ORVA 2YTZA 3NP7A 4DQLA 2YQ5A 1XCLA 1ZCJA 3E81A 1ZGGA 3FSRA 3OVMA 2R1VA 2QVCA 2Z8ZA 5K0TA 4I2NA 2AHRA 4PWYA 5EMKA 3EOBI 3O2JA 2RAPA 4F11A 1IN1A 4OAPA 1C14A 4DLUA 2X3FA 3SDSA 1KRXA 3ESAA 4XYMA 2CVFA 2TMKA 1HYHA 3UJCA 2GVDC 5ILGA 5JZVA 1W96A 4MPRA 3QY0A 1F8YA 4L3OA 3RHFA 1T3SA 2HHHB 1RADA 1O0BA 5D6OA 3L7OA 2XNDD 4GMXA 5CT4A 3RI3A 4DVJA 3QFTA 3ULKA 4AS3A 4E5VA 5I4KA 4OFZA 3LVRE 4PANA 2JFZA 2UZ4A 1PUIA 1E1QD 4DDKA 1N7JA 2HLHA 1L7RA 4LWPA 5A6SB 2QLJA 2XRMA 3TH5A 5CCXA 4WGFA 3LH5A 4AZTA 5FUWA 4C0QC 2IH5A 3V1KA 2II6A 4JLPA 4OUDB 1CVIA 3BHNA 4O4HB 2C2MA 4L9AA 3K5HA 1JXMA 4R8KA 4DR6B 2DR0A 1Q7CA 4CI0B 1E4EB 3ONWA 3WGQA 1YULA 1IJBA 1DAKA 1MRZA 3TW0A 2QN3A 3ER8A 1X13A 3RC1A 3RVQA 1R3DA 4OHXA 1QANA 2Z9DA 1NTRA 1W47A 5IABA 2B83A 1TEHA 2XQVA 3L0DA 4IJ6A 3UMSA 1X80A 4B45A 4DG8A 4EYOA 1WKCA 2D4AA 2OT3B 3F4BA 1HG0A 4CQMA 1ND6A 2ODNA 3M70A 4LYYA 3OI7A 3QG1A 2ZRKA 3AY0A 2R2GA 4LOJA 2XYGA 1MF7A 5HNKA 3U4IA 4EGFA 4NE2A 2IY9A 3TLEA 1AJEA 3GFTA 2PLWA 3MMPA 4W5JA 1OYYA 4OJTA 1V11A 1UJ6A 3MCZA 3NJRA 2QV7A 3BRWA 4GSYA 5IVDA 3INYA 3OCWA 3TLAA 5AW8A 4DV6B 2JBWA 2CLFB 3JQ6A 4J43A 1TVKA 2O8FB 3CG4A 4R4JA 4F06A 4RENA 3WNDA 4B4UA 4V24A 1TQ6A 3GCGA 3WK7A 3VDXA 4EHBA 3H83A 4MA4A 3VR2D 2F3SA 4X92A 5H7XA 4G9GA 4KGDA 5DMHA 4EGJA 1VPWA 3DTVB 4KQKA 1LRLA 4Q66C 1DFHA 4QREA 5AJHA 2LRHA 2P2ZA 3A6FA 4EPXA 2V0GA 2GDJA 3J80A 1EMDA 3FPHA 5EPUA 3H5NA 4O2BA 4XQ0A 3DM5A 1E3MA 3DVAB 1QF9A 1Z22A 3T4EA 4EB6B 2YJNA 3RVKA 4V02A 2MINA 3R2JA 5AJVB 4ABTA 2QI9C 2C2KA 4D41A 1L7VC 1LI4A 1TZBA 1U5AA 5KJ6A 4BLPA 4YTEA 3BWCA 2QV0A 1IY0A 1NAIA 1ZK4A 4HR7A 2QX8A 2JIZA 4MS3A 1Z6ZA 1FCJA 1SB8A 3FLAA 4UE6A 4WZBA 3R7AA 2FG7C 4C22A 5CBPA 2J67A 5K5EA 3IERA 3I6IA 4YJFA 4J76A 4N76A 4TMKA 1BMFA 2EBUA 1X7XB 4Q9HA 3PEVA 3ZI4A 3IBGA 5EMMA 3EUAA 1XEWY 3CNHA 1N6PA 5FJIA 4EF5A 4C2TA 1O5OA 2WAMA 4X9XA 3QEMA 1B3RA 5B58C 2C97A 1PJCA 2OCLA 2UZ1A 2V55B 3LSTA 2X7XA 3MBOA 1QTRA 4RY8A 4WY2A 4XIJA 2OORA 4BEBA 4MV5A 5KU7A 2A4MA 2BJHA 5I8PA 1K6EA 4QJ4A 4B3MB 4IUBS 4KVFA 4C5BA 4FUTA 1UQTA 2HDNB 1K06A 4W9MC 4DEXA 4PS0A 1N5KA 1OI2A 4WK2B 4AZ3A 4G0VA 2I4OA 3BQMB 4PYQA 4WZBB 4MVJP 3N0XA 4RDIA 4Z86A 5B58T 1E0KA 2IOHA 3H16A 3LP6A 3STVA 3LY8A 1B0PA 4YBZA 4UUBA 1VRVA 4NFSA 4DLWA 4ENVA 5B36A 3UTCA 3FDZA 3QKSB 4LOIA 1TLTA 1EUZA 2M6LA 2BYTA 3SQXA 2DBVO 4I4TA 5L9AA 5BORA 4LCEA 5JJCA 2VSYA 2EYUA 2NXNA 1D6NA 1WSAA 3HYCA 1PJZA 3LBNA 4EFDA 5JCOC 2I4NA 2DWUA 1AUQA 1XRJA 4OSOA 5BW6B 2FGJA 3LUHA 2OZEA 4EBFA 1GM5A 2REBA 2IS2A 4TKVB 2NU8B 1RAAA 1QHHA 2HWUA 2W9XA 2C95A 2P77A 1UFQA 2P5UA 1NPTO 3ELWA 1EXDA 1T9ZA 4DNQA 1VJ5A 3ZJUA 5LSAA 3G17A 3PUKA 1T4CA 2C5GA 2DQZA 3ZY4A 1NR5A 4JBGA 2ZYIA 4LMBA 2CNNA 4YECA 1JYSA 2HXGA 4FYWA 2V54A 2VK4A 1C0LA 2V7WA 2YWEA 3CX4A 1IYZA 1XMJA 3JW8A 3COPA 4K03A 3TM4A 3ZWBA 5KQPA 3EG5A 4N0MA 4LDPA 1ZNQO 1Y8RB 3MRTA 5FEUA 1HT0A 3BSWA 2IP2A 4F12A 1EIZA 4YMTA 4EG7A 1PWXA 1V1RB 1UKBA 1XDGA 4CQMB 1BYIA 5JECA 1L4MA 3B1FA 1JMKC 3AK4A 4FDTA 4UNRA 4AN0A 2AB0A 4ZZ1A 2QZZA 3E6AA 3EZNA 2VDLB 3ZWPA 4E6EA 1RBMA 1V41E 2HDHA 2XUAA 5AI0A 2RE8A 1T8PA 1WF6A 2Y4OA 3DT9A 1XO1A 1QYDA 4ZQIA 3D31A 1WDTA 4EGCB 2ZRDA 4G1EB 2X9GA 2BP7B 1M54A 3W8DA 1T4GA 4H7PA 5JT1A 3I9OA 1Z36A 3JQBA 5T4HA 4RFSA 5TXGA 3MINA 3RG8A 3VC3A 4A23A 2OZLA 1A2BA 5FNVB 2ES4A 1DPFA 2W8ZA 4C21A 4BZXA 1T8RA 1A27A 5SZHB 3D4IA 3K8YA 3WYCA 4XTRA 2BV3A 2IIBA 3TIXB 4AP5A 4KR3A 2GJ9A 3UKOA 1KAOA 1O4VA 4DFDA 2XH8A 4CL8A 5EP4A 3WMRA 4EI8A 3WYDA 2VATA 4ETNA 2CHUA 4D4IA 5BSEA 3WGGA 1NRIA 4OQNA 5EHNA 2WMYA 3DL0A 4L9WA 4L8FA 4RHXA 5KSYA 1ZA1A 2HA0A 5K3EA 3H2ZA 3S28A 4CQLB 1TIBA 1UUFA 3D0OA 4PQYA 5KQMA 3LHIA 2XWQA 3ZJTA 4BCDA 1TM2A 2XOEA 3OEHA 1AS3A 3WIDA 1DEHA 1ZIXA 3K16A 1I7LA 2VTDA 3QU2A 3RAPR 3UHPA 1UWLA 1JLMA 4R6WA 5CXXA 1VJRA 5JWHA 2X8WA 2HL6A 4YHHB 1UXIA 3MA0A 3SLKA 1TAUA 1QG0A 1CZRA 2D1FA 4DCUA 2F55A 3M4NA 2OOSA 3TQCA 4IIEA 2ZRGA 2GB4A 3L01A 1C9YA 4INPA 2ZAMA 1QPGA 3RBXA 3WMXA 4EFNA 1PG2A 5KNBD 5D7BA 1EVKA 4RK7A 1XR3A 1UXOA 2AT1A 3HWRA 1NRXA 3D7KA 4KO2S 3DLHA 4HH3C 3DKVA 3EK2A 6GPBA 2PPVA 5K3CA 1V5FA 2C9DA 3TRHA 1BMDA 1CIPA 1NUPA 1KP9A 1S3IA 3EH2A 2JK1A 4LXQA 2DEUA 4H1WA 5MF6A 1YZYA 4FYIA 5KO2A 3G2QA 4UFNA 1PJ3A 3L9WA 1CEEA 1ZMBA 3JASB 2YOGA 1W6UA 3Q3GE 1EBFA 2GXSA 5AK0A 2C84A 2I0FA 3E58A 2JLRA 5K3DA 1YQQA 2B3DA 3P45A 4XJXA 2ZRBA 1LBHA 5CG2A 2W6JD 3HHPA 1ENPA 3RU3A 4CMAA 3WK4A 4H3SA 3UWMA 1RSZA 1GIAA 1PTKA 1WLSA 5EZQA 1X8KA 4Y6RA 1XEFA 2H85A 3FFXA 3F6SA 3O3CA 3U62A 2ZJ7A 2QN8A 3AESA 1DJMA 2ZSAA 3AR8A 1GSIA 2VC2B 5HCUA 3AV0B 3N28A 3HSSA 1Z56C 1P1BA 4FS3A 3ZGXA 1SXJC 1YGPA 3GLIB 4YCDA 3KALA 5JMOA 3S7TA 1W8IA 2AMYA 2V8BA 3M1IA 4C3UA 3UXHA 4HGPA 3FSGA 4PLVA 4IUYA 5JH7B 1F2DA 4UQPA 1I5RA 2AMFA 2ALJA 3B85A 3C4QA 3EXHC 1F8FA 4NEGA 2FPRA 1X94A 4YCAA 3S7ZA 1SZDA 4C0LA 1JDVA 1TX4B 1FFEA 2ZS7A 3D8NA 1EEHA 1MC1A 2HEIA 2R751 5AJZA 3SQLA 1XJCA 2WFLA 2HA3A 3NAGA 1U3TA 2OGTA 3CISA 4MH0R 5JPIA 3ZCQA 1WIWA 1RQ2A 4G0OA 5JAOA 3OLCX 5K8VA 2JHAA 3K35A 1SY7A 1W94A 3MWLA 3VZBA 4AC9A 2VAMA 5EJ9A 2ZWVA 1D0IA 3SBXA 3WOHA 2HO4A 4TXJA 2HIGA 3ETEA 3S2ZA 2WYOA 3B5IA 4PG8A 5LKAA 3C3BA 2CEAA 5HWSA 1LV7A 1MOZA 2AC7A 1WUIS 2YMMA 5BVGA 1X8JA 5CDUA 4EOGA 4DXAA 2J3IA 4JJ8A 2Q6LA 1ZMOA 2GZHA 1K63A 1P2GA 1SHTX 5LU8A 2HCFA 3OEEA 4IHJF 3TTXA 5ETJA 5FKJA 1MG0A 2E2WA 4XX1A 1XVTA 4EGSA 3BWMA 3TLYA 1QYCA 3LNTA 3MILA 4CT0A 1EA5A 2AN4A 1BGVA 4ENPA 4W5WA 2C88A 3O8DA 5CDFE 4WA8A 3BIWA 2ASVA 3KQWA 3MM4A 3C3AA 3OQOA 1QRAA 4M0EA 4LYFA 1C3VA 2F9MA 2ECFA 1P3Y1 5LB2A 1R16A 1GT91 4QEDA 1ADGA 4CF6A 1O5IA 3AP2A 2OLJA 1YZFA 2JKZA 4JODA 3LLUA 1PKEA 1RKVA 1AUXA 1BN6A 5IANA 4QYSA 3TZBA 2AUNA 3E8XA 4OLFA 1GQSA 1IY2A 5AOVA 1JSLA 4OXYA 4MDYA 1IN8A 2B9VA 5H59A 2FPSA 2HQ1A 2ZE6A 1X8LA 4I1SA 4W9RA 2OUIA 1EX7A 2B82A 1SQ0A 2BEVA 1NBWB 2B2XA 4LRQA 4TL7A 1VJTA 5HOQA 4RTSA 5ALIA 4YRLA 5BUSA 3GK3A 5F78A 1O6CA 1T5SA 2GAIA 1T2AA 3RVRA 3W6OA 4LSZA 4D79A 2B2NA 2DKOA 3LDUA 5CAEA 2V7BA 4D0SA 4TV8F 2IDMA 1MC4A 3QUAA 3B3JA 2X19A 3AOEC 3GBPA 4K6MA 2Q4TA 1QRDA 1HO3A 3HXTA 4FSXA 4OBWA 4FJ1A 1K1EA 2ADOA 3EEFA 4CMIA 1WXDA 1SUBA 4E4YA 4M1TA 4O4IB 4E94A 1XKXA 2HLDA 3H9CA 2VP0A 2Z5LA 3O03A 3M9WA 1OB5A 1RXWA 5AK6A 4MIYA 3U44B 3KEMA 1I14A 3Q5GA 2Z1DA 1U99A 1NIPA 3PTLA 3QKSA 3TPCA 2MSDB 2BMDA 2XMSA 3UOGA 1C4WA 3WKDA 4QU5A 2H07A 5FOUA 4KRXA 5A03A 1YF3A 4ECEA 1XKTA 2KW5A 2UDPA 1CR0A 3HKEA 2ZRNA 3IPLA 1WTCA 1TU3A 2QY6A 1GA1A 3L6UA 3NXSA 4IW3B 4B35A 1ULTA 1YC2A 4QECA 4D0LB 3HKBB 4PC2A 2C7PA 2PJRA 2WJVA 2Q07A 4INAA 1NUUA 1OY1A 3LU1A 4RPHA 1PNQA 2C8KA 2RAFA 1E0SA 3OIWA 3H2SA 3DOHA 1JRLA 3NDJA 5TGTA 5A9SB 5HIJA 2R1TB 5SICE 1RVDA 3QOXA 1FQKA 4IS2A 4JQCA 4Y6LA 4EYGA 2UAGA 2ZJ5A 3TVDA 1WDWB 3IBSA 2EF0A 1HQDA 4K9NA 1OA0A 3LBFA 1XF9A 4NJEB 2Z57A 3K1ZA 1RMYA 5AOCA 1MCZA 2NZUG 1PR3A 4XVUA 4B3RB 4G9EA 4EGQA 2YY7A 4G0ZA 4CEIB 3BMNA 3M5PA 4DR5B 3JYQA 3QI2A 3A1UA 4CM8B 4RHTA 2ZIZA 3RUDA 5C32A 3EQ7A 1YE8A 3GT3A 5IH7A 2DT8A 3IPXA 2BZSA 1J33A 2RGBA 4QBFA 3UXYA 3JS5A 1QGDA 2QTLA 4JJKA 4DRZA 1MEEA 2FUEA 3I76A 1P5ZB 4PAMA 1BVRA 2IKQA 2MINB 2HXSA 4ZOLF 1RAIA 2IHTA 3CHYA 3EGOA 3L6RA 4HEJA 3UCFA 3IKJA 1B4DA 3DKIA 1QGED 4F3CA 1F8UA 1CQZA 1QUFA 2PIDA 2G1PA 4YNBA 3I37X 3P4YA 4UVHA 3FYSA 2PX3A 1ADYA 3MRSA 4L0QA 4DIOA 1WV0A 2NVBA 1PJTA 2EJBA 4NI5A 4HGOA 3SDZA 1OPRA 1ZIDA 3C7TA 3NEPX 2B4TO 3ZBTA 3R7FA 3ZPXA 3DE5X 2ZJOA 4HPJB 2CBGA 1YZNA 3BXXA 3F98A 2IDKA 3IP3A 2A3NA 2JGDB 1FVHA 2VDWB 3CE9A 4HD8A 4IIVA 4L50A 4RLFA 3ZEAA 4B4KA 4BMDA 2CNDA 2H31A 4LYAA 4YJ3B 1LCIA 2BF7A 2DHQA 1W30A 5KTOA 3KQKA 3ECAA 4HYEA 2O7NA 1Q1ZA 1YD7A 4ODIA 1IRIA 3CLTD 3QLTA 4AWXA 4AS1A 3D54D 4G1CA 4GKBA 3QX8A 2F1RA 1G9TA 3GLGB 3K20A 3QPAA 4DPLA 3AWIA 4ZRDA 1IEVA 4JXXA 2NUPB 3GWZA 3NRBA 2XDYA 4JAVC 4KP7A 2EW1A 2IQIA 3GA7A 1ISRA 3RPEA 3W2EA 4IYJA 2QZPA 5THXA 2AOTA 2PZ8A 2JCSA 2ZANA 3EWAA 1K75A 1QIDA 1OI4A 1UXGA 3IAHA 3NHBA 3OT5A 3RFUA 3U7QB 5JSZB 3OIGA 2VKQA 4O4HA 1N34B 4CMEA 3RTBA 3S1AB 5JQWA 3LWNA 2AEMA 5ALSA 1Z38A 5I7WA 2F8TA 3BORA 3CEPB 2JHPA 2WFMA 1K6XA 3OIFA 4YRGA 1JR6A 2QD1A 3EFHA 1E1RD 1JHQA 1RWKA 3X3HA 3NVMB 2PBLA 2C9MA 2YC4C 4WSOA 2BEWA 1SD5A 1U7HA 1WW3A 2KE5A 3OKFA 3FTNA 1IVSA 3AINA 2IYRA 4O6VA 4H7IA 3HKDA 2JIOA 2R86A 2Z3WA 5CYOA 1F4PA 3M5WA 5DGCA 5L3SB 3A9VA 1AQ6A 1JIUA 1Q1EA 2CXUA 2Y6VA 4X8LA 5AHKA 4I1PA 3GW8A 3P0EA 5F7ZA 5JS6A 2OB2A 2QT0A 3KL2A 4FE3A 3TFOA 4DCNA 1RZUA 3QZUA 4BKQA 3C48A 4D81A 5J4YA 1NI5A 2CK3A 4XWWA 1DXQA 3HM2A 2OHFA 4DLLA 3FB4A 1COWD 4C4SA 1WPGA 3D3QA 1ODCA 3BD6A 3L79A 3PVCA 2XE4A 4FC6A 4M76B 3OIVA 3CNEA 1Z4MA 4FE4A 4LOHA 1XFAA 3DVSX 1TKAA 5DWVA 3RLIA 1RRMA 4B7AA 4ZCIA 1GZ6A 1SHUX 2HF9A 2QQ0A 3O94A 5CFRA 2WW8A 5J2TB 1U4NA 3C6ZA 2V7TA 4MKIA 3IDZA 4UFOA 5CG1A 3K5IA 1KEWA 3PQEA 2CL0X 2V6BA 4FR2A 2QIPA 4LRWA 3AM1A 4I99A 4H0CA 2E4UA 5TPZD 1QB8A 2H08A 2FKNA 4Y0NA 4F7WA 5LYJA 4Z8YA 1A95A 3PFCA 2R8YA 3DZHA 1P8AA 4G1MB 4C6TA 5TIIA 3TGPA 4OKSA 4MMYB 4GU5A 4J6FA 3E2IA 4YJ2F 1I01A 3KEQA 3OFSA 1BCRA 3PIDA 4DMHA 2RBEA 2YIMA 3WG9A 5A5DA 5JNRA 3O5AA 1ZI8A 4AKGA 4PPGA 4RHCA 1J0CA 2VSXA 3AFIA 3IVAA 4B33A 2NOAA 2FPIB 2PT5A 5H82A 3QUTA 4YAIA 1BCRB 5EJ7A 1PR4A 2VCEA 3ZHCA 1OXVA 4L02A 4XARA 3GRRA 4C0KA 3QMMA 4LBWA 4AJHA 4X7MA 1VSQA 2J5QA 3M6AA 1WB9A 4Z53A 4X97A 2XMBA 5DN6D 5LQCA 1DO0A 1OC2A 2X5JO 1NVXQ 5TNXA 1YRQA 3SCZA 4CDMA 3F71A 3PQ7A 5E2BA 1UFVA 5KHOC 5GOTA 2NV0A 1A5TA 2V8OA 5J2TA 3O6VA 4BNVA 3NJ8A 1CWUA 4M1ZA 2IX3A 4H35A 3SLGA 1PD0A 1EDOA 1KZYC 2WTEA 2RJNA 1BWSA 3DVLA 3JARB 1RQGA 1UP6A 4FE7A 4TS3A 3AHIA 3IUSA 3FUCA 1T5LA 5E9AA 5CDSA 4PCVA 3OQIB 4EPWA 4YRBA 2FRDA 3W1WA 1FYEA 1QFJA 2GEJA 3A9UA 3MCAA 2ADMA 4X54A 4NJMA 1V8OA 3KWFA 4ZVLA 4Z2YA 5L4LA 4O02B 4QDXA 3FKSD 1VE6A 2R60A 3O83A 3OJCA 3WLNA 1CETA 3DF9A 2K5UA 4GXQA 3WSVA 2Q5LA 1KARA 1F5SA 2QMHA 4ACBA 1OWOA 4XM0A 1WU7A 2VJQA 5FNVF 4ZTZB 3LPAA 4N65A 3K70B 4U7TB 5T8KC 2PT9A 3R20A 4ZPXA 1DV1A 5AKKA 3G8AA 1XTIA 3LQRA 4W8HA 5B4UA 3GLGA 2DYKA 1SQFA 5TEWA 3TSYA 3G5UA 2LDBA 4HX9A 1B73A 4AJ9A 5LMCA 1DC4A 3AQ4A 4OXIA 2HJRA 2OFWA 4KPYA 1LDGA 1WXFA 3H8VA 5ALNA 3HO8A 4GOOD 1NR7A 4RY0A 3LVQE 2BN4A 3GGCA 3T6KA 1AHIA 4RFVA 3HCPA 3RFVA 1Z0AA 4K9MA 1ZZGA 5SY4A 3VH3A 5ADVA 3O8RA 3L06A 2VDWA 1QCZA 1T0BA 3S1AA 1D4FA 3BIXA 1DKPA 4HY3A 4RIEA 2JJMA 5FL7D 2YRWA 4AF6A 1KI4A 2J09A 2J0UB 4RMJA 3G23A 2FSVC 2QSYA 3GEBA 2BD0A 3P9PA 4XQ9A 3C6KA 4Q9NA 2WU1A 3VR5H 1JBKA 1VOTA 2P5YA 3B5EA 3DBLB 1UBLS 2HV9A 2WIGA 2XYHA 3GJYA 3MUEA 1R0WA 1ZRHA 1DRUA 2RHGB 1M6EX 3E05A 3IIEA 4CWAA 2HJSA 4HWOA 1AT1A 1YFZA 3EVNA 1K3UB 1KAGA 2BT4A 2PZKA 3AGQA 1GYRA 3I01A 3ICCA 3JQAD 4A10A 7REQA 2O8EA 4J9UE 3FDIA 1M8KA 2O19A 2YVKA 3ETNA 3RRBA 1EK2A 4A9AA 1E2PA 5GONF 4FEYA 4JBXA 4MCJA 3HCCA 2HK8A 3KX2A 4KXVA 2FUG1 1QOZA 2DQSA 4OI4A 1STOA 2AWNA 1G7CA 4FIZA 1ZCFA 3AQIA 2Q5JA 3IILA 3PCXA 2QP4A 1DADA 4FW8A 1YDWA 4WBXC 4G4SO 4KIGA 4Y1EA 1ZONA 3PRKE 3ORSA 1V8PA 4HDKA 3RS5A 2B4QA 3WJ7A 4KQEA 4H7KA 3F4KA 4MVJG 2FEPA 4G97A 4JHXA 1FP6A 1NY5A 3IP1A 3CEAA 2FQQA 1FYVA 1WCYA 4M0FA 3A11A 1K8QA 3KT0A 4CG3A 2A88A 2P5TB 4OFXA 3EPJA 1BE1A 1W5BA 4X5OA 4M8SA 3AR3A 4IOMA 4K6OA 1X7YA 4REOA 1RRCA 1E66A 4W63A 4R5HA 4E1AA 2QNIA 3F7OA 3HN6A 1NFQA 4RZ2A 2ZR7A 2YMPA 3Q12A 2H1IA 5LA6A 4UFPA 2HCJB 4MR8B 2FDXA 1UINA 4RD6A 1P1CA 4HQ6A 3E5RA 4NS1A 3NQ41 4IJQA 3U5TA 1R0SA 1CZHA 2YYYA 3AX6A 4KVAA 5DCLA 5CVUA 3N5KA 4HT3B 1YDGA 4Z0TA 1FRVA 3HKCA 3OPYA 2JBAB 4YHBA 4AY5A 2VYNA 3FTFA 4L6CA 3FCUB 2QTNA 2YMQA 3CNQS 3Q11A 2CE7A 4L8GA 3SKXA 3GROA 5CH8A 1X7ZA 3BDIA 4YPOA 5EZYF 4GPTA 4OHRA 5KJFA 2VXBA 5KNCH 2P40A 2Q29A 1FYXA 2AOUA 1V4VA 2E87A 3PDCA 1N0HA 3OOWA 3G7NA 4RM2A 5JSFA 3HPRA 5JCPA 3INGA 1W1UA 13PKA 1JA1A 1I0LA 2UZIR 1QAOA 5FDFA 2PQMA 2WU8A 4LZJA 3B6KA 1SELA 1SU4A 3IA7A 1RBYA 3TB6A 1L9KA 3AEZA 1WSBA 2GRJA 2QPAA 3GMIA 1U0SY 1U8XX 3IQFA 3QU9A 3LY9A 1JIJA 1Y4AE 1J7KA 3HDQA 3UTDA 1XEWX 2PUVA 4E0BA 2W0MA 4KQXA 1FS4A 1JQ5A 4O63O 5B1IA 1B6TA 1OXSC 1Z26A 1JFFA 1GU7A 2LXNA 1EFCA 4WERA 1NU8A 2JFWA 4MUYA 4OQ4A 4P7GA 4B2PA 2CYBA 4BO3A 5KTSA 4F3TA 3QV2A 4YRDA 2NSJA 4OHVA 4KITB 4MVYA 4PCLA 1P74A 1P5JA 2C42A 4D8WA 1JEYA 1DKNA 3SKVA 1EXVA 3QVLA 2VHUA 3WP0A 2EBHX 2WIFA 5BNFA 3R75A 1HUQA 3UYLA 1HTTA 1ZOIA 5GONB 4DCOA 3PHGA 4JC0A 3ABQB 3L07A 2IXFA 4KMOA 3T54A 4JI4B 2QTVA 4TVKA 4G8DA 2WYWA 1I7QB 3HYSA 5IC6A 4LEIA 1E3TA 3AT1A 3G59A 2C31A 5IDQA 1EX1A 2C59A 2CUNA 4I66A 1ZOSA 3R5SA 4LXGA 4YRNA 5FPSA 4OXXA 2ZI3A 5H3HA 2RH8A 4RV9A 1NJFA 5K3OA 4GGPA 5E95A 3OT1A 1OH7A 5BMVB 1BGWA 4A3SA 4PYOA 2W2PA 3G0OA 1E8DA 3PKIA 3WGNA 3U3KA 4KUHA 4YASA 2H6EA 4YV2A 4JOQA 2ROQA 3VVLA 4PSUA 4MQMA 3W8EA 3KR1A 4R9VA 3UA3A 1YJQA 2C9BA 4R41A 1B0AA 1J22A 4QDUA 2HU2A 4KDFA 2V6JA 4RSHA 4YDSA 3DLAA 5A3SA 2QU8A 5AI9A 5CDHA 1RLJA 4X63A 3A9CA 1U8ZA 3F5FA 3S2GA 3KZXA 1I7NA 2CFCA 1XRPA 1Q83A 3FX2A 4G24A 4L15A 4OQDA 4X0EA 5ALLA 4UM5A 5GV8A 3UGQA 4N03A 1H5QA 2YJZA 2L17A 4B4VA 1FK8A 3BTOA 3TRFA 3GJRA 1MN6A 2FP4B 4MXDA 2XUGA 5ESRA 4RMHA 5AVWA 3G8BA 1QS0A 2R8OA 1HZZA 4D9HA 1F3LA 5GQSA 3DC2A 1XZEA 3PC3A 1VBNA 4N0DA 3TX2A 3ADBA 4BKOA 1YCDA 2PEYA 2JIZD 3RQSA 2WIJA 1TU4A 1S2NA 1UAAA 2NTJA 3H5LA 5KTYA 2CSXA 1KNXA 5D5QA 4H7EA 4LTMA 2P5SA 1AN9A 2WWWA 3FZGA 1ZM4A 2VCHA 3QUBA 1KYVA 2NVUA 2IDJA 5FP0A 4DA7A 1E3QA 3KZMA 4KDRA 4ZA2A 1WQ4A 3LHKA 2VPPA 1W36B 1VHWA 1Y9AA 1HRKA 2VAWA 5FA5A 4NBLA 3WZ2A 3GGOA 2ZBRA 2CNWA 4ND1A 3BGDA 4TS4A 2OENG 2ZR9A 2NO6A 2YZGA 2BDUA 3N2KA 3TGWA 1JKJB 3T1YB 3FWKA 1YQWA 5JY1A 1PIWA 4XPZA 1LPOA 1W2WB 5GIOE 5NULA 2NTVA 5EN4A 2QLNA 4BJHB 1PR6A 1GTJ1 3HV2A 3LXMA 1ML3A 3OLYA 2XX3A 1EYZA 3KQYA 4V0QA 3T3EA 1DO8A 1NQTA 3NBMA 5BQOA 1PSWA 4ZT6A 3SIWA 3BPSA 1J5EB 3G2IA 3CVOA 4P34A 1IXKA 4ALKA 3PI7A 4ZEXA 2WHPA 1GUFA 1WR8A 2BELA 2WAXA 3P7MA 1IY9A 2UYHA 3NCHA 3FKSA 4XLLA 1BYUA 3CF4G 4AECA 4EHFA 2ZATA 4X7PA 1JXAA 2AA3A 1JXOA 3M6UA 3Q8WA 4GMFA 3HN2A 2DWOA 4J4TA 4NEQA 4EO4A 1T2DA 2JZCA 3NGXA 4E22A 4UAUA 4HXGA 4ZAYA 1KVRA 4EUSA 3UH0A 4X7BA 1MOQA 3O4IA 3CO5A 2JCXA 3GUZA 2FP4A 3TDNA 1GV1A 1N2CE 2JIQA 5B4TA 5KSZA 4ER7A 2IEBA 3PC7A 4FBMA 4L08A 1W2HA 5BSGA 1PI3A 1WEHA 3C70A 4EJ2A 4S05A 1FF9A 1NQUA 3I1YA 2O0HA 1QE3A 4U2DA 4IO0A 3WDSA 4L16A 1XEAA 3P20A 4S1WA 1PGOA 3DHYA 2OV6A 5KAMA 1HEUA 2WQZA 1P4HA 3W6UA 1H8HA 2HJHA 2OCGA 3NH6A 1C5KA 4RL4A 4RF3A 1AK1A 3G1WA 1N92A 1P45A 1JB9A 2GN6A 4HMOA 2OHHA 4XEHA 1EHCA 1MC8A 2DWPA 1PFVA 2RCYA 3ABOB 1ZUWA 1ZJYA 1TGYA 3HBJA 4JR1A 4L73A 1MR3F 1RXIA 4N7MA 4QBHA 4S1TA 4DDTA 1UFOA 3BIOA 1XJWA 4RGYA 1R9JA 1IHPA 3K15A 4N0EA 2PR2A 1ZM9A 4WGGA 3GFGA 4WXPA 5JAQA 3BB3A 4JI0B 1PG0A 2BMEA 2Q27A 1O9GA 1JDJA 3OZEA 1HE8B 5KEIA 1L2TA 1BRMA 3AL3A 3EGEA 4BFTA 3FMVA 3H5TA 1EGQA 3GUCA 2AD5A 3IHTA 2W00A 3IAS1 3B1JA 1RM3A 3CF4A 4NENB 3D4LA 3V4FA 4EFMA 1QIMA 2I3GA 3BC1A 1A9OA 1QHYA 3M8KA 1W36C 2FN7A 1GGJA 4R2WA 2OP0A 4ALLA 4RY9A 5FBZA 1PL7A 3KV3O 1PFYA 1UPXA 1WPQA 1FFCA 4HCJA 2HAEA 4K9QA 1G8GA 3U3JA 2FMTA 1PL6A 2R5WA 2Y8EA 3RIXA 9ATCA 1OBCA 5FXMA 1CBUA 2WSIA 3DBVO 1US8A 1W93A 2P62A 4KXNA 3N7TA 4NNPA 1NNI1 2G8NA 3GEPA 5HUJA 3VI4B 2NU8A 1OIVA 3WAKA 5JXJA 3FWZA 2B5WA 1E79D 4BE9A 3PQ2A 2BZ1A 3WGTA 5IJ9B 5KNBH 2IYUA 2FTKE 3WHPA 2C9YA 2CMFA 2NV2B 4EW1A 3ICEA 2D1RA 2ZYUX 2WT9A 3QG5A 1E2IA 4F6RB 4MKRA 1C1XA 1TUBA 1P2TA 1XA4A 2ZJ0A 3G5AA 4NXMB 2Z95A 4C4OA 4CQJA 3KSAC 1JIXA 5AI5A 3PQ3A 3DYIA 4UOZA 1J90A 3DB2A 3MJEA 3EIEA 1CUBA 2Q28A 4WEQA 1RI3A 1GN8A 1RXCA 4Z8XA 1KAMA 2JKVA 3OPXA 3URMA 1MB2A 4GOND 5HRUA 1R9GA 4MWSA 3D02A 5FTMA 3UN1A 4WFJA 1DS6A 2NT4A 2P6OA 2GEFA 3ODGA 2UVPA 4EW3A 2NZWA 3I2JA 1UKYA 2Q3JA 3FD8A 5BSTA 5DW0A 1XXHA 2CJYA 2CCKA 4QM7A 4L07A 4LNHA 4FDLA 5I7HA 1QFZA 2P9YA 4HBGA 4PZAA 1Y7HA 4NYJR 2HMUA 2YZMA 2PAFA 4P32A 2QGZA 2AVDA 3D5QA 4K9KA 4EI7A 1O6GA 5F23A 2EERA 4KQGA 4C7VA 2Y67A 2P0EA 2Q8NA 3RSZA 4GF5A 4MGKR 2D54A 1EFAA 4TKUB 4LJRA 2P2DA 3AEKA 4LS3A 2AJTA 3DE1X 4AG6A 5IWCA 2JLXA 3GCZA 1QGZA 1YZTA 1KRHA 2B8JA 5DX1A 2ZG6A 3OBIA 2O14A 3G1UA 1ZMXA 3FOAA 5HJEA 2O1WA 1PVOA 5B6JA 5JH7F 5P21A 3IQDB 4KPGA 1PW7A 1R74A 3E8SA 4IV5A 3KYDA 1DKMA 4XYGA 4U5QA 5TSDA 4EMTA 3KKQA 3UK6A 1UMCB 3B1XA 1FUUA 2RGXA 3R9IA 1Q20A 3GEIA 2JJ8A 1DFGA 3TWOA 3JZDA 4Z4IA 3ECCA 1GLNA 3DAHA 3KQOA 5MGBA 1RYBA 3KYBA 3BQ9A 4JQZA 1SHJA 1NI3A 4NE9A 1SURA 4KQIA 4A0HA 5KYXA 1DHTA 1C9DB 2YJ4A 3EVBA 4MS1A 5EJ4A 1R5OA 2QD2A 1KF0A 2W11A 1YT5A 2JH9A 2B8WA 3GLKA 4RKEA 3GRCA 4MARA 4HN2A 5B6PA 1T2FA 4FX5A 2I9PA 3HCOA 1QRTA 1LDNA 3BAFA 3E53A 3EGDA 1ZM3A 2X1LA 2FSSA 2ZQZA 3BFVA 3GVHA 4PSAA 4PC3A 3VC7A 1KMNA 5A5EA 4YGXB 3LC1O 4KE6A 5A06A 3DLIA 1YFLA 5TJ9A 1QLWA 5FOVA 1DKRA 1JILA 2H11A 2VLIA 3OOYA 4RSGA 4MVJF 3D6VA 4PG5A 3WAJA 3OQJA 3ZLTA 2X22A 3EASA 4KLRA 4KPEC 3V97A 1E2JA 2A7XA 4RCYA 3GLHB 3IIKA 2JGRA 2DFVA 1L7QA 2GZ1A 1II0A 2KHZA 3HCWA 5CHEA 5C1OA 3TNJA 2WJZB 4IICA 4HS9A 5DTEA 3AF4A 3E5NA 3HGTA 1Z13A 3EY4A 3LBAA 3LUAA 5FTKA 1ZD1A 1QGYA 1RRFA 1TVKB 2AX4A 3LZDA 4H1UA 4JQYA 2YRXA 3L4KA 1I10A 3D6NB 3FI9A 1QVWA 4R01A 1I4OA 5HE9A 3TOVA 4ZEMA 3CLSC 2FSHA 3LPCA 4NCJA 1LDYA 3MJCA 4RGBA 3SJUA 3EVZA 1F9AA 5ALOA 3WIBA 4D9FA 2F62A 4PVCA 4AD8A 5HIAA 3MJTA 2AG6A 1QO0A 1RU3A 1DG1G 3ZTYA 4CU2A 1I7DA 2PUDA 2FZ4A 4FFOA 1SM4A 3OQNA 1TO1E 4GWLA 4EAQA 2FU5C 2PT6A 3WFIA 1TVMA 4D74A 1TYAE 5C5IA 5CVVA 3C3CA 3GUYA 2EG9A 3VAYA 2D5AA 4NRDA 1DCFA 2VHQA 3QBDA 3QEOA 1EGHA 4RD1A 3OFNA 3ITDA 4BMCA 5HPYB 1ECBA 4BFLA 2PJZA 2XODA 1RKUA 4YPFA 4B6EA 2BHNA 2GK7A 5FH9A 4IEEA 3Q7PA 1YU9A 3RSQA 1M8FA 1S96A 3UQZA 4ZI7F 2FZCA 2JIBA 1M2OB 2ORIA 2NZ2A 3DHWC 5DHPA 2RGYA 3BL8A 1NQOA 3D64A 3JSAA 1V37A 3OAAD 4LJ8A 4F1KA 4N47A 4IIFA 5CURA 3JARA 4KNWA 2XCTB 4L27A 3OQPA 2CL5A 2QJWA 4D26A 4GLJA 4W9NA 4WW0A 4P7KA 3ZR4B 4IHJA