1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
4QYWA 2FQWA 4WUTA 5FBHA 1EWTA 1Z2EA 1JFVA 2JCGA 4KK4A 3BBLA 3CNBA 4MR8B 3N0RA 4RV5A 3GL9A 3T8YA 2H3HA 1RXIA 2XDYA 4HNSA 4KRFA 5IEJA 3OLZA 3N75A 4FB4A 4MS1A 4OLAA 3FFWA 4JB0A 2QVGA 1J56A 2FMKA 3C97A 3ILYA 5TQJA 1USKA 2GI4A 1PEAA 2MSWA 4RSMA 4MR7A 1ISRA 3O2QB 3BILA 3URMA 4Z4CA 2JVKA 2YHAA 4RY9A 4LE2A 4EGSA 2CD7A 1TMYA 4ETMA 1ZITA 4D74A 4EVQA 2R25B 4MS4A 4ZYLA 1Z2DA 3ROFA 4N0QA 5FWYA 5BRJA 4PZ0A 1ZGGA 4M88A 3OMWA 5B3JC 3OM1A 4G0QA 1QP7A 1GCAA 1CEYA 3KJXA 4Z0NA 1U8TA 2IKSA 3RVPA 4RU1A 1ZAYA 5JNWA 2QVCA 4MRMA 2VYCA 3HM9A 1GUBA 2ZWMA 3MYYA 3ILHA 2ID7A 5DGCA 3T95A 3OM0A 3TX6A 1ZESA 5PNTA 1DCFA 1NXPA 1Z15A 3GV0A 1JWLA 3QELA 1H9CA 5EWMA 4ML3A 1IIBA 2AYZA 1PEYA 4MQFA 1M2FA 2QSJA 2IPAB 4W5RA 3GA5A 5TQ0B 4GPAA 4MQEB 3EQ2A 3T38A 4EUKA 1E6KA 2NT3A 3MM4A 4MR9B 4IGAA 8ABPA 3Q7RA 4L85A 3C3KA 1E2BA 1ZVVA 4WT7A 1YK1A 3F7NA 3OQNA 3GYBA 3LUHA 4W5TA 5JNUA 3F6CA 2FQYA 4P1ZA 5BRAA 3N0XA 1P6QA 3JVIA 4DN6A 4EYQA 2PL9A 3W9SA 3QEMB 4S04A 2IYNA 1ZY2A 3A0UA 3O1IC 1DRKA 2JBAA 4O1IA 1JBEA 4QYMA 4ETIA 5IUJC 1YK0A 1DCMA 1U2PA 1Z13A 4LE0A 3H5IA 5TPZA 2WRZA 2H0AA 2FMFA 4RY8A 3H5OA 2OENG 1YTUA 4EYOA 3O1HB 1A2OA 2PUGA 4L4UA 1T34A 2QU7A 3TB6A 2IDMA 1VRVA 4ZJPA 4W5QA 1JF8A 1AB5A 2LIVA 1OXBB 4RXTA 3RQIA 5EWJA 3RVJA 4F8JA 5KQGA 4DADA 2FW0A 3NHMA 3A10A 1L5YA 3H5WA 1Z26A 4H60A 1QP4A 3KHTA 3MA0A 3SY8A 4EVSA 5EWLB 2VK2A 3OQMA 4JASB 2E4XA 3OO0A 4F06A 2JB9A 2GBPA 2W42A 3QLVA 4HNRA 1DBWA 4EYGA 5KQMA 4RK1A 1JFSA 3IP6A 4OATA 2CHFA 2L18A 2MYNA 3K4HA 4HNQA 4EYKA 1FFGA 1GCGA 5CNJA 3SAJA 1TVMA 5KC9A 5DLEA 3VNBA 9ABPA 2JVJA 4YV7A 2J48A 5DKFA 1PNTA 3GWGA 5KC8A 4KNYA 3DZDA 1JX6A 4Z4IA 2LBPA 3CG4A 3QLTA 4RK5A 4KREA 3UUGA 5IEBA 3H1FA 1JFTA 4LZLA 2FTKE 5KWSA 3O74A 3HDGA 2NUBA 3EODA 3KLOA 4RXUA 2L17A 3TD9A 4GNRA 1QP0A 1KMIY 3LUJA 4PICA 4N41A 5BR1A 2I6FA 2IOYA 1NATA 1AB6A 4FE7A 3RVLA 1YS6A 4MR7B 1MB3A 3OMXA 5F64A 3HO1A 2HQOA 4LDZA 5FBKA 1S8NA 1BDIA 3CU5A 3IP9A 3BRSA 3LKVA 4N0PA 3JS5A 3RVMA 3CFYA 4Z9BA 4N47A 2GX6A 3L6UA 5GQSA 1JDNA 2E4VA 3C3WA 4G0MA 5IC5A 2HQRA 4TLMB 2VUHB 5T7BA 4RK0A 4MS4B 2FN9A 1DCKA 3OO1A 4QICA 5TPZD 1RZRD 4NCBA 4MS3A 2PAFA 1DP4A 2Q5CA 2P4UA 3E61A 1Z18A 4G0OA 2AYXA 1NXVA 1R8JA 1ZH4A 3BREA 1OXKB 3QELB 2OQRA 4XFKA 2RDMA 4H3HB 2V0NA 3HK2A 1ZDMA 4WXMA 4EVRA 3JTEA 3N0WA 1QQBA 4JP1A 3QLVC 4CBVA 3K9CA 1ABFA 1C4WA 1GLGA 3RVOA 5HSGA 2FMIA 3HV2A 2PJUA 3CKMA 3CG0A 3CRNA 4MR8A 2L19A 2PLNA 4RWEA 4YGXB 1DRJA 3KCNA 2M98A 3JVDA 1FQWA 1QQAA 1A0OA 3O1JC 3ROTA 5DCLA 5TQ2B 3KSMA 1DC7A 3G1WA 2LP4Y 1QPZA 2QW1A 1YVUA 5FWXB 4OBBA 3N6VA 4KZKA 1W9HA 1Z16A 4YR7A 4Z4HA 3C3MA 3LKBA 3JY6A 3LMKA 1Z17A 4Z99A 1VPWA 1YMVA 1M2EA 4LDAA 1U2QA 1LJUA 5D2CA 4RS3A 5KQPA 5IBQA 4G0XA 4NCAA 1E6MA 1BVHA 5I4CA 1KRXA 1Z25A 2QR3A 4P98A 3L49A 2WB4A 4XAQA 2FN8A 1APBA 1PNRA 4NICA 3SNKA 5HM6A 3KYJB 2NT4A 2WMYA 2JRLA 5TPWA 2NZVG 3CS3A 4D6XA 3HDVA 1RZRA 4YCSA 3E3MA 2WJAA 3H5TA 4QPJC 4E7OA 4G0ZA 4KV7A 2R48A 3I5AA 3EJWA 2FLWA 5T3YA 2WY2D 4RK6A 4WWHA 4W5NA 3UKJA 2RJNA 5CHYA 5E3JA 3JPWA 3MQ4A 4ZPJA 2R47A 3DLBA 3VNAA 2JK1A 5IUNC 2R4QA 1ZHHA 1RPJA 1VKRA 1NXXA 2DRIA 2MYPA 4MYRA 1RXEA 4KPYA 1P6UA 1D5WA 4UHKA 3HVRA 4MQEA 1SXIA 4WXEA 3RVNA 4OG2A 1LJLA 4MR9A 4RY0A 1JDPA 3LTEA 4N76A 2B1JA 4B09A 1NXTA 4ZMSA 1NTRA 2PUFA 2A9RA 3RVQA 3NHZA 2E4UA 4LRQA 4Y9TA 2FLKA 4Q6WA 5JNVA 2P9HA 3CZ5A 1ABEA 3NNNA 1JYFA 1M5UA 1Y1LA 3QEMA 3MF4A 3SM9A 3NNSA 4MGEA 1FSPA 1DJMA 5CNMA 3I45A 2O20A 2HQBA 1TJYA 2LUOA 3M9XA 7ABPA 3EAFA 3DGEC 4YP9A 1Z12A 3H6HA 3JPYA 3EQZA 4H3KB 2F8SA 4DQDA 1URPA 2IPNA 1LBIA 1QNLA 2E4ZA 2KYRA 3BRQA 3MIZA 5CNIA 1WETA 1NY5A 2E4WA 2FXIA 2N9UA 2CWDA 5HQJA 1EFAA 1MB0A 3QX8A 1A04A 1BA2A 1M5TA 4E7PA 4MS1B 3O21A 1D2AA 5EWLA 2GWRA 3RVRA 3UK0A 5JNTA 2WJWA 1PHRA 1USGA 4KVFA 2M1ZA 2HSGA 3NNDA 1XHEA 3KKEA 4Z4FA 1UDRA 4ETNA 2JVIA 3A3KA 3O2JA 3SQNA 1ZGZA 3IPAA 4KQ9A 3N53A 1EWKA 1TLFA 4LX8A 2ZAYA 4YWHA 4JOQA 2X7XA 3QEKA 4RKRA 3HUUA 3SG0A 3FFTA 5CNKA 1U0SY 5FWYB 2FEKA 4RDCA 3RH0A 2QZJA 1USIA 2FKAA 5JS2A 4UHJA 2FVYA 4YLEA 3EULA 3DBIA 3C6QA 5ABPA 3QK7A 4MRMB 1XWWA 3GBPA 3MMNA 1CYEA 4NV3A 4XARA 1DG9A 2RGYA 3N8IA 3OLYA 2ID9A 4RXMA 4G86A 5C5EA 1MIHA 3HUTA 1P8AA 1SXGA 4N03A 3FGZA 4MLCA 1MVOA 3GRCA 4JAVC 2PKXA 5EWMB 4XXHA 4MQFB 6ABPA 1TM2A 3Q7TA 1MAVA 4IMIB 5KQLA 4IF4A 2MSKA 1ISSA 2NZUG 4F12A 1QMPA 4KQCA 4NQRA 3P9YA 1D1PA 3LUKA 3OLVA 4RZSA 3HSYA 3CTPA 3TO5A 1JLKA 3OQOA 3Q15C 4PE5B 4TMYA 2PMCA 4W5OA 3H75A 5IX8A 1VLZA 3DGFC 3Q41A 4WZZA 3O75A 4LE1A 2PUBA 3H1EA 3LUGA 3T6KA 2PE5A 1YS7A 3LUAA 1KRWA 3KYIB 2PUDA 2JBAB 2PUEA 1LBHA 5DTEA 3KLNA 3G85A 3IP7A 5TPWB 5C5CA 1JYEA 4Q7EA 2A9PA 2VUIB 4MAAA 1P2FA 2FEWB 1JL3A 3KG2A 3CHYA 2LPMA 3LUCA 3EGCA 3HJFA 2MYTA 4YRZA 1DZ3A 4Z4GA 2FSPA 1FFWA 5BQ3A 1F4VA 4O1HA 5EWJB 1SXHA 1D4ZA 3CZCA 2MYUA 3IPCA 1YIOA 3H5VA 2WWVD 4ZMRA 6CHYA 1JHZA 3LUDA 4G0YA 2B4AA 3CLKA 1C0EA 3GBVA 1F51E 1XHFA 1LK0A 1ZN2A 2IPLA 3TMYA 2PUCA 3Q7SA 3D02A 4HYEA 2E4YA 3QLUA 3A0RB 3KTOA 3F6PA 2TMYA 4Q6BA 3S99A 1DBPA 2QXYA 2PL1A 4IRXA 3FFXA 4KK3A 1QO0D 3Q9SA 5TQ2A 4KFCA 1DBQA 5TQ0A 1B00A 4XLTA 5FWXA 3H6GA 3I42A 4KMRA 5HKOA 1CHNA 2PUAA 4O5AA 1K66A 1YMUA 3D8UA 1NXOA 3OLWA 2A9QA 1E6LA 3I09A 3HXMA 1RNLA 4IMJB 1SRRA 3LUFA 4RK4A 1EWVA 1W25A 2HPHA 1GUDA 3IDOA 3LOPA 3FDFA 2MSLA 5JNRA 1BDHA 3KS9A 4D6YA 1KGSA 2FQXA 1EAYA 3F73A 5TE9A 3H1GA 1L5ZA 3FMVA 5B3JA 3M6MD 3HEBA 3RVSA 2FEPA 3DLHA 4EY3A 4F3TA 3B2NA 2YHBA 4OTZA 5ED4A 1D1QA 1SD5A 2GKGA 3EDCA 5GOTA 3LFTA 5IULC 4RK7A 3R0JA 4G0PA 1NXWA 1U04A 3H5LA 4MLDA 4XASA 5JNSA 2CHEA 4JB2A 2FMHA 1DC8A 3HZHA 4TN5A 4TLLB 3GT7A 2HJ9A 2RJOA 4YO7A 1EHCA 3HCWA 2IPMA 1ZH2A 4MS3B 3RVKA 4PYRA 5KI6A 4F11A 3NBMA 4IILA 4RKQA 4Z9AA 1K68A 4G97A 1QO0A 3HS3A 2F8TA 2L2QA 4S05A 3OLXA 1HEYA 4FE4A 3M9WA 3O2SB 4JA2A 4Z4EA 1BAPA 1FFSA 2QV0A 1I3CA 1NXSA 4PEVA 5IUKC 2BGGA 3IP5A 4OLBA 1JH9A 1PUXA 2A9OA 4MPTA 5JS1A 1BDJA 3QLUC 1QKKA 4YS6A 3QX9A
chains in the Genus database with same CATH superfamily
1VL0A 3E8MA 3MIIA 2F3PA 3FMGA 3LT0A 2WUEA 4D2IA 1QC5A 1RJ9B 2OGUA 3CNBA 1N6IA 4L5YA 3MVEA 1PDWA 3E9DA 5BV1A 1ZZEA 4R40A 2WAOA 5JHGB 4JC0A 2JRCA 5TMEA 3MAJA 5M2QA 1AK9A 4XA8A 1HPLA 5JAIA 1HQCA 5IRCD 2P2CA 3KZNA 4UDOA 1N3BA 5KYKA 3GAAA 4OGWA 2O3JA 4MA0A 4TTPA 4UEKA 4MA5A 1MEEA 2ANBA 4RSMA 1H9AA 3V4OA 2GN9A 3HB4X 4IIXA 3H5RA 4LXXA 1TU0A 4MHTA 1C0IA 4HXEB 3DEHA 4MTCA 4NC9A 4MWBA 2ATVA 2DKNA 4IDQA 4X7MA 3VH2A 4A82A 1CETA 2QL5A 4FVTA 3S7ZA 2BFFA 1E6UA 5KJCA 4GHWA 2A7QA 3T7TA 4PAQA 4U2GA 2R25B 1ZXBA 4HH1A 2KJQA 3ROFA 5KS2A 4H3SA 5G4KA 3U44A 3FMOB 3JQFC 4PZ0A 3UMVA 3ZIAA 1WE2A 3ABRB 1CY4A 4G0QA 3UUEA 4CI0B 5CYOA 1ZUNB 4AY5A 1OGYA 4TYWA 4JOCA 4X7RA 1RQNA 4BMZA 2VQDA 2I66A 3IVMA 2WFLA 1NC1A 1O4VA 1XSEA 3VC1A 2DLCX 4X93A 2IYTA 4IKEA 1JG2A 2WYVA 1KDYA 2JKVA 5EA2A 5BORA 4RTNA 1H4SA 5K2MA 1QIEA 1SUSA 4GMHA 4HT3B 4AXXA 3MT8A 1QVRA 5MFPA 4RTRA 2RCNA 3MCVA 5E9JA 2F3RA 3E7PA 4MYTA 4ALNA 2NUAA 3CGWA 4BU0A 4Y2JA 4C6SA 3EPRA 4NBLA 4E3WA 4EY7A 3ZNQA 1MJFA 2D6FA 4TUYB 2B1QA 4Z51A 3C3EA 5KMGB 4P92A 4BPRA 4P32A 4FONA 2F62A 2J9GA 2PIDA 1OR8A 1YCFA 2JAUA 2PZAA 4KJZA 1XRLA 1ID1A 3CNQS 5KTTA 2BF7A 2EATA 1JGTA 1VJCA 3GYBA 3P2IA 1UMBB 3RRJA 1PG0A 4GPD1 4DDMA 1KO1A 4DSOA 3AONB 4R41A 3QITA 2HZ7A 4MI9A 1U7OA 3O1IC 4N18A 4HZGA 1TXGA 5A02A 2V3VA 3ZE2B 1JBEA 2GASA 2PD3A 1KFJB 3DXYA 3UT5A 4RM2A 1JU3A 2B94A 2ARKA 4R0VA 4PHCA 2CL7X 3EUFA 3QVGA 3TL2A 4BQIA 2A5GA 4UEQA 3GPLA 2BJVA 3I52A 1EIZA 3D1LA 1E7WA 4F2PA 2BHLA 5ENZA 2QPOA 2RBKA 4IS3A 1GDHA 4C30A 3I6ZA 1TD9A 4F4JA 4D9NA 4IZ6A 2PZJA 1AXEA 4XQCA 2VJNA 3QHQA 1FX1A 5A62A 3NHMA 2WNHA 1GGEA 4FOLA 3U3JA 3DT9A 3HYLA 4NXNB 3MJFA 4H60A 1DIOB 4PG8A 3V00A 5FA8A 1PFQA 1W34A 3FWPA 3HYNA 3FDZB 2EBUA 4MUJA 2Y0CA 1SZPA 3U4QB 3TW4A 1BKSB 1TJ3A 3CYFA 2OLJA 1DTWB 2ZQYA 1WVGA 2A88A 1N9GB 2XUJA 3QLVA 4V0LA 4BO0A 4M99A 4N9QA 1A2QA 2FDXA 2DQZA 3C3BA 1TQ8A 2L18A 2WSYB 3BSYA 3P19A 5EPEA 4CF4A 5A3RA 5EQJB 1HLFA 2G9QA 3R7NA 1GCGA 1EVEA 2XW6A 3QVSA 3STVA 4JYAB 2HLDA 4BJ6A 1I7LA 3FCUB 4ZHQA 5KC9A 3T1OA 4S1VA 1S4MA 4MKHA 4WTOA 1FSPA 1DX4A 1MVLA 1PQUA 1RWKA 1Z0SA 2QJFA 5JW6A 5DKFA 1JIXA 3CE6A 3A1DA 2FW1A 3CX7A 4DKXA 1GGNA 3DHEA 2FX2A 3R5HA 4H6WA 3NAMA 5EMLA 2YOFA 3OUTA 3DQQA 4PNZA 1H6CA 2XKKA 3H9GA 5EE5B 5KX5F 1Q95A 3O92A 2IHZA 2BLLA 1ZGAA 2NU7A 1GQ2A 1ZVMA 5E6RB 1Z7BA 3WV4A 4A1FA 5KNCH 1MFPA 1XNGA 2JNWA 2X86A 4LJ4A 5F9FA 3MERA 2H1HA 1RFLA 1TT5B 1V0JA 2IY9A 2J87A 3U48A 1U0RA 3ZCVA 3EXEB 1L5SA 3C3XA 3HXKA 5CX4A 1R0ZA 1YS6A 1VXOA 3Q7IA 4BNWA 1P1FA 4LSZA 1V8OA 3K2QA 3BRSA 1PWEA 2BGWA 4DG9A 2X1HA 4DV0B 3NJ8A 2AFHB 5KVCA 3D3JA 2P1RA 3KOXA 2R60A 3K2IA 4Q21A 5KCZA 4N65A 1U2DC 2VUHB 3W9UA 1O8CA 1YOVB 1CKEA 3LX8A 4ZPXA 1NTOA 1NW9B 1RRGA 1DFGA 2ODWA 3NBXX 1X1CA 3RYHB 4YALA 4BX8A 2JGLA 2DBRA 4CMKA 1XCBA 3QXXA 4XWWA 4NCBA 3VV2A 1HG0A 4JITA 4HQFA 3OQ1A 3S5UA 4EJMA 5BYKA 3ZLVA 1M74A 2XCOA 2HBYA 4G1CA 1NMSA 5JQGF 1M2VB 3PUWA 1MB4A 4R7TA 4BNXA 1ZIDA 2BONA 1C7JA 3F97A 1ZH4A 5AT1A 4ZEXA 4EQ6A 3WICA 5BN3B 1X1QA 3NP7A 3Q98A 3HA3A 4BFTA 1S2MA 2QN1A 4H3HB 2ZIVB 3NHWA 1YB5A 1YQXA 5IT4A 4XD7D 3JTEA 4GOJA 1W30A 4JJZA 4KXYA 5HIMA 3RSZA 3TIXB 1RWXA 5AICA 4CBVA 3EPHA 5KOJA 3CEPB 5JJ5A 2R4UA 3CKMA 3O8LA 4YGXB 1KYZA 3FFAA 2CVZA 5JFGA 5THQA 2AZXA 1BD3A 5A7GA 3JVDA 5J2TF 2RK3A 4J7UA 3KDSE 3A8TA 1FK8A 2R1ZA 4TKUA 3RUEA 3K09A 1VKJA 1U4OA 1ZUHA 4W1PA 5DYTA 2DM6A 2CXHA 5D87A 4DLKA 3D8BA 4UEJA 4G5XA 3N6VA 4MDHA 4F71A 1Z16A 2VWPA 4K28A 3HVIA 1ZK0A 4II3A 4L7VA 1K63A 1HDCA 4BS9A 5EGNA 4RNDB 3T3IA 1QHYA 1P29A 2CBXA 1YMVA 1R6UA 4AXBA 1LLDA 5BW8A 1OFTA 8ATCA 1M2EA 5H70A 4HN9A 4QC2A 1KSJA 2RAFA 3R23A 4GXTA 4Q1EA 6PFKA 4G0XA 5FH9A 1K5HA 1T1EA 4EAAA 3M4ZA 5AI8A 1WSAA 4G65A 1DG1G 3ROEA 1KRXA 4B48A 1KIFA 1EQAA 2DPYA 7AT1A 5KNLA 2QMQA 3I0MA 3A4NA 4WA8A 4OQMA 3ZDFA 1N7IA 1SHKA 5DOVA 1X7ZA 3X1DA 2FZVA 4L0DA 3S2UA 2A84A 2WE8A 3A9TA 1J0EA 4IUDS 2I78A 3CX3A 2VNKA 4P3XA 5A3JA 3EJWA 4XWGA 5J4YA 4KLNA 2KHZA 3VC2A 1FP4B 2O8DB 3VJKA 4K9MA 4ILEA 2EZ8A 3UKJA 2RGUA 4H0CA 1I7SB 1ODCA 1T1JA 2R47A 5BNTA 3T4XA 2AIRA 2PKEA 5LQSA 3CB2A 1XNHA 2JK1A 2XRYA 2DRIA 3E03A 4B3JA 1AJEA 2CJXA 2R6R1 5GIPE 2QZPA 4PNHA 1EXVA 4MQEA 5JSFA 1DEKA 2XXJA 2YBDA 3HZRA 2FWRA 2E48A 3R6LA 4HEJA 4MR9A 4UXIA 5BPFA 3T4UA 3ESDA 4DR1B 3PUIA 4FYMA 2GCEA 3MILA 4EHNA 2XCUA 2BHNA 1Q1NA 1TE2A 1Y4ZA 3AKDA 2RGEA 3MSXA 4P8RA 2YY6A 4H0NA 1ORVA 4ZAFA 5G0VA 5GV8A 2XMBA 4BVHA 2EARA 2I6GA 4EUSA 5J2UF 3MWFA 1JEOA 2WMDA 2WJJA 2YJ5A 1XZ8A 3P71T 4H18A 3I6YA 3AVPA 1N2OA 3PQ7A 3EZYA 4PX2A 3UH1A 1DJMA 5AYVA 4BJHB 5DFAA 2PSSA 3BFJA 3D43A 3R5TA 5CNMA 3M6VA 1DU4A 2Q1XA 1GGVA 2UVQA 2J9XB 4ZJZA 4PRYA 2IXEA 3ASYA 4LHSA 4NMWA 2NOAA 1GG8A 1GA4A 4MMYB 4A0GA 4Q39A 1G3UA 1PYGA 1Y3CE 3S27A 2ZK7A 5I7RA 1FDTA 4HB0A 4MCHA 4Y6OA 3QW2A 5J9FA 1DXHA 4B2PA 4RMNA 1RIIA 4I8DA 2F3QA 2ZTUA 4P3PA 4PHFA 1OFGA 4ZVPA 4A6PA 2DPGA 2XKAA 2A78A 1Z83A 2QWXA 1S3FA 3FPFA 1M5TA 4G26A 3RIYA 5A6SB 1E3MA 3SN6A 1G38A 4OM7A 4GO1A 3RV4A 1GTVA 5LM3A 4MS1B 3W3AD 4QLBA 3L4JA 2BKLA 1WHSA 2OYRA 1O03A 3ZE0B 5JDIA 3P0HA 1SELA 4TSFD 4F3YA 3AG6A 4OXXA 2ZDQA 4ZZ2A 2QRHA 3ER6A 4GWKA 2VPTA 3IIKA 3OETA 3AR6A 2PXCA 3TAXA 1QFZA 1WF6A 2EEZA 2GKOA 3GXOA 3LA8A 5DXAA 4F84A 1A9XB 2ZBQA 1T8UA 5FUXA 3RBAA 4OQXA 4ZVVA 5DNYB 1Q3TA 5HCUA 1DRWA 1GQOA 3AEZA 4MWEA 4XEHA 3TL6A 3V2IA 4N0MA 4L4RA 1Y5MA 4BP1A 3PGXA 1GQYA 2ZE5A 4IVRA 2IYAA 1RHMA 1BEZA 1ZNWA 4BB6A 4TKVA 2XXBA 4J07A 3W90A 1E94E 1JSRA 1LDNA 1OT5A 2C3MA 3G02A 3QI2A 2G4LA 3VSEA 3CINA 1WAMA 3KV3O 3I9NA 2IK8A 3WRYA 1TDJA 3SLGA 2RGYA 4ZAXA 1NYTA 3DT8A 1V8PA 1RI2A 2JFUA 3C0KA 4HEQA 4OO3A 4Y2GA 5BSGA 1P8AA 1GZ4A 3FGZA 3F96A 5TGTA 3IR5A 3LCMA 3NVKI 3REQB 3RWBA 1O95A 1TM2A 2JD0A 3G5AA 5DM1A 2P2NA 4OH1A 1L8QA 3ZCXA 1KJZA 4CN9A 2BZGA 1IY2A 1C9NA 1NG1A 3TB4A 2XGOA 2BDEA 1S9DA 2GJKA 2CCKA 2YWDA 1PS8A 1OX4A 5C9ZA 1P5FA 4DMKA 3O75A 3ZHCA 1BVRA 3NMUF 2GEUA 1ZMRA 2XGJA 5BY2A 1ICIA 3QXJA 2QORA 4WXRA 3M33A 3JARA 4MXDA 1NKSA 4PG6A 1CUUA 4URZR 2XT6A 4YRBA 1SVNA 3ROQA 3EQ6A 3ER8A 5C52B 4R2LA 1VB5A 1Q0UA 3EF1A 5CA0B 3RU2A 4XPIA 4UNRA 3U5TA 4BEVA 1XMOB 2HDOA 4HLNA 3DLTA 5KVAA 1EZZA 1HX7A 1BE6A 2VZ8A 3OA0A 4DBLC 5HGXA 2C58A 2H59A 5EZYF 1A5SB 3SZOA 5BQ3A 2W5UA 1KC1A 1NUQA 1J25A 2SNIE 4BVKA 1FYXA 2PTHA 1OH5A 1C0PA 1JG1A 4BN5A 4E1VA 4ROSA 5C3MA 3LUDA 1YNOA 4Q0MA 1F7UA 2OUIA 4B8WA 5CD1A 1DQRA 2C54A 1JHRA 4HDNB 3WK9A 2JGJA 2C9ZA 1MHTA 1F14A 5DTIA 4BFWA 1DJNA 1M8KA 1UXHA 4QXOA 5I7WA 1NJGA 1RYEA 4BV2A 5G0SA 1G4UR 3AFOA 1PN3A 2AFIB 3GVPA 5ESWA 3H6GA 4N6NA 1LU9A 1XAHA 2YC2C 3K94A 1Z6YA 1UT5A 3CN7A 4BAUA 4KG7A 2WFAA 2JLAA 3TPCA 2DG2A 2O8NA 2GEVA 3FOZA 2Q5HA 4B4UA 2JGDA 4TUYF 3U40A 2Q3CA 2YUTA 3LDAA 3R4VA 4G81A 4KXFB 1FDWA 1FBTA 4IIDA 1GXSA 4Q4LA 1TRHA 1HT1E 3BOSA 1H0KA 4CL0A 3KTAB 3WIOA 3C3YA 4F38A 4ZVQA 3U81A 4K2AA 1AMUA 3LGXA 1O6BA 1GV0A 2F00A 3B7GA 3KS9A 4TRNA 2X7HA 2QRPA 4IHKA 4M1YA 2DWUA 1FLDA 3GOHA 3H8WA 2OFWA 1F0YA 3FMVA 3OURA 3RYCB 2IH5A 1CP3A 4TYPA 5CU7A 5DNCA 1SA0B 4S1OA 4DXHA 1BE8A 1YB4A 3ADPA 4LTDA 1SXJE 1C9DB 4OTZA 5E38A 5DXFA 1SD5A 5ERXA 1U2SA 3KOWA 3LFTA 3DV0B 4CMHA 4X8OA 2R44A 4KJXA 2JIQA 1NXWA 1PJTA 3EIFA 3JAWB 4L2IA 4KN8A 3T1HB 4CL2A 3LO5A 3NDRA 1I8TA 2XGMA 1L5KA 2GHIA 2P9FA 3BTVA 4MPJA 2NZYA 2Z6AA 3UZUA 5IJ9B 4WIAA 1SVIA 3ONEA 1GPLA 4DIMA 5KX5A 3QV2A 2Q8QA 3B48A 3ZV6A 5KTOA 3UMMA 1TZMA 5A4JA 2GEDA 4GQAA 1GDDA 4IO1A 4C2AA 4IILA 5BWLA 5B64A 1QGUA 1QO0A 1DT3A 1LK5A 1BVYF 3IAUA 3R7AA 4S05A 3S5JA 4B1FA 1EJ0A 5JCOA 4O1MA 3TOZA 5U1PA 4LNHA 5ED0A 1V6SA 1VCOA 2C5EA 4YY3B 3HBAA 4G6ZA 4XKJA 1R8QA 4Y6SA 3EGIA 4YDHB 4G5SA 1U3DA 3N8DA 4DCSA 2P69A 4I99A 4K05A 4YS6A 4NF2A 1EP3B 2AYYA 2RBEA 2WUGA 4ROTA 1Z2EA 4WVLA 4AICA 4P36A 3PEYA 2IF2A 1AK2A 1DXYA 2CWWA 2F9MA 1BEUB 4N3CA 2Z2KA 1IHXA 1T5DX 4FB4A 1NVXQ 4OLAA 2WT8A 2X77A 4LXIA 3KAKA 3ZZMA 2FMKA 2G04A 3TG2A 4C7OA 4TM8A 2FMTA 4PTYA 2AQ8A 3FAKA 4NBSA 1RBYA 2GZHA 1WMAA 3U4MA 2XD4A 2JJ2D 4QTZA 4NU6A 4TVSA 3HM2A 2G09A 1KXZA 3PTLA 4Q66C 5DN6A 1HQYE 4E2XA 3CO0S 1K6XA 3OICA 5L6LB 2YXEA 5D3ZA 3HVJA 4DIOA 4ETMA 1K88A 2BEWA 4X6UA 1UT8A 1NVAA 2ID4A 4DLXA 2FZCA 2I4IA 2RHHA 1PTJC 1Z38A 2HWWA 3QTLA 1NSTA 3W1WA 4OH7A 4YK7A 1C41A 2X7JA 4MRRA 3RYIB 1J0BA 4D4KA 2FZLA 4J0CA 1EKXA 5J2TA 4TVBA 2D13A 5EE1A 1OLXB 2FFQA 2XMPA 3C15C 3LOUA 3GF4A 4R2JA 5K3BA 4X91A 3V46A 1HURA 1Y7LA 3DUFB 1P7YA 2NIPA 5JD3A 3HU2A 4QVIA 1ZESA 5G1PA 1PJCA 2HLNA 3KEOA 3SP1A 1I94B 3PU6A 4YPOA 1CTQA 2PXAA 4MYSA 3F9IA 3K9WA 3KT3A 1YA8A 5DMXA 2I7TA 3BE6A 5IW8A 2VHZA 2ZRLA 3CRVA 3KD2A 3P4XA 4Q7LA 4RD0A 4YMIA 4FOOA 4IUYA 3SXJA 1QTRA 1RI4A 1ZAKA 4J90A 3D3QA 4CM5A 3L41A 2J3JA 1XTTA 4Y67A 1J06A 1YK1A 3GN2A 3GRPA 3GPBA 5EJAA 3HACA 1BW9B 4QREA 3I9LA 4MYUA 3NYWA 4TQ9A 2ZJAA 4H7JA 1ZY2A 3HSSA 1ZWKA 3EG9A 4YMGA 1I6MA 1XMPA 5AHRA 3UPTA 4O1IA 2IP4A 3I34X 1SQGA 3VKUA 4P84A 5DRTA 1N0VC 2HOQA 4X60A 3AF6A 3ETNA 3VV3A 3C5WP 4E6PA 4KXMA 3IKTA 5EQFA 5EEHA 3WIUA 4E46A 1UBEA 3KQSA 1SUWA 2CYBA 3W6UA 1MORA 3AOEA 1CVRA 2X0FA 4O3MA 2VDMB 2BGIA 4XM1A 3VR5A 2QRKA 3RQIA 4U00A 1SKYB 1PW5A 1NYQA 1F0NA 3DKRA 5MDHA 3QNMA 2YFKA 4FR2A 1A98A 5LA6B 3Q2IA 5BYAA 4ZI7A 1U7ZA 2GXUA 2DLDA 4NI5A 3KQUA 3R3XA 1OSNA 1WUYA 4E0BA 5KSOA 2VF2A 5CITA 1XDDA 5F4BA 5KWVA 2FN7A 2BGLA 4A36A 1TVKB 4XGQA 1AGNA 1F17A 4LV6A 5ER6A 3F5MA 3IAS6 1FU4A 1BFDA 2GBPA 2OO3A 2CLEB 2ID8A 2VT6A 4UCXA 4RV9A 5CFQA 3FIUA 1N8NA 2ERXA 3JX9A 4D9IA 4KSBA 1GNLA 3L84A 4EB0A 3FPHA 4O25A 3UJCA 4QVGA 5EIWA 5BO5A 4HNQA 1QFYA 1Z74A 1CUSA 1OFIA 2VK4A 2ZSHA 2B34A 3GNTA 4KN9S 4KXNA 3JQAB 2FFAA 4L3WA 4HNTA 3FSJX 1LVGA 5IF3A 3PNSA 2J0UB 3BZWA 1NN3A 5K6AA 2XB9A 2PM8A 3GJ3A 1TZBA 1J00A 1AKYA 4RIEA 3VSDA 4KREA 1SVWA 1E6CA 4HG2A 4B6FA 1R15A 3RAGA 1D7OA 2BIFA 3TW8A 1OT3A 2PY6A 3TJZA 2VP2A 2F59A 1J2JA 2R5WA 2F3TA 1SVUA 4FI3F 4EI8A 5CDUA 1W4LA 4C1BA 3I01M 5DX8A 3ZQJA 1TYBE 3OF2A 3IOMA 1U0OC 4Q9KA 1YR9A 2WU0A 1E2UA 2OTCA 4WRRA 4C08A 4HVLA 4UC0A 1EJBA 2HC9A 3LY5A 5I7UA 1W5BA 1RI5A 1WDLA 4RMGA 4AAYA 1YGYA 4TYYA 1NATA 4F4FA 2RONA 2O05A 3BWMA 3FBWA 3TLCA 3WA7A 1SK9A 1Y33E 2AFHE 3GRRA 4KXQA 4RKEA 5HMMA 3WYEA 4YHHB 1PDOA 2HQOA 1FZTA 3OT4A 4LDZA 4UATA 1A9TA 4R71A 1SB8A 4N47A 4ARBA 4BP9A 4JJFA 3D81A 5DI9A 5ES4B 1GADO 3BL6A 4JQOA 2Q3JA 3HQ4O 3JXEA 2OBMA 3O83A 3NHFA 3AEXA 4DUYB 4DA7A 1NVKA 3E7WA 1ZINA 4MNTA 4OAOA 1WKCA 2WWHA 3ZWNA 1B8UA 3SBEA 5JYBA 2UZ1B 3DB1A 2TMKA 3NHAA 3NU1A 2IELA 2R7KA 2V7PA 2AK3A 2HEIA 2WZBA 4HK4A 4XJXA 3QKUA 4DOMA 2QN3A 3AVWA 2CMFA 1YHZA 2D0PB 1V9LA 2LTAA 3UA3A 4I1IA 5B3KA 2AD5A 2HB6A 2EP7A 2HHJA 1YJAA 4F8EA 4JLKA 5BQ5A 4EPWA 1A9OA 1T3LA 2D2VA 2CV1A 5LP6B 2D1YA 4I9NA 2PUHA 1OD6A 4G41A 5FTLA 4NCKA 4YDQA 4I9HA 5FWNA 2IYVA 1G20E 1KC3A 3BC1A 3PE6A 3DOIA 4J2OA 3HK2A 4MI3A 1FP7A 3FSGD 3HB7A 3N0WA 4IWYA 1I6LA 1H94A 5DSTA 2WQ7A 4OB7A 2XD9A 3O5AA 1RJ9A 3IP1A 2HCFA 2L19A 2PXXA 3C7KA 2WHRA 1WPRA 1XTBA 1QQAA 2CKDA 1E77A 1M10A 5G3YA 1CUHA 5TQ2B 4BX0A 1EDBA 1GP2A 3IKMB 1YAHA 4NJMB 2FFRA 4X1YB 1K06A 3VU9A 4M8IA 1KARA 3FVTA 3JQGB 2JZOA 4MWDA 1Q3HA 2Q2QA 3H16A 3VYUB 1J9ZA 2HUPA 3ZLJA 5JSUA 4QJ4A 3CUWA 1CRZA 5EZYA 2V74B 3AGQA 3PK0A 4WEQA 2OXTA 5KOHB 3BTSA 1ULUA 3MRXA 1BJKA 3B2QA 3NT4A 1UEIA 2HBQA 3OZIA 4KZPA 4WGGA 3RS4A 3GLRA 3KC2A 2GCIA 2FSFA 3KCQA 5F2EA 3U1TA 3H2ZA 2DBQA 3DCYA 4XAQA 2JIDA 2WOOA 3MNFA 3FD8A 3WGGA 1S02A 2XJ9A 1DX9A 2VPYA 4R2IA 1SVSA 1FFBA 4QUHA 5DISB 4RF5A 2ZDHA 5F52A 1M0TA 2NLOA 4NCNA 4CKXA 5BR4A 1ONBA 5DVZA 3TLZA 3W6ZA 4NENA 4WI1A 1JHOA 1K6EA 1DT5A 2B8WA 3EMKA 5T3YA 5JCJD 1FYEA 3FWHA 4ALMA 4W5NA 1SCUA 1XJQA 2RJNA 1JB9A 2WT4A 3FSEA 3KWJA 4TVKA 4WESB 5HKAA 5CA0F 3U61B 3WL4A 4U7JA 3VNAA 2DWQA 1JKXA 1XP8A 1XD8A 4TUYA 4OUDB 5B1SA 3JRXA 1C7IA 4RLQA 1D5WA 3R3WA 4XIYA 3JR3A 2YN4A 5KMGA 5AK3A 3DEZA 2W6ZA 5T6MA 5CEEA 1PKEA 1K4KA 2PZKA 4N5DA 2AJDA 4TRRA 2N3ZA 2XQKA 2ZSKA 4FHGA 3BK1A 5L8VA 1MRSA 2XUAA 2ABWA 3MS2A 3RVQA 1KI3A 2UVPB 5B1IA 4BB9A 1SG6A 2DAPA 1TPYA 2BCGY 2VZLA 2Z08A 2EX4A 1U28A 1DVRA 2RH5A 3GN1A 4IDBA 3TVDA 5KBYA 5FI3A 3ONFA 3NASA 5JI3E 3TZLA 4YUWA 5HCIA 3V7NA 3HHPA 5DV9A 3GIDA 3PL5A 4IHJB 2P6RA 1D0IA 4MK4A 2BTOA 4JROA 4M8KA 5EESA 1XOIA 1BX1A 4NEQA 1KDVA 5IKPA 2WF6A 2V98A 3H6HA 2BMAA 4BMYA 3WI7A 5BUSA 4NPAA 4DT1B 3VR1A 1UJNA 1FRZA 2OSBA 4ZU6X 3DM5A 3E1KA 3FRJA 3HFSA 3K05A 4PAWA 4C6TB 4DHEA 4LQ4A 5DCYA 1QM5A 4M22A 1MOZA 6REQB 1GZDA 5HRCA 3JQ8B 4QM7A 1A04A 4OHRA 4XJVA 5CTJA 4XWKA 2GPYA 1W35A 4YYEA 4EY4A 1INLA 1UFQA 3ECSA 2Q5JA 3TQHA 4BDSA 4F72A 4QOIA 5IXJA 3JRNA 2YOGA 3MJVA 3HYCA 4PYLA 1TJ4A 2OECA 2C03A 5D3MB 3UK0A 1AS2A 3JQBA 3U4QA 2ECKA 4IIFA 1DGQA 1C7RA 1XDWA 3DAFA 1S1MA 3NDPA 4DZZA 2CJPA 1UL1X 3ASUA 1DTWA 4UM7A 3U7QB 2FWPA 2IODA 3QIAA 2GD0A 1E5TA 2Q4TA 4OYYA 5AI0A 2ZUEA 1RACA 2BSQA 4NYMQ 1H2WA 1JHMA 3DL4A 4C0JA 4QXMA 1QWOA 1SCQA 4J3FA 5BMVB 1EFDN 1EP2B 3ANMA 3HUUA 1ST2A 1OYWA 4I1OA 4IR7A 1F6DA 1H22A 4PN7A 1XTQA 1Z0FA 5CJJA 4RD1A 3FPCA 2ZPAA 2WF9A 3A2LA 3WNQA 4DYHA 2FPUA 4CNQA 2WIKA 1NF2A 2DLNA 1E2KA 3PENA 3MGAA 1G2PA 1ZEJA 5AKYA 3MJRA 5B53A 1JHVA 1V8BA 1UDAA 2FA9A 3HJTA 4KKVA 4LPSA 5F33A 2YHSA 1LPPA 4RFVA 4JP2A 5DGHA 3DT6A 1LBQA 1MO5A 1WSBA 2GEFA 5EMHA 1G4AE 2ID9A 5E6RA 4MINA 2RC6A 1R5NA 4E2YA 1EXDA 1IMJA 1ZKDA 1DIRA 1GUYA 1TT5A 2QF7A 3AXTA 4A7PA 1HTWA 3R3VA 3VR0A 5TS3A 5CBKA 1O0CA 2A0FA 3EXEA 3WBFA 3ETDA 1HL7A 3NRJA 1YIDA 1T2EA 2E1PA 1UIMA 4FD2A 2ATIA 2IDKA 1E9AA 1AKWA 3LUKA 4YRLA 4H1TA 4M0PA 5DDIP 4EUFA 5IPFA 3SZLA 1QF6A 1VA4A 3DTVA 1BYUA 1IEQA 4RW0A 2PMCA 3DBVO 1VLZA 2AFHA 2VJLA 4BO6A 2BHRA 3H1EA 3DH0A 1NNUA 1N0UA 4QBGB 2NO6A 1YOVA 4LYFA 1NAIA 4E09A 4UZFA 3T7IA 1KRWA 3ND6A 1MA0A 3RKRA 2YWXA 2JAWA 3N5KA 4O2RA 3G0DA 2J3DA 4X8HA 5FOUA 5C5CA 5BWNA 3L7DA 3HDTA 1NJSA 4LXUA 2A9PA 4REQA 2AEMA 4I5IA 2WYHA 1KI6B 2AG6A 3HKDA 2J59A 3ISJA 4UTXA 4BP8A 4G4IA 5IG2A 1N7JA 2VK8A 2X4DA 3WKCA 2R1TB 2XMDA 2FPGB 3GLQA 1NVFA 1VSBA 1U3VA 4V02A 3VHRA 5BN3A 3C39A 4RABA 5AVWA 3R7LA 4KACA 3A05A 1VMKA 2W2VA 5JH7A 3QZUA 1HE8B 4YUAA 1SR8A 3K0AB 1QUFA 4RDHA 1FCJA 4Y9UA 4U3JA 2IHVA 3D4BA 2VXYA 2HHHB 5GONB 4I3HA 1ZM3A 1XVTA 4OA5A 2E5LB 1F51E 1G20A 3P0EA 1T0BA 2Q6LA 1N8TA 4AIRA 2HF2A 3IVRA 1E1YA 1GRCA 4UAVA 2AFIE 4IVNA 4PV7A 5BXQC 1DBPA 3WK7A 1Q20A 1JYSA 1T0IA 1E2IA 1JQBA 3FNRA 4L28A 4LJSA 4UNSA 1B00A 5ICCA 2WWTA 1S8AA 2AMYA 1RYDA 3GHYA 4ENUA 5DEOA 4RTKA 2C04A 1GL6A 1UJ6A 4O5AA 1K66A 3LF2A 5JADA 4OXNA 1LXCA 4S1WA 4NAUA 2B5VA 4UAJA 3WDMA 1UXKA 4R1TA 5A5EA 1NVBA 1FJXA 4ONEA 3LUFA 3FNFA 4CF3A 3W5BA 3IODA 2WIBA 2AF4C 2HPHA 3EVCA 1IM5A 3LDFA 1YBHA 5D6OA 3FDFA 3PQ2A 4FLEA 3KQHA 2VT7A 3LVRE 4OX9Y 2VNHA 2EC5A 3GLIE 4DB2A 2MR5A 1SCDA 1JA9A 4KQJA 4XOUA 4CM1A 2YL2A 3UV3A 4E88A 3LTNC 4C01A 3RTBA 1M1NA 2DFTA 4EKGA 1SEPA 4ZYTA 3A1UA 5A2QA 4YJGB 2RMKA 1Z45A 4JUAA 3I2HA 4PX3A 1ACLA 2QN7A 1NM5A 2H17A 4RYDA 2YVKA 1UBMS 2BKEA 3G2NA 4I7EA 3KE8A 3ZK7A 2XYHA 4XASA 5FBZA 4YQZA 2FMHA 4KX5A 3N3BC 3S2FA 3QY0A 2PANA 1T8PA 3NANA 4TLLB 3MS7A 3Q6IA 9LDBA 5HDQA 5H1YA 4EYEA 1P4GA 1H3EA 1W4BA 2XB6A 3L8DA 5LA6F 2IPMA 2NV6A 3RSOA 1RCFA 1ZH2A 2QM0A 2QN2A 3DEJA 3MT9A 3L05A 4H7EA 1VCNA 3HMQA 2CJYA 3Q6MA 3S55A 5JTTA 1MX9A 4M1QA 1W581 2OHHA 3NS7A 5EC8A 5FLYA 4C0XA 4EW1A 1QKJA 1G291 1LVHA 4GXQA 4AULA 3CH6A 2P2LA 1GM5A 1IHPA 3Q3EA 3TCXB 1UBJS 4FZ5A 1JDSA 3OHPA 1JPNA 3IESA 4PYMA 3A9RA 4R31A 5KYXB 3ZDEA 1QE5A 2B1GA 3PLAE 3FMFA 1EGHA 2DPMA 3MUNA 2ONZA 1KP2A 2VP5A 1CY7A 3DONA 3Q5EA 4EAQA 1P75A 8LDHA 3CEAA 2NX2A 1IIRA 1RC1A 3OJOA 1KI7A 2WU1A 2FQWA 1EWTA 2FR8C 3GELA 3LECA 4Q15A 5GMOA 5JY1A 2B9VA 1CUJA 3P96A 2JHFA 2PO7A 2PT7A 1QOPB 3R6GA 5ERGB 4ID3A 1P7PA 4RE6A 3HY6A 1NVEA 3IBCA 1OI2A 3PQ6A 1XYYA 1HOXA 3N75A 3LIPA 4GG1A 4MS1A 1VHTA 3WC4A 3WP1B 1OX5A 5KQRA 2MIIA 3LQRA 4UDXX 5CUQA 5TQJA 5GINE 3RSSA 1ECPA 1HDYA 2PMKA 4IIYA 5JRDS 4MWSA 4ND2A 3ZVMA 3DEAA 3WRXA 1CFJA 3FTFA 5KU7A 1N8KA 4ZO4A 1ND5A 2Q9UA 1JAIA 3E6AA 4G8JA 3CRRA 5BQPA 5A4FS 4YCLA 1PV1A 2Q5FA 1U7HA 3DMTA 3LIIA 1FXUA 4M21A 1FNDA 1OA0A 2P91A 1P0FA 2IU3A 1I3NA 4TTQA 1PZNA 1YQDA 4JC5A 2O9JA 2FRDC 1FMTA 4J0HA 1L4EA 2NU8B 3Q5DA 4DR3B 2GZ2A 1XFAA 1Y37A 2JGFA 4J7XA 1E2GA 1HI9A 3KKKA 4B8YA 3OFNA 5H02A 3RGGA 2HGZA 2VRWA 3QHAA 4B6GA 1KYYA 4YONB 3F5SA 2XE8A 4FYVA 3EOBI 3TR5A 3X44A 1QCYA 3OAAD 1N5KA 4OI4A 3QPCA 4RD6A 3REQA 4UD2A 3O73A 3BIJA 3OPNA 1LLCA 5TT1A 3AKCA 1EA7A 1DEOA 3JYLA 4OBXA 2DBZA 1KK0A 2DPLA 1EK2A 5REQB 1B14A 3TVYA 4PQEA 1SG9A 2JKYA 2I7XA 1E0AA 2ZS8A 1C7EA 3CPJB 1DLIA 3HJUA 4FYJA 3Q7RA 3U5ZB 2BCEA 2YN0A 2ECOA 2EZ9A 5AK4A 3DDHA 1G1MA 3P0JA 4H16A 4F4IA 3RRYA 2HHLA 3CF4A 3EQ8A 3F7NA 3PV0A 3SZUA 4QHTA 1SURA 2BBOA 2AEJA 2QQGA 1VFPA 3TEFA 1OVGA 4BQRA 4EUEA 2R5FA 2GZ3A 2EKPA 4GI3A 1Z35A 1IU9A 2J9YB 3PDIB 3B7PA 1WV0A 1XP5A 1ULTA 5FTKA 3TQOA 1X8KA 2WZQA 2YS6A 4JENA 3LX6A 4I5DA 4YRDA 2FZWA 5J43A 2EFEB 2C4TA 3KEFA 1SKYE 3DOEA 3ICCA 4NTZA 5ISMA 1T3HA 4ZOLB 5FYQA 2C9BA 5G2OA 3UHOA 4D0GA 1P5JA 3LLCA 1L1FA 4CCYB 1HE1C 1JLLB 4ZJPA 2KLBA 3PPIA 2FCAA 1C9JA 1H0RA 1FEZA 4GRDA 2WJVA 1XVVA 1A9ZA 1HORA 2O5RA 4XX1A 4JI6B 4NP6A 2VCEA 2RGNC 4LHWA 1BQEA 2CN1A 2YJTD 4N82A 3TE7A 2HIAA 3ZDQA 4HDNA 1RHQA 3C3JA 4D4IA 2BEUB 5FL3A 2RG1A 2EYQA 5BYJA 5CGQB 2EJBA 1JFLA 4G1UC 1W4CA 3AY0A 5B1HA 5D5HA 2QM8A 4L76A 5ALVA 1TADA 2R79A 1EXMA 2JGNA 2EFCB 1OPXA 4C29A 2ZE6A 1NE7A 2JBWA 5JMPA 2AFIA 2FWNA 3IQDB 1UUFA 1JFSA 5LP6C 4C76A 5IVIA 2QI9C 3TM4A 2VTEA 3OOWA 1Z73A 2Y1XA 4BNKA 4GYWA 4K1XA 4LXHA 4YUVA 2Z8XA 1N5LA 3M70A 1IZZA 2I99A 1QAQA 3CLRD 3O90A 4FFBA 2MOKA 3GFPA 3NHKA 2J5RA 2GH1A 4GE0A 3V4ZA 3CG4A 4RK5A 4ZO7A 1T9HA 1A4RA 1VCIA 1RRPA 3TJMA 1QX4A 4FDTA 3D4LA 4Z9YA 4B31A 1VE9A 2TRSB 5JSKA 2KW5A 1VIAA 3ESXA 1QG0A 1HT2E 2GFHA 4AMVA 1J90A 2A14A 3VSCA 1W44A 4JEUA 3QUAA 1QGAA 2PFGA 1Z06A 3IP3A 3N2LA 2L17A 4G1BA 5U4QA 4LXQA 4LMBA 1KQGA 1KMIY 1OLSA 2WMOB 3RYCA 1RYZA 3ICPA 3SU8A 4WERA 3GLIA 4IHJF 4ENPA 1EBUA 3RC1A 3RS9A 4FWTA 3HKEB 4IVQA 5DGIA 4MR7B 2IS2A 2JARA 5IZCC 5F64A 4N6GA 3DV0A 2ZCVA 3IP9A 4N0PA 3IAM1 3UOAB 3JAWA 2F1IA 3GXBA 2PL3A 1MOQA 4EY5A 5FLKA 1PKXA 1XZQA 2I87A 4TT3D 5T7BA 2QRGA 4Q3NA 3AVUA 4RJKA 4M1WA 1E9SA 1QIFA 1ZFNA 2TSYB 3D5QA 5IJ9A 2LE0A 3FXAA 3W7BA 3AHJA 3FG9A 4OPMA 4BBPA 5K05A 3I9KA 4J43A 3VDXA 5DNEA 4US1R 3N28A 4B71A 3VPXA 3D3EA 2NVUA 2O48X 1HDEA 4RFSB 3UMSA 5AUQA 2QL7A 3L46A 3LPLA 1N2EA 4J7AA 2IVFA 4CG3A 3WL8A 2O54A 4RPCA 4WECA 1W6RA 3GLFE 5FBVB 1I4WA 1UC8A 4N5LA 1OXKB 2JEZA 4Q3AA 4UHBA 2F90A 3NYIA 3U6KA 2H48A 3ZGVA 5BMVF 1GL9B 4L4SA 1H0HA 3UKDA 4OKSA 2BMDA 2Q50A 2IU6A 3FB1A 4LN1A 2NSHA 2OAQ1 3OFJA 4QOHA 3EZ6A 4ZA2A 4BYGA 1GLGA 5KHOC 2WNSA 4R2KA 4WN3A 1EQUA 1YQUA 3CG0A 3CRNA 1IDN1 2NAPA 3PC8C 2Y1DA 3EA0A 1KI4A 1VE7A 5HZHA 2VNAA 1PVVA 3HGQA 4PCVA 2VPZA 3ZGNA 1FQWA 1EJ6A 5IJ0A 3G89A 5ENDA 3LY7A 3NZEA 4RZUA 1HSOA 5FULA 1FJGB 2YXBA 3K1TA 4JR0A 2KSQA 5AK6A 5EIAA 1WL8A 2Z5LA 3DOFA 3EC2A 4FKBA 1MIOB 5TRTA 4NFLA 1F2DA 3AUUA 4L4YA 4DR6B 3H1BA 1D2GA 5EHXA 1HXHA 5K4GA 1U0JA 2FEMA 2PVPA 4YAUA 3KQVA 1AF4A 4PLCA 4MCIA 2XWBF 4FP9A 2B2NA 1JW9B 4IHAA 1UPTA 3KRTA 4NCAA 4MIOA 1OIWA 2QP9X 3HYTA 3CLUD 3I2KA 1CF9A 1XR3A 2XA2A 5D01A 4ZMBA 1Q6YA 2CXXA 2Y0PA 3KLBA 4ER0A 3OCYA 4LRXA 5C5DA 2P4SA 4YCAA 4CM9A 3A4IA 3RYIA 4FJ1A 3N6RA 3LDUA 5ALUA 2O2IA 2DQYA 1MO3A 3M2TA 2XDQB 2PMDA 2ZITA 1XZKA 2XNSA 5K99A 1OLXA 2Q3EA 4YP7A 5A0TA 4WBSA 1EUDB 1O8BA 5JSZB 1WZCA 3DUFA 3L18A 4PQFA 3I9V6 2Z9CA 3C1AA 3OEWA 4ZPJA 1EWQA 1CJBA 3PYMA 3MG9A 2DFNA 1GSIA 2Z1DA 2K2QB 5KKNB 2Y27A 3FR8A 3IMKA 4KGDA 4ZCQA 3VR6A 3L0SA 4D9EA 2DHDA 4JB8A 1MOPA 5JDCA 2YWBA 2GCGA 3CF4G 1VCHA 1FFHA 3GG2A 4YEDA 3C5HA 1F2TA 1MHPA 4V0QA 4CKCA 2VJDA 4JEIA 1ENOA 3HCAA 4HRYA 4EYSA 2XCTB 5ALPA 1W2GA 1P1CA 5HKKA 2R84A 3S2IA 3TQSA 1BW9A 3BRCA 4C6HA 3MMZA 4AO8A 5JNVA 4DF3A 1Q1ZA 3N2YA 2KMLA 3QQPA 4GQBA 4OQEA 2VN8A 3TRFA 3U7RA 4LRUA 4Y6PA 3VTAA 1YB1A 3ZDYB 1EVKA 5B6IA 3IVGA 1N2BA 5G40A 3FI0A 1GKLA 1GU0A 3GJ6A 4U1RA 3QLJA 4XYMA 3W5DA 1PYOA 1EBFA 3M9XA 3OBIA 5HILA 7ABPA 5MN6A 3DGEC 3MW8A 4Z3KA 4ED9A 1IEVA 3JVUA 2VDRB 1SU6A 5K3FB 1AO0A 4Q4AB 1RYHA 4OLFA 2I1VB 4OIFA 2YC4C 3UYLA 4J0DA 5AP9A 2DFVA 1T36B 2BC9A 2VHTA 3BN3A 1DO2A 3F47A 4NE9A 3UICA 1IBLB 4PYIA 3ST7A 3QX8A 1W29A 4JP5A 4LC1A 2PMBA 4JLSA 4KO3S 621PA 5LA6A 1UZUA 2XQVA 3ONDA 1PFVA 1ZSNA 1OY1A 5DWQA 3THOA 1U2EA 2HXYA 3M3DA 5KWIA 3SZ3A 2WABA 1IJEA 2WJWA 4AUEA 1F8XA 2GS9A 4RACA 4YRTA 1TVKA 2BTQB 5KDOA 1JZSA 3K30A 2C31A 2XITA 2X4LA 3PJEA 3GEDA 4XRGA 1Q12A 5IH7A 3CONA 4LXTA 5DWDA 5C80A 5H0IA 3PA6A 4B5LA 4WY5A 4G63A 2R6FA 2OFFA 1V9SA 1F3LA 2OL4A 3AUYA 3WYFA 1MX5A 1US8A 2V9CA 3JAKA 3K92A 3SG0A 1IQPA 2A6PA 3PWTA 1U0SY 2GBCA 1AXGA 2IEBA 1JBQA 1ORIA 3JQAA 1VTKA 3OF3A 4HJXA 2YXNA 2X6TA 4PNPA 4G8CA 2QJOA 5FUVA 4EFMA 4HWOA 5HHTA 4CQNA 5CEJA 3I2IA 3O26A 4QNRA 1E5XA 3UWOA 2J9RA 1JXOA 4IINA 2OV3A 4C2TA 1W1IA 1NURA 2PMWB 1SU7A 1KZ6A 4AG6A 5FA6A 4ZZ3A 1NVUQ 4N01A 4BFYA 1FVHA 2ZREA 3ORHA 4G9EA 5ARBA 1QSGA 4KNVA 3BMCB 1XPRA 3KZOA 2NACA 1MVOA 4WNCA 4CN8A 3DL0A 2VC2B 4OD0A 4RVCA 5EUMA 3HJGA 7ADHA 1NP6A 4MQFB 3SWWA 4PQRA 1MAVA 4H7HA 4R8VA 4IF4A 4KXUA 5B1DA 2ORIA 2XMZA 2XTMA 4A16A 2IP2A 3B20A 2AMJA 2BY4A 1BHO1 3D2AA 3P9YA 3EWSA 3AY7A 3RC2A 2Z6QA 3UUFA 4Y1FA 3F3MA 1FY2A 1G42A 5ICMA 2DERA 1TLLA 4QELA 3HADA 2M9MA 3G2OA 3K7EA 4TWIA 1DADA 1NQVA 1T9BA 3ZE8A 4OCZA 1E20A 5BPHA 1KFEB 1Y8CA 1YS7A 3A2NA 3IAXA 4B33A 1XKXA 1TW2A 3DDCA 2NADA 2WD9A 4JY7A 3AB8A 4PLZA 5C1BA 5NLLA 3KZMA 4IFTA 4OSOA 3AF4A 1XTJA 2O7SA 4FJ2A 1UWVA 1KEUA 3EDQA 3IP7A 5CXXA 4J29A 4U0JA 4ZT4A 4REMA 4W4TA 3ROZA 2YH2A 5AJUA 2WM3A 1Q0RA 1YSCA 4XFDA 2CZGA 2JHCA 4U9IS 1YDFA 2Q7DA 3RHFA 3WS7A 3WLJA 4YXFA 1VYVA 1CDDA 3EGCA 4EHLA 2BFCA 2Y6UA 2XOKA 2YINC 4QOEA 4EGFA 4P4LA 2WJIA 4Q1DA 4RA6B 4R84A 3V1TC 4BNDA 1AKEA 5KREA 2Y68A 4ZCTA 3GLFA 2CYCA 5JRJA 2BP7B 2WP0A 1AURA 1FUIA 4KN6A 4G0YA 3NG1A 4PS1A 1A97A 2TS1A 4D9BA 2DZDA 1PT6A 4NCIA 3CISA 2JZNA 4GLFA 4IJQA 4PAGA 4GOKA 3ZV3A 1UK9A 2IPLA 3D54D 4C7VA 5IBCA 4RZ3A 1Q50A 4JXJA 2O8FA 3U16A 1HO3A 3CLTC 4CM8A 3MJSA 3QLUA 1UBHS 4GECA 2TMYA 5CFNA 1TRKA 3GUVA 2G76A 3DNFA 4N3GA 1VE3A 3GH3A 3ZWCA 5TQ2A 3LXUX 2Q7XA 1WHTA 2QUHA 3CNNA 3R0QA 4CIWA 1M3SA 4NJMA 2VF7A 4X1YA 5DW0A 2DOKA 4K81B 4Z0PA 3GU3A 2RHLA 3I42A 2XZDA 3N76A 1Q0ZA 2M32A 3JQGA 3VTKA 3WBKA 3OCUA 2PUAA 3SLKA 2IXDA 4BLOA 4LHXA 1A8PA 3FLEA 2B3DA 2JPDA 3WLFA 5A1TA 1A4IA 1BCRA 2FKNA 4INAA 1G21E 1JHDA 4KVAA 1EWRA 4CIDA 1E6WA 1Z8DA 1D0SA 4I66A 3ZN2A 2QZ9A 4AF7A 4CKEA 3TAHA 4J16C 3G2JA 4MV6A 4AP9A 1H85A 1BN6A 3C7TA 2ZYVX 2B5WA 1VECA 1C80A 1J5PA 1TQ2A 2JI8A 4QOFA 5BSVA 3B9BA 4R51A 2N46A 1QH9A 2JLSA 3UUWA 1EK0A 2ZKLA 2DSNA 2C5GA 1IFXA 2V9PA 5EMJA 3PTAA 3QMVA 2RJ3A 3RB8A 4WESA 3TDNA 4K6HA 3WGZA 1QE3A 4NJEB 2UYGA 2GNOA 1D1QA 4OJNA 3V7YA 4EFKA 1MAWA 4YLGA 3EF3A 4MSUA 4OUDA 3OCVA 1D1TA 3DEIA 1TA0A 1WEHA 4ZOLF 3V4LA 1Y48E 1PNQA 1YCDA 3C70A 4JKIA 3WFJA 4GM1A 4QDKA 4KP7A 2B9EA 1I14A 1UODA 3GLSA 4X1IA 1UMKA 4YO7A 1E2FA 1GYPA 1FU7A 4JJ6A 4AUMA 3NJRA 2UVPA 2QPAA 2PKRA 3ETJA 2P4EA 4X54A 1NUSA 1MT0A 3AI1A 4ESEA 2HPVA 5HVNA 3Q40A 1CB7A 4GI5A 4DYVA 5IT9A 3FX2A 1AHNA 4IW3B 2D4AA 4MPDA 3SS7X 3WMRA 4JSTA 3UMYA 1B2LA 2PLRA 4IHJA 4JLPA 2XE7A 1QG2A 3DAYA 2WG1A 5BSWA 2BFAA 1BAPA 1G6HA 3CR8A 5DHUA 2CDAA 1JVBA 2BGGA 4F7DA 1FQJA 4WLFA 2B8EA 1IBSA 4G5RA 1YCGA 1XEAA 4BO3A 5JS1A 1R10A 1U1EA 1EK5A 3ENNA 4TV9A 1FMJA 4DT1A 1QKKA 3NFRA 3AO0B 2RAUA 1YA6A 1QDLB 2AB0A 4MVJM 4C6TA 5J4KA 5FBHA 1JVNA 5I8PA 4LCJA 6REQA 3JQ8A 4ZRDA 1XZPA 1OLUB 4MR8B 5YASA 6ADHA 5ETJA 1V3TA 4OGKA 3T8YA 1H9BA 1E2JA 3KO8A 1TUIA 1Z0KA 2QGFA 4LOJA 3KXKA 1T1IA 3GFOA 1HK7A 4D99A 1NSFA 2XH8A 5HS6A 3HP1A 1JAXA 1OAAA 3DBHB 3V4FA 1CNFA 2QN9A 4GAEA 4LGYA 2X6RA 2WSSD 4XLZA 2CXOA 1WM1A 2JAOA 3C5VA 4G1VA 4RO0A 4HZIA 4Z4CA 5HWSA 3SJZA 4LTNA 5AXBA 3QEAZ 2G1PA 1NQTA 2NYAA 3H9UA 2CDCA 2OAP1 3CUVA 2IUUA 4ENQA 3X1WA 3BH6A 2O2XA 2PRKA 4LVOA 1GRNA 5BMVA 4EVQA 4ZARA 1AZTA 1PG2A 3PDUA 2NZJA 3RFCA 1QS0B 2R8XA 3DVSX 3R0VA 4L95C 1MX3A 5JCXA 4AU1A 1CQZA 2V5AA 4MMXB 3UXEA 1MV8A 3N86A 3LYLA 5CFZA 1JHAA 1II9A 1EFKA 1LDYA 2HEGA 2HREA 3FBTA 1TPZA 2O0KA 3HGTA 1ECCA 2VYCA 2V97A 4BYMA 3HM9A 1GA1A 1SCNE 3EW7A 2R0QC 1KI2A 3C6YA 7GPBA 2EWVA 3DO5A 3ROPA 5FV4A 1V7QA 2GJ8A 2JHPA 3B85A 3ZZNA 1FFXB 3B78A 4P35A 1NXPA 1O77A 2R6DA 4PPNA 1EB8A 1Z15A 3O8QB 3QELA 4IO0A 3D6TB 2O4CA 3DBOB 1XRPA 3HXLA 4LWQA 3C43A 4M86A 3KKZA 3U3ZA 2C7RA 1NUAA 1LB1B 4JLJA 1KVUA 1YL7A 5E2IA 4ZKDA 4QTTB 2P40A 4OY3A 2NSJA 3PDHA 4IG9A 4BKMA 3BERA 4CV2A 4IGAA 3DMRA 1OE0A 3MN1A 3PR2B 4IYJA 2VHCA 4UCQA 4IJMA 4MV1A 4P0TA 4ABYA 2NGRA 5EJ9A 3LT1A 2C1XA 4FYXA 1IOVA 4F5EA 2CV0A 4DSAA 3R5XA 3D6JA 4KIWA 5JNUA 2IE0A 5BRAA 1CUDA 5DGTA 3N0XA 1S5PA 3QUTA 5HFAA 1YQEA 1E1DA 2BFNA 2QVLA 1TQDA 4YH1A 2QX8A 2WQ6A 3EGOA 4CU5A 4JL5A 1C50A 1WXWA 1LW6E 3CKYA 4DANA 2BCJQ 5CM9C 1WB5A 5M34A 5K8VA 1QYRA 4FFLA 3A6JA 4URXR 1M6VB 1QYVA 3GPIA 4TWZA 5KSZA 4KHPB 4XYBA 1LDEA 3O1HB 4W9RA 1UC4B 3C1OA 1EFRA 2OHFA 2GK4A 3R6WA 2PUGA 2P62A 2FPGA 4BMPB 3AEQB 3KPWA 2ZBUA 3BZUA 4OHUA 3NLLA 2GEBA 4TXNA 1K27A 1NNLA 1OXBB 2JF0A 1G7TA 1KJ9A 2FK7A 5FPKA 1E66A 2ZBRA 3M6UA 3B53X 3ELYA 1K8RA 2D00A 3RIMA 3C3AA 4UXJA 5K5EA 3B13B 4OXIA 1Q0PA 3RWOA 5SV2A 1XXHE 2XYRA 4LZWA 3VSBA 4FN4A 5FAKA 2JLWA 3T54A 2MWMA 2X3YA 1S2NA 3JSXA 3A6DA 2Z83A 4GUAA 1KMQA 3JQRA 4JKOA 3JWIA 1WF3A 1N36B 1LUAA 4BVLA 2QXUA 3TUJC 4JQYA 1D2NA 1B42A 2DFKB 4XUDA 1ORWA 1XV5A 2HR1A 4EW6A 3OJXA 1P72A 2HTFA 5FFMA 1SK8A 2Q8NA 1TU3A 1V6AA 1P73A 1EP1B 2MYNA 2F1HA 1R9NA 2YQ5A 1AQYA 1FFGA 1V1MA 1I1QB 1X86B 2ZANA 5AI6A 2XVMA 3TK1A 5ICGA 4RX1A 5JARA 2YR0A 5CLFA 3EGXB 4YPVA 4M1EA 1QH8B 3Q3VA 4GKVA 4M2LA 3UXMA 4KWIA 2GO1A 4WZ6A 1TU4A 1NVGA 1PNTA 1L4LA 3GWGA 1C8KA 4MPPA 2EBHX 3ZVKA 1CT9A 2ZT6A 4B75A 1G21A 1SUPA 1UZLA 5K4AA 2ZUTA 1U0HC 5K2OA 4NE2A 5KYUB 4YRJA 2GUGA 3CZMA 4YUYA 3AR8A 4KTTE 1PJ8A 4GI7A 3OKCA 3V1YA 4IQ4A 2NAFA 3BHIA 1BROA 3GT3A 3DPSA 1SULA 2IW3A 3HCCA 4OAQA 1L4BA 1ZM4A 4LISA 4HQRA 4ZAWA 2UXCB 13PKA 2Z4SA 1G8FA 4HAOA 2N1MA 2SICE 5ALDA 2K87A 4KVZA 3OMXA 1GNVA 1JFRA 4D98A 4E33A 5I45A 3B5JA 1J42A 1O9GA 1VM6A 4FW9A 4YJ2A 5CLQA 1KAGA 1AMOA 3OD5A 5E7QA 2OORA 3UW3A 1QU3A 2DE0X 2Y93A 5IC5A 4Z8XA 2O6LA 2QDKA 1KAMA 4IIJA 5HR5A 2H8GA 3V33A 2UZIR 2YMMA 4UE3S 5BSHA 3SR0A 4HNGA 1H8HD 5EJ5A 4MW1A 5FJIA 3FLBA 2QQ5A 1QG6A 2HLHA 3AEYA 3PDWA 3RT9A 3PPYA 3AUAA 3ET4A 3GCXA 1DP4A 4CIAA 1FFCA 1FA9A 2P4UA 5JR3A 2UDPA 4TWAA 1J8YF 4Z3OA 2ATEA 1XD9A 5DJ5A 4BNVA 3BWBA 1LPNA 4DA9A 2ZZKA 2ZR9A 4OKNA 3ZS9A 2OQRA 4FFRA 4PPGA 1JSLA 4XFKA 3T1NA 1KQOA 5ILQA 4JXZA 3B6EA 2WYWA 4L6IA 4CLDA 3G5LA 4B6PA 1QQBA 4B3BA 1BX0A 3AEKB 3QLVC 1JIKA 4LOKA 3SSNA 3FOFC 4M4SA 5IFKA 5T4EA 2GM4A 2X22A 3K0FB 3L7AA 4HR7A 3ZWBA 5CA1B 3UN1A 3UTDA 4H7FA 4KFSA 1C2TA 5JXIA 2I54A 3WTCA 4AO7A 4CR6A 1ADGA 1KPHA 1YVUA 1JMKC 3W3AA 3W7AA 3NOVA 3FCXA 5HK9A 1LSSA 2Q2VA 3RBXA 3F1LA 2CHQA 4HX9A 5FPTA 4CKWB 4QX6A 1ZL0A 2OXFA 3ITNA 4MTLA 1Q1EA 4QATA 4IBOA 5TEWA 3DCJA 1YDMA 1DWUA 1WNFA 1AM4D 5D2CA 5K8JB 4OX9B 1PWZA 4R3WA 2UUCB 1RQPA 2C4NA 3RBZA 3V4VB 3WGJA 2H63A 3PT9A 1B0PA 2C1EA 2ZE8A 2HJVA 5DHAA 1KJJA 1NC3A 3PGA1 4JGBA 2WG2A 1D0VA 3AR9A 4CV1A 4BLRA 4EENA 2NU8A 3BH0A 2ONCA 4Q05A 1YD7A 4IIEA 4G09A 2JRLA 2XWSA 3JYHA 3P4YA 4ENSA 4K9NA 5AVJA 1N5DA 3CS3A 1CLUA 2Z6VA 3ADDA 2X8WA 5THXA 3CE9A 2VNSA 4HEA1 5DWVA 1V1RB 3FYHA 1RLOA 3OZTA 2VOJA 5CB6A 1WV1A 3LC1O 1L7RA 5IHXA 4G5YA 4DQKA 4M0EA 1K2WA 5ALSA 1M1YB 2OHGA 3DLBA 2YXDA 5SZIA 3AYXB 2VSNA 1DHTA 4GZLA 4WUVA 5EPUA 3DF7A 3MTAA 4ZV9A 1FSFA 4M0CA 4M0LA 3CLTD 1ES9A 2XQIA 4O4IA 3DFFA 4GZMA 4TN1A 3UJDA 1XJCA 4XZ3A 4DE5A 3PSHA 3D6UA 3QUBA 4D0RA 1JRLA 4RY0A 2OFPA 5BOSB 1JDVA 1TA4A 2GN1A 2Q2OA 4FD3A 3RVDA 1XLTA 4NEHB 4D56A 2QQ0A 4J7CA 2RIRA 3NH6A 1UOOA 2BH9A 4JZYA 2FSHA 2ZJ7A 3NUGA 1DWOA 2ILVA 2A1UA 3H9BA 1QR2A 1K97A 1VQ1A 2QZSA 3HR4A 3O4IA 3LDHA 2QENA 4BTVA 3PDIA 521PA 3AIKA 3HZZA 1YRLA 1JEEA 3SYNA 1REQB 1FW8A 4KIGA 1SOVA 1P4RA 3H2SA 4LJ9A 1RS0A 3LVQE 2XCIA 2VPQA 4UHHA 5IM5A 3SCZA 1KEPA 5FEUA 1GJRA 1ESNA 1VXRA 1F1JA 2EQAA 4KFUA 4MV4A 4ZOLA 3R7WB 3DDWA 5CXUA 3K09C 4FGZA 1GEEA 4S1TA 3A6LA 3GZNA 3U13A 5M29A 1YKFA 5JIBA 1BA2A 3I1YA 1F1BA 4XM2A 4B43A 4QEZA 5EZSA 4EB6B 4LK2A 4E7PA 1NYRA 4D26A 3P2OA 3S3TA 2PAAA 1Y98A 4UPVA 3SX2A 3EYAA 1QO9A 1HFEL 2BEUA 1A3CA 3L9XA 1QWSA 4GXNA 1XXHA 2XBUA 3D31A 4J94A 1GKUB 3S4YA 1I7DA 2W90A 3STWA 1CJMA 3I2JA 4LNAA 4RNCA 2HGSA 2W43A 4R7GA 1J8DA 1NLMA 2ZRFA 4B6SA 5JWOA 1P9NA 1TVEA 2C42A 4YWHA 4GE3A 4COOA 1U94A 4EJFA 3B2EA 4BV9A 5K03A 2Z6UA 5FWYB 2JIBA 2FEKA 4GMKA 1G9TA 2QLTA 2XQJA 3ZVNA 1I51A 3MOIA 2QDXA 2H51A 1NMZA 4NOJA 3GQBB 5CYGA 4J1TA 4OHWA 1V5WA 4RCYA 3JW8A 5IBPA 3E9NA 4COKA 4JQSA 1E3LA 5GP1A 3X1MA 2WU4A 2CVQA 3BB1A 1FNNA 5EP3A 1SBYA 3PXXA 4RXMA 2CB0A 2FV8A 3GA7A 4MLCA 4TXLA 4PYJA 1ZM7A 1HZJA 2WF8A 3CPSA 3ZZ1A 3BE8A 1YB6A 1H2RS 3I39X 4NMMA 1QHNA 5ITWA 1U5BB 2OESA 3MB8A 3PHGA 5HF8A 3I04A 1FJHA 1HQKA 1U2GA 2XEXA 1XJ0A 3A04A 3C7AA 4L9AA 5HK8A 4ZYWA 1QQ5A 2CLHB 4WH0A 4LFBB 1MB9A 1MO6A 2O7RA 1C9MA 3AR5A 4TMFA 5EZ5A 3GLTA 4PS0A 3KWLA 3Q15C 4WLNA 3S6JA 3TINA 4AN0A 1JDBB 3A06A 3DGFC 1G5IA 1GZ6A 2CXRA 2YTZA 2KE5A 1OXUA 3PRJA 3UVEA 1JKIA 3ONNA 4QNMA 1VSTA 3W79A 5FORA 1ACMA 5HE9A 2DQSA 1J2EA 3T7CA 2OZVA 4C05A 3QENA 5DTEA 1WXXA 5H3CA 5LYJF 1VGVA 4JYZA 4YJ3B 2EKDA 2DFLA 2VBFA 1JJ7A 3GJZA 4IRUB 5EJ6A 3E3LA 4GSLA 5GGXA 1WOMA 4RFSA 4I4CA 1SXPA 1MC8A 1SBCA 1TTPB 3LUCA 4JODA 1N25A 4G5GA 4KQHA 1FVOA 1CYDA 1D2HA 1F60A 1R6XA 3VTFA 5LOVF 4JI4B 2R6CA 5CBPB 1O7JA 3LQFA 2X5NA 4FX2A 3O8OB 5JDIC 4X61A 4TS1A 1IJBA 2IL1A 4KUGA 4AN4A 5FEMA 4DG5A 3CZCA 3IPCA 4O0MA 3RJZA 1ZR4A 3FUUA 4DM3A 4HNUA 3PEVA 3QGMA 3MAGA 5DI3B 4I50B 5CIYA 3KR1A 5LLTA 3QPAA 5A0VA 2O7NA 2WUVA 3HL4A 4MJLA 2J7KA 3WMWA 1JG3A 3NHBA 3TNDA 3HGMA 1RC0A 2FMXA 3WLKX 1JEDA 1JEQA 1Y3IA 2BKVA 4RTPA 2P3LA 3FOAA 3HABA 1XZLA 1IVYA 3T35A 2HMSA 2H92A 3WRYC 4X1KB 1X7WA 1VYUA 4R83A 3P27A 2JJ2A 3H8VA 5A4IS 3T7AA 5GZ3A 1ZYUA 2VRBA 4TZTA 4CYMA 2YZMA 1ORDA 2JDID 3GZ4A 3MUEA 4DPKA 1SD2A 1BU5A 1T8RA 4WXPA 4EI7A 2VL7A 3F6EX 3E9MA 4HGRA 4RK4A 5TSDA 3LOPA 4F6RA 1O95C 3GD5A 5A5VA 2H1OA 2CMKA 1G63A 3GUZA 3DQPA 3U4DA 4CODB 4D6YA 3QUCA 2P9JA 2SKDA 3WGNA 2HO5A 4UBMA 5FOTA 1PJZA 5IBRA 3F73A 2H2DA 2RHTA 3M4XA 1K7XB 3A4LA 3TNYA 4E5DA 4IEFB 2GRJA 3GDHA 1EFCA 1EUDA 2HU7A 3BQNB 4JIGA 1TTHA 4V3CA 5JSZA 3KSBC 3ANLA 4O2AA 3DLHA 4L5AA 4F3TA 4NU5A 2YHBA 1ISHA 2I80A 3VH3A 1Y8ZA 2QD4A 4FYPA 1ZN7A 2QG6A 5G0UA 5IULC 1YDEA 5GJWC 3ZXYA 3RC3A 2NVOA 3C4VA 5JNSA 3L82B 3TCNA 1BA3A 4NABA 3AWDA 3GJ4A 3ZIAD 2N42A 5ALTA 4BWYA 3OEEA 3BCRA 3LC0A 4GNKA 4F4CA 4C5CA 4FJ0A 2G4CA 3CRQA 3FPJA 3T41A 3R3UA 1CJCA 1PZMA 1HE4A 1FXSA 2FCRA 4BFLA 1OKKD 4NAVA 3FIJA 4JGIA 2LNDA 2Q4RA 2GRUA 4F2WA 4NDAA 3THYA 2AN9A 3O2SB 4KH1A 3RNOA 5IAOA 2AL7A 1HSZA 1U6KA 3SEQA 3UJ8A 6Q21A 1R3UA 3FGOA 2YWHA 4R2HA 1YJ5A 4FNGA 4Q37A 4YAFA 5B37A 5KHLB 3NCTA 1UPBA 1FTGA 1XRRA 4Q4AA 2QTHA 2DULA 1H1LA 4NLLA 5JS8A 2PRSA 1EM6A 1II8B 1IQ0A 1T36A 1DXQA 1NBIA 1S7CA 2FB9A 3L8YA 4BQNA 5A9SB 1CEQA 2JCYA 1P2GA 3IUJA 1NGSA 1JXMA 2EBWA 1R4ZA 3GL9A 5LYYA 4HNSA 3WGOA 1U9IA 4X8LA 3QLEA 2ZJOA 2GCOB 2IZOA 2J0EA 1VJDA 1VSQA 3DR5A 1DBRA 2AMLA 2FLVA 2W0SA 1F5SA 4W63A 3IQFA 2GK6A 1ORTA 5KSWB 4XUGB 4RGVA 3DMNA 1OA1A 4LE2A 3PJFA 1T13A 2HCRA 3DDUA 3NGMA 1EDDA 1QRUA 1VLJA 5CHEA 1Y5RA 5KJEA 5TGDA 1ZQ9A 4R1LA 5KWJA 1U0BB 4RBNA 4RS4A 1VPTA 1TF2A 4H27A 1ZGGA 4KODA 3LCVB 4MKGA 1L7OA 2R1VB 1YS2X 3M5PA 1T2UA 4D9FA 4ZANA 2ASEA 2RBGA 3FF4A 1J22A 4NOLA 2VF4X 3PE4A 4K3VA 2ZVQX 2D59A 4ZDJA 1NUHA 1EM8B 3L4SO 4LECA 4TXJA 1KSFX 2NU9A 4ENTA 3I37X 2GHRA 3CZ4A 3JQCA 1UJMA 1UP7A 3OM0A 3TX6A 1WXIA 1Z37A 1VMEA 3U6BA 2QT0A 3GCWA 5HX7A 4EITA 1IIBA 1OXXK 4W99A 2P67A 1RPAA 1TUEA 2W2OA 3OD1A 4MQFA 5IZ4A 1VJTA 2F2TA 3EMBA 4B7UA 4BO9A 5B7PA 1ZJWA 2AK2A 3T5PA 1Y5IA 2YCLA 3LQ1A 3NKVA 3TW6A 5FIUA 2IW1A 4EMSA 4DDTA 1EUYA 5EN4A 3LBIA 5EUCA 1YNSA 2XNCA 2O1SA 2HMAA 1BD4A 2IXAA 5CB4A 3T4EA 3A3OA 2F43B 121PA 5JCOC 3LS2A 2QTZA 2WBLC 1C9EA 3CV3A 3LGAA 5CVEA 1TCAA 3U3DA 4G67A 3ZJYA 4DABA 3ZGYA 1CS4C 2F8LA 2PL9A 3QEMB 5KTSA 4JXXA 1N33B 4EZIA 4HUQA 3A0UA 2Y9MB 1WG8A 4AP6A 2B21A 5CA1F 3G2PA 2IYRA 4QYMA 3WSVA 1FYVA 1NJFA 1Z6QA 4DWVA 2G4VA 5IJAA 2A1TS 1PNVA 3PNQA 3B1YA 4RY8A 3RAPR 3ZIDA 4L15A 4RJ2A 2X5JO 1H4QA 2YYYA 5ECGC 2X13A 1NQ5A 4XCVA 1AUVA 2QTMA 1E1KA 4RA6A 2O3RA 2C3YA 5D7BA 1Z39A 2QG4A 3SMVA 3DWEX 1WZEA 1L3CA 5B6PA 1G1AA 2BP7A 4B9EA 4DARA 3PQFA 3FKSD 1DAEA 2VT2A 5C8YB 2AMVA 3E2PA 3EE6A 1E32A 3MQFA 3NTRA 4QHSA 4XJTA 3UANA 1IXKA 3WA6A 3WNZA 1CCWA 4QZVA 3FSGA 2I7DA 2FK8A 1JDZA 1F12A 5FLXA 1E9EA 5AKJA 3ZU3A 5HDBB 2CUZA 2GN4A 4TQAA 3COSA 2KWIA 1Y8QA 3L7NA 3WGTA 4F96A 1D4FA 1NI4B 1P44A 4IUCS 4JJKA 1VLQA 4YFYA 2WHPA 3KAJA 2QLNA 3M3HA 5F5XA 2W48A 1HDGO 1P2TA 3RUFA 5BQFA 5LSAA 3I9FA 2PV7A 2OBXA 4HGYA 3SYLA 3O4JA 3F8SA 4G5HA 4OU4A 4ZTZB 3SBOA 4FZ3A 4GPEA 3PXEA 1EFPB 3MTJA 4L1KA 3ZCSA 1JIVA 5BV8A 3P32A 1OC2A 3CBQA 5TMBA 1JX6A 1NRIA 4U39A 3R3YA 3Q3CA 1J21A 2NO4A 3HWWA 5IKEA 2KX7A 4IDHA 1GZ7A 1H69A 1QOQB 4WNYA 2OXCA 4AWBA 1P19A 2B1RA 4FQ8A 2AZDA 1K8QA 4E6EA 3NWOA 3DW1X 3RTDA 5JZ9A 2PTGA 1JDJA 1GYRA 2B20A 3G7UA 2H18A 4MIYA 4HWRA 3WKAA 2FZ5A 3OA2A 1BOFA 3GP3A 4R8KA 4CMIB 1CIJA 3NIFB 2DR2A 3H4IA 4QJ5A 1AS0A 3K8YA 4GVXA 3W5UA 2P7HA 2FUCA 4PCUA 4C0AC 3WYBA 5GJVC 4WACA 3DE7X 4ME6A 5FBKA 2POQX 5DBOA 3S2GA 1O96B 2YIDA 3CFYA 4NFYA 4ZCLA 3L6UA 1QYDA 1C3OA 2W98A 4IIHA 4ZCMA 2ZQ5A 2SCUB 5CT6A 2WJZB 2AXEA 3PUYA 5F51A 3Q72A 4EMBA 4RTQA 1PJRA 2CXPA 3D3KA 4QULA 4FYIA 5FPHA 3N8NA 1NKVA 1JHUA 1K7FB 4K03A 3B6KA 3FLAA 3GIWA 4HYTA 5SY9A 5K51A 1DAIA 1X77A 1H2BA 2P5TB 2NW6A 3AOEC 3DO8A 3JWPA 3QKSA 4I2VA 4MW4A 3TLGB 1M2NA 2PAFA 2QD3A 1XQ6A 1DJQA 2WJ6A 2OZEA 2ZR8A 4MVJG 2Y0EA 2ZE7A 2GVZC 3G9TA 4RH3A 3T4PA 3HN2A 3LH5A 4MUMA 4DY6A 3ZY2A 4C7BA 4CGYA 4U6SA 3TIFA 2WJYA 1GG9A 3DSRA 3HFRA 3EBOA 4I1YA 3NEJA 4RD4A 4S2UA 5I5GA 4CPDA 5I51A 1QTIA 1TB4A 2EFGA 4XX0A 2Z56A 4PSDA 4PW0A 5HRAA 2HSDA 4M0DA 1EINA 2PQ0A 2HNAA 1UWKA 4JA0A 1OBOA 5CLLA 4DWOA 2PBZA 1B43A 3BH7A 5ITZA 1ARZA 1YFLA 2OM6A 3MWEB 3QUSA 4KQGA 5HF6A 2B37A 1JJFA 3RVOA 2VTBB 3U9SA 1V5IA 3P45A 1NDQA 1OLUA 4MR8A 3B9RA 3DNPA 3UQYS 2J5XA 3Q0EA 4LF9B 2BHSA 1GPYA 5LYJA 3WYAA 1QLJA 2Z1NA 1HRDA 3O1JC 3D6FA 4LSWA 9ATCA 3FZGA 3KSMA 3NOQA 2J0VA 1T9ZA 3G68A 1XQ1A 1IQUA 3IMEA 3DBHA 1TCCA 3KXDA 3MD9A 4TYMA 4KZKA 4UU1A 3LKZA 4BZZA 5C7LO 5HIAA 1GL7A 5JI2E 1GPKA 3G88A 4KI0A 2ZR0A 1I1HA 1LLQA 1T5OA 4Z99A 3FWNA 4NZOA 1L7BA 1MR3F 3L7BA 1QDUA 3ZDRA 2CJFA 2YIJA 3A1WA 4UMVA 5E0KB 4OJQA 1H23A 1E5VA 3QX7A 1E6MA 2WD7B 3ADCA 1UBFA 4CT4B 1NE2A 2FG6C 4C04A 2JBHA 2XY4A 2PVCA 1PNRA 2Q29A 4PC2A 4RQBA 2NO7A 2NYVA 3E5NA 1OC4A 3M89A 4AMYA 5HRUA 3O6VA 4IOKA 4MP8A 3L6CA 1M1YE 2C2KA 1SXJC 5TARA 5IN5A 3A4VA 3PDCA 1FFXA 1R0CA 4YJ3F 4UUBA 5E3JA 3U3XA 3BEOA 4Y6QA 3T3DA 2AZMA 3U0VA 1E3JA 3O8QA