1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
4O1HA 2FQWA 2MSWA 4CBVA 1ABEA 5KC9A 2R4QA 2AYZA 8ABPA 3HSYA 3OQNA 3CKMA 4RK1A 2FEWB 3CZCA 1GLGA 3F6CA 3H5OA 2RDMA 4Z99A 1SRRA 2ZAYA 4JOQA 4F06A 3OQMA 4MR9B 2RGYA 2FEKA 4KZKA 4Z4FA 2LBPA 2GI4A 2PJUA 1BVHA 2MYPA 3DLBA 1ISSA 2OENG 3B2NA 3O74A 1JF8A 1YK1A 3FGZA 4QICA 4RXMA 2TMYA 3UK0A 1QO0A 4W5TA 2HJ9A 3IP5A 3NNSA 4MR7A 1D1PA 5IUNC 2E4VA 4XLTA 1U8TA 1J56A 3IP7A 3LKVA 1ZH4A 1JBEA 1XHFA 1YMUA 2NT3A 3CFYA 5FWXA 4FE4A 4EYGA 4RWEA 1FFGA 3OM0A 3CLKA 1F51E 2IYNA 2QVCA 2WB4A 3F6PA 3EQ2A 1MAVA 5BRJA 2FLKA 3CZ5A 1Z18A 3H5VA 3R0JA 3OQOA 3K9CA 4Z4GA 3MQ4A 3LUDA 4PE5B 3KKEA 1W9HA 1H9CA 2F8TA 4LDZA 4RS3A 2IOYA 3C3MA 3DLHA 3QEMA 5HQJA 3MIZA 1QMPA 1Y1LA 3QX9A 1QKKA 4B09A 3QX8A 1RXIA 1SXHA 4W5OA 3IP9A 1AB5A 1MB0A 2MSLA 1K68A 4MR9A 2FEPA 5B3JA 3KJXA 3RH0A 4DADA 6ABPA 5KQLA 1JYEA 1WETA 1HEYA 1YK0A 3Q7SA 4HYEA 3MMNA 4RKRA 2JB9A 5TPZD 3RVOA 1QP7A 3HJFA 3LUHA 4Z4EA 2WRZA 4ZMRA 4TLLB 2W42A 4RZSA 3LFTA 1TVMA 3OO1A 4H3KB 2FW0A 4ZPJA 3QLUC 4RDCA 4RKQA 4XFKA 3DBIA 1JLKA 1ZAYA 4EYOA 4UHKA 2JRLA 2HQRA 3QLVA 1LBHA 1NXOA 1OXBB 3DGFC 2QV0A 4N0PA 4LE0A 1S8NA 2A9OA 3NNDA 1DBQA 3RVQA 3GBPA 4D6YA 2GKGA 2VUHB 4O5AA 2IPLA 1U0SY 2P4UA 3I09A 3LKBA 5TE9A 1VPWA 1FFWA 5F64A 4OLAA 3BRQA 4YRZA 2B4AA 5GOTA 3CS3A 3OM1A 1L5YA 3OO0A 4LE1A 4RY9A 2FMIA 3S99A 3SQNA 1RZRA 2PUGA 1DZ3A 4P1ZA 1BDJA 1DP4A 1XWWA 2CWDA 1MIHA 1NY5A 2GBPA 3O2QB 1Z2EA 3H75A 4W5NA 4MLDA 3HUTA 2QW1A 1QP0A 3OLWA 4E7OA 3HO1A 2PAFA 1BDIA 1Z16A 3FFWA 5JNUA 2PKXA 1USKA 4MAAA 3NHZA 3T95A 1E2BA 3RVRA 1B00A 3H6GA 5DKFA 2IKSA 4KQCA 4N0QA 4D6XA 5ABPA 1QP4A 4G0OA 1Z25A 4TMYA 3FFTA 1YS6A 3JS5A 3VNAA 1LK0A 2E4ZA 1GCAA 4IMIB 4JB2A 1KRWA 1K66A 3C3KA 1NXSA 1EWTA 3HDGA 2LPMA 3OMWA 4DN6A 4EVRA 2FMKA 2QVGA 1P2FA 2IDMA 4N41A 4LZLA 2B1JA 5CNKA 4F11A 2QZJA 3GBVA 2H3HA 5FWXB 4KQ9A 5CHYA 3EODA 1SXGA 1EFAA 3LOPA 2Q5CA 3E61A 2LP4Y 3Q9SA 1JDPA 3CTPA 5E3JA 4PEVA 4GPAA 4RK4A 4MQFB 4Z9BA 4ML3A 5TQ0B 3T6KA 1VLZA 1USIA 3HZHA 3MYYA 1ZESA 2I6FA 3L49A 3EULA 1JX6A 2QR3A 1JFSA 6CHYA 1QPZA 3LUKA 3QEMB 3EJWA 1NXPA 1MB3A 2DRIA 4MPTA 4PZ0A 4YV7A 3NHMA 2QSJA 1ZGGA 1Z12A 2JVJA 1PEAA 3DGEC 3RVNA 2R25B 1YTUA 3O2SB 1JFTA 3O2JA 3OLXA 2E4UA 3RVKA 5EWLB 4YO7A 4YLEA 3SM9A 3LMKA 2LUOA 1NXWA 4TLMB 2E4XA 3OLVA 4IMJB 3LTEA 2ID7A 4TN5A 5JNTA 5JS1A 2E4YA 4FE7A 2A9RA 3SG0A 4MS3B 1E6KA 3GRCA 3JTEA 3QK7A 3BRSA 4MQEB 5TPWB 5BQ3A 1XHEA 4OLBA 4KREA 2A9QA 2KYRA 5ED4A 2NT4A 4E7PA 1DCFA 1FFSA 1JWLA 5HSGA 1QO0D 2VUIB 1NXTA 3F7NA 3N75A 5CNJA 2N9UA 1U2PA 3RVSA 2JCGA 3E3MA 2FMFA 3CG4A 4Q6BA 4UHJA 4EYQA 4MQFA 5TQ0A 2QU7A 1NXXA 3KLOA 3Q41A 3ROFA 4ETNA 4YWHA 4M88A 3KYIB 4OBBA 4ZJPA 3ROTA 1EWKA 1KMIY 3FFXA 3ILYA 3LUCA 4NV3A 4RK6A 1LJUA 2YHAA 3C6QA 5PNTA 1LBIA 5KC8A 2HQBA 1IIBA 3NBMA 5EWJA 2JVKA 1TMYA 3D8UA 1VRVA 3N53A 4Z4IA 4YS6A 3QLUA 2FN8A 1E6LA 5EWLA 3OLYA 4WXMA 4KPYA 1Z13A 3KSMA 2O20A 2P9HA 3IPCA 3SY8A 2M98A 2WJWA 4L85A 1GUBA 3BBLA 2PUDA 2PUAA 3M9WA 4MS3A 2E4WA 1OXKB 1C4WA 3GYBA 3L6UA 2J48A 4MQEA 4QPJC 5TPWA 1F4VA 3O21A 1DBWA 4WZZA 3RQIA 1KRXA 2LIVA 3MM4A 2PE5A 5IUKC 3HM9A 1PNTA 3A0UA 4W5RA 2FSPA 1R8JA 1A04A 3HDVA 3MF4A 5DCLA 3KG2A 3T38A 2HQOA 3D02A 3O75A 4MR8B 5IUJC 1JH9A 1TLFA 1NATA 3H1GA 4XAQA 2HSGA 5HKOA 1TM2A 4N03A 4NQRA 5KQPA 3JPYA 3N0RA 3H1FA 1T34A 1JL3A 2GWRA 3GV0A 4KV7A 1I3CA 4D74A 5TQJA 3M9XA 1NTRA 1URPA 3M6MD 3URMA 5KQGA 1A0OA 1BA2A 4Z9AA 1CEYA 1KGSA 2FLWA 2PL9A 4WXEA 2FMHA 2QXYA 2HPHA 4JP1A 2RJOA 5IEBA 1RZRD 4MS1A 2WWVD 3C97A 3EGCA 4GNRA 4ETIA 1P6UA 1CHNA 3JVDA 3N0WA 3KYJB 1M2EA 3SAJA 4DQDA 4IILA 5T7BA 5C5EA 2PMCA 4S04A 1YS7A 4LDAA 2NUBA 3RVJA 4Q6WA 2ZWMA 4NCBA 4WT7A 3T8YA 1RNLA 1DG9A 1ZITA 3W9SA 4MR8A 3TX6A 5D2CA 5KI6A 1D1QA 9ABPA 5BR1A 4JAVC 4FB4A 3KLNA 4JA2A 3TO5A 4G0PA 4G0YA 7ABPA 4RXUA 1DRKA 5IC5A 2PUCA 4RSMA 1ZVVA 1DCMA 4HNRA 3EDCA 1SXIA 5FWYB 4IF4A 3SNKA 1ABFA 3EQZA 4W5QA 5DLEA 4PYRA 4WWHA 5GQSA 2CHEA 1DJMA 2L18A 3BREA 2V0NA 3ILHA 2XDYA 4MYRA 2WJAA 2F8SA 1P8AA 3G1WA 3IDOA 1D4ZA 4G0XA 4NCAA 2CD7A 1JFVA 1W25A 3N8IA 5JNRA 1PHRA 1EWVA 1UDRA 2JBAA 3TMYA 2PUFA 4LRQA 5EWJB 5KWSA 3CU5A 4Y9TA 3O1HB 1U2QA 2VYCA 5T3YA 4F8JA 3HCWA 4MS4B 3H5IA 3I42A 4KFCA 1A2OA 4LX8A 5JNWA 3UUGA 4HNSA 3C3WA 4JB0A 4O1IA 2ID9A 4Z4HA 1P6QA 4RU1A 1Z15A 2BGGA 4KNYA 4EY3A 1RPJA 1YVUA 5TQ2A 1GUDA 4YCSA 5FWYA 4EYKA 2OQRA 2JK1A 2A9PA 4KK3A 5CNMA 4MLCA 4KVFA 5FBHA 4H3HB 4WUTA 1U04A 2YHBA 4F12A 3I45A 4KRFA 4G0MA 3GL9A 3OLZA 3QEKA 3G85A 2IPMA 3JVIA 5CNIA 3A10A 1USGA 3Q15C 3Q7RA 3H5LA 1PUXA 4EGSA 3A3KA 1AB6A 1DC7A 1BDHA 1M5TA 1SD5A 3H6HA 4RK7A 3F73A 5IULC 3O1JC 3DZDA 1D2AA 1ZHHA 1L5ZA 2FVYA 4EUKA 4MS4A 1E6MA 3KHTA 3MA0A 3FMVA 3IP6A 1QQBA 2PL1A 3NNNA 3O1IC 2MYUA 3P9YA 3HVRA 3I5AA 4ETMA 3HEBA 4MS1B 5IBQA 4YR7A 2MYTA 3H1EA 2GX6A 1ZY2A 1EHCA 1Z2DA 2R47A 3N0XA 4ZMSA 3CHYA 5IX8A 4RY8A 1EAYA 5HM6A 4MRMB 1QNLA 1DC8A 1ZGZA 5TPZA 3JPWA 4OATA 4RY0A 4L4UA 5EWMB 1ZH2A 2FQYA 3HK2A 3CG0A 5FBKA 4G97A 3QELB 2NZVG 1DBPA 1DCKA 1BAPA 2CHFA 4KMRA 3H5TA 3LUGA 1LJLA 4Z0NA 3HS3A 1DRJA 2FKAA 3IPAA 4RK5A 4F3TA 3KS9A 2R48A 4PICA 3CRNA 4ZYLA 2H0AA 4LE2A 3HXMA 5B3JC 3RVPA 4RXTA 3A0RB 5BRAA 1JHZA 5JNVA 5KQMA 2JBAB 3JY6A 2IPNA 1PEYA 2MSKA 2IPAB 2L19A 4RK0A 1RXEA 2FTKE 2WMYA 2WY2D 3TD9A 3HV2A 4YP9A 3FDFA 4QYMA 1JYFA 1QQAA 3KTOA 2PLNA 4IGAA 1Z17A 4MRMA 5C5CA 4G0ZA 3GA5A 3K4HA 3RVLA 4OG2A 5EWMA 3RVMA 4MGEA 4IRXA 3LUJA 1YIOA 4EVSA 4G86A 4NICA 3QLVC 3QELA 4KK4A 1APBA 4S05A 1VKRA 1Z26A 3KCNA 5DGCA 5TQ2B 2L17A 1PNRA 4P98A 4XXHA 1M5UA 3HUUA 1CYEA 2MYNA 2JVIA 2PUBA 3LUAA 4XASA 3UKJA 3BILA 3QLTA 4Z4CA 5DTEA 5I4CA 2X7XA 2L2QA 5JS2A 3VNBA 4G0QA 4JASB 4OTZA 4N47A 1TJYA 3GWGA 4QYWA 3CNBA 1FSPA 4Q7EA 2PUEA 5IEJA 1JDNA 3LUFA 2FXIA 2NZUG 4MR7B 3Q7TA 2M1ZA 1C0EA 4YGXB 3EAFA 1GCGA 3GT7A 3N6VA 4XARA 4HNQA 1ZN2A 2AYXA 4RV5A 4H60A 1MVOA 3OMXA 1ZDMA 3TB6A 5JNSA 1M2FA 1YMVA 1ISRA 1FQWA 2VK2A 1D5WA 2FQXA 1NXVA 2RJNA 4N76A 3H5WA 4EVQA 2FN9A
chains in the Genus database with same CATH superfamily
1M75A 1SG0A 3B2EA 4KZPA 1C9KA 1WG8A 3L6BA 1C3EA 1UJBA 3WGNA 3RUFA 2GDZA 2P4HX 3VO9A 4TV8B 4R31A 1NUTA 1P29A 1I4DD 1ZXLA 3H17A 4JEMA 4DUPA 5F76A 2F7SA 4AO6A 4KI0A 3U17A 1N2CA 2LBPA 2RAPA 1SXJC 5FPQA 3GJXC 1Y6GA 2OCDA 4TKVB 1IN1A 1T5DX 2ZATA 3F0TA 3WRWA 3P2EA 5TMPA 4RUKA 5MGBA 3WNCA 3QBTA 1E2DA 2YZGA 4MEBA 3W3AH 3M5CA 4MR7A 5CEFA 2ZWOA 4YT4A 3TTUA 4OH1A 1FTGA 1YKGA 1S2GA 1RXCA 2O7NA 3HQ4O 3LC0A 5EE5B 4BAZA 4J0CA 4EK9A 1DKUA 2FRDA 4J94A 2BEUA 4ZT6A 1YMUA 3ETHA 4MYDA 2DLCX 4L9SA 3DE3X 16PKA 2A9JA 4LWQA 3VNVA 3E15A 3D43A 2GOYA 4RM2A 1KL7A 4DT1A 1M3SA 1UT6A 2Q8NA 1Z18A 1IY0A 5HEKA 3I8OA 1LDGA 4FBGA 3ECCA 3R44A 4IS3A 5AOBA 3TEJA 4Z4GA 4H7EA 3CLRD 1T9AA 4MQ5A 3ENNA 3LUBA 2ZYSA 1YRBA 1Q1QA 3I01M 5CXXA 5K0GA 1T1JA 3LYHA 3RS5A 1KKUA 3UBMA 2X8BA 4AUMA 1JRLA 3RLIA 1Z73A 2CUKA 4W5JA 2KSQA 1SZPA 1S2DA 1QF7A 3QKUA 3RT7A 3RS0A 3STWA 3QX7A 1AUXA 2V6JA 1C7IA 2OHOA 2HA4A 4C0QC 3O0TA 1II8B 1HTBA 2HYDA 4G4SO 3K4QA 3ZU2A 3V7WA 4ENUA 3AKZA 2KBFA 3RKUA 5BR8B 3O8QB 3CEHA 3FCUB 3SFTA 4NZ9A 1R5OA 3L6EA 4QYXA 3GO4A 4GZMA 3C8MA 4HY3A 5BVGA 1X39A 2G17A 2HBQA 4TLLB 1FUUA 2XVZA 2ZJ0A 4RZSA 3ZXUB 4AFNA 3Q8MA 3U44A 3LIPA 3QF4B 3QM1A 5K0SA 2FX2A 2OCAA 1SRQA 5ITZB 2YKGA 1UINA 1FMFA 1EMDA 1E2UA 2JC3A 2X41A 3GLHE 5CK4A 4FW8A 1MVNA 2O2CA 5ICSA 5U1PA 3VR6A 3IV7A 3WMXA 4AKGA 1VL5A 3GEGA 1OHHA 2OYRA 4HH4A 3JYOA 3FAZA 3S70A 4V0NA 2BBWA 2Y71A 4P7FA 4O5AA 4H3VA 3FDXA 5GY7A 3T3DA 5JXGA 3CUYA 5FJJA 2MSDB 4ZI2A 5EIBC 3WK8A 3CS3A 1EWRA 4JBIA 4UFPA 4B3IA 1AKVA 3PEVA 1KSJA 3D7RA 3CGWA 1HDCA 4U7GA 3UT5A 4RHEA 3E9ZA 3O2QB 1NY5A 1OC2A 3QNMA 4B85A 1TLLA 1N0HA 1WDMA 1Z8DA 1VPTA 3PXBA 3TTWA 5KDOA 2OWDA 4PXSA 1XL0A 4E03A 2UZ4A 1OB5A 2W37A 3KOWA 1SVWA 3I64A 3NBQA 1E5VA 2DKFA 4WNIA 5AJXA 4TVBA 1Z16A 3IURA 5DWVA 1E4EA 2OK7A 1XF9A 1Z33A 2PKXA 2ZJ7A 1U9ZA 1JFFA 1IDOA 1E7YA 3CRQA 1N4DA 3DT9A 3GPDG 4ODIA 4TMXA 2AVNA 2GARA 2QGFA 2GILA 2YNMD 1W85A 1B00A 1X7YA 4OSEA 4PG5A 1YR7A 1Z7BA 2Q6VA 3H2SA 5LQCA 1KAEA 4LAFA 2EZ8A 4JDUA 3RS4A 4ZU3A 3TVYA 3O7MA 2P0EA 4ALMA 5HMLA 1WEHA 4MCIA 2BAGA 3I6IA 2W98A 1NIPA 1JHYA 3ZW7A 2RBGA 1ZUNA 3TQCA 2V1UA 1T3ZA 3HDGA 1ISFA 4R81A 4YIKA 2WF8A 3EX7C 5ES4B 2G9RA 3JR3A 3ONVA 2IDMA 1NQAO 4FFBB 1SUWA 1ULUA 1JKJA 3SE7A 4DY6A 5I48A 2XMSA 4HX9A 1KWGA 1VMAA 1O94D 1AY0A 3OEHA 4FR5A 2D0OB 3Q8WA 1RM0A 4XPZA 1YASA 3LOPA 5ALVA 1K27A 4J9UE 4M0PA 3E58A 5IVIA 3WP1B 1CYDA 1JDPA 3JZFA 3MLEA 2ZJZA 1H93A 1QE0A 2B5VA 4OCZA 2FMTA 4GPAA 2XCOA 2O19A 1O87A 4FR0A 3OUUA 4MPRA 4O2AA 2XB9A 3KVYA 5EGSA 3TLGB 1CQZA 1VLZA 2FOIA 3KO8A 3RAPR 3C6KA 3L8GA 1P5RA 4LBZA 2N3ZA 2WM8A 4NAVA 4LYGA 2X3UA 2VWQA 1SCAA 2IY9A 1MB3A 4OMFG 4QPPA 4KQGA 4Y1RB 4DQLA 3ESYA 1HNXB 1OYYA 1VYTA 5TY0A 2JNWA 4C88A 2X15A 5BWMA 5EMJA 1IXRC 1BGVA 1E9BA 2QUBA 4R2HA 4UAGA 4WKNA 4NXNB 5AVUA 3M82A 3N7TA 4LJ5A 2E4XA 2PX5A 3NC4A 2H92A 5DNWA 3HJBA 3O26A 1PFVA 2WZBA 4FYPA 1H2EA 1SBIA 3GRCA 2C2YA 3BL8A 1V71A 4PSUA 2RK6A 4LRTB 5G4KB 2J3JA 1OIVA 2DUMA 1KXZA 3GZNA 1S1CA 1WD5A 3DPUA 5D6NA 2R6JA 4V24A 3MSXA 1I2ZA 3QHAA 3RVSA 2B0JA 2R00A 3DOJA 4KQFA 1VPEA 2X1VA 4Q3BA 4Q7LA 2ADMA 2I6TA 2YRWA 3DXXA 3FUUA 3I2HA 4EYQA 1RQLA 1TRKA 1JAHA 2CJYA 1BCSB 4M88A 3FFXA 4FSHA 2ZDQA 5DYYA 3SR0A 1LLFA 2UXBB 5PNTA 3ITDA 4D0GA 4DV3B 4DJTA 1J7JA 2RI1A 3Q8XB 4FT4A 3V4PB 3SVTA 3BQ9A 1GKKA 3CF0A 1RVDA 2Y1WA 1K9VF 1OV4A 2ZE5A 1IOZA 3B1VA 5LB4A 4ZZ0A 1SHKA 2YTZA 3FNGA 4E5MA 3OCVA 3PJFA 2XUJA 2Q6IA 1QS0B 4N6GA 5EWLA 2PH7A 2QL6A 2VDOB 1A72A 3LL7A 4WXMA 5AI5A 2O20A 5HMMA 4DC9A 1J2EA 4R1LA 1P5HA 1TTHA 1U8CB 1VLQA 7YASA 4D25A 4KQKA 3JRWA 1TXGA 1IZYA 4NPHA 4ER5A 2GYWA 1OA1A 3GYBA 2WJJA 4TGLA 1WY5A 3BTSA 3LFHA 3NWOA 4MRAA 4B46A 1EHIA 4F4CA 1K7XB 3OC6A 5JJCA 4R2KA 5HP4A 3OKPA 2AOTB 3JRNA 3ZWKA 1L1EA 4D57A 2N0SA 1JQLB 1R8JA 1S89A 2D7CA 3A1EA 4QFMA 5MFZA 2AL7A 3G8BA 2LE0A 3O75A 3SJAA 4RPGA 1AUQA 4NABA 4L0DA 3D6HA 5TJ9A 1C29B 4MV4A 3N0RA 1I94B 4PZPA 3ETLA 3HVHA 4BRSA 4DQUA 4QGSA 1QANA 3GLFB 1XTVA 3GV0A 5JE8A 3TI7A 4ARBA 4D74A 4XJSA 3UC9A 3ZLVA 1URPA 3A1UA 3D7SA 1QVWA 2C2BA 3F6BX 3OJ0A 1RC0A 1W6RA 1FY2A 4K9QA 2RGNA 2XVYA 2GM3A 1T0BA 3QMVA 1YHNA 1D6NA 2AFHE 2QI9C 3U40A 5HZGA 1YHZA 3V34A 1Q5PA 1LZLA 5EI5A 3BXGA 2SICE 3VNRA 1E1KA 4DAOA 3FDIA 4TYPA 1PRYA 4L5BA 1YUMA 3ASYA 3FF4A 4GNRA 3WIDA 2HHAA 3EXG2 3SAJA 4XVCA 3GUZA 4ID9A 3MOIA 4GI2A 5AH0A 2IS6A 4HDCA 1YJ8A 4TZTA 1WV0A 3R5FA 2YWBA 2VHQA 3MJVA 1AUPA 1FMCA 4H7DA 2GPJA 2WSSA 2Q3LA 2VWHA 2M1XA 4NYJR 5CR9A 3VOAA 1TDJA 4K0KB 1EEHA 1VLLA 3A6DA 5HOEA 1KQPA 4W9RA 2YV5A 2MDTA 1ZIPA 1Y1QA 4UOEA 3I8XA 4EEKA 4DG5A 1QH1A 2V6MA 3T99A 1R0KA 2E2WA 4GKBA 2XKJE 3V8PA 5IXSA 2EG5A 5KVSA 3UQYS 2VPTA 2C8JA 4JS0A 5JASA 1H4SA 4UCXA 1W5TA 1ZL2A 2I6SA 3CH7A 4OV6B 2K87A 4FD2A 2QRLA 5AW3A 2I2CA 3H2IA 1N6LA 3VR6H 4OO3A 1Q3HA 3WB1A 4FMBB 1AQNA 1IN7A 1FQKA 3H0CA 3LBHA 4A2QA 4G0XA 2R3SA 1ADBA 2CD7A 3EIXA 3G49A 3BEDA 1EWVA 1NN3A 1Y89A 4ESHA 1HFKA 1VQ1A 2RH4A 3G0CA 3FUCA 4GW3A 4PM4A 3DV0A 3VSBA 4CCYA 1GR0A 3BA1A 4EKGA 4ESOA 1XU9A 5EXPA 3HI6A 2OBYA 3IHKA 4HEJA 4Q7KA 1MB2A 4ZMBA 2R1TB 3FNHA 1Q0ZA 5CJ2A 3U16A 3M49A 3WZMA 3ZU6A 4LK2A 1I9GA 2BFCA 2IEIA 4XZ3A 4UU0A 4D9HA 2IBSA 4WASA 3V7NA 1E98A 3GRFA 3P71T 3A3NA 2JFOA 1OIWA 3E05A 3GGCA 4XQCA 5FUBA 3MJRA 5HXAA 3TNJA 1X14A 1OUMA 3COPA 4L7VA 5ENDA 5A4FS 3AVOA 3TTXA 5I7SA 1PZNA 2QEQA 3UAOA 1UL1X 1FXUA 3AMVA 4MYHA 4CFSA 4EPTA 5F35A 1XRNA 2NO0A 5BOSB 1HT3A 3OTWA 2OO7A 1YACA 1VC2A 2IYFA 1XEAA 2PO7A 3FWYA 2ASEA 3I76A 3LVBA 5K0FA 1IWOA 3FCCA 1AQUA 3OIWA 2A33A 2X7JA 1R8QA 1DC7A 3KTDA 5LOVA 1UZLA 1LDBA 3DV9A 3P9SA 3B9BA 4Y7DA 2Q9UA 1WXFA 5EJGA 2VJAA 3EBPA 1IOLA 1FX1A 1LH0A 1E6MA 3F2VA 2CK3D 4V3BA 2IU0A 3G8DA 2AUNA 4Q3OA 2GJ4A 2IODA 2YOGA 4RANA 3O1IC 1WXQA 2JA2A 2CDAA 5I7WA 2GGSA 2YW2A 3GLTA 3L9WA 2H7YA 3EVTA 5G1PA 1YZGA 1UXKA 4TMTA 1XI2A 5GJVC 4KSYA 3PGJA 1DQZA 4BTLA 3NEAA 1LVGA 2A88A 5F5NA 1S8AA 1NR7A 2HGSA 5EZYA 4M55A 1YC2A 4Q4DA 5EHIA 5GJCA 4QEZA 4YCDA 3NGLA 3I9LA 3AM1A 4DZRA 4OGLA 5THQA 4ZEMA 4OHZA 3UK2A 2OQ2A 2QM7A 4ZDWA 2CKMA 1IWBB 1W2GA 2I7DA 1UCFA 3FNEA 5K99A 1DAPA 5F3WB 1U8YA 4OA5A 2BGNA 1DBPA 4PLPA 3TLJA 4F45A 4RENA 4MKXA 4GBED 4K3UA 3UJDA 1UZAA 3PKIA 4QWWA 5B7PA 4JOSA 2Y68A 2ETVA 2R48A 1WZIA 2R1UA 2OZLB 4NJEA 4PNPA 2H0AA 4D1YA 3ZEIA 4LE2A 2WIBA 1QZ3A 4QGBA 5AHOA 1UT8A 2JEYA 2RC6A 5TS2A 2PMFA 4ZZIA 1PNQA 1HZJA 3KSUA 4LX0A 1ZVKA 2OV6A 3PA6A 1UK7A 3MXTA 4ND8A 1BTOA 1PDVA 2W8ZA 5GONF 3WV5A 1F0YA 1OBCA 3SSNA 4BQNA 1U6JA 2KX7A 2PAAA 1QTRA 3QF7A 4A2CA 2OK8A 2Q5JA 3LSTA 1VMEA 4ZICA 1R0WA 3FBWA 2PLNA 2AUTA 2C96A 2WHQA 2GZRA 4IWYA 4JSRA 5JHGB 1T3HA 3BG5A 5EWMA 4H1VA 2P2DA 3LUJA 2WJ6A 1ZD8A 1WA5A 4J2TA 3KCQA 3QLVC 4DMRA 1HFEL 5JTTA 4OSPA 4MVJI 4CIWA 2PTGA 3GGSA 3TINA 3WWCA 1ZU4A 2HHCA 2P68A 1MQAA 2CLFB 4ZO8A 1L9KA 5TQ2B 4CHGA 3GW8A 3OX3A 2QP4A 3K9GA 4GR9A 5D86A 1V6AA 4GQIA 1NUSA 5AIAA 3LNTA 1ZIYA 4ZRNA 3L8HA 3RSFA 3ZWOA 3JVUA 5HIJA 4KLAA 4EJMA 4KKVA 2AH5A 2BM9A 3EH1A 4NZZA 3N70A 4QQKA 1B0AA 3FSGD 2QE6A 5IVPA 3GEBA 2ZI5A 1J24A 4ITVA 3G6KA 3ELUA 2RGGA 1HWYA 2BKAA 3BBPA 5KSYA 5ALFA 1TYAE 2X2OA 1GNLA 4FHCA 4C06A 1OWOA 5IEJA 3CC8A 2D3TA 2OFOA 2NZUG 3R3XA 3V6MA 2P9TA 4B73A 4M4SA 5E9JA 3R7WA 4FQ5A 1DOZA 2YZMA 1TCBA 2JGFA 4W9NA 3W6UA 3N6XA 4XARA 3CEJA 1RMQA 5C8DA 4DA4A 1V7QA 2LRHA 3HJUA 1MDFA 1DX6A 5DNUA 4MCHA 4OB6A 2CNOA 3UMYA 2FQXA 1N5DA 3SVZA 4RNCA 4FLEA 4WW0A 3HLYA 1SIWA 3K0HA 3C6XA 3K1AB 3KPWA 4FYXA 4LJYA 4YAEA 3ER9A 2HAEA 4FGLA 2IDZA 4M7OA 5DTRA 3TX2A 2R0QC 2WYOA 3JQDA 8ABPA 1EVEA 3DOEA 3FPCA 1XDZA 3NBKA 3EPKA 4JJ8A 3HXQA 1QYXA 2ZB8A 3C8UA 1X13A 1XVTA 1GLGA 1HSOA 3DTVA 1N8SA 2MMGA 1ZD3A 3GVIA 3AEUA 4M76B 1WVIA 4MR9B 2BMWA 5E6UA 1JTFA 1VG9B 2Z57A 1SC3A 1RE0A 2D2VA 2VP2A 4QDOA 2DKNA 2JIMA 2OCGA 2OENG 3Q9LA 3R6GA 4TWZA 2J0SA 4RVGA 2XSZA 1M0WA 1Z4NA 1KMCA 1VA5A 5K6RA 1XLTC 2ZYVX 1YQGA 3EEQA 2P9JA 4QXOA 4R51A 5TEWA 2EQ5A 4BKPA 5KJ1A 1Z5OA 4MTLA 3U7QB 4EX7A 3O4FA 4H7JA 2NT3A 3NAGA 1T36B 5H4HA 1JDSA 1D2NA 4F8EA 3DCNA 3LX4A 4JWKA 1YAHA 3O1LA 4YFVA 1FDIA 3DUWA 2QVCA 4BEBA 5C1BA 3WRVA 1XNRB 5AIBA 4KQ6A 3SHFA 3BIXA 1U2SA 4L95C 3WQBA 2ZSAA 1Z8NA 1CQIB 3IO3A 3IERA 3NW9A 2FSUA 4E3WA 3BJZA 4UU8A 4CLOA 1Q91A 3B1YA 1E1QD 2GCNA 5CP8A 2BKVA 3I58A 2GAJA 3REOA 4ZZ1A 4A8JB 1GPMA 1K4KA 1U3GA 3EXHC 4B83A 5G02A 4UTXA 1K68A 1SKBA 2BLLA 1UPAA 2IYXA 5B3JA 4B47A 4LV5B 2K6GA 3GMDA 1MQ8B 4PX3A 4E31A 1P1JA 3FLAA 1AU9A 1PR4A 5GM1A 3RH0A 1GNTA 1B1CA 1VBFA 1WVGA 2I0FA 4DBLE 5HJ7A 1V39A 4R2LA 1H9BA 5ARDA 1FEZA 3WRXA 2NAFA 3EDRA 1FNBA 4OXQA 1RZ3A 2X0EA 1RI4A 4FFVA 1CIVA 2IHTA 4RKRA 2JB9A 1KDOA 3CX7A 3H42B 3AL2A 5ER6A 3WAKA 4DZZA 5CMLA 2C0PA 2ZRHA 3NHSA 5IZCA 1ZI8A 2QY9A 4J7CA 4LXUA 3PBKA 4G1FA 3C5EA 2D1QA 2JIQA 2NU7A 2OMEA 3KXKA 3MWEA 4O2AF 4QECA 5EE9A 1KMQA 4E6PA 4XGNA 3GGDA 3MAAC 2D2IA 1EXNA 1Q19A 1D9ZA 3D2CA 4OKNA 2O0KA 2Q3BA 2P4EA 2BBSA 2ZWVA 4GLJA 3TQQA 2QN8A 3NHBA 1PF7E 4PQYA 2HCFA 4TLEA 2B3TA 1RYHA 1EK6A 4MB6A 5FO1A 4RKFA 7MHTA 1QLHA 3I9KA 1H6BA 4YRZA 3WJAA 1XGKA 3PNSA 1UBEA 3O4GA 3V9AA 3S81A 5EIXA 4IIGA 4GXNA 3LBYA 1R9JA 1DMSA 1JJ7A 1YRAA 4BLSA 3AG6A 2FDRA 4P92A 4TXLA 5I4BA 3W3ZB 3HUTA 3HB9A 1XRRA 4UNIA 5ALRA 4ZAZA 1Q0SA 3PQEA 2O1WA 2P79A 5JZMA 1GNSA 5DP1A 1XQ1A 5E7JA 2VT6A 2W90A 1GGMA 3SZUA 3ZTYA 1WY7A 3I9OA 3Q7IA 4GMGA 2DAPA 3STXA 1K7SN 1U8FO 1W4RA 4QBHA 3R40A 4BLUA 2A3NA 1OJ7A 1N3IA 4QU9A 3ETJA 5DGIA 5BV1A 1GNQA 4LRUA 2XYQA 3RIMA 1U0JA 3Q5DA 2PHZA 1LK0A 4DWVA 2MSEB 1K8RA 5KHOC 1X0VA 1QRDA 2PZLA 3LF1A 3SQMA 4DV7B 3EUFA 4WOPA 3DV2A 4FR2A 2QVGA 1ZI9A 1PX2A 2VHEA 2WA2A 3IJPA 5BYKA 5I3CA 5HHTA 2VBIA 2YJ4A 2J41A 1N2IA 3JQCA 3WGUA 1L1QA 4UEWA 4XGRA 4JP2A 4CIXA 4DLRA 3PEFA 1IJBA 2A35A 3KQQA 2ZP1A 3B2QA 4D81A 1ZMBA 3DUFB 4MQFB 1CDDA 3T6KA 1Y5NA 4P58A 4MVYA 2QDXA 2WA1A 3MAJA 4BB5A 1VM6A 5ARBA 2CBXA 5C4IA 1IXZA 1JDJA 1USUA 1G64A 1T43A 1K0UA 4DM4A 5HF8A 1AKYA 3W4IA 5F2OA 1YUBA 2I8CA 3L1VA 1Z4MA 4H6VA 4OFXA 4RPJA 4BHTA 2O8CA 1EQUA 5A4MS 3EQ6A 3AU9A 3WGZA 3O9VA 4A10A 3LMKA 2AMLA 3OFNA 4LHXA 3TXXA 5JYBA 1E3LA 1VFPA 3G1TA 4LDPA 4JXJA 2UYOA 4J1QA 3ZH2A 5H83A 4YRSA 3SG0A 4XCXA 3C1TA 4O63O 4A8PA 1SXJE 3TLXA 4LXQA 5BWNA 5BW6B 3ZI0A 5CURA 4ER0A 2UDPA 2P1DA 1Q50A 1DSSG 1K8XB 3EF1A 3QOYA 4BVLA 2VUIB 1NXTA 1KEEB 3OZWA 4RVDA 4PIPA 1OFUX 1HE4A 1CT9A 4QGHA 1EK2A 4RVCA 3T9DA 5CLHA 1BVYF 4E88A 1XZKA 1IZ0A 1P2DA 4EPRA 1YZNA 3IEMA 4YWHA 5FOTA 1L6RA 5KKAA 5FPTA 4OBBA 1EKXA 1XJCA 2YXBA 1IN6A 3IIMA 4CL8A 1JPNA 2YHAA 5FBWB 2R6ZA 3PNVA 4KVAA 1XDDA 4KN8A 5EWJA 2CB9A 2G4LA 4LSZA 1E5LA 3TZHA 1WUKS 4DMFA 1ZKDA 2R6HA 4A2PA 3A1SA 2ZUBA 2WUFA 4WXYB 5H7XA 4JYCA 4MSUA 3ROGA 4CMIB 4QGGA 1LPPA 4B5KA 1MIOB 3SD7A 1E3IA 3UUFA 2WJWA 4KB5A 2GEBA 2HV8A 2ZBRA 3KQVA 3BBLA 3SGLA 4DSUA 4NHOA 3M9WA 3Q8KA 1TM5E 3SFZA 3HA7A 1NP3A 3ABQB 4H6WA 2BIFA 5P8WA 7MDHA 2D4AA 1FJGB 2J48A 5J23A 1J9ZA 1KSHA 1EUCA 1XCPA 2FWNA 3V1LA 2HSEA 2QTRA 2ZJ2A 1RZVA 2ORIA 2Q1YA 1XP8A 2G28A 1F8YA 1JQDA 3GXOA 1DWPA 1AN0A 2FRDC 4IFIA 4M0UA 4R6XA 5GP1A 1GYQA 2CW5A 3I05A 4BCDA 3BCHA 4EB0A 1AS2A 2CDNA 4CG2A 4Q05A 4RD2A 1WIWA 5H4GA 1XJ0A 4LGVA 4AYWA 3D7KA 3TRHA 1UR5A 1V35A 2GRJA 4B4UA 1ORTA 2IVZA 4RD4A 3PT9A 2XRFA 4NNOA 3F4BA 2FW7A 3KT6A 4GG1A 4CKCB 5CB4A 4KV7A 2WFZA 4NFLA 3HHPA 3PHJA 3SKXA 3SZOA 1L7DA 4C21A 1QGDA 2FZLA 1WBDA 1N5OX 3PS9A 5JYEA 4U5XA 3MFQA 2GF9A 5AESA 5F9MA 1UQRA 3KYCB 4RDHA 3CR3C 4Z54A 3C3JA 5HQ3B 1WUHS 1YR3A 1JR3D 4C0KA 1GT6A 5F7XA 3GQBB 1JQ3A 4TROA 3EWNA 3UIEA 3W2EA 4HNTA 4WOKA 3IFSA 4R2JA 2ZJFA 2XGOA 2AZTA 5FH9A 1H1LB 3I52A 1I01A 2QLMA 1JKIA 5BV2P 1JQKA 3N0WA 5JQGB 3D81A 3FCOA 4NG5A 1EX7A 3CBQA 1UDWA 1YMQA 2DHDA 4I2NA 4K46A 5LZ9A 5KOJB 2OHFA 4V03A 1RRPA 3UENA 3M1LA 4WT7A 1ZLXA 5WRFA 3ZWMA 1JEDA 2ORWA 3T5BA 1O0SA 1GZ4A 3W9SA 1KMMA 1KMNA 3NV7A 4OF4A 4ZO4A 1D1QA 4TL6A 1U9YA 2AF4C 5LOVF 1OV6A 2WJ3A 1Z82A 1E2FA 4Q4CA 5KNLA 3TLBA 2OD2A 4OBEA 5JUWA 1I3NA 5F1OA 2PWZA 3R3ZA 4OMUA 4WI1A 4CG0A 3MTAA 3LHIA 2RMKA 3FWZA 1C30A 1KDVA 4ZJYA 3EZFA 1LVHA 4DQKA 3RBXA 2X6QA 2FPGB 1VL1A 1OAAA 3NIDB 4XDHA 3QEOA 2QAGC 4OOEA 1RJFA 3H5NA 1KBQA 3GDGA 3BREA 1R00A 2PIDA 4QM6A 5IJZA 3P1JA 4QU8A 4UASA 3N8IA 2Y0PA 3VMFA 4NJMA 2CT8A 1GUYA 3LOUA 4HGQA 3LT4A 4LRQA 5DJ5A 3AESB 2QUAA 4FVTA 3PYXA 3UOAB 1RCUA 1NVVQ 4QJ3A 3GARA 4UUQA 2HZBA 3ICCA 3ZNPA 1HDEA 1AOXA 1A2OA 4PQGA 5YASA 3OLQA 3NBZC 1R6BX 3OCUA 5BPFA 2K2QB 5CCBA 2JLBA 2GWHA 1P9WA 3KD2A 2CF5A 4H1UA 1U4NA 3K0CC 4WSOA 2HREA 5IDQA 1W0CA 3TKLA 4C4RA 4EHNA 2DT8A 5AM5A 4YRPA 4V0MA 5B5SA 4KV9A 3O0DA 3ZI7A 5E1DA 1QHHA 4X45A 1YR2A 5J2UA 3OJXA 2R6DA 2FN4A 3ND7A 4XX0B 4Y0AA 1RHUA 3C5VA 3L8CA 4NBNA 3UWDA 5B6IA 1TF7A 1PW5A 1UMBA 3MINA 3PFBA 3QE2A 3PQ8A 3RABA 5EXTA 2ZSBA 3NLLA 3LWZA 4FHZA 5EGNA 3QVMA 1ZRHA 2J4DA 2FU5C 1RU3A 4D3XA 4B45A 4DJEC 1SBYA 4PLHA 4KBFA 4BDTA 1GVNB 4LZOA 3GEDA 1Z7WA 2PH3A 2A5LA 2GVZC 2Z2KA 3ESDA 4HP8A 2R86A 3FXAA 4TQAA 1XEXA 4UHFA 4IQ8A 5I4IA 2QROA 4FX5A 3BJIC 3UWSA 4BJ3A 5FOSA 4OGFA 3QUSA 2R65A 3IAS6 3TRDA 4J0GA 3RF7A 1J33A 2H7XA 2CMFA 2HDWA 4G5HA 1EP2B 2XAUA 3RROA 3VZBA 1FYFA 4EMUA 4YJ3B 4L07A 3KUXA 4KO1S 3GBSA 1KO5A 1SB9A 1WF6A 3IQWA 4WNCA 2PGAA 1U3CA 2H57A 3VSCA 3ZS8A 1F1JA 5H0IA 4ALJA 2RCYA 3CMCO 3G23A 4QT0A 4WKOA 1GAJA 2JEZA 4PINA 3HR4A 1GL6A 4Q0MA 4ZGBA 1O8CA 2MYTA 3CO5A 3IVRA 1QIFA 2GX6A 1ZY2A 2EVWX 3ILXA 5ESRA 3IESA 2IBTA 2PXAA 3T35A 5IYZA 3PQDA 3CLUD 2XTJA 1RCTE 3VU9B 4HWTA 4XW2A 2FDCA 4HYQA 3DFIA 3LLSA 1F6DA 3H97A 1K92A 2G09A 3BF8A 3AQ4A 4FP9A 5D1NA 1H3NA 3IB3A 2JFBA 4HDNA 3JV7A 4GO1A 2GJ8A 3K6RA 4MULA 3NOQA 1JXQA 4XR9A 2C8KA 4A6DA 5LXTA 4QTXA 1FDRA 3FKQA 2VTBA 4TZ6A 3LRPA 2B25A 3WIEA 3LDGA 4HWGA 2I4OA 3H5TA 3LUGA 3M4NA 3HS3A 1DRJA 4Z0NA 3GYGA 3SZ3A 3TSYA 1RYBA 3WHKA 5LDHA 3MCTA 3L0PA 5IXYA 1U5AA 3QYJA 3JYHA 4QXQA 3C41J 4ZI3A 1YA4A 3S4YA 2HMAA 3WYNA 2DPYA 2AN4A 5K8TA 1IVNA 1Y1SA 4RXTA 5JR3A 3QWAA 3J7AC 4RULA 4PRKA 3EVGA 1O95D 3JAWB 3P0IA 3CUUA 1F3OA 1Y81A 2A1UA 2OCXA 1G5RA 4PFKA 4NZPA 1ZS9A 5GOZA 4N7MA 4EPYA 2XWSA 3KSRA 2E7ZA 4JC8A 1OLXB 4H17A 1XDSA 1FVFA 4QYMA 1F6WA 4PSAA 2ST1A 1Z2CA 3WK6A 2ZAGA 3EEYA 5JDCC 1WPQA 3GA5A 2POQX 1TECE 4L0CA 4BVAA 1E2HA 5K2MA 3RC3A 2RGDA 3RVMA 3FAKA 1XKQA 1XCOA 5SZKB 1HDGO 4H59A 2UYHA 1YU6A 1NBHA 3WNBA 3F5DA 1V6CA 4R0MA 4FXOA 5TVGA 2F43B 1CUYA 3U5TA 2E48A 3AP3A 5FA5A 1HYBA 4WFKA 3W4JA 4AZ3A 3GJSA 3CV3A 3QTLA 4F21A 2BKXA 4DQVA 3BULA 2C7QA 1W1WA 3IRUA 2B9EA 4QG7A 3SXJA 4FYYA 5IJ9B 4DDWA 1MF7A 2JFUA 2P5YA 2W00A 3MT8A 1BJKA 1QHNA 1KIAA 4MUKA 4E5PA 5DK4A 4FOLA 3T52A 2XXAA 2C84A 1RAHA 3IKVA 3LSYA 5I4CA 4ZOLB 3P2IA 4RZIA 3CVOA 1M67A 4DDKA 2QXUA 3E70C 4B34A 2PWBA 1T0JB 4EFMA 5KYUB 2KBEA 2HJGA 2H3EA 2QU8A 5I3ZA 1GGNA 2ZTSA 1EJ0A 4B31A 3AR4A 1JDNA 2FB9A 3DQPA 2YMLA 3OCCA 1UANA 4DIFA 1W7AA 1Y6ZA 3RJ9A 4PBTA 1GCGA 1GQQA 1PFWA 1QZTA 4JR1A 4YV1A 1SU6A 4TMZA 5A0VA 2WG0A 4WV3A 2ECPA 4COOA 2YW9A 1FLVA 4JYAB 4GMFA 1FTNA 4C7XA 2NQTA 4EYEA 2FDXA 1D5WA 2A9FA 3PJGA 1A97A 5JW6A 2FX5A 2G1KA 3H5RA 2JGNA 2C9ZA 1I51A 5HBRA 5CB0A 3ZE1B 3B78A 2DF8A 1TU4A 3L8EA 2FE4A 5ALTA 4LY6A 2DR3A 4HXYA 4WD3A 3WLJA 4CKYA 1P2TA 1GQRA 2QVYX 4RMIA 5KC9A 3AZPA 2UV8A 1CY0A 3HSYA 4YUAA 2C20A 3B1ZA 4XWAA 5AK0A 5EXXA 1HO3A 3D4BA 4KIJA 4MW9A 3ZWVA 4B5LA 1NMEA 5BNZA 5JY1A 3NC1C 1Q0QA 5EMMA 4CCSA 1GRNA 3I3OA 4R2IA 1X80A 4Q93A 2OPHA 4NDAA 2RGYA 3MMZA 5HZHA 2ZS8A 4CZ2A 1E3SA 1FJ2A 3B2NA 4IXTA 2OHGA 3RODA 2ATVA 3FUXA 4GOMD 5FEMA 3WO0A 4AJPA 2X9VA 4QM7A 2OWEA 1QO0A 1YULA 3U3DA 4HNAA 3GD5A 2K7FA 4XWYA 1H2YA 4FK8A 4KN9S 4FX2A 1U0NA 3DOUA 3ZD9A 1GPBA 2GO7A 3KQHA 4GL4A 1M33A 1GILA 5B6JA 4ER7A 1ZH4A 3K1ZA 3QTBA 4PO9A 3RRXA 1KZ9A 3OM0A 3CLKA 5DEIA 4PCVA 3D8TA 1SG6A 1D2GA 2ONKA 3FNBA 4G4JA 2GKOA 5K7SA 3EQ2A 2JI7A 2X40A 3IL2A 4HQ6A 1QHEA 2BCGY 1LQ2A 5KNCH 1OCEA 2UZ1B 4PN3A 1C41A 3OU2A 4TWJA 3WDMA 2ZYDA 5I9IA 3LFUA 2PKEA 1GTL1 3IXMA 5FQOA 4TV8A 3GVHA 5E2BA 3MIZA 4B09A 4ZO7A 1YDHA 5IJXA 1WBBA 1RXIA 5FTMA 3RYFB 1MB0A 2GAAA 4N5MA 4IIHA 1L9XA 1K6IA 5FKJA 4ECAA 2VVTA 3SEFA 3AHHA 2XY4A 1OFHA 2WWWA 4TKVA 3U80A 4KQHA 3SC6A 2ONZA 3DEFA 4HN9A 3PIDA 4LDNA 4TRJA 4E11A 5C32A 1XKTA 3AVYA 4KG7A 3T3NA 3HWRA 3PGXA 3A6EA 2J3DA 5TPZD 5LZ8A 2WM2A 5AHWA 1KA9H 1SK8A 3GP5A 3L6CA 4QDZA 2CLEB 1UBSB 5BN3B 1QIMA 2CJFA 2GA9A 4M1OA 5I9BA 1PR0A 4AX8A 3T34A 2BGMA 2IXFA 1X8XA 2AC2A 2PZJA 2VSQA 3F98A 4UHKA 3BK1A 4XH9B 2QTAA 4PYQA 4BEVA 4PFJA 1CUWA 2QV0A 1VECA 1ADYA 3AW8A 1S8NA 2A9OA 3PUVA 1P0FA 4K0RA 2V55B 1NQXA 3L18A 4GOXA 9LDBA 2XB6A 4DNPA 5U4QA 3IV9A 2BP7A 2WPDD 4EW2A 4YRQA 1SVNA 3C3BA 1FFWA 4RHUA 1FLNA 4K7JA 1GFIA 5ALPA 2HU5A 1PT6A 2QR2A 3OM1A 1AKWA 4QHSA 3FFAA 1NUHA 3L6DA 2PX3A 3ETGA 4KVGA 3X1XA 1PSZA 5JROA 1KDTA 2NXCA 3MJSA 1II8A 1SOMA 1XTRA 1OGIA 3NKLA 5LQMA 5JNLA 3EXAA 3VO8A 4KYIB 4WNYA 3FLEA 3MCUA 3O8QA 4QRHA 1MG0A 1ODKA 1ULBA 1SOAA 5IK2A 2GJSA 4BLQA 3IAS1 4FINA 1P1KA 3SIWA 3R9XB 4TN1A 5I9TA 1WCWA 2G4CA 1UXGA 3EA4A 2F1KA 2SECE 2O8NA 3H6GA 3IQGX 1TD9A 3QF4A 1GGJA 1NRIA 4M89A 4N0QA 2J30A 4U0KA 3RT1A 3UYLA 3ZU4A 2NZ8A 1RQXA 4IZHA 3C87A 3A4TA 3J80A 3PF8A 3VNAA 1CNEA 1QHXA 2XA2A 3IXLA 2R2GA 3NDIA 2Q6LA 1QKIA 4QAQA 2Q5IA 3EIWA 4RHTA 2BL4A 4G9EA 4EVRA 4FCTA 5JJ5A 2JGLA 1VE1A 2FPXA 4AUNA 3R09A 1XUOA 1NNUA 1QLJA 2B1JA 2EARA 5TGDA 3F2IA 2ZVDA 5EZ6B 4F11A 2H3HA 3ZDQA 1EFAA 1Y3HA 3LRXA 2WU8A 4ZK2A 1PGQA 1Y4ZA 1JEYA 5H8WA 4DWWA 3K94A 4Z51A 5DI3B 3VR1A 5HK9A 2Z83A 1R0CA 4RK4A 1NQ5A 3AV0B 3EXEB 1K1EA 4G9GA 4R8RA 2CE2X 2BRUA 3HZHA 4PPQA 3HDJA 4FYHA 2CJWB 3DMTA 3N9IA 4KBGA 3PXAA 2ZUDA 2CVHA 1MQ9A 2V7EA 3EJWA 3NASA 4HB4A 3Q0EA 3ZV5A 1P4SA 2Y05A 3FLBA 1P1RA 3UJ9A 1YB2A 1Z12A 1YZKA 2VCHA 3AR3A 5JH7B 5AVXA 5KB3A 5IM4F 2VXCA 1VCNA 3OLXA 3FIUA 1CXZA 1F0PA 3EAQA 3EF0A 3EVEA 4NENB 4AJHA 1RPAA 1E7SA 3HFGA 4YLEA 3ZDZB 2QHXA 1RJWA 4ID3A 4RGYA 4ZKEA 4H1WA 5JNTA 1WZUA 4GYYA 1HK7A 1WHSA 1RRKA 1RQNA 4FE7A 2DFVA 2XUHA 1BXZA 4FHFA 3FMOB 4IKEA 3K0SA 1MX1A 5TT1A 1ODCA 4BB9A 3K8OE 1R5BA 1R6VA 4ND3A 2AFHB 3D5TA 4F71A 4F93B 1E2EA 4DLYA 4EEZA 4DHWA 4BWVA 1YIDA 4OLBA 5B3LA 4IDOA 2NT4A 4RSGA 3KKOA 5FPKA 2WM9B 3D0QA 4L1KA 4W6ZA 3FGNA 5BVHB 4C0XA 3UANA 2QNIA 4D98A 3I5MA 1DRVA 2RIRA 4OAQA 4H4DA 4MLPA 3A2NA 4EUSA 3TLGA 1TOAA 5ERGB 3TEFA 5H9VA 2GCIA 1AHIA 1OD6A 2PNFA 3R6WA 4MWCA 4Y2HA 1TE2A 4LOKA 4XOUA 4A9AA 3S28A 4A6XA 3NUQA 3P0JA 1CUSA 4OHVA 2JIPA 2QY6A 3RTDA 3T1YB 3UFBA 1VPVA 2Y76A 4Y1RA 5REQB 4RF3A 3SBDA 1QU3A 2Q1WA 3WLAA 4Z4IA 4YS6A 1RP1A 3KEOA 3QLUA 3KR0A 2BBOA 1G6KA 3TTSA 1YDEA 4C4ZA 2FN8A 1KZHA 1E6LA 5K6TA 1GL3A 3CE6A 3LLMA 5JMOA 3HWSA 1DDGA 5DHFA 3QVOA 3SY8A 1G7CA 3JQGB 4N3NA 2G0NA 1VHWA 4K40A 1WE2A 1YE3A 3O84A 1UPUA 1KY4A 1PS9A 2B1IA 1ZKMA 2Z2IA 3FJOA 1V7PC 1GLNA 3C5HA 3HCDA 3KTAB 5FULA 5G4KA 3TFOA 3NHLA 1KOJA 3IEKA 4MUFA 2G9VA 5TVKA 3JQ9A 2CNKA 5JXWA 1GVHA 5JY6A 4CQLB 3KBBA 1KRXA 1I3LA 3KBOA 4CCAA 2DHEA 1OB2A 4I81A 1M6VB 1RLJA 2XTZA 4CKBB 3FMPB 3G79A 4LC9A 4IV5A 2YIJA 2Z1MA 1G63A 1XVVA 4PWYA 4R1TA 5SY9A 1BCSA 2V6GA 4G67A 4X65B 3QSYA 3TPCA 4KRGA 3ZVLA 2QIPA 2XX3A 2AD5A 1T34A 1QG0A 4HVLA 3V48A 4GVPA 4Q3NA 2A67A 2I2WA 1WMBA 2P5UA 4DCOA 2QTCA 3DYBA 3OD5A 1ZHOA 2GZSA 3O9ZA 3TVTA 3PB3A 3G7SA 4GS5A 2I5PO 3WA6A 2OZVA 4OMCA 1QS0A 2I71A 2XOKD 3C3DA 4DXHA 1IN5A 1YBMA 4G4IA 1KYXA 2CL5A 1XA3A 2AQ8A 2WNHA 3K5WA 1M0SA 3P9ZA 3PDIB 1EUZA 2FJ0A 4WXEA 5J2UF 2C5SA 1UWVA 3EWIA 2AG6A 4JJ7A 4EW6A 3PX3A 1U0TA 4FSDA 3RYTC 2IW3A 5DDIP 3VX4A 1NYTA 1M2EA 4HZGA 5HYVA 1X7ZA 3MFYA 4PONA 2AOTA 4QOIA 3ZC3A 4AN1A 2Y93A 3VKGA 5H68A 1TU3A 3NONA 1JR6A 1XEWX 2DH5A 4KLNA 1I2BA 3WNVA 2X4DA 5BR1A 1YBAA 2JGKA 3DWGA 1QZZA 1V5EA 2VZ0A 5K0NA 2HJWA 2QRMA 1CUFA 2P90A 5A2GA 2PUCA 4NCXA 3GLFA 1TMKA 1E79A 1U1FA 2O1SA 3BHIA 2HF8A 1VKOA 2XLBA 4Q9JA 5ILGA 1NBWB 4KIUA 5GGYA 5LSAA 5A71A 3F3MA 5DP2A 2PUHA 2V7GA 4ENRA 2FSVC 2X5JO 2HWKA 3EJ6A 5JXHA 1Q74A 5LA6A 3VSDA 2V0NA 1D0IA 1WDWB 3QFRA 2GEKA 3OCJA 4QOJA 5BUCA 4UQLA 1A4RA 1IN8A 3AR7A 1EIWA 3RJMA 1PZEA 1YJAA 1Z3IX 5IYZF 5KWIA 3E9QA 4ZVKA 4PWZA 4EENA 3RNOA 1G16A 1W49A 1YZTA 2PUFA 2EERA 4FFDA 3BUSA 3E5MA 2V7WA 1OZFA 3QEBZ 1ZR4A 1YV9A 3BD7A 1NLYA 3CCBA 3RW9A 1P18A 4BASA 3JYNA 4RLSA 5ELMA 1MX3A 3P9NA 5JMPA 1K98A 3TLMA 1OIXA 2IUFA 2XF2A 2ZRAA 4M0FA 4EG3A 1IK4A 1PFKA 4NE2A 1L1RA 1SQ0A 4Q15A 5K51A 3R7LA 3TNLA 3WFZA 4X8LA 1BHSA 2Q0QA 4A1OA 5CGQB 4UHCA 4A03A 1E0KA 4BZZA 4L5AA 2UVPB 1P2VA 2Q50A 1ECJA 4D4MA 1QOPB 2YWCA 5K1ZA 2P6NA 3TNYA 5LLDA 1K8YB 1PWYE 4LK3A 3HCPA 2FHSA 2GLUA 3ROZA 2GBCA 2F3TA 5A4AA 3M3DA 2HRQA 1S3IA 2PLFA 4X5OA 4UEKA 2VDNB 3FWHA 1XG5A 1KQ3A 4ZI7A 2WNSA 4HJXA 3I45A 5FI5A 4PPYA 4KRFA 1KPIA 4ZODA 2GJ9A 2VATA 3I2IA 2RHMA 3Q15C 4HH3C 5CXSA 1NLUA 1GUZA 4BV9A 2AFVA 1AZTA 1EM8B 1AB6A 1UBMS 4X1IB 4H0NA 5C9ZA 4RK7A 2Q7XA 1V5WA 3B89A 4HZUB 1E5DA 1XA0A 1V5IA 1D2AA 4F8YA 4ZT4A 2NN3C 2R1TA 5KJ6A 3KJZA 2B5WA 2Q3MA 3LXMA 4J16A 1N6PA 1NX9A 1I2MA 2EJUA 1G6HA 3ANSA 3FTDA 1R16A 3VAZA 3ES9A 3PPIA 3WWZA 4XYLA 1QK4A 5KWJA 1Z8HA 1MEEA 2GTHA 2A8YA 1KP2A 5HJ2A 4QHTA 4FDLA 5DOZA 3NT5A 4ETMA 4Z9YA 3CF2A 4A0QA 3ZGZA 1JMKC 1ORWA 4MS1B 4W7HA 1KI6B 3A32A 3G9XA 2UYCA 2B20A 5KX5A 4JB8A 5LP6F 4DR3B 3O92A 4V1CI 4N6OA 4E2FA 4F85A 1N36B 2XVAA 4FEEA 3PENA 1Q7TA 3JQ7B 2BR5A 3R0ZA 4NEGA 1T10A 2QN6A 1EFCA 4YP1A 5BQFA 1QNLA 1E18A 3ICOA 4E3ZA 4XWWA 3NCHA 5BOSA 5KREA 1ZH2A 4GC9A 2GAOA 3DE5X 4Q9HA 1V4NA 4L6AA 4M8SA 1NFFA 2QRVB 3IPLA 3JAKB 2WQ6A 3NKVA 1UOQA 3W8FA 1GNRA 4US2R 4R05A 3PX7A 4CN9A 4RHXA 2PPLA 4HQLA 5HZKA 4TLCA 4V0SA 5CT6A 2EW1A 1H0SA 4YUZA 3RTEA 4KH1A 2XRMA 3TDKA 2J0QA 2WT9A 2YZ7A 4BNYA 4ENSA 3AEYA 4D43A 1Z6QA 5BSVA 4F4IA 3HRKA 3GA0A 1BKSB 1UBTS 1WW3A 4GAEA 5A1JA 4MV5A 3AF1A 4IVRA 5DOVA 3WKBA 4B32A 4ZJZA 3PRJA 4RH0A 3W0LB 3L6RA 3V2UA 2FPPB 4G2NA 1ACLA 1EG7A 3FDFA 1Z68A 4OHBA 1JYFA 3BWMA 3G6WA 5LMZA 3NVMB 3E9YA 2P9EA 2QGNA 1R0YA 2C0QA 1TM1E 3G5TA 1TJ4A 4G26A 4Q37A 3RHTA 5I01A 4OMDA 4MGEA 2VTDA 1MAUA 4IRXA 2YNMA 1OAKA 4YJKA 4BAUA 4EVSA 4IIDA 4F84A 1M0EA 1I32A 1UC4B 2QMUA 1NF3A 4X1KA 2Q28A 4WLEA 1XNJA 1Z26A 4F97A 1OFUA 1NP7A 5EQJB 4DC0A 1NRJB 1W73A 2XE7A 1PNRA 1CDEA 4P98A 4AX4A 4CGZA 1ZH0A 3ETNA 3DO6A 2O54A 1PLLA 3T0FA 2HMVA 3GIWA 2J9XB 4LIPD 4EX6A 2OZLA 2VPQA 2AKAB 5TF4A 5HRUA 3KQLA 4TWIA 4BGIA 4PHHA 4H08A 1L4UA 5JS2A 1J00A 1OXTA 1IPHA 1O94A 4EZIA 3DLPX 3QX3A 1FSPA 4TV8F 1GPAA 3VM6A 2ZYHA 3X1ZA 1H4QA 3LP5A 1B1AA 3WGQA 2BZGA 1IJFA 4FYIA 3N2YA 2WZDA 3LGSA 4AJJA 4K6OA 5JMWA 1FPMA 3TCXB 3DT8A 4BPRA 4YT2A 5J1TB 2EFCB 3EZXA 3KEQA 5F12A 2Y9MB 4X61A 4CIBA 4RAOA 1ISRA 1PTKA 3DO8A 1NXVA 2PBLA 1T9BA 4BNMA 1T0PA 1OROA 5C2JB 1ZSVA 4J1TA 4HZIA 3PC4A 1Y98A 3GT4A 3UM9A 1V4VA 1ETHA 3R0QA 1T8SA 3QG1A 3AVQA 4EFDA 2AYZA 5ESDA 4Z3KA 4S1PA 4CXMA 4G9BA 4P4TA 4KR7A 3KKZA 2LCFA 3OJFA 3Q3EA 1TPYA 2RHWA 4MKRA 3UXMA 3LQFA 1KFCB 4YGYA 3X44A 3Q2OA 3BVPA 3G9QA 3TBFA 3U49A 1SRRA 2V4UA 4E46A 2YHIA 3K3PA 3NVDA 4ZVMA 3DE1X 1HLPA 3O8CA 1NI3A 3UHFA 3U60B 1V16A 4AMYA 5DW3A 3E8SA 1WAMA 3OKFA 4G1EB 4BDSA 4D6PA 4DF3A 2GHIA 4KSBA 1E9FA 1VJRA 2E4VA 2R8ZA 4HAVA 3DMNA 4KOAA 4QLAA 1U8TA 1J56A 3OFJA 1CQWA 4TV9B 3GLGE 2NP6A 2DFKB 2PH1A 1VLJA 2EZ4A 3IAFA 4FJ1A 3OQJA 1U3FA 2NU8B 3WJ7A 5FLXA 3DMHA 4EL0A 1GTSA 1BXGB 3P45A 3W1WA 4HQRA 4BNWA 2VSFA 1RI5A 4DTIA 5BRJA 3CZ5A 3K1AA 4Z9XA 5DNDA 2FWRA 3LHSA 3I6BA 3STYA 3WDKA 4WK0B 5AOCA 5DHTA 5C8ZA 3MQ4A 3U4QB 3QH4A 4NOLA 4TS9A 4TXHA 1QYWA 4KO8A 5JBNA 4NCIA 4PHCA 1NQUA 2FWMX 1L8LA 4K6CA 3AILA 4OBXA 1FSZA 3L4EA 4OLJA 2UZ0A 3Q85A 2QR5A 1F7VA 2V8BA 4IYJA 2XV1A 2MSCB 4EKDA 3IT1A 1SG9A 4MR9A 4XCQA 2CXOA 3KJXA 5LMCA 2P2CA 1M8JA 2IUEA 2P77A 1EBBA 3LW8A 4UUNA 4CT5A 1B6RA 2AR7A 2PGJA 4GUDA 6ABPA 5LCXA 2JFWA 3JWGA 4F86A 2B78A 1OI4A 1LDEA 1CUZA 2F9LA 4M0EA 2UAGA 1EZ4A 4H1HA 5K0BA 4C3OB 3U3RA 1A9SA 2WTNA 4A36A 5IHPA 3PEUA 3U7QA 2IZ0A 2W42A 3O4RA 3O82A 2QM0A 3THXB 3TM4A 3G2MA 1T36A 3DP7A 1F2UA 5JAUA 4OXYA 4BECA 5LZ2A 3KQNA 1A96A 3ROXA 3WLFA 3PE3A 3AEXA 4BMXA 1BDBA 2WIJA 1JLKA 3IUNA 3NHUA 1KIFA 5ITSA 4P82A 1S3SA 4TS3A 1Z06A 1IMOA 3GT3A 1T5SA 2VZLA 1CQIA 4FN5A 2VHZA 4B3TB 2PFKA 4CDGA 1YBVA 4F7DA 4LE0A 2RD2A 1DBQA 3EXFB 4CEIB 4JSYA 1U0SY 2Q5LA 5CH8A 2HDOA 4A8JA 5F64A 3DAPA 1SHUX 4G3XA 5DTIA 5C5IA 2FPKA 4LE1A 2UVDA 2FMIA 1U1EA 2VJKA 1QJ4A 4P9NA 1SU4A 1EFDN 3CZMA 3UJCA 4U2CA 2CWDA 3HCNA 5ANRB 5AW7A 5DX1A 3VH1A 1X70A 3IEIA 1J0BA 2JLSA 1IQ0A 2QW1A 4DYDA 4FSXA 4QQNA 4JYMA 4YHBA 1F8GA 5EIEA 3ND9A 3ZWWA 4DCCA 2ZIFA 2CCKA 4D4KA 4J4HA 4M1QA 2I8LA 1K9SA 1PBNA 2YVLA 5DE3A 5DXAA 4Q9NA 4RE6A 4MP8A 1QBKC 5F21A 1E6UA 2OHJA 1OTHA 3PA8A 2W2VA 4D6XA 1V8BA 2ZR0A 3TW4A 5A2QA 5LMUB 1YFZA 1NURA 5B4TA 3PHIA 4BVEA 2C57A 1YZUA 1SVKA 3GJ3A 2OCYC 3JZAA 3VPAA 3K9FC 1WXEA 1CB7A 5BR4A 1DBSA 2B4TO 4OH7A 4MGHA 2ACEA 4B3GA 5IWCA 4MJ7A 4DN6A 2Y1DA 4IJ5A 1VG1A 3MLBA 1E64A 4JBHA 4YYEA 1VCMA 1XQWA 4PC1A 2Y1LA 2I1VB 1JI3A 2F1OA 3OBIA 4FCVA 4J43A 1HZZA 4TPKA 4BLPA 3IHTA 1XVAA 3T1TA 1QRAA 2P62A 5FWXB 4KQ9A 1RKBA 2BI7A 4PSDA 1P4HA 5EZQA 5EC8A 1WOMA 1VHDA 1YQDA 3S2YA 3LZ6A 3W5SA 1C8LA 4GUAA 1V8FA 1KPHA 1GU1A 1ULHA 2M6RA 5L4LA 3NHFA 1JJIA 3L49A 5DGXA 5IW8A 2XRZA 3C3PA 2QYTA 3BB3A 3QEMB 3CRRA 3IRVA 5DN9A 5J59A 3HVKA 4MW5A 1WSDA 3SEZA 4BO6A 4UUOA 5AK4A 2RH9B 3X43A 3H65A 1HLDA 3WLNA 1E32A 5LP6C 1TA9A 1O03A 2E4UA 2QQ5A 3BJMA 4FI3F 3KWFA 3RVKA 5HX7A 1QYDA 5EJFA 3UJNA 3SM9A 3S1LA 4DJDC 1DL5A 4EUEA 3HCOA 1H4TA 1KEWA 4K3VA 1AGRA 2XECA 2X13A 2OD9A 1U0OC 4LNUA 3NUGA 2JEOA 1CR1A 2EV9A 5BSRA 1DT5A 1E6KA 2QTHA 2QNBA 1F2TB 2OOKA 4NI5A 3LT5A 4NQZA 3C8ZA 5KQSA 1TC1A 4WJLA 4JU9A 5ED4A 1C1XB 1H6DA 2J09A 1RI3A 1NLFA 3N75A 2HLPA 1S02A 2HIGA 1SU8A 2QN2A 1KSGA 4E5VA 2XOEA 3LVQE 4MQFA 3DUFA 4OQQA 3LL4A 1NW5A 5C8YA 4OBWA 2CK3A 4YRFA 3SVLA 4QBKA 3AW9A 4C3ZA 4I5EA 1FNSA 1TU0A 3DKIA 3ROPA 2GPAA 4KR3A 1HQYE 3OUTA 4S1TA 2GZ3A 4CDNA 2H1OA 1GN9A 2EAUA 1M72A 4MVJF 4MQUA 4UMVA 3RSGA 4ZVPA 2BSXA 4DS3A 2BZ0A 3D4LA 3H3JA 4JJIA 2UYGA 3PR2B 1W59A 4LRYA 4YPOA 3KOYA 1FDOA 3OLYA 5KTMA 2RG7A 5CDSA 4JXKA 2JIDA 5KOHB 1KK3A 1TZMA 4PX9A 2J07A 1G8JA 2IYEA 3BMNB 3DAOA 2EFYA 4F9GA 1BMDA 1ZINA 3ROEA 3LOQA 3M6XA 5D3MA 2HRDA 3KLMX 5FRDA 5KYYB 1TQ6A 1UEIA 1AZWA 2Q0HA 2E0IA 5LBTA 4BZQA 4X0EA 4JUBA 3NG1A 2RHJA 4AC9A 2PSEA 3CQ9A 4P86A 2IUUA 2I9KA 2FUNB 3UC5A 4DIEA 3VPFA 1DAHA 4MUJA 2BE9A 2DWQA 3EVDA 3UA3A 5F2NA 1VFNA 1GR1A 1B76A 3TL2A 4PAOA 2JIBA 2HSGA 1XLWA 2Q27A 2LV8A 3RTGA 1NDUA 3FGOA 3QFCA 2EHDA 3W8RA 5JALA 1UOPA 4TRMA 1HY3A 3DDSA 4YPVA 4M8IA 1FVOA 4L4YA 1V11B 5EJMA 4BE7B 1FSFA 1LZKA 1PT7A 2D5BA 1F8FA 1GRCA 3E5HA 3UV3A 2CZCA 3EUEA 4RA9B 1NSFA 5JD5A 3MMSA 4CMIA 4UE3S 3VYUB 4EJ0A 3KETA 5FFNA 1MIOA 3E84A 4B44A 1NJSA 3SLKA 2ZZKA 1DEHA 3TZBA 4YT8A 1NBOA 5E8RA 4BLVA 1VRCA 4BC1A 1QFMA 4QGFA 1G7TA 1NVMB 4UM7A 1P3DA 1FP1D 5J40A 3SBXA 1QK3A 4D9EA 1E58A 2QENA 3QWIA 2HWYA 1EP9A 1FU8A 4JT2A 4BO3A 1QRUA 1L4LA 2HWXA 4MVXA 5GAJA 2R79A 3OPYI 5K01A 2WF5A 1B0UA 2IXAA 2Z3ZA 3H19A 4ITRC 5B37A 3TNFA 3ZDEA 1QIGA 1J07A 3M2TA 5BMVF 1WKVA 3TTYA 2H9IA 2OPBA 4I5DA 3IMEA 3RT9A 1TCVA 3Q9NA 4H16A 3TX6A 5K0LA 4MK4A 3PD7A 221PA 3PCXA 4BC0A 5DNEA 2WHPB 3G2HA 1TGYA 4YP6A 2BGWA 3OHSX 4RXUA 3FSGA 4RGQA 3LDFA 4CKCA 1WDKA 3FOWA 4HUQB 4BLTA 2AMVA 5L6MB 5EMKA 3QBJA 5FWYB 3MWYW 2BGUA 1H8ED 2G5CA 4HH0A 2EZTA 1F5NA 2H6EA 1ZA2A 1M2KA 1XN4A 1XMVA 2QTWB 2ZREA 3B85A 1MTOA 4RIHA 5FUMA 1KNQA 1J5EB 1PJRA 1WPRA 3HU5A 1PJ2A 3A9RA 3GQBA 4PANA 4OI1A 1U1IA 2I4LA 5DNYB 3H83A 1MPXA 3GMSA 3O31A 5FPYA 3VUFA 1H1LA 3W8EA 1ZIXA 1UM9A 1JEEA 2PXCA 1QAOA 1K06A 2XGGA 4YYZA 4LF5B 4X6YA 5KOJA 3JSAA 4JLPA 4Y6RA 5CA0A 4BZWA 3OX2A 2GCEA 4HWKA 4QPCA 1THTA 1XZEA 5DBOA 1N5MA 2YWXA 1LBEA 3M3PA 2QYSA 5FPSA 3K72B 2P69A 1VKZA 4GSYA 4B7UA 2RG1A 5JBIA 2G7MC 2CB0A 3AIMA 5ICCA 1VE5A 3WYGA 3ZBUA 4JQCA 4AJOA 2J5XA 3INNA 5DK6A 3M1AA 4K05A 3OF5A 4Q03A 4BNVA 3UXYA 2XEXA 1CR6A 2W6QA 2YJGA 3ETDA 3IAAA 2OQRA 2ORVA 2VJYA 1WL8A 3TQOA 5FBHA 4E5YA 4JI8B 1N2GA 2OBXA 4H3HB 2PVCA 4FN4A 3W9YA 5LD2C 1ISIA 5AP9A 3ABOB 2IPMA 2YFQA 3LDAA 4Y2JA 5CNIA 4AQDA 4DL9A 2UXDB 1JDBC 1MR3F 1O3YA 1PUXA 4DGSA 2DTEA 1EBFA 1IZ7A 2BZSA 2O14A 2BRUC 3A3KA 3KZKA 4FILA 4PF1A 3AESA 4CL0A 4NXMB 1OGYA 3AR6A 3K2BA 1LLQA 4HDRB 4WADA 1ZXXA 4ZCTA 3RIHA 5JDIA 2G6TA 2PJZA 4L6CA 2AX4A 2WD7A 1GG9A 4UVGA 1OASA 2HIMA 3DQZA 3ND6A 4JX9A 4TWBA 1O97C 3HRHA 3INGA 1E1QA 3IP6A 1NMZA 1DQPA 3FCYA 2AC7A 3FW1A 4LHYA 4TQUS 1YRLA 3FOBA 3HB4X 3MPUA 3AHCA 5KSOA 3AVTA 2FA9A 4I5GA 1Y7LA 1I30A 1OZGA 2OLJA 4C4YA 4DRZA 4ZQBA 4KLZA 4HTFB 4WXPA 3EW9A 5CYGA 2B30A 1N5KA 2WVJA 3KE8A 4HAZA 4LYYA 4XX0A 1V9LA 3SI7A 4EMBA 2FWPA 1UPXA 4EVIA 5IX8A 5BW4A 5GADl 3TRJA 3BGOS 4MRMB 2C07A 2ZRDA 2ODBA 4CM6A 1ZOOA 1Y37A 1T4BA 3AHGA 4LMRA 4P5PA 3DVAA 3K20A 4OATA 2RI0A 4YV2A 1ZMXA 2J3LA 2WIDA 4HB2A 3RPEA 4ZDJA 4AU1A 3K9WA 3Q6IA 5GINE 4RIEA 3U26A 3FE2A 3HWX1 1TI7A 4CR7A 4ZANA 2INGX 3AHDA 1WABA 4NONA 5BNFA 1XC7A 2CHFA 3SS7X 1E7WA 4MI1A 4XYEA 4LF4B 2QL7A 1T9KA 1Z0DA 3TOCA 3OEED 3OZAA 1EDZA 2ZXFA 1YO6A 2NQ8A 4G5RA 3TZEA 5KTYA 2CEKA 1XAJA 4YJ3A 1Z29A 1M2VB 1WCXA 2ZE7A 4FQ7A 5M29A 5A62A 1M10A 3HXMA 2GCGA 1NC1A 5K8UA 3G59A 4TL7A 3ZBQA 2W93A 1W87A 2O5VA 2WYWA 3IDFA 1KJJA 4G8BA 4GQBA 4N9QA 1P4JA 1S96A 2I4RA 4FHGA 2WMDA 2LW7A 4TLBA 4CTNA 5CDFE 4C0LA 1A7UA 2L19A 3OEWA 2NMVA 3E2IA 3PLAE 3PQ3A 4Q48A 4J8PA 4BO8A 3HJRA 1MU0A 3QLEA 2UUOA 3F96A 2VPPA 5AHRA 1KAMA 3BSYA 3E82A 3IS3A 1T4GA 2MTBA 1Q22A 2G40A 1XZDA 3N76A 2YYSA 4H1TA 1VYHA 1YIOA 4GVLA 3RS2A 3D3NA 3GFQA 4G86A 3N2NA 3E18A 5KTOA 3IHWA 2VZ8A 1VKRA 2OQIA 3DEIA 4FI3C 1PSWA 1NFRA 2C5EA 2PCLA 2RKBA 2WIGA 3CLSD 4TZ0A 1L8AA 2JGJA 4NCNA 3JATB 2HU2A 3WHPA 1IRIA 2CXQA 2YFKA 5F5LA 1F9AA 3I62A 4DC1A 1KI9A 4ZVUA 5EZSA 2P6RA 3KFLA 4EQ6B 1KSFX 5KYXA 4JQZA 3SYKA 3L46A 3DONA 1C3XA 3VPCA 3ZBTA 4R1QA 3U7HB 1SUEA 5DBFA 4B87A 3SEAA 1F06A 1XCBA 2X7XA 3ZE9A 4N49A 3E1KA 3MOGA 4OGWA 5DRTA 5BSHA 2OG1A 3JAWA 4CMEC 4FWTA 4PG6A 2AN5A 4OTZA 1BEEA 5AJHA 3K53A 4O8CA 4DJAA 3GWGA 3EY4A 5DCYA 3FYHA 1KKMA 4Q3LA 3V9PA 5CEJA 2D62A 1C7ZA 3Q7TA 1DIGA 2XBMA 1C0EA 2DTDA 4Y2TA 2VF5X 3GOHA 3GT7A 1OLXA 4G01B 2BBTA 3NAMA 5AW1A 3FWPA 3N2ZB 1CPYA 2FFJA 2GASA 3EG9B 1CVLA 1G0NA 5ELLA 1UJCA 1EESA 4ZT2A 2C5LA 4HDSB 4WLFA 1V7CA 4NH0A 2YIMA 4X60A 4B3MB 2EWWA 1NLZA 4IOLA 3TDNA 2YYYA 1HNWB 1TX4B 2P35A 2H1IA 1I7LA 2I3GA 3L07A 1HE1C 3UQZA 2IHJA 3PXDA 4P22A 4V39A 2YWJA 1S7GA 5DVZA 3KUCA 4B9EA 3S2SA 1NMYA 4ZP1A 4E22A 4XA8A 2NADA 1H66A 2ZS7A 3HCCA 4P32A 5EP2A 5IJ9A 4Z99A 2J6HA 4GWGA 3GUCA 3O91A 5K4HA 1DDIA 5AVTA 1QRRA 1VDMA 3DE7X 2HA2A 4XFJA 2PXXA 2FAXA 1FQOA 1E5QA 4K9RA 3TLAA 2PJUA 2Z5FA 5C5DA 4NOKA 4ESEA 2REQB 3B6EA 2PQ2A 3R7AA 5IDVA 5KYUA 4K9PA 4D9BA 4YCNA 2OHHA 3B6IA 3WX0A 3PC6A 3CYFA 4MWBA 3FGPA 4FFRA 4UVIA 4ECEA 5AUPB 2PKYX 1NVXQ 3MT7A 4J9VA 1P74A 2PUTA 1NQWA 1VCOA 2VKTA 4YAWA 2JGAA 3FPKA 2H5LA 1WMAA 2NYVA 1UFRA 2FKNA 3IP7A 4X92A 1FZTA 4DDUA 4E14A 3A4IA 4MV8A 1YH3A 1R66A 3IAM6 1Q7CA 2AZDA 2ZYIA 5DYTA 1MOZA 1PG0A 3RB8A 4RHYA 2ACVA 4JFAA 3PHGA 4KACA 3TB4A 4PYNA 5DN6D 5I5GA 2XT6A 4QELA 3CWZA 3QPVA 4UTNA 3U4CA 4GEGA 5UKDA 3FVWA 3GDHA 4DM7A 3L93A 1W9HA 3SICE 3GLHA 4RS3A 1E1CB 3PQ6A 4MDYA 4WH0A 3RFVA 3RU7A 3TUIC 1UKYA 3VNQA 4HT3B 1NULA 4C7OB 1BW9B 3IP9A 2YN2A 2O0JA 3SKYA 3C6MA 2CJPA 4YMUA 3TI9A 2YIDA 4MYSA 1NVTA 3DM9B 3AY3A 3ZU5A 1TMOA 3FKSD 2ZU0C 2XDQB 1I6MA 4XIGS 3SBOA 1R0BA 1K63A 2RHBA 3GD7A 3K70D 4US1R 4HYEA 1F48A 3IBCA 1YDFA 1A8IA 3BA6A 3KOUA 4J49A 2CUNA 3C98A 4DARA 1PFUA 2CLDX 3WTCA 2G5GX 3UMMA 3MMXA 3RFXA 3FLMA 3LXXA 3SNHA 1P62B 2ZBUA 1RDFA 1H6AA 4R4JA 4N7RA 1FK8A 3HUEA 2L69A 3WGKA 3OCXA 2GBGA 4L02A 1JA1A 3CLRC 3IB6A 5EY5B 5TMEA 4OLFA 2BEWB 2PSJA 2ZJAA 2GKSA 3DE6X 4O0MA 4PN7A 3KQTA 3EXG1 5CM2Z 1UC5B 1GXSB 2CUTA 2WDZA 3KT8A 1AUVA 1PO7A 3QU5A 4J16C 4X97A 5EIFA 1NXOA 4MVWA 2IA5A 1F7UA 3ZCUA 4HADA 3M6VA 2I4MA 1I2AA 1QQ6A 3AY7A 4IICA 4BNLA 8ADHA 1JR3A 4TYNA 4RFSB 1FFCA 2RHCA 4LOHA 2HX1A 5F3DA 3RYFA 4C2AA 2GO1A 4GE0A 5FUQA 4FWBA 1X7GA 3REFA 3H7AA 1DZ3A 3Q10A 1TQ8A 1Y9ZA 1Y5IA 3FSEA 3HHEA 3ZYCA 2WAAA 3DOFA 5L3RA 4MUXA 1UXIA 4PG8A 2NIPA 2QS9A 4KIFA 3MJCA 2UYQA 4RFLA 1FC0A 1SXQA 4KRXA 4EB6B 3HO1A 1ML4A 2FUEA 3A26A 3CN9A 1Q7BA 1QO9A 4GWKA 4OM8A 4Q4HA 5TV2A 1RYZA 2G1JA 3RJTA 3BKXA 1G4AE 2PANA 5ULLA 1RM5A 2VJNA 4HXGA 4HBZA 4YTEA 5JSKA 5BN3A 3II6X 3B8HA 1XIVA 3B6JA 2IKSA 1ZXBA 4OFWA 4D44A 1H5NA 4YALA 3QVLA 1RKQA 2PIAA 5GIOE 5EVCA 1UBOS 1SCJA 3LO5A 5JVDA 3IVGA 2LPMA 4F38A 4K81B 4WLVA 1SC4A 1EU1A 4KMOA 1DLJA 3NOVA 5IZ4A 3BMCB 1LY1A 1ESZA 2OKGA 2GCOB 5C7LO 2E1PA 4BRZA 2GSWA 2QZJA 2G83A 3GBVA 1RWKA 4F91B 5CHYA 3G7UA 4OJTA 2VEOA 4YCMA 4MAFA 4QUIA 5FO0A 1U80A 3FWNA 4D0SA 5I6DA 1BWSA 5A03A 1QV7A 2V98A 4PEVA 1G59A 5CB8A 2B82A 1A8UA 3R5XA 2XLCA 2YV2A 3D1LA 2POCA 1CIPA 3OU7A 4L22A 4WRRA 2YNMC 3H9EO 4PLVA 1ZQ1A 2DFTA 3NHRA 5IJWA 3TG8A 6CHYA 1V0JA 1QPZA 3L0CA 1J8FA 4QXPA 2DHQA 3R9XA 1N2XA 2VJCA 5BSFA 1SR8A 4G65A 1G2OA 4URVR 3DGEC 3UPUA 2R6GA 1OXUA 2JKZA 3CWQA 3EPPA 4KXFB 3KOZA 5A06A 4MIYA 3DVRX 2FYTA 3L4BA 3BXPA 1OJLA 1Z56C 2K2WA 1M76A 1DTWB 3NV9A 3NPMA 5F78A 3VTZA 4YAOA 1NVBA 3KKQA 3NO4A 1K8QA 1W2WB 4EY8A 3CZAA 3B7GA 1O94C 4LHEA 2JK0A 4IJMA 5E9AA 1PR9A 1YA6A 3QK7A 3AFOA 1MCZA 2V9ZA 3IP3A 4V3CA 5TPWB 2JD2A 1XVIA 3FF1A 2BUCA 1XHEA 1DQSA 3PLNA 4ZQFA 5LWQA 1XELA 4URZR 4EF4A 3ZNOA 4B7ZA 1FFSA 3VC1A 4B6QA 2ZJ5A 5CNJA 1RSZA 3JQ6A 4CKWA 4GP7A 3FYTA 2HJSA 2CXRA 3DMDA 3E3MA 2QRZA 3LJKA 3KZVA 3BXEA 1A9RA 3KLOA 4KWTA 1UBHS 3EXEA 4WJZA 4YJFA 3Q7EA 1QGYA 2DWPA 3KYIB 4R8VA 4W8HA 2CJWA 3RC1A 3ZD8A 4B3JA 3JQRA 1RM3A 4TVOA 3UOGA 3TR5A 3NBMA 1M2JA 5JZOA 2CSXA 2R7KA 4M87A 5J4KA 1WQ4A 2FR8A 4DG8A 2GN2A 5JH7A 3H9CA 4Q47A 4KXVA 1E77A 4BFXA 3MTGA 5K8LA 2V6IA 2Z4TA 2BELA 4OKIA 4TTVA 3VO1A 3WOHA 5M34A 4NENA 4LOJA 1Z13A 1HYEA 1F0NA 3QBDA 4V0ME 4CGYA 4MJXA 1DKRA 3TWOA 3D2BA 3INTA 1M6WA 4BGVA 2HEGA 3L5OA 5F2KA 3WL7A 5JC8A 1ESMA 1GD1O 3FHTA 1I4EB 2GZ2A 3NR2A 4KE8A 4QPJC 2AFHA 5CJJA 3IA7A 4ZV7A 1YZFA 2FW1A 1QPGA 2DBYA 2QRUA 2X0IA 3O21A 4RF2A 2HNAA 3DBHB 2PX8A 3EZYA 3FUVA 4I66A 1ENPA 4UNSA 2ZSIA 3DHYA 2CXHA 4TX1A 2UUAB 3FIJA 1D5CA 1PNTA 5FOQA 3R3WA 4M1WA 2FSPA 5BVHA 4RW0A 5KHAA 1OPXA 1W4BA 4B74A 3H1GA 1QFYA 2VYVD 4CTMA 1OF1A 2C5AA 3A9TA 1TM2A 1WZCA 3P9CA 4FFOA 4Q3EA 5JQGF 5FF9A 2WE8A 3Q7QA 1WP4A 1ACMA 3OE7D 4TTQA 2VK4A 4EFLA 1P2UA 2V58A 2XD9A 3GJ7A 5A7GA 3U31A 1JL3A 3ZDXB 5TS3A 5IANA 4IINA 1O95A 3T1OA 5FFMA 4JI2B 4HGNA 2WVHA 4PYIA 3HPRA 3UHOA 3BGSA 4W5WA 1LK7A 1NTRA 5AQ1A 3M6MD 3DP9A 3RC7A 4JI3B 5JFGA 1A27A 3BE8A 2EX1A 4FWIB 5BOVA 5EZ5A 1BA3A 3EVNA 3K7EA 1M7BA 3WGHA 1Y1PA 3JQGA 2ID4A 2HB6A 2IELA 3DE0X 4YAUA 1NJ8A 3NVAA 4XDYA 1FXSA 1V4BA 3PIIA 1Q6YA 5KTKA 1MKYA 3U61B 3USCS 4JZYA 1GAXA 1U8ZA 3K96A 4H6XA 3R9WA 4ZHQB 3ME5A 3T0IA 2XWPA 4U7DA 5AK5A 1ULTA 3CEMA 3ZI4A 4CQLA 4M1EA 3RYHB 3GPLA 3UK7A 1KFEB 1FX0B 1RNLA 1M6VA 5CVEA 5C31A 4CKBA 5C53B 2H51A 4JA2A 2EBUA 1G8YA 3ENWA 4MRNA 3QNWA 4YRMA 4HV4A 2XKKA 3GN1A 3PEWA 3NRJA 2PSDA 3ICQB 5L7TA 5H82A