1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
2E4YA 5EWMB 3LUCA 4MPTA 3QLVA 4ETMA 2X7XA 5FBHA 3T95A 1W9HA 5IEJA 3OQOA 2BGGA 3QK7A 2P4UA 2E4ZA 1FFWA 1RXIA 2B4AA 2GBPA 4YCSA 4JAVC 4RS3A 3HO1A 2FEKA 4OATA 3OMWA 2WMYA 1QP7A 4W5NA 3VNBA 5TQJA 3JY6A 2FQWA 3LKBA 3H5VA 3O1IC 2RGYA 4DQDA 5ED4A 1KRXA 4MS3A 1Z12A 4KPYA 2IKSA 1U0SY 4FE4A 4EVRA 3NHZA 1GUBA 3A0RB 2H3HA 2FVYA 3KYIB 1DCFA 3KLOA 1YS6A 2PUDA 4LX8A 1APBA 5EWJA 4Z4FA 4RZSA 4Z9AA 1ZESA 2FEWB 3CFYA 3C97A 3ILHA 3NHMA 5DLEA 4F11A 4JB0A 4RXMA 1TMYA 1JFVA 3GT7A 2MYTA 2PL1A 3H75A 1MIHA 1JLKA 2PLNA 4KK3A 4MLDA 3M6MD 1JHZA 1BDHA 4D74A 3OO0A 1A04A 2QSJA 4DADA 3H1EA 3Q7RA 3LMKA 3KYJB 4MS1B 3F73A 4MRMB 3EGCA 3HUUA 3JVIA 2E4UA 2HQOA 4MS4B 1PUXA 1LBHA 3MA0A 4W5QA 4KNYA 1K68A 1P6UA 4KZKA 5FWXB 1CHNA 1NY5A 1S8NA 4F12A 2XDYA 1NXTA 3LUDA 3HM9A 3QEKA 1Z13A 8ABPA 1D5WA 4N03A 3OLWA 5GQSA 2L17A 1U8TA 2CWDA 1D1QA 3A10A 3EODA 2GWRA 3IP6A 4XLTA 3T8YA 4E7PA 3K4HA 4ZJPA 1Z25A 4S05A 4O5AA 2FSPA 3G1WA 3HEBA 3LTEA 5CNMA 5HQJA 2PMCA 4L4UA 4G0YA 1DCMA 2N9UA 2VYCA 3CHYA 3N0XA 4TLLB 4MR7A 3A0UA 4RK1A 3B2NA 4P98A 4EYGA 2R48A 4WXEA 2QZJA 4PE5B 3HXMA 4PZ0A 4KFCA 3IPAA 3QLVC 4TN5A 3S99A 1SRRA 1Z17A 4LE2A 1U2QA 1GCGA 2MYUA 4MQFA 1F4VA 4MR9A 1NXOA 3FFTA 4OTZA 3H5IA 4GPAA 5DTEA 6ABPA 4L85A 2JVKA 3C3WA 1LK0A 5KC9A 2QV0A 3KG2A 1EHCA 2IPLA 3OLYA 2H0AA 3O2SB 3DLBA 3HUTA 2R25B 2PKXA 1PEAA 1VKRA 2HQRA 4LZLA 4NCAA 1IIBA 5D2CA 4MR8B 4YS6A 1Z26A 5IUKC 4G97A 4DN6A 2PE5A 1QMPA 3RVLA 4ZMSA 2ID9A 3O2QB 1ZH4A 4RY8A 3EDCA 4WUTA 1PHRA 4HYEA 4YO7A 1MAVA 1Z18A 2GX6A 4N0PA 1JH9A 1KRWA 1M2FA 1Z15A 3LUAA 4JB2A 4RDCA 4IILA 1DBQA 4IMJB 1JBEA 4QYWA 1OXKB 3LUFA 4XARA 2YHBA 3HSYA 5EWLA 2LUOA 4F06A 1USKA 4Q7EA 5CNKA 1P6QA 4YP9A 4UHJA 4EY3A 4OLBA 4QPJC 3HDGA 4H3HB 1E6MA 2IYNA 2FTKE 3I42A 4XFKA 3IPCA 3DGEC 2VUIB 2JB9A 2E4XA 1NXPA 2WJAA 1I3CA 7ABPA 3HVRA 4Z9BA 5TQ2B 4MGEA 2J48A 3NNSA 4OLAA 4M88A 1SXGA 5TPWA 4KREA 2MSWA 4MRMA 2FXIA 4KVFA 4HNQA 2KYRA 4XAQA 5EWLB 2JBAB 4G86A 1QNLA 4RK4A 5BRJA 3OLVA 1OXBB 1VLZA 4WT7A 3OLZA 4ETIA 1QQAA 1VPWA 1U2PA 3CTPA 1BA2A 1DRKA 2PUBA 4S04A 4KMRA 3RQIA 3NNNA 3KHTA 1WETA 4YR7A 1U04A 3RH0A 3TB6A 1RZRA 3O1JC 3Q7TA 2FMKA 2I6FA 3E3MA 5JNUA 4N0QA 3CG4A 3CU5A 1A0OA 1TVMA 1HEYA 4EYQA 2QVGA 2O20A 3OM0A 4QICA 1PEYA 4RKRA 3SQNA 3H5WA 5JS1A 1QO0A 3LKVA 4RSMA 5E3JA 5IUJC 5T7BA 1USGA 3A3KA 3HDVA 4Z0NA 2VUHB 4HNSA 4RY0A 4WXMA 4ZMRA 3IP9A 4RXTA 4ML3A 2L2QA 3N53A 2NZVG 3O1HB 3JPWA 2A9RA 5BR1A 1ABFA 4D6XA 1ZVVA 3H5LA 3JTEA 3KJXA 5IUNC 6CHYA 3HV2A 1NXSA 1FSPA 3N8IA 4NQRA 1M2EA 2QW1A 3M9WA 2IPAB 2OENG 3CKMA 4XASA 4CBVA 3KCNA 3O75A 1C4WA 1QKKA 3KLNA 4G0QA 3NNDA 4JASB 5B3JA 4F8JA 1JWLA 1Y1LA 4YRZA 3LUKA 2F8SA 2W42A 2PUAA 1ZGZA 1L5ZA 1YMVA 2WJWA 1JF8A 3JVDA 3D02A 2HJ9A 3SM9A 3H1FA 1CEYA 5FWXA 1MVOA 3RVNA 1NXWA 3FDFA 1QP4A 3DZDA 1XWWA 5DGCA 4G0PA 4KV7A 1ISSA 3GL9A 1DZ3A 3QEMB 3CZCA 4JP1A 2RJNA 4IRXA 3KTOA 2WWVD 3OQNA 4N41A 1W25A 5FWYA 2JRLA 1B00A 5IEBA 4Z4GA 4NV3A 3RVRA 5DKFA 1RXEA 2FQXA 4O1IA 4KQ9A 3CZ5A 2AYXA 2IPNA 4YLEA 5KQMA 3QX8A 3QLUA 3TO5A 1EWTA 2JCGA 5JNSA 1Z2EA 3JS5A 4H3KB 2NT4A 4P1ZA 3QEMA 5JS2A 3N6VA 2E4WA 4RKQA 1C0EA 2CHFA 2CHEA 3H5OA 3LFTA 2FW0A 1DBWA 1EFAA 3Q7SA 2A9PA 5DCLA 1D1PA 4E7OA 3LOPA 3OQMA 1JL3A 3UUGA 4RY9A 4MR8A 1P8AA 4G0MA 1SXHA 5C5CA 1M5TA 4YV7A 1DRJA 4Z4IA 3URMA 3W9SA 1TLFA 3UKJA 2M98A 4W5RA 3F7NA 4Z4EA 1J56A 3RVQA 3MIZA 1DP4A 2JVIA 3KSMA 2ZWMA 4YWHA 5IBQA 3OM1A 3P9YA 4WZZA 5EWMA 1AB6A 1DBPA 1QP0A 3EAFA 4GNRA 4LRQA 5IC5A 5JNRA 2HSGA 4IMIB 2JK1A 1T34A 2FQYA 1LJUA 3L49A 4MS1A 1M5UA 3DBIA 4LE0A 3FGZA 3MMNA 4G0XA 2MSLA 4MS4A 5KQPA 3OMXA 5TPZD 3OLXA 2IOYA 4PEVA 1ZDMA 2WY2D 1KMIY 2FMIA 3UK0A 3SNKA 3BREA 4EYOA 2CD7A 1K66A 1DC8A 3IDOA 1EAYA 3QX9A 4JOQA 2L18A 1UDRA 2MYPA 3JPYA 3M9XA 5PNTA 4F3TA 3MM4A 5BQ3A 3RVMA 4W5TA 2NUBA 3RVKA 4Y9TA 3K9CA 3TMYA 1RPJA 9ABPA 5EWJB 3ROFA 1PNRA 3HJFA 3GWGA 1ZN2A 2GI4A 3I09A 3C3KA 1ZHHA 1E6LA 4LDZA 2WRZA 3CRNA 5HSGA 3IP7A 1BDIA 3FFXA 4LE1A 1TJYA 1GUDA 4IGAA 5KQLA 3H1GA 4RK0A 4MQFB 1AB5A 3EQZA 4MLCA 3LUJA 3H6GA 2LP4Y 1YK0A 3OO1A 2RDMA 1BVHA 3I5AA 1YS7A 5HM6A 1D4ZA 1ZAYA 1RNLA 3HS3A 3SAJA 2L19A 3CNBA 1LJLA 1SXIA 4EVSA 3RVOA 4O1HA 1H9CA 3QELB 4Z4HA 1LBIA 4RWEA 1CYEA 1JYFA 1JDNA 4TMYA 5BRAA 3N75A 2F8TA 5TPWB 3Q15C 3SY8A 2ID7A 1Z16A 2JBAA 1USIA 5KWSA 3Q41A 4Q6BA 2JVJA 4TLMB 1ZGGA 2GKGA 3HZHA 3IP5A 3BILA 2R4QA 1GCAA 1NATA 1JFTA 5TE9A 1YTUA 2RJOA 1DCKA 1E6KA 2FN9A 4N76A 1BAPA 1D2AA 3GYBA 3KS9A 3BRQA 1FQWA 3G85A 1RZRD 1JDPA 4EGSA 3BBLA 2IPMA 3LUHA 5C5EA 3H5TA 4Z4CA 3QELA 4W5OA 1ABEA 2AYZA 4MAAA 5KC8A 1XHEA 5I4CA 2QU7A 3SG0A 2TMYA 1EWKA 5IX8A 4EVQA 5TQ0A 3EQ2A 2MYNA 1NTRA 4EYKA 3RVJA 3N0WA 1YIOA 1NXXA 3Q9SA 2R47A 2PUFA 3GBPA 4PICA 1QO0D 3VNAA 1JX6A 1P2FA 3L6UA 2LIVA 3GBVA 1BDJA 4KRFA 1JYEA 1ZITA 3ROTA 3CG0A 4FB4A 2LBPA 1Z2DA 3GV0A 4KQCA 4Q6WA 5TQ2A 2HQBA 4XXHA 2P9HA 3KKEA 4RV5A 4NICA 5TQ0B 2DRIA 3MF4A 4JA2A 2FEPA 2NT3A 4MR7B 1EWVA 3O21A 5ABPA 3N0RA 4NCBA 4IF4A 4N47A 1QPZA 4FE7A 1R8JA 1A2OA 3DGFC 3GRCA 2YHAA 4Z99A 2E4VA 4EUKA 3MYYA 1PNTA 2A9OA 1URPA 5CNIA 3QLUC 3CLKA 2LPMA 3RVSA 4ZPJA 2FLKA 2FMFA 1TM2A 2PUCA 2MSKA 3EULA 3FFWA 3QLTA 3T6KA 5JNTA 5JNVA 1DC7A 1DJMA 2WB4A 2OQRA 2PAFA 2QXYA 3C3MA 2ZAYA 2B1JA 1DG9A 1NXVA 3GA5A 3DLHA 4G0OA 4ZYLA 3HCWA 2QR3A 1MB0A 4MYRA 5FBKA 3MQ4A 4YGXB 4OBBA 3CS3A 2QVCA 4D6YA 1MB3A 1ZY2A 3TX6A 3E61A 5KI6A 4OG2A 5IULC 3BRSA 2FMHA 4PYRA 3O74A 2M1ZA 2VK2A 4RK6A 1SD5A 5GOTA 4MQEA 2FKAA 4H60A 3R0JA 4RU1A 5T3YA 3HK2A 1L5YA 2V0NA 1ISRA 2PJUA 1FFGA 2PL9A 3F6CA 4LDAA 5TPZA 2Q5CA 3FMVA 3TD9A 3NBMA 1KGSA 2FLWA 1VRVA 3EJWA 5F64A 3C6QA 3F6PA 1ZH2A 1YMUA 4ETNA 3D8UA 2IDMA 5CNJA 4WWHA 4QYMA 3T38A 3I45A 1FFSA 2FN8A 2NZUG 4RXUA 4B09A 3LUGA 3H6HA 5CHYA 1JFSA 2HPHA 4UHKA 4G0ZA 4MQEB 1XHFA 1YK1A 4HNRA 3RVPA 2A9QA 2PUEA 3ILYA 2PUGA 1QQBA 4MR9B 1YVUA 1F51E 3O2JA 4RK5A 5KQGA 1GLGA 4MS3B 5B3JC 1E2BA 4RK7A 5HKOA 5FWYB 5JNWA 4KK4A
chains in the Genus database with same CATH superfamily
2GLTA 4LXUA 1MC4A 1XALA 4QX6A 5DOZA 4AC9A 2I66A 2BGGA 1YCDA 1A4XA 1N5MA 3A6JA 4JL5A 4PZAA 5CB4F 2VHYA 3E9CA 2A0UA 1QP7A 5AHKA 3RGWS 2FFHA 2ZWPA 3O1IC 3EY9A 3OKAA 1TMOA 5DV9A 5LR6A 2I33A 3ICPA 3WYEA 1JDUA 2PWZA 2V96A 4BO3A 4EPYA 2QMUA 1L7OA 1RFLA 3PWTA 5EIWA 4OM8A 4WD3A 1LCIA 3PDUA 1DOZA 2OAQ1 4LZJA 1E58A 3IAHA 1W85B 1EVQA 5MN6A 1Y63A 5JSUA 1KSFX 4LBVA 3CPEA 1N2OA 4Q7MB 3DE3X 3TCNA 2I6UA 2FZVA 3HN7A 1K7EB 2OBNA 3ST7A 3B3FA 4BC1A 1EP9A 4XD7A 1SG0A 1BVYF 1JKIA 1ST3A 3HWWA 2W37A 4K9SA 1HDCA 4CG2A 1ISFA 1Y98A 1C50A 3L92A 1IIRA 1HV8A 4KK3A 2O8NA 3RU9A 1VCHA 4BUCA 6LDHA 3CLTC 121PA 3O8BA 1XAGA 4PGHA 2MSNA 1U7WA 3C39A 3UZUA 3PC7A 3DLPX 4I9NA 2CJPA 1BKYA 4ND6A 3ZW8A 3LY8A 5B6JA 1Y7PA 3ELYA 2D74A 5J2UB 5I51A 3MWYW 1B0AA 2O0LA 3OIVA 4ZRMA 5GWXA 4AQ7A 3UTDA 4JVNA 2E4UA 3MBIA 3DDNA 1DJPA 3MA0A 2DVMA 2H2WA 4J7UA 4B84A 4ZK2A 1BN7A 4WW0A 3N3BC 2DHDA 2CZCA 2WZCA 3R3VA 1CUBA 4AJ2A 4EJMA 4TYWA 3JQGB 1YJ5A 3RSCA 3WSWA 4H4CA 3FY4A 1K7XB 5GQSA 4HP8A 3D4BA 5KHAA 3A10A 3IP6A 4ZALA 2GWRA 2XZPA 1C3OB 3T8YA 1E9AA 3H2IA 3U3XA 4UFPA 1Q0ZA 3JASA 1R8QA 1FTSA 5HQJA 4MUEA 4HAXA 1JHXA 3INGA 1Y9EA 4CMIB 1E4EA 5EYPB 2JFGA 1N78A 1INLA 4IQ8A 1PCXA 2OUKA 3FHLA 3RBXA 4F8EA 1FZTA 4TN5A 1SM4A 4US0R 5CDFE 2QQEA 3ECAA 3FWZA 1UOEA 3M6XA 5A02A 1BCRA 4TZKA 1JJIA 3M8KA 4OTZA 1IJEA 2W6JA 2ZIXA 4GX5A 1UMDB 3FPSA 4GYWA 3WWDA 2W9XA 1L7QA 1ZK0A 4Y2RA 5GGYA 1B1CA 1B7GO 2IZ5A 5FLKA 2CMKA 1SBQA 2PZMA 1TT7A 1W87A 1W94A 2GS9A 3HA2A 3HUTA 3LXXA 2FE4A 3MGAA 5J5CA 2B0CA 4I36A 4UQLA 1MJGM 4UBIA 1U4SA 2QORA 4MR8B 5T64A 3THYB 2KPOA 5IUKC 3A4IA 3DCIA 3WLSA 5HWSA 4K9RA 5AHOA 2K5UA 4XUCA 3TDKA 2XXAB 1N75A 1XNHA 1FTGA 1SURA 2R1TB 3D3WA 3KJQA 4JQZA 4WK0B 1VHJA 1Z18A 2B61A 3R7DA 2V7QA 3COVA 4EARA 4BX2A 1ZN8A 3WLAA 3ZN2A 1GAJA 4JVMA 3CPSA 4XJTA 4X54A 5EJ6A 2GJKA 1YULA 2LD4A 2PH7A 4PYNA 2ID4A 5ALTA 4AZ0B 4EPTA 5EHZA 5KJFA 1WF3A 4WCDA 3WDMA 1P5HA 1QV7A 2R9VA 5L6MB 3S40A 2MR6A 4XWWA 3JWPA 4E5YA 4XLZA 2YVUA 3UK1A 1GRQA 1NUUA 3CO5A 3WJ2A 1U2DA 1EXVA 2XUAA 4GZMA 3AONB 8MHTA 5H3CA 4ZT5A 2JCSA 3JQAA 1LS1A 1L6IA 1K3TA 1YT5A 1TUBB 1Q20A 2JEYA 2WJAA 3O8QA 1G8YA 1I3CA 3IAFA 3QI7A 3ESQA 7ABPA 3V80A 1XP8A 2Y0EA 3TZ6A 4RSHA 4DR1B 1E0AA 3E18A 1NXQA 1D3AA 4F21A 4EDFA 2MSWA 5JTUA 1FYWA 4DCMA 4QAQA 1AUQA 3N5KA 5CX4A 2CLLB 1K1EA 5J1SB 3PHGA 1TZKA 1TRKA 1AKWA 4CEJA 4Q7JB 3CTPA 4XPZA 1WMBA 2C5LA 3R41A 3VR6D 1TTPB 4YJHB 1JLLA 4DT1A 1SGWA 1WHSA 5KOJA 3NONA 2WM3A 2Y1DA 3JYHA 2HQSA 4FPXA 2ZS7A 3KYDB 4LWPA 1KR5A 2B5OA 4OQZA 1NQXA 3T99A 5DNVA 4N0QA 1GTL1 3BJMA 3K9FC 1YNSA 3KQOA 2ICAA 4RGYA 3DF9A 4PIVA 2A0KA 2RHCA 2WVJA 3RYFB 2KWIA 4LJYA 3H5NA 3TD2A 3W5SA 4BNTA 4MIOA 3RTAA 2EL7A 3F6EX 1R15A 4NNJA 5M2QA 1RCTE 4AX8A 5BSKA 4GBED 4HK4A 1VPDA 2IEZA 4NFLA 2OP0A 5D1NA 5G3ZA 3U0BA 3WO0A 1LFAA 3T7SA 1YQ9A 1O87A 2HXSA 3UMCA 4CM4B 2H08A 4WXMA 4B2PA 3KJZA 1HKHA 5JQWA 2VXCA 2P6PA 2YHIB 4ML3A 3F8SA 4OXRA 1BKDR 3LWNA 4JBWA 5ADUS 2A9RA 2JI4A 5KPDA 4PPQA 3LQYA 1GP2A 1JXAA 3WZMA 2NO9A 4MRRA 2AR0A 2G08A 3EUWA 1Y3BE 2DJIA 3E5HA 1UR5A 4JNCA 4IG9A 4KMOA 1SZCA 3PDHA 2CVOA 3MS4A 3PE6A 5KKCA 1C9MA 4C08A 3VNUA 3ND6A 2OXCA 4HXEB 1PJCA 1AKNA 4FINA 5SICE 4JI1B 1U9YA 1TUEA 4URUR 4YRZA 1M83A 3K8QA 2W2TA 4TM8A 4ZJUA 4KXXA 1RS0A 2Y1EA 2P2NA 4IUYA 1OWOA 5I7WA 2JFYA 3BE5A 5DE3A 3GJ3A 1ZBQA 2XBMA 4PTLA 5F7JA 2Y9MB 5EINA 1K08A 2XIJA 2MTBA 1KIFA 2VF2A 3KRTA 4HEHA 5GVSA 3FDFA 1OHHA 3DZDA 4YDQA 2J0EA 1IUNA 1LNQA 1W47A 2CC2A 4PCUA 1L5GB 1A69A 5DGCA 5I8PA 1RBZA 1N6RA 4G9GA 2VG8A 2VZ0A 5FTLA 1JEEA 1P60A 1UADA 1KH2A 3CZCA 3OPXA 3TR6A 4EB8A 1AKVA 3GJTA 3KTOA 4G89A 5KWIA 2VPIA 2YXLA 1VE3A 5ALHA 1XDUA 4GOND 4EJ0A 1F6DA 3D43A 4QECA 3DOIA 1GY8A 1GYQA 5FFNA 4TWBA 4N3CA 2RD2A 2DBVO 4L9AA 1OFVA 2XVXA 3L0ZA 3WDLA 4Z4GA 1DO0A 3LZ6A 1SVSA 1UMBA 1GPWB 1T9GR 3DOEA 4WFKA 1HYHA 2H9AA 4GPZA 9LDBA 1IZ9A 2SCUB 1PFKA 2NO6A 4NIMA 1OIXA 1VG1A 3DDCA 4LECA 3CLUC 3QEMA 2VDNB 3GDGA 5LZ4A 2E4WA 5IDWA 3S44A 5AESA 5FR1A 3NYIA 5CCEA 1RU3A 2O0KA 3WGTA 3E35A 2C83A 1H6BA 3VSCA 5EJ9A 4F7DA 2PNJA 2KI5A 3UJHA 2DUWA 3E2PA 4KO4S 4LWQA 5INTA 1V5EA 2BEUB 3HN2A 4W9NA 1IH8A 2RONA 3GUZA 4AW9A 2JAQA 5CFOA 1PW7A 4V0QA 3TXXA 3LNTA 3VSEA 3HJCA 1DFGA 4GXRA 1N9GA 1ZK3A 1U5BB 2P2SA 2YWDA 3IBYA 3PI6A 1T9DA 5IBQA 3R75A 4W63A 1PSWA 4MRVA 2JASA 2FDRA 2JK1A 4FNAA 2TECE 4NOLA 5HDQA 1UMDA 5B53A 4Q7QA 5IC6A 4JROA 1GFIA 3SYMA 1MO4A 3GH1A 2EKZA 1J90A 3HCAA 4JBXA 4OL0A 5JXJA 2ODBA 4QXAA 3QIVA 3EIOA 3PFWO 1RKVA 5TPZD 3DVAB 2XE8A 3PD1A 5DM60 4DUYB 3K30A 4Q19A 3A2KA 4OA8A 4HWGA 1P91A 4I4CA 4J16A 3FYHA 1B76A 1RXWA 2GOYA 1AS0A 3V4PB 2F62A 4JOQA 5TR9A 1JA1A 2OCIA 4CG0A 1JPUA 4YQZA 3S2YA 4N3BA 1KYXA 1SIBE 2DPHA 3MJFA 4IFIA 1IHYA 1KVSA 1Y3IA 1RZ3A 1LJ8A 2OORC 3P9SA 4EIWA 4IJQA 1IJFA 2GD6A 4URYR 1UKCA 1X7WA 3SSMA 4HDMB 3Q8XB 3AR7A 3GLGE 1R64A 1J1IA 3INTA 4ZVLA 5YASA 4FOPA 3WWPA 1DGQA 4BL5A 3C7DB 2NUAB 1XCOA 2OHGA 1NVMB 2HU2A 1OOEA 1NKTA 1OYOA 2HZ7A 4M9QA 4DDMA 1R6UA 4MV4A 1KYZA 2IWHA 1VBMA 1XPRA 4GMHA 1ZAYA 3CW2A 2O1XA 3VDXA 2WYHA 5JVDF 3RYCA 3TUZC 2PLAA 4XJXA 3ZY4A 1DBVO 2ZYIA 3CNBA 3DVSX 4EAAA 1E9EA 3PXXA 2B8JA 4Q34A 3AR8A 4YROA 2PVCA 2P9EA 4PWYA 1ULSA 3O91A 5JISA 1B41A 3UC9A 1DKRA 1EK5A 4COKA 2Z3WA 1U94A 1D2RA 5EUCA 1U7OA 1VPTA 4OCZA 4R7GA 4B6JA 2EJCA 5FADA 3JYOA 5EXXA 1GCAA 4KDEA 5JNLA 1RQLA 1FFEA 3MCWA 3V00A 5HW0A 1W5SA 1JT2A 2ZB8A 2FN9A 2OC9A 2VWPA 1F5SA 5IAJA 3LFHA 1AK2A 3WKAA 5EJ8A 3U4MA 1A8IA 2ID8A 2ZPTX 3PFHA 4UBOA 2A4MA 2VNJA 1G2IA 1AS2A 4MB2A 3JU3A 3IBFA 1WY5A 4R41A 3TTSA 4H7EA 5IT9A 1SA0A 2DTDA 5HUHA 4BVJA 2VTBA 4DR4B 1UKEA 5LXTB 1YJAA 1Q7TA 1TI7A 3RVJA 1RXVA 4JI7B 4EABA 4UTVA 3AVYA 1LDBA 3FVTA 1E2IA 4H9GA 1ZCAA 2ZRDA 4QUGA 3FTCA 4R9UC 5JZ9A 5LD2C 1LPSA 5B1YA 3EA5A 3RIEA 2VJKA 3GN2A 1B6GA 1NZFA 1VE1A 1NA5A 2V7TA 2WTXA 4AKIA 2E9SA 1A5SB 2OA0A 3QPWA 4BO0A 3AB8A 3QWAA 3OIWA 3AL2A 4JLDA 5JRJA 1Q2UA 3C6KA 3MBOA 3RUFA 2WTEA 3U2QA 5LPNA 2JGDA 4X61A 2PV0A 2RKWA 3AY3A 5AK4A 1LF5A 5B2ZA 5KUTA 3H97A 5DFAA 3IQEA 1NBMD 2QTLA 2NQ8A 421PA 3SIPA 4QVKA 5ADVA 3G2NA 1OGYA 4RV9A 2B2CA 1OH7A 3UG6A 3BZUA 5DW0A 3MYYA 3AEQB 4CT5A 2CZGA 1W93A 2ZRIA 4CRWB 4WINA 2ZWVA 5EKTA 3T7TA 2LPMA 3T5AA 3K6SB 2NO5A 3L1JA 5F98A 3PP8A 2HA2A 3I1YA 2F4NA 1IBCA 2CUKA 1L1QA 4TZTA 4DSUA 3ZWXA 2YRXA 1YMQA 3DO8A 2VAMA 1KAQA 2E0IA 2REQA 2X8JB 1E3QA 2QXYA 4E2XA 3ZHTA 5L4LA 2H8GA 1NXVA 1YR3A 3GLUA 1SKYB 4HR7A 4G0OA 5P8WA 3RLFA 2BFBB 3ZIAA 2OECA 4FFPA 4JYBA 4AJJA 3PGLA 3B2QA 3VJRA 3VKUA 1JIUA 5TJ9A 4AF8A 1MRNA 1LDMA 2GZMA 3SS7X 1H0SA 2IHZA 3WP0A 4Y1EA 3WL3A 5K0TA 1SG9A 4OBBA 1RBQA 2R3SA 1U0GA 1XQ9A 4S3MA 4XE5A 2DKOA 4ARCA 2ISSD 1IRXA 3ZD7A 3JVUA 3ZHUA 4PLCA 1K5DA 1KXZA 1QANA 1JDZA 3LC1O 4J07A 5B7PA 3UHFA 3NBQA 3GR6A 1CQWA 4EKYA 3AR2A 4GYJA 2ZXEA 3WJAA 5DDIP 3Q7QA 4KAXA 5GJVC 5TPZA 4E46A 3BXGA 4TWJA 1EDEA 2C57A 5FTNA 5B4UA 4EQZA 4YGYA 1IN1A 1V11A 3I61A 2HK8A 4PX3A 2SECE 3C6QA 1SKBA 2COEA 3TOXA 4YT4A 1NPTO 4KH1A 3RPEA 1P0PA 5KYYB 1PV4A 2Q3CA 4C7BA 1LBQA 3N74A 4NNPA 4R1MA 1Z22A 4C4ZA 1E2LA 1ZVMA 2NZUG 4MWDA 3WICA 2WU8A 3WBBA 2IX9A 3EE6A 3PCTA 4HNRA 4PZYA 3OEEA 3WLQA 4QULA 1H2FA 2FJPA 1RI5A 3CWZA 1G63A 4MR9B 5TGDA 4D7AA 4D6PA 3BIFA 3H1AA 4MS3B 2NSLA 1KOLA 3NS7A 3VR5H 3CLSC 1B42A 3GCXA 1NC3A 3NOVA 1JQBA 4OQEA 1LPPA 4W7SA 5ELMA 5TVGA 3T95A 3QK7A 3RSGA 1FFWA 3KKZA 5IJXA 3QKRB 3I92A 4NBRA 1UMBB 3OMWA 2XWQA 2BEKA 2EVWX 3NYQA 3V55A 2CUTA 5TQJA 3B9BA 3CRVA 3M5WA 3RT7A 5AKJA 5BSGA 2YV2A 5T8KA 1AUVA 1GGEA 1N6NA 3UXHA 1T36A 4YMVA 3L18A 1U1DA 4PHTA 1DSSG 3FHCB 3OEWA 3C1TA 3NAMA 3K70B 1G8AA 1S5PA 2XNDD 3BULA 5K6AA 3GH3A 3MXTA 3ZY6A 4F8JA 4M8NE 2X76A 5FUMA 3KWMA 2I6TA 2QAGA 5JXIA 4XQCA 4EY8A 1OI7A 2MMCA 5K8VA 2JZOA 2SICE 5F2OA 1AKMA 2X7JA 5F51A 2HF2A 2ZSIA 3E22B 3PWSA 6GPBA 2JCVA 2XOEA 2VT7A 3GARA 2WSLA 3D31A 1T0HB 1ULZA 2HCRA 1MIHA 2L82A 2Z30A 2ZIXB 4NENB 3VBEA 3DBLB 5IT5A 3LX8A 1W44A 3ZNNA 4HAVA 3VHRA 4M0KA 4QLBA 1ZIXA 3PC8C 4FEGA 4J3NA 3PXCX 1G2PA 4EJSC 1VPEA 2YY5A 1O08A 2E5LB 2DLCX 4TV8A 4Y1GA 4RYLA 2FG7C 2ZE8A 4F3YA 4FC6A 3RYCB 4JR2A 4CCYB 2QX9A 5FPQA 4TS3A 2H65A 5DHUA 4FN4A 3WIEA 1UJMA 4IIVA 4UU7A 4DV4B 5HIIA 3FMPB 3KE9A 1BYIA 1WMEA 3ZDRA 1EKXA 3KSRA 4NPCA 2GFQA 1H69A 3I4FA 5HE9A 1MJHA 4TSFD 1F38A 1XYGA 3NHWA 3EJ6A 1NXTA 1Y89A 1WA5A 2IVZA 3LUDA 1Z13A 3GI1A 1T1GA 3RKUA 1HA3A 3PDIA 4F5YA 3OLWA 2L17A 4ZO7A 2IF2A 1Y6JA 3ZWQA 4BFZA 4C2BA 1HDZA 2BONA 3ANNA 3QXGA 4TS9A 2J4DA 2EIXA 2RARA 4BBPA 4CV1A 3QKWA 4JLVA 5ALKA 4RTMA 4BAZA 1HH4A 5DWDA 3SBOA 4QYSA 3WK6A 2Y99A 4CKZA 3N2YA 4KE9A 4P98A 5DNAA 1XR3A 2O52A 3T0GA 1TO6A 5FPHA 4EFMA 3T1TA 2QR5A 3BXOA 5AJYA 4XUEA 1TAHA 3G7NA 5LBIA 1BFKA 1DRUA 4K26A 4FYHA 1CZHA 1N2BA 2ERCA 5HS6A 5DTEA 3RRXA 2R66A 4L4SA 4Q05A 4R0MA 5BVHB 2C9MA 3CLTD 2XW6A 3QGMA 4S24A 3V4ZA 5JROA 2PSEA 1M1UA 1NAHA 1RRMA 2YICA 3ROGA 3S1LA 3O47A 5CVJA 2Y27A 5LL6P 3HCFA 3GWZA 3TQQA 1TXGA 3PNMA 2XWJI 3GFFA 2XCTB 1ML4A 2I6GA 4N5LA 3MMZA 2IEAA 4MVYA 4MWSA 2A67A 4WASA 4XM2A 3AVTA 3MCTA 3I34X 2RGBA 4RZ2A 4MJ3A 3WYAA 2HRBA 4ZO4A 2BR3A 2O14A 1Q3HA 2Q4OA 3UJDA 3W3AH 3BGWA 4RD0A 2FEOA 3DE6X 3IP3A 3LBAA 3UMBA 1ESZA 1CX9B 4AX4A 4RAQA 4QTYA 4IMJB 2D1SA 4CGYA 2H0QA 3OT4A 4DJFC 5I6DA 3RTGA 3EGOA 3ZWYA 2EDCA 2R8BA 4YRDA 1NFQA 3OZ7A 2MCFA 4CKEA 4DSAA 2C5BA 2HPAA 3PLRA 1K4YA 1EVEA 2BZGA 4XB6B 5E9JA 1POXA 3Q9UA 4CQLB 4URVR 1CTQA 3MTIA 1QRTA 1X1DA 1QF9A 2IYNA 4INJA 2ZYWX 2Q5IA 3Q98A 5AR1A 2BJWA 4JJFA 1I5EA 1Z62A 1M54A 3GNTA 3IPCA 2OD2A 2X4IA 1NFFA 2IHKA 3S2IA 4CKYA 2BUCA 1H2BA 1UM9B 1KDTA 2Q27A 3MLEA 1EUDA 1XVUA 4AMBA 4NXNB 1CY4A 1E0DA 1EESA 3OZAA 2OKGA 3A3PA 4ZDWA 1KNXA 4HSEA 2FSSA 1MUUA 1B73A 3M33A 4WZAA 3MFQA 5K8CA 2R6FA 3U56A 2O8EA 4WZBE 5EZYF 1DQPA 3MLAA 5JJKA 3NKLA 1U2GA 3L40A 1UFOA 3P9NA 1L1EA 1LSUA 4AS3A 4IVRA 2VQFB 1A2QA 4RH3A 1JEDA 2Z2KA 3SX0A 4S04A 2QGNA 4QBTA 1SBZA 3CKYA 5DF1A 1GLVA 4EB3A 5BN1A 2XMGA 2BMJA 3FAKA 3TB6A 3CUSA 3QFHA 5AI9A 3U81A 3WGOA 3OCCA 4R81A 4TWRA 5HF5A 3OTOB 2HT1A 3E3MA 1I2BA 2A7XA 5AIBA 2EKPA 3P96A 1W73A 4N5DA 1Y42X 1II8B 1TVMA 5TT0A 1BW9B 4WDRA 1U0NA 3ZNQA 1GZUA 5CT6A 3ZR4B 4Q3BA 5JS8A 1N77A 2FUG1 4JL6A 4XKJA 4TL9A 2KX7A 1UFRA 3ME5A 1V4NA 5DI3A 4FMCB 4MP8A 5JS1A 1QYVA 2B9EA 2ZJFA 4I0WB 4ZQEA 1NYQA 4AURA 4NWIA 3DEIA 2QM0A 3QF7A 4LJ7A 4CM7A 2GHIA 3R3ZA 4H7HA 2WF7A 1GTVA 2ODEA 5JDCA 4C7OA 4ZMRA 1JSLA 3IP9A 1Z6TA 2YJNA 1KZGB 4C05A 1D03A 1PJ4A 3TW6A 4OHWA 1ZA1A 4J3FA 1OLSB 1JPVA 1QORA 2OXEA 1T3TA 2UYHA 3HKBB 1JG1A 1RWQA 3TLKA 4DG9A 4P9NA 3IALA 4ISCA 3UAWA 2QJOA 1P9WA 4WFJA 6CHYA 2TMDA 1UMCA 4KQKA 4E5KA 4LRSB 1M2GA 4NCJA 4F72A 1C0KA 1M0SA 1Y1PA 2QA5A 3DKRA 3IE2A 1GZ6A 3ZGXA 3ZGNA 2O0MA 1Y5MA 1E9VA 2P3QA 2YZGA 4KEAA 1HT1E 2FSUA 3I4CA 4U00A 1GUZA 1FP1D 3EIXA 1TAUA 2QUHA 4AIRA 2UYCA 3ROQA 2FXVA 1GTMA 2C2GA 2DQYA 4UOQA 1W7AA 4FMBB 2VDLB 5GM2A 2V8BA 1CKEA 1NJGA 3PU6A 3CRMA 3VZQA 4TKZA 2ZBVA 5JWRA 3QMVA 5L3VA 4QRDA 1H1DA 2PNFA 3U44B 1RRKA 3FNBA 1U63A 3KOUA 3ZXUB 4IUCS 3A9SA 1JG3A 4N8DA 2JGDB 3S6JA 4FC7A 1LI4A 1RKUA 1VIAA 4LNHA 4NEGA 3PICA 3STTA 3QEMB 1Y6GA 5KU1A 1TAGA 4UPDA 4BWVA 4E31A 3SYNA 3RUHA 1YH3A 3L1HA 3UIEA 2XVAA 3TRFA 2JRLA 3AC0A 4IMRA 1XIVA 1Z33A 4UU0A 3RS9A 1IZYA 1KJWA 1O8BA 3AJ9A 4NV3A 4FYYA 2ZQ5A 1PGOA 5I7VA 1E62A 1GZ3A 3GFOA 2DPGA 4A0RA 4CLHA 2FWJA 2JJ2D 4HLCA 1IOVA 3SQOA 1IY2A 3FDJA 2OHXA 1JQKA 4JLOA 3IKLA 3A3OA 2D0OB 3EOZA 3IMGA 4J91A 4RMIA 2JLBA 4QREA 1PZMA 1YCGA 5EP4A 1RQ7A 3AGQA 4N49A 2NACA 1U1IA 1IHOA 1NDHA 3A6LA 5EPOA 3UT5A 1NWHA 1X2EA 1ZVKA 3G5LA 3O8DA 1J99A 4DDWA 2X5OA 3S27A 3RT9A 2X1HA 2VI5A 1YKSA 2I62A 1D0SA 2A5GA 2WM9B 3HFGA 1P8AA 4M6WB 5HOEA 1P5FA 1JEYA 5K0JA 1CHDA 2W2PA 3T0IA 2ONCA 3C8UA 3OWHA 1N2CA 5A2QA 1X7ZA 2OMKA 2PVPA 2Y8EA 4L6AA 5ARDA 5SZJA 3TL2A 4Z6KA 5KWVA 4EG7A 4B17A 1DP4A 2JVIA 3D4IA 3FJYA 2WHEA 2MIIA 3QVJA 3A9WA 3NKFA 3SK0A 1PJ3A 2GB4A 4OX9B 1RCUA 1OBHA 2IHYA 1DBPA 1SXJB 5ALQA 4JJIA 4ZODA 3BRCA 1R9JA 2G17A 4LRQA 3KKNA 3K0AB 4KN9S 1G55A 2P1ZA 1KSHA 3ELWA 5HKLA 3X1JA 1Y8QA 4HFNA 3G49A 5C4IA 3O4VA 2CL6X 2IS6A 4OX9Y 2JJ8A 3RFCA 2XKKA 3DBIA 1NVWQ 2ZRJA 5C8YB 2YJTD 3CEJA 4KB5A 2NTVA 1EYZA 3R7NA 2FX3A 1ZPDA 2IXGA 2ZSUA 2BSQA 1E9DA 1Z75A 2O0JA 1NBHA 2FUG6 2GEKA 2IOYA 3MZ0A 2AVNA 1KMIY 1E1CA 2GDZA 3OJFA 4WBSA 4JR1A 3O8CA 3WKDA 1FS6A 3NRBA 4UARA 2DHEA 2B3TA 3TTVA 4YV0A 1OLUA 4EHBA 2BM9A 1CDZA 2PX8A 4Y9TA 3AW8A 2R8RA 1WXFA 2ZM6B 2D8AA 3ZOKA 2EG9A 4JX8A 2C0QA 3IBSA 4RL6A 2CL5A 2JGFA 3B1WA 3I09A 2AKYA 2CMHA 3V1UA 2VHUA 4BMXA 1WHTB 5F1OA 1E60A 3BMOA 3G8AA 3L2OB 4Y1RB 4AKTA 2ZSDA 5BR4A 1OX5A 1S0UA 2PMKA 3DUFB 3QLEA 4NH0A 4YO8A 1Z82A 3SZUA 3UAZA 1KAEA 2DQKA 3M4ZA 2NIPA 1RWKA 4PIPA 1M8JA 4OYYA 1ESEA 5GY7A 4RF2A 4P7JA 1Z7YA 1TTHA 1R4AA 4L6IA 5E2IA 3U7QA 3S3TA 3RSOA 1MBZA 4PPYA 3BB3A 4ONEA 3L9WA 1V25A 1UC5B 4CFSA 4H2DA 3V3TA 3AEUA 1IWBB 1DKLA 1ZZEA 1MX5A 2YR0A 3QELB 4RWEA 4WDQA 2FLVA 2OILA 1JDNA 3HWSA 3PC3A 4LUCA 2MSCB 2Q9BA 3RFXA 1B43A 1RHRA 2ZCUA 3HB9A 5KOHA 3P9KA 3VVMA 5E6RB 3BE8A 4F9EA 3UMGA 4CI0B 5KTMA 4I2VA 3OQJA 2JVJA 1C14A 3PUWA 4B2LA 4EJSA 4RTOA 1E66A 5AJUA 1YVRA 1GTG1 3FOAA 3TOZA 4H0NA 4N8SA 1N57A 3PYMA 4LDPA 3G2PA 3DOFA 1BAPA 5CMLA 2X15A 4K86A 4UKDA 1A9YA 3K94A 3KB1A 3UJCA 3BBLA 1QFZA 5IG2A 4EPRA 4G0NA 4MARA 4GQAA 2GJ9A 4R83A 4XM0A 4DC9A 1UXHA 1FIUA 2C8JA 3CLHA 5AW0A 1N9ZA 3SZLA 5TIIA 1C80A 2MYNA 1N2CB 1RTKA 1D6JA 1G8FA 3G7UA 3R4VA 5GONB 3M82A 5HCUA 2WV9A 3UMVA 4CM6A 1YIOA 1P77A 2YV5A 1EFCA 1T8WA 1WD7A 3KAJA 1M34E 2CYCA 1JX6A 2EHJA 2HMTA 4FK8A 2EFYA 4P2BA 4RIFA 1QIDA 5AMXA 3ITDA 4O3FA 3BEOA 5JVDA 1ZITA 3LKZA 1FMLA 4JL8A 1C2YA 4R8VA 4XIJA 2H48A 3Q7PA 1ZD2P 1U80A 2WD7B 4NHOA 3E53A 4LCBA 1T24A 3A9VA 3LC2O 4ZYYA 4LA4A 3J81k 3TG2A 4LYJA 2ZJ8A 1SC3A 2ZI7A 4QGSA 4DQXA 2QP4A 1SBTA 2X1VA 2OFOA 3M5CA 1Z0ZA 2BFBA 4PBRA 3RK1A 2X41A 5IAKA 1XU4A 2E4VA 4J0CA 4B3DA 4LOJA 3HA5A 1I33A 3GRVA 4PGMA 4EI7A 2E87A 2FI1A 5DT9A 1Y4AE 3RF6A 1J49A 4TRJA 3ZQJA 4UFOA 4ZCRA 5DSXA 5CT4A 1E8MA 1S8AA 1NMSA 2HWWA 1ZC4A 3KQTA 2GCOA 3PUYA 4DC0A 2H57A 1OXXK 2MSKA 1GKYA 2PBLA 2ZT7A 2X6TA 1IHXA 3DMPA 2FETA 4PLGA 4UM7A 4EHHA 5BUCA 1FX1A 1J0CA 4KUEA 4P81A 1HURA 4ND5A 1L5NA 4ZTUB 2GPTA 5KX5A 2QQ0A 2X2PA 1XTTA 3O4GA 3WISA 4ZYLA 2JKVA 3ZDCA 2VSOA 3QPVA 2Z8ZA 2F3RA 3BICA 2ZIEA 3DC2A 1MORA 1MB0A 4Q9AA 5ETJA 2H1FA 4QEKA 5GGXA 5KIAA 1X15A 3Q87B 2YHIA 1ZINA 3Q6NA 4DF3A 5E95A 5EMMA 2PWYA 3NB0A 3PBKA 1FJ2A 1QNFA 3E61A 3HEAA 1PWZA 2QTMA 2YBDA 4MYHA 4DCVA 1Q0SA 3U31A 1PUJA 3A31A 1YZGA 2JHCA 4JVOA 4CQMD 3SKVA 2C2MA 1F9AA 1XQXA 2YFHA 2ZYGA 3OM8A 3FKSD 3OFNA 2FMTA 3RARA 2O8FB 1FSGA 4Z9XA 4CU5A 3R74A 2F8LA 1PZFA 2QX7A 1QQ7A 3BCSA 4UM9D 3NBMA 2G4LA 1P31A 2Z5GA 5K0BA 3A6FA 2ZRBA 4OMFG 5EIAA 1UDBA 1UT6A 1XEWX 4D96A 3U4QA 1EE9A 1WCYA 3C1AA 2ARKA 1O1YA 5AJTA 2NQTA 4X64B 3QU2A 3SYKA 2ZUSA 3D9QX 3HY4A 1J0EA 1FFSA 2EATA 4NLLA 4OXYA 4ES6A 3FLMA 3PC6A 2JAXA 3O95A 3KR1A 5CXSA 1TZ2A 1XHFA 3JD2A 3BE6A 1Y9DA 2IZ0A 2YW2A 5JYDA 1AV6A 3OCYA 3GJ5A 1E61A 4NFHA 5IARA 3VH4A 5FL3A 5A6VA 2XADA 3WZ2A 1JE0A 1OTHA 3TM5A 4BZPA 2WUFA 1KI6A 5EMNA 2LCFA 3DEZA 2E7ZA 5CAEA 2HUPA 4RHFA 4YRIA 2GBPA 3M83A 4FHDA 1DS6A 4JZYA 4LJSA 3BK1A 3OZTA 3HA3A 4QG7A 3GA0A 5EKSA 3A11A 4RMGA 4BQQA 2C7OA 3U09A 5CDHA 5CG1A 1MVNA 3IHKA 1THMA 3MT9A 3GRFA 3DZ8A 4ZOCA 1YZHA 2VRCD 1Z12A 1VL1A 3F46A 5JAHA 5K2MA 1E18A 2BTQB 1T0IA 1Q7BA 1KY4A 2YIMA 1JJFA 1OSNA 4U7TB 2RSLA 1L7VC 1WR8A 4IIJA 1T13A 1TYEB 4ZU3A 4A8JC 3BL6A 1YS6A 2OCKA 3A6DA 2CLKB 3HYLA 3CJTA 5TT1A 3QLJA 4D80A 5MF6A 4II7A 4ZOBA 5DULA 2VAPA 1DDOA 2KW5A 1NY6A 2PX0A 3LOQA 2WAMA 5KSWB 2VATA 4JB0A 1CR6A 2W7TA 4RA9A 3X0DA 2C54A 5JRZA 1QFSA 2O05A 1ORVA 3AVVA 3SDBA 1QGUB 2PL1A 4ZVSA 1GFWA 4L1KA 2XWBF 4Q1BA 1KPGA 3CRW1 5I3CA 2H9IA 5DHAA 3T0FA 1D4AA 4RHCA 4AJ4A 1BDHA 4I81A 2ODQA 3ZDBA 2C1ZA 5L9AA 5T57A 3U1TA 2WWTA 3H2HA 2G3YA 4JCOA 4CKBB 2C8LA 3K1AA 1YU9A 1YDHA 3OSUA 1NX9A 2Q6TA 1XCMA 3NYWA 1GPAA 4M0PA 4RWZA 2HRDA 1QHHA 2B8NA 5CA0A 1RWVA 2V03A 3ESXA 3TKLA 1RJEA 3JRNA 5BSEA 2ZBFA 5ALZA 2PMBA 4AL4A 5KYGA 2FP4A 1JT9A 3TGPA 3GBSA 1A1VA 3I9V6 2DUMA 1ESMA 4WEQA 5HJ5A 3KL4A 2QL5A 4CL8A 3ONWA 4RCYA 1RWXA 3E6AA 5J23A 1E3LA 3HYNA 1T2NA 4H27A 1RACA 4ZJPA 3DXYA 3OVMA 1RLUA 4WLFA 5HVNA 3G1WA 4V38A 1ZICA 3IUQA 3OTWA 3PQ5A 2CVFA 1IXZA 4L5AA 2J0QA 3BDAA 1S4QA 3N0XA 2H8KA 3DE5X 5CXUA 1ZD5A 1NW7A 1VDZA 3KBOA 3T3DA 1FP4B 3L05A 2ZWOA 4GMXA 2QZJA 4WXEA 5KNDD 3S8YA 1OH6A 2PSFA 3ZLTA 1QGYA 3L84A 3NO4A 2Q2WA 2R6JA 3GHHA 2R6CA 4G5XA 5IDYA 4ZCSA 2A9FA 4PHGA 5FNZA 1J21A 2BAGA 2J45A 2ZITA 4WECA 3BIJA 3FIJA 3PQ7A 4ZZ3A 2ZRFA 1SXJC 1BYUA 4DV7B 1A76A 2QV0A 1BE1A 1PUIA 3EH1A 3KG2A 2FRVA 3MS7A 5CLQA 3BC1A 2GNPA 4OLHA 4ZARA 3NU1A 2AD5A 4W8HA 2KB0A 4S1VA 1UIMA 1DHTA 2I5PO 2NW6A 2CXQA 1F2DA 1F20A 1RM3A 4GI7A 4IOKA 2NU6A 3GCWA 1IMOA 1BS1A 1OIWA 1QMPA 1Q1GA 4V3BA 4GL2A 1PEDA 1W581 2WPDA 1VMIA 1S2NA 3G9QA 3P52A 4RY8A 3UJ7A 4RPHA 4FKZA 3O0TA 1UWCA 2QRMA 3MGKA 3R23A 3I39X 4JLBA 1DEKA 3Q85A 1SXJA 4NARA 4WOCA 4ZN6A 3R9XA 2PJRA 1G0NA 4BKUA 1NX6A 3HBNA 3JVEA 1FXWF 3K0CC 4FT2A 5F23A 4RHEA 5J4LA 1J0DA 3SC3A 1CFJA 3LCCA 3BE4A 1UFQA 3KQYA 4KXVA 4QYWA 2B21A 2PYZA 4RH0A 3MJRA 1JQ5A 5EWLA 2OM6A 1WKCA 4OJKA 4OQLA 3EBLA 4C30A 4EX6A 2HGZA 1WNTA 5TF0A 1DIGA 1P6QA 3ANYB 3T9EA 5B58T 3VX4A 4TOIA 4F6RA 5M04A 1U3CA 2NV2B 2RG7A 4UZFA 4OUDB 2IYPA 1Y1RA 1JHOA 4QO8A 2QQFA 3IUSA 3MWDA 4H18A 4MP3A 1JSCA 2OHVA 1N1DA 1FE8A 2EV9A 2WD9A 1B0UA 2YYAA 4YUWA 5LFAA 5D3ZA 2FRXA 2P7HA 1L7AA 3ANXA 5NLLA 1JDVA 1NXPA 5CDSA 3PPYA 3PX7A 3HHEA 4RIHA 3BTSA 2J48A 2OV8A 2ZCVA 2WU3A 3DFUA 3VO2A 1X80B 3ODGA 4PYIA 4FB5A 1DFHA 2AR9A 4ZP1A 2MSEB 4Z8YA 1I4OA 1IPHA 1TZBA 4NCKA 3OY7A 4MCHA 2Z6UA 1QTQA 1GNPA 1OBVA 4RK4A 4YB8A 2I1WA 3GAMA 4P86A 4XA8A 2BF4A 3I4LA 3V8EA 2PX3A 3A1SA 3BSWA 2LGJA 2IL1A 3BZWA 3EGXA 2IOHA 5A3JA 5E7QA 1H23A 1WETA 1VLVA 2QYHA 5I4KA 2JFUA 1PWEA 3DKIA 4CF3A 3Q5GA 4DMLA 4YVFA 3FUVA 4Y6RA 2GBLA 2BFFA 2CXOA 5BSUA 2FMKA 3PB3A 4QU8A 1QG6A 2BGLA 3FMGA 4WJLA 2F3UA 2JH3A 4P58A 1G42A 2YINC 4Q4HB 2IGBA 4XX0A 3WVNA 5B6PA 7MDHA 1PFUA 1H4SA 4TRMA 2BRUC 3UPTA 3U60B 1NPDA 3CH6A 3HVHA 4PIMA 4PLWA 4H1WA 1NDUA 1IBMB 2IY9A 3FI9A 1B23P 2W48A 4B3RB 1WDWB 3LT5A 1WO8A 3DULA 4FGJA 2VCHA 2FPIB 4HFMA 3ZHCA 1GTJ1 1E92A 5DOVA 1JSZA 4WMLA 5CITA 4YA6A 4RXTA 4KYVA 1PYDA 4DWOA 2WZQA 4M1YA 2NZVG 2WUDA 1IG3A 4ARZA 2B5VA 4JGIA 4X5OA 2J3IA 1H05A 4N18A 5AI0A 4D97A 5I8WA 4LC1A 3RYFA 1FPQA 1QIMA 3GEEA 4LMBA 5EIXA 3FHTA 4JB8A 1TDJA 1I3NA 1R66A 4R01A 2C5FA 4YJFA 1VIDA 4IGKA 1JE1A 5F33A 4XSGA 1FX0B 1GTSA 4MHSA 1Z2NX 2VTDA 2YN0A 3ABQB 3ZE8A 3OTGA 4C0KA 2XGJA 1BJRE 4G0QA 3K20A 4AD8A 1G6OA 3BAFA 3P1JA 3LUKA 3FCYA 2WLTA 1N5LA 3G2QA 3R24A 4H6XA 5C52B 4HN4B 5CBPA 3BF7A 3D3NA 4MVJE 1WMDA 1FF9A 3C4JA 1GKIA 3I9LA 1BKSB 1LZKA 1MO6A 1LBEA 1N0UA 4I08A 2PZEA 5GINE 1Q21A 5GONF 4CDRA 5KVSA 3ANMA 1PWHA 3JZDA 5DYYA 2R8PA 2YFYA 3I1JA 3K8YA 5KSYA 4EZIA 1L3BA 4LI0A 1XPUA 1E9CA 5IDQA 2X0NA 3GUCA 4JP1A 3AF6A 1GO2A 3ZJTA 3MWEA 3ZLUA 1GN8A 2E18A 4LHZA 2QTTA 3KPUA 2D7DA 4DLUA 3IHLA 4TYQA 5C8YA 1FUKA 2V54A 3OX2A 4Y30A 5CLFA 2QG9A 3DZCA 2YIDA 1NVEA 4N9WA 2P65A 3NJ4A 4L76A 3TPCA 5JFOA 4RTKA 3B82A 1FJGB 3DV2A 4R9RA 1Y6QA 2BFEB 2JG3A 1XEAA 4EJ2A 4N5HX 4E1BA 2ZUCA 4RENA 2DEUA 3NOXA 3WJ7A 1B6RA 1XDZA 5IFLA 4RGQA 4ZZIA 2I1VB 2J5RA 3ISVA 4BFUA 3HKCA 3FNQA 1JHDA 4KIJA 5JS2A 7GPBA 1A9SA 1C0EA 1T5TA 2O6HA 2GSDA 3FRJA 3H5OA 2OGSA 1E79A 3PITA 2C20A 4MVJI 4WBNF 2Q2OA 4ATNA 3QQPA 4O33A 2A30A 3JWHA 4GMFA 4PC7A 3VAZA 2EGHA 4DIBA 1K27A 4FYIA 3UUGA 4F60A 5J2TA 1GA6A 5JADA 5GOZA 1BTOA 1CLEA 2UXBB 1JQJC 2IS4A 2JGJA 3UJ9A 1Z34A 3B2EA 5IU6A 3DONA 5TXGA 1DNPA 2OAP1 5HCIA 4FGLA 5GZ6A 1F60A 3A1DA 1SOUA 3I2GA 4N7JA 5IDVA 3NKVA 2YJZA 2X7HA 4LAFA 1V2GA 4RV4A 4CYMA 4ABYA 4JBLA 4J29A 1WTCA 1M6HA 1I3LA 2RH4A 2ZGVA 3GFSA 3QVGB 3FGZA 3OE4A 4P34A 3G9XA 4L3VA 2G71A 5A5VA 3TI7A 3TZLA 3DNMA 3PEFA 1E2FA 2GYVA 2WUVA 4LV6A 2IH2A 4L2IB 2WF9A 4U6SA 1TZJA 2WY2D 5B4TA 2G7MC 3SNKA 2JFQA 4MHOA 3MTBA 5C8ZA 3UUEA 1AUXA 3F47A 2CBGA 2PKYX 4KIGA 5DNWA 1YFJA 3FWHA 2JHGA 4XFDA 2DZDA 3ONFA 2O2DA 2GQ0A 3SWWA 1WLYA 4K6HA 3UMSA 1XDGA 3WK5A 1ESNA 4CEHB 4YUZA 2C5GA 3HXQA 3KWJA 2O8VA 1Z83A 1DIBA 5E9AA 1L8AA 1LDYA 1DWOA 2WAAA 4V0NA 5IBPA 2A35A 4O4IA 1MVLA 2AEJA 3AF3A 2OBLA 4OHRA 3C6YA 3GRAA 5E6RA 4OP2A 4JFRA 5BQOA 1CRLA 5KSZA 2B7LA 2RDMA 1BG6A 1SHZA 4MUNA 1CIPA 2P3LA 5HM6A 4PS1A 1PT9A 3HS3A 4R1PA 3UEOA 1GJRA 3KETA 2C4KA 4G37A 4HGZA 2NU8B 5EJGA 1J42A 3BGIA 5FORA 4YAKA 1K75A 1KOGA 1JQDA 1RQ2A 2IHVA 1RLOA 2VF5X 3MNFA 1RW4A 5DMXA 4EHKA 4Z4HA 3BMNB 1GPBA 1XX6A 4LDNA 4LBYA 1IB6A 1LGYA 4ZYWA 2WAYA 4MUHA 2OO5A 3WTBA 3L1VA 2F9MA 1C7IA 2ALJA 1LVGA 2QU8A 3AGPA 4Q6BA 4NYJR 3WB9A 1JTFA 3TUJC 4EKNB 3TMKA 3FCSB 1ZWLA 5FF9A 4WPGA 2GM5A 3SQXA 5TMPA 2GMWA 1E6KA 2I3ZA 2LZ0A 4JYAB 4LZAA 3AERB 1QRSA 2MWMA 3GJYA 4DSNA 1PT7A 1Y6ZA 3GGJA 4REOA 3GVXA 5LB4A 3WDKA 5EKDA 1W8IA 1RZRD 4KQIA 3R8FA 1DPFA 3IT3A 3LUHA 3H5TA 4RAOA 4RHXA 2QGFA 1W1IA 2X4LA 2WHXA 3P4XA 4NMWA 4ZVPA 4YXFA 1TEXA 1RMYA 1T4CA 2VPWA 2HJSA 1T2EA 1NVTA 1JVNA 1QHHB 2H5EA 3Q8WA 1C81A 1J8FA 5AOVA 4MI9A 4BJ1A 4CMEC 4E5MA 3SHTA 1MTZA 3LRXA 4CLDA 1PR0A 1P2FA 2UU9B 2CK3D 2VHCA 4HCJA 4HLUC 1UBJS 3H8JA 3N0TA 7YASA 2ZVQX 3EIUA 5HBRA 2IK8A 3CG0A 3ETCA 2HPVA 2XKBA 3HXLA 1FYVA 1LRKA 3MSCA 1HT2E 4CZ2A 2PBFA 2X9LA 1R5OA 4TSFA 4XGIA 3SJAA 2IYAA 4BN5A 1WW3A 5FOVA 4DV5B 2AXPA 4P80A 2Q3HA 3L5KA 5A06A 3TIIA 2VHWA 1P81A 4OJTA 2DT5A 4L73A 2F3QA 1I0LA 4IF4A 3OFJA 4BWYA 2I78A 3THXA 1MAAA 1VBKA 1VLJA 3JSXA 4P22A 2J9FB 5K8LA 4BDTA 1PNTA 2YXBA 3ENQA 5JEDA 5AFSA 3GGCA 1XLTA 4UMEA 4WK2B 2QSUA 1OE0A 1TM3E 1Z74A 3K0BA 4G1MB 3RVSA 1QK4A 3HDYA 4HPJB 1QU2A 1TVKB 2DU8A 2Q21A 2C2BA 4XRRA 1ZOSA 3L7NA 1DUVG 2WBLC 5EXTA 5A62A 3ZE9A 3JCZA 5ILOA 3LC7O 1U28A 2ZE5A 3IA2A 1GDTA 2WB4A 3GLFB 4KGDA 4YI3A 1ORIA 3TEJA 4BFWA 4D26A 3Q10A 3P2IA 1S2IA 1KFBB 4NENA 3CEPB 1WP4A 1Z6YA 2C59A 2W6ID 1FSZA 4DMHA 4KOEC 2QR3A 4FNOA 2FPMA 4JWKA 4MKZA 1KDYA 4PRLA 1CWUA 3AR3A 2ZT8A 3D8SA 3A1UA 3H65A 5DEIA 5CAEB 3ZI7A 1KK2A 2WKPA 1KJIA 1KO4A 3DZJA 3PXUA 4EI8A 5KYXA 4D6YA 2R4TA 4GWGA 4IRUB 1IN4A 5AJHA 4TXHA 2CD9A 1ECLA 1A2BA 2K4MA 2ZBEA 3OQPA 2CHUA 2ISCA 4UCXA 2OQVA 3TZHA 1MO2A 1FLDA 2Y1WA 2CFSA 3H42B 5TQVA 3L6DA 1EXWA 3LJKA 1Q22A 5ENZA 1ZW6A 5DBIA 4EH1A 1WOMA 4H6VA 4LWZA 1M7HA 2A7QA 3NDJA 5T3YA 2V0NA 4BP1A 3LA8A 4EW1A 1FFGA 4TVSA 1K8YB 1CQIB 1M6VA 4OV6B 3D0OA 2D0IA 4FMDB 1E9RA 3F6PA 3HB5X 1PT5A 3DDWA 2ZRNA 2DBRA 3KQQA 2W2MA 3N86A 1PD0A 3ZVRA 2IU6A 1HI9A 1V37A 3H99A 4MGIR 5HMLA 1KDVA 3TW4A 3DHEA 5JV5A 3MRXA 5JR3A 1XMSA 3H84A 4X8HA 3VR2A 3A26A 1HKUA 4BO4A 3QVLA 3PEVA 4MQEB 2OHHA 2ZYDA 3EZYA 2X1LA 2Q2NA 2ZRCA 1NMXA 5AM4A 3A6HA 3AI2A 4BYGA 5FJIA 1JQ3A 5LJIA 5FV7A 3O2JA 4PCVA 5EZSA 5F73A 4BBZA 1PVOA 1UL1X 3GG2A 1V9CA 2W6NA 3A05A 5FWYB 4NV1A 3D5EA 5U4QA 5BUSA 3R3JA 3EYAA 5EUBA 1AZWA 3HG7A 5DHPA 1ULBA 4YUAA 2L69A 1PW5A 3LVRE 4PW0A 4YCSA 1UWLA 3CH7A 4RS3A 1RJWA 3B7GA 5JSQA 2BHTA 4C4XA 4O59O 4YRKA 1HDIA 5IMSA 1NF9A 3AVPA 2BV3A 2FQWA 3KHUA 4C2AA 3KQUA 2DWQA 1VKJA 2Y93A 2C7VA 1A98A 2L42A 3SMVA 4N3GA 4DIOA 1QBKC 4C29A 5AVVA 1XAHA 2H63A 4LCJA 2Y0BA 3FR7A 1P1FA 4FGKA 3D6MA 1F7UA 1E94E 1HETA 3OD5A 1C0IA 3A1FA 2FVYA 1U2SA 2PV7A 5EUMA 3KLOA 3B60A 2MDTA 2AX4A 3A2LA 1QDUA 2WKSA 3LYHA 2VTEA 4WJKB 3P2MA 3KP1A 3AUAA 3CFYA 3DE0X 2HSZA 2WM2A 3MJTA 1RRPA 2XUFA 1QFJA 4JKIA 1KS9A 3NXSA 1FUYB 3SEAA 2MYTA 4G26A 1YOVB 3WAGA 3K0FB 4H16A 4UUQA 2Z98A 1DO2A 4P84A 1ZVJA 4UJ3A 3ZJ5A 4CKCB 1EFHA 3IVXA 3OO0A 3LBNA 5EVCA 4F91B 2Z1NA 4FUQA 3DBHA 2HWKA 4CM5A 1ZAKA 4X1KB 2BGIA 3IJ5A 2HXYA 4IINA 1K8QA 2XNJA 5TSDA 3F3KA 4TKVA 2V6FA 2Z4SA 2EKQA 4ITRC 4YPFA 4ARUA 3B20A 4UNIA 1NSYA 5KYKA 3U7GA 1VMAA 1J7JA 2ACKA 1IOZA 2CKMA 2OQIA 3JD1A 4QQRA 1YGPA 2PGXA 4I19A 3T7CA 4R1OA 5CXQA 1DB3A 4M1QA 4MO2A 1Y1KE 4BRUA 3X1XA 4XSVA 3TNLA 4EB6A 5TB5A 1SU6A 2Y68A 1ZLXA 4C2TA 3OWOA 3WQSB 4CGZA 3AVUA 1RE1A 4O4JF 3EK2A 1T9KA 4JMPA 3KSBC 2RHLA 3CX3A 5KZMB 2YJ6A 2D1TA 1N2GA 1SPBS 3ABOB 3V8NA 5K0CA 4DMUB 2VYCA 3AVXA 1NR1A 2P9BA 1ZS9A 2W11A 3R6WA 3FXAA 4HLQB 4RK1A 4IOJA 5CYPA 2QTNA 2NGRA 2YOGA 3KPWA 3OZXA 1LLFA 3B3AA 3ZLVA 3R6LA 1WXDA 2BMDA 3EF0A 3WLJA 2ZJ6A 4A10A 3E7XA 3EA4A 4QPPA 3VGJA 4BLQA 3H9JA 3TRHA 1NXOA 3I32A 1KE1A 1JAYA 1F8GA 1SCKA 1V1RA 3GZJA 2V74B 3E9MA 1KAGA 1N9KA 3I9KA 2ZIFA 2GZ3A 4G1FA 3CEMA 1QHIA 1PJLA 1US8B 3DMHA 4L85A 1NW5A 5EGSA 3UUWA 2AFHA 1GPNA 2F3SA 4OQFA 5IXSA 2XDQB 1HT3A 3BWEA 3GB9A 5LQCA 2BEVA 5E3IA 1OJ7A 1RYDA 1Z45A 3ENVA 4NCAA 2H18A 3DD5A 4R9SA 5J2TB 1JDJA 2AEEA 2VPQA 4X24A 1FNCA 3WLEA 4QDUA 3SBEA 1ZR4A 1U7UA 1GUFA 4DSTA 3FPCA 2XF2A 2CMDA 1B2LA 1FVXA 4X8OA 2V6BA 3ZY2A 4EZEA 1GL9B 3WWOA 1PHRA 3FB1A 4CV2A 1B3RA 1E2KA 1ZH0A 1OGJA 1YHYA 1MPXA 1V48A 1T9HA 3PIIA 1Z4LA 3DW1X 4IF6A 4XX0B 5F3WB 2QRLA 4RDCA 1L7EA 2OFWA 4ZGGA 3SHVA 4HVCA 4ZYTA 5FJJA 1CF2O 2WJZB 3H11B 2YVLA 4PNPA 1BDBA 5BWCA 1P4HA 3HUDA 4Q7EA 1CUEA 2IYUA 3G8YA 4EY3A 3BXHA 2WSIA 2DC1A 3VZCA 1QRRA 4RBNA 1FRFS 1E64A 2Z8YA 3B38A 4QXOA 4WEOA 4A5OA 5BN3A 2PWBA 1B93A 1H42A 4FIDA 4AMYA 5G4LA 4TGLA 3DMYA 1QIGA 3RRJA 1XU9A 1JIIA 2FB9A 1OAOA 4BIIA 1VTKA 4U7JA 2QSZA 2IT1A 1ES9A 3AG5A 1E6EA 1TEHA 3VRHA 5LYJF 2QAGC 3DQPA 2WWYA 2KE5A 3W2IA 4C7MA 4ETIA 3BH0A 4J6EA 4N3AA 1HQDA 4BNDB 1ECGA 4OLBA 2VOJA 2V7QD 1TT5A 2BE9A 4O2BA 2RKBA 4CUJA 3HYSA 2J9FA 5FH9A 1QQTA 4UQPA 1BZYA 1UQTA 1Q15A 4I1YA 1P5RA 2QTRA 3Q7EA 2Q7XA 3V7FA 2BC9A 4MI3A 5JD6A 1P1CA 1TLTA 3FFAA 2PWPA 1M2VB 3TLGA 2OO5C 1A0OA 2ECQA 4UULA 1F3OA 1T6XA 2G04A 3CMCO 3ICVA 4IV5A 3LY5A 2O20A 3V3KA 1EQUA 4RPGA 1NC1A 3EXEB 3MTDA 1UWVA 3NIWA 1XF1A 5I7FA 1FUUA 5ADHA 1LRJA 2D5IA 4AG3A 4PG7A 1I7LA 3EPHA 4TUYA 1EDOA 1WXIA 3HJTA 1DRVA 3LVBA 3QXCA 5TARA 4FYJA 1JBQA 4UUAA 4IDNA 3WAKA 1GHTA 4MMZB 2L2QA 3W5BA 2R00C 5BWMA 2C78A 2COKA 4WKOA 5CLGA 4TYPA 4DM3A 4PAQA 2BFEA 1TQ8A 2A4KA 1SH7A 3ETEA 3FBGA 1POWA 4YNBA 3HC7A 1T26A 2AXNA 2OT3B 2QM7A 2TRSB 2WABA 3V4LA 4CLEA 1ADYA 4GFDA 4MHTA 2C4MA 5E1OA 2APJA 4K9OA 4RESA 1OWNA 1GFZA 2QW1A 1I8TA 1GCOA 1N2HA 1XQ6A 2OENG 3CKMA 3LWDA 4PGGA 1HL3A 4U2DA 3O75A 5E4JA 1BGVA 1YZFA 4JASB 5TGTA 2CB0A 3ZUGA 3ASYA 5HF8A 5HGJA 2JLAA 1J20A 1JLLB 4BFXA 3DOOA 2NADA 4F3NA 1VJDA 1SCUB 3KYDA 2H5JA 3J80A 1QXSA 3RGGA 1OKKD 4RKWA 4F9TA 3H1FA 2ATVA 1UT5A 2VZEA 3P94A 4G8CA 1Z88A 5EE1A 3VU0A 3RREA 1SQ6A 4MKGA 1YBHA 4INZA 2NNWB 3FUWA 3OQIA 2XDWA 4PY2A 1IG0A 3BPSA 4BMVA 1BQ3A 1ISSA 4WCFB 5EN4A 1JZSA 4B40A 4Q4LA 5JWHA 3UHJA 3O4RA 1KEPA 4QU9A 2JFHA 3WL4A 5FYDA 2FZ5A 4MYCA 1Z5VA 1N8KA 5COQA 3QOWA 1RHKA 3QY0A 2ZIWB 1T1EA 3K05A 3F4KA 1U5CA 5FWNA 3DLIA 3ID6C 3IXMA 4GVPA 1E8DA 1L5LA 5BRNA 1CDEA 1DL5A 2H16A 2I03A 2XXBA 3DJFA 4D4GA 3ENZA 2N0SA 1PJ2A 3X2SA 4B35A 1F2UB 2H54A 1K2VN 2YUTA 4ABTA 3QX8A 1S89A 5FKJA 3INRA 2Z3VA 4DR7B 3L07A 1EK0A 1U8YA 1Z2EA 4QO7A 4RF3A 4YJ2A 3ADCA 3R7FA 1ECJA 2QD5A 3UENA 2H4YA 1TCUA 4RKQA 2G9ZA 1M33A 1BH6A 4MV3A 4HQRA 4UAVA 3P2EA 3WB2A 1N6LA 1T3SA 2DXIA 4Z86A 1XXHA 2XQVA 1Y4UA 1Z5PA 2RGGA 2XJ4A 4MR8A 1P75A 1I32A 4P54A 1H5UA 2IXTA 3AVQA 3B36A 4GDMA 2BF7A 2WIDA 3QOYA 4EA9A 1WSBA 1UBCA 3W9SA 4YV7A 3LBIA 1W36B 1WZ2A 2XA2A 4QDZA 3AV3A 4Z4EA 1FRNA 3AF1A 3NGMA 3CJRA 1S3SA 2IOFK 4L0DA 4GKKB 3NC1C 1KZ9A 5CFPA 5JANA 1ODTC 3RS7A 4WXPA 5EWMA 2BGKA 4G67A 2E1PA 5EMHA 1WB4A 3V42A 1QP0A 2FU5C 1ST2A 3EAFA 4UBLA 2IYWA 4L50A 5IC5A 4G4IA 1D2EA 4KP7A 1TEZA 2FK7A 1EG7A 2O57A 3G5AA 2YMPA 1SB8A 4MIKA 4KVGA 1UJ6A 3NP7A 1I4DD 4A2QA 1X7WB 1TECE 3IBCA 1FOEB 3SC6A 2PRJA 4F2PA 2JIOA 3LD9A 4UDNA 1QIKA 4ZVKA 2HFKA 2PANA 3ASVA 3NHBA 3UYLA 5FA8A 2OLEA 3EZLA 3D4OA 1CU1A 4Y2VA 5BSTA 4BVFA 5FX2A 3NCHA 3HGMA 2EP5A 1D2CA 4DBLE 1NW8A 4ZYZA 2QT1A 3O7MA 1F9EA 3UK7A 1Z6PA 4OFZA 3RVKA 3W78A 3UOWA 1RPJA 2DSNA 1OWMA 1EK2A 1UK7A 2VUUA 3CUVA 2W2NA 4REMA 3AWIA 1UJCA 4NATA 4YAWA 3A6GA 2AWOA 4LOAA 5K3SA 3Q2KA 1M8FA 4R8SA 4YECA 3OUUA 2CLEB 1R3UA 1CULC 3E2IA 3QVSA 1R0KA 4L8GA 2OBBA 2GO1A 3RTCA 4HOYA 1H85A 2IFTA 3CUKA 4LE1A 1VIVA 2FVXA 1DKUA 3E9NA 3GEHA 5GP1A 3W6ZA 2FDCA 2F48A 1YA6A 3E8SA 3KKQA 5EE9A 3RYHA 3VU9A 1AB5A 5FAKA 4JODA 3OMLA 4DV6B 3NANA 1DVRA 3V48A 2R8OA 5AP9A 3VZBA 1K8RA 5HG0A 2A8YA 1DG3A 2KHZA 4ZT2A 5AKZA 3ZDXB 1NM5A 3G6KA 1II0A 2HA3A 3T1OA 2PFSA 3OQHA 4K2AA 1IWOA 2GO7A 4I4IA 5JG7A 1YCHA 5BW5A 3EEQA 3I8OA 5CUQA 4Q3LA 3TN7A 2XUDA 1OW3B 4X85A 4QODA 1VMKA 1E2JA 4AROA 4CDGA 3CO0S 2HCTA 4EFKA 2UYOA 2FWPA 2XTNA 3IMCA 3U7JA 5KCMA 1KE2A 1JAHA 5FI1B 4D57A 3DQQA 1JFTA 1VE6A 1OWPA 3U7IA 1IZ0A 3FDIA 4HEA1 4AULA 1V6AA 5DRTA 1P9NA 3GYBA 1EVIA 1ZM9A 2RHJA 3ICOA 3KS9A 1TVKA 2YC2C 4EGSA 1JNYA 2B94A 3TZEA 4BASA 3JZAA 4ZFNA 4UNSA 4HAYA 2GN8A 1FFXA 2C9DA 4DLSA 1RXCA 3FWYA 1R1DA 2VHJA 3LX5A 3RS5A 3TLXA 2OR3A 5F9MA 4O29A 1BHQ1 1BN6A 2FV8A 1TW2A 3GEDA 3TWOA 2PG3A 1Z0IA 4C7KA 5JZVA 3BWMA 3DYIA 4KI7A 3WE7A 3AM1A 4AS1A 1ZNYA 2A33A 2C9CA 2SKEA 4M2LA 3SICE 5JH7F 3EA0A 3ADDA 3AOEC 1PYGA 2YWEA 2FW9A 3CSUA 2AOTA 3D3EA 4OH7A 4YJGA 3VUFA 2NSYA 3SZMA 4PGAA 4HRVA 4ZXPA 2ORIA 2NVOA 3AI3A 5BSRA 3EDQA 1BHSA 1PKXA 5F78A 2VTBB 4GMGA 2CLFB 2DR0A 2PTGA 3TMAA 2B4KA 3VKWA 3WHLA 4PC1A 1P0QA 3N0RA 1WUKS 5HJ2A 1RRCA 1EMDA 1R16A 3BWDD 4A0QA 1XVVA 3ZDFA 4D99A 1QPZA 2I4LA 2F43A 3B48A 2QN6A 3M6IA 4HAZA 3EUAA 3IURA 4IAOA 1GXSA 4LHEA 2IX3A 2UKDA 5HCNA 4EUKA 1MO3A 5A4KA 3ZIAD 4CKWB 1VYTA 1SAYA 2W00A 2BWJA 3W1VA 4ZPJA 2DQSA 2XRMA 3MPUA 4B3FX 4INAA 1RAGA 3KL2A 3NHFA 4FR2A 3NASA 1XJCA 3C7KA 3K7EA 3D2CA 2YL2A 4W1QA 1W5BA 3I76A 1P1JA 3UJPA 1OX6A 4U4AA 1DG9A 1CVLA 1ORHA 1JGTA 1PQPA 5TEVA 4EGQA 1VRCA 2VS1A 4TMVA 4YN3A 4F7WA 1X7YB 2BE7A 4TXLA 1VSVA 1JLSA 3IXQA 3W7AA 2I3BA 5FBKA 3SPXA 1ZVQA 4A9AA 5EPEA 1LI7A 3FRHA 4LQ4A 2CE2X 2VRBA 3Q2OA 5AI5A 2QS9A 4EHIA 4ZCTA 1GAXA 1ITZA 1AO3A 1G9TA 1H0HA 2FW8A 1TB4A 3LX4A 2X6RA 3CTMA 2C3PA 3W5CA 4FI3C 3BFKA 4R8RA 4YT5A 5IULC 3K2IA 3T1VA 3B5EA 1R4MB 3BSYA 5HFAA 3RQSA 1GG8A 2FF5A 2ODNA 4BWGA 2FZEA 3BHNA 1P2UA 3PXDA 3O9ZA 4M0UA 1EFKA 1MJNA 1RAIA 3KVVA 4DWJA 3HVIA 5K3FA 1QE0A 1EEXB 4Q48A 1E98A 3H87A 3L41A 3BT7A 2D5BA 2X0IA 3DHNA 4KIWA 4MIEA 5ECYA 2C5AA 5A4JA 2J6HA 5SZHB 2XYGA 1HYEA 2CUZA 1Y7HA 4US1R 2PBZA 5MN5A 4EJFA 2CJWA 2VSQA 1J5XA 4GRDA 4LVUA 3PDWA 4RIEA 4A36A 2Z2YA 4MUKA 1I3MA 4I1VA 5AUQA 4C88A 2HBQA 4OGFA 2OZKA 1WBDA 4IEEA 1M0WA 3R7LA 1AQNA 3SKYA 3EDYA 1Q84A 5CCDA 4C87A 2XPCA 1NHGA 1F51E 2BR4A 2YYYA 4B33A 5KNDA 3FPLA 3DBHB 2BD0A 4S1PA 4Y2HA 3K70C 1XAJA 3MWEB 2O8BA 5EWMB 1U7HA 2F1RA 2V9PA 3LUCA 3M7IA 3MVEA 4HMPA 4HEA6 4K6FA 4C5BA 3C5CA 1CEEA 5DMHA 2JJ1D 5IMBA 2SNIE 2AF3C 4B0PA 4D9KA 1KTIA 3H3XA 1YRYE 2FEKA 2EYQA 1P19A 2YV3A 3EXIB 4LJ6A 1OPRA 5B12A 1TLLA 1W30A 3OKFA 3WNDA 5D3MA 3SJ7A 4OBEA 1N5JA 3C3JA 3JWEA 3D7NA 3EVZA 4KPYA 2Y9PB 5DCUA 4FE4A 3F7TA 4ACBA 1C30A 1KHTA 4Q4JB 4X3OA 4X6XA 3FYDA 4ALKA 1TMGE 4MB0A 5C35A 5FOQA 3QVOA 1F3LA 2W6OA 4F84A 4DGQA 5CFRA 2GD0A 1Q95A 3RRFA 2M32A 4R1NA 4J9UE 1EK1A 4WTOA 4E2FA 5IJ0B 4RD1A 3U5TA 1Z36A 2GR9A 1AKEA 4HB4A 4NPAA 2AJ8A 4F11A 5KJ6A 3WYGA 3RV4A 3HCRA 2GCGA 2J1LA 2PZBA 2JI7A 2ZI6A 4RORA 4NRDA 5C81A 4X93A 4EL5A 2HSWA 1RT9A 2ORVA 1JIXA 2WA1A 3C41J 1U9IA 1ZJJA 1QR6A 4MA5A 3RB8A 1NQTA 2QT9A 4IIYA 4M4SA 1N5RA 4WNAB 4BN4A 5I9LA 2NPOA 2NUTB 5BUQA 2R5NA 5CYGA 5FLXA 3RHTA 2V4MA 4RCVA 4C0AC 1M2HA 1U7TA 1QGZA 2AJCA 1N4DA 2FSGA 2DKFA 3IT2A 5LNK1 1DRWA 4DV0B 4Q47A 2GRAA 2L0XA 1QCCA 3QWBA 4LW8A 3TBKA 3U44A 1CHNA 1T4DA 2IUUA 1XAIA 5TS3A 2IIQA 1S8NA 2VJLA 4XIFA 4EATA 1K8XB 1D1SA 2PZAA 8ABPA 1JKJA 1TUIA 3OHPA 2C99A 4I50F 2GEJA 2XAUA 4OXXA 4R2XA 3G2IA 3IOYA 3GLTA 4JJAA 5EC8A 2Q45A 3S5UA 4ZI2A 2QJRA 3M6UA 3WLPA 4KPEC 2C4HA 4P4SB 2DQZA 4I99A 1L4UA 4NF2A 1FP7A 2NVUB 1E3EA 1N6HA 4U2GA 4E4RA 3O7WA 5EOVA 1U90A 5CIYA 1L5QA 3IO3A 1NVKA 2A94A 3KQMA 4NE7A 2WF8A 3IPAA 4XTRA 5F4BA 3BERA 2GD1O 4YXWA 3JQRA 2WUWE 3HKEA 1U2QA 4KQXA 3HDTA 3KR0A 3M1LA 3I2KA 6ABPA 3DFIA 5C1DA 3KQLA 3IAEA 1E63A 4M54A 4Z7JA 5J1TB 2RHHA 1Z08A 4GOJA 1GEGA 1F0NA 1MR3F 2GM9A 1ZK2A 5CM2Z 3NEPX 1LH0A 3I53A 5T4EA 1ZK4A 2Y66A 4KFTA 5A6SB 1B16A 1DXYA 3IUMA 3B1KA 3BQ9A 1Z26A 1FY2A 3RRNA 3OAAA 2K7FA 3Q88A 1OI3A 1UT8A 3PSHA 3BF8A 3UUFA 1M34B 4C3VA 1MH9A 5AVZA 1T0UA 4S2UA 3KWLA 5JIBA 3FNGA 1RYZA 2RGXA 4JJ6A 5HYVA 3VVCA 1T9ZA 3U1BA 3HN6A 3SFTA 2XZLA 2JLWA 5T3UA 3LUAA 3I0ZA 3VR5D 2WI8A 1UKBA 4HDAA 4D3ZA 1KI1A 1ECFA 2Q3EA 1C1HA 1SFRA 2C0PA 3FOCA 5I5GA 4CN8A 5HXAA 4YYZA 1TYZA 5FTWA 5K8UA 3ICQB 4HHEA 1GLNA 3MCZA 4UHJA 5C4GB 5FHRA 2GLXA 1N8TA 2QRUA 4UTNA 1GGFA 1E6MA 3P4UA 2WUEA 4AO6A 2RI0A 2EP8A 1LUAA 2J87A 4KTTE 2WWHA 2PUVA 1CY1A 5E7MA 3DAOA 5CT5A 5TQ2B 3O2NA 4MGEA 1N8SA 3H9CA 3K2QA 5BV1A 4DAEA 3TECE 3PNBA 1BGXT 1QMGA 1ZH6A 2FXIA 4QDOA 3MOGA 5E1BA 1V71A 3B3QA 4I4NA 2ACWA 3G82C 4CQLA 3G2LA 2OBFA 1CJCA 4L5JA 3OLVA 1GQRA 3WP1B 2ZZMA 1IDN1 4X7PA 4M60A 3RS0A 1BA2A 3QUBA 1O6BA 1MQAA 1T9BA 3BGOS 3IS3A 1T3HA 5FWAA 2F1JA 3W8DA 5C80A 3BWCA 3WGHA 1U04A 5FI3A 3SYLA 2CLSA 1JKJB 2AD1A 3A04A 3DSRA 4KW7A 4KPUA 1QAOA 4C7VA 4WNCA 3Q7TA 4CMHA 3W3AD 4ROTA 4D8YA 1KEUA 2R96A 3OPQA 5AVUA 1CR2A 5JPIA 2H11A 2AMJA 1QLJA 1SUDA 2IEBA 2YTZA 4FGUA 3EVGA 4KWCA 5DX8A 1KL7A 2NVUA 4CM8B 3FVVA 4Z53A 3VZSA 5A9RA 4C7JA 3EGDB 3KEQA 2DWCA 2VTKA 4ZOAA 2RCNA 3EZXA 3IP8A 4OO3A 5G2OA 2EF0A 3RRBA 1PN3A 2Q3MA 4GKVA 3KZNA 2CHVA 3EASA 3O5AA 4DA0A 2QL9A 2P5SA 4OQPA 4LOKA 1A5ZA 1I80A 3QBEA 4EDHA 3EPKA 2VUHB 1PAUA 4BQFA 2C98A 2CNNA 2ECKA 4KH0A 3T7EA 3CWQA 1WRBA 3K1TA 3E05A 4BXOA 4J75A 3MPOA 4ZCMA 2Q1SA 3JTEA 3FCEA 5I01A 1X38A 1SKQA 4B4OA 3E22A 3B1FA 4J7CA 3JYPA 3ZCUA 4B76A 4LSZA 3KELA 4O5OA 1N6IA 3KDAA 1V45E 5LYJA 1XO1A 3EMKA 3LU1A 4M9ZA 4C0JA 4U7GA 2O8EB 2W43A 3UGJA 1QK5A 3CW9A 5KAPA 2IPAB 3AOEA 4IDPA 4ZI7A 4AP6A 2ATCA 4V39A 4QXMA 4NECA 2K2WA 2AH5A 1M8GA 1BU8A 1CRQA 1GIAA 2QNBA 3D2AA 3D3WB 3HY3A 4L75A 4DL9A 1B74A 1Q3KA 2EKBA 1KK0A 3L6BA 3UB2A 1YMVA 3FYUA 4MCJA 3F5DA 3ZY3A 2WJWA 5ERGB 4DIFA 4DLWA 3BD9A 1GTRA 1NLUA 1CUJA 5KNBH 3T3OA 2DPLA 2CJWB 1F8YA 5BQ5A 3BS4A 1TCCA 3F4BA 3WKCA 1JDSA 1MG5A 1WJGA 4PO8A 1F2UA 1AF7A 2GF9A 3QW2A 4Q16A 4UM8B 2GN4A 2YXEA 5DK6A 3VI4B 1JAXA 2GSWA 2R8YA 2VXYA 3OJ0A 3A37A 5BW4A 1BEZA 1KYVA 3SLGA 2WQZA 4ON9A 4ZJZA 5TMDA 1ZHOA 1RR6A 1ISPA 3HJBA 4AZWA 1A8QA 2RG1A 4HGOA 1GCIA 1ZCBA 4BZQA 4MYSA 1Z4NA 1XGKA 2VF4X 2GVNA 4MKIA 3SJBA 3FYUC 1J8DA 3Q3GE 2OPHA 3ZU3A 5LD2B 3SQWA 1B8PA 4FP9A 2HWUA 4JJZA 1ZJWA 3L4JA 3PHHA 1ICIA 3VR0A 3VVBA 1DAOA 4E5SA 1PJBA 1NBOA 1G8GA 4ZICA 1JI0A 5DLPA 2R1UA 2ZJBA 4KQ9A 3KWFA 4IW3B 4JLJA 4RQTA 3DKPA 3C43A 3ZOZA 1X1CA 1R27A 1KOFA 2WYOA 4HNVA 3C3BA 1GARA 1J5EB 3EEIA 1F06A 4GSLA 1K86A 4O4LB 3VUEA 1T2FA 2G4VA 5G0TA 1IXSB 4IGFA 2Q9CA 2Q4DA 1UBOS 1NQOA 4KQFA 1NV9A 4MWEA 1BX0A 1D1PA 3C8ZA 3MJHA 3QX7A 4BRWA 2ZJ7A 1PNVA 3SMQA 5H9VA 5K0FA 2XOKD 5CB8A 1C4XA 1KC1A 5I7OA 1TTTA 2AMYA 4AYTA 4YAGA 3EBOA 4E6EA 3KBBA 3W2GA 1P9LA 2YQZA 4MUGA 3IV6A 3GZ4A 3NTXA 4N39A 3QU7A