1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
b'VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
3SG0A 3LUDA 1KRXA 3Q7SA 4HNQA 1ZH4A 3H1GA 1NXOA 2P9HA 4RK0A 3G85A 1ZN2A 2HQBA 3LUAA 1Z15A 3M6MD 4N03A 1EAYA 4EYKA 1QKKA 1M5UA 3EDCA 4TN5A 1FFGA 2WY2D 4YRZA 4RXMA 4MS3B 2WWVD 2RGYA 3ILHA 2FSPA 2L17A 4RXUA 1PEYA 2AYXA 4LZLA 1DBWA 5GOTA 3ROFA 1KRWA 3FFXA 3MMNA 1C0EA 3EGCA 2OQRA 5IBQA 4F8JA 2FEWB 3JTEA 4N47A 3A3KA 4D6XA 2MSKA 3KG2A 4N41A 7ABPA 5IC5A 1ABFA 2RJNA 3O1JC 2GWRA 4XLTA 1LBIA 1NXWA 5KI6A 3LTEA 5FBHA 2V0NA 1LK0A 1D2AA 4QYMA 3MM4A 3IP5A 2E4YA 4TLMB 4JB0A 2H3HA 5CHYA 2PUGA 2HQOA 3FDFA 4RY8A 1QP0A 2FW0A 1ISSA 1NXSA 3JVDA 5BRAA 3D8UA 8ABPA 4NQRA 4EYOA 2ZAYA 2HSGA 3RVMA 2CD7A 4Z9AA 5CNIA 1OXKB 5ED4A 4W5OA 3SM9A 4HNSA 1QPZA 1Z2EA 2A9RA 2VK2A 3JPYA 5DTEA 4O5AA 3CU5A 1LJUA 4E7OA 3QEMB 5IUKC 3G1WA 1Z16A 4MR9B 3GBPA 3S99A 2LUOA 4E7PA 1JDPA 1JFVA 1YMVA 3SNKA 4MS1B 2PE5A 4LRQA 4B09A 5IX8A 1ISRA 2E4UA 1QNLA 4O1IA 5FWYB 3GRCA 1U2PA 2M1ZA 2QW1A 3H5LA 4OATA 2PLNA 2PUBA 5KQLA 3A10A 1P6UA 4L4UA 1JL3A 2FMKA 2LIVA 4MRMB 4D74A 4TMYA 4ZMRA 1DCFA 1SXHA 1E6KA 1Z17A 2VUIB 4OG2A 4DQDA 3HCWA 1JF8A 1R8JA 1D4ZA 4F06A 4DADA 4KQCA 2JVIA 3H6GA 1GLGA 1DZ3A 3T38A 2RDMA 2RJOA 3M9XA 4DN6A 4JAVC 4RK5A 4UHKA 2PKXA 2N9UA 2R47A 3EQZA 1QQBA 1JLKA 3OO1A 5JS2A 1RZRA 4MS3A 1APBA 2ID9A 1P2FA 3JVIA 1ZGZA 4G0MA 4JP1A 1FFWA 4XAQA 2PUAA 4EVSA 3H5IA 3Q41A 2FQXA 2B4AA 3BRSA 3E61A 3I5AA 4XARA 5EWJB 3CHYA 4GNRA 3P9YA 3F6PA 2PAFA 2A9QA 3HV2A 4YP9A 4KFCA 3A0UA 3L6UA 4H60A 3BBLA 3KYJB 2PJUA 1GCGA 2IYNA 4O1HA 4Q7EA 4WXMA 3MA0A 5KQPA 1ZHHA 3F7NA 5HM6A 4ETMA 3OLWA 1DRKA 2WMYA 3EULA 2H0AA 4KK4A 4N0PA 4FE7A 1ABEA 2NZUG 2IDMA 4EVRA 4IGAA 5T3YA 3OLYA 1EWTA 3O74A 5JNTA 5IUJC 3F6CA 1RZRD 4LE2A 3OM1A 3VNBA 1FSPA 1USKA 2JCGA 2QU7A 3N8IA 3CNBA 3TMYA 5KQGA 5DKFA 3HM9A 1VKRA 2FLKA 3DZDA 1BDHA 2MYTA 4PICA 1U04A 3LKVA 3IDOA 4IF4A 1EWVA 3H5WA 1EWKA 4JASB 1PUXA 2E4VA 4JA2A 4G0YA 3O2SB 4Z99A 3OLVA 1K68A 2JVJA 4OBBA 4NCAA 5ABPA 4F12A 5JS1A 2WRZA 2IPMA 3QEMA 4EGSA 1QP4A 4Q6WA 4MR9A 1Z25A 5GQSA 3CKMA 3KSMA 4MS1A 3N53A 3RVPA 2FEKA 5JNSA 2LPMA 1NXTA 1B00A 2FKAA 4YWHA 5FWYA 2GBPA 3Q7RA 2FEPA 5BRJA 4RKRA 5IEJA 2VYCA 3QLUA 4S05A 4MYRA 1A2OA 1M2EA 2GI4A 3D02A 3HXMA 3VNAA 4Z4EA 3HJFA 1NTRA 1AB6A 1MAVA 2L18A 5TQJA 1JFTA 4MRMA 3QEKA 1KGSA 4N0QA 2KYRA 2JRLA 3O2JA 4WT7A 3HO1A 3NNDA 3OO0A 3SAJA 3URMA 3SQNA 2MSLA 4F11A 1CHNA 4L85A 3LUKA 4G0OA 3H5OA 3NBMA 4PE5B 4G0PA 3LUGA 4PZ0A 1E6LA 3LUJA 1MVOA 2NT4A 3GBVA 3HUUA 4H3KB 1P6QA 2JB9A 4RK7A 4WWHA 1YIOA 1RNLA 2WB4A 3CG0A 4FB4A 3O1HB 2FLWA 2FN9A 1DBQA 4JB2A 1XHEA 3GV0A 3QLUC 3T95A 9ABPA 5EWJA 3EQ2A 1ZY2A 3OQNA 2MSWA 5EWLB 2QSJA 2PL9A 4YR7A 5I4CA 4W5NA 1D1QA 3MYYA 1ZAYA 1F4VA 1XWWA 3LKBA 3Q15C 5DCLA 4RK4A 4RU1A 3MIZA 4ETNA 5JNVA 3HK2A 2L2QA 2FMIA 1JWLA 4Y9TA 4G97A 3ROTA 1JBEA 2X7XA 3IP9A 3Q9SA 5KC9A 4MLCA 5E3JA 3KKEA 4NCBA 4YO7A 1NXVA 4EYGA 4ZJPA 3ILYA 1J56A 3LOPA 2OENG 3I09A 1TLFA 3RH0A 4ML3A 4W5RA 3CZ5A 3UK0A 3H5VA 1JFSA 3L49A 1NATA 4RZSA 2BGGA 3N6VA 5PNTA 3RVLA 1L5YA 4LE1A 5DLEA 5B3JA 1YMUA 4EVQA 1QMPA 3H1EA 1JYFA 4MR7B 1RPJA 4MGEA 5HKOA 4CBVA 1QQAA 1MB3A 3QELB 2FMHA 3HS3A 3HZHA 3H1FA 1JYEA 1DJMA 1VPWA 4UHJA 1DG9A 2YHAA 3TD9A 5C5CA 3IP6A 1QP7A 3BRQA 1YK0A 1TM2A 5C5EA 3KJXA 3OMWA 2B1JA 2FVYA 3IP7A 2A9OA 3CTPA 3LFTA 3QLVC 4IMJB 3FGZA 3OLXA 3JY6A 3O75A 3KLNA 2HQRA 2QV0A 3EODA 2HJ9A 3JPWA 3NHMA 4G0XA 4EY3A 1QO0A 2FXIA 2JBAB 2YHBA 2WJAA 1M5TA 1YVUA 2IPAB 3HEBA 2F8SA 3RVSA 1NXPA 3OLZA 3GWGA 2CHEA 1UDRA 2WJWA 2XDYA 4QPJC 4Z0NA 5B3JC 1VLZA 1U2QA 2W42A 1MB0A 2IPLA 2MYPA 4WXEA 3OQMA 2GX6A 3HDGA 3RVOA 3RVQA 4Z4GA 3OM0A 4P98A 1CYEA 3CZCA 1LBHA 2PMCA 2R25B 5TQ0B 1L5ZA 4RY9A 4MLDA 5EWLA 5FWXA 4KK3A 1GUDA 3RQIA 3C3WA 5KQMA 3H5TA 1DP4A 4MR8B 1RXEA 1Z2DA 3H75A 3CS3A 1Z18A 3C3KA 1YTUA 2F8TA 4OLAA 3FFWA 5CNJA 1PHRA 4KQ9A 2ZWMA 3O1IC 5EWMB 1BA2A 4PEVA 2LP4Y 3W9SA 2PUEA 1W25A 1YK1A 3CRNA 3N0XA 4KMRA 1TMYA 2HPHA 3GT7A 1BDJA 1GCAA 4MPTA 5KC8A 3M9WA 2R4QA 5KWSA 4QICA 4YS6A 3HVRA 2AYZA 3RVJA 1SXGA 5CNMA 1BDIA 2IPNA 3BREA 1C4WA 1E2BA 2FQWA 1LJLA 4ZPJA 4Z9BA 4G0ZA 1DC8A 1ZGGA 2FTKE 1EFAA 1BAPA 4MR7A 2PUCA 2FQYA 1NY5A 3Q7TA 1FFSA 1RXIA 3QELA 3GL9A 3GYBA 3KTOA 1E6MA 1I3CA 1NXXA 3EJWA 4LE0A 2CHFA 3I45A 1SRRA 3O2QB 3SY8A 1M2FA 5BR1A 2PUFA 4KV7A 3DGEC 1MIHA 5HSGA 1BVHA 4M88A 3KCNA 5TPZA 3HSYA 6CHYA 2E4XA 4JOQA 1VRVA 5TQ2B 3LUHA 3UKJA 2LBPA 4KRFA 1JH9A 2R48A 1S8NA 3EAFA 4IMIB 2JBAA 2DRIA 4MS4B 4Z4CA 5FWXB 1W9HA 4XFKA 3DLBA 3MF4A 4HYEA 1KMIY 2L19A 4OTZA 2ID7A 4Z4FA 4MQFB 4N76A 5TPWB 2PUDA 1F51E 4RY0A 5JNUA 2Q5CA 1ZH2A 2MYNA 2P4UA 4QYWA 3N0RA 4GPAA 3A0RB 4ETIA 1PEAA 2QZJA 3TO5A 1CEYA 5FBKA 5TPZD 5TQ0A 3QLTA 4KVFA 4Z4HA 1DRJA 5T7BA 4RK1A 1HEYA 4MQEB 1GUBA 3QLVA 1IIBA 3UUGA 4F3TA 4MR8A 1WETA 5BQ3A 4XASA 3H6HA 3FMVA 1T34A 1OXBB 1Z12A 3C3MA 2CWDA 3KYIB 4G86A 5EWMA 3BILA 3DGFC 4RWEA 4YLEA 3T8YA 3DLHA 3IPCA 3C97A 4RXTA 1DC7A 3FFTA 1ZITA 5CNKA 1SD5A 2JVKA 4D6YA 6ABPA 1D1PA 4RKQA 3QK7A 1TJYA 5F64A 3E3MA 3IPAA 2A9PA 3TB6A 1A0OA 1JHZA 3MQ4A 4LDAA 4IRXA 5DGCA 4ZYLA 3GA5A 4S04A 3KLOA 4W5QA 3JS5A 2PL1A 1AB5A 3DBIA 1Z26A 4FE4A 3RVRA 3TX6A 3R0JA 2GKGA 4KZKA 4RV5A 2FN8A 4KNYA 5JNWA 1ZDMA 4Q6BA 4LDZA 3I42A 3K4HA 1U0SY 4MAAA 4WUTA 4PYRA 4W5TA 4EUKA 3NHZA 2E4ZA 2QVGA 2I6FA 4RK6A 4RSMA 3CFYA 3F73A 4KPYA 2FMFA 3LMKA 4XXHA 1ZESA 3O21A 2VUHB 3OQOA 4YCSA 5IUNC 3LUCA 1A04A 1P8AA 1ZVVA 1USIA 1TVMA 1DBPA 1URPA 3QX9A 5TQ2A 1DCKA 2NUBA 1JX6A 3HUTA 3NNSA 5D2CA 4Z4IA 4MS4A 4NICA 3LUFA 2NZVG 3KS9A 1YS6A 4IILA 1PNRA 2MYUA 1PNTA 2M98A 3HDVA 3N75A 1QO0D 3CG4A 4MQFA 1FQWA 1XHFA 4H3HB 5HQJA 4WZZA 2E4WA 5TPWA 1SXIA 3N0WA 4YV7A 5JNRA 3KHTA 1DCMA 5IEBA 1USGA 3QX8A 4G0QA 1JDNA 2IOYA 4NV3A 1U8TA 4P1ZA 4RS3A 2IKSA 3NNNA 3CLKA 4MQEA 1Y1LA 2QXYA 3C6QA 2J48A 3OMXA 4RDCA 4TLLB 4OLBA 4ZMSA 1K66A 4EYQA 4YGXB 3RVKA 1YS7A 2QVCA 4LX8A 5IULC 2QR3A 1Z13A 4HNRA 2TMYA 2JK1A 2NT3A 1EHCA 4KREA 3T6KA 2O20A 1D5WA 3B2NA 5TE9A 3K9CA 1H9CA 3RVNA
chains in the Genus database with same CATH superfamily
4X3CA 1SVNA 3ST7A 1E4EA 1FYFA 3LUDA 4RTJA 2OCGA 3Q7SA 1ZH4A 2J0UA 3IT2A 3EDOA 3DEZA 3FFAA 5AK0A 1KZ4A 4MJXA 4N03A 1PTJA 2AG5A 4GHWA 5AT1A 3MJEA 1Y6RA 1OD6A 3K70C 3KKLA 4YNBA 4BO8A 1NQVA 1FRQA 3KXKA 3BL6A 1HKUA 1K8YB 1KP3A 2HGZA 2HY7A 4CM6A 4YJGA 1WNTA 1DKOA 4JR1A 4LZLA 1XROA 1BSVA 3D59A 2TYSB 2X13A 3UWOA 3EEOA 3FNHA 1E1YA 3E27A 1KRWA 3L79A 4DDKA 5LOVF 3ZI4A 5IPFA 3KUKA 3H87A 5DRTA 5AVTA 1E9DA 1OYVA 3CXRA 4E4YA 3A3KA 3FPCA 4HRAA 5B6JA 1EAMA 2Q41A 4JLBA 1TIPA 1HMPA 2VHTA 1YGYA 5KSYA 4IDGA 2XE6A 3O8OB 5AP9A 3AEZA 3PNLA 2XGGA 1JQ5A 4GW3A 1J5EB 3M33A 3MM4A 4LZNA 4DCTA 1RI3A 3LAWA 1NVEA 2FGKA 1P0CA 2RI0A 4I1VA 4WY8A 3M5CA 2B94A 4AMBA 1Z6PA 1XRQA 5L8VA 2QYSA 1SM4A 2WV7A 4NBVA 3GQBB 3I1FA 1NX6A 3IMGA 2DUNA 3S2UA 1DOZA 1T3ZA 4QUBA 1N5RA 2WMDA 1L3IA 1W87A 2O52A 2H4HA 5CNIA 5LKAA 5ED4A 1IQ0A 1QHFA 3JQFC 3QFCA 1GG9A 1PX0A 1Q12A 3C4QA 1BHQ1 1MO3A 1YR8A 1CEQA 2GEFA 4HNSA 3WFZA 2B8NA 4RD6A 4CEHA 1YCHA 4G6ZA 3AFOA 1Z75A 1FQOA 2PZKA 3M49A 3HA5A 4G26A 2ZUCA 4LSGA 1J9GA 3RYHA 3UJ7A 2I6UA 3HZRA 2JFBA 4KPEC 3UJPA 4N7JA 4WNYA 5GVSA 3NMUF 3VC1A 3IE2A 1S0UA 1ISRA 1WZNA 3JQAB 3NCTA 1PG5A 4PG7A 4YV1A 4BXOB 3NP9A 4IHAA 2ZTUA 4LQ4A 1PFYA 1V8PA 3IIEA 2J45A 3EY9A 1QHHB 3BFVA 3FCOA 1Z7YA 3K4QA 1XN1A 2DHDA 1W36B 2PFKA 4KGVA 4Q9DA 1HYQA 3AYZB 2GRAA 2JIZA 4I1RA 4NE7A 1R8JA 2E5FA 2AXQA 3L3BA 4TKUA 1SIOA 4WFQA 4EFDA 1MHPA 3U44A 1WB6A 4FUQA 5I7HA 1KJQA 3TRIA 3GEDA 1J8VA 5DTJA 3VMFA 1C41A 2JLSA 2P68A 1VGVA 3FYSA 4YWJA 1G66A 1V4VA 3V3KA 4CUKA 4L4XA 5AI6A 2IFTA 3R0QA 2J9FB 4OVKA 4F5WA 5KYUB 3Q11A 4OUDA 2G1UA 4FLFA 1FFWA 3L01A 2K4MA 1CZRA 1EX6A 1R3UA 4HVAA 2ZYTX 2L42A 3P2YA 1O6ZA 2NVUA 3OCCA 1VSBA 4YP9A 3VYTB 1GL9B 1OHHA 4H60A 4OQ4A 5EY5B 4JJKA 5JWRA 1LNQA 4C88A 1AQUA 4MHSA 3U09A 1YU9A 2P35A 2VDUE 4ZTUB 1KTIA 2IS4A 5HM6A 1QIKA 4ZYWA 3NR2A 3B5IA 4UMFA 1V11A 4KK4A 2VJPA 4XWTA 3UJBA 3H1TA 1SBTA 3ZPXA 1G5FA 4ZP1A 4XGRA 4RE6A 2RGCA 3JYHA 4YRQA 4AMVA 1H94A 3SS8A 1MORA 3TWOA 3PUXA 3CNBA 1EGQA 3N74A 1VKRA 3TTUA 5IHPA 2CEKA 2V9ZA 1R9NA 3GH3A 2P3OA 4PICA 5F2KA 1P81A 3E84A 1P5FA 1Q7RA 2H18A 3K6RA 3LT0A 4G56A 5BW5A 1H3EA 4RKYA 3DHYA 2CFCA 4UUOA 2CFIA 1PUXA 3DBLB 1SKQA 2YY7A 2V8OA 3KDPA 2H17A 2RB5A 4MUHA 2JVJA 1UF9A 4REQA 3X1XA 4BMZA 4KLRA 5CXUA 5JS1A 4KUGA 3VYSB 3PGA1 4MJLA 1V3QE 5IM4A 5EKSA 4RE5A 2OL4A 4AIIA 4AQDA 4QFDA 4TUYF 3JASA 1SVOA 1VIYA 5H82A 1XJWA 1X1BA 2CZCA 4J3JA 5H83A 1Z6XA 4A2CA 1XA0A 1BMFD 4I5DA 1EQ2A 1CZKA 2FEKA 2KWIA 3LWBA 1DX9A 1XI2A 2VTVA 5FCDA 2Z5LA 3O90A 4S2EA 4LPSA 1B00A 4X85A 1Q0SA 3ZZMA 3TQQA 4ARAA 4X61A 2YS6A 3MCVA 2ZR9A 1TYCA 2FUKA 2YHIA 2XYHA 4L9SA 1JBQA 3BIWA 3H9UA 3OSUA 2JGMA 5JD3A 4DEVA 2PBRA 4IWYA 4TKZA 3OX3A 1NUTA 3WMFA 4DLXA 3KBBA 2J3MA 5MFZA 2J3DA 2KYRA 3D54D 4RQAA 3DUFB 2FGJA 5DM0A 1A2KC 4OOEA 3OO0A 1FE8A 2XMQA 3E9MA 3URMA 3V1MA 2JCBA 5KOHA 5KBYA 4LNUB 3BMCA 3LWNA 1GQQA 3PNYA 3LUGA 2ZE8A 5GGXA 1QO9A 4BC0A 3LOUA 4AY6A 4F5EA 3F5QA 4E5NA 1F60A 1FSSA 5G3ZA 2W2LA 2COUA 4IY1A 8LDHA 2FLWA 2DBQA 1QK3A 2PHZA 4WERA 4FYVA 3EQ2A 2VJAA 2PDAA 3PC7A 3F8SA 4B6EA 4J7CA 1OVMA 3PUVA 5K0ZA 1G2QA 1C7EA 3DJFA 5BPHA 1HE5A 5ALNA 4UMEA 1EFPA 4ON9A 3N28A 3PXGA 3E23A 3FVTA 3VO9A 3WWOA 4XH9B 4HWKA 1U4NA 3K0EA 3GEGA 2B4KA 2C2YA 3EF3A 1FRVA 3H17A 5CK5A 4BQPA 1JIQA 2WWXA 3LM8A 3P97A 3RYCA 2QU8A 3EIHA 4BUCA 1C1XA 1W52X 4CF7A 1UOEA 2B4YA 3CKYA 3HV0A 1J42A 1PLLA 3IFSA 4BNZA 2CVFA 5CFNA 3PC4A 2QM8A 3A04A 3BZBA 3LX5A 5LM3A 1EJ2A 5L45A 1U0BB 4KAXA 2B0JA 4L74A 1ZN7A 3ENKA 3L7NA 4HWTA 4Q4HB 4EYGA 4MSUA 2WICA 3A37A 5DM1A 5H16A 1KDTA 2VHUA 5C1BA 3AVPA 2VJLA 5F7ZA 4BGVA 1KGDA 1X7HA 2G77B 3CNOA 4C7OA 1PZXA 3L05A 3DAFA 3OEEA 3GDWA 2FJ0A 1UPTA 4BDTA 1QH1A 1KKUA 2QX9A 1RCUA 1SUCA 2PVPA 3E3OA 3OWHA 2F3PA 3LCRA 5ECDA 5IJAA 3SE0A 3U4AA 1YMUA 4EYEA 1J2EA 5JBIA 2VQEB 1H23A 3WB2A 3CUKA 3LUBA 3GDOA 5EIHA 1IVSA 3I2YX 2DFLA 1GV0A 4U2CA 3H1PA 3KXIA 3NJ8A 2BSAA 1LVGA 1P8JA 4GEGA 4I50A 3Q6IA 2B0CA 4IXMA 3LX8A 1AKRA 2XWQA 1M9NA 4JUFA 1Z6YA 5JRDS 3SOPA 4GBED 3OMWA 1JR3A 1U7PA 2V7BA 1KAHA 1LW7A 1U2SA 3ANLA 3AF2A 1IBSA 4G8DA 1AKYA 2ZJ3A 3F96A 3II6X 4RQTA 5B4UA 1J7JA 2DHQA 2WWWA 3HDTA 1QJ4A 3PC8C 5ILQA 5JPDA 1HURA 5A0TA 1GEEA 2XITA 2XWSA 1XYYA 1H1LA 3FI9A 2NO6A 3AVTA 3F6YA 4QWMA 2I9KA 3ZE0B 3MJTA 4GM4A 4TXNA 3SXJA 3AFHA 1Z3CA 4G1BA 1R2QA 1NN3A 1A9TA 2YBDA 4S0ZA 4M49A 1U2QA 1I7LA 1SCAA 3WZLA 5DO9A 3AJEA 1F1BA 3IR5A 3UB3A 5L3RA 3A58B 2B2NA 3OEYA 4UMDA 4HUTA 3QX3A 4C05A 1G8FA 5AI4A 2WEKA 4D8YA 5CCEA 3EHEA 2JGRA 2I2BA 1DP4A 3RIXA 2ZBFA 1L8QA 5T4BA 3QVOA 2DB3A 1U2GA 3BSFA 4GQBA 2PA3A 4PZDA 3FWKA 3R3YA 1BQEA 4FI3C 4MJ7A 4X0EA 3FR7A 2J5XA 5E8JA 3UPTA 4TT8A 1UBCA 1N2JA 4J91A 4D8TA 4KDFA 4R7GA 5GONA 2PUEA 4DB4A 1IEWA 2BYTA 1FLNA 4IJMA 2F1IA 3CONA 5LCXA 2QMYA 2QRJA 4D9JA 3R3XA 4Z0TA 4ES6A 3T0IA 3FSEA 1KZYC 1ND5A 3GYGA 4Y98A 4QICA 2F43B 2WKRA 1IDOA 1VJDA 5HF6A 4ACBA 4LYHA 5KMGB 4K05A 3RS9A 4LYDA 1JR3E 5DYGA 4BWVA 2HR1A 3VAZA 1XCJA 3DYIA 3FOZA 2CL6X 4KMMA 4L8FA 4QUHA 4XX0A 5YASA 3AVWA 1SNYA 4X41A 3LBIA 1O6BA 2J85A 3ZJVA 3TF5A 1GU0A 3IILA 1K7XB 2C83A 3TGPA 1RRMA 1TC1A 4Q00A 1BO6A 1TZBA 3GZTB 5JNVA 1QUFA 3U3KA 1KKLA 1NNSA 4DJFC 1FFSA 1RXIA 4O4HB 5GZ6A 5AVQA 1W8IA 2ACKA 1XPOA 3H8SA 1NG9A 1Q5PA 2FFAA 2JFHA 3U0VA 1KQPA 3GGPA 1QFYA 1HE4A 3KCNA 5CLGA 1EM8A 1NLZA 2QT9A 3NTRA 4OFXA 2FP4A 2E37A 3RSFA 3SQMA 4EMUA 4FDTA 4PSAA 2YZMA 1U65A 5AJTA 5LLSA 4OA8A 5TQ2B 4IXDA 4Z3KA 2XLBA 1P7VA 2KM1A 4O4LA 4EPRA 2VJBA 1Z0ZA 5DTQA 5JI2E 1AZWA 3OM8A 1IXSB 3FCEA 3AR3A 1MO4A 5D87A 3MW8A 3ZLTA 4INPA 2D54A 1BH2A 1GZ7A 2ATXA 3FTQA 5CG1A 1ZRHA 3AOEC 1E61A 2BGUA 4N76A 3CX3A 2VLIA 2EGHA 3BCSA 2X42A 3TSWA 4F96A 1V1JA 4OV6B 1MNAA 5CLIA 5CXXA 3R5SA 3RAGA 4AJ1A 3A0RB 4L3WA 4C04A 2AK3A 3T5AA 1L4KA 5FBKA 3RJZA 1XD8A 4WLEA 3RYTC 5TV2A 3RIGA 2X6RA 2ACVA 1HO3A 1GUBA 2KB0A 2YCBA 2AF4C 3K0BA 3WHLA 4E5DA 2BPOA 4EMSA 1I3NA 3V8NA 2Z4SA 4EKNB 2J4FA 3G2KA 5FO0A 3N7AA 2XCUA 3W6ZA 3ZEIA 4XASA 1RKBA 2Q4DA 5G1NA 4FWIB 1QS0B 5E6RA 4Y9UA 4WJLA 1AJEA 3OLQA 3N59A 4FQ8A 2A57A 1ST3A 1T3TA 5DBFA 2IW1A 4WKGA 4B83A 2JJ2A 4RVOA 1W7AA 1DBIA 4D0NA 1V4NA 4PPYA 4AJEA 2ZCJA 4QGAA 2AN3A 5DSTA 4LZPA 1GZVA 3LFUA 1ZC4A 1MJHA 3E3MA 2G0AA 3QV2A 3PPYA 1VSQA 1JHZA 4H3SA 4LDAA 2O8EB 2FOXA 3SF8A 1IK6A 1B15A 4ANFA 1EWRA 3QOYA 4QXAA 3NEAA 5CUQA 5KYXA 1C7JA 4U7PB 3FVWA 3L6DA 5CB8A 2IGBA 5CW2A 1A8HA 4HMOA 2ZM6B 2PUWA 1RQXA 1IHUA 1XZ8A 4FYIA 1W1WA 2HEGA 1EVJA 3RS4A 4EGFA 1KWGA 3SQLA 1LV7A 3COYA 3EA5A 1TZMA 1SQ6A 2CNWD 1XDWA 3K4HA 2ZUFA 1UFOA 1UZMA 2WD9A 3MBOA 2DHRA 5LBTA 2A30A 4ZI3A 1QGYA 1TUBA 3B60A 1YHNA 3NM4A 4DVGA 4P7BA 4YRJA 3DXYA 5HFNA 3CNHA 1DEHA 2DY0A 2GDJA 3GF4A 4OMUA 5C8VA 1OX4A 2GLTA 2IWRA 3EVZA 4ZT6A 3K9FC 3TFQA 3CPEA 2FZ4A 3F0TA 2PNFA 1DBPA 2UYYA 4R98A 1ODIA 3O6VA 3IUPA 3WA6A 2Y1CA 4W5HA 2ZWPA 2C2BA 4KWHA 3E22A 1N6PA 5AJZA 3T1YB 4Z4IA 1GNSA 3JD4A 3L6EA 4EP1A 3W0LB 4PLYA 5FD8A 2R8OA 1I01A 2AUMA 2AEMA 2OK8A 2WD7A 3SHQA 3REQA 3AW8A 2FQ1A 4Y2GA 1E1QD 2HIMA 3ORRA 1KVTA 2B61A 2C3PA 3TK1A 5B4TA 4H3HB 4WFKA 3F71A 4U5QA 3O5AA 1IZ9A 4WZZA 5AW1A 5MFPA 4KIJA 1JR2A 4LV5B 1OASA 3H5AA 2OBNA 3KHTA 3L7LA 3UAZA 4F2WA 2DP4E 2VQ3A 4H4DA 1I8TA 4B7XA 2W0MA 1EWQA 1XK7A 3SYLA 2OVBA 3SLKA 2BFFA 1V7ZA 1EH5A 3NIBA 4Z9YA 5CDFA 1FTQA 1NWCA 1BX0A 3AL2A 4ZKEA 4OLBA 2OHIA 1G2PA 1RZ3A 2M6RA 2ZUUA 3EEQA 3EWAA 4MW2A 5A3QA 2MR6A 3C2QA 3RU3A 2Q07A 3REFA 1QV7A 5JTTA 3T3GA 4FW9A 1R6AA 1AGXA 3T35A 3T61A 3UV6A 4IDBA 4EHLA 3DC2A 3E3AA 4J2OA 2BH2A 1TMGE 2CV2A 3KOOA 6REQB 3FAZA 4IOKA 1WM1A 4BZZA 1GUFA 1SCIA 2NWQA 3CKKA 3OZAA 3LT4A 3SJUA 3K6SB 2BFNA 4N3BA 5BWCA 1PG2A 3H7IA 2BGWA 4X92A 1N2GA 3RLFA 4A03A 3LW7A 5DNYB 1RHRA 3OQ6A 3PFNA 1M34B 4JHXA 5LQJA 3IAFA 2HV8A 4OHCA 5TXGA 1TQHA 2ODTX 2VJYA 1LD3A 2P2LA 2Q5HA 3QUSA 5DI3B 1E0AA 3GUYA 5A5VA 1GTVA 2RGYA 1SUWA 4MWDA 2B37A 3MINA 3B1YA 2I6GA 5EJ4A 2KMLA 4FMCB 1QTNA 2FHPA 2GTPA 3B3AA 3CR3C 3HABA 3LYHA 2H2HA 2NQ2C 4MLPA 3FFXA 4WDRA 4YAFA 1ADYA 3S5UA 3V4VB 4BUJA 1PR9A 3CIOA 1U5CA 4XYBA 4YI3A 3ASYA 4F8JA 2CJFA 2DCUA 3HCNA 3QMVA 3GFQA 1R7RA 1EFDN 1NULA 2NU7B 4LA4A 3LV8A 1P0PA 1YU6A 3BX1A 3ECSA 3KTAB 7ABPA 5KNDA 2NX2A 1IIRA 1JU9A 4XLTA 4B4UA 2HJSA 1N1EA 1PD0A 4YRIA 2I91A 4RH1A 1ZOOA 4EG7A 1NURA 1UK7A 1LK0A 5ALQA 3BQNB 4ZMBA 4OXIA 1NJ1A 2OD9A 1I3KA 3LKDA 1I9CA 4DRXB 4U9IS 2HQOA 4CKWB 3O3NB 5CTJA 2GAJA 3IRUA 4RY8A 1AGRA 3SHVA 2Z8XA 1COZA 3GAMA 4TKVB 1RHJA 1FNNA 5BRAA 1DOHA 2QMZA 3THWB 4V0QA 2QRVB 4O4IB 1GZ6A 3T1OA 4ND1A 3V6LA 3V2HA 5NULA 1KAEA 4M22A 1M6NA 4TZTA 5JY1A 2WZCA 1Y5RA 1Y8QA 3WK7A 4M9UA 4ER0A 1RIIA 5K3AA 2W70A 3S5JA 4C0HA 4LRSB 2WFLA 2GN2A 4B5KA 1G8YA 2J1LA 3VO1A 3SC6A 4N0MA 1HDGO 3G7SA 4YPOA 2PCLA 2C84A 1XCOA 5E2BA 1NM5A 4MS1B 2XA1A 4KXFB 3WAGA 4OI2A 1K06A 5J2UF 1CNFA 2JATA 2E6KA 1MUUA 3FUVA 3W3ZB 4IW3B 3AU9A 4F8YA 3PQ8A 2PLNA 4RVGA 5KQLA 1OUMA 4ZAXA 1J2YA 3DCNA 3OCXA 1QZUA 3ME5A 3A9WA 4RD3A 4KLCA 2XYGA 4OHFA 5EJ2A 3OF5A 4ZMRA 5C7YA 5J2TA 1M8KA 2PMEA 3A4NA 4I9GA 1N1GA 3C15C 2IHBA 4MAFA 4PHTA 4U9HS 2YFHA 1WS6A 4KQCA 1Z6TA 2GERA 3HACA 2BTOA 2VYVD 4XJVA 3V3TA 1BD3A 1CS0A 1QLWA 3HN2A 4B3HA 4UHKA 2DKFA 4D5EA 1KOJA 4URHA 3CT4A 4X71A 1FU4A 1HT3A 2R1VA 3HB4X 2XT0A 4INAA 4QYIB 5CD1A 4IQGA 2QF7A 1S9HA 3DQQA 2HNAA 2VA9A 2DX7A 1NE2A 3I5AA 2ZYUX 3MGAA 4M36A 4GNRA 4UNNA 2R8RA 1FMJA 2W11A 1FC0A 3ABIA 3QF4B 2YKGA 3NJRA 2DKNA 4BL5A 4LDNA 1PJ8A 3ZTYA 2VJOA 2VHWA 5KNDH 4MB0A 3Q7PA 3SZUA 1E8DA 3KYDA 4AYTA 2ERXA 8OHMA 1TUIA 2FDXA 3ED5A 4KDCA 1WHSB 3A6ZA 1M7GA 4LOJA 2H3EA 2WJHA 1XVLA 4N18A 2Q1XA 1PQUA 4FE7A 4H08A 2EKLA 3SYTA 8MHTA 2BTQB 1FTSA 1PZNA 2RC5A 3QKRA 3VSDA 2G1PA 4K9DA 5JNTA 2QN1A 2F3QA 2OORA 3T1HB 1JJ7A 1U6JA 4ZHSA 5KKCA 2F3UA 3GI1A 3IUBA 3F6BX 5DKFA 1P1IA 5DN9A 4K6KA 2DC1A 3LZ6A 4Q01A 4TTRA 3AUJB 3DL2A 1IWPB 3HKDB 4KCGA 2B4TO 1CP2A 5KCZA 2QE7D 4J0JA 5KJEA 5L3QA 4RHEA 2XQIA 1QDUA 2ZTHA 4TWRA 1P3DA 2PLWA 3MAJA 4GYYA 2Q21A 3AF3A 3THXB 1ADGA 4IDCA 1E7QA 4OSEA 4CR7A 5JJIA 5JSYA 1G6Q1 2NTYC 4MR9A 1JSLA 3Q3EA 4WFIA 3AESA 3HYNA 2MCFA 4EM6A 3ISVA 2VTEA 4YRMA 5CFMA 1N5OX 2E55A 2NXCA 3LPDA 1KJWA 4JLOA 4B5LA 1EK0A 4K28A 5JXWA 2VP3A 2VPIA 3HJBA 1SKUA 3GCXA 4EB6A 4DRYA 4KXLA 1JDBC 5JASA 1TKRA 2PS9A 4E2XA 5JBNA 3LP8A 2GBIA 3VNAA 4F2GA 4Z86A 4LFAB 1AB6A 3A26A 2E5WA 4QU0A 1G0OA 1M76A 4R1OA 1HE1C 1TVKB 3W3AH 1LY1A 2JRLA 4UEQA 4A2QA 3KPWA 1D09A 5HCIA 3SC3A 4HX5A 1JT9A 2VF2A 4MUMA 3SAJA 1M33A 3JQ8A 5EKXA 3ORFA 5D3KA 1I1NA 1A8SA 3E8MA 5EUCA 5K0TA 3H5OA 1QB8A 1G8GA 4IH1A 1X7XB 4L2IB 4B47A 2ES4A 4PTLA 4DAEA 4A36A 3ETNA 1ICIA 2BBWA 3QBVA 3STUA 3JX9A 4HXGA 1GL7A 2FZCA 3BE6A 3HZZA 3GGDA 2G04A 3MUEA 3ND5A 1A9SA 4K9NA 4JBWA 2EZTA 1QSGA 1WLSA 4MP3A 1G17A 4QU8A 3ZWPA 4QT4A 1XTVA 2B4QA 2WU0A 5AVXA 1C14A 3ZDRA 3N8GA 4MVJG 1PZGA 1M1YB 1Y3FE 2OHVA 2WJPA 3JZFA 2PD4A 3OFSA 5B7PA 1GZUA 1F48A 2MSCB 1OH8A 5JS6A 1FA9A 2AZ4A 1QU3A 2MSWA 4JQSA 3GNQA 3ZC3A 5KYKA 2X8LA 3EIWA 4LVNA 2WKPA 1RKVA 2QE6A 3VU1A 1Y8ZA 3TEJA 2ACWA 1XRJA 3MERA 4HB0A 3D2LA 1RAHA 3BMQB 3PEEA 1QLHA 1C2TA 4UBLA 3T3PB 5AW5A 3MTIA 1DKQA 2GQ0A 4PM4A 3T54A 5HGXA 1FFYA 3MIZA 1UFKA 4YGYA 2O05A 4CMIB 3WLKX 5I9LA 1SC1A 1X7GA 4F91B 5DLDA 1AUQA 1USVA 4UKDA 4QGSA 3VVCA 4G09A 5CG2A 1CY4A 2WW8A 2XYPA 4IO1A 3SXUA 3TOXA 4J0GA 2WFZA 1XEWX 1K3TA 4U0JA 1M6VB 3WJ7A 1VJ1A 3FSGD 5HJEA 4OP2A 1NVVR 3DEYX 3I1YA 3KYCA 1L7OA 1YB1A 1ZH0A 2GZSA 3ZTTA 3ZCTA 1ZWKA 4BVKA 2MINA 4BJHB 3QXSA 3HYLA 3TNJA 1NP3A 1EIZA 3EDMA 4PX9A 1U0LA 2C5SA 4QUGA 4ARSA 4P86A 2XE8A 2BGGA 2NUAA 4EVQA 2V98A 1QF9A 3HO6A 4MI1A 1N7JA 2O8CA 4KIWA 3R24A 4PC2A 3KL4A 1SCKA 1JEQB 1OXVA 5AVZA 1E3EA 2R5FA 2YV2A 2G17A 4FOLA 4CBVA 3R9XA 4I5GA 5E0OA 3JZAA 4HYYA 4D9EA 5LDHA 1E5XA 1MA0A 1YHZA 4PTYA 4EHNA 1RQ2A 3MC1A 2EARA 2XIQA 3Q87B 5LD2B 3JRNA 3R2JA 3IP7A 5B1IA 4IZHA 3IKJA 4IMJB 4TV9B 3EXIA 3O75A 3F4BA 1GG2A 3GC6A 3UGJA 3JPWA 2HJ9A 1XCGB 2DFNA 2K2QB 2J4DA 1JTVA 1EFTA 1XN4A 3AUAA 5AW7A 4GOND 2ZAIA 1XFDA 2UYOA 2DSTA 2G1KA 5TF4A 3HEBA 2Z1NA 4D4KA 4JQYA 5I45A 2PXXA 1ZCZA 4HUQB 4BZQA 4N5DA 1DDIA 4ZC1A 5HDQA 3TL2A 4EI8A 1ZVQA 5MN6A 1ONSA 1BE1A 2GX6A 3QMMA 5E95A 3LXUX 1TAUA 2PX8A 3PGKA 1N36B 2EAUA 2OCKA 3QSYA 4RQBA 3D2BA 1LLDA 3SEAA 4HFJA 1T4GA 4JVLA 3SP1A 2HH9A 5EWLA 4PLTA 2EKZA 2ODPA 4TLEA 2VQSA 1EE2A 1PGJA 4DAOA 3KZMA 3K5WA 1ZH6A 2CLSA 1RXEA 2X41A 1Z4IA 1F2DA 4UHDA 1R6VA 1JQJC 1R0SA 3PA6A 4OYHA 3FFWA 4AJHA 3E9DA 4UD2A 5EWMB 3OE7D 5B2EA 2G4LA 1I10A 5BNZA 2IZ6A 2DPLA 3HXOA 4N7MA 4P2GA 4YCCA 1WKCA 2JI7A 3DEHA 4H7HA 1Q57A 4G07A 1TU4A 3ER6A 4MVJA 1YAJA 1DLJA 2RGBA 3P2OA 4L0DA 3ZGVA 2Z95A 1CS4C 5BSKA 1QG0A 3IAHA 3K30A 4UDNA 4MGHA 3Q3VA 1T8WA 1TTTA 3ZWVA 1JUDA 1K6XA 3H3FA 3NC4A 4C14A 2D4AA 3H16A 5HRCA 3HVRA 2ZE5A 4HN4B 1KR2A 3W2HA 1W96A 3G3EA 3EGXA 5BO5A 3RNLA 3Q8MA 4TMTA 2LRHA 1C4WA 4RGBA 2G9QA 4IDPA 2MT9A 1U1IA 1QVRA 1O8BA 1ZOIA 2F1OA 2QXTA 1G9XA 3SVTA 4RF5A 1VDMA 2GSWA 4PHHA 1VSUA 4D9NA 4NZPA 1E9CA 1LI5A 1UPBA 3FUUA 5I9MA 1MAUA 1ESCA 4FI3F 4L4YA 1L5HA 3VYWA 4MR7A 4ED9A 3KETA 4URYR 2PUCA 3PRJA 1UEJA 2GO1A 4BY9E 5CEFA 1R4MB 5BV8A 1E60A 1QC5B 3AIKA 3ZVMA 3VZPA 3I45A 3HB5X 5A4FS 2C7BA 5BR1A 2H6EA 2H5JA 1G59A 3MMZA 2PRKA 2R8YA 3T3IA 1TEZA 3D6UA 4MROA 1JXMA 2HRQA 5JARA 1PWXA 3OPYB 1FP4A 5F9HA 1G60A 4H35A 3AJ8A 2PR7A 1DHTA 4HEQA 5C34B 3AVOA 1MU0A 3CNNA 3GVXA 5FWXB 3INYA 3JQDA 2EFDB 2UZIR 3A3NA 3NXSA 4W9MC 3DLBA 2Y77A 3DT9A 4RJLA 2O1XA 3BUSA 5EIXA 2HRZA 2OFOA 4WW0A 5KYWB 1W76A 3L8HA 4IP0A 3E0XA 4YRLA 1E5TA 3W8EA 4V0NA 3IPXA 5AIBA 2EFGA 3WP0A 3GVHA 5T6BA 4EQZA 3LNTA 1CHDA 1HE3A 2Q5CA 1D4AA 2D74A 4LJ6A 3MGBA 4UE3S 3TLGB 3UGKA 1IQPA 5FUMA 3EYWA 1YQQA 4RIEA 2QYHA 3PE6A 2YWDA 2YHSA 4S1OA 5ITVA 3AOGA 3IVMA 3B52X 4GMDA 5TQ0A 4MVJE 4U3JA 1HQKA 1SXJA 3OZVA 1HEYA 4AP5A 2P65A 1SD2A 2VWGA 2PXHA 3D1LA 3LBYA 3M0EA 3QLVA 3KU4A 1I2DA 2QRGA 1KQ3A 3L06A 3KAKA 4P6VF 4NZ9A 5TX7A 1IOVA 3NBZC 3SFTA 5LSAA 5K51A 3C3MA 4NP6A 4DS3A 3QPDA 4G86A 1H8EA 3T8YA 3BDIA 3O3CA 3D3WA 1L9KA 3C97A 1QIFA 1EWYA 1G8MA 3DYBA 4HC4A 4MRSA 3VUFA 4EI2A 1KP9A 1ZNWA 1PT8A 9LDTA 4Z2AA 4XJSA 3U81A 1JGTA 5BN3B 1VA4A 3PNBA 4QXMA 3RJ5A 3U4QB 3U4MA 5KWJA 1P0FA 2JJ1A 2NZYA 3N5KA 4G1EB 2ABWA 4ZYUA 4DIEA 4JQOA 3OA2A 4W5QA 5HCNA 3DBIA 3RS0A 2Q1SA 2VA8A 2PWYA 4P9NA 1W19A 4UM7A 1O0BA 1YJXA 1AMUA 1XDUA 4L5AA 1TF7A 2P5UA 2H0RA 1CB0A 3OECA 2X19A 3CYFA 2EC5A 3LE8A 1ZDMA 1RJEA 4PGGA 2YJGA 2OY0A 3NKLA 3TW8A 4FLEA 2G67A 1I6MA 3A31A 3I8OA 4P4UA 3LU1A 2H4ZA 1U2RA 4FSHA 2ZE7A 4RZHA 2AL7A 2HMAA 4P83A 4DC1A 1VOTA 4AUEA 3HCFA 4W5WA 1X7ZB 3C3PA 3GZNB 4G5OA 1NU6A 2WZQA 1S7GA 1WHTB 1ZESA 4MDYA 1RQGA 3GFGA 4GX1A 5B3AA 4IO0A 5BSMA 3VO2A 2JK0A 2VUHB 3KPJA 2GJ9A 3ZHTA 1B2RA 2PZGA 2Z2XA 1V8DA 2Q45A 1U0FA 1U0NA 4EA9A 2V7UA 4ID3A 3HUTA 3RIYA 1JX6A 2WD8A 2O3RA 1IEVA 3MCUA 1FS5A 3CNEA 1UJ5A 1IY1A 4P5DA 1R0CA 2OEPA 2VHEA 3FVRA 1C4KA 2VPPA 2GS9A 4I08A 3IOBA 5E3IA 2JRCA 4Q9KA 1IH8A 5IJ9A 5CDHA 2YDYA 5L7YA 6YASA 2CXSA 5E7JA 5HX7A 1A4UA 3AEQA 2CB0A 3NEPX 2WWFA 1NZDA 2IXTA 2IP2A 4F97A 2JH9A 2HPZA 3EUEA 5HOQA 3DC7A 3B6IA 3EMVA 4X6LA 3V8BA 3UHFA 5CT5A 3VMMA 1Y6QA 1CVRA 1Y1PA 3D5EA 1WQ4A 3KEMA 3MK31 4LZZA 3ZJ4A 2W4IA 3ZWBA 4FFBA 4XVCA 2YMPA 1FFCA 3DDHA 4NE2A 5HR5A 4YMVA 1J9EA 5B5SA 5HQ3A 1MW9X 3NTXA 3THYA 1ISIA 2D5CA 3L7MA 3FBGA 4IJVA 4N48A 3QPBA 1N5DA 1Y1LA 1NMZA 4XWGA 4UVEA 4BRSA 1MP0A 1EEHA 2JGFA 3UCEA 1IPEA 1OR8A 3ESBA 3VNRA 5AH0A 2PGLA 3ZK7A 3U5ZB 1G6HA 1G8AA 2VJMA 3T0GA 2ZUTA 2O8DB 1TKBA 1BHO1 3EXAA 4MKHA 3WG9A 4E21A 4JL6A 3U49A 5CFQA 4QIHA 1P7WA 2R11A 1B73A 3D4BA 3KZXA 5EESA 3SIRA 4DKJA 3MB8A 4G01B 5GZ3A 1WNFA 2OZLA 1GL6A 3IJRA 1TT7A 5CT9A 1CR6A 1L4LA 2ZRHA 3PLAE 1BQ3A 3EXEB 3VR0A 3FNIA 4DA8A 4MDEA 3TE7A 1T2AA 1JJFA 1ADFA 3H8WA 4NQZA 3ZQ6A 4C6TA 3BL8A 5EUQB 2VDQB 4Y2HA 5EXSA 3KT8A 4MI6A 1OKKD 4EYKA 1CDZA 1DEAA 4A10A 1M0WA 1GHTA 4L9RA 5LXTB 4AWBA 2OORC 2WY2D 4GEKA 5KUTA 5LQMA 3PDCA 4HATA 1UQUA 4JWKA 3VX3A 2FN4A 3EXHA 4LV6A 4KOEC 2ID8A 2C4MA 4E1AA 5AW4A 4HNGA 3OTGA 1PEKE 1NN1A 1DRUA 1OYYA 2CF5A 3RG8A 3AILA 3IB6A 4HAWA 3DP7A 2C98A 4XFDA 1VE1A 2GBGA 1VLLA 1Y3DE 2MSKA 4J1QA 4X20B 2WINI 3HBJA 1KQGA 3TTYA 3ZBQA 1J20A 2JS7A 2BHLA 3RD5A 2M32A 3QPUA 4C2TA 5D6NA 1X7DA 2DBRA 3CWCA 3FYTA 5JG7A 3VDMA 1VCOA 1MQAA 2VNJA 4C3UA 4CM9D 2GF9A 4GLOA 3SFVA 2FK7A 5CHYA 1BQ4A 1DIGA 1H6BA 2E4YA 1BDBA 3M9LA 5BV0A 4CEIA 5ILOA 2V0GA 4B6GA 1YWGO 2HUNA 4HSEA 3T1NA 2PGJA 2JEZA 5BOSA 3RVMA 1P80A 5IC4A 1JB1A 2B20A 3VM6A 3V8PA 4JEUA 4PZ9A 1O54A 3E1KA 3JYNA 3STTA 2PZLA 3KZNA 1RADA 5IT0A 3OZUA 1QCDA 1JA1A 2J07A 3F47A 3SC2B 5LL6P 1HY3A 1GGEA 3PFFA 3U4HA 4CCYA 5IM4F 1AV6A 1OX6A 3ED1A 4YY3B 1P5JA 1YKFA 3HY3A 3BGVA 2JZCA 5LP1A 1JG2A 1KPIA 1GLVA 3HKBA 1X1DA 4MZXA 1T8SA 4K6MA 2ID4A 2RH4A 4DLRA 4KHPB 4BATA 4ABTA 2VUTA 2ATCA 4M4SA 3RSOA 2PUBA 1O4WA 1GYPA 1DJNA 2RBKA 3AIIA 1P6UA 2AFIA 2HA2A 4FGLA 4JJ7A 1NOIA 4XOUA 3V7FA 4R1NA 3ESYA 2R96A 4MRMB 4ZO6A 2GPAA 4K1XA 4OG2A 3TM5A 4Z53A 2YIDA 3RTEA 3HCWA 4FSDA 4DCJA 4DJ5X 4E5VA 3IC5A 2WHEA 1XFAA 3ACDA 1LRLA 1TA4A 2CUZA 3SF0A 3D6JA 1O95A 4BEJA 3K1TA 1DZ3A 2I4MA 5DV9A 4H77A 4PZUA 2Q6KA 2VRWA 4TRJA 5JRZA 221PA 1ULHA 2A5DA 2ZBUA 3AY6A 5F5LA 5JS2A 4CM8B 3T5TA 2VAXA 3WZ2A 2BBOA 2Q3JA 1O97C 1OROA 3N39C 4NS4A 3B5JA 3LPLA 4C7XA 5CBKA 2P11A 3V4PB 1IMOA 2XGJA 2IYQA 3H5IA 2VBIA 2Y6VA 3BRSA 5EWJB 3I61A 3LCMA 4FFMA 5ERGB 1IUOA 1SCBA 2OQVA 3SQOA 1E64A 1UXIA 3TJMA 2QY6A 1E69A 1UZNA 4EK9A 1T9DA 5FR2A 5TMBA 4OQYA 2OCDA 3YASA 2ASVA 4CW7A 2GD0A 2PJUA 4B6QA 4JJZA 1SBQA 1F0YA 3O8OA 3SDBA 1RWMA 3C3YA 2HB6A 4RZUA 3ZD8A 1TRKA 3CTMA 2R1ZA 4LJRA 2HK8A 1TO1E 1SZCA 2Z6VA 1T0PA 1WTAA 5CM2Z 4EVRA 3PP8A 1RC1A 4YP6A 5IUJC 2NV6A 4NBTA 3O4FA 3OM1A 5EIFA 2XB8A 1EP1B 1O6CA 3GQBA 4RNCA 3HM9A 1W73A 3BRCA 1NASA 1J1UA 1D6NA 2PU5A 3EIQA 4POAA 3PV0A 5C4GB 4D5GA 1TA9A 3P7MA 5JU6A 2OXRA 3FMOB 1JHQA 3OZRA 4FHCA 2ZQYA 1AQ6A 4P53A 5DZSA 1TM4E 4R0VA 3GO4A 1QG6A 4UTNA 1ENPA 1TUEA 3MMPA 1D9XA 1W59A 3FWHA 5DMXA 1EB8A 2AW3A 3NDBB 3P52A 3R41A 1K0FA 4MULA 3UPDA 5KIAA 1RYFA 3TLEA 1T9AA 2R5NA 4F1JA 4KSYA 2VHCA 3KE8A 1NFFA 3JQAA 4IQFA 2O50A 2AMFA 3MUFA 4P38A 5HA5A 4BXOA 4FS3A 3DMDA 1Y9AA 3NOVA 3OZCA 3R6TA 3UH0A 3QKSB 4I50F 1QHHA 1N1MA 4QHYA 1CXZA 2IXEA 3FW1A 4NAHA 1XZBA 4AICA 5C32A 3RR2A 3ZCSA 5JSFA 1NPDA 3GNSA 2UZ3A 2W9XA 4Z9FA 1DWUA 3NWJA 4UASA 5F9MA 1I4LD 4QUJA 2ZSIA 1QH9A 3WIOA 2IYUA 1Y4SA 4EJSC 2QUJA 1TCVA 4G5FA 2ZG6A 4DY6A 2HHAA 3V1UA 3I32A 2HEIA 3FLMA 3IS3A 4HTFB 5CBPA 3DWGA 4OU5A 4QUAA 2VDWB 3P96A 4CMEC 3HH8A 2J9FA 2W6IA 2BIFA 4JBXA 4LSWA 1GL3A 4WKNA 1ZP6A 5KYUA 3NRBA 2ZWOA 4HS9A 2XBLA 4US0R 2PQ6A 4R51A 1LSSA 4HBGA 1JIJA 4Q39A 1DBQA 4A0FA 2QD1A 2ZCVA 3D6MA 3V4FA 2VSOA 4YMGA 5K8TA 1ZICA 3PIDA 4EJ0A 3PXUA 4ZVMA 2PL9A 3DOIA 3AONB 2YYYA 2A67A 4PFSA 4KQJA 1ZR4A 3DHNA 3N2IA 2ZLBA 5DHTA 1Q17A 2ECPA 3FKSD 5JC1A 1ABBA 3Q15C 2ZTVA 3BCHA 1FFBA 2O8NA 4QJ4A 4CKEB 2BCJQ 3DKIA 1BWPA 1QH8B 3HM2A 3QYPA 1E3DA 2V7WA 3UOGA 2HLDD 2ZJYA 4EHKA 2GXAA 1PNOA 3HU1A 4E5MA 4JYMA 2EF1A 3NVKI 1MN6A 1GGNA 2W4QA 5GONF 4LJ4A 1Z36A 1DV1A 2P4QA 5TMEA 5FULA 5BYJA 5JWHA 1AQNA 5EVJA 3AJRA 1XZJA 3GLFB 1A1VA 3W06A 3D1JA 3H9JA 3UJAA 4PZCA 3QFHA 1E66A 4OLHA 2G08A 4J43A 3ILYA 3L77A 2PUTA 3DBLA 4DLNA 3OE4A 5JVDB 5H59A 2BM8A 3SSAA 3GUHA 3QSGA 4BRZA 3ZYZA 4BNFA 5FLEX 3UK0A 3A6KA 1X1AA 1Y8RB 1HOTA 2GN0A 1HZZA 2F55A 3UW3A 4FYYA 3I5YA 5A9SB 4HLUC 3IJEB 2IP1A 1HDZA 2JW5A 2Q9CA 4EI9A 5BQXA 4DLWA 1YNOA 4AF6A 1KK2A 4C2AA 3QMWA 4ZOBA 1V7QA 4ZU1X 2O8BB 3DZBA 2OP0A 4X44A 5BSTA 2W22A 2ZJ2A 5K3SA 3HSSA 2P77A 4OFBA 4WOJA 2VDMB 3I1IA 3QLVC 4DRZA 5KOJB 3DUFA 3OLXA 4Q3NA 3WGJA 2BMDA 5BMVF 3CUTA 3T1QA 1EX9A 1JDTA 3DT8A 2CL0X 5IKXA 4PXSA 4DV7B 3AV0B 4LNUA 1I24A 5HIMA 1IBKB 2YHBA 3C70A 5KSZA 4OYYA 3NH6A 4O4LF 3G2PA 1XQXA 3LKZA 4BB9A 4F6LA 5CFPA 2OVFA 3PRHA 5LZ5A 4QBKA 5LMZA 2PVCA 1TYEB 4W1PA 4MK4A 1QCYA 3O9ZA 2C96A 4FDLA 1X14A 2H59A 4IDNA 2IEAA 2IU0A 4JJ4A 721PA 2DKOA 2HW8A 2OCIA 1I1HA 2GJAA 3A25A 4MLZA 1T4CB 3H9BA 5E3HA 2RD2A 3ZUGA 3RVOA 1H5NA 3C5WP 2EZ4A 3FR8A 1XT6A 4DMGA 2PMCA 3U39A 4DF3A 2ZM5A 3NTUA 4E88A 2X5OA 1Y9DA 3FLBA 5KQMA 1G18A 1VLQA 1G0NA 3NKFA 3Q5EA 4FU0A 4I6EA 3N07A 5JDIA 1G5RA 2CGEA 3ER8A 3VQTA 1Z18A 4GM0A 4LOAA 4DG5A 2SNIE 3RJTA 4I9UA 5CPFA 5CYGA 4G1UC 3A7EA 3I6QA 5C35A 1RQPA 5JEEA 2O9JA 1NVWQ 5D8DA 4A15A 3W8NA 4CCSA 5EIEA 2J3EA 3BKXA 3BQ9A 2QL9A 5DHQA 1P1RA 1NKSA 4HOYA 4JXKA 2ARKA 5DWDA 2PK3A 2XB4A 3ZR4B 5JCOC 4HNHA 4I55B 1YK1A 2WIFA 1E0DA 2PZJA 3C5VA 4K6CA 4QOFA 4FVTA 4IVQA 4YRPA 2HPHA 1V5GA 3AG5A 3KHSA 4M0MA 4BNUA 5KC8A 1OAOA 2J9XB 4GGPA 1O9BA 4WJZA 4GD3Q 3EPPA 4Q4HA 1YZTA 4JZYA 2GD6A 2OCYC 6Q21A 3ZW9A 1Z4OA 4LZWA 4KIUA 4D9CA 1KBQA 2EU8A 1NI3A 1UPCA 3MRSA 3UT0A 4PSVA 1UKZA 1DXQA 1IZ0A 2I2AA 2JC3A 1CR1A 4AZ3B 3ZGXA 3ZVNA 1KDRA 1L2TA 2BGIA 2RJ3A 4M1KA 1S3GA 3KKNA 3GRAA 2IBSA 2XCSB 2W71A 3QP9A 1U4OA 1XU9A 1LBEA 3A9VA 3K1ZA 3JAKB 3QWHA 3OQMA 4K2AA 3ZX5A 2ZXFA 3PXEA 4L51A 3R8XA 1FUYB 2GUWA 3QMPA 1PX2A 3V2GA 1F17A 3ZUPA 3NXKA 2C59A 5EZSA 3ROGA 1KDOA 3AWIA 3CJRA 2WQ6A 1ETUA 2AKYA 2PT5A 1PFGA 3OCJA 2V7GA 3TQTA 1QWOA 2P3LA 4OMDA 2A5GA 2VNIA 3L84A 4IMIB 5ECGC 4UAUA 3JD0A 3KZKA 1JZTA 1NJSA 1D1SA 1VYTA 4UHEA 1VHJA 1GWNA 2VJQA 3RSCA 3UMCA 3QU9A 2H63A 1Q95A 3ZNNA 1XQ1A 1WCIB 4F46A 3ZHZA 4PYLA 4HWGA 1OT5A 1X19A 2DG2A 2ZWVA 3N2YA 5BN5B 2YJZA 3PK0A 4AY3A 2QN8A 4DUZB 4LN1A 4P3KA 1ZD8A 5IABA 3TG8A 1DO8A 1QGED 2K87A 2BEWB 2HSJA 3OWOA 5AO9A 3ZDFA 3QLTA 4X7RA 3KT0A 3OIDA 4JL8A 1PGQA 3LNCA 3MAGA 3GIDA 1IIBA 1UBSB 2W6JA 3FPJA 1E0KA 3JCZA 2C20A 3MSCA 2HJWA 2H1LA 3ETGA 2BBSA 5A0FA 4PC3A 1OW3B 1O58A 5EMMA 4IGKA 3ND8A 4RGYA 5EQJB 3UMFA 5H70A 4O29A 4LGYA 2O2EA 2O6LA 1E2JA 2BP7B 1IYZA 1DDOA 2I1QA 2NVBA 2HRCA 3DGFC 4JT8A 4DZTA 3KV3O 4YDHB 2C3MA 3CZ9A 3W1EA 1HZJA 1JV2B 3FHOA 4WKPA 4JNKA 3TBHA 2N1MA 2VUUA 3KQTA 1UC5B 3NHPA 2AI1A 1SWWA 1NAHA 1BVRA 3QFRA 3WNBA 4ER6A 1GV1A 2C7GA 3MWLA 3NHAA 4TTTS 1LPPA 4WJKB 3GA5A 3RS2A 3BRWD 4B6FA 2IYZA 3W77A 1IDN1 3PNQA 5KMGA 3G7NA 4A0GA 1OFTA 2GJ8A 3DZJA 2O8FB 3UAOA 5LFAA 2QVZX 5KNBD 3I76A 3DTYA 1KS2A 1TCBA 2OP1A 4BLPA 4OJMX 4LUCA 1JILA 4WINA 3ZWNA 3MMSA 3EGVA 3SQDA 1YQEA 3RUIA 1FFAA 1PR6A 4XQCA 3UV7A 3H8VA 1KAGA 1MF7A 1R6TA 1RRFA 4O4HA 3TSOA 2FR8A 2QNRA 3RHZA 4GP9A 1Z47A 2FX5A 4NPHA 2YV3A 4EI7A 3OIYA 3BH0A 1ZXLA 2C2MA 1ZSYA 3NYQA 4UEOA 4HZIA 5GP1A 1KVUA 3CNLA 1RM4A 1Z82A 3PICA 1Y9JA 3PX2A 5TQ2A 5FEUA 1BCRB 1JAZA 2NO5A 4ENWA 1OU4A 4MZDA 2VVTA 2OYCA 5A71A 3RYFB 4URFA 3ZE7A 1XXHE 2MHCA 4ZU3A 3D4LA 1RTKA 1B0AA 3PIIA 4ZCSA 5FV4A 1I9GA 4NDAA 3OJXA 2ZK7A 4FT2A 3VZQA 1V8OA 4RTNA 1KIMA 2FG7C 2YYSA 4IKOA 1IRIA 3WGTA 1M1XB 1I0IA 4NJOA 3N0WA 4HH1A 5IN5A 1AG9A 2LR0A 3F9CA 3U7RA 3F46A 4ND6A 2GJSA 2AHOA 1JDNA 3AM3A 3OKCA 4DMCA 4NV3A 1HH4A 4HUJA 2HHCA 3AKDA 1GNTA 2IKSA 4FOOA 2C8JA 2F1KA 2I87A 2H1OA 2DR3A 2GHQA 1GFSA 2POCA 2QX6A 5CLHA 5K4AA 4EWLA 3WLSA 2C2KA 4I4TB 2TMGA 3KE9A 3RAEC 2CLCX 1QM5A 3EIUA 5DM2A 1SGWA 4LX8A 2ZSEA 1QS0A 3LQ2A 2V3VA 3SJZA 3T7DA 4EMBA 3GEEA 1GUYA 1OFGA 4XA8A 1HM5A 5FBQB 3UICA 2ON6A 5EZYB 5K6TA 1KEEA 3OICA 3IDQA 1F3OA 1GG5A 1K7FB 5J2TF 1Q6ZA 3JR3A 3RI3A 4CDNA 2ZRNA 4N0EA 4QBGB 3SR3A 3SHWA 1N8KA 2H52A 4MGIR 4W9NA 4Q34A 5ECYA 4TYMA 2O8EA 2DQZA 1T2NA 2FUCA 2HQBA 2PUJA 3OJOA 1KFEB 4G0UA 2R8EA 6GPBA 2B5OA 4YRZA 4ZEVA 2IOFA 2KBFA 3MELA 4NYJQ 4PX3A 4AP9A 4DCCA 2QRZA 3O47A 1Y7IA 2P2DA 3CF2A 4L8YA 1RPTA 1A76A 3LLMA 2Z3ZA 1UBOS 1VE7A 1YVRA 2OHJA 2HTFA 2R6HA 4R0NA 3DULA 4CKXA 5FOQA 4PYQA 4YEDA 2H65A 5IBQA 2FEWB 3U4IA 2C9OA 1JECA 5LWHA 3KQHA 1E1RD 1FU7A 1WF6A 4XRGA 5LWQA 2PWZA 3CB2A 4NRDA 2VG8A 3GFTA 1P2UA 2CXPA 3P9CA 1C3VA 4CI0B 1QVAA 4QYMA 2X1HA 3IP5A 1AXRA 1EDDA 3DQPA 4GECA 5CFOA 3QEJA 5F7JA 2WYIA 1Y5IA 4QSHA 1QP0A 1RXVA 2QQEA 1NI4A 2ICAA 3DF7A 4MV8A 3NWOA 5IH7A 1JEDA 2XTNA 5IHXA 2ZRKA 4XQEA 1QGUB 3MTAA 3NHUA 2Y6UA 4YMSA 3G68A 4FHFA 4WDQA 4CV2A 1RYHA 4DA6A 2GETA 2HWWA 3RFVA 5JYDA 2Q6IA 1GILA 1X3SA 2FPGB 3KCQA 3NM6B 3NLLA 4BLWA 4MARA 4O0MA 1SCNE 2A9RA 2CLDX 4KE9A 3RHFA 3LSTA 4XSVA 2XWJI 3DHWC 2LCFA 3FKJA 3NRJA 3OZXA 3TKAA 4BMDA 3B9BA 5JJLA 1UKYA 1II8B 2FAXA 1X6VA 4JVNA 4JI0B 3U1VA 3V8EA 1YA6A 2WDZA 4OHYA 3ELWA 2NPOA 3DPIA 5A1JA 2PE5A 2Z08A 5ENDA 4LRQA 3DLAA 4XCXA 2O7SA 2M1ZA 2H92A 1L5RA 3ICPA 3VBCA 4I1YA 3DJYA 1D2NA 4DYDA 1FSGA 3F90A 4JXZA 4XTCS 3O3MB 4CIWA 2D0PB 1UJNA 5I9TA 6REQA 1VYVA 5LJIA 4S1TA 1OZFA 5B1EA 3DDSA 3BJZA 4UBNA 3R3HA 5F51A 1VRCA 3K6SA 4DADA 4Z7NB 4MA4A 1R0WA 4O8ZA 5BN4B 1ST2A 1LW6E 1E77A 2PT9A 2C8LA 1GLGA 3P0FA 1RWPA 4DLPA 1KEPA 2RJOA 1MBZA 4JAVC 1QYXA 4GRAA 3BPSA 1RFLA 1L8LA 3GN1A 1JLKA 5DI3A 3ZY6A 4CR6A 1DMRA 4EHIA 1HF3A 4U0KA 5CVCA 4LZAA 2WSSA 5JD5A 4ZGBA 3OOSA 1JAIA 4AF7A 3DTVD 2ORED 4OL9A 4LHYA 2OC4A 2FFJA 3OY2A 1NSTA 2NV0A 4LRTB 1QYCA 1QYDA 3G2HA 4K0KB 5E1OA 1GPBA 3L1HA 3ZIAA 2P4EA 2QTRA 4KXWA 5FBRB 5K03A 4D96A 3L1JA 4PXAA 1P60A 3QVWA 3GEHA 2AKEA 1HZZC 1WZCA 2NU7A 5FOVA 3V80A 3SS9X 3AUXA 4JX8A 4NBLA 1ZHHA 4WKBA 4P4GA 1DS6A 1DRKA 5D7NA 1XJ0A 2QUIA 1OWLA 1EBFA 1KEVA 2F67A 2QMOA 1Q0ZA 5DGTA 4BCDA 4C6SA 1BMFA 1RQ7A 5MN4A 4DRXA 4FHEA 3TECE 4IGAA 3ONWA 1S1CA 1P39A 2RBEA 1CF9A 2BFBB 2I0FA 3CLVA 2R8PA 3Q40A 4IDOA 1WUTA 3URKA 4YMIA 4TKVA 4IMPA 1UBEA 2Q3EA 3M1LA 1L5MA 5KU7A 3M6LA 2FZVA 4QX6A 1DWQA 4F86A 3TGLA 3THWA 5BRNA 5KYTA 1GPYA 2QRVA 2ASEA 1DIRA 4O4IA 3OE1A 4R01A 3THOA 3G9TA 3JSXA 2O0HA 2FZWA 2VQDA 4H1UA 2VP0A 4AO6A 3ABZA 1ZRMA 4DQVA 5JMTA 4B3IA 1LI7A 2P1RA 1FDVA 3TRFA 1ZCBA 1U94A 3KSRA 4KJZA 2RGWA 4PAMA 4I81A 4CMJA 1CIJA 3MWEB 3TBFA 2WYUA 2NQTA 2H5IA 3MJRA 4FFSA 4OP3A 4NYMR 4B2YA 3ANMA 3P9SA 3EFBA 4DCMA 1KZ6A 3LL7A 2A0KA 4G3XA 5IM5A 5ALOA 2WT8A 1QRAA 4RHUA 1EGAA 1R5BA 4MS1A 4C01A 4KO4S 5JNSA 4R2HA 2HT1A 1TADA 2BLNA 1M34E 3R5XA 2C9DA 2FEPA 2W6NA 3ZWOA 4S05A 4D56A 1G7RA 2A92A 9MHTA 4LCEA 4M54A 4BECA 2GK7A 1A5SB 3DMFA 5NLLA 3ZLVA 2JLVA 1FNBA 4C4RA 5JV5A 3GW8A 1MIOB 4ZAFA 5TNXA 2WHRA 4BO5A 1CD5A 3NDPA 4IHJB 1DAGA 1G6OA 2JKVA 2KW5A 3WMXA 2XWBF 5FLKA 1V8FA 1Y4ZA 2RHOA 4O5OA 5JYBA 5BUSA 4NBKA 1I1OA 2YZNA 2VDVE 4MDFA 1T2VA 3QTTA 5DRYA 4H9GA 4TTSA 4PW0A 4RV9A 2G88A 2VDPB 3KSAC 1AUXA 3RF6A 1BG6A 4URUR 5HF5A 2H2FA 2FWAA 2QAIA 3ZBPA 4E31A 2FXVA 1OAOC 4K9QA 4QYIA 4UXIA 4AMGA 1ZGBA 2HA6A 1U5AA 3HHPA 2B8EA 3JQBC 1XHEA 4DLUA 3BXHA 3BDAA 3WL7A 3WGQA 2O57A 4BFUA 1KWKA 3CZMA 3GLIB 1MB4A 1WZIA 3UMVA 3EC2A 3QF4A 1BJTA 2ZJ4A 3TCNA 4E08A 1V2HE 4Y8VA 5I6DA 3OCUA 1ZVJA 2NNWB 4FIZA 5JXGA 2YY5A 2FNAA 3ONDA 5IG2A 1MCZA 2GAFA 2NAPA 2W2QA 3JWIA 3GJXC 4IQ8A 1KMMA 1O08A 1WHSA 3K9NA 5HJ2A 1OIXA 5SYMA 3VUEA 5A4MS 1M6WA 2DT8A 2O5CA 4NG4A 1N3IA 3IKMB 2BTQA 4TKLA 2K6GA 1JALA 1TI7A 1GGVA 1V9LA 3M6XA 1TF2A 4EF6A 2CDRA 4ZOEA 3M5PA 1JBEA 1VRWA 3BTVA 1E2HA 4JU9A 1ZONA 4LGMA 4PVDA 1Y34E 2WUGA 4YROA 2YINC 1KEZA 2IU4A 4M0PA 4MQ4A 2FP3A 1SB8A 2ZVJA 4MVJF 3SHTA 4FCCA 4OIMA 4IEEA 4NDNE 3HKDA 4YO7A 2JI4A 3HY6A 4GUAA 5HIAA 3PTAA 4GDFA 2D0OB 3JVUA 5H68A 3OUUA 1RCTE 4W5RA 3P0JA 1YIAA 3WL5A 5F5XA 2XUOA 4HB4A 2JBWA 3N70A 2FFHA 4J0CA 2LDBA 2CKMA 4BP8A 2FWRA 1M74A 1ENZA 3RVLA 2UYHA 3V8RA 4TRMA 1QIHA 5DMHA 3EG9B 1RRVA 5HZHA 1H66A 2PSJA 3TW6A 5H0IA 4OXYA 5M2QA 4KN5A 2VATA 3CLRD 2C4WA 1GD1O 2CDNA 3C4JA 3HS3A 4LYFA 4HDAA 3ROPA 4RTLA 4OHRA 2A0UA 2PSSA 2Z57A 4AJJA 1VPWA 1E32A 2GPYA 2WSMA 3KFXA 1YK0A 4IYRA 4J2HA 1TVKA 5FOXA 1CJVC 5SYAA 1CLUA 2DLNA 2XVAA 1U5BB 4B7CA 1G5IA 3LVQE 3NB0A 4N9WA 4RKWA 1NR5A 2QN3A 4B44A 3FPSA 1X7XA 4L2IA 1E4VA 5HBRA 3W5HA 4AZ0B 3ESQA 1I2AA 1YS4A 1ZXBA 3HO8A 3M7IA 1XMVA 3BGWA 2OT3B 2RAFA 4ZOAA 2YL2A 5CB4B 3D8HA 1EBBA 1KKMA 4LYGA 4QAQA 1IN7A 1D4FA 2ZIFA 4HYTA 3UMRA 5ALIA 3F78A 2W42A 2R8ZA 1MB0A 3R7SA 2VP9A 2CMKA 4DDMA 2QQ5A 3TLYA 3OJEA 1A82A 2XA9A 4DPMA 3SJBA 4ZT4A 2BSQA 5ITSA 1M1YA 1SRQA 4C4YA 1AO0A 2O0MA 5JYCA 1G42A 1T8RA 1UWCA 5C53B 1VPTA 4R05A 4W63A 1X7YB 2C8VA 4GP7A 4D0LB 3LZDA 4I5EA 4IXWA 4TMZA 4C7KA 4HWOA 4YCMA 4TZ6A 1DXYA 3MWKA 4GMHA 3IBSA 4JLVA 1M2JA 4EHHA 3H75A 3BMQA 4DR7B 4ZPXA 2Y67A 1GNRA 1VSVA 2EP7A 1K3FA 4FEEA 2C7RA 4CFZA 1Z6AA 3CW9A 4CMIA 4LXHA 4P5EA 1EDZA 1SIBE 4KMRA 1PW7A 4DNQA 1O89A 3RAFC 4TT3A 1GCAA 2ODBA 3DV0B 4Q93A 5AUNB 3X1WA 4I1IA 3WMWA 4MPJA 3LQ4A 5B2ZA 3JQRA 1M6VA 3T3EA 1VFPA 2WUVA 2WK1A 5DWVA 1T9ZA 2Z0MA 1YRWA 5JT1A 5HMLA 1WMEA 1U02A 4LKRA 4D9BA 3BREA 5A3JA 1B93A 4WK2B 4R71A 1SHUX 4ARZB 4EFMA 1DQRA 2QJWA 3BTSA 3GNLA 4C0QC 1ECBA 3AERB 2J4CA 3ZCPA 4BO3A 1ZGGA 2CVQA 1P1KA 4QG3A 1KHTA 2X9NA 1JEQA 2DTEA 5I7FA 1EA7A 3RBXA 1EZ4A 1KU0A 3ISTA 4LE0A 3EJWA 2AJ8A 1LQ2A 2VOEA 4JBHA 5DH9A 1WSWA 1AKWA 2VPXA 4YX9A 1SHJA 4Q9AA 4DPLA 1ITZA 4TV9A 3HXPA 1M1YE 2PH7A 2JLWA 1V3TA 3ZJ5A 2DE0X 3H6KA 2BFDB 4JKIA 2LBPA 4YJKA 1K6EA 4JI3B 1WG8A 2XUHA 4MS4B 2IRWA 4N8DA 1NXQA 1Q91A 2RIPA 1U8ZA 3OPMA 4XOIA 2IHTA 4KH1A 2NUTB 4QTXA 4AULA 4MUIA 3SZMA 2QTCA 4JUCA 3IKVA 4TYYA 5I9BA 2Z4TA 3E35A 4GGOA 4XGKA 2GXUA 4LRWA 2FR1A 2EJCA 4ICIA 4AKEA 1YVPA 3FI0A 2W37A 3UH1A 5IDQA 1ZVKA 3I30X 1ZGCA 4AX4A 3GFFA 3X0DA 3Q98A 1FNMA 4UNQA 1V26A 3C7CB 1OI4A 2A0XA 4V1CA 3LLUA 2AB0A 1GT6A 3QE9Y 5L3ZA 1OAKA 4KN6A 5FDFA 1OI2A 3MAAC 4AXXA 4F85A 3GOQA 1NVTA 1PL0A 4DA4A 4C20A 4GGMX 1BEUB 4NNOA 4QULA 2PD6A 2AG1A 1YC2A 4BQQA 3RTGA 1T34A 3EIEA 3KYIB 1XLTA 4F21A 5EWMA 3AR6A 1HYEA 2LE0A 3OCZA 4I8IA 3M6VA 4LJ9A 4MKZA 5EPEA 4Z0HO 3KB6A 1T8YA 3NVAA 2WE7A 1QE5A 1UBNA 3Q72A 4MUNA 4COOA 4YYZA 3LYAA 1JFTA 1F6BA 6ABPA 4MQBA 1XMQB 4H6VA 2D5BA 3QK7A 1TJYA 4KVZA 1K5HA 1Z45A 3V00A 1AHIA 3KKPA 3MQ4A 2R6JA 1C5KA 5D3ZA 1YZFA 1K7SN 1NBEA 3PI7A 4L6AA 5G0UA 2ZBEA 4LHEA 2NMVA 5KCMA 4FYXA 3ZDXB 3HXQA 2DY1A 3R0JA 4W8HA 1YRYE 4MIYA 1ZOSA 3VU9B 4XEUA 2YFQA 3VKHA 3FZNA 3LH5A 5BMVB 3DE2X 3LDFA 3V7UA 3RASA 1VMEA 3LQ1A 3EXG2 4WUTA 1E1QA 2OCXA 2A58A 3B82A 3E7PA 4LFCB 1XMSA 1YGPA 3TYXA 1QRTA 4Z8YA 2CHGA 1FDRA 2XKBA 3HDJA 1U9IC 3T9FA 1PJCA 3E8SA 4OP1A 4D4LA 3OHPA 1R4MA 1UP7A 2F62A 2WDPA 1QC5A 3NGLA 4HRYA 5CIQA 5BR8B 3KD3A 3V97A 1S7CA 5A03A 4KR9A 3CCBA 5K7SA 3TPZA 1HFJA 1HE8B 1L5SA 3CCFA 4FJ0A 3PFCA 3EIOA 5DBHX 4C4OA 4YCSA 3HWRA 3OPYA 3KUDA 1LTKA 1IC6A 2V6FA 1D0IA 4RMJA 1WRBA 5KVSA 3R3VA 2B83A 5HE9A 3E7DA 5EKDA 3C3CA 3H3XA 2W83A 2MYUA 4PN3A 121PA 1CUWA 2M98A 2WIKA 3DBRB 4JXXA 2A94A 2ZRBA 5P21A 4K6GA 3QI2A 3F3KA 4B79A 1RHKA 1E6CA 5KYWA 1O0CA 5FL7A 2B3TA 1TW2A 4X45A 4CG0A 5CM9C 5ALXA 1XJ5A 4J0IA 4NV1A 4WIAA 3R9KA 1F6DA 2EEZA 1Q1ZA 3K9HA 2BMJA 3PLNA 3TLGA 1QU2A 3PT9A 4I99A 2EW2A 1T9HA 3ZWYA 4FOTA 4HDQB 2MU1A 1GN9A 1J7KA 2C1EA 4KB5A 2MSNA 1G4UR 4JR0A 4YT5A 4W7IA 4BE7B 4ZV4A 2UYCA 5CFLA 2KBEA 4ZMSA 2SKEA 3DB2A 4DMUB 3IEIA 4U7GA 5IRCD 1ECJA 1U3VA 5EUMA 2FE4A 3CKLA 2QQ0A 2VH2A 2VK4A 2X9VA 1P4RA 5A2QA 2ZSDA 3OIGA 2V74B 1GCUA 2QD4A 1EHCA 4JLAA 4RTQA 4ZANA 1SO8A 3B2NA 2FFRA 4HD8A 1E3IA 1J8QA 4LYEA 1M8PA 2GJ4A 3GP5A 2P4HX 1MAAA 3GCDA 5DDIP 1HTBA 1M8GA 2OCBA 3QVMA 4PGFA 5ELMA 4YB8A 4HN2A 3RUAA 1QFXA 3U4QA 4QGHA 1Z7EA 5ECWA 1VHWA 5JZBA 1GQOA 1QKKA 1ZL0A 2XNCA 4UTXA 4TN5A 4JL5A 5KSOA 4QFBA 4ZEOA 1N5IA 3MLBA 5BYKA 1VHQA 3A28A 5BP7A 4DTIA 1WA5A 2PD3A 3MILA 4MMXB 4QRIA 2PFGA 1CLEA 3IL2A 1XRPA 2QZPA 2W6ZA 5BPFA 2V7VA 3MMNA 3A1NA 1M1UA 4H2DA 1T43A 4RNDB 1Q11A 3WMEA 4HO1X 4A1OA 2UDPA 3FYUC 1JSRA 5E9QA 3FPAA 3KG2A 4TQGA 1X7ZA 2EQ5A 2X14A 3GZNA 1VYHA 4WSOA 1GNQA 1WHTA 1ABFA 2OE2A 1ZX1A 2Q28A 4MKFA 4NI5A 2IV3A 3C8HA 3ZU3A 4ZZIA 2YOFA 5IF9A 3U7GA 1QX3A 2VNAA 3SIPA 2UZ1B 4X1KB 4DCVA 4EFKA 1VJRA 2A6PA 4LMRA 3OY7A 2R87A 1Y81A 3S8EA 5FTKA 2EL9A 2ZROA 8AT1A 3ZHOA 1UMBB 3W05A 4ZZ1A 4IUYA 2FW0A 4O8CA 4QU9A 2D2XA 2FUG1 3BWEA 3U62A 1R9MA 4C3OB 2GRUA 3NHJA 4DIMA 5AD1A 1IM5A 3CO0S 3ERCA 4GLJA 4LX0A 3SX4A 1E99A 3DE1X 3I5MA 3TRJA 1II0A 4Z9AA 5HKKA 3A6EA 1OI7A 3ZE9A 3MB5A 4XPIB 2OXTA 4Q3LA 2BE7A 3S40A 2E4AA 1UH5A 3G5AA 2VK2A 3EGIA 4IGEA 5DTEA 3T7AA 5INTA 3DMRA 3WRYA 4JB8A 2O59A 4FHGA 4KO8A 2HMVA 3JWEA 4JKOA 1L7NA 1Z16A 4RM3A 5EXEA 2VYVA 3MLAA 3G5TA 5ERXA 2I3BA 1NBMD 4JELA 2CXHA 4FT4A 3HMKA 4OK6A 4BFWA 4BKRA 1WD7A 2EFEB 3IX7A 3CIFA 1B1CA 1IJFA 1DQYA 1UDBA 1J0AA 3HBNA 3G9XA 1JSZA 5FWYB 3UWKA 4X62B 1U2PA 2FUG6 2QW1A 2HCTA 3CV3A 2CK3D 2WWHA 2NP6A 4CG1A 2O8DA 3LW8A 5C5IA 1Z08A 1A9PA 3DMTA 3A10A 1Q0QA 3AC0A 4G4IA 5KHLB 3OZFA 3GFSA 4AC9A 4HG2A 1OREA 4Q3OA 4Y2XA 3SKXA 4TMYA 4M8IA 1NRIA 3I0MA 1Z29A 1L7MA 2X7JA 1L6RA 3CURA 3LIPA 3N05A 3UC5A 3VPHA 3ZBTA 2FUEA 2VEDA 1G6KA 2QN6A 5FI5A 5FPQA 1A96A 3EXEA 1NFQA 5A7GA 2G71A 4RZQA 1VL0A 4HWRA 4UPVA 4MMZB 3OBIA 2AQKA 1S1MA 5P8WA 5IAAA 1E79D 4IX9A 4X3PA 2V97A 4O08A 5LXTA 1QZZA 4QOIA 4JD5A 3IXMA 1VKOA 2PKXA 1KI6B 2G70A 4NJEB 3IURA 2ORWA 4G8BA 1GPNA 2WT9A 4C0JA 4OFZA 5BQFA 1SVMA 4IIUA 5DNVA 1AK1A 2P7HA 3ESAA 3G2NA 5TGZA 3HNOA 2VHXA 2Y4NA 3Q1KA 4EVSA 2BWJA 4UBJA 3CUVA 4KMOA 3W34A 5B55A 3E61A 4B3BA 3IHWA 4C1BA 2BR4A 1KI9A 1QJCA 1Y4AE 3RWBA 3HV2A 3AEYA 4Q03A 3L41A 1I3LA 3OCYA 2WTBA 3KYJB 4X20A 1GCGA 4TLBA 3MQFA 5AUOB 2XF2A 2X5NA 1VE3A 5IVHA 1LVHA 3WP1B 4D42A 1E1DA 5T8KC 4EPXA 5BV2P 2XEDA 1PR3A 1MPXA 2V4UA 1IAVA 1JKXA 1DFIA 4HYQA 4RSGA 1JIVA 2FZEA 3QEBZ 1GTRA 3QYAA 4JUIA 1PZHA 4Q82A 3S44A 3VYRB 2E87A 2VZ0A 2G09A 2W4MA 4NCNA 3B2EA 3LKVA 5K2MA 4NMWA 1FMTA 4G41A 4Q4DA 2VDLB 1E18A 3HEAA 1I3MA 3LPCA 2Q4OA 2WRZA 4UUMA 1VGRA 3ENNA 4GZLA 3SC2A 3TN7A 5AVWA 4ZI7B 1X77A 1ZJJA 3V9AA 1PT6A 1XG5A 2VDRB 2HJRA 4PGAA 3KNZA 3MOIA 4R9UC 3DMGA 3GT0A 4UMVA 4CM4B 3QVXA 3WJ2A 1MC8A 1E6WA 3OE5A 4QOGA 1QHIA 3WC4A 3WAKA 2GYWA 1YQUA 2LPMA 2OGUA 2CBGA 5AVYA 1DAFA 1EVYA 4R1TA 2IYAA 1H05A 3TQOA 3N9IA 2FDRA 4JLUA 1FYWA 2QS9A 4UPDA 4Y9SA 4DDVA 4LXQA 4MRMA 4LFBB 1Z7GA 3PJDA 1GPAA 4Q12A 1N0VC 1J22A 2SHKA 2RB4A 1MB2A 2H7XA 3PT5A 2WYWA 3MQ2A 4OQMA 3RS3A 2HA7A 1ESZA 4GX5A 3QU5A 3UXHA 2PWPA 4BO6A 5BVGA 1FYXA 1RI1A 3OD1A 3FB1A 3MCAA 1RZUA 2QY9A 1KY3A 3KDAA 3VR6D 3ZGNA 1XLVA 3Q88A 5KTYA 1ZNXA 4MRVA 2AX4A 3GNTA 3IV7A 2OGTA 4XJXA 5T6MA 1H2WA 3GP8A 3HN6A 2QWXA 3P9PA 3C6XA 5FPYA 5F23A 4CUZA 3NUZA 1Y5NA 4YYEA 2TRSB 2RHDA 4CLEA 1RBYA 4R1UA 2J67A 3OT1B 4UATA 5UKDA 2RIRA 2ZI4A 4LJAA 3HPRA 5EWJA 3DO8A 2NO1A 1U8UA 2BDEA 2H5LA 2VJNA 1P1HA 5EJMA 4I3GA 4JVOA 4LF4B 3W6PA 4BLQA 3TFWA 4PYJA 3QJYA 2ZR0A 4KUEA 3DAGA 5DHSA 4DR5B 2ZYHA 4YP7A 5A9TA 3KXPA 2OUKA 4F93B 2Y76A 3JQQA 1XRRA 3R3ZA 1ECLA 3PQ5A 4PPQA 5CGQB 5FOUA 3WOHA 1PKEA 5H9VA 1T2UA 1P4AA 2O3SA 3PJRA 1Y63A 2XUGA 5AKZA 5F2EA 4H1WA 2WJJA 1YR7A 5I3ZA 2BFCB 1M2OA 4Q02A 3CZAA 3NKVA 4PSKA 4YUWA 5LD2C 3L1KA 1I7QB 4KN9S 2PV7A 1WCYA 1XZIA 1AHPA 2BRUA 4ZQIA 3G5MA 4OHPA 3QNMA 2F9FA 2DPYA 1TD1A 3EIFA 1NXVA 1T5OA 2V45A 2WG2A 4AMZA 1W49A 3I09A 3D2AA 2H29A 3BJRA 1C4OA 1BVYF 5EJAA 1VLJA 3IUEA 3T52A 1E94E 3WYBA 5CA0B 2WTUA 4GKAA 2R7LA 1SU8A 2ZTMA 1SG0A 1WW8A 5EPOA 3S29A 2QTAA 1L5YA 4S12A 4P3XA 5DFAA 4DE5A 4I14A 4A6EA 4QREA 1WPQA 4OJYA 1KAMA 3ONVA 3AVUA 1GGJA 2ZI9A 2Q5IA 2YXBA 5SZHB 1JYEA 3QKSA 3H19A 2HMUA 4PRZA 1I2CA 1JHXA 2YHAA 1EPUA 4AX8A 2AGVA 2D1QA 4MQLA 2JI6A 4BOYA 3L5OA 4BMCA 4D9GA 3INRA 2Q1WA 3JR7A 1LF5A 3KLNA