1C0EA

Active site s19a mutant of bovine heart phosphotyrosyl phosphatase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
154
structure length
154
Chain Sequence
VTKSVLFVCLGNICRAPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TYROSINE PHOSPHATASE (ORTHOPHOSPHORIC MONOESTER PHO
publication title The structure of the bovine protein tyrosine phosphatase dimer reveals a potential self-regulation mechanism.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 52
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1c0eA00
3CHYA 1M5TA 4KQ9A 5CHYA 1B00A 1EAYA 5FBKA 1ZH4A 2VUHB 3RH0A 1USGA 4OTZA 5GOTA 1J56A 5IUJC 1JFTA 5JNRA 3T95A 1FFWA 3CG4A 4G0YA 4WT7A 4EVQA 2N9UA 3O1HB 4ML3A 2LPMA 4YS6A 4KMRA 4RU1A 3JTEA 5B3JC 3HXMA 2MYNA 1PEAA 4P1ZA 2QZJA 3N0RA 2NZUG 4MR9B 3N0WA 3OMXA 5TQ0B 4N47A 1DG9A 2FSPA 3IP9A 4Z4CA 4MYRA 3H75A 3O1JC 2IOYA 4MS3A 3RVQA 5KWSA 3P9YA 3EQZA 3GA5A 3OO0A 4YWHA 3TB6A 2FVYA 4RY8A 3L49A 4MGEA 1CYEA 3O75A 5BR1A 2WRZA 4Z9AA 4PZ0A 1GUDA 4TLLB 1JH9A 1DBQA 3UUGA 4ETMA 3O2JA 1RZRD 1T34A 4KFCA 3H1EA 4F11A 2FQXA 1Z18A 1Z17A 1JDPA 3H6HA 4F12A 4Z4FA 2PUFA 3CU5A 3OMWA 1AB5A 4LE1A 5JS2A 5C5CA 4N41A 3QELB 3TD9A 4DQDA 3C3KA 3JPYA 3QLVA 5CNKA 4WZZA 1BVHA 1E2BA 1NXVA 2ZAYA 2E4ZA 3HJFA 2MSLA 6ABPA 3MM4A 3KYJB 4H3HB 1FQWA 1KRXA 1ISSA 4KZKA 4MAAA 2WWVD 3RVMA 4YP9A 1YK1A 2FMFA 3HM9A 3HV2A 4E7OA 1M2FA 1UDRA 5PNTA 2JVIA 5ABPA 3O74A 4IMJB 1GCGA 3G85A 4JA2A 3QEMB 3K9CA 2NUBA 1P6QA 3N53A 1APBA 4FE7A 1VKRA 1JYEA 4Z9BA 4O1HA 1XWWA 1IIBA 3GWGA 1VRVA 1ZN2A 1A04A 4RSMA 3IDOA 3KYIB 4PEVA 5HQJA 5BRJA 4NCBA 1SXGA 2GI4A 1P6UA 3N8IA 3HZHA 2HJ9A 3NNDA 1ZGGA 4G0ZA 2GX6A 1D1QA 1Z26A 3NHZA 4QICA 3HCWA 1XHFA 1ZH2A 3OLYA 1XHEA 1D1PA 4TN5A 3UKJA 3CRNA 2A9RA 3MIZA 1LBIA 4XARA 3BRQA 2CD7A 1Y1LA 4YGXB 5FWYB 4UHJA 3FDFA 3T38A 5JNUA 5BRAA 1USIA 5KQMA 2PLNA 3O2QB 4NQRA 3RVSA 4MR9A 1EWTA 5TQ0A 4YV7A 1D4ZA 1ZAYA 1MB0A 2LBPA 4HYEA 2VUIB 2L19A 2M1ZA 2OQRA 1DP4A 2PAFA 2PKXA 1NATA 2JBAB 2IKSA 4QYMA 3UK0A 5IC5A 3MQ4A 2IYNA 4MS1B 4W5OA 5DLEA 1ABEA 1SXIA 1TM2A 2IPNA 3NNNA 1DRJA 3KLNA 3R0JA 5HM6A 3LTEA 1ZGZA 3KTOA 3NNSA 3B2NA 5DCLA 3N0XA 1NXOA 3I45A 1U2PA 3IPCA 3D8UA 4RZSA 2JVJA 1W25A 5EWJB 1GLGA 4HNQA 3IP6A 5IEBA 4JAVC 2WB4A 2FN8A 1RZRA 4MS4B 1NXTA 3LUJA 1SD5A 2P4UA 3RVPA 1RXEA 4IGAA 3H1FA 4D74A 5ED4A 2NT4A 5B3JA 3Q7TA 3QELA 2RJOA 3CS3A 1TMYA 2AYXA 4RK4A 5KI6A 1Z2EA 4CBVA 5IEJA 3LUHA 2F8SA 2IDMA 4F3TA 1BDJA 3OM1A 3F6PA 1DC7A 2MSKA 4EYOA 1PUXA 3HDVA 3FFTA 5T3YA 3GV0A 3BRSA 4RDCA 3H1GA 4KK3A 1JLKA 1S8NA 3KLOA 1NXSA 3CG0A 3EDCA 1QQAA 1ZY2A 1LBHA 2VYCA 3RVOA 3QEMA 3M9WA 3HSYA 3CLKA 2FMIA 4F8JA 5T7BA 3Q15C 5JNVA 2MYTA 2PUAA 2HPHA 4RKRA 1BAPA 3DGFC 3H5VA 4TMYA 4WXMA 1QP7A 1JWLA 1ZHHA 2IPAB 3C6QA 3EQ2A 3EJWA 3O21A 2AYZA 5I4CA 5KQLA 1DCFA 4G0PA 1KGSA 4S05A 5FWXB 5BQ3A 4G0MA 4LE0A 5F64A 2RJNA 4F06A 4FB4A 1PNRA 4H60A 5FWYA 3DLHA 1DC8A 1DBWA 3A10A 3CTPA 3VNBA 1WETA 2QV0A 3Q9SA 1NY5A 1URPA 1SXHA 3URMA 4RK5A 2FEKA 3T8YA 2GBPA 2JVKA 4XXHA 5IBQA 3KSMA 1F51E 1PHRA 2ZWMA 4PYRA 4KPYA 4L85A 3TO5A 4EVSA 1QO0A 3O2SB 1DRKA 3QLUC 1Z25A 1CHNA 1FSPA 4YRZA 1L5YA 2GKGA 3LUFA 4EVRA 3I5AA 4OBBA 3DGEC 3M9XA 1KMIY 2M98A 3IP5A 4LRQA 9ABPA 1H9CA 1MB3A 2PL9A 3ROTA 1CEYA 3M6MD 3ILYA 3OQMA 2RDMA 2FTKE 3GRCA 3T6KA 5JNSA 3MMNA 1ISRA 4WXEA 4Z4GA 1NXWA 1K66A 4KVFA 3OLVA 4O5AA 2PJUA 3ROFA 4XASA 4MQEB 4N0QA 3SG0A 5EWJA 4RXUA 3CFYA 3RVJA 1LK0A 1D5WA 1DJMA 4P98A 5TQ2B 1YMUA 1YVUA 2Q5CA 1ABFA 2E4UA 1TLFA 3GYBA 2JK1A 2B1JA 5DTEA 1U04A 1JHZA 5JNTA 3K4HA 4JP1A 3LKBA 3FFXA 1W9HA 3E3MA 2FW0A 3CZ5A 2LIVA 3NBMA 3HO1A 3GL9A 5IX8A 3N75A 3LUCA 2GWRA 4GNRA 2HQOA 4WWHA 3N6VA 5TE9A 4DADA 8ABPA 4Q6WA 1YS7A 3A0UA 2YHBA 2PUDA 4JASB 4UHKA 5D2CA 4NCAA 1A2OA 1M2EA 3KG2A 2MYPA 5HSGA 1JX6A 3EAFA 4W5QA 3DZDA 1Z12A 1MVOA 4XLTA 2FKAA 5CNMA 1EWKA 1TJYA 2FQYA 4G97A 4ZPJA 3HK2A 5IUKC 1QO0D 2I6FA 4ZJPA 4MRMB 2JB9A 2A9PA 1JL3A 1VPWA 3QK7A 5CNJA 5FWXA 2DRIA 3OLZA 5E3JA 2FXIA 2FMHA 6CHYA 3I42A 4L4UA 2OENG 4Q7EA 4MR7B 3Q7SA 1ZVVA 3F7NA 1KRWA 4RS3A 5C5EA 7ABPA 3FMVA 4RK7A 2WJWA 1JFVA 1BDIA 2HQRA 3BREA 2CWDA 3LKVA 4IRXA 4W5RA 5JNWA 2HSGA 4HNRA 3FGZA 4E7PA 3Q41A 4IMIB 2LUOA 3DBIA 1R8JA 3H5LA 1DBPA 3JPWA 2FEPA 4KV7A 4YCSA 4S04A 5CNIA 3EODA 3OM0A 1PEYA 3KHTA 2WJAA 2FLWA 5DGCA 3A3KA 1NTRA 3JVDA 2YHAA 3RVNA 2MSWA 2A9OA 1FFGA 1MAVA 3LMKA 1TVMA 1QPZA 1VLZA 1GCAA 3NHMA 1YS6A 4PE5B 3F6CA 4HNSA 4MPTA 2NZVG 5FBHA 3VNAA 1Z16A 2TMYA 3G1WA 4RK6A 4XAQA 5TPZD 1C4WA 1SRRA 4MQEA 3TX6A 1JYFA 1ZESA 1HEYA 2R25B 4WUTA 5JS1A 1USKA 1YIOA 3L6UA 5TQ2A 4W5NA 4LE2A 2ID7A 4KK4A 5TPWB 2J48A 3HS3A 3QLUA 2LP4Y 3ILHA 2O20A 3JY6A 3LOPA 3FFWA 1DZ3A 4Z4HA 3H6GA 2QW1A 1OXBB 2HQBA 4MQFB 4XFKA 3H5WA 4D6XA 4ZMRA 3CZCA 3RVKA 3HEBA 5EWMB 3DLBA 3QLTA 2QR3A 4JOQA 3HUTA 4LX8A 4RXMA 4KREA 1E6LA 2ID9A 4YO7A 3SAJA 2PUBA 2IPMA 1ZITA 3MA0A 4DN6A 4G0OA 4Q6BA 3HDGA 1RPJA 3RQIA 1QNLA 3BILA 4JB2A 3O1IC 2PL1A 4MRMA 4M88A 5IULC 1QQBA 5EWLB 3CNBA 2V0NA 2JBAA 4RY9A 3LUDA 4Z4IA 4YLEA 4MS1A 3SY8A 4MR7A 2QU7A 3KJXA 4RKQA 3LUAA 1EWVA 3HUUA 4ETNA 1NXXA 2PUEA 3EGCA 3Q7RA 1DCMA 3KKEA 4RY0A 4MR8B 1NXPA 3SNKA 5GQSA 2WMYA 2F8TA 4OLAA 2FEWB 2PMCA 4LDZA 4Z99A 3C3MA 4G0QA 3A0RB 1K68A 3JS5A 4ETIA 4OLBA 3MF4A 4NV3A 4W5TA 4MLCA 1OXKB 2R47A 4B09A 1LJLA 4N76A 2W42A 4MS4A 1JDNA 4RV5A 1I3CA 1E6KA 2L18A 4PICA 2WY2D 4RK0A 1EHCA 1EFAA 1QP0A 3EULA 2FLKA 4GPAA 2PUCA 1BDHA 2JCGA 4ZMSA 4KNYA 2VK2A 4OG2A 3QEKA 1YK0A 3HVRA 4KRFA 3JVIA 5KQPA 5TPZA 3H5OA 4OATA 2KYRA 2CHEA 2E4VA 4EY3A 2JRLA 4G0XA 4EUKA 1U0SY 3E61A 2FQWA 3LUKA 5DKFA 4Z4EA 1YTUA 1E6MA 5TPWA 1P8AA 4EGSA 3C97A 3I09A 1LJUA 2X7XA 4QYWA 4EYGA 1C0EA 3MYYA 3CKMA 2R4QA 5KQGA 4EYKA 1U2QA 2CHFA 3RVLA 1QKKA 4YR7A 1RXIA 3C3WA 3H5TA 2XDYA 4MQFA 2PUGA 1Z13A 3GBPA 2H3HA 3OLXA 1M5UA 4G86A 2A9QA 3SQNA 1ZDMA 5EWMA 3LFTA 3QLVC 1MIHA 2E4WA 4ZYLA 4RXTA 4QPJC 4D6YA 2QVCA 2QVGA 4TLMB 2FMKA 4MS3B 2H0AA 3KCNA 3SM9A 4EYQA 5KC8A 2E4XA 4O1IA 3GT7A 3TMYA 5HKOA 2RGYA 3F73A 3IP7A 3OQNA 4IF4A 1JFSA 3H5IA 1QP4A 3S99A 1Z15A 4H3KB 5EWLA 4N03A 3OLWA 2PE5A 1Z2DA 1U8TA 2B4AA 1D2AA 1JBEA 3D02A 5IUNC 4FE4A 4MR8A 4Z0NA 2BGGA 2QXYA 1DCKA 3GBVA 2P9HA 4LZLA 1PNTA 3BBLA 4RWEA 1A0OA 1GUBA 1RNLA 3QX9A 4Y9TA 3W9SA 2IPLA 2FN9A 4JB0A 5TQJA 2L17A 1FFSA 3KS9A 1QMPA 4N0PA 2R48A 2E4YA 1P2FA 1AB6A 4MLDA 4RK1A 1YMVA 3OQOA 4IILA 3RVRA 2MYUA 1F4VA 3LUGA 3OO1A 4LDAA 1JF8A 2QSJA 1BA2A 3QX8A 1L5ZA 4NICA 3IPAA 2NT3A 4KQCA 2L2QA 5KC9A
chains in the Genus database with same CATH superfamily
4CU2A 4PVCA 4ZO8A 1QZTA 1DIOB 1VI5A 2ECKA 3HI6A 4UW9A 1GOTA 3NYWA 3AQ4A 1UC4B 2OAEA 5F7ZA 3ZWDA 4LJLA 4EUEA 5DJ5A 2OV4A 3NC4A 1OREA 4X6YA 3IAS6 4NV0A 3BCRA 2G5GX 4KGDA 1KI2A 3JAKB 1ES9A 1VLHA 3O1HB 4KZPA 2D74A 1FSFA 2PMEA 5BN3B 3K2QA 1W47A 3ROQA 4WBXC 5AKIA 1LNZA 2QUJA 1XDDA 4FE3A 3N0RA 2ONCA 1E3WB 1DELA 2FSPA 2NU7A 4RSRA 2G6TA 1DIHA 4JT8A 1UJ2A 1KR5A 4M89A 3B3QA 3EUFA 4WY2A 2XDQA 3CF4A 4YB8A 4GX0A 3RB8A 1C9YA 5DT9A 3WWZA 2WOOA 3X43A 3ODPA 3G2LA 4PCLA 4PAQA 4MICA 3LVRE 3L3BA 1DAGA 1GTMA 4CMCA 3HU3A 1DEXA 2QI9F 1HDYA 3LL7A 1P7VA 4J16A 3PI6A 4NESA 4MWSA 1Q1NA 1CJSA 1ITZA 4RA9B 1UBLS 1ORDA 4HQ0A 2BV3A 2FG7C 2VJMA 1DBQA 4MMZB 3RQSA 3T12A 3IE0A 3IJ5A 5CXQA 3DEJA 5JSUA 1NBEA 1CU1A 4L8WB 2JI4A 5JPCA 1B26A 2IBMA 2FMTA 1JKJB 2R6JA 2RGBA 1CUIA 4PZLA 4BO2A 4Q3BA 3IV6A 1GKYA 1P3Y1 3I23A 1QE5A 4S1WA 1F17A 2NO1A 1LB1B 2XNHA 5B1IA 4IICA 4F2HA 1UKVY 3JPYA 3PC6A 1RMQA 1BMFA 2DFLA 4OFWA 5CNKA 3BPSA 4IRMA 1ZOLA 1NG1A 2GF0A 2ZAYA 3GD5A 3HJFA 1NQWA 1QX3A 3G9XA 1JTFA 3ZGXA 3OQHA 3HMQA 1FQWA 1U0RA 3KL2A 3QVMA 5BORA 5G0SA 4C6RA 1WR8A 2P9GA 1DFHA 2C5FA 2QRVB 3E2IA 4O08A 3CR7A 3VTKA 4PYLA 1HDGO 3WOVA 4D0NA 1I94B 2IHKA 2W2VA 1R4MA 1CQIA 2Q29A 2WFLB 3H2HA 4EQ6A 5BVGB 3WFJA 1GPJA 2HWKA 3W3AD 4J7UA 1YQDA 3SOPA 1B41A 1WHTA 4HDNB 1GADO 4ZT7A 3PL5A 4U2GA 3RSGA 3PUZA 3FTNA 3DQPA 1P6UA 3B8HA 1C3LA 1C81A 2PZGA 2VT3A 3B6IA 3CO0S 1X2BA 2X15A 1SQGA 3M4XA 3MNFA 4HWTA 4NDZA 1RAEA 3DEHA 3M6XA 3FMGA 3A6GA 5A2QA 2OHHA 1WW2A 1XE3A 1NVAA 2GEBA 2P68A 3UKJA 1QUFA 5C8XA 3GB9A 2O59A 3IOYA 3GGSA 4KQWA 2OK7A 4NOMA 1NE7A 2VDKB 1P1KA 1MABA 1XN4A 1M6VA 3OZTA 3RC3A 3I2KA 4UHJA 1E79A 2RHRA 2ETXA 1W36C 3N6XA 1NSTA 1PWEA 2J41A 3NIBA 1BVRA 2QN2A 1U0EA 3LHFA 4KDCA 4CMGA 4DZTA 5BRAA 1AZWA 3WL4A 3T7IA 5D5HA 3H9CA 4Y2HA 2E5WA 3RS3A 2ZYTX 1YQWA 2R00C 1V26A 4URYR 5JZBA 2Q3FA 2W4MA 3C4JA 1ZAYA 2EFGA 3F8SA 1MB0A 2GRAA 3B5IA 4JQYA 1NOKA 4OP3A 5LP1A 4BRSA 1TKRA 3AHIA 3L04A 1BKSB 4JVLA 4K9MA 5JROA 5IC5A 4ER5A 2DFPA 2FY8A 2FDCA 5C1OA 2C3YA 4RQBA 5LA6F 4WGGA 5FYDA 5EEGA 3NORA 4ABTA 3RKRA 4FVTA 2O0JA 2YOGA 1KZHA 1Q7CA 3CUKA 5CLHA 3OBIA 2C00A 2A1IA 2WJHA 1EFPB 2JVJA 4X65B 1OXUA 3FZQA 2FPWA 3CH7A 1GQYA 3WGNA 1KR2A 3UT0A 4YAIA 1TPYA 5E0KB 2D4HA 2XOXA 4FR0A 5TX7A 5DTRA 5ED4A 4EYEA 4YRQA 1ZH8A 5HZHA 4X24A 1XI2A 3MJSA 4PAOA 1Z5GA 5B3JA 1Z63A 1H2FA 5F7XA 3SC2A 4BZXA 2E9SA 1GTZA 1QK5A 4NOLA 3LUHA 4CBVA 1DUSA 1T29A 2Q4BA 1Y8AA 2WPDD 4EF5A 1XBTA 2HNBA 3NEYA 3UGKA 3FDIA 5EKTA 3HKCB 3WLJA 4KYVA 5GPBA 3UJ8A 2RBEA 5KPDA 4Z1MA 3GGOA 1N5OX 1DAEA 1LC3A 1XIVA 5J40A 3WV5A 5LYJB 5C46F 2QYTA 4ZT6A 1T3SA 2XGOA 2VZEA 4OLHA 4CUKA 1FVOA 3RABA 3RADC 2DJIA 3GRVA 4OEHA 5DYGA 2ZRQA 4C4YA 3M49A 1RQNA 1YACA 3UMVA 2OV8A 1E79D 1UBTS 1FFAA 2JFVA 2FMIA 4MMYB 3X1MA 1IDN1 4BQPA 4G56A 1CY4A 2QBYB 4Z7QB 2HPHA 2QP9X 4OL9A 2BTQA 3DGFC 2DT8A 3OIGA 4QQFA 3FIUA 1JAHA 3EZ6A 2PMBA 4OJQA 4WLNA 4CI0B 4UE3S 4KRGA 3ZU6A 1XXHA 2WYUA 2REQB 4MGKR 1IC6A 4TTVA 2I5PO 3QYFA 2PKWA 5TMDA 4DCOA 4EZBA 5KOJB 3BFKA 2ROQA 1XP5A 1MV5A 3HWX1 3I83A 4KE9A 4KLCA 3WL3A 2C96A 3D7SA 1BKYA 3EDYA 1V8FA 3G59A 2YWGA 1R4ZA 2AMYA 2IZ6A 1I2ZA 2XX3A 1JEQA 2I22A 3F46A 4Z9FA 4LC1A 3Q9SA 2QJTA 3D3EA 4NHOA 4OCZA 2H48A 2FWMX 1A2QA 4RIHA 2J9ZB 3GGGA 1XMVA 3ZU2A 3Q2KA 5TB5A 5LZ7A 3KZCA 3T7KA 4Z9YA 1KTIA 4W8GA 3LLMA 3THRA 4HCJA 3EFEA 5T6BA 3RSLA 1I1NA 2BFDB 5FEUA 2GK3A 4UNQA 4GM4A 2P62A 4O8CA 5JATA 3NKFA 4EG8A 4JLOA 2XHZA 1LX6A 4H9GA 3UOGA 3KJQA 4GKJB 4JL8A 4CCYA 2XA9A 3JALB 4BNMA 5F1OA 4ZHQB 3STTA 1A88A 3M6MD 4B75A 1CEYA 3GNSA 1QXSA 3WGLA 2SCUA 2EV9A 2AZTA 4K6KA 4WPGA 4X8OA 4Z0PA 4AQDA 3G8BA 4Z4GA 1Q19A 3T15A 4QDXA 2HXYA 3AHJA 3F74A 3IULA 3L05A 3LSTA 4L7VA 4A2PA 1UBRS 4FFOA 1CQJB 3KWFA 5BMVA 1EX9A 3ZLUA 3PLAE 1NVMB 3FB4A 1OH6A 2XXBA 3AKYA 1M6YA 2JGJA 5T41A 3R2JA 3VC1A 4FUQA 2ISCA 4C4SA 3WGQA 2JEZA 3NG1A 1PU2A 2F3SA 1Z7BA 3AVXA 5ECWA 2H7CA 3D2BA 3RC9A 4DNOA 1U04A 3EXEB 3TM5A 4EPTA 4IDFA 2GESA 1W9HA 1VECA 4NMWA 4RHYA 3ZJUA 4JI2B 5DU2A 1GGNA 3KAQA 2LIVA 4CQMA 3C6BA 3LQQA 3TFWA 2QD1A 2VP6A 1PW7A 1NLMA 2WG1A 4HQRA 5J2UA 3OT4A 1R4NB 1C7JA 1NMZA 2PNFA 3NANA 1R3UA 1QZUA 3MCVA 1GG9A 3GELA 3G2PA 1OFVA 1U7XA 5EZYF 2OCIA 3QUSA 4E6EA 1DO2A 3BEDA 4Q1EA 5EJ8A 2HW8A 4HGYA 4G5SA 4YUWA 4W5QA 2JANA 4FJ0A 4D4HA 4W8OA 1NYLA 3MPUA 3ZI0A 2YICA 5BPFA 1GTSA 2D0PB 4P7GA 1WL8A 5AI4A 3S5UA 4C0XA 5CVEA 4J1TC 4EUNA 1EQUA 1EWKA 5E7IA 5HQ3A 3EQ9A 5IUKC 2NSHA 1J42A 1SRQA 2DHRA 2GWHA 3NUZA 4JA0A 3A05A 4LXHA 4QUJA 5FTKA 4B9AA 5K6AA 2WTUA 5AXAA 4OFZA 4YLGA 3WMGA 2FEOA 5IDQA 2Z2YA 3DBHA 1CDEA 1BN7A 1D2EA 1PJ8A 1PJRA 2F3PA 4Y6SA 2FHPA 3PENA 5D6OA 1SIBE 4OLJA 4ZAFA 4ZD6A 6CHYA 2P2DA 2W00A 4KXXA 2I9KA 2IYLD 3QSYA 3F7NA 2FW7A 2PX5A 5GONA 1HK7A 3GPLA 5FA5A 4RZ2A 3WLIA 2DUJA 2VYNA 3UHAA 3LKVA 5COQA 4ZCMA 2VDJA 4WBNF 4RO0A 3TTTA 1EU1A 3KJHA 1JLMA 4HUTA 3CF0A 3DXZA 4RIGA 2FPMA 2PUJA 3DWEX 2XUIA 1C3EA 1DWQA 4GL4A 4INOA 1ZVJA 2EKZA 2J5QA 5JCOA 1JEEA 1RLTA 2EGGA 2LW7A 2QZZA 4OD0A 2HHLA 4P35A 3ON5A 5AI0A 1C0IA 3A4TA 1P0QA 3C8ZA 4MVYA 2WWYA 4OHFA 1NR1A 5K8TA 1JHAA 4I9FA 5DP2A 3DO8A 1G6Q1 4ND7A 3SXUA 5LWHA 1P0PA 2FF5A 3FSJX 4B6OA 3I73A 1LQTA 2IE8A 5KYYB 3OVMA 1HOXA 3H17A 2I6GA 3HYNA 4H7IA 3ZKAA 2QVBA 2XR1A 1BA3A 1JAZA 3HSKA 4HDSB 4CQMD 4MPTA 3J81A 3O73A 2BPOA 3HFGA 1R18A 1LA2A 3LY8A 1TU3A 2XGSA 3FSRA 4TT3A 4KQIA 4WUTA 3ZZUA 2XYRA 1OI3A 4NKRA 4N1AA 3I9JA 1I6KA 4H2DA 5E4YA 4LE2A 2H0QA 1H6CA 2JAQA 3NHLA 2E4AA 3GZJA 3OZVA 3A9UA 1ZBQA 5H7XA 1XCLA 4UEQA 2P6RA 4GKBA 1TZKA 4JBNA 4S35A 2AG8A 2GN6A 1TT5B 1J2EA 3GLHA 3FR8A 3H5WA 3EA0A 4LV6A 4N40A 1IATA 3NBYC 4LIPD 4PHGA 3HCNA 2Q0QA 4IRUB 4G1UC 4FGUA 2P2CA 4RVNA 4U7TB 4ZVLA 4L22A 3IV9A 1Z6GA 3VKHA 1KTVA 1HDRA 4RXMA 2AQ8A 3OPYI 4IJVA 4ZKDA 1K88A 2ZK7A 3DVLA 3SFVA 3ST7A 3VSCA 5K6RA 1CEEA 2X1MA 2VYND 3A9SA 2NTJA 2PRIA 3BB4A 4NFYA 1AUPA 4G0OA 1CY7A 3CLSC 3HDGA 4NENB 1SWVA 1T3GA 1U2TA 4PO3X 5JG7A 4YLYA 1KO7A 4DIBA 1CJVC 1P0MA 3G1UA 3F6RA 5JECA 2YWRA 4M88A 4BATA 5IULC 5LLDA 4Q9KA 2Q4DA 1QQBA 4YP5A 1Z4NA 4KSBA 5EJMA 4I4NA 3IA2A 3MG9A 5ITSA 1GZDA 1QH9A 1Z28A 1DXQA 1QORA 3AEKB 4JUFA 3SZGA 2COEA 5LOVB 4P4SB 5DLQC 4D4LA 4A23A 1R8SA 1K86A 1DIRA 1T10A 3FNFA 3CUSA 1L0BA 4FBGA 1A72A 1OASA 3LCUA 5HRCA 5K01A 3B1ZA 1WY5A 5AW7A 2BMDA 1NXPA 3ZDRA 2EFHB 2QLFA 1Z3CA 3VPBA 1UMDB 2ZATA 1V8ZA 2NXNA 2QYSA 1XFAA 1HX7A 5CLJA 3QV1A 1B4DA 1Z5VA 1NYTA 1L4FA 3UJBA 2ZQYA 3OCYA 1ZUWA 4JMLA 3JQAB 4WINA 1NI4B 1LPNA 4LCJA 1PQ4A 3DZGA 4PICA 2L18A 1KOLA 1TRHA 3TJRA 3DL7A 3ZE0B 4DL9A 2IPOA 4PG7A 1XXHE 1CLEA 3TQOA 1YA4A 4E31A 1N3IA 3EVCA 5CFRA 4FI3F 2OHGA 4KNYA 1UBOS 4KQ2A 4OG2A 5EJGA 1DTWA 2ZAGA 3E5RA 1Z6TA 2EX0A 2ZYWX 3F3KA 3W6OA 4BBJA 3FWKA 3LV8A 4EA7A 5ESWA 4EJ6A 5AOVA 1UMCB 3V1YA 1CUDA 3FXAA 4GT1A 5ELMA 5KJ1A 2O5EA 4F71A 4CEJB 3TG2A 1RJEA 5F5XA 2FQWA 4XOUA 1Z2NX 3GIWA 4L6AA 5IWCA 2OKGA 2BFOA 1MC8A 3BZWA 3DMPA 1I33A 3MIIA 4IHKA 2OE2A 2VF5X 3CN9A 1E32A 4GUDA 3DAHA 4OH7A 4FT2A 1OT5A 4XSGA 2G5TA 4YJGA 4EARA 2RHHA 1PZNA 1TU0A 1WUJS 3CUUA 3ELDA 1FX0A 1EBFA 3W2EA 2OLJA 1WSWA 2QMOA 5BW8A 1U9CA 2C2OA 1CJTC 4DLPA 3LBYA 1UKCA 1JDJA 3OJLA 4TKUA 4WBSA 1J2TA 5ECGC 4IDGA 3U3DA 3UZUA 3ZGOA 4B7AA 5A3RA 4UQPA 3RM3A 1RJ9A 5IN4A 4MQUA 5MN4A 4RTNA 5TMPA 2O23A 2XUZA 2ZWVA 10MHA 4J0FA 4B6SA 3RG8A 4C7BA 3K8QA 3MJFA 3MFQA 4MQBA 2YBDA 2R0QC 4IIEA 2NO5A 1BS2A 3L0YA 3N87A 2FPRA 3DUFA 5IYZB 4M9CA 1CV2A 1FLVA 3UGTA 3FBGA 4E12A 5SZHB 3VHRA 4OHYA 2EP8A 2R66A 3BWDD 4GP9A 1ESEA 1P2UA 3QG5A 3W6PA 4AMYA 4DEVA 2OBLA 1D2AA 2VNJA 3AV3A 3RTDA 5MGNA 4TS9A 3CN7A 1P39A 4B6PA 5AI9A 1D2HA 1P7ZA 1YZFA 4KU4A 4R81A 1YXMA 1IG3A 2GHRA 3WQSB 4HDMB 4LSMA 4LZLA 1XPRA 1HXHA 2H29A 4YDQA 1A0OA 3BHIA 1R6BX 5CGZA 3MJDA 3CVJA 1XOIA 5BMVB 2ZBRA 3JZDA 1DTSA 1JXQA 4Z3OA 1FP7A 1NW8A 1D3AA 4AJLA 2L0XA 2IWHA 3K70B 4QODA 3VI3B 2PH1A 5BOSA 1Y89A 5ITZB 2IZ7A 3OQOA 4LF8B 1FQJA 4IFTA 3OO1A 3B82A 3X44A 5B6PA 5DK6A 2O1EA 1AS2A 2B0JA 1UQRA 4CCAA 4YHBA 4ZK6A 5K0SA 3PC7A 5CVJA 1CTQA 3MRTA 1MAAA 2RHDA 2WA2A 2PRZA 2Y93A 3G2IA 4QUKA 4QOFA 4UUNA 4D4MA 1TQ8A 5EKSA 3D7LA 1KJIA 4I3FA 3S27A 1B16A 2HBRA 2VUHB 4X7RA 3RRYA 3HJNA 1RTTA 4YA6A 2OB2A 5EMJA 1G291 4YEDA 2HYIC 1P74A 1BDBA 3M5WA 2A5DA 4DV4B 4TRMA 3HRKA 1PQPA 4JHXA 4MOWA 3PNMA 5FFNA 5UKDA 3ZR4B 4TTQA 4OQLA 3K7EA 6REQA 5A3JA 1GPLA 4A82A 1OVMA 1Y42X 2I0FA 4C4ZA 4ZI3A 2EWVA 2CHQA 2ZTHA 2I7XA 4BY9E 3PQEA 2VJKA 3NJ4A 3U56A 4PAMA 1T43A 2GXAA 4OP1A 1KEPA 1UBNA 2V7GA 3ISVA 4O0LA 4LYGA 3DBHB 1PF7E 3TKAA 1ST2A 5A3VA 4IDEA 4DCCA 4QTZA 1UM8A 3GIDA 1OLSB 4FX5A 4ENTA 1JSZA 1NLUA 2V9PA 3RVQA 5L6MB 4DVJA 2B78A 3FGNA 3COSA 4IIBA 3EQZA 4CUZA 5GONB 2FQ1A 3DNPA 4PR0A 3AB3A 3AEYA 4AIIA 5CLIA 4GI7A 2FVYA 1AGNA 1EM8A 2UVQA 3SNHA 3VTFA 1J0EA 2W2OA 2BBWA 1F6WA 2VT7A 3QHPA 4L0QA 2X3FA 3DZCA 4M0EA 1DAIA 1R50A 4Z8XA 2BGMA 2NUAB 4HMQA 4ZALA 1NHWA 2FQXA 2PYIA 1UJ5A 1CRQA 2EBUA 2QD2A 3EF1A 1QFMA 3GLHE 3T52A 4F12A 4HLUC 4Q7MB 3H7AA 1UINA 3D6MA 4J49A 4JL6A 4BNKA 4YCBA 3KVNA 4E1BA 3G49A 3BVPA 1L7DA 4P8RA 2ID8A 2E6KA 3QFHA 2P79A 3QVKA 5U9CA 1T0HB 1XTKA 1QQTA 3SEFA 4KE7A 1OVGA 1WKCA 4LDPA 3HFRA 4UTPA 1AMOA 1A4XA 3PNQA 1SA0B 2FMFA 3HM9A 3HDYA 3C5HA 4HOYA 3JD4A 5CU7A 3RE1A 1UDRA 2GFIA 3L7YA 3O74A 4DPLA 5FI5A 1E7QA 5JJCA 1EESA 4FE7A 3H19A 3OCZA 5T4FA 4JBIA 5U4QA 3TL6A 4Q82A 3T34A 4FINA 4NHEA 1KY4A 2MMGA 4JH0A 2B9VA 3AC0A 1CY8A 3HNPA 3PHBE 3CCFA 4KWHA 5HQJA 3T7JA 4FT4A 4IGKA 3LBAA 4FEYA 4NS1A 1UJMA 3BTUA 1JIJA 1NM5A 5LKRA 5IRCD 3RWOA 2PZMA 1M67A 1T4CA 4WCDA 4MUXA 3TLGB 1MA3A 2NO7A 4DSNA 2OXCA 5FP0A 2NPIA 4X7MA 4M8NE 4RJIA 3R3YA 4NBWA 1VSTA 2BGIA 4U7GA 2A84A 3S7ZA 2I2CA 3SSOA 3U62A 4O6VA 1JEOA 3IMCA 1C14A 2W48A 4MVJD 4FFBA 3SX4A 4ALKA 3NDBB 4DLUA 2AW3A 1HDXA 4MR9A 4CMJA 1HQKA 2J9FA 1U7PA 2FPSA 2JIMA 3CUVA 2ZDGA 2F9FA 5DM4A 5F1KA 3QKTA 3ELYA 2P6OA 3IKLA 4QYMA 5AOBA 1CJKC 2BWJA 1EX7A 2F59A 4JBGA 5LWQA 2QJOA 4CMAA 1K4MA 2IPNA 2HH9A 2PT9A 2ZT8A 4MDFA 2YTZA 3DVSX 4X00A 3WNBA 2YJTD 4YRRA 4DNQA 1YDGA 5HILA 5A03A 1AM4D 4I1VA 4UMDA 4B43A 4ZZIA 1W36D 4UUPA 2C2ZA 3CT4A 3A9WA 2UZ1B 3KUCA 4WZ6A 3IP6A 3T3MB 4JAVC 1RZRA 1ZQ9A 4QZVA 2ZCVA 1G3IA 4DPMA 3CA8A 5JD6A 2F3UA 4ROTA 4JI0B 1EVQA 1QCCA 1G8KA 4EHFA 5JLAA 5B4VA 4X94A 1MX1A 1YD7A 3FCYA 1NRWA 2V7VA 4MYUA 2HWXA 3UAWA 2WF7A 1G42A 2UV8A 4ZV9A 3I64A 4TWBA 5IP5A 1WCYA 1N7IA 2CNOA 1BDJA 3OM1A 4XIGS 3CM0A 2UYCA 1G8HA 4X1YA 3S7TA 1DTWB 1SU7A 1E9EA 2V58A 4CR6A 5FH9A 1K97A 3KAPA 5FR2A 1LDEA 1WG8A 4Q9AA 3ZVLA 1JA9A 3DDWA 3GLIA 4ZN6A 1JLKA 3WKAA 2D4AA 4ZWNA 3ZPXA 4R6WA 1XDSA 2I3DA 1Z0UA 2FKNA 4F8JA 2CKMA 5ALIA 2HA6A 2KW5A 1WXDA 1H05A 2YRWA 5C9ZA 3QJ5A 1PFQA 2QLNA 3H5VA 4N5LA 4BB0A 4AN0A 3E5MA 3Q12A 5DNVA 3JVVA 5F9FA 3CWZA 3ZQUA 3K4PA 1H1LB 1X94A 4HAVA 5EKDA 3OQVA 1GDDA 3UWDA 2PVSA 1JNXX 3O7MA 4X62B 3VX4A 3ITDA 1QIEA 3DPUA 4S3MA 2P9YA 1U2GC 1V25A 2FWAA 3B53X 3BHJA 3IDQA 4WXRA 4YN3A 4RJKA 1HKHA 3CUEF 4QYIB 3LA6A 1U94A 5JZ9A 2CJFA 3ZHRA 1Q84A 4OHVA 4DV5B 2VWPA 3LWBA 2NGRA 4KBGA 3ZY3A 1DT3A 3ND8A 5ERGB 2IEAA 3NYRA 4YACA 1II8B 4BO8A 4JJFA 1F51E 2GPTA 4QFDA 4BGUA 3HUDA 3BIWA 5EL0A 2OLEA 4P3NA 5G3ZA 3O4GA 3RRNA 4ARZB 1UBKS 1YI0A 1DC4A 1I1HA 3VU3A 3HN2A 2H59A 3CRQA 2QRKA 4L8YA 2H63A 4N3NA 4RUKA 2E1RA 3DC2A 3FMOB 4E2FA 3QKRB 4EA8A 4B6QA 1DPGA 1NVWQ 3O3MB 3QPBA 3KQMA 3TINA 1JFFB 3FLBA 3OQMA 4L07A 3BXZA 4PV7A 3EGXA 4WXEA 2OHIA 1W49A 3UMFA 5HK9A 3P4YA 2PU5A 4NRDA 2WHPA 3RTAA 3ROEA 5LNK1 1AY0A 2ASEA 2XA1A 1V5IA 1XTTA 4E5MA 5B3KA 3PT9A 4P4TA 2JAOA 3CFYA 2RKWA 1SCDA 4FR2A 2AI2A 5C8DA 2PS1A 2C7GA 4FJ1A 4J1TA 4LC9A 5TQ2B 1YVUA 2F1RA 2HXSA 1THGA 2A6PA 2HMYB 5IAJA 5DTEA 4EUFA 4F2DA 3AR3A 3THWA 3TD2A 1CZOA 2Q27A 2Y0PA 1CQPA 3FHOA 3JD1A 3U3ZA 4EABA 5JY6A 3DC7A 3EVEA 3GA0A 3ZC3A 1NN0A 4NYMR 1U7HA 1DAHA 2ZXEA 1F8YA 1W44A 4XRRA 1JBKA 1EFRA 4FWIB 2JGIA 4HDKA 4XWGA 4US1R 1SG6A 4II3A 2JAWA 4K9OA 3CWQA 1VMAA 4EMUA 1N1DA 3HJCA 1M2NA 4JASB 2NQ8A 4UHKA 3UGJA 4MVJE 4NFHA 4ZTBA 4ZYXA 1OAKA 3GRZA 3EAFA 5K3FA 3X1KA 4CCSA 4DV2B 2XTAA 2IEBA 1M73E 1E9CA 2OP1A 1UK8A 2ZJ5A 4BNYA 5JS6A 3F8WA 1V4VA 1FPQA 1YCFA 3IT3A 3JX9A 3JQPA 1E2QA 4LK2A 4NBLA 4KJXA 4KAAA 1JSXA 5C3UA 4N5NA 2ZIWB 1F06A 1N8KA 1IY9A 2A88A 5EGSA 2IU0A 4RTQA 3KHUA 4L2IB 4KIWA 3KU4A 1IONA 1VLMA 3ZGYA 2E49A 5AESA 3WSTA 4G5RA 1W52X 4IG9A 4ALLA 2WVJA 3SR0A 5E3JA 2GEJA 2GD6A 3I5XA 2FMHA 3IS3A 2D6FA 1CT9A 2EGUA 1H0SA 2VHJA 1OE0A 2ZR9A 1U1GA 3LQRA 5D5PA 5EQDA 2A1UB 3T7CA 1GJRA 4CLOA 5DNYB 5HCUA 1Q7EA 2BZ0A 1UC9A 4DYVA 5AQEA 1I30A 2A9JA 4W9NA 3ZDZB 4A2QA 2XKJE 4BE7B 1ELOA 5JJBA 3L84A 2KJQA 4K88A 2LUOA 3QMMA 3PD0A 5AKZA 3SJZA 3TW4A 4C5AA 4AMGA 2BI8A 4IIYA 1JB9A 4TTSA 1WEHA 1Z37A 3EXG1 3GARA 5DGCA 3I5UA 4OHWA 2GERA 2YHAA 4BMPB 1AUQA 3GLVA 2HJGA 3I8SA 2QQFA 1PZMA 1MQ8B 1NVXQ 2FGKA 3FLEA 1NBHA 3DE3X 3Q6MA 2IY9A 3UB3A 4CM4B 2ATCA 1GCAA 3TZCA 5I7SA 1I10A 3SZMA 2JASA 2IS4A 3ZZNA 1EFRD 2BE7A 3RUCA 4DBLC 4YCNA 2DTXA 3A6EA 3ASUA 5DWDA 2IXTA 4FFLA 2F1JA 2WJ4A 3L18A 3TX6A 4BWFB 1YZQA 3RC7A 3QFCA 5LMNB 4OHXA 3U1BA 4NJMA 3R0VA 3DAPA 4EUSA 4IGEA 4OIMA 3T1OA 5TPWB 2L42A 3HCBA 2HXGA 4LWZA 4U7HA 1UBJS 1YV9A 2LP4Y 2LXNA 4P08A 1MXHA 1SG0A 3E9ZA 3QIVA 4GMGA 2BISA 3VBEA 4QPCA 5BV2P 5L3QB 2PM8A 4QOGA 3IUYA 3P9SA 2IQIA 1L6RA 4D6XA 1ZHOA 3RK4A 2HT6A 2WK1A 1RWNA 2ZBUA 1EYZA 1KAMA 5EWMB 3UUFA 2AHRA 1Y1TA 4JP3A 4BX8A 2UKDA 4BO7A 2ZQ5A 2E5LB 2AZDA 1J0BA 4P5DA 1JIUA 2V45A 1K27A 3ROZA 5ENZA 1R0CA 3PJGA 3G82C 2QN1A 1SUFA 2VK8A 2FWJA 3TD6A 1T6BY 1HE3A 2A0XA 1NAHA 5C8YF 5CA1F 3W6NA 4XR4A 1XTQA 3SF0A 3GAZA 5FL7A 3T3NA 4FYKA 3QQPA 5EJ9A 2IYPA 2NUPB 4V0SA 4BAGA 1EDDA 1FUEA 3GDOA 3ULKA 1IWOA 2C4NA 3ITEA 3W5HA 4DLKA 4W99A 2WUEA 3IBSA 4M0FA 1XMXA 2QYOA 2UYGA 2YW2A 2JS7A 3NEPX 1LVUA 4WZAE 1EWVA 1E98A 3DHNA 2XNDD 1Q1EA 5F7OA 2P6PA 2PUEA 1PL6A 2PGLA 5ALPA 3RC1A 4G9GA 4CIBA 4NAHA 1OX4A 3DT6A 2AGVA 3FWPA 4Z99A 5EY5B 4QG7A 1QLHA 3R9KA 3T7TA 2IHVA 2ZB7A 3U5ZB 2QTVA 2FPGA 2YZ2A 3O38A 3DOEA 3OX1A 1PGQA 5GP1A 3CLSD 1ZN8A 1TA9A 4RCYA 5HIKA 1JDNA 2BP7A 4ZREA 1P2GA 1L5FA 1ZK4A 2AWNA 1GQQA 1YHNA 2X3UA 1Y4ZA 3FWHA 1GILA 2CLEB 3I72A 5LQSA 4HNUA 1RLOA 2D0DA 4N3BA 1NUSA 5HK8A 3IUBA 4TYQA 2VPXA 2QL5A 2BFAA 4F91B 3BGVA 4NYIQ 5GVSA 1YK0A 5TEWA 2QA5A 1KWKA 4KPUB 4RH1A 1NW9B 2VDUE 4Y6PA 4J0CA 1WQ1R 1FNSA 5DB4A 1V1MB 3HNOA 4K81B 1G21B 4OM8A 4D99A 3ZHVA 4BLQA 1LPOA 2ECOA 4HVTA 3KDSE 3VR2A 3HP4A 1ISGA 2A9KA 5GIPE 2R96A 5AM4A 1E9BA 2GAOA 1QVRA 1YBVA 4X1IA 2BM8A 2FFHA 4U0KA 5D87A 4D4KA 2QE7A 4D80A 4CLEA 2AN5A 4NLLA 1GNSA 2EKDA 2XTMA 1EAMA 2WAOA 3H5TA 4WUVA 4DCMA 1U0FA 4LDNA 1SBCA 3EMDA 5FL7D 3WAGA 1EFKA 2VJDA 3GBPA 1N3YA 3NXSA 4FYJA 2H8KA 4FIDA 4O2BA 2E4WA 4OK5A 3NVAA 5M34A 2DR2A 1WZ2A 2LVBA 4LXGA 4UHFA 2QVCA 5GJWC 1Q7TA 3AUYA 1O95A 4J3JA 5TXGA 1SVNA 1R0BA 2VWHA 3DBOB 3FPGA 2HCFA 3PPXA 4UE6A 2C57A 3NALA 3T5PA 4GYYA 4A16A 2CKDA 3RASA 4YRBA 3B5JA 3TR5A 2BF7A 3F67A 4LBZA 2O8DA 2WQZA 2YHSA 1GZVA 3T1NA 5KNCA 1JHXA 1FJXA 1TCAA 2O8CB 3O31A 1ADBA 5TNXA 1KEUA 2FJPA 3LPNA 4MYCA 2W0MA 1NQAO 2LE0A 1JPVA 1IZ7A 4HEJA 2B1GA 1QRRA 1TYCA 2DYKA 1Y1SA 3L1IA 1IVYA 3OG9A 4RLQA 1C1DB 5F2OA 4QECA 3ZDFA 4FEGA 2RC6A 2B37A 3M6IA 4BX3A 1XU9A 3AYZB 1VGVA 2PEYA 2POQX 4BTVA 3GYGA 4KDEA 2EZ4A 3DKIA 3GBVA 5HG0A 1SULA 5D84A 5JAMA 1IIRA 4R2HA 1O1YA 3R41A 4UXHA 4YJ2A 2JCXA 4GOND 4QTTB 4EG6A 1C9MA 1O5OA 1CB7A 3WMXA 1CUAA 3D4NA 4TLCA 4FMBB 4IFIA 2IS1A 1JQDA 2DR3A 5EFZA 3VR2D 2G1KA 2VHQA 4GP7A 2E87A 2XUGA 1HT2E 5JXWA 5JDIA 2P78A 3THWB 4FHFA 4CKWA 3U4DA 3DS8A 4CF6A 4RIEA 4ZU6X 4LDAA 1TKBA 4WK6A 2GYWA 2VAMA 1BDMA 3ZWOA 1U0BB 1L5ZA 3DJFA 5B7QA 2GN8A 1H2HA 1NSFA 1J0CA 4HDKB 1FNBA 3R3UA 4I6EA 1F20A 1JSRA 4EPYA 5J43A 3V34A 1KP9A 2EARA 1CBUA 4BNVA 2GJAA 2JIQA 2KQUA 1O95D 2YWBA 4M1OA 1LFAA 2AXPA 3O3CA 3VV3A 4F6LA 4WFIA 1T5IA 3FYUA 5C18A 1JSCA 1J56A 5JNRA 5KINB 4Y1EA 4G1FA 3BF8A 4JR1A 5ALGA 2R1TA 4RGQA 4WT7A 3TOSA 4DR3B 2J7PA 3CRRA 4ML3A 4E1AA 2WMOB 2OUKA 1PT6A 1ONSA 3T7DA 1CJCA 4E32A 5KNCD 4OPMA 1M2OA 4L4YA 2DUNA 4HADA 1V3VA 1Q15A 2BGLA 3QE3A 4YTEA 5TQVA 3C48A 3T3OA 4PQGA 1PX0A 4NZYA 1C7EA 1RDFA 1GZSA 3NBAA 1Q6ZA 1V1RA 3WL6A 2XOKD 3ZX4A 4LF6B 3O1JC 2Q49A 4LYDA 3I76A 4HN2A 3PFBA 4MS3A 1D4FA 2XT9A 1HE2A 4MV6A 5TSDA 1FRVA 3FNQA 2E89A 2AQIA 1V8OA 1OOEA 2WD7B 3EBOA 4K6FA 4CDGA 5LIPA 3ZIUA 3QG1A 3QP9A 2D54A 3EUAA 4DR2B 1JU9A 4MGHA 3N6RA 4BX9A 1CYEA 2ZRJA 4Z9AA 1GUDA 1G5TA 4GXRA 2Q62A 4H31A 4PLYA 1KPIA 4YIHA 2BBTA 4D79A 3EFBA 2WU1A 5LYYA 1SKMA 3B6JA 2I2WA 4M0MA 4AI6A 1U7WA 2Z09A 3BMCB 3INNA 4P5PA 1T4BA 2JZNA 4QYTA 2BFEB 3UV7A 3VZQA 4BYMA 4TV8B 2F64A 1KXZA 2QVZX 3AZPA 1YZKA 4BJ3A 2R5NA 2ERXA 1E2BA 2QR2A 2IUUA 2GNPA 3JQ9C 1H0KA 2XMGA 1M33A 1F12A 2GCPA 3BTOA 1C7FA 4JHLA 4PX9A 1N9GB 5EHGA 4OUDA 1DEAA 3GJYA 4H3HB 4MW5A 4AICA 3GNTA 4KZKA 4AX8A 1LZKA 3DV2A 2AN1A 4HWSA 1Q0HA 3ONEA 1TEZA 1OWNA 3U7RA 1QF7A 2QJWA 1M8KA 1C8VB 1GKLA 2D1RA 4ED9A 1W4LA 5ABPA 1FS4A 1JILA 1UAYA 1GCGA 3ESQA 3QEMB 5DEIA 5L40A 1ORWA 4QUDA 2VH2A 2PUTA 2SHKA 1IIBA 2ESRA 1EIZA 1VRVA 3SZUA 5BWCA 1CJMA 1FUYB 2WMDA 2WFAA 1JAXA 1MORA 1ZGGA 1LLUA 2PX6A 1M72A 2MINA 4ARSA 3UBTA 3NC0C 4CQJA 2BC9A 3V9AA 1JN0A 4QBKA 3MT7A 3CEMA 3E9NA 3L07A 3MCZA 3DHEA 1Q3KA 4HX5A 1DLIA 1A9QA 4DF3A 2F4VB 2R5WA 1T5SA 5B7GA 2Q1TA 1E6WA 3ONDA 4TUYF 1G1AA 2P9FA 5DX1A 3BRQA 5DE3A 5BWNA 2PLAA 3I0NA 1T0PA 1Q1BA 4GPD1 3UHFA 4A6XA 3DWIA 3PGKA 3PRKE 4X3OA 3ENWA 4AQYB 1POWA 3GLFE 3GVHA 4PZZA 1NJ5A 4WN9A 5F5NA 5JJKA 3OOWA 3QA3E 5B55A 3AM4A 3B6EA 1ZU5A 2QTCA 3F2VA 5FUXA 3SIPA 4C2BA 1XYGA 3AM5A 1YBAA 4CF4A 3K6SA 2GM3A 4D43A 1U02A 3R40A 4GG1A 4IMRA 1QHIA 3H13A 2UZ4A 1TM1E 3S2ZA 3Q7EA 1SXPA 5D6NA 3AR9A 3QVOA 2JAUA 3PQ3A 3WQBA 3CLTC 3BL6A 5DLEA 4KQ6A 4EGAA 3J7AC 2VDLB 3NYIA 3MRVA 2H7YA 1KDVA 1V4NA 2ZJ8A 3IT2A 4Y67A 4K86A 3U09A 2VH5R 2JF0A 1FA9A 1OYOA 2EGHA 4GYWA 1JQ3A 2YIMA 3QU4A 4X3CA 3UAYA 4D0SA 5CH8A 1ISHA 2QTVB 5AKLA 4E5KA 4ZOLA 5D5QA 2YQZA 2CEAA 3BGSA 3F5MA 1YOVB 1M10A 5BSMA 4IO1A 1U8FO 3R20A 2Z5FA 5IF3A 3WY9A 4LI3X 1KSGA 3SVTA 2C88A 3GH3A 1RHRA 1Z2EA 1RXUA 3NXKA 4MTLA 2C4HA 4PBTA 4V02A 4XFJA 3FSEA 4ALJA 1QCDA 2BSXA 3MQFA 2PRKA 4NNJA 5BYKA 4K0KB 4TTTS 1A76A 3PSAA 2MSKA 4R8MA 1KJQA 1QHSA 1JJVA 1MOPA 5BURA 3HRIA 4GHWA 2Y67A 4RLFA 1TTQB 2JA1A 3BXFA 7ADHA 3BRSA 3AU9A 2AEFA 4RAOA 4YMVA 5I8PA 1QVVA 3IO3A 1NXSA 1CPYA 1MRSA 1W93A 3QVLA 3B2EA 1QQAA 1DDIA 2VYCA 4FYMA 3ZIAA 5JTUA 5KEIA 4D9FA 1BYUA 2BMEA 5L95A 2UXCB 4I1YA 1VL8A 2AOVA 3D1LA 1E1KA 1JLLB 2C9CA 1I1OA 4B3DA 5I6DA 3L0PA 3EXHC 4PPYA 5CBPA 3CH5A 1TZ2A 5FAXA 4B81A 1JU3A 2Q6OA 2HJVA 2WAMA 5CXUA 4CIVA 1VHWA 4WESA 3AFHA 3V7YA 2WYOA 4DXAA 4J0QA 2H1VA 5F9MA 2IPAB 3S2UA 3ZEIA 2JJ2A 5E7QA 4G0PA 4NBTA 4MKZA 1QAQA 1U8XX 1KGSA 2ZYDA 3ET4A 3O47A 4EX6A 4IDNA 4ZT2A 1L1QA 4BB6A 4E5UA 1BYIA 3UICA 2BFBA 2ADOA 2XGJA 4DT1B 1ICEA 3STWA 3A10A 2VYFA 1W7AA 5M5BA 1WW8A 3K0CA 2O0MA 2O4CA 1Y8QA 2B1IA 3MC1A 2G9QA 3PGMA 4FCTA 4PSDA 3L7KA 4XM0A 4EVSA 4MIYA 4NV1A 1HLDA 2GVDC 3GY0A 1NLFA 2GKGA 1U1IA 3QJYA 4I2VA 821PA 4W1PA 4PYOA 5HKKA 1RBZA 3KVRA 1P2DA 1IZZA 2ZUSA 1SHJA 3S70A 3EPJA 3N70A 3T9AA 1BS1A 2XD9A 1K9SA 3ZWCA 4DKJA 2DETA 2R6CA 4QAJA 2M6LA 3CYFA 3ILYA 4CKZA 2IYAA 3T6KA 2YYZA 1ZL0A 3D0RA 2COUA 2C7RA 4GMDA 5CVUA 4TGLA 2PGDA 3C4VA 4EPXA 1BXGB 1FP4A 1YC5A 2RKOA 2HV8A 2CUKA 3GVPA 5ITVA 4K9LA 4ND8B 1YI8A 5SY6A 3NRJA 3KX2A 1RI2A 1HT0A 1UK7A 2JLSA 4P82A 2JK1A 5EINA 3N3BC 2NO9A 1U7TA 1HTBA 1W5EA 4GNKA 3K4HA 4MWTA 1UIRA 1VRCA 1Z34A 1LNSA 2EKBA 1E61A 1FRNA 1PR6A 1DG1G 4X1KB 3DTYA 3HP1A 3EG9B 1YFLA 3I9V6 4KMSA 3U7JA 4HNHA 1RM5A 3OLCX 4GNRA 1COWA 4QFCA 2XMRA 4M46A 4YCDA 1E4OA 1ZNXA 1YS7A 3SOZA 4EO9A 2O8FA 3ZK7A 3ABIA 2VS1A 3QNWA 4LQCA 4B84A 4A4DA 1Y7IA 2O3TA 3IMKA 1ECCA 3IEUA 3REGA 1XRQA 3NC1C 4ZYYA 1UDBA 3NAQA 4K1XA 2DR0A 4D1YA 1DINA 3O4RA 3WRXC 2YYSA 4C3UA 1U8AA 4U63A 5IJ9B 1PSWA 4YHHB 2CNWA 2F17A 2R1TB 2WIKA 1N34B 4WKNA 1F2DA 1R9MA 1X6VA 2I4IA 3BHMA 4PG4A 3DULA 4DCTA 5BV1A 4MRMB 4XLLA 1M2OB 1RD4A 5AJYA 3UN1A 3I4LA 4P7KA 4U5XA 5HKKD 1YZ3A 4PC3A 1ODIA 2DRIA 1Y9EA 2G80A 4AP6A 3P0RA 4IHJA 1GGFA 4KHZA 1U2DC 2P0YA 3AGQA 4AKIA 1QOQB 1TZCA 2BHLA 4R3WA 3WIVA 3K6JA 3WICA 3RYCB 2AEEA 5BSVA 3JVEA 4I1SA 3IRUA 2XBMA 3VVCA 3GEPA 5CD1A 1OWLA 5C51B 2Q3EA 2I54A 3EXFB 3X2EA 2YFKA 1G18A 1SO8A 3E8MA 4ZVKA 2OESA 3RW9A 3QEAZ 2FSIA 1E9DA 1GNQA 4G8JA 5DDIP 5KZMB 1XRRA 2PHZA 4O63O 3I3SR 3QE4A 5CW1A 3ZE2B 4A7PA 3FPLA 3H8JA 1GCOA 1UC5B 4NFLA 3WOHA 1TJ5A 4KPFC 1TVCA 4EJSC 1FTNA 1GHTA 3U9LA 3RVNA 5KWIA 2ZJYA 2IYOA 3RUHA 3DT8A 1UZMA 3HKDB 3LMKA 4IM7A 1GCIA 3FUWA 3FKSA 4FOOA 4I6JA 1QPZA 4PLWA 1M3SA 1VGRA 4EAAA 3HU5A 1CUCA 5CB4A 3LYLA 4XFDA 3M9LA 2D2VA 3GMDA 1P1RA 3G1WA 1SOAA 4OUDB 4XJTA 1W46A 5ALVA 4OFBA 5KNCH 1OV4A 3PITA 3FPAA 1USKA 1MXFA 3K0KA 3OF3A 4UU7A 3WIDA 1GYPA 4YYZA 5A1JA 5FLKA 3TSCA 4ADSG 4ZEVA 3L7BA 2C7VA 2QL9A 3R3SA 1XZAA 4ACAA 3A14A 3FG9A 2V65A 4HC4A 3ROPA 2J33A 3TTUA 2ATVA 2HHCA 2G06A 3OCJA 3G7SA 1VSBA 2QW1A 3N8HA 1YZTA 5FQNA 2QPAA 3EARA 1NDHA 4HQ6A 3LDHA 3K53A 1T5DX 4ZMRA 1G8JA 5J9FA 2ZRGA 3HABA 4ZODA 4BBAA 1E8MA 3QTBA 3U2QA 3P2IA 2JIPA 3NTXA 4H1UA 5KNDD 1JDVA 1GSOA 3KR0A 1H3NA 1X0XA 1JIKA 3OTOB 4KLAA 1E6LA 2J0SA 4JKOA 3K71B 4Q3CA 2ID9A 2O2CA 1Y8RA 3COWA 2PDAA 1N2ZA 5J2UF 5CDYA 1ZITA 3MA0A 5KU1A 2J0UA 2BBOA 2QDKA 1MTOA 1QNLA 2A0WA 1MTZA 2GFHA 3BXGA 4WOPA 5E8JA 5G4KB 4R8VA 5EIOA 1ZI8A 3SGLA 4ZAVA 3EYWA 3NIFB 4OU5A 3JAWA 1JQ5A 5EWLB 1SUDA 2JHCA 3WWPA 3TF5A 3ZD7A 1XC7A 3EIXA 3DA8A 3DT9A 3L5KA 3UWOA 4A15A 4RY9A 3LUDA 1VOTA 3NWPA 1YRYE 4JKIA 1VB5A 2HO4A 3K9GA 2QX6A 3N74A 2NO4A 1NUQA 1HF3A 2A0KA 2IU4A 1JPJA 2WKQA 1W5AA 2ZRCA 1KBQA 2FW8A 3AL3A 1XKLA 3KKEA 4JROA 1R8YA 4RY0A 4EB6B 1BXRB 1T2FA 1TO1E 1PKXA 3BFVA 1INLA 1XZMA 5DTMA 1D1TA 2RHTA 4FCVA 3SVZA 2GPJA 4G0QA 1ID1A 4WDRA 1Z4MA 3JS5A 4LBVA 2RGNA 5CX1B 4BMDA 4NYJQ 1D9ZA 1LJLA 1RLMA 4PLCA 4MS4A 4B4UA 1DJQA 3GCXA 1QHNA 1ZUHA 3DFKA 3C24A 5H80A 3HL4A 4G07A 4JJ4A 4ZIRA 5E2AA 2B5VA 3LK6A 1QB7A 3QTLA 3PSHA 4MEBA 5AKYA 2X41A 3DVQX 3PNLA 1YJXA 5AI8A 4KH1A 1PJCA 2XCOA 4RKEA 2YZ7A 2OZLA 3D54D 4IJUA 1D2GA 2XCLA 5J58A 1NPTO 1C0KA 1RIFA 4KVGA 2NM0A 1QHGA 1X7GA 3TLKA 3RK0A 1GFSA 4QDOA 3J81k 3WBJA 4DRYA 4BPRA 4XEUA 3I58A 3D3NA 5AOAA 2B8EA 4EY3A 1FFXA 4D3SA 2JW5A 5JYEA 5E8RA 3LUKA 2OAP1 4HXGA 5HW0A 3BCUA 1R7RA 4WLFA 2VHYA 3KAJA 1LUAA 3QM1A 3TLBA 4A26A 4WD3A 4F8EA 3MYYA 1EZZA 1Y81A 4KBYA 4NH4A 2OFFA 3WWEA 4XYLA 3RVLA 3G0DA 3EMKA 1MOSA 3W1VA 1P6XA 1BMQA 3P0HA 4K9SA 2NOAA 1QH1A 3CB2A 3CJRA 1K5PA 3GJ4A 3SBXA 3LX4A 2B6HA 2ZSIA 4NWIA 4ZYLA 2FWBA 4OB6A 4DE5A 4IXWA 1BH6A 4C22A 3AEQA 1SOUA 5ARCA 1A9TA 3KB1A 4YDSA 3VHLB 3WQHA 4KPEC 1GKKA 1TA0A 1ZGBA 4JDUA 4CR7A 3KCNA 4I46A 3BG5A 4XX1A 2ZUTA 3SM9A 4A1OA 3AX6A 4DUGD 1YA6A 2RH9B 3SEQA 2E4XA 4RTPA 1L3IA 3V4RA 2R2GA 4J1SA 4CETA 1BHQ1 3DEAA 1GXSB 3ZW9A 4MZDA 3MWKA 4B76A 1IJEA 3LBIA 4DMRA 1S8AA 3AY3A 3MJVA 3NBUA 4N3GA 1CQXA 1N2GA 4HRVA 3HA7A 1JT9A 1TFRA 2DQKA 3L8MA 4LNHA 2CFIA 2F7SA 4BGVA 3Q88A 5CEFA 3DFMA 1S8FA 4FYWA 3NIWA 4UMVA 1DC3A 5GM1A 1CF9A 4OYRA 1U8TA 1E8NA 4EENA 2WWHA 2OK8A 1YKSA 2B25A 1JVBA 4R3NA 4BNXA 5IUNC 1LC0A 1Y1PA 4KQXA 1E7WA 3WB9A 4EITA 5JRJA 4V1CB 2BGGA 3NAGA 1Z4LA 1A5AB 2WHYA 2MIIA 2XWBF 4L1KA 3P71T 4JODA 1Z36A 3H11A 2Z57A 4RA6B 1RAFA 1HNXB 4LRXA 2CVQA 4JB0A 4OREX 4DMMA 3AP1A 1ZVQA 4IIVA 4RQTA 2W83A 2UAGA 3KS9A 2IHYA 5LXTA 3A2KA 1SBTA 2GNAA 3G6KA 4K9NA 3MXOA 1I7QB 1NASA 4RK1A 4DLBA 1P5FA 3VYSB 2JHPA 4AO8A 2MYUA 3GJ5A 1JDSA 3OU2A 4DBLE 3GRUA 5KMGA 4C7OA 3GR6A 3NDRA 2QM0A 2AKEA 1PE0A 2HMWA 1LRJA 1OKKA 1ZH0A 4XUDA 4DMUB 5H4GA 1JFLA 1X86B 4W9RA 4LF4B 2I4NA 3IPLA 3NBQA 1H8HA 3EGDA 1J9EA 3KKMA 1CUJA 1SIOA 2VOJA 4KQ9A 5HCNA 5CDGA 3LLVA 4Q05A 5JWRA 4TV9B 4NE9A 3AYXB 2VSQA 3CNQS 3HFJA 4I4TF 2ZOSA 1Z4PX 1HYEA 8GPBA 2J5RA 1ZGAA 1OFTA 3DMTC 1FFWA 4WOCA 1J97A 5H81A 4CL8A 4DHEA 3K0SA 3JWEA 3OZDA 2D5CA 4IS3A 5EXDA 3GAMA 5KOYA 5IAGA 4IYJA 1E2FA 3OU6A 2ZETA 5ECDA 1LSUA 5CVVA 1PEAA 3EIQA 5DWVA 4MULA 3W2FA 1ULBA 3EH2A 1L8QA 2QTNA 4LMPA 4ZZ2A 2O52A 4Y6LA 2D0IA 1U5CA 3K16A 4N7MA 3M6UA 2HJRA 4G84A 4MIKA 4QOJA 5DNDA 3SQOA 4EG5A 3L82B 4IHJB 4B82A 4DG5A 2JFGA 2BTEA 2X13A 1HO3A 1CXZA 1MGOA 1PJZA 2CMFA 3DZKA 1WSAA 3OO0A 4OFXA 4Q1AA 2CK3D 4QDZA 4RHCA 4TKMA 1DIGA 2EEPA 3U4CA 2AVNA 1TO2E 3NM6B 4OQEA 5GV8A 1MH1A 9ATCA 2FN4A 4XOIA 3BA6A 4ERXA 4F38A 5C31A 4PZ0A 5K0EA 4FGWA 5HRUA 2PMDA 4INJA 3NO4A 2YNMA 4AJ9A 1MAUA 1W73A 1PQWA 3AR5A 3H1EA 3VQTA 1Z18A 2V4MA 3HXLA 4CIWA 2E55A 4AP9A 3QE2A 1YZYA 2G1JA 3MGCA 3R5HA 1H1DA 2C5EA 2OUIA 2X2OA 1SIWA 2YUIA 2VF7A 1XTUA 4OL0A 2C3PA 3KT6A 4TT8A 1B8UA 3T1VA 3IHWA 5D1HA 1NNI1 1T36A 1K6JA 5ICGA 1OKKD 1NXVA 4GQIA 4DV7B 5KOHA 2PRYA 2ZYIA 2E18A 3IAEA 1H8HD 4OGLA 3KOXA 3SC3A 1A9SA 4OMFG 2BM0A 3PIIA 3S2IA 1Y48E 1L8AA 3ZY6A 3IQZA 3IXLA 3P9XA 4RZUA 4BE4A 3KT3A 4A8JA 4AUEA 5H9WA 2DLDA 3NETA 3PV0A 4L72A 5F3DA 2HWWA 4Y1FA 4ZI5A 4EW1A 3IAS1 1MEJA 4UNSA 1P61B 1M1UA 4O1HA 3GWGA 3U16A 1PVDA 1H42A 1OBCA 3QI7A 3IDOA 3KYIB 3KR2A 3OE1A 3A2LA 4LHSA 1Y3AA 3QBTA 4AKTA 2XY4A 4NCBA 1S2NA 1GU1A 1PLJA 1U99A 2C84A 2HJ9A 2OBMA 2V9CA 3LF1A 4LMBA 1UM9A 4UPVA 3RR2A 1RLJA 4X6LA 1D1QA 1C4KA 1W5FA 3C3AA 1YL6A 3G6WA 4L4RA 1PFGA 5FPSA 1XN1A 4BHTA 1RACA 4PC7A 2MOKA 4TN5A 4YXWA 4HLQB 1NC1A 2Y4OA 3LFHA 4WEQA 2DWQA 4MIEA 3U60B 3K9WA 2GZ1A 2NVUA 4NBKA 4BNJA 2PX2A 5M2QA 4ZYUA 2D0OB 4AJ4A 3TVDA 1F9AA 3H5AA 4E88A 5KYUB 3RAFC 2FSUA 2HKIA 2ZBGA 2J0UB 4BNDA 1J1IA 1PTJA 4MHOA 1CY6A 2OFXA 4EZIA 3BD8A 4FD3A 3O2QB 2YNMD 3ZVNA 1F0NA 3HADA 2YIJA 5TQ0A 1KI6A 4MVCA 3KQPA 4LUCA 4DCJA 4JP2A 3N2ZB 2DAPA 1N33B 4L4XA 2V03A 1MZPA 4BO0A 1K7EB 3L6BA 4MV4A 3TRDA 4DFDA 1L4YA 2A9FA 3C1AA 4GRDA 1XLWA 2B8NA 3UAVA 4X92A 3ZBUA 2H9YA 4BLOA 3LECA 2IU6A 3I2YX 1JEJA 2OMEA 2C4WA 3LY7A 3BE5A 3NHAA 5L3ZA 3CEHA 5CA0A 3ZCUA 3SS9X 2AC4A 2FWNA 3TIGA 3N5CA 2ZIZA 3P9RA 1NBIA 4KX5A 1ODLA 2PJZA 5HJ2A 1W25A 4Q16A 2ZRAA 3LXRA 5EWJB 3I6QA 3TQFA 1GLGA 4F4IA 4FGJA 1EUQA 4W9MC 4RVCA 4MS4B 1S2IA 2P4UA 2AT1A 3ONVA 5IVIA 4ZT5A 5LMCA 1SQ0A 3HKBA 4EHDA 1KSJA 2H2AA 1RWBA 4MVJF 4HWOA 5IJ0A 3HA3A 3QEOA 5I7WA 4FPXA 1OTXA 1RAHA 5DSXA 2R7AA 4BJ5A 4EI9A 3C3XA 5JO9A 1RLIA 4BQIA 1BE6A 2CF6A 1P5ZB 3CLTD 4L9WA 4EW3A 3OKPA 3UC5A 5FHRA 1L5LA 3D4BA 1VL1A 2O2YA 1MIOB 2IX3A 3TRHA 2ZVDA 1HZZA 3MWJA 4FWBA 3NH6A 1E1MA 3MAJA 2W6PA 4MKFA 4ZC8A 3CG0A 1M0SA 1QE0A 4IQFA 4Q4DA 1RPAA 1GKUB 1CK4A 2HEGA 2B5OA 5EFOA 3FNEA 4UPEA 4U7FA 3ZQJA 2ZLBA 3HSYA 4BKQA 3FB1A 1DEHA 2LWIA 2IH4A 3PR3A 3Q15C 3L8YA 1G20A 3ZBPA 4JI8B 4OQNA 2V98A 2HF2A 2OG2A 4DLWA 2IODA 1KVQA 4TZ6A 4M7RA 1VG8A 2QUBA 1R0KA 1VG1A 1NVFA 5JCPA 1L5GB 3A9VA 1A69A 5AVRA 5C7IO 3PHJA 4BRWA 3NATA 5ES3A 5BR8B 4MWBA 2O0KA 1OZFA 3RS8A 3HO6A 3IQDB 3Q8MA 4FTWA 5JHGB 1K06A 1NUPA 2VPIA 1DDGA 1Y37A 2D5BA 5E1DA 3NHWA 1DC8A 1C2TA 1TTTA 3ILSA 3ZY5A 4WNIA 1QQ6A 3BWMA 4M8IA 4P7BA 4DLAA 1NUUA 1RKQA 2OECA 3LY5A 4INZA 3QGMA 1NNLA 3QMWA 3UXMA 4NE2A 1Z8DA 1TFUA 4TRRA 2ZUDA 1E18A 5EZ5A 4CEIA 4G0WA 1AZTA 1BWPA 4DVGA 2XJ9A 3Q3GE 1CS4C 4LWOA 4TPKA 5AI6A 3I5AA 4IH4A 3SHVA 1YQQA 5JZOA 4N0DA 4R98A 4OBBA 2I1QA 1AO0A 2IS2A 2IIBA 2GBLC 3O3NB 1SQFA 4LRQA 1X77A 2R6HA 3OIDA 1MB3A 3R6GA 3NQ41 2CFOA 3UUEA 2ZQZA 3PQ2A 3IVGA 1MNAA 1A2BA 1JG1A 3GQBB 3NHYA 4WOJA 1QGOA 2W2LA 1K66A 3RSQA 2J3DA 3FJYA 2PJUA 4CJXA 3PUJA 2QZ9A 4ZI7A 1XZIA 2CGEA 2JIOA 3JQRA 4ARAA 1XNJA 2ES4A 4JV5B 2HHHB 3ZGNA 2PYZA 4FS3A 1KSFX 4P98A 4YMLA 4OHBA 1X7ZA 4L95C 5TRTA 4DM4A 5LXTB 2NSJA 2PGNA 2NTEA 4N9WA 3W2HA 2WILA 3RHZA 3GFFA 1DEOA 1LS6A 1R2QA 1CVIA 2HB6A 3A7EA 3I8XA 3IR6A 4O4JB 4D3DA 4G0UA 2JFXA 1T35A 4RHFA 1UDWA 5ICFA 2W0SA 3K35A 3U3JA 3V1MA 1TYAE 1B6TA 1CUEA 1PTKA 3PDIB 4JXKA 4K0RA 3CNHA 4R7ZA 5KJFA 1VE5A 2O8EA 1N2OA 3V1LA 2W2NA 2XUOA 4WWHA 2ZPUA 2B2NA 2CXHA 3FZNA 3P9PA 1SCUA 2HRBA 1V5WA 2QAJA 3A0UA 4RW0A 4ESEA 5IC4A 1RC1A 1N3LA 4C08A 4FDLA 4AUMA 4NCAA 3CLUD 3AUFA 3MWYW 4A27A 3PGXA 3VOTA 3T9FA 1BX1A 4KQFA 8OHMA 2I99A 4Z54A 4N0EA 3EA5A 2WUFA 4FUTA 4YRPA 3PGLA 2Z30A 2QG4A 4P54A 2QU8A 4JGGA 3UT6A 2I6FA 5EE5B 1Y4AE 4RSHA 3S8EA 1PJLA 2HN9A 4BMXA 4F4JA 1C7QA 4IO0A 4QLOA 1FU4A 3EIOA 4PW0A 2VBCA 3CZ9A 4QXQA 1CDOA 3F6BX 1Q1AA 1X38A 3OZRA 3S55A 2AF3C 1JKXA 3REQA 4BQRA 1LK7A 1EP9A 4BZQA 1NNEA 1FDUA 4RS3A 4BNNA 4KRYA 4HZGA 2Y9PB 4OBXA 1MDFA 5TIIA 1SHUX 2YUTA 4GDMA 4RADA 5B5SA 2OCDA 4L5IA 3ZWPA 3FN4A 2W2LD 2P4QA 5F7JA 4W5RA 1JT2A 1N5RA 4QWMA 4ZO6A 4IX9A 3AEUB 1AKUA 4J43A 4IMIB 3RV4A 1EK1A 2WVAA 1YRAA 3C1OA 3KZOA 1TM4E 5JSZB 3O5AA 2G28A 4UARA 1AN0A 2VWGA 2AG1A 3BMQB 3DL0A 1JMKC 4NSNA 4QYXA 1MBZA 1BTOA 3GRPA 2Z6UA 4GKVA 3S68A 1WPRA 2A9OA 3F9RA 3ENZA 1Q91A 2AFIE 3PF9A 5BW4A 1T4DA 1B3BA 2IY7A 4PE5B 1T36B 1KWGA 3H05A 2KSQA 5FBHA 3MFYA 2P8SA 2ZZMA 5T8KA 4M8LA 5KOHB 2PFGA 4JLPA 4RK6A 5KYXB 1HL7A 5LKAA 3AHDA 3EWIA 4HZIA 5JS1A 3ESAA 2JKYA 3JARB 2F67A 2BMWA 4O33A 4DPKA 2RK4A 2W6ID 2WKPA 5CVCA 1W2GA 1V37A 4UBKA 4OI2A 2G88A 2XVMA 3RRXA 2R87A 3JY6A 3RS2A 1ENZA 2YR0A 3DDHA 3JWIA 3TL2A 1Z0KA 3K5PA 4W63A 1DI0A 1ZSYA 3GEEA 3H6GA 5CGQB 4BUZA 4BZZA 5KHLB 1N4DA 5ADHA 1LLCA 2YL2A 3OP4A 3SHFA 2EFEB 2PQ0A 3EEQA 1CULC 4INAA 3VGPA 3ZCVA 5D7NA 3H1PA 2NNLD 1OJ7A 3AVVA 5DN9A 4LX8A 4O3MA 4BVAA 3QPUA 5DX0A 3HDHA 5DXJA 5BUQA 3K20A 2HLHA 2Q1YA 1HORA 4PZEA 1KGDA 2UUAB 2IHBA 2X8BA 2Q99A 3EZYA 4HNAB 4AZTA 1UQUA 2FK8A 3H18A 2COKA 3QNUA 3OZBA 3JQCA 3N7AA 4BNDB 3OFNA 3O8BA 1I14A 3R9XA 4HPJB 2O2JA 3O1IC 4MARA 2VRNA 3C3DA 3GJZA 3PFNA 4CODB 1PK9A 2DHDA 2D1SA 3EIFA 1YJAA 3FTCA 3CNBA 3IKJA 1JECA 2ON6A 1JH8A 3D0QA 1IMOA 3LW7A 3R3VA 4R1QA 4JS0A 4ZXPA 4CTOA 4ZMBA 3LT4A 2QNIA 1IK4A 5DMXA 2X9LA 4RKQA 1FXWA 1KAQA 1Z35A 3OPYA 4M0CA 1HYHA 4BLWA 2AJDA 2QL7A 3QKSB 3QVGB 4KXVA 3CPHA 3N28A 4H18A 4E4YA 1NNSA 2IC5A 1Z6YA 1E4YA 3G02A 2SKDA 2R6AA 3H1BA 1NUTA 4NV3A 5KCMA 4B33A 2QRGA 4N7RA 4XQGA 3WNVA 2G9RA 4Y18A 5IASA 2CB9A 3SP1A 4Q7JB 3TSWA 1F2VA 4HAOA 4H77A 1XEWY 4LNUB 3T06B 2V7TA 1E66A 3I52A 3QU2A 3BMNB 4C6HA 1TJPB 2J6HA 2IBSA 2I2AA 5FV7A 5BN4B 4BV9A 3BRWA 2D2EA 4GPAA 3T5TA 3TBKA 4EHNA 5C7YA 1YBFA 4OJTA 1BDHA 2ZTLA 1WDWB 2XB8A 3JQGA 3MERA 4IHAA 1F6DA 3S2GA 4WVLA 1LDGA 3JVIA 2FU5C 1NMSA 4B3FX 4DCPA 3AWIA 1GQRA 4YONB 4OJNA 1K08A 5FL3A 3JQBA 1Y4DE 3C7TA 1TKCA 2IE0A 2WJ3A 3FMPB 3IV7A 1I2DA 3J80A 5K0BA 4HXFB 4OOFA 2CNNA 4EK9A 2BZ1A 4KHPB 1A4UA 2PFSA 1QQ5A 3I09A 1MHTA 3B52X 4G09A 2IYQA 4XDYA 4AYWA 4BMVA 1SWWA 3EG5A 3F97A 4G5GA 3G3EA 4QUAA 1NBOA 4F21A 4B4OA 3D7NA 2H3HA 5H70A 4HDRA 5AJHA 2HDHA 2RK6A 3PC2A 5G1PA 1I9GA 1T3LA 3II6X 4P36A 3MILA 1LVGA 2CLIB 4AL4A 1B8VA 1VE7A 5CFNA 3WLRA 5J1TB 4M9RA 2R7MA 2YVQA 3NIGB 3RFUA 1XJQA 4Y7DA 5IN5A 1CY2A 2XUDA 1P2BA 3DB1A 3PXAA 5CPFA 2IEGA 2QMEA 3ESXA 4G85A 1DE0A 4R31A 2ZS7A 3KZMA 3DOFA 3OUUA 3PYXA 4R51A 2J6IA 4G4GA 3TW6A 5FPYA 4B0PA 1SKQA 1AQIA 2OSBA 3WHIA 1KI4A 2V5VA 4EKNB 4F6CA 1MMFB 1JI3A 3WNCA 3RVDA 2QS9A 1NGSA 3BRWD 1M2HA 4UUQA 3DR5A 1CE8B 2CJPA 4DA0A 2A5GA 1FE8A 1ZM3A 2NU8B 1QV7A 3DXFA 2GK7A 3L7MA 3ASZA 5H02A 4LRYA 5FWAA 3N8NA 4I4TB 1Y6GA 3A11A 1OGIA 4LZJA 1KH1A 4R16A 3V8BA 5KBYA 1XMSA 1G17A 1RNLA 3RTEA 2QE6A 3ZI7A 4I55B 4E5DA 5K0FA 5KB3A 2DJ5A 1X7WB 2FN9A 2IY8A 3V2HA 3UYKA 1L4UA 1FNCA 2XCIA 1FFSA 1AOXA 3E5NA 4AURA 1UP4A 1EQ2A 3SQLA 3M1YA 4QGGA 5HWSA 1AB6A 2PZKA 2VAXA 3MMSA 1UKBA 2Z56A 3NJRA 1Q22A 2GCGA 4QNMA 3IUQA 3QLJA 5HHTA 4DTIA 3WTBA 3Q3JB 1XA0A 1SVIA 2PGOA 3LUGA 2QSJA 4MI1A 1VL6A 2JIRA 4U2DA 1ZK2A 4ZCLA 4NJEB 2PGIA 5HIAA 1GGJA 4RX1A 1FFBA 2ST1A 4FZVA 5TT1A 1Y3DE 4MV8A 1U1FA 4X63A 5CDHA 2XB9A 3OZUA 4GU5A 4N82A 3KPVA 3ID6C 4OTZA 4MRAA 2GJ8A 2HSEA 4U5QA 3F5DA 3EJ6A 2E1PA 1SUCA 4LWQA 1E3JA 3MHPA 4ZO7A 4DCGA 1Q20A 4L5CA 1Y1KE 4OV6B 3DNMA 4D3FA 1P19A 3G5TA 3TSAA 2PBZA 2BRUA 1BOOA 2UZ3A 2J4DA 3ZV6A 1L7MA 1R9NA 2VPQA 3IOEA 3KXIA 2VHEA 3L06A 4IIDA 1HDEA 4KRXA 4PRZA 2IP1A 4X20B 2NAPA 1QVZA 3AUXA 3B13B 1Y5MA 3FOCA 2JI9A 1A7KA 2QHXA 3CF2A 1G98A 2X0DA 4JLMA 3I01A 3UFXB 1Y1RA 5KX5A 3D2LA 4TYMA 4MTCA 2GYUA 2BE9A 2X0IA 1R9GA 3FDXA 4HUQB 4BEVA 4KN6A 4TWAA 1T3TA 1GO2A 1X7YB 4RTOA 2Q45A 2ZSJA 3AK4A 2CJYA 2FUNB 3S29A 1U80A 1ZNZA 5FHQA 3HBMA 1P2SA 1UZLA 1WLYA 3WLHA 3KE8A 4KFCA 1VPDA 5J2TF 3P1JA 4MA4A 3PDJA 4M8SA 3R44A 1CG6A 2NZYA 1TQDA 4BXOB 5AHOA 3ZNNA 1AB5A 1I32A 3IQFA 4XDHA 3ZGVA 1RI4A 2C0QA 2CUZA 2QQ5A 1NI3A 2R6GA 4BQSA 3HJUA 3TIFA 2VC2B 2FUG6 1IZYA 1E7RA 6AT1A 1G9TA 1V71A 2VP4A 4CLRA 2VBFA 1VDMA 1O57A 3HL0A 2E4ZA 1DAPA 2M6SA 3AFMA 3C3EA 3GRYA 3IAXA 3R5XA 4YJ3A 4ZP1A 3VRHA 1JJAA 3JYLA 3AI7A 1M1NA 2JFBA 1JEAA 4EFLA 4KI0A 2GF9A 1T8RA 2QSUA 1NVBA 4AG6A 2VP9A 3BWXA 1SKUA 3QVSA 1KFEB 1UWLA 3KOWA 3QPDA 4R1PA 4ETWA 3N2KB 2AJLI 2QAGA 4D44A 1KEEA 1H4SA 3G7UA 4IIFA 3MRSA 4V0NA 2WG2A 2ZDHA 1TMGE 4P81A 1WMBA 1OHHA 2PK3A 1TF5A 1PZFA 4YJ2F 3WK7A 3E7FA 1UFVA 3H2BA 3GUVA 4R9RA 4ISCA 1YVRA 1IBLB 4NABA 2WM2A 5FCDA 3LXXA 4IJWA 2DT5A 2RGRA 3JQFC 2XVXA 2W2PA 5CRIA 3EEBA 4L76A 3DOCA 2X0FA 5D01A 1D6MA 3PHCA 4MKIA 3SZRA 3OZWA 4BGIA 1PWYE 5ER6A 1VLJA 4X61A 3C85A 4YQYA 3GF4A 4M53A 1XVUA 2AMLA 4KXYA 5FKJA 1E8DA 4IOMA 4AROA 1FL9A 1V4BA 2P27A 2IT1A 3OAAD 3FCOA 4G67A 3ZXYA 4M1EA 1CRLA 2HUNA 3VJKA 3OLQA 1G3UA 2D13A 3SSNA 3KT8A 1PV1A 1WMDA 3WNQA 3GRAA 4UU1A 1FYVA 3ZS8A 3CQ9A 3ELWA 3BGIA 3NLLA 2NXCA 1WB4A 2FX5A 3T61A 2AV6A 3UK0A 1NATA 1QB8A 4S1OA 3W0LB 4Q7QA 4V39A 4AO6A 3DLCA 2CE2X 1L4HA 4GGOA 2AKYA 4MPPA 1WAMA 2GCOA 2WHRA 4WXHA 3KLNA 4PGGA 8ADHA 2HJSA 3FF4A 3NNSA 2CCKA 3UA4A 2UVPA 4UCXA 2P4EA 4G0VA 1R6XA 3V1TC 3G9TA 1G9SA 1GWNA 1HKUA 4HNQA 4UHCA 1W36B 3OZGA 2ID4A 4UTVA 3H5RA 1U7UA 1SUPA 4FW8A 2F43A 3H0KA 3O8QB 2CXOA 2OO3A 3LT2A 4IGAA 3K30A 4XCVA 3WSVA 1XPJA 2HK6A 4NC9A 4K6GA 4E30A 4DSAA 3KL4A 5ESXA 4DEXA 1OHHD 4LZWA 1DT5A 1B6SA 3MXTA 3QLEA 1PL8A 2CMGA 1YTLA 2IXAA 1QU2A 3IAHA 3PX3A 1BXKA 1AUOA 3E6AA 2GO1A 1FZQA 5DXAA 3F5SA 4FN5A 2CNKA 3KZKA 4RHEA 1UPCA 3KU1A 5F4BA 1G2PA 2H4HA 2WC1A 2ABWA 4PSCA 1FMFA 4Y98A 5DHRA 4UCQA 1ZP6A 3OETA 5IVKA 1USUA 3K09C 4CUJA 1TM3E 2AG5A 3EFOB 3ET5A 1J5EB 1MPTA 2R79A 1HQDA 1AQYA 4F5ZA 3EDCA 2X1HA 3ZOZA 1YJCA 2WLSA 2VUUA 4RZIA 4FI3C 4M7OA 4L75A 1V5EA 3KFXA 1AGXA 1S2GA 1A9OA 4TKVA 3OFVA 4O59O 4V0QA 2AMVA 5J3JA 3EXG2 4MINA 1M2VA 4M38A 1XF1A 4DIFA 3QUTA 2QM7A 3ZJ4A 4L16A 4C76A 2GBLA 3NKLA 1L7BA 4LHEA 3UMMA 3RNOA 4REQB 1FU7A 2FZCA 1KJYA 3PQ6A 3GXBA 3PX7A 3VR3D 2BAGA 4ER6A 5BQ3A 5CHEA 3GP3A 3AY7A 3H9JA 1QCYA 2CNDA 2RJNA 3L1JA 2CUNA 2FJUA 1XRNA 3OQ1A 4GIBA 4AK9A 5HKAA 1I6LA 5FWYA 5EMNA 3IAM6 3Q0TA 3ZDQA 1NQTA 5GIOE 3WGIA 3JZFA 5IDXA 3VPHA 3QU7A 5DRYA 1B2RA 5KDOA 4C5CA 2WF6A 4B3MB 3WMRA 1W94A 4BVHA 4WOKA 4BQOA 1RE0A 4CHTA 4L85A 3A3NA 3KPWA 1CZKA 1JDBC 1V48A 1ZD5A 3A28A 3A1TA 1KY2A 3LCJA 3MWGA 3QLUC 1L5YA 4RPHA 1VPVA 5G41A 1K3TA 3ZU3A 4LFBB 3TLJA 2HPAA 3R5FA 4EPRA 2OD2A 1H1TA 4TVOA 7MDHA 3I01M 1KK3A 2GXUA 3LO5A 2RDMA 5IG2A 1TAHA 2IUTA 2QX9A 3EIHA 1UFOA 5L4NA 1CS0A 3HWRA 2OO5C 3RU7A 4L8VA 3UHPA 1Q83A 4DV0B 3AKDA 1IYZA 5C2JB 4AJIA