1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
3HZHA 1F4VA 3KLNA 1B00A 4Z4EA 1DC8A 4NICA 2OENG 5ABPA 3N0RA 3EODA 4MQEB 1GUDA 3MYYA 1NXXA 1UDRA 4Z99A 2PUGA 2F8SA 4LE0A 3KCNA 1VKRA 3JTEA 1SXHA 4M88A 1RZRD 5KWSA 2R25B 3LOPA 5CNJA 4RU1A 4FB4A 3P9YA 3RVNA 3LFTA 1D1QA 5CHYA 4B09A 3T95A 2FMHA 4NCAA 3RVJA 1BDHA 2GWRA 2JVIA 2XDYA 1Z17A 1NATA 2MYNA 2PAFA 4F11A 2L17A 2RDMA 2KYRA 1P6UA 1ZGZA 2HSGA 2L19A 3N8IA 3RH0A 4TLLB 3LUFA 1W9HA 4P1ZA 2DRIA 2MYTA 3CKMA 2PUDA 1KMIY 2VK2A 3LUGA 1C0EA 2P4UA 5TPWB 4RXUA 5IUNC 4YV7A 4ZMRA 1U8TA 2PUAA 2A9OA 3EJWA 4WXEA 1SXGA 4H3HB 2PKXA 4N03A 4MS3B 3A0RB 2QW1A 3Q7TA 3NHMA 3CLKA 3FFXA 4MS1B 1ZITA 4MYRA 4HYEA 3H5VA 3Q9SA 3EAFA 4WWHA 4MS4B 1EAYA 1ISRA 3HEBA 3C3WA 3KLOA 3M9WA 5TE9A 2Q5CA 1DZ3A 1LJUA 1CHNA 5TQ2B 4G0MA 3CG4A 4MR7A 2O20A 4KFCA 4MQFA 4LDZA 3O21A 4W5NA 3LKVA 4EYQA 1Z25A 2MSWA 5FWXB 3QLVA 5JS1A 4Z4IA 2X7XA 2IPLA 4JAVC 3FDFA 3LTEA 2AYZA 2WB4A 3BRSA 1M5TA 2FLWA 3HDVA 4MRMB 3KSMA 2I6FA 5EWMB 2MSLA 3QLVC 1ZH4A 2FEKA 3URMA 3MIZA 3EGCA 5KQLA 1YVUA 1QP7A 3A0UA 1Z26A 2QXYA 3BREA 5EWLA 3MQ4A 1YIOA 5IBQA 5B3JA 2FQXA 3KJXA 2PUBA 3OO1A 3OMXA 2QSJA 1Z2DA 1KRXA 4EYOA 3IP5A 1MAVA 4N76A 3CFYA 4DADA 2FW0A 5B3JC 3SY8A 4QPJC 1ZHHA 3IDOA 5IEJA 2HPHA 4Z0NA 3ILHA 3RVPA 4XAQA 5FWYA 1BDIA 3D8UA 2W42A 4NCBA 2PLNA 4MLCA 2MSKA 3L49A 4ZJPA 5I4CA 3HK2A 4JOQA 3CG0A 1DCMA 4MAAA 1QKKA 3NNSA 1W25A 3N75A 1H9CA 3I45A 4LE1A 1QPZA 4JB2A 3HDGA 5TQ0A 3JPWA 3OLWA 4WZZA 1RXIA 1NXOA 2VYCA 4ZMSA 2AYXA 5TQ0B 2J48A 3JPYA 1U04A 3TMYA 1MB0A 3JVIA 2IOYA 4RK0A 5JNVA 1U2PA 2ID7A 2FVYA 4N0PA 3VNBA 3JVDA 2F8TA 3UKJA 3F73A 3DLBA 4OLAA 4WUTA 4CBVA 1DG9A 3HM9A 1KRWA 4OBBA 1ZAYA 1URPA 2FLKA 2R4QA 4G0YA 3GV0A 3RVKA 4TN5A 4XXHA 2JBAA 2JRLA 1D4ZA 2B1JA 2QU7A 3JS5A 4LRQA 4PE5B 5CNIA 5DKFA 4KQCA 3EDCA 1JWLA 1JDNA 1A0OA 3OLYA 2E4XA 3HS3A 4G0ZA 2RGYA 3QEKA 1EWVA 5BQ3A 3HCWA 2PJUA 3MMNA 3CZCA 3LKBA 3EQ2A 5DGCA 5JNTA 4Q6WA 4MR8B 1M2FA 3HVRA 3CHYA 4EY3A 2PUCA 4RS3A 5EWLB 1M5UA 2HQOA 1PEAA 3OM1A 1E2BA 2E4YA 2A9PA 1E6MA 2P9HA 1USGA 3RVQA 4OATA 5EWMA 4EVQA 1EFAA 4MRMA 1TJYA 3QK7A 2FMKA 3B2NA 3KG2A 3LUAA 3UK0A 1DBPA 3BRQA 3H5LA 3R0JA 5FWXA 3RQIA 3H6HA 4H3KB 3TD9A 4EUKA 4XFKA 2FN9A 5JNSA 1JYFA 1MVOA 1ZESA 4RY0A 1J56A 4MQFB 3OQMA 1DCKA 4KK3A 4PZ0A 6ABPA 4KVFA 3HO1A 5TPZA 5GOTA 1JLKA 1RZRA 8ABPA 2GKGA 3DBIA 2RJOA 3TX6A 2NZVG 3CU5A 3VNAA 4KNYA 3E61A 5F64A 3HXMA 2QZJA 2M98A 4IRXA 3IP9A 3O1JC 6CHYA 4EYGA 4Z9AA 4KRFA 4HNQA 3O75A 3CNBA 4RK4A 5HSGA 1LBHA 3G1WA 4MS1A 2FMIA 3FGZA 2YHBA 5DCLA 1D1PA 1RXEA 1FSPA 1ABEA 1JX6A 2FMFA 5IEBA 9ABPA 4RK6A 4MS3A 3QLUC 4N0QA 2PUEA 1YK1A 4D74A 3FFWA 4IMJB 1ZVVA 3L6UA 1JYEA 3SQNA 1NY5A 5TPWA 5IX8A 2JCGA 3IPAA 1Z15A 1NXWA 3QLUA 3KTOA 4YLEA 5IC5A 4G97A 5KQPA 4S04A 3OO0A 1HEYA 4KZKA 1ZDMA 4W5QA 3TB6A 5PNTA 2WRZA 5IUKC 4RXTA 1PHRA 4MPTA 1JH9A 2LPMA 4HNRA 5JNUA 2FXIA 3D02A 2HQRA 2PUFA 3F6PA 3O2JA 1GLGA 3FMVA 2PE5A 3LMKA 4KQ9A 1CEYA 1NTRA 2WMYA 2CHEA 4JA2A 4MR8A 5HM6A 1QMPA 1QO0A 3QLTA 3O2SB 1YMVA 3KHTA 4YP9A 1VRVA 1C4WA 3IP7A 3H1FA 1DBWA 4Q6BA 3GRCA 5GQSA 2FTKE 4O1HA 1USKA 1QP4A 4EVRA 1MB3A 4UHKA 4PICA 1ZGGA 2VUHB 2JBAB 2FQWA 2ZAYA 3I5AA 3CRNA 5BR1A 4MR9B 1M2EA 2VUIB 3TO5A 1P2FA 2E4WA 3OMWA 2QR3A 3LUCA 2IYNA 3QX8A 4ETNA 3ROTA 4DQDA 4EGSA 1A04A 1IIBA 1WETA 1Z2EA 2YHAA 3HSYA 1DCFA 1S8NA 1T34A 3C6QA 1DP4A 1QNLA 1QO0D 4RDCA 4RK7A 2MYUA 4O5AA 3GYBA 1EHCA 3S99A 4RXMA 3RVLA 1PEYA 2H3HA 2JK1A 3MM4A 1NXPA 3KKEA 3OM0A 3A10A 2N9UA 3NBMA 4G0XA 4YO7A 4QYWA 3RVRA 3BBLA 4E7PA 3H1GA 1L5ZA 4N47A 1NXTA 1QP0A 3HUTA 3GL9A 1DBQA 4QYMA 4IGAA 3HV2A 4RK1A 3A3KA 4Z4HA 5CNMA 3RVSA 5JNWA 2IKSA 1P8AA 3DZDA 4YWHA 3Q7SA 2IPNA 2WJAA 1FFWA 1JF8A 1TM2A 5KC9A 2B4AA 2FSPA 4XLTA 2TMYA 5FWYB 2JVKA 3GA5A 3LUKA 5EWJB 3F6CA 5FBHA 1Z13A 5HQJA 2FN8A 1DRKA 4KPYA 3QELB 4IF4A 4S05A 1LK0A 3GBVA 4RK5A 3H5TA 2JB9A 3O1HB 1K66A 4G0OA 2QVGA 4Z4CA 1K68A 4RZSA 3OLZA 4TMYA 4JP1A 2PMCA 1GUBA 1E6KA 1ZH2A 2HJ9A 4E7OA 2L18A 2FKAA 1Y1LA 1XWWA 3MF4A 2IPMA 5DTEA 3Q15C 4FE7A 3H5WA 1MIHA 3G85A 1RPJA 3QEMA 4IMIB 1USIA 1DJMA 3CZ5A 1D5WA 4ETIA 3N0XA 4JASB 7ABPA 1RNLA 3W9SA 1YS7A 3T8YA 4OLBA 1D2AA 4MGEA 5BRAA 5CNKA 1OXBB 3QX9A 4XASA 3RVMA 4DN6A 2A9QA 5DLEA 2NZUG 2NT3A 1ABFA 2E4UA 3E3MA 2LUOA 5D2CA 1NXSA 4MR7B 3NNDA 1AB6A 4OG2A 2FEWB 4KK4A 4Q7EA 5TQ2A 3Q41A 1XHFA 1QQAA 3OQNA 3LUDA 3UUGA 2GI4A 3F7NA 3KYIB 1OXKB 1ZN2A 2M1ZA 3DGFC 3IP6A 4MS4A 4PEVA 1JFSA 3GWGA 5TQJA 5JNRA 4RY9A 3GT7A 3ROFA 1FQWA 4ZYLA 1BAPA 1APBA 2L2QA 4G86A 4YS6A 4F3TA 3OQOA 1F51E 1VPWA 1YTUA 1JHZA 5HKOA 2RJNA 1SXIA 4PYRA 2CD7A 1DRJA 3EQZA 1BDJA 5IULC 3OLVA 4YR7A 3IPCA 1I3CA 3H75A 1U0SY 3RVOA 1FFSA 1NXVA 3SAJA 4D6YA 1GCGA 3O2QB 3H5OA 2V0NA 2ZWMA 4L4UA 4Z4GA 3HJFA 2FQYA 2LP4Y 4OTZA 1JL3A 2CWDA 4WXMA 2PL9A 4G0PA 1TMYA 3NHZA 2WWVD 3K4HA 3GBPA 3SG0A 5KQGA 1EWKA 3HUUA 2PL1A 1YMUA 1XHEA 1JBEA 4NQRA 4RWEA 4GPAA 2NUBA 1QQBA 2IPAB 4MQEA 3NNNA 1AB5A 3SNKA 4L85A 3C97A 3C3MA 3ILYA 4H60A 4Z4FA 4QICA 3N0WA 4MLDA 1KGSA 2CHFA 4ML3A 4WT7A 2LBPA 4JB0A 4YGXB 2JVJA 2IDMA 1SD5A 2NT4A 4UHJA 4EVSA 5T7BA 5KI6A 5BRJA 3Q7RA 5JS2A 4FE4A 2QV0A 2OQRA 1LBIA 3H5IA 2FEPA 3QEMB 5KC8A 2QVCA 4RY8A 1ISSA 4IILA 3MA0A 4N41A 4KV7A 2GBPA 1P6QA 3LUHA 3N53A 4TLMB 5C5EA 3O1IC 3LUJA 4ETMA 1GCAA 3O74A 3BILA 1YS6A 3CTPA 4P98A 1TLFA 2BGGA 2HQBA 1SRRA 3DGEC 3FFTA 5T3YA 3N6VA 1EWTA 5IUJC 4RKRA 4Z9BA 4LE2A 4W5RA 1DC7A 1ZY2A 5ED4A 5KQMA 3M9XA 2A9RA 3QELA 2ID9A 5FBKA 4W5TA 1A2OA 5TPZD 1TVMA 1BA2A 4G0QA 2GX6A 5EWJA 4KREA 3I42A 2E4VA 4YCSA 4ZPJA 3T6KA 1PUXA 1LJLA 5C5CA 1L5YA 1U2QA 1VLZA 2E4ZA 3I09A 3T38A 4F06A 3KS9A 3M6MD 3SM9A 4F8JA 1PNRA 1PNTA 3DLHA 1Z16A 3C3KA 4O1IA 3EULA 4KMRA 4LZLA 4RKQA 5E3JA 3KYJB 1BVHA 1CYEA 1Z18A 3H6GA 2R47A 2WJWA 4RV5A 3JY6A 4LX8A 2WY2D 1R8JA 1YK0A 4NV3A 1JFTA 4HNSA 4W5OA 2MYPA 4XARA 4Y9TA 4F12A 1JFVA 1FFGA 4YRZA 2H0AA 2R48A 4LDAA 3K9CA 1E6LA 3CS3A 4GNRA 4RSMA 4EYKA 3OLXA 1Z12A 1JDPA 3H1EA 2LIVA 4D6XA 4MR9A
chains in the Genus database with same CATH superfamily
1ECPA 3KPYA 3NIBA 4V0QA 1U6IA 2Y1WA 4WUVA 4AROA 4RACA 1HTBA 1QHSA 4F96A 3HJHA 3RADC 4P80A 1YUMA 1HORA 1GUDA 4DUGD 1QR6A 2ZU6A 3K2BA 3ENVA 5BV2P 3ER9A 2IZ1A 2BHSA 4Q03A 4QDTA 5AJVB 1VKRA 4RANA 3GGPA 1QF9A 3MMSA 3IOMA 2IYOA 5TQVA 1CQJB 5C1OA 4ZQFA 1SQ6A 3LDAA 2O8BB 4HS9A 1UJ6A 4M49A 2CBZA 4NPCA 2YZ7A 5KHOC 4LJRA 1HR0B 1SO8A 3C3JA 5FPHA 4PZ9A 4H7PA 4BGVA 3IEMA 4DIBA 4AW9A 2HEIA 4GGPA 1O03A 1EKXA 4IOMA 1KDVA 1XEXA 3FYCA 3ME5A 3Q7QA 1JHXA 4IJKA 3G88A 5I01A 4LHEA 5LQKA 2ATXA 1ZMRA 2B1GA 2DBRA 2HADA 2XKBA 1NVXQ 3LHIA 1Q0HA 3OM9A 4BP9A 2PUDA 2JJ2A 3Q10A 4BRUA 5JAZA 4CT4B 2FW7A 2WHPA 3INYA 2X0RA 4FOOA 3K05A 4UHEA 4F2DA 4YDQA 3LFHA 4BWFB 1UJNA 2PUAA 5DBFA 3CT4A 2KMLA 4N03A 4CM4B 1FZQA 4CL2A 1C81A 4JJFA 1H9BA 3OF3A 1V71A 3NHMA 5DULA 3H5NA 2XBMA 1QZTA 1HYHA 3IESA 3CGGA 4PHTA 4PO8A 1L2TA 2O52A 4XPZA 1DOZA 3DCJA 2J07A 3E48A 5FR1A 3C0KA 1R16A 5GWXA 1NA5A 1F9EA 1M8PA 5KNBA 1ZH8A 2C3UA 3DWFA 3CEJA 5TE9A 4B4KA 1W5SA 3E81A 4HB4A 2XVXA 2O20A 2R66A 2BBTA 3IDQA 4XSVA 1TYBE 1MDBA 4XPIA 4PANA 3T3HA 2GS9A 3ZWWA 4EYQA 1KSGA 1NW6A 4LCEA 3E7WA 2ZTSA 1QLWA 4BNGA 4CGYA 5IT0A 2IPLA 5FFMA 3ZR4B 5C8YB 2ZROA 4AX4A 3EXHB 2YXEA 1O54A 1QGYA 2IBMA 1ZOSA 2HTEA 4HDMA 4UMVA 3HEAA 3DE0X 3ZWNA 3ED1A 3RLFA 3OOWA 1RJDA 1HTTA 1JXQA 3DE3X 1EFCA 2IYPA 1IK6A 1ULTA 4DNFA 1ZU5A 1SXJB 1XEWX 3FR7A 3GGGA 3RAJA 1MBZA 1KFJB 3AUUA 2FPUA 5G0WA 2O8EB 4JBLA 4NBSA 5ERGB 5JS8A 3BX1A 1JR6A 4Y2QA 4TV9B 4CEHA 1N1DA 2YBEA 3A1VA 4LTMA 4PQYA 3ZHVA 4P6VF 4K86A 1MJHA 3FCYA 3NO4A 3WL5A 4IIGA 2XE4A 1PX0A 2PEZA 3AV3A 5A3RA 2I7CA 4GDMA 1K8ZB 1U4SA 2N1MA 2HGZA 4D9NA 4FZ3A 4YY3B 4L78A 3EEOA 1I5OA 4G24A 3Q98A 3PFWO 1KO5A 2A5YB 2GF9A 5DGXA 5K1ZA 4DA6A 3WA6A 1AMOA 5C37A 2WTXA 5EY5B 5TGZA 5A9TA 1LSUA 4BX3A 3CW9A 4MLCA 1W5BA 2DYKA 1Q84A 4AAYA 1TEZA 1SC9A 2RH4A 4Y6GB 4CCWA 4DVJA 1COWA 3NNSA 1O5OA 5FB3A 3PHLA 3R5XA 4FPXA 4AN0A 4B83A 4E3WA 3E3OA 5ALHA 3PGMA 4GOOD 2IP2A 5FTMA 3V8MA 4EUEA 4H1VA 3ONNA 4GF5A 2C8KA 2X1MA 4M8IA 2IEIA 3BCUA 4N6GA 2HO5A 5YASA 1HLPA 3T5MA 1H94A 4F21A 2N3ZA 2JL1A 5EXEA 4Q1CA 4E5YA 1JZSA 3OCJA 4A10A 2IOYA 1YCHA 2O8CA 1VA4A 4B3CA 2C97A 2JGAA 4C5BA 3JVDA 5G1PA 1UZMA 3TW0A 5ITZB 2F8TA 5DM0A 1ZICA 2IVFA 3V7UA 2P65A 2Z9DA 3BXEA 4YQFA 4N3GA 3BE5A 2XMRA 5AK0A 4QBGB 3RSGA 1HV8A 4ZT6A 5KJEA 4NL4H 4AMVA 2W4MA 1QHEA 1Z68A 2DT5A 4MKRA 1YJQA 2EKZA 3DEJA 3EISA 5JZVA 3SEAA 3PNQA 1L7MA 2W6JD 4MPPA 4TN5A 3ZKWB 2JRLA 1PD0A 2H2AA 3QRWA 4LN1A 1W8IA 4R3NA 1GDHA 3WYCA 4ARAA 4KAAA 2R2AA 4E33A 4RTMA 4GR4A 5IWAB 3LNTA 3HMKA 1E7SA 3M4YA 1CG6A 4HWRA 3SS8A 1LNSA 3USCS 1XRJA 5AH0A 1FFYA 5T67A 3CVJA 4MPRA 4E08A 2A1IA 1DNPA 1HLFA 2OQVA 1NI5A 5HOEA 1EUCA 5L40A 4OH7A 3TLKA 4RS3A 1LTHR 1M3SA 3EB9A 4ZICA 3D6AA 3ZVNA 5JLJA 1BOFA 3QXGA 3NJRA 4DZRA 3B52X 3NT2A 5LNK6 1U3UA 2XRZA 1F6WA 2XUPA 3V7YA 3OT5A 5T8KC 1EK0A 2W2TA 2UU9B 2XUKA 3T9CA 4BNTA 4KE8A 1M34B 1CF9A 1E3QA 1U31A 2YFYA 3IBSA 3DD5A 1EMDA 4R1OA 4RFLA 4BNYA 3L4KA 1HDRA 4W8HA 1IJKA 4MWZA 3KUDA 3HYLA 3GUYA 3AIMA 4AO6A 2HNKA 2PLRA 4RH3A 3QVOA 2GOYA 4B84A 1J0EA 3WIOA 4BQNA 1N2EA 1D7OA 3I4FA 2QENA 2IHKA 3KKPA 3LT5A 5K20A 3MSCA 1LS1A 5FOSA 1RZRA 2AFVA 1KZ9A 3C6KA 3LHDA 4GI1A 1EWRA 2VZEA 3BMOB 2YOHA 1U1CA 2X8AA 5CYPA 4YCLA 3VR5D 2BGLA 1UM9A 3ZE0B 2AJCA 3ZD9A 2BBSA 3DBLB 1V1RB 1JJBA 4M1WA 5JLAA 4NCNA 4INPA 4S1NA 5GJCA 5F2KA 3TCNA 3CH6A 4GMDA 3QWHA 5CU7A 4LFCB 1E58A 1KJYA 2DKNA 4O2BF 1WEKA 3VI3B 3WZLA 5IAOA 2Y2VA 4HCJA 2XXJA 5F9FA 2I3GA 4KNVA 3SZRA 2UVPA 5KYYA 4KUHA 1RLOA 3BRWA 3SYLA 4C7XA 3HL0A 3U40A 4RFSB 4FFBA 3R7SA 4B7ZA 3P9RA 1W87A 4UTRA 4H4EA 1ZDMA 5CFRA 2QD3A 4OV6B 4C20A 4IYJA 2YZ2A 4LDRA 1N2HA 5AKIA 5EFZA 4K03A 1TU4A 2BN4A 1LI4A 2CVQA 3M8KA 3STYA 4E15A 1O95C 4ZVTA 5IF3A 1J42A 2C1ZA 2XNJA 3G2LA 3LWNA 4MWDA 4ENTA 5C35A 4PNEA 5IZCC 2WF8A 3TSCA 4N82A 4KFRA 2HB6A 4JA2A 5DASA 3LVRE 4B79A 2R6HA 9ATCA 1Q7RA 3JWGA 2R6JA 3T7IA 3T4PA 2I4RA 1DBWA 3EXG2 2GETA 1USKA 1IUPA 4R01A 1EUYA 1QIIA 3WICA 3NV7A 4PFKA 2JDIA 5I7AA 3OTIA 3EOAI 1L6RA 1CUBA 4CLHA 4UHCA 2HJGA 4GMKA 3ELWA 3TNYA 1O08A 1VKZA 1PVVA 2UAGA 3MWDB 3RYIB 4Q9AA 4BGDA 1KMCA 4H6WA 1SQGA 4MKZA 3C4JA 4PQGA 2C42A 2VL7A 2BGMA 1QG4A 2DQSA 2H52A 1N5LA 1XALA 1XYGA 1VL1A 3B78A 3G59A 4HH3C 5CGQB 3S68A 3RFUA 4DIDA 3W4KA 3P94A 1DKQA 1P33A 1SUDA 4X3PA 5EKXA 2E0IA 4DMMA 4LJSA 4C88A 2H1FA 3KSDO 4JB3A 5B4UA 1LD3A 3OM0A 3L0ZA 4HEJA 4HWSA 2VDWA 1CULC 4N47A 3WWOA 1RI1A 3QUAA 3OFJA 5AJTA 3WRWA 4C21A 2VDPB 4DTCA 1EX6A 1SG6A 3IAUA 1L4KA 3NHAA 3H42B 4LXHA 1W4CA 2Z2KA 2X22A 3NKFA 2CNOA 1S2OA 4KOAA 4AD8A 4PGMA 1HZZC 2PV0A 1DOHA 2CUKA 2C4MA 4N9WA 4NDNE 2GJ8A 3PQDA 1Y7HA 2NSDA 3RIMA 2TMYA 5FWYB 1WEHA 2P2YA 2KLBA 3CF6R 3EFOA 3JYOA 3EVGA 3K0AA 4OM7A 1EINA 2FN8A 2ST1A 2ZCVA 4EI7A 1FSSA 4FE3A 2IL1A 4JQOA 3K4QA 5F2EA 3H5TA 4DIMA 2C7RA 4G0OA 1FFXA 2QVGA 3PLRA 1A9QA 2C2OA 3BWBA 2IY7A 3OLZA 2DFVA 4MKHA 1K3FA 1C9KA 4PLCA 5K6AA 1GUBA 3R5FA 2PFKA 2OB2A 5LYJF 2L18A 4HD8A 1CUWA 5L3SB 3MF4A 3R7BA 4H7IA 1EXMA 1J23A 1IBKB 2UUOA 3IXQA 2ZWOA 3UAXA 3QWAA 4G8CA 4JEUA 4QECA 4BMDA 1KMHA 4RETA 1T5BA 5CGZA 2WV7A 3I5YA 1O7JA 3EE6A 4HATA 2Q07A 3H5AA 3VU9A 3W9SA 2QW8A 1R37A 1YTLA 2VDNB 2YHIA 3DE4X 4OP2A 5BRAA 3CR3C 1Z5PA 4DN6A 3DQQA 4F7DA 1FSGA 1LC3A 4W5WA 3FUTA 3VSEA 3LH5A 2LNDA 4JYAB 4A2QA 2NO1A 1KQPA 2EVWX 2GCNA 2P68A 2Q5HA 3AEKA 4S0ZA 2CT8A 3H8JA 1QQAA 3C3XA 3DCNA 3OEYA 4MVJF 1Q5PA 4EPWA 1PSWA 2M9MA 4IO1A 4AJ1A 5TARA 3SJUA 2I3ZA 2ZJ0A 2FP4B 4CNBA 5K8UA 1R00A 2QRNA 2NZJA 3VPXA 1D6JA 2GEBA 2YC2C 3E7PA 1DL5A 1E92A 4U39A 3A2MA 3ROFA 4B8WA 1FTNA 2YV4A 3FNRA 1H2FA 1CJBA 1II8B 1ZUD1 2FV8A 5TGDA 2CSXA 2QL7A 1SPXA 4X1IB 3P9CA 3HA3A 4YRGA 5BV1A 2QRVB 3TPZA 2OAEA 1EJBA 3D6TB 1AQUA 3W2FA 3HCEA 2GVDC 1SMKA 2WFLA 1E96A 3MCAA 1GADO 4LSGA 1WSWA 3EPPA 3HJBA 4FUQA 2VVTA 4D82A 2ZJ6A 1A27A 3FE2A 3FH0A 2G28A 3T9DA 1S1MA 3VUEA 1J8MF 3MXOA 4CMAA 4V2IA 3O8QA 2UUAB 4DR6B 2JLYA 4AS2A 5I7WA 2FZCA 4KGXA 5JOQA 4MQ5A 1L7RA 1G5IA 1L4NA 4CI0B 4EA8A 3HJFA 2OBFA 3N6RA 3WJ2A 3K70B 3AESB 3GZTB 3ZXUB 2PO5A 4L95C 3PB3A 3HUUA 2G0NA 4XR9A 4Y2YA 1GQ2A 5AVRA 2VXBA 3QVUA 3QKSB 4P7KA 4JXXA 3E9EA 4XD7A 4KH1A 3ZCTA 3C74A 3L7NA 1PZHA 1TB4A 1T0IA 1TZMA 1FDUA 2ZOSA 1AB5A 2XQIA 2YZNA 1OWMA 1FUYB 3VGPA 4CQMD 4A36A 5EKSA 1ZK3A 4M9SA 4C3ZA 3HEMA 4AMYA 3B6ZA 2RSLA 4C3VA 2P91A 1GA6A 4RL6A 3CZAA 3CUUA 3WRVA 4HX9A 1Q0PA 3WXBA 2BFNA 3RW9A 4MROA 2C9MA 2ESRA 3DR5A 4GMXA 4RE6A 2QVZX 1H4VB 1ML4A 2B21A 2QGNA 2H08A 2PYDA 2REOA 1A8HA 3HWX1 3TLCA 3UPTA 4TTVA 3A6ZA 3EEIA 3M5CA 4QLAA 5GONB 4AF7A 4GHWA 2LDXA 3QEMB 2ERCA 4C7OB 1W29A 5CM9C 3KSBC 3ELBA 1XT6A 1OREA 3AVPA 5FUYA 1E2UA 4A26A 4CU2A 1ISSA 4EG6A 4Z7OB 5KMGB 5LOVB 2BFPA 5AW8A 1X77A 1BXKA 2J9GA 2DUWA 2ZPTX 1JUDA 1P1JA 2P5TB 2LCFA 4I4TF 1DEAA 1U65A 4PSUA 1DARA 2D2EA 2Y66A 4FNAA 1ZQ1A 3KEGA 4JI1B 5LN1A 4I6EA 2BGUA 3I39X 4OMFG 1OH8A 2WF6A 4HEA6 4I2VA 3CF4A 1AGXA 3M1AA 1GQQA 4QFBA 3SLRA 4M98A 4CL0A 4MCIA 1DIRA 4E5VA 2AHOA 3K0KA 4TTRA 5KCZA 1K08A 1T6XA 4H1HA 2JARA 3BFJA 1PUXA 4GI2A 2G25A 1FVXA 2XXBA 1X2EA 2VHWA 1M6VA 4ILKA 2EJBA 4COKA 1FDIA 3ZQJA 2FEAA 1Q1BA 3KS9A 1IN1A 3ZI4A 1XG5A 1PWEA 3FPJA 1NU6A 5DWVA 5GIPE 3RTAA 4IEEA 1Y6RA 3RYHB 3BIXA 5SZJA 3VO8A 1PW5A 2JZOA 2VP2A 4OYHA 3HN2A 4U8GA 2J0UA 3GEPA 4XQGA 1DBSA 1DXYA 3KLPX 2QF7A 5AP9A 4NMWA 3CH5A 4YRMA 5J2UA 4GLOA 2WUGA 4GOND 1QO9A 1RKQA 2QTVB 3C43A 4D46A 3P9ZA 3UHOA 1YK0A 5KMGA 3BOSA 4UEKA 5I8ZA 2I3BA 2XR1A 4MUKA 3TLAA 4POAA 4HNSA 4ZU1X 5NULA 2BGTA 4K05A 4C7OA 2OORC 4XARA 1VHLA 4WOKA 4Y9TA 1A4UA 2BF7A 5AHKA 1VE3A 1PE0A 1QHFA 1XQYA 2XF2A 5LMCA 1UPUA 1Q6ZA 3Q7EA 4K9SA 3K9CA 4HLUA 3LLCA 4LDAA 2PT5A 1RYHA 4RYDA 5AYVA 5ALWA 3RV3A 2G8LA 1X38A 3NHUA 1I0ZA 3BB4A 1DRWA 3F7OA 4GQBA 1E8MA 2PWZA 4GXQA 3NFRA 4B6RA 4F71A 1T5TA 2J6HA 1TQ8A 2X9GA 3GGDA 3JYNA 1LUAA 4QQFA 3C6YA 4EW6A 5BR1A 1BYUA 2C7PA 4HQFA 1P0PA 4Q3KA 1H2YA 3L1JA 4P8RA 3H6KA 1GGMA 3THYA 3IV7A 1K5PA 3IVAA 4M9CA 1KKLA 4XYGA 3BGSA 4GX5A 4JA0A 4R7ZA 4DV7B 5TS3A 1HK7A 3B6JA 4FDVA 4MUGA 5BSGA 5BW5A 1I10A 3CTMA 1RZRD 1K89A 3G49A 1LPMA 4BDTA 3LW7A 3FHJA 3INRA 4KGVA 1KDPA 3DAOA 3K9BA 1A9XA 4IKOA 2JGDA 2Z0MA 3S44A 3I73A 2GM9A 3E5MA 5I45A 4PPYA 4F11A 3A36A 2IV2X 3O8QB 5EGSA 3AK4A 4TTSA 3NHPA 1MB9A 2WG1A 4OL9A 5FF9A 2AFIE 3IOBA 4EL0A 4TLLB 4E6PA 2RB4A 1PYOA 4MPJA 1GG9A 1KDRA 4FLEA 4IOLA 5DU2A 2A9JA 1RI4A 4B85A 4J0CA 2LRHA 2OKCA 4XIGS 5FBVB 3FNEA 4H3HB 4LWOA 1CZLA 3G89A 4M0EA 5EA2A 2X9LA 3P96A 4DGQA 1ISIA 3IB6A 2ORYA 2QU8A 4BPRA 3CXUA 3T7KA 5JVDA 1V2GA 4ZJUA 4BLQA 4AS1A 3WNZA 1A9OA 2ZIZA 2AVNA 3MJ4A 1M1YA 2CXHA 4X20A 4W6QA 4P35A 4EECA 2MWMA 3S2EA 1XNRB 1ULHA 2PTGA 2GK3A 2Q5CA 2QWXA 2YFHA 4JQSA 3P5SA 4PRKA 3L93A 3SZUA 3V7NA 1J90A 1WMBA 2F17A 1GGKA 3FWZA 2I1VB 5T6BA 1EP3B 3P7MA 2AK2A 3BMCA 1I3OA 4TMFA 3O21A 1W0JA 4HZUA 1JVSA 3SBXA 1JU4A 2JFGA 4U8HA 5F3RA 2AWNA 3AI2A 3FTCA 4XB6B 5DPMA 3WB9A 2GPNA 2WSLA 3GDWA 5BSFA 2X7XA 5E7MA 1SPBS 3VU9B 3CKLA 2AD1A 4WN3A 4Z1OA 3K70D 2WG2A 1W2WB 2OWDA 1KMHB 3KSMA 3R0QA 3WQHA 2ZKLA 5EIBC 1IH8A 4KIFA 1SUPA 1ZK1A 4OUKX 4ZEXA 1JPNA 4D8YA 4LK3A 2FWIA 3BH0A 3DS8A 2JLXA 1M7HA 1UK8A 4IMRA 1DPFA 2BCEA 3A25A 1NQVA 3OAAD 2Z5LA 4J6FA 3TBFA 3NHLA 4JLAA 3DOEA 4PWYA 5J3JA 2F9FA 3G0CA 4BJ1A 1VL2A 4UUQA 5EIWA 1ZI8A 2IITA 5B3JC 3C5HA 1RT9A 2AXQA 4ER5A 2WM3A 2YUTA 2ZSUA 1OX4A 1J09A 2P1RA 4YUVA 1HFKA 1E9FA 5DM70 1IHUA 1IMJA 1G20E 1WTAA 3NAMA 5A3SA 1UMCB 1NG9A 4CEJB 1GOTA 2C5BA 4UBIA 5A5DA 2XE8A 5AVQA 1H23A 1QQ5A 3MS4A 1U5AA 1ZIDA 4ND8A 1IAQA 3AR5A 4EMBA 5BSVA 4ECAA 1XMPA 3AUYA 4LHZA 3TOSA 2P4SA 5F76A 1RAHA 5T64A 3R76A 3KV3O 4HLUC 4HB0A 4K1LA 4PS0A 4N3AA 2LCIA 2J30A 4ICIA 1HT0A 5DCUA 5IT4A 1WQ1R 3NM5A 3OZWA 5CFNA 5K0FA 1VJ5A 5GZ3A 5HUJA 2P75A 5ALGA 2J46A 1R0SA 1P4RA 5DH9A 2V03A 5C1DA 1KJ8A 1GZ3A 1P60A 1B0PA 3QV2A 1A4IA 1GVNB 4FDMA 3HKDB 4HQKA 1QE0A 4N5MA 4YC7A 5WRFA 3SK0A 3FB1A 3THOA 3VJLA 2Q6LA 3O6VA 4GXRA 1E6UA 2AKAB 2BKVA 2ZBRA 3MWEA 1U0EA 4H3SA 3LHSA 4LWPA 1WZUA 3OOEA 4MIOA 1EVJA 2H5LA 3AILA 3A26A 1G3UA 1IHXA 3ICCA 1L7AA 3CMCO 3MWDA 4ZVQA 5KZMB 3KXIA 4LHYA 1AS3A 2GLXA 2NGRA 4MW7A 3G5MA 2YVQA 1TKCA 2ZIUB 3K2QA 4L8YA 4AUEA 4BL5A 3JAMA 5I9MA 2VJCA 4PE5B 4WZ6A 3JS5A 4IR7A 4J1TA 1HE2A 1KFBB 3DKPA 4L5IA 3FOEC 6REQA 2E4XA 2O2SA 2OHHA 3NXKA 3QEKA 4DV2B 3MMNA 3NLLA 5DNYB 1Z5VA 2IZ5A 2TYSB 2Y71A 2BI8A 4OIMA 1DAPA 4CM8B 3NRJA 1AHHA 3CHYA 5HE9A 1X0VA 2KW5A 3D7KA 3NKVA 3ZDZB 1BQ3A 1HO3A 1CUFA 1HRKA 4GW3A 3I1IA 5CFPA 1Z7YA 2I33A 1I5EA 2D1YA 2Y1DA 4EKYA 4XR4A 1OIWA 4TKUB 4AG6A 3AFHA 5HM8A 4PYIA 1TJYA 1E3EA 3RWMB 3L82B 5GZ6A 2NUAB 3IDSA 4H59A 4EUKA 2OM6A 3U5ZB 3N8GA 3O03A 4RFSA 3T12A 5GM1A 3N59A 5TF4A 1UDBA 3KJEA 4HEA1 4ND1A 4KRYA 5E0OA 2DLDA 2NLOA 2UVPB 5KYYB 3NVKI 1EI9A 1K2WA 3KKLA 4P5DA 3FWHA 3OE7D 2VPZA 4QWMA 5DXJA 1RPTA 3QNUA 3TS1A 4LHVA 2VQFB 2E55A 2QG6A 1K2VN 3MFYA 4O29A 1NDQA 5JXHA 5AK6A 1P62B 3T4XA 3Q3CA 2H1LA 2AXNA 4P3KA 4QDOA 4RHEA 1JYSA 4Q0MA 3RFFA 3LT1A 3O1JC 3OHSX 2WWIA 5JE8A 1UM9B 2H1WA 3H2IA 1SU8A 2QNBA 4BFVA 2GDZA 3B8HA 5DCLA 3U17A 4KQXA 4IZ6A 1XF1A 3U3MA 9ABPA 1KTIA 2R62A 3CPSA 5AVTA 3NIFB 4ZODA 4FIDA 5DHAA 4XYEA 2JIDA 4QG7A 3C7DB 3UV3A 4QVIA 2Q5EA 1NUPA 4LQCA 2FX3A 5TPWA 3IPAA 1H8ED 3L1KA 3VR5H 4BJ6A 4ER3A 4IH1A 2W83A 1P9OA 2RIPA 1SQSA 2XKJE 3CNOA 2QTTA 4PBRA 3ZVKA 3WWDA 3N0TA 4BHTA 4D0SA 1Y6JA 3TKYA 1A8IA 4RQUA 5EOVA 3EK2A 2X0DA 2FHSA 5GADl 1O96B 5AVSA 5L4SA 3R74A 4ISBA 1UL1X 2RHRA 2WUDA 1OZHA 1PP4A 5EIBD 3ZWOA 2PGXA 2LKCA 4FQ8A 4PC2A 1FTYA 4YTEA 1EUCB 1SRQA 3BSFA 2PL5A 2FF5A 2EIHA 3HVHA 1ISGA 5GZ1A 2IYAA 3BE6A 4KE7A 1XB2A 1GGEA 4WSOA 4A1FA 2I9PA 3K8QA 4Q3LA 4RW0A 1EFDN 2W2NA 2IS1A 1D6SA 1VG9B 1S2NA 4DV3B 4ERXA 1GP2A 2ZAYA 4JD5A 1UT6A 5H5JA 2O2ZA 2HU2A 5EE3A 3WLEA 2WQ7A 1N2IA 4WPGA 1SU6A 4EX6A 3TO5A 4ALLA 3FOBA 2COKA 1KI9A 3STHA 3ROKA 4DLRA 1FQKA 4ERNA 1VPVA 4PN7A 1YL5A 3MCWA 2TMKA 1TU0A 2YW2A 4NYJR 4BMNA 4KXWA 4AULA 4U7PB 1Z2EA 1KP9A 2YHAA 1JA9A 1RDFA 4NHEA 1C41A 4LPKA 2O8CB 4YECA 4M7OA 4ZVVA 4ZD6A 1M2HA 3LRXA 3FR8A 3PC8A 4JY7A 3TQCA 1R9GA 1S4QA 1KYVA 2C3PA 2B98A 1BMDA 2H65A 3RSQA 2A94A 4I5FA 4DLUA 2XIJA 2WTBA 1P2BA 4ZVRA 3UMRA 2BEJA 2PVCA 2FFJA 5BMVB 5A4JA 1E20A 4HVTA 4HGOA 1PL0A 2FZEA 2QUBA 4B3TB 1DFHA 1TJ5A 1MT0A 5JRDS 3CF2A 2DPYA 1HRDA 2GXAA 1YR7A 4ND7A 4KYVA 1TM2A 3KAJA 2Y1OA 4HGRA 4IIEA 1QVRA 3N2KA 5REQA 3KB2A 4DM7A 3UGJA 5B3LA 4WLOA 4K6GA 5CB0A 1FRNA 4PTZA 2P5YA 3F6EX 4EF5A 5AESA 1HDIA 3WL4A 5C4IA 3KQLA 4QOEA 3I1FA 4RK5A 4ARZA 1GV0A 1PR2A 3C3AA 3O4JA 4Y6RA 2FWRA 3O8BA 2Z3VA 4TV8A 3UXYA 2VT3A 1YHYA 3FZYA 3WOVA 5M5BA 4TV9A 3LPCA 3ENZA 1RU3A 1E1LA 3FNIA 4C7MA 3UAGA 5HKBA 2ZYVX 3E2PA 5JVDF 5A0FA 2YV1A 1JEQB 1UBKS 4GI5A 5IKOA 1I6LA 1NQ5A 1R4AA 2GZHA 2GYUA 4OHMA 4X84A 1Z82A 5AW4A 2F8MA 3N58A 2EYQA 4KIJA 4D81A 1JI0A 1RBYA 2VNKA 4UFOA 5KU1A 1USIA 2IHZA 2WWWA 3IAHA 4CXMA 4YMUA 2PH7A 2BFBA 4D9HA 4DWVA 3Q0IA 5ANRB 5J2TF 5C8YA 5AW3A 4ZC8A 1UAAA 4BZXA 1E61A 4GQAA 3PFNA 3H7IA 1W4RA 1MXHA 4LYGA 4PHHA 3NB0A 4XASA 3ELUA 2NU9B 4EARA 2K7ZA 2ZWVA 4IVQA 4MXDA 3C16C 4RHUA 1V95A 4H1WA 2J0QA 4L7QA 3NVDA 3IHTA 4RTQA 2DLCX 3NBAA 4TLBA 1IG3A 1N32B 3F0TA 1JHPA 3DTYA 1C7ZA 3UYKA 1UMBB 4EAAA 2YBDA 2VRWA 1JFRA 2OECA 1OAAA 3D6NB 5HQ3B 1GN8A 3EX7C 5TRTA 3KVVA 1HURA 3K09A 4LV5B 3VC3A 1C30B 4BGUA 4KPFC 5JDIA 1XNGA 3KZKA 4J9UE 1CRLA 3GT7A 5ENZA 3SYNA 2HSZA 5AHWA 3ADPA 1Z5UA 4CQMA 2OUKA 3T1OA 1U3DA 3UMMA 2VP9A 4F3TA 3NALA 3U3DA 1JG1A 1W59A 1MAWA 5GY7A 4EKIA 2HA3A 2HRRA 2BLLA 1ZVQA 2RJNA 1WIWA 3NBQA 4FMBB 4PCUA 1LF0A 4KL8S 1Q6YA 4OI2A 4J0GA 6Q21A 3IIMA 4AUMA 3KTFA 2WNIA 1H85A 1I6MA 4OLHA 1I3CA 1XFDA 1EVLA 1U0SY 1BKDR 1TM1E 1H2RS 1UKCA 2EZ4A 2OHVA 2XBUA 4F1KA 4JCCA 2NSLA 5L3RA 1QOZA 2YWJA 1SB9A 3QPUA 1E4VA 3Q72A 3O92A 2JJ8A 2HIMA 2ZWMA 4HK4A 4QUEA 1S7CA 2JGFA 1T9AA 2OFOA 3KZNA 1SUFA 4WXMA 3N28A 1CDOA 3NHZA 4YJFA 1E62A 5AKZA 1CY7A 5E8JA 2O8BA 4CEIA 3DEYX 4NQRA 4PZPA 5DWDA 2Q45A 5DNDA 1NVKA 4OUDA 3CV3A 1TW3A 1XZCA 3C4QA 3QBEA 1X1TA 4TQAA 3SHWA 4OVKA 5KQSA 1NW7A 3O1LA 4CLXA 3AM3A 4FFDA 3MAAC 1BFUA 3ZU6A 5BR7A 3QE2A 3C3MA 1R8SA 3UBMA 4Z4FA 3TE6A 4Q3NA 1XFAA 3IUSA 5HF9A 3UAWA 4B4WA 2LW7A 3PC8C 3QSYA 4ML3A 1DWPA 3SP1A 4DSZA 5LUAA 1UJ5A 3TSAA 2IDZA 4MIKA 1M67A 4TL9A 5IDVA 1U7XA 3KQOA 3ROXA 4RELA 1CD5A 3BG5A 3I6BA 2PKRA 1A9SA 5HDBB 3TLMA 1EE2A 2VF2A 1THZA 4HAOA 3I9FA 3BDIA 3NBKA 1NQOA 1GGJA 1S2MA 4L76A 4X5OA 2AGVA 3LI2A 3N07A 2WAOA 3E15A 3HBFA 4R2WA 1DQPA 2AUTA 4LY3A 3AY6A 1ZIPA 1SVNA 1C1YA 2IZ6A 2V7XA 4QREA 1I01A 3D8BA 4C01A 4LXTA 1Y5RA 3C8ZA 3E9ZA 5AKJA 4BLSA 3AEQA 1KORA 1OLOA 1U11A 2PGLA 3V97A 4J0FA 4FCCA 1KRHA 4DA0A 4W4TA 2A0XA 5FBZA 2C4HA 3CLRD 5F4ZA 1S6YA 2RCYA 1YDEA 4DHEA 4ZJYA 3NOOA 3ZXXA 2IT1A 3IP8A 3OY2A 2NTVA 5BXYA 4FZ5A 2EU8A 1Z5OA 3G17A 2CNWA 4FN4A 1TU3A 2BZ0A 3MJVA 3V6MA 3O9ZA 4UPDA 3KD3A 1ZZEA 1LRJA 3MJFA 2AEFA 2X8WA 3PU6A 2ZI6A 1UXGA 4QGAA 1WF3A 3CPHA 2CXTA 4ZKDA 2EYUA 2HOQA 1UKAA 3S0JA 4X64B 1L5LA 3FZQA 4QFCA 4RKQA 4DCGA 1G5PA 3WLNA 2PWAA 3EXIA 2FSIA 1QRUA 3DMTA 4PIVA 3AONB 5GGYA 2H2DA 2GPTA 1XA4A 2VK1A 3AB3A 4HMPA 2R97A 1ES9A 5F5NA 2M6KA 5CYGA 1ORVA 3WIVA 3QOXA 1CQXA 4RVUA 4MW6A 3VZBA 2YQ5A 3T94A 3VI4B 1HFEL 3M0EA 1SAYA 3LQ4A 3MTIA 2JLVA 4MUFA 2H29A 4HX2A 3H2BA 1IZ8A 1EVQA 5H1YA 3G13A 5CDHA 2ZAOA 3RRNA 4HH1A 3SXJA 3IOCA 2R6DA 4E5UA 4PPFA 3ZHOA 3CS3A 5FYDA 2XOKD 4UTNA 3TZQA 1NZFA 1MG0A 1Z4QA 3A1NA 5K4AA 2QKYA 1CU1A 2DJ5A 3P0IA 5HFJA 5J4HA 4X94A 5LA6A 1KMMA 1L4UA 1XRLA 2WAMA 1AMNA 3KLNA 4Z4EA 4MQ4A 4QVGA 2C2GA 1KVSA 3LCJA 4IDCA 2QA5A 4CMGA 2PUGA 1S9HA 1TZ2A 4GBJA 5TDHA 3FFAA 1LLUA 4NFSA 3VDNB 1PGJA 1S02A 1WW8A 2Z2JA 4IQGA 5ARDA 1XSEA 2P62A 3UN1A 3WADA 5ICGA 2R25B 4GYKA 2W2OA 5EJGA 4TV8F 2G9UA 1ORDA 3F4BA 3T4UA 4Q9LA 1QFZA 2VDLB 4M6WA 3T95A 1V8PA 4IDFA 3NT4A 3RM3A 3SIXA 1RXUA 5AK5A 1V9CA 5D00A 1Q0SA 1LPBB 2MJLA 3RUFA 1XYYA 4EITA 1D9XA 1US8B 4EBBA 3N74A 4JJKA 1VJDA 1V9LA 3ISJA 1D07A 1WNFA 1NYTA 1G9SA 2AJLI 3A4IA 4PZUA 5F1KA 2VK2A 3EWSA 2VXYA 5I9IA 1XCOA 3FYTA 1E2LA 4NPAA 4CDGA 2F59A 1GNLA 2VJMA 3AJDA 3OD1A 4FLMA 4FINA 4E0BA 3E18A 5AVUA 2R11A 1VMEA 4JUBA 1Z6YA 3OMLA 3CC8A 3DZBA 4FW8A 4PIMA 5B30A 1VE1A 2GTHA 3CLKA 3QOWA 4ZRNA 5KJCA 1T9GS 4NTZA 4O2BB 3ZWPA 3OJXA 5KTYA 3ILSA 3IPYA 3MD9A 3VH1A 1E5VA 1KF0A 4NESA 4P4SB 1IWBB 1KHTA 2XI4A 3AFGA 4UNNA 4WWHA 4XE5A 3L0IB 1XMJA 2Q1XA 2P2LA 4JKYA 3VAAA 3WWZA 4EHIA 3NCTA 4HI0E 1HUQA 1T8WA 1LC0A 2BMWA 4R8VA 1JFFB 5JS7A 1JAXA 3OTWA 1D8TA 2AEJA 1JEOA 4NCIA 3AL3A 1YKFA 2A0YA 3KRTA 5AJXA 4B43A 1A4XA 1OIVA 3OHPA 3FMPB 3JAKA 2A14A 3UTDA 2GZAA 4NOMA 3AERB 1NOIA 2JHFA 4LYAA 5HWSA 4G4SP 5I7UA 4BV9A 3LPMA 4YUAA 4EY6A 2V5VA 3ASYA 5FWXB 4JLJA 3CLTD 2WKSA 2DQKA 2IF0A 3BD9A 3AR9A 4HBGA 3A1FA 4I8XA 3IERA 4GFDA 3WK8A 2XYVA 3VYUB 1X1SA 2FEMA 3GLQA 4TT8A 1IQRA 2XLCA 3K0FB 4DW8A 1Z4IA 1T6BY 2GTPA 1XDDA 2OV1A 3G2MA 2MSLA 4NDAA 5EWMB 5H81A 4LF9B 4KU4A 3VU3A 1SXJC 4Z1MA 3SDBA 4EQ6B 2DVMA 4GMGA 4WGFA 2IUFA 2NXEA 2HMWA 2QXYA 3IMKA 3LUPA 4F8EA 2O14A 1CS0A 3TIGA 5C81A 1RM0A 3KKMA 1FMFA 4ZKEA 1KU0A 4UZEA 3VZQA 5FUQA 4UHHA 4XJTA 2C96A 1FYVA 1U9YA 2IEYA 3IP5A 4EFLA 4EYOA 3QF4A 1BXGA 1TUBA 3A6FA 5EL0A 2YIJA 5C52B 5FA5A 4RZ3A 3F6RA 4Z0NA 2O0JA 1RYZA 1SCKA 3BXFA 4CU5A 2X5NA 4FNGA 3DDNA 3DP7A 2W4IA 5IMBA 4F5YA 4QAJA 2J4DA 3VUFA 4QJ5A 3DHYA 4IP0A 5HHTA 4ZP1A 2HD4A 3LHFA 4NBLA 3VR4D 4XVHA 3BT7A 4FZJA 1J2JA 3STVA 1A76A 3HM2A 3L49A 1D1TA 1U3TA 3X1YA 4G9BA 2VHYA 3IILA 3QV1A 2XOEA 2A59A 4KSBA 5AMXA 1C9MA 2ECQA 2QRKA 3OH8A 2AJBA 4GM0A 4X1KB 4EMTA 4M9UA 1W25A 1XI2A 5KPJA 4CM5A 1UBRS 4DARA 3COYA 4E22A 2RG1A 2EP8A 4CFSA 1X7XA 4RLHA 4RH1A 1UKZA 3KKNA 3LY7A 2WF9A 3OZDA 3RNLA 3DJFA 1E2JA 3GMIA 5K0NA 4Q3OA 2AFHB 5JH7F 1TVKB 5K9ZA 2A3NA 5K3DA 3TQTA 3T15A 5D85A 3RLIA 4KR0A 4NMLA 4N0PA 1U9IC 1PX2A 3T06B 5CXQA 3RS9A 4ZVNA 4I9NA 4OP3A 2YKGA 2F4NA 5CX1A 4I8IA 1JLRA 1EBBA 1E6EA 4IGIA 3KJZA 5J9FA 1M0EA 4QFMA 4TRNA 1R0YA 2A4MA 3QX3A 2Z4SA 3HCFA 5EMKA 2VR1A 3G68A 4IXTA 3VGJA 2O2GA 1J39A 2XUHA 1GAJA 2R8RA 5TXGA 4EJ2A 4PYOA 2W37A 3LPNA 3QUTA 4O8CA 3BULA 3IA7A 4MUHA 1MQAA 4RHTA 1EWVA 2XCUA 4LGVA 4B9EA 1E2PA 4AXXA 1NW3A 2YRWA 4RIIA 4E5DA 2Q0QA 4KXYA 4ES6A 3G7UA 2EEPA 3DMHA 3TX2A 1QV7A 3N8HA 1JDSA 3RT9A 1VCIA 4D8XA 1ATZA 4Y2JA 4TGLA 1K5HA 2QL6A 5K3EA 4OK5A 1TPYA 4FGSA 3E6AA 2CMDA 2W6IA 1NRIA 1E6MA 2Q2NA 4M55A 1R2QA 4B9AA 2Z5GA 4CCAA 2JEZA 3AIKA 1JHAA 1XBTA 3FDZA 1ZP6A 3DHEA 1XAIA 3R1IA 3UKOA 3D6JA 4YMGA 4GKKB 3T34A 1V7QA 5DT9A 3R0JA 3PF9A 2J3LA 4C0XA 5DE3A 1O6BA 1K6JA 1DEKA 1QH0A 2P1ZA 4NZYA 3S2SA 3GEBA 1JYFA 3EF0A 2E49A 4JXJA 3SOPA 3PJFA 4BP1A 3OQJA 4D4GA 5KTMA 1A2KC 3Q8XB 4IHAA 4Q9HA 3DZ8A 3H8WA 3ZIAA 2ZUSA 3JALB 2WIKA 3E8MA 2PGOA 2AN5A 1KE1A 1DDGA 1L6IA 1USUA 2E1RA 3L04A 4HDQB 5KVQA 4WEOA 3DVAB 2BMDA 3K5PA 2IDKA 3HXOA 3UAOA 3O75A 3DBVO 4GPZA 2Z6QA 5JAQA 3HB0A 2FMIA 4ZEMA 4US1R 1JR2A 3IQWA 5EKUA 3DULA 4IDPA 4JLSA 1MW8X 3I01M 3SJCA 4RK6A 2XWPA 2VN8A 2WJ4A 4J16C 1H6AA 3SXUB 1YK1A 4K1XA 3QHAA 1MPXA 1M54A 1R0ZA 4IMJB 1KO8A 4MV8A 3WNBA 4XQ0A 3BK7A 4MEBA 2I4TA 2PWPA 3SQNA 3UWDA 3ZDQA 4B5LA 2B35A 1WXDA 1K7CA 1KETA 1NXWA 5IC5A 4CETA 2CFTA 4AM8A 2Q1TA 5D3ZA 4AL4A 2Q27A 1GPH1 4OQFA 2O7QA 1XZJA 4TSFD 1FMTA 2WVAA 2C03A 2QAGB 3EC1A 5K0GA 5JH7A 2PS9A 5EP3A 4Z6KA 4KYTA 3AINA 3D59A 1SXPA 4TVKA 2HXSA 1ISMA 3OFSA 1JDBB 3T9BA 2GZMA 4MRAA 3KXLA 4BYGA 2KBFA 4CMEC 1FRFS 1Y3DE 2OP0A 1Q1AA 4WV3A 1FF9A 4OHRA 1FW6A 3ND6A 4IJUA 4XCVA 1UOOA 4AMZA 1R0KA 3GVPA 3GRCA 1U3WA 3F47A 4QZVA 4O1HA 2PQ0A 2WJPA 1HE3A 3HL4A 1DIBA 2V7BA 1IZYA 1XTJA 3IL2A 1OD6A 2PPVA 4YRSA 2XA9A 1E0SA 3L5OA 4HNHA 1KOLA 2MOKA 4PPNA 1ODFA 3P0JA 3L92A 3VNRA 2QPAA 2E4WA 5HKKD 3I28A 3O84A 1U2RA 1Z2PX 3SICE 3QEBZ 4XVRA 3EEQA 1G8MA 3LXMA 1DHRA 1FBTA 3RFTA 3V33A 1J2RA 3O3OB 1AOXA 3HKBA 3MOIA 4ARSA 1IU9A 3JYQA 4V0RA 3WQSB 1YRLA 5C32A 2X19A 4U7FA 1XPOA 1X87A 1G41A 3GYBA 3I64A 4IHJF 4O5AA 4Y8VA 5ILGA 5T57A 3ONFA 1NVFA 1PEYA 5SYNA 4KPEC 2JK1A 3HU1A 4KRFA 1RJ9B 3PKJA 4YO7A 4QYWA 1CQIB 1Q44A 8GPBA 3GRFA 3MUFA 2A0WA 2NIPA 3U44B 1MO5A 2AN3A 3HI6A 4NABA 4B80A 4G81A 3RVSA 3T1VA 1L5WA 1YBVA 3LCCA 4DPMA 4KDEA 1AGPA 1OMOA 2FJUA 1QIKA 4BBAA 3BICA 4ZVUA 3WOHA 2VF7A 3RAGA 2CJWB 4YNBA 2ZTMA 4HWPA 3V2GA 2G1AA 2RGUA 1TLTA 3PQCA 5HOQA 2O7SA 5FI3A 4BWVA 3TW4A 2BCJQ 1YULA 4R9RA 5T3UA 3WLQA 1W0CA 4BECA 1KMNA 3QBJA 5HZGA 2P1DA 1Q7BA 3UW3A 4II7A 3GROA 2WJIA 3IHWA 2YMLA 3RABA 2R65A 4DV5B 3T7EA 4RJIA 3NETA 3UCFA 3OUTA 5M29A 3DONA 1ZRSA 3W5AA 1GFIA 3AHJA 3M6XA 2D0DA 4QIHA 2OV6A 1DX4A 3FKSA 1NQXA 5DLPA 4RPIA 3VSCA 4B8YA 2YRFA 2BSAA 5E7QA 2R0QC 2X8LA 4FFWA 2V1UA 4F4DA 1R9NA 2OBLA 1JS1X 1NN3A 3FMGA 1NNUA 3A1TA 2GBCA 4JFRA 3WLIA 2PGDA 1A97A 2JI7A 1U1EA 4AB1A 5KVCA 4YXFA 4NNJA 1DJMA 4DYHA 3U1VA 3KAQA 4D8WA 2QVLA 2JAXA 1CR6A 5F12A 1VYTA 3JSAA 2WHYA 4JMLA 5TS2A 1Y8QA 3GHYA 1BTOA 1VXRA 1Z0JA 3PPWA 4FDAA 4XGIA 5ECDA 3SR0A 5A9SB 1JHMA 4HTFA 1TMOA 2HSJA 2VUSA 5DLEA 1BFKA 3LP8A 2GK4A 4EPTA 3TKAA 1UC4B 2WMDA 4P2BA 3WNDA 2B34A 3UW1A 2D00A 1C7JA 3ZZMA 2QM8A 2FPGB 4NV0A 4QBKA 2VH2A 4V1CB 4WK0B 3SLKA 2HSDA 3I52A 1JQAA 3IC5A 5TMBA 2EGGA 4K88A 1PDOA 1PSZA 3HABA 3MN1A 4TWJA 3R3JA 3O4RA 2EKPA 4WZAE 5JZBA 5KREA 5B6JA 3TGLA 1JKXA 2F1JA 4L5AA 4PEVA 1YOVA 3PA8A 2BISA 2IXBA 4YJGB 1XTVA 3PF8A 4I3HA 2QIPA 2PU5A 1DKPA 1BQ4A 2XVMA 3I1YA 4J0IA 4EUSA 5BSKA 4A8JA 3Q0EA 3QE4A 3RSOA 3KQMA 3U60B 1YTUA 4RABA 1MT3A 2CHGA 3GZJA 4IAOA 5ALOA 3DF7A 1Q91A 3JWEA 2ECKA 3OLVA 4KJZA 4ZGBA 1LK7A 2CNLA 4GI3A 4B34A 1KZ7B 2XOXA 3TM5A 1EXWA 1NXVA 3H99A 4YPFA 4BB9A 5ICEA 2IK8A 4FYKA 2HF2A 4N7RA 4U7WA 3UGKA 2DHDA 2HEGA 3GRVA 3KBOA 4D80A 3PNBA 1HSOA 4MAFA 2VQDA 2DWCA 1MTOA 1M5RA 1VPLA 2DT8A 3SG0A 3N5CA 1PJBA 1ZN9A 2CY0A 3F5SA 1GKLA 1DXOA 1N8TA 3ID6C 4JOCA 3B3JA 1DWOA 3GO4A 4EG5A 4C4PA 3EHDA 5FNVA 4MP8A 2VT6A 5CJPA 1Z6TA 4J03A 2EBFX 3DZGA 3DL7A 1P80A 1P7YA 4PAQA 4L4YA 4CFZA 4G2TA 3ZCRA 1RQNA 4A8PA 1KY3A 3V5NA 2BHLA 1PZEA 4JEIA 4BFXA 3NNNA 2C94A 2CL5A 2J5BA 4D4JA 1RQRA 3C97A 3W0LB 4ZV7A 1IEWA 1TKAA 1E3DA 4O4HB 3IVGA 2P2SA 1OKKA 1FU4A 4FDTA 1KGSA 3CLSC 4FJ0A 4NBUA 4NU8X 4RSGA 4BVAA 4NXNB 1P9LA 4G09A 4DCVA 3U7JA 4J3FA 1KAHA 1OI3A 3GFQA 4OHZA 3UWSA 4PYMA 5LYJA 2VLIA 5BN4A 1EVKA 2PJZA 3GGCA 3BAFA 4UCXA 3GNQA 2UZ4A 4H35A 2YJNA 3PHGA 4V0SA 5JS2A 1PJZA 1YZQA 1HEUA 1QYWA 1ZOIA 3IO3A 5IW8A 1P18A 1WDKA 1YR9A 1XELA 2WI8A 4CMIB 2FDRA 4HRAA 3IAXA 2VSNA 4XVCA 2HCJB 4DNXA 3LUJA 2Q6IA 3O74A 4QOFA 1XTBA 4XUDA 4MUEA 1EFPA 1G8HA 5EUCA 1BE8A 4HNVA 2ETXA 3JQFC 1Z3CA 2YVUA 4F6LA 2C9BA 3IVXA 3N6VA 2QXUA 1XU4A 4TUYF 1IB0A 3PFHA 3AVYA 4ZIRA 4J3JA 3L7OA 2FETA 1OLXA 2WPDA 1XIVA 2BJHA 3REQA 3GRRA 2WABA 4D9MA 1TTTA 3BSWA 3WBFA 5JMOA 1A2OA 3GMSA 4BUJA 3PHBE 1OYYA 2WUEA 2ZS9A 2C0CA 4Y6QA 1PSDA 2EW2A 4KXMA 1IIRA 5IFLA 1Q1ZA 1ZFNA 3EIFA 3V4FA 4JI7B 3VVCA 3MG9A 4JUFA 2OMKA 1USVA 3MS7A 1T25A 3DZCA 4WHMA 5CD9A 3QYAA 3HJRA 2EAUA 5DCYA 1T6ZA 5AOBA 1BHSA 4GSYA 3UJ3X 2XQJA 1Y4UA 1PBTA 4MYDA 4TMTA 4KMSA 2ZUVA 4XWWA 2C7BA 1BNCA 2QVYX 2RAPA 3NT5A 1YA8A 1ML3A 3AR6A 1MTZA 1SHJA 4J0DA 1IHYA 2AJDA 3ORSA 4HLCA 4L0QA 1C9JA 5ENVA 1O4VA 3CUSA 5TB5A 3W4IA 4YMVA 5DN6D 2FGJA 5KSWB 1PAUA 2AE1A 1TNDA 4IZIA 2XSZA 5EQDA 4E1BA 4BMSA 5LZ7A 2AOUB 4D3SA 3OC0A 3NXSA 5AW5A 4YFYA 1MZVA 3EDYA 4XUCA 2I6UA 3V8PA 5KUTA 3RSFA 2AEMA 3ZV5A 1Z5WA 3DFZA 4D3FA 3I9V6 5K7SA 4KQ2A 4CIYA 1JIXA 1XROA 3V2HA 4EJFA 4F4FA 2O6LA 2FJ0A 3UMSA 4YHHB 1Y4DE 5IJXA 3BC1A 3BS4A 4NU0A 1G8SA 3LT4A 1NIPA 3N0RA 3VR5A 1XZFA 1E4OA 1V7PC 2IYSA 2WG0A 2Z43A 3FVQA 1BYIA 3I58A 5TNXA 3S1AA 3N2EA 1YNOA 3F3KA 1WWKA 3KCNA 2CK3D 1CZOA 5CLIA 3IE0A 3RSSA 3CUYA 4MVJE 2Q41A 2FCRA 2XJ4A 5KWSA 3WLKX 4BO5A 5EHIA 3T5GA 1GQRA 5DXAA 1TGVA 3M6LA 3I9NA 3VA7A 5AI6A 4ZI7A 2DWQA 2Y4NA 2YVLA 5EYPB 4E21A 1EGQA 1UM8A 1Q0TA 4O4JF 4KYIB 5K0EA 4BWYA 3RH0A 1YS1X 2OD2A 3T52A 2FW8A 1EM8B 2A5JA 4EB6A 3ANYB 4GX2A 3O8NA 4AY3A 4FC6A 1C0EA 4TSFA 4BX8A 2PD6A 4QGGA 4UC0A 1YGYA 4WXEA 2ACEA 3QIAA 4ZVLA 3RV4A 1NX6A 3TR0A 4KXQA 5C7YA 3A0RB 4HH0A 4KLCA 1T26A 5H16A 3FYDA 5KAMA 1HF3A 3RYIA 3ZHBA 1V3QE 1NI4B 4Q4JB 4L1KA 3RU2A 3T0IA 4BLUA 3FFXA 3NHKA 2WU3A 3H19A 4MYRA 4YRLA 1Z7GA 3OCWA 1V8ZA 4FILA 1EVIA 1G5TA 3U7IA 4IINA 4TTIA 4BNZA 1XKTA 2RHMA 3EMKA 3PBKA 4RHCA 2AW5A 2E6KA 1P2GA 5IAKA 5HYVA 1BW9B 2R85A 1T1GA 3DXZA 3GW8A 1KOGA 2DOKA 3WQBA 4X1YB 3CH7A 1LJUA 1YKGA 1NIJA 3ANMA 3FPEA 2JCXA 3CG4A 4JSTA 1N7GA 1OQAA 2WHXA 3MPUA 4N40A 3SC4A 1XCBA 3A37A 2JGNA 3IMGA 1CRZA 1JHOA 5DYWA 4WMLA 2MSWA 1U5CA 4QRDA 2WD9A 4S2EA 1K6IA 2XAUA 2HWWA 2AQ8A 3A8TA 3C98A 2C8LA 5KAPA 3ZIAD 3NBYC 3TLBA 4GZ6A 2Q8PA 1X39A 3ZK9A 1FRVA 3SU8A 2HHAA 1UBTS 2PZFA 4RM3A 1C7FA 2BIFA 1UKEA 3EGCA 4X7PA 2PRZA 4JVOA 3DTVD 3LP5A 2IWHA 2F43B 1NBAA 5FA6A 5LXTA 3ZDYB 1EUDA 1UZAA 3GRUA 5EWLA 3PGJA 1NU8A 2O05A 4WBNA 1N2BA 1Y48E 3DYIA 2IXGA 4TQUS 4RGYA 3IFSA 1NOKA 2C2XA 5L45A 1C1HA 3PZBA 4GKVA 1DAEA 3I6MA 4WX2B 4N76A 4IIJF 3RYCB 2YFQA 1N6IA 2C9DA 1G8KA 4JBWA 1L4HA 4TWRA 1WS6A 2JATA 2HH9A 2X5XA 3FLBA 1ZX1A 1M1NA 4HQNA 1O6FA 3DV0B 1YRAA 4W9NC 2CFRA 2EFHB 3M3HA 2D2IA 1NVDA 3VAYA 1VPDA 1I8TA 5F2NA 1BDIA 2AT1A 4AURA 1UJ2A 2BUAA 2GQ0A 2I6TA 2WMOB 3KKQA 5IF9A 5DISB 4B3MB 1KJQA 5IYZF 4RFVA 2SKCA 3QNMA 4MARA 3V1UA 1QZXA 1ETHA 4UU7A 4BKMA 1Z36A 2BKLA 5IJAA 4CUJA 3D8TA 4GXNA 1YDMA 1FK8A 4LE1A 4PAOA 2FMTA 2QMHA 2QAJA 4JJ7A 3ZH9B 1BS2A 1MX1A 2Q0SA 3I76A 1ZJ6A 3T9FA 3LY8A 2H1HA 3MXTA 2H4JA 4IKEA 2NMVA 1KY2A 2VYCA 4M46A 5A5VA 2NVWA 3JPYA 1Q1GA 1C3JA 1U04A 1WP4A 8ADHA 2XYRA 2BZSA 3PPYA 3H11A 1WUTA 5JAOA 2BKEA 3O8CA 3CH4B 3ET5A 3PXEA 3IUQA 4IRUB 2OOSA 3JRWA 1Z4MA 2P9FA 3DMGA 5K45A 3BMNA 2IUEA 4JT8A 4PFJA 3KJFA 1J99A 1HDZA 4OXXA 3ZWBA 1TKRA 2HT1A 1Y3CE 1D2CA 2HI0A 4KHPB 1KRWA 2H17A 2GD1O 3IQGX 1QFXA 1YBMA 1XMOB 5B7PA 4F5EA 1URPA 2NADA 4BZZA 1P4SA 4G0YA 4NV1A 2QORA 1S8AA 1FVOA 4EO4A 3U3KA 1JBKA 1QFJA 2ZBPA 3CX3A 3GLIB 4JVMA 4GX0A 5I9NA 3MWYW 1MHPA 1SHTX 1JV2B 3RSZA 3BMQA 4HGYA 3EZYA 3ORRA 4JT9A 5FPTA 1K8QA 4HDSB 4DQ0A 3VR2D 4RVNA 5H3CA 2IV3A 3CR7A 4TZKA 5JNTA 1WB6A 4MR8B 4INJA 2Z83A 3OU2A 3DVQX 4QL3A 4RESA 4AXBA 3HVRA 4L75A 3VPSA 3QHQA 6PFKA 3DC7A 1QYDA 2KI5A 1FDSA 1M0TA 2C88A 2EF1A 1XPJA 4FGWA 1RE0A 1USGA 3ND7A 4MI9A 3CZPA 1SQFA 1JE0A 3RJ5A 4A6PA 4AF6A 4EVQA 4UATA 5AVJA 5HILA 3ZLBA 2IW1A 4NCJA 2FN7A 1PJ4A 3V4VB 5A4KA 1JZQA 4YT2A 3ZGVA 5AIBA 1XVIA 2R6AA 3HB5X 1QAQA 5IANA 1ZJ4A 2WHEA 4UVIA 5JALA 4JC5A 1C9NA 2I2FA 3T7DA 3PCRB 4E46A 1NR5A 3NIWA 2ZJ4A 4LW8A 3HH8A 3OCXA 2BFAA 3B20A 2O2YA 2QDXA 3DEIA 2NYRA 3WKDA 1DAGA 2H9IA 4J75A 3N76A 4YJ3A 1T5LA 2RK3A 1R8QA 4A8JC 1HE1C 3K2IA 4OXQA 3SEFA 1PGNA 1UP4A 3TINA 3EEFA 4HNQA 1KPHA 3FPFA 3H97A 3L6BA 5TT1A 1QANA 2PRKA 3QTLA 3WRYC 1RXEA 2H16A 4MP3A 3JD2A 5IEBA 1KP2A 2PR2A 2Z8ZA 3ZY5A 1CRPA 1WABA 2J3HA 4GOJA 5FOXA 4YBZA 3CWQA 4REQB 1DWUA 2W7TA 4GECA 2DBVO 3AIIA 4NU5A 4P4LA 3TDNA 4WBNF 4US0R 4X90A 1G21A 5IX8A 5JO0A 1ATIA 4FOPA 3T3IA 2VF8A 5CEEA 3HKEA 4KMOA 2WZDA 3C87A 4HL6A 4EG3A 5A5EA 4RTNA 1E0DA 2M1XA 1NP7A 3A2NA 3U4AA 1J22A 2Q4TA 3OEED 4AKTA 1LFDB 3IR7A 4GC5A 4N3NA 4PM4A 1E1RA 3F6PA 1J1IA 1U8FO 1YQWA 5JSKA 4DRZA 2TMGA 2ZT8A 4EM6A 2QW0X 2OUIA 4RIEA 4E5KA 4HPXB 2AE2A 1DHTA 2GFQA 3GLHB 1X7WB 4MI3A 4Y67A 4F1JA 2Q3LA 3TXYA 3WI7A 5I7RA 4O08A 5AKEA 4CUKA 5JV5A 4DR3B 1WMEA 1PZMA 2XE7A 1OHHA 3DQPA 4HX5A 4L9SA 3W5HA 1NJ2A 2CLCX 3SE7A 1OV4A 4UZSA 2OZKA 3I5AA 5F7OA 3BGIA 4MR9B 3URKA 1NBOA 1YZHA 2WJGA 1CUUA 4PAWA 2XVYA 3MJRA 2ZIXA 2C0QA 2B20A 3FCEA 3M2TA 3I2FA 3K5HA 2RHLA 5ENDA 1T9KA 4IDNA 2GJSA 3QU4A 4ENQA 2PLFA 3C5CA 3ORFA 3IJ5A 2P9YA 1D9ZA 3ROTA 5CA0B 3EA4A 3WNVA 1XD8A 3EVCA 4NKRA 4MWSA 3WB0A 4D3YA 4WKBA 3HZZA 1C80A 5J2TA 4NAVA 4RDCA 3MWKA 1Z7BA 4LZZA 2YJ5A 4RD3A 4RK7A 4DDTA 2NVUB 4MV1A 2QT9A 5IDQA 2PUVA 5JQGB 5CBPA 2DPMA 2JFPA 4U1RA 4IS3A 1KQGA 2BR3A 1TRHA 1NXPA 2XYHA 1KAQA 4FW9A 4FR0A 1NM5A 1BXRB 2WM9B 2JI6A 1QP0A 5CA1B 3K30A 1DBQA 2YVKA 1Q11A 2VSQA 3E9MA 3S8EA 1YCDA 2FZWA 4GVLA 2DB3A 1PT7A 2UYOA 3HO8A 4GLJA 4B2PA 4GKBA 2DQ4A 3F5DA 3RI3A 4OEHA 5JXGA 5A1TA 3SKYA 3TQHA 5AW0A 5BWBA 5I7VA 2R6GA 3D81A 2QL5A 3PYXA 4FDUA 3GA5A 2WU8A 3D7NA 1WDLA 2JNWA 3LUKA 2XB6A 2BI4A 2X6TA 3M81A 4ZOLA 4D1YA 3AVUA 4GL2A 8MHTA 3O31A 3FUXA 2QGFA 1GEEA 2SHKA 3GLSA 3QLJA 4F9EA 1V41E 2GN9A 4AF8A 4DJJA 1N7HA 2C5LA 3GZNA 4DEVA 2WF7A 4PZAA 3F46A 4TS3A 3AU9A 3GGSA 4M38A 5JSZB 2QPTA 5LIPA 1UBNA 1O9BA 2EKLA 2EFCB 4W8OA 1OA1A 3PQEA 4MQ6A 2GBLC 4DMUB 4QGFA 1NNI1 2WQZA 2PMDA 4WASA 3ZHCA 1FX0A 3GLGA 4X91A 4DCMA 4E13A 1U7PA 2HMYB 4PXSA 3DUWA 5AW6A 2ZULA 2H9AA 1VMDA 1EFKA 1ZWKA 1FA9A 2QRPA 1Q57A 1H2XA 2RHBA 3I5MA 1MMFB 2IGTA 2DH6A 3RIYA 3UUWA 3Q11A 1NLFA 3LA6A 2IOFA 1G8YA 1I33A 1OLUB 4K8RB 4LF4B 4IXMA 3SC2A 1QDLB 2ON6A 4DREA 1LVHA 1PWZA 3CUTA 5JNLA 1NXSA 4B3BA 1RKUA 1U2DC 4G1EB 1A5TA 821PA 5JAIA 2H4YA 3A31A 4UZFA 3OQNA 1H1LA 2XMPA 5FEMA 3O90A 1P1RA 1HDCA 3PXBA 1SCAA 4F93B 1M2NA 2LR0A 4RZUA 2GN0A 1OXKB 2LDBA 1WDTA 1KR2A 5I5EA 5G1OA 3DBRA 1GA1A 3EBLA 3AKZA 1QBKC 2ZRPA 1TT5B 2JKVA 5AJHA 5AOVA 1LBSA 3CF0A 5KYVA 1W76A 4DZZA 3I2YX 1U8EA 3Q8MA 5BNWA 1NUSA 1VMAA 3KQKA 2GM5A 1XVAA 1XRMA 2ZDQA 4RVOA 3AF6A 2CB9A 5EZYB 5EFOA 5JCOA 1ZM9A 3QYPA 1T10A 3FF1A 3AVVA 3EGDB 3TTWA 3FSGA 4BIIA 1OPRA 4ZO7A 4NBWA 4XSGA 5ICCA 2Z98A 5E6RA 1V35A 3JRXA 4N49A 5ELXA 3JQDA 1DJLA 2YJ6A 2RCNA 4ZZ2A 2ZRKA 2CJPA 1GZ6A 3LBIA 2Q5IA 5JQGF 5MFPA 1RRMA 2BFCA 1OC2A 1RWKA 3C8MA 2VQSA 3DMNA 4D9GA 3IPRA 3FDIA 3CKKA 2BR5A 3OJLA 4OHVA 1YMUA 1JJVA 1LVGA 3AB7A 3KZCA 5CT8A 4F97A 1N9ZA 2GPWA 2ZDGA 4HQOA 4PRLA 5SV2A 3EUEA 4GP6A 5JEDA 4ZT7A 3ADCA 1EGAA 3GVHA 1R9MA 1AGNA 1WB9A 5BYJA 4XJXA 2HHJA 4RD4A 3ZQKA 2D1RA 1UDXA 1BN6A 3KQNA 2LIPA 3N0WA 5F9MA 5C8ZA 3G5AA 4H27A 3ZJYA 4FFSA 9MHTA 4WT7A 2QSYA 5BVGA 1F7UA 1QX3A 3VZCA 3QBVA 4ZOBA 3HBLA 1UDCA 3B1KA 4OQ4A 3H2ZA 2QPOA 2HK6A 5EEHA 3QQPA 3V8VA 3QSGA 2CNDA 3TJZA 3DM9B 4LFAB 3NRCA 1WCIB 3CIFA 3P8ZA 5F1PA 4BLWA 4DMGA 5BUQA 2P2ZA 1Z0FA 2IH4A 4KAXA 1P8JA 3F8WA 3CZ4A 4P93A 1XAJA 1WO8A 2AI2A 2M6RA 4PO9A 3RRBA 1OJLA 3RC3A 5ALNA 1S7GA 2EGUA 2HK8A 2JFXA 4HH4A 4ZCSA 1GCAA 1E2KA 1Z38A 2NSJA 4JJGA 4OHYA 3IODA 3G0DA 1XRSB 5KTRA 3LPLA 4BFLA 5JZMA 1EWTA 3IUEA 4D9KA 4RKRA 3NPMA 1FXSA 3WFIA 4D9JA 3M9XA 1I2DA 3GYGA 3FUCA 2W0MA 3DZFA 1JRLA 4G0QA 5EWJA 1KI3A 1Q15A 2PGIA 4F3CA 1X0XA 4GBMA 3B5EA 4RKWA 1N5DA 2AR0A 2IOHA 1JE1A 3V3KA 4L5YA 2O1SA 2PEYA 2VJPA 1AXGA 3K9NA 4B1FA 1G38A 3T1HB 1FJHA 3LD9A 5AHOA 1QE3A 5D5HA 1L7QA 3KYDA 4LCJA 4OYLA 5LU8A 1R10A 1Z0SA 2BYTA 1NJ5A 1PTKA 2SKEA 4DLWA 4YMLA 2AH5A 2UZIR 4OFZA 2OG2A 4PYQA 1OOEA 1BVHA 2OYCA 5F5XA 2CLHB 1MAAA 4M99A 4Y6PA 1L5RA 2VBCA 1KDTA 1N34B 3A04A 4W1SA 5LKRA 5TVGA 5HRCA 3GD7A 4MULA 5NLLA 2XXAB 1HDGO 4Q1BA 2ZI9A 1GZVA 1ZXLA 1T5SA 3PC6A 1V3VA 1ZA1A 1QSGA 1I9CA 3VOBA 1YQDA 5HBRA 1DC5A 1EFRD 2Y68A 4DDKA 2VDUE 1PV2A 2XZLA 2YV2A 1DTWA 4X8LA 4YRBA 3N1UA 3NATA 3Q6IA 3CISA 5HXAA 3A58B 3H9GA 1IBSA 1QTNA 1RIIA 2HXGA 2ZT7A 5K0LA 2OBYA 4DR1B 2BONA 3ZWKA 1XWIA 3NM6B 5EVCA 4U2DA 4AKGA 2W2KA 2BUBA 4Z2AA 4PLGA 2E82A 1F4VA 2C4VA 4MWTA 4BGEA 1GIAA 2PR7A 1DC8A 4PC3A 1YSCA 2FSVA 2SICE 3JQ6A 3VVBA 3KNZA 3ZXYA 3GUCA 2FX5A 1JT2A 2RI6A 3LX6A 4LE0A 4MRPA 2C5GA 1POWA 5THQA 1M75A 2BFEB 1ESMA 1T3LA 2G6BA 2YH2A 3SXPA 5EE9A 2R7MA 1V43A 1WSDA 1YRWA 4JP3A 4B71A 1YT5A 2ID8A 5J4LA 4O3MA 3FRJA 2OZLB 3P9QA 4M53A 4BFCA 1XP5A 4Q4DA 3FKSD 4BE9A 1IZ9A 5AKGA 4YRIA 3KTDA 3ANXA 2PTHA 3A2KA 1JEEA 4UPVA 2VOJA 2AK3A 3RHFA 1T35A 4LNAA 3LUFA 1UXOA 2NP6A 1MEJA 5JDCC 1QVVA 3MMPA 2GKSA 1UFQA 3LX4A 1MEEA 1B0UA 2GBLA 2P4UA 2WTMA 2XZPA 4ZMRA 2QNIA 4WY5A 2J3DA 2LE0A 1NSYA 2I8CA 1EZ4A 1P73A 1ZZGA 2W2QA 2JKZA 3D8HA 1Y81A 4OQEA 3RGGA 4F0JA 2FR1A 2NW6A 1MRSA 3AMVA 1YZFA 4QJBA 4O25A 5KINB 4ZZIA 1NAIA 2CVPA 1RKBA 1QVZA 2D0PB 2GN4A 4UEWA 1RWVA 1VLMA 2J3IA 3TL2A 1P7PA 3BCSA 2YR0A 1KYWA 3KELA 3DVLA 4L4ZA 3JQGA 1K92A 4KBFA 3CNEA 2F1OA 5E4YA 1ISRA 4RD6A 2E1PA 4UDYX 2Q28A 4LY9A 2IUYA 1YR2A 1GWNA 3OIYA 2CDRA 3WLOA 4AO8A 3ZE1B 3V4RA 3F8SA 1DZ3A 2XTZA 2YN2A 4YI3A 1DU4A 1NN5A 3RRJA 7AT1A 2SECE 4KFCA 3CE6A 4OAPA 4NG5A 2JAHA 3EXFB 2YWXA 4OQMA 4J1TC 4ILEA 1J7JA 1R7RA 4HQLA 2WPDD 4N1AA 4BNUA 4C6TA 1EFUA 4DEYA 3DW3X 4XGQA 5KNDA 4N7JA 1OTXA 3HFJA 1E64A 3BRSA 3FMOB 1OH6A 3OBIA 4ME6A 4MRMB 4MEJA 1YDHA 2VK4A 2Q4BA 4YRQA 4CKZA 4WL0A 1FP1D 3VV2A 2YWGA 3HFGA 5IXYA 1M76A 1YVUA 3PIRA 4P81A 1VE9A 2C8JA 2E89A 4RLSA 3AETB 3P9IA 2FOIA 4Y1FA 2WW8A 3SPXA 5B36A 1N77A 1JHUA 4PAMA 3PTLA 4DDMA 4CV2A 2O3UA 4KPGA 5DI3A 2YJZA 3ZV4A 4EA6A 1B26A 2XCLA 3IEXA 4FN5A 1KRXA 1K8XB 3A6LA 1PRYA 3GIWA 4YRPA 4HDCA 4DADA 2FW0A 1QS0B 2WF5A 3WR5A 3FPCA 4QPJC 4ZU3A 2EBHX 3ZE8A 2WINI 2ZVPX 1J5XA 4WDQA 3D1JA 5BQOA 1JLMA 1MO4A 1TYDE 3II6X 1CKEA 3LBHA 4GWKA 4BVFA 4H6PA 2X1LA 5BURA 4IEFB 1AJEA 4DNQA 1OTHA 1SB8A 2XMDA 1PK8A 5FTJA 3MOGA 2CLSA 5BQ5A 1QVWA 2WWYA 4NCBA 3EVAA 2IDJA 3TD6A 4M36A 3HK2A 5J1SB 3DDOA 1TMKA 3BHNA 1H9CA 4ESEA 3N75A 6LDHA 2GNAA 3QKUA 1AV7A 4GWLA 3HDGA 1G0OA 1U2EA 2EFYA 3NWOA 3PSAA 4ZMSA 1M8KA 2AYXA 3WGJA 5TQ0B 2NUPB 4YLGA 1N6LA 3TW8B 2WU1A 5JCPA 1QGZA 4KBGA 2WJ6A 3GARA 3LGSA 4BO1A 4MGYR 1E60A 4OM8A 2GHTA 1SEPA 4PGFA 1A50B 4A82A 3A6JA 4FOSA 1W93A 1IC6A 3LOUA 4Y9UA 3KVYA 3T5BA 1TYAE 1SCUA 1AO3A 1OHHD 2CYBA 3KDPA 2ZYUX 4R9VA 3FLEA 4Z7NB 5FWAA 3L7CA 3HR4A 1A95A 3L8FA 1CIVA 1SD1A 2JBAA 1X7ZA 5F77A 2V1XA 3W1VA 1T91A 2XOKA 3NX4A 2SBTA 4IV5A 4RQTA 3WISA 3BCHA 3HVUA 3QXCA 3GLFE 3JD3A 4EW2A 1PT6A 4G0ZA 1GL6A 1Q1QA 4UBKA 1GLNA 4Y2UA 2FNAA 3UGQA 3UT0A 1Q14A 2PJUA 3W8FA 3ZK8A 4D42A 5F7ZA 5IYZA 1XZAA 1QGAA 3LKBA 3OQ6A 4P3PA 2H85A 3EGXA 3PA6A 4D9FA 1M2FA 3D0QA 2ZUBA 3GA0A 4YP6A 4F9TA 2UZ3A 4ONEA 4QPNA 1LI7A 2XW6A 3S2IA 3ZE9A 1Z35A 3LFUA 2QRJA 3JV7A 4RDIA 3PUYA 5JTUA 3F71A 1ZAKA 4E4YA 1JSLA 1PFYA 2XUGA 4RYLA 5DLDA 4NE2A 2O5VA 4CKEA 3RU9A 4J2HA 1B74A 1KJZA 4AIIA 1CYDA 1RR6A 1A7AA 4M0UA 3W90A 2NZ2A 2O1EA 3A27A 4YMSA 1KYIA 4RQBA 5JBQA 5JJLA 2J59A 2OK7A 4O0MA 3OFNA 4JYBA 5GVRA 1D4OA 3OPNA 4Y1GA 1P9RA 1YZYA 3S5JA 2CNWD 2FSFA 3B1WA 3L46A 1PZGA 1O5IA 5JNSA 3QKIA 4RULA 3PI6A 4Q3DA 1CUIA 4OD0A 5AW7A 2O3QA 4G01B 1N7IA 5MN6A 4LX0A 1P5FA 1JLKA 4BS9A 1Y5IA 3TX6A 3PR2B 4AZ3A 1ZIYA 5TVKA 4C4RA 2MINA 3DWEX 3FMFA 1EFLA 2Q2QA 3OBBA 2OAP1 4YYEA 3CEHA 4DT1B 4ZV4A 1NVUQ 4GSKA 5FTLA 3WK5A 5B5SA 3DB2A 3FGZA 3UT5B 4UTPA 4KBYA 2UDPA 4RTPA 4TMWA 2J9XB 4I4TA 1ZINA 4RPKA 1UBCA 3QPBA 3G2OA 4YRDA 2RKBA 5C80A 2YY6A 3KKOA 4RH0A 3TEJA 2XDQA 3BFKA 4PCVA 2AX3A 1L1RA 4KEAA 4QYIA 2YMMA 1Z15A 3OPYA 2K4MA 3AF1A 5BSMA 3DOCA 3PFKA 5JU6A 1CIJA 5EKTA 1U9IA 3SMVA 5L3VA 3DKRA 1JHYA 2WYVA 2BF4A 1M7GA 1PGPA 3GG9A 4RXTA 5E6SB 3VZDA 2WHQA 3QYJA 4RMHA 3RC1A 2R79A 2ZB8A 4FYWA 4Q5IA 1D2GA 3K8OE 4EF4A 1GUZA 4ADSG 2QZSA 3IBYA 2IUUA 1K6XA 4JELA 4PX9A 1J5EB 3DEZA 4LZPA 1G2IA 3LMKA 3TCKA 2CF6A 3O8LA 1DELA 2O8DB 3I2KA 1I4DD 1G17A 5HM6A 3M6AA 3QLTA 1KQFA 2HFJA 4XWTA 3H18A 2GFHA 1P1IA 2APJA 2BEVA 3IHKA 1FSZA 5HCUA 3RS2A 3ZBUA