1Z9BA

Solution structure of the c1-subdomain of bacillus stearothermophilus translation initiation factor if2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
NEFELGTRGSSRVDLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-2
publication title Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Translation
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 1z9bA01
4N3GA 4N3NA 3WBKA 3WBJA 1G7SA 1Z9BA 1G7TA 1G7RA 4KJZA
chains in the Genus database with same CATH superfamily
5H59A 3ZU3A 1P73A 1PV1A 3AI1A 3PDHA 4DLTA 1OASA 4ENSA 2XCLA 2A0KA 4MJXA 1FS4A 2ZQYA 4OHYA 3VR5H 4C0AC 5EE3A 1I7LA 3BSYA 4XFJA 1SCDA 2NVWA 4F85A 4F2GA 3JYNA 3C8MA 4M6WB 2D4HA 3NASA 2O7VA 4NBKA 3R0ZA 4R83A 3RVSA 1D2CA 4IINA 1AV7A 3CKKA 3PYMA 5J2TB 2EZTA 4HZUA 1UPTA 2XT6A 3C7DB 3HJRA 4O2RA 1TCAA 5C34B 1Y89A 2QV0A 5EZ6B 4NAUA 3TOXA 5I4IA 1HWYA 1M54A 3K2EA 4C1NA 3DT6A 4UUQA 5AJZA 5A7GA 1P1KA 3L01A 1WF6A 4XUEA 1KI8A 3WGUA 3ZU5A 1U1CA 4EAQA 4Y1EA 1EA5A 4FNMA 2N46A 2P4HX 4ID3A 4LJ7A 2ZJ6A 1RVDA 4JC0A 2B0JA 2GM5A 3C3JA 3BD8A 3ICCA 3IOBA 3KHUA 4IFEA 5EFOA 4XR9A 5LUAA 1O9HA 4KQWA 4OHZA 3BIJA 5CK5A 4Z4HA 1L5RA 2YXDA 3ZTTA 3Q3GE 4YP0A 4XAQA 3E48A 4MWDA 4AKTA 5JAZA 2J87A 4LG1A 3AKDA 3QE9Y 4RV4A 2ENUA 3EFEA 1Y5MA 2EFJA 2J30A 2QUIA 3I1IA 1O1YA 1Q6ZA 1UK7A 2C8LA 3NHUA 1Y34E 1MVOA 3LKDA 4YAIA 2QQFA 1TM2A 1NF2A 4B6QA 1IG3A 2C2GA 4FMCB 4R8KA 2CW5A 3T1NA 3SF0A 3E2MA 5HUJA 2ZE8A 3ZXIA 1UBTS 2WE7A 3SIPA 4BCBA 5K0CA 3MJ4A 3AF4A 2ODBA 4P86A 5HCIA 1X38A 1AA9A 1I7NA 1YAHA 1NOJA 3W5JA 1F12A 4C01A 5TT0A 2QU8A 2WWIA 3SYLA 2CNKA 2BFDB 4PFQA 3I01M 3BQMB 1TC2A 2XDQA 4L75A 4NIMA 4TRRA 3AY0A 3TKLA 3P71T 3EZFA 2VZ8A 2X5XA 3PGMA 3AR5A 1A4XA 4E21A 3PD7A 1A2KC 3V8EA 1JLLA 2C4HA 2JJ8A 4AI6A 1XROA 1QRDA 2ZVDA 2F9FA 2WEKA 4FEEA 4GZ6A 3TL6A 3FNEA 1W0JA 4BXOB 2AD5A 4JOCA 2JCVA 1Z9BA 2UUOA 5EWLA 4LYEA 4MUIA 5AMXA 3O3OB 3DT9A 4GI2A 3L8MA 3GLUA 3IQGX 1JX6A 2WMYA 4K6KA 3AJ8A 3AR6A 1GTL1 1YOVB 2YHSA 1E4EB 3IXLA 3M2TA 4YO8A 3MCVA 2GO7A 2O1EA 1NX9A 3RFFA 3FKSD 3UJ9A 1V26A 1OSNA 2PUAA 2V5VA 1RJ9A 2W93A 1WDWB 2BN4A 1ECGA 2HUNA 2I8AA 3PL1A 4MLDA 4NCIA 3E05A 4QQFA 4TTRA 1UOOA 5GM2A 2LKDA 1Q19A 1CQJB 2PT7A 4RXMA 4EHHA 1DIOB 1KH2A 5FH9A 4C0SA 1TKCA 5EIXA 1RWXA 4ER6A 1VI2A 1LD3A 1W19A 2QRUA 2EGUA 3FCAA 3B3QA 1O5TA 3FMVA 1VMDA 3N8GA 3JAKB 2HF9A 4FYXA 4GD3Q 1P3Y1 4HS9A 4RZ2A 2R7AA 2Y68A 2G9VA 3MMSA 5DSTA 1LCIA 2XXBA 3G3EA 1ZD1A 4HZGA 5F21A 3RQSA 2R7LA 4EATA 1I94B 1G17A 4NV3A 2YXPX 2HK9A 3GZNA 2C9YA 3BF8A 4QGHA 3B1WA 3EIHA 1ECPA 5BT8A 1ZICA 2JBWA 4RK0A 2AMLA 2XKBA 5HJEA 4OM7A 3EMVA 1CJSA 3GZTB 2OUIA 1LNQA 2WKRA 1YFJA 5FF9A 4NWIA 3R23A 2P78A 1A88A 1QIEA 4U39A 3E5HA 2BKUA 3P9PA 2AUMA 1OFUX 2JDID 1WCIB 4B2PA 4QQ8A 3AVTA 3R2JA 3O2QB 3ESQA 3S2YA 1KQGA 4FU0A 1U2TA 5EPEA 4JVOA 4TWAA 4DZZA 3IILA 1GFWA 1XRQA 2Q5HA 3DEAA 2Y2VA 3QNWA 1M1ZA 2C20A 3BAFA 5K3BA 3X43A 4GF5A 4LKOA 2Y4OA 4P4LA 2UVPB 4MA0A 4E7PA 1YS2X 3GIDA 4GOOD 3SGLA 3P26A 1FIUA 4CEJB 3JZIA 3ER8A 3ADKA 4MNTA 3N70A 2W8BA 3G2IA 1LBTA 2FUCA 3E7DA 4MAMA 4ZQCB 1BQ4A 4ZOEA 3U44A 3KQMA 1I6MA 1POWA 1E8NA 3F5MA 2ZUDA 3PFWO 5E1DA 4RMNA 5IK2A 1NLYA 3FDZB 5KZMB 3IRVA 4G0WA 4WOJA 3LP6A 3DV0B 2CVQA 3RTEA 1CDEA 1PLLA 2E2WA 2Q29A 2EQ5A 3BB3A 1SKUA 4I55B 1L0BA 1OWOA 2PGAA 4WT7A 1R0SA 3BH0A 4MQFB 2RKBA 4AY5A 2DKOA 2HLNA 3E58A 3RB8A 5JNSA 1TMGE 3TZ6A 2XECA 4LDNA 2N0SA 2WT9A 1OLSA 1DKUA 1KJZA 2QX9A 2WKSA 1FJGB 2EWMA 1VXOA 3N8KA 1T9DA 4AUMA 3QYPA 4NU8X 1KQ3A 4M1OA 3VDRA 3UAWA 1VSBA 5IWCA 5FL7A 4UDNA 4JEIA 3GELA 4MULA 5BR8B 1WP9A 1NKVA 3HCOA 1YD7A 3QKTA 2VSFA 2RH5A 3DDWA 3H16A 2XWSA 5BPFA 2XUDA 3DE2X 1E3QA 3N7AA 4FE7A 1R0YA 5H83A 4KN8A 2QZJA 3EXEB 3BTSA 3Q7RA 4FOTA 4RD4A 2WUFA 1M73E 3ZKWA 1EFPB 5TMBA 2V6IA 5K6TA 1EK0A 2Z4SA 3GLRA 1I32A 2XX3A 4B34A 4LSGA 4DR5B 4FM9A 2IH5A 1I33A 4ALMA 1YS4A 1ENZA 2CL0X 3RS4A 2WYOA 3CB4A 4YS6A 4TVSA 2NU6B 3BXHA 3WSWA 1N2BA 3FUTA 4E5DA 4J2TA 1LPNA 2C2MA 5FNZA 4R2WA 5I5GA 2BTEA 1GPLA 3EXHA 4DHEA 3DL0A 2DG2A 3VR3A 1DJNA 2XOXA 3R0VA 1SZPA 1A72A 2JH9A 2WSBA 3BWEA 3HH8A 3VNAA 4ZYLA 4YRFA 5LJLA 1Z8NA 3FE2A 3H9BA 3OETA 4I8IA 3ABIA 1N2ZA 4X44A 2OC9A 4JZYA 1ZIOA 4C5CA 5LZ4A 2GUWA 2OUKA 4R9NA 1YB7A 4WDQA 4C2BA 2IOHA 4K46A 1V11A 2POCA 3NAQA 3QE3A 4DDVA 2QN9A 3A58B 2QTBA 3LT2A 2OESA 4C4RA 2AG5A 4N3AA 4ZQGA 3I72A 1RWPA 4DSOA 1CEQA 2TSYB 1FTSA 5F5XA 5K1ZA 3LYUA 3THYA 1OV4A 1YB2A 3JX9A 1E1RD 4RE6A 4HL6A 3ZE1B 1CZNA 4UUPA 4C6TA 1WXQA 5KTSA 2H8KA 4AAYA 1IK4A 1SZJG 2W6NA 2ZBEA 2XJ9A 1H23A 1X7ZA 1A4IA 2AOTB 2ECFA 2QMHA 5FNVB 1EDEA 3OPMA 3SSMA 3SR3A 3LT4A 4R2JA 3AI7A 1JFVA 1KOJA 3X1DA 2DR2A 5CK4A 5CT9A 1OZHA 2XCIA 2TMDA 4RGYA 2G70A 2ZBVA 1QV6A 3O3CA 5B5SA 1U7HA 3NIBA 1EFAA 2NU7A 3H04A 1FSPA 1VYHA 3RVLA 2B21A 3HCDA 4KB5A 5BYJA 3UT5A 3GNLA 5DHPA 3GNTA 5IDWA 2BHRA 4YQYA 3HDGA 5CH3A 5JSUA 2IHZA 4Z3KA 4I5DA 4B4VA 3NHWA 1D03A 2H11A 4DPMA 1SUBA 4DYDA 4LMRA 1IN7A 1R74A 3TUJC 1R64A 4DR6B 4ZU1X 2VI5A 3LPNA 4L8WB 1Z5GA 2PLNA 2FW1A 5CYGA 1NXVA 3MT8A 1BJKA 5CDTA 4OHXA 3GFPA 3QBVA 4X24A 5HBGA 5KINB 1T26A 3OX1A 2OHHA 1NTOA 3WK8A 2EKBA 3MJRA 1VSQA 4FW8A 3TLBA 1SC3A 2I1QA 3KUXA 4BWFB 4PXSA 2O6LA 3JQAD 5ALZA 2IZOA 4LXXA 1W93A 2J3QA 5C3UA 5ITWA 3ZOKA 1JFFA 3CCCA 3HJGA 3L0YA 4KH0A 4PYRA 4H7HA 5CT8A 4WZBA 3A3OA 4ZRDA 1RZRA 2DFDA 4F2WA 3SICE 4R8SA 4O4JB 3IIJA 1U8UA 1JBEA 3O8QB 3QXXA 2O1XA 1N92A 4XGQA 1UZUA 3CR8A 3ELBA 3HJNA 1JU9A 4S1NA 4N6GA 1TUBA 5CDYA 4L8GA 4PNZA 4ZZ3A 3G2KA 1YZFA 1ONOA 5TJ9A 3CY6A 3K94A 3V8BA 3QVSA 4CIXA 1G42A 4K2HA 4WFIA 3VYWA 4H7KA 4IWNA 4NKRA 4DIBA 1E6LA 1UKYA 1BVYF 4I7EA 4DMLA 4HPJB 1GL3A 3H1AA 4TLLB 2GK6A 3QF4B 1C7RA 1SOMA 4ZI7B 2NN3C 4XWWA 3SOPA 2GHQA 3ZI0A 2HY7A 2NUBA 3L7NA 1P1HA 1U5CA 1XTZA 4I3FA 4YB8A 5GJCA 4N0EA 4L7QA 2ORVA 5EQDA 2GO1A 2HJWA 2Q8NA 3QBEA 4LDAA 3QLJA 4HTFB 3H7AA 4Q00A 3RVKA 1TVKB 2B1QA 3V1KA 2A78A 1KFCB 2WRZA 3IQDB 3KWJA 3TINA 1A8IA 3KLPX 3WGKA 4PHTA 3STHA 1ZFNA 3QTLA 4D97A 4HNAA 4QTTB 1A9RA 2WU8A 4AJJA 1TK2A 4YMHA 3HP1A 1JN0A 1M2FA 4K8OA 4CL3A 4R1PA 1K88A 1C9NA 5EHZA 2BMAA 3UM9A 2VYCA 4C7VA 4QBFA 4EY5A 1RHMA 1JTEA 1KIMA 4Y6QA 3FOEC 1KDRA 3ONEA 4Y0NA 3REQA 1BMQA 1UDCA 5DTIA 1N6PA 4O8CA 3SLGA 2O3QA 4MZXA 1NW9B 3JWHA 2JAHA 1KO4A 2OO3A 2YJ3A 1F14A 4U7JA 4U7WA 4M1YA 3WK6A 3GLIA 2P8SA 5JHHB 1Z26A 3QVWA 1UWCA 5I9MA 2AKAB 4C9BA 5JHGB 1EFCA 1TQHA 1IL0A 2YTZA 4H0NA 3NBXX 4QASA 4RU1A 1NXXA 5A5VA 1QPGA 1M1XB 1JWLA 2XKAA 5CDHA 3EF0A 3KOXA 4GKVA 1M33A 4JC4A 3UMMA 4XA8A 1IZYA 1M1UA 4LXHA 5G0UA 4RGBA 1QZXA 4H1VA 3V6MA 2HCFA 1E60A 4LI3X 1C3VA 3NRJA 2IWHA 3WDLA 5TARA 3IERA 4ALLA 3EQ6A 5IS2A 3NHAA 3RVNA 2FPGB 3OLCX 1PEKE 2JPDA 4KIWA 2PRYA 2X4GA 1IXKA 4LHSA 1XKLA 1OFTA 2B6HA 2W71A 3TTYA 3CNEA 1BWSA 4I9FA 2F3SA 4L2IB 4DY4A 1KVSA 4W9RA 2VVTA 2VHVA 1S89A 2RHWA 2QXTA 4IXWA 4R5MA 1S2GA 2B8WA 3RYFA 4WMLA 2AV6A 1HKUA 1EKXA 2AOUB 2GHRA 4REMA 3JQDA 1GKKA 4QULA 1ZGBA 4TKVB 1T9AA 1BCSA 3AHJA 1Z28A 1DX4A 3N2KB 2YYZA 2XMZA 3LHSA 4IWYA 4V1CB 3HFGA 4MEJA 5LZ2A 1XALA 5AWFC 3PE3A 1OYWA 1GZVA 3P5SA 4C7KA 3HZRA 1CZRA 1USWA 2QROA 1NOIA 2FCAA 3LI2A 2B4AA 5I7HA 2JKZA 1MC4A 1QB8A 2FKAA 3HLKA 1RJWA 4BMDA 4AY3A 4ARZB 2B4YA 1VKHA 2C3YA 2XNSA 5TSDA 4DLSA 4G5OA 4LC9A 3CR7A 5A3SA 4JKYA 3BA1A 3IP9A 1X2BA 4NCNA 1Q0RA 3CRW1 5A05A 4UNRA 1UP6A 2G25A 3QVTA 1PS0A 4CL0A 1XCJA 4B8WA 1O77A 1JRLA 1MV5A 5AUOB 1Y4UA 3C3BA 3PQDA 1M1YB 4EKYA 3P9RA 1OKKA 2BGNA 2JJ1D 1GNTA 1MH9A 3DVLA 4K81B 4M37A 3V48A 4K03A 2PA3A 4PF1A 1Y37A 4AS2A 5KSZA 1T5HX 5AHRA 2XUJA 3M83A 4YVFA 1Z13A 3ZHSA 1ULZA 1VL6A 1O03A 2OHGA 3KLOA 3NFRA 4L57A 4KU4A 3QYAA 4AP9A 2W2OA 3JASA 4J2OA 4DT1B 5ITSA 1E94E 2GBLA 4HFMA 2IZ5A 1EPUA 4LGCA 3TAHA 4C7OA 4QKQA 1QP0A 2VHWA 3NKFA 5CVCA 2A5LA 1NFRA 4B45A 3COWA 1ZLXA 3NHLA 2WI8A 1EM8A 4EA9A 2NX2A 4WX2B 2WHPA 1NONA 1R5JA 1XQYA 1YCHA 5AHXA 2F17A 2QTVA 1W581 2HMTA 4PG7A 2A4KA 1NT4A 4IJWA 1K9VF 2VPXA 3KYDA 3RU7A 3AGPA 3SK0A 1JIIA 2FSHA 4DAOA 2MSCB 4CLDA 6REQB 1XF1A 2X0NA 2J5XA 2L69A 3QENA 2ODEA 1EFUA 5C8VA 2Z2IA 3FSGA 4K9QA 1GFIA 2JGJA 3EY9A 1T8SA 1UM9B 4NEHB 1O8CA 1XTVA 4QU9A 4LQLA 4CQMD 5KTKA 5EMKA 4LZOA 4H3HB 5AESA 4KFTA 3BK1A 1WLSA 4GKAA 4WI1A 4X6LA 4EIWA 4WL0A 2B1IA 1G60A 3A9SA 3BEOA 3L7MA 3FNQA 5FWYB 2RAVA 1NJ8A 3HUFA 3NTRA 1LB1B 3TD6A 1SELA 4NBRA 1VHLA 4PSAA 2ZSDA 5J2UF 1E3WA 3PEVA 3ST7A 5KYUB 2X5OA 3T3GA 3V00A 1K4MA 2Y1CA 3JAMA 1TGYA 5BO5A 1W85A 5B3LA 2W2XA 4GXTA 3V9AA 1E77A 4NEQA 1KH1A 3JQ8A 4Y9SA 1Y42X 2QLBA 2Q9BA 3VVLA 4BFXA 5LQNA 1CEEA 3JQ6A 1SZDA 3T4XA 3LBNA 2RC6A 4CIYA 1PYGA 5L95A 1HFEL 3TYXA 2EFDB 1FXWF 1BFUA 2QHXA 4MR9A 4WN9B 1HT0A 3PWZA 3M6WA 5MN6A 3UGTA 1GZHB 1TM4E 1ODIA 3TLMA 5AXBA 1Y1SA 2FG6C 3EFOA 1RNLA 2XWBF 3IALA 5E7MA 5J4LA 3LQRA 4BEBA 4E31A 1HT1E 3O4FA 4JA2A 2OQIA 4LXGA 4NBWA 1HLDA 2VKTA 3GJZA 4BV8A 4D80A 4EA7A 1R4MB 3RYHA 2Z6AA 3IHWA 3HN6A 2BISA 3K0EA 1QNFA 2C2WA 4IXTA 4FZ5A 1IQRA 5DX1A 4RD6A 5AQ1A 3SM3A 1CUWA 2G67A 4BY9E 3CWCA 4RADA 5IAJA 2X42A 5BVGB 4QFBA 1MAUA 1GCAA 1U0EA 2D5LA 2H1RA 3P9SA 3DZHA 1SKBA 3Q12A 4HLDA 2ERXA 4W8OA 5BQFA 3RTGA 1PK7A 2UZ1A 4BP3A 3H99A 3OA0A 1XAJA 3WA7A 4XVUA 5DXFA 4F93B 3A1WA 2RHMA 3FM9A 4E5UA 1MO3A 2YHIB 3T95A 3IUQA 3QKSB 1E1QD 3PFKA 4HWKA 4P53A 3SS8A 5BWNA 1R10A 2GPJA 4PLTA 2HWWA 4EPYA 4JP5A 3SMQA 1KFEB 3RNOA 4RDIA 4L72A 5IJ0A 5DN6A 4PX2A 3HM9A 2DXIA 4YWHA 2VUHB 4M8NE 4RVUA 3R8CA 5G02A 5DNWA 1YZTA 1RDFA 4ON9A 2YVQA 3KV3O 3M6FA 2QTRA 1V96A 1TTHA 3MJCA 3TF5A 3ETLA 4ZD6A 4KJXA 3H4VA 2R6GA 2OD7A 3VSAA 4U63A 2NXJA 1GEEA 5AUPB 4CRWB 3EVZA 1M1NA 2YVKA 1UR5A 2FF7A 2FSIA 3ACCA 3CPJB 1K4KA 1PD1A 3HMKA 4DWVA 3DFUA 1WJGA 4GI1A 4I9UA 2LE0A 2X3FA 2WSLA 4COKA 1YHZA 2BJVA 5AM5A 4Z2YA 4MRRA 4BFWA 1GA6A 3H5IA 2B36A 1SXIA 2OCAA 2H4XA 1S3GA 3IP8A 1B42A 5AVUA 4W1QA 3A1NA 4GBMA 4RYLA 4E5VA 4Q47A 1N57A 2VQEB 3C87A 2FOIA 1P4GA 2X9NA 3VSDA 4ACBA 4FOLA 3E9RA 1SEPA 3A6ZA 4ZVNA 2CUZA 1H5NA 5D3MA 2AI1A 4R3NA 1TZJA 3VZBA 3LQ2A 1EXNA 2EJWA 4A0SA 2ZDHA 1FMFA 4D56A 4MA4A 2WJ6A 3T3HA 1TJ4A 4BTEA 3ANYB 4HLQB 3PUVA 4TKMA 3R8FA 4NLLA 3PV0A 2O0MA 3SE7A 3UN1A 3SWWA 3LY5A 2VC2B 2M9MA 3CVOA 4KXQA 4EABA 5CD1A 2OBMA 3AYXB 5M34A 4OI0A 2EKQA 1PUIA 3PHJA 3WQBA 5HF6A 3U4IA 3U4GA 4YJFB 1CY8A 2IYVA 3CTPA 3QUTA 4U6QA 1XRJA 3EQ9A 1ZRSA 2RJOA 3GLHA 3B6KA 4OBEA 2R7KA 1C0PA 4FD2A 1MEOA 1V6AA 4JB0A 3KTDA 1UAYA 1UZMA 3WIEA 2I9PA 3PI7A 1Q1GA 4X64B 1GGHA 2XA1A 2ZS7A 1PNVA 2PM8A 1GTZA 1P45A 3JQ9C 2XNJA 3OAAA 4Y67A 4GWLA 5IARA 1C3OB 1L6RA 3O8OB 3RFCA 4AG5A 1SR8A 3T3PB 2DBQA 3FKQA 4Q7MB 3MMZA 2I4OA 4GX5A 5ELLA 4RY8A 3PQCA 3UMCA 3CF6R 2O2CA 3DQPA 5LBTA 2NADA 1AS0A 1L5GB 1SVMA 1U1GA 4FE3A 1P9RA 3DKVA 1F9AA 3N86A 4POAA 1FFXA 2Q3CA 4GLLA 4X8LA 2Q5CA 4C2UA 1TMKA 5EI5A 4DMUB 3F3YA 4C4OA 1U2QA 4RABA 5LWQA 1I2ZA 3D0KA 2WQZA 1UBMS 4PIMA 3VR2D 1ACMA 4Y9UA 1KPHA 2KW5A 3TQOA 3TW6A 2V9CA 5A06A 3NMUF 3F6RA 4B3RB 3IP1A 2QTHA 621PA 1U80A 1HDGO 2JIBA 2C0QA 4PC1A 1XK7A 3H2YA 4H6VA 4LZNA 3MTEA 3FRHA 4URHA 2IDKA 1AF7A 3N0RA 1DAHA 4JOSA 5A4JA 1OIXA 2QZ4A 1U98A 3FNFA 3S2IA 4AZ0A 5T8KA 1QYWA 3SC4A 1RM5A 4YJGA 3D8SA 4BB0A 1VJTA 4RE5A 2NQ2C 4FN5A 2P6NA 3DMHA 3OLXA 1SVWA 2IF2A 3QMMA 3U49A 2R8RA 3EPHA 1DKRA 4HAVA 3AESB 1IHOA 4OATA 1WSDA 4V0SA 4X85A 4HN2A 1ZQ9A 3OI7A 3KDSE 1TUGA 1BDBA 2YVUA 4MS1A 4D02A 4DL9A 3BSFA 1J06A 4IF4A 4GKBA 1U81A 1VG1A 1UBFA 3F71A 1EVYA 1FTGA 1NXQA 4C0QC 1IBRA 4MVJM 4PGHA 4E08A 2I1LA 4OBXA 1V43A 1WW8A 2AQHA 5EHIA 4BO3A 1ZY2A 2LVBA 3DFIA 4EEXA 1XDGA 1L5LA 4MUYA 3G59A 3P8ZA 1HC7A 1IN4A 3AZOA 4PYQA 2NZJA 4B9EA 2VNIA 2RE8A 3LY8A 3A26A 2PCJA 5EA2A 4KMMA 1SIBE 2H0AA 3WJ1A 2ZK7A 4P31A 4UU8A 4FCTA 5AM3A 5AXCA 1Y7PA 1D7AA 1HNZB 4OJKA 4PSDA 5EZYB 3ZWCA 4YCNA 4MMYB 3N2NA 2XBUA 3JQGB 2MR5A 4X00A 3AJ9A 1NW3A 4HKTA 5FBHA 1J70A 2H0RA 3R9IA 1RWNA 2GEJA 4DLBA 2JHAA 4C29A 3SQXA 2BRUA 4NTZA 2P9ZA 1RBYA 3B7GA 2ZJ1A 1F38A 3KSDO 5JDCC 2A5DA 2R44A 3DBIA 2KYRA 2DCMA 3I2JA 4C6RA 2RSLA 3K1AA 5BN4B 3GRZA 3E1GA 4QLOA 1FYWA 2XAAA 1JIQA 3F3KA 4M21A 4S2EA 2L2QA 4RHFA 1DINA 2E7ZA 1DQSA 3OTHA 3WZLA 4D45A 1UJNA 5JD6A 2WP0A 3KP1A 3BWYA 2A3RA 3R8XA 4DBLE 1AY0A 1JKIA 1NVXQ 3EGOA 3OCCA 1G55A 4J03A 2GZ2A 1VPLA 4PQFA 1PGJA 2J0UB 2QU7A 4Q4LA 2BDEA 4I9GA 5AKYA 2EHDA 4NFLA 2BLNA 2PFGA 3LDHA 3OECA 3QJ5A 5DI3A 5F2EA 3VH2A 4AZTA 2JLXA 2OB1A 3A7EA 4HEA1 3EX7C 4HI0E 2CN1A 2OXRA 3I23A 2WD7B 4IHJB 2DTDA 2FZKA 4ZO9A 2JFQA 5JS2A 2CF5A 4EHJA 2CNLA 3QLUC 4H0CA 4V0RA 5DYWA 5JRZA 3V4LA 4UM5A 2VDPB 5EIBD 1GY8A 1MRZA 2PX0A 3Q2KA 3VDQA 2L17A 1PWZA 4ZC1A 4AMBA 1GJRA 4F4UA 3MHPA 3N76A 1VYTA 4L3OA 1X1SA 3AB3A 3HKEB 3PHHA 5GOTA 5FHQA 2YZNA 5JSFA 1JL3A 1JTVA 1Z6TA 3HCCA 4FFNA 4XGKA 4BNDA 3V4RA 5KKCA 5IPFA 2QEQA 2I8LA 1L6IA 1OXXK 3LBIA 4K26A 3SN6A 2XYHA 4MUNA 5D86A 3HJAA 4B09A 2ATVA 5A5DA 3VGPA 3MTJA 4QDOA 2F43A 4M53A 1NQWA 1D9ZA 3TQCA 1N1DA 3OT1A 1T2EA 1E79A 1ODJA 1DV1A 2IYSA 5EIFA 4NXNB 4B2LA 1MAVA 1AHIA 2E0IA 1E1YA 3PNSA 4RHCA 3MJHA 3M1AA 1B3RA 3O7WA 4LK2A 3SXUB 3VYRB 2FMTA 1FVFA 1K5PA 1MTZA 3O9VA 4GMDA 3MT9A 2H06A 1Z4LA 1JILA 1BS1A 2VDOB 2BIFA 4HXEB 3WIBA 3IR5A 3DKPA 1QTRA 3WBKA 1M2WA 1YQQA 1MN6A 1R3UA 3CG4A 3UHOA 4BNTA 5KNCA 2KHZA 2XB6A 3ZEAA 1T9BA 1T36A 2J9ZB 2OGZA 4O4HB 3SZLA 3NEAA 5JCXA 4ZHQB 4AWXA 1IG0A 1QOQB 5SZJA 1ZHHA 4B3HA 2GASA 3DOUA 4F3KA 1AH2A 1ENOA 3BRWA 4G9BA 4FHDA 4V03A 2VA8A 3SIRA 4JIMA 3BN3A 3C3CA 2F6RA 3TJZA 2BHSA 3VZRA 1MOPA 2H1HA 2YC2C 3OD1A 4QVIA 1KI9A 3DQZA 2Y3IA 1GPKA 2Q0HA 3THSA 4K6FA 3RRFA 2J08A 3JSAA 1RVV1 4J0QA 4JQCA 3VC1A 3ELYA 1C2TA 1AIPA 3IT2A 1V5WA 2PHZA 5JRDS 1SHUX 2JVKA 1KK1A 2WSYB 3N2ZB 4E13A 3T7CA 4TWIA 1YU9A 3KVVA 1QH8A 4L7VA 4Q34A 1LA2A 3CRRA 3MF4A 3U6KA 3AEUB 3UPDA 3T7DA 2WT4A 1XL1A 3VR4D 2FFAA 2R48A 3G49A 2J59A 2R1UA 5G4KB 4ED9A 4UUAA 3BMNB 4MCHA 2D1QA 4DNOA 2G09A 2PS3A 5THKA 2JCSA 2ZRCA 3ND6A 1QIJA 3LCRA 4WXMA 4MIYA 5BV1A 4A8TA 3PE4A 3RWOA 1FDOA 2FDRA 3JS5A 3NXKA 4N40A 2C7PA 2OAQ1 1T0UA 4EG0A 1XD9A 4AUNA 3OE4A 4FHCA 4EGSA 3QZUA 1TJ5A 2P79A 2GA9A 4OXXA 4PZCA 1YR9A 3T1VA 2HR1A 2NACA 1G8PA 5DRYA 5JG7A 4KQCA 4OXKA 5T6BA 1WSAA 1A5ZA 5EQTA 2JA2A 4P22A 4XRRA 1XP5A 4HAYA 3PRKE 2ZJAA 1E20A 1VJGA 2QW0X 4YJ2F 2ZIXA 1EFRD 2ZYGA 4RY9A 4ZP1A 2HSZA 1BXGA 2RKWA 2DPGA 1KQOA 1LSSA 4GPEA 4A91A 5D84A 4BMSA 2IRWA 1MABB 4CR6A 1KJQA 2QD5A 4X65B 1T9GR 3EULA 1VP3A 3KT6A 4UNSA 4X7BA 1SIUA 3NWBA 1XRMA 2BE7A 2OZPA 2DY0A 2IF0A 3EBPA 3FNRA 3WLMA 1O58A 2AS0A 2IIVA 3KL4A 3OOJA 1A71A 3AJDA 4AVYA 1LLCA 3EB9A 1ECBA 1AZSC 4MHOA 5E4YA 4CMCA 4AJOA 2JHGA 2BSXA 3EEIA 2IYXA 4EH1A 1RJGA 3WLHA 2P62A 5JH7F 1QKKA 3LVFO 1KOGA 4FKBA 3ZE6A 1R4NB 4X1KB 3KQYA 4AM8A 1F06A 1PFQA 2CFCA 5ECWA 1QGDA 3EGDA 3FTFA 4CI9A 1RXWA 3UMSA 1Z6YA 4ND4A 2N75A 1NULA 1RYEA 2WAXA 3IT1A 4E88A 1TZKA 3K4QA 3PD0A 1AQ6A 1HL3A 3NTVA 4GR9A 5F73A 1NUSA 4R9UC 2AEJA 3S7TA 5KVSA 1EUQA 3R5HA 4AQDA 5CEFA 5AKJA 1IVNA 1FP1D 4OD0A 4D5GA 1OR8A 3BHIA 3G7NA 4QYWA 4WY8A 3PCTA 3QIAA 3SEQA 3UV7A 1G20A 3DMFA 1EXWA 4I9HA 4OG2A 1LLFA 1KWKA 4DILA 1QP8A 3TKYA 8AT1A 1F2TA 2Q45A 2V7TA 3PC2A 1KO1A 4MVJF 3Q3EA 4GLJA 1C7EA 3LGAA 1JEYB 4AS1A 4QDKA 2FRVA 2WVJA 4XVQA 3OO1A 3V97A 1DRKA 1Z36A 3DULA 1ELOA 5ITZB 4BPBA 2KS6A 4RD2A 4BLVA 7REQB 5LZ9A 3CB2A 3HHEA 3BJEA 2FFBA 3SHOA 2FQ1A 2L42A 1JAZA 3QOFA 1W2WB 3L6RA 3PYLA 5CPFA 4Z0TA 4AXBA 5GPBA 4BGUA 1D6SA 1TUIA 1E99A 2OV3A 3K0FB 3OE7D 4R2LA 1FRZA 4RGQA 2YXEA 3QNUA 3VPBA 1YUBA 4R2IA 3BE4A 4J7CA 1RQNA 5KMGA 2O9JA 1DBPA 1OI3A 1XXHA 2IL1A 2ZRAA 5JYDA 3ZWPA 3WL4A 5F3RA 3EDMA 1IAQA 3RUAA 3SQNA 3UCXA 1SUCA 2HGZA 5JXJA 4RENA 4BGDA 1XTTA 2H9AA 4Z6KA 1CIPA 3L49A 1M2VA 2RHBA 2WWRA 4CNQA 5LU8A 4FI3F 3KVRA 3U3MA 4MDEA 4ND8A 1UPCA 1Z8HA 5A9SB 2IV3A 4CT0A 5CW1A 1JG1A 3ZTYA 3NU1A 1G8JA 1Y9JA 3ZV4A 2OM6A 3T15A 2W6JD 1ZK2A 4BB5A 4RYDA 4V0MA 2ZPAA 4CFZA 3FWHA 1EVLA 4FONA 4OKNA 2NUAA 2ZB7A 5BV7A 5JC8A 4NZOA 4PGAA 5KYNA 4FD3A 1PU2A 1EGHA 4IOLA 4JQZA 3FCEA 4B0OA 3G8AA 1P2FA 4EX7A 1WV0A 2IZ6A 2PZGA 3ZWAA 4DM7A 4TN5A 4DMGA 4UBIA 4QUBA 5LMNB 3AIKA 3Q5EA 2TECE 2WFMA 3IKMB 1UEJA 1IEXA 2WKPA 4EYOA 3A14A 3A6EA 3WGZA 2RG7A 4WZBE 1V71A 2VP2A 2WYIA 3DEFA 4ZVKA 1JVBA 2R85A 5H70A 1FVOA 1E5QA 1UC9A 5B3JA 5GGXA 3WLTA 3QKUA 3SF8B 5DWDA 2WKWA 1UJ4A 4AULA 1FUKA 2B4QA 2JKYA 2D0PB 3RC3A 5A2QA 2ICAA 3KETA 2PE5A 4OU4A 3HKBA 5FUVA 5LQMA 2RFLA 2NNLD 3FKSA 1VL8A 2PUWA 1NLFA 4LJYA 4AT1A 1YA8A 1YFKA 2P9EA 3OIDA 4Z4CA 5I7OA 2ZRQA 1YMUA 1HV8A 2LIPA 1XZCA 3AI3A 1XDDA 1H1TA 2HC9A 1T1EA 2J4FA 3MB8A 4MJ3A 4YV7A 1JP7A 3PXAA 3SD7A 2SICE 4ILEA 4KGVA 1PR3A 3KQPA 1CF4A 5DN9A 3J7AC 4H9GA 5B4UA 1NMYA 1CUDA 2VQFB 3CS3A 1Y4DE 3TLCA 4DIKA 1PKEA 1CDDA 1ZH8A 1RPNA 5KQLA 1RP1A 3S1AA 4ZWNA 4FCVA 4AN4A 1RR6A 3GQBB 4JLOA 1Z06A 1ZZGA 3I3SR 3QITA 2P75A 4L4SA 4D0LB 1W0KD 3VKGA 3N75A 2OEPA 1K92A 5FRDA 3WDKA 4ETMA 3L6EA 4BN4A 1GG2A 4FC6A 1WUTA 4OB6A 4OQNA 1II0A 4KE7A 3ZQ4A 2KLHA 3JRXA 1XMOB 1U7DA 2JDIA 1OFGA 3CONA 1FRFS 3G89A 3I9FA 3KJXA 4IIDA 4KXNA 3TRIA 4BKPA 1CK4A 5LQSA 1HYHA 4S05A 5CEJA 1GFZA 1UKVY 1E9EA 1U0GA 1QONA 1WG8A 4FX5A 1LC0A 1ESEA 1W5BA 3B78A 1BXRB 1Z12A 3UUFA 4UAVA 1UBEA 5IH7A 1QH1A 4QOFA 1Y6RA 3HCAA 3GUZA 1D9XA 2XE6A 2XUGA 3LLSA 4IZ6A 3W34A 3I83A 3OFND 3IE2A 1CQIA 3RANA 3TXXA 4DMHA 4D6PA 821PA 1CY1A 4P7BA 4FS3A 4NU6A 4ZQFA 3J7TA 3HU3A 2DQYA 1UXGA 4P4SA 1QZZA 4ZKEA 3AZQA 4HLNA 3HCRA 3O73A 4NPAA 4QQRA 1CPYA 1ZJ5A 1T3HA 2BKVA 1KZ9A 3AK4A 4GL4A 1SUEA 3LSYA 3RUEA 1NVKA 4B9AA 4QLAA 5FPSA 3K9NA 1V9LA 3M89A 2ZRGA 1O94C 2Z57A 1V16A 2A7XA 3DC2A 3OHPA 2C1ZA 2R00C 2RHDA 4LWZA 4N5NA 1VOTA 4OH7A 4B4KA 2H51A 9GPBA 3GO4A 1ODKA 2YQZA 4PANA 2OO5A 1G2OA 4H1UA 1KIAA 3KBBA 2F3QA 2C5BA 1Z45A 1OXMA 1NI4B 1SRQA 3A9CA 3NS7A 4RK5A 4HMPA 5BSMA 3H2GA 3SR4A 4O3MA 3GDFA 4Q01A 3EDQA 3QA9A 4XM0A 3VX4A 1ULAA 1Q21A 3OE5A 5ED0A 3HK2A 5EQJB 4RTKA 1XTBA 1VHQA 1Y1PA 3OQVA 2JGDB 3DWFA 4QXAA 1HR0B 2W2MA 3AUUA 3B1FA 4JC5A 3CSDA 1PLJA 3V1YA 4QM6A 1W7AA 1D07A 3CA8A 1HA3A 3TS1A 1YONA 1GQFA 1U8CB 2XB4A 1EQ2A 1WBJB 4H4DA 4CMJA 4QJ3A 5KYXA 2DMRA 4PZLA 4YQEA 5DCUA 3D2LA 2O8CB 1ZL2A 2J85A 1PT6A 1E2UA 3PXEA 2B92A 5TS3A 2AC7A 3OX2A 1XJ0A 2NXNA 4CIBA 4S0ZA 4KP7A 5BMVF 1ZNXA 1L1RA 3WMXA 4YP9A 2IJGX 3Q10A 1KJYA 4ZXPA 4XVHA 1OVGA 3C7TA 3U60B 4D25A 4MS3B 1WZ2A 1IHDA 2RHGB 4C2TA 1WR8A 2QD2A 2ZOSA 1RYNA 1U1FA 1N75A 4I99A 1EIZA 1NBME 4M49A 4PNPA 4XSGA 5E6UA 3OUUA 3DVAB 1JIXA 2DUWA 3CPHA 2J3HA 3D6VA 1P5FA 5DGDA 2GWHA 1JAYA 4CLXA 1FXSA 1N0UA 4MI3A 5BN3A 1PF7E 3KHTA 1ZXBA 1GKIA 1J8FA 5D3QA 1HQKA 5ERXA 1WABA 1KDOA 2IUEA 1NQ5A 2PBLA 2WA2A 2M1XA 4P3NA 5AVZA 4LY6A 5LFAA 3U2QA 3IKLA 1JQAA 1G1MA 4N6OA 1E89A 3NNNA 1GPDG 4JSRA 3UVEA 4BZZA 4D44A 2XY4A 4S0XA 3A0RB 3V7WA 4YIHA 4K6OA 1E1RA 3ZBQA 4QREA 5E38A 1M72A 2W4IA 3DBHB 2GCEA 4HF7A 1W29A 1Y3HA 1SCIA 4P81A 1MHTA 1JXAA 4IIBA 1TPYA 1OC2A 3C6BA 3I73A 3BICA 4DY6A 1K66A 1N4AA 1H5QA 2C9CA 3HM2A 3PEFA 2P69A 2ZBFA 4FDTA 4QNMA 3V34A 3VR6D 1CR4A 2E5LB 1XF9A 1ZD2P 3A1CA 5JS7A 2C5FA 1L4YA 2CMHA 4GR5A 1RAIA 1Z47A 2XMSA 2CJXA 3COZA 3QFRA 1UMKA 1E0KA 1VCHA 3KWMA 3QVUA 1X0VA 1L4LA 3SQMA 2EARA 2JFBA 4NRDA 3MLEA 1BRTA 2RJNA 3WS7A 4D6YA 5DTEA 2Q62A 4JXJA 5DTMA 1Q0PA 1LBQA 1XHFA 5EUBA 4LJ5A 1VE5A 2IYLD 2VNKA 1EP3B 5TPWB 4TVBA 5JZBA 4KVZA 5BOSA 5E1BA 1V5IA 4IJVA 3CLRD 3TXAA 1DMSA 1D1TA 2WBLC 1YJ5A 2Y27A 5DP2A 2FR1A 2HI0A 2PX5A 2XWPA 2QRGA 3WKDA 5AT1A 1GL6A 3FX2A 3A9WA 3JQAA 2Q4OA 4EB6A 5BN5B 1I0ZA 3P9CA 2VQ6A 4JASB 1KSJA 2GN9A 1H42A 1X1EA 2E82A 4V0OA 3IBSA 3VR1A 1TT7A 2QE6A 3EC7A 2QRLA 1GITA 3WKBA 5DLDA 1TZBA 3PJDA 4AF8A 5KC9A 2BMDA 1QAMA 4YV2A 4Y2XA 1QIKA 4GBED 3KDPA 1ND6A 4MP8A 4KTVE 5KYYB 1I30A 2JEYA 4R1LA 3EUFA 3PQ8A 3RM3A 4D8VA 1Q3HA 2E4VA 4FI3C 3W3AD 2R1VB 3UQZA 5T7BA 4NYMR 1JHRA 3H84A 2X3YA 1JEQA 4PQYA 4FLEA 3TZQA 3BXXA 3DZBA 3QVGB 4G1MB 1WU7A 1K7SN 2OYSA 3GW8A 4YAGA 3LX6A 2ABWA 5LYJB 3ZHUA 3K0CC 5KYWA 5K2OA 2PX6A 2VDLB 4E46A 4LDJA 1D0SA 1G5IA 3DE3X 3NGLA 5C9ZA 1CUFA 3OIUA 1L5VA 1WMSA 2OECA 4GI5A 2OGTA 3ETGA 4P33A 4WFJA 721PA 5I4KA 2AJDA 3V4ZA 3NBQA 3ISTA 2YMPA 3WV4A 4N3BA 4Y6SA 3RODA 4Q3EA 1IMJA 4ZGBA 1QZUA 2V1UA 1FP4A 2PR7A 1K75A 1PG0A 2Q0XA 1AGYA 1AO3A 2OKGA 3HYTA 4BO7A 3QLEA 3KLBA 3CE6A 1Z62A 2ODQA 4N65A 4KQ6A 4BP1A 3LHKA 1PLKA 3EWIA 1K3FA 4W1SA 3ZS9A 3AETA 4ZZIA 1C9DB 4QT0A 4ZYWA 5F9HA 3SSNA 3F98A 1X8LA 1K8YB 1HPLA 5JJKA 1XZQA 4RA6A 4CDNA 4NZMA 3RVJA 4BNWA 2WVGA 421PA 3ZYZA 4D98A 2PV0A 3WP0A 3BS4A 4ZZ0A 1FU8A 1O6BA 2BGJA 2J6HA 2DPHA 3LC2O 3MFQA 3OT4A 4HVLA 2JEOA 4CTJA 2C4KA 2C3UA 3KQSA 2WPNA 3NBZC 5BT9A 3DMRA 2MTBA 4IH4A 1M6EX 2GDJA 1WB4A 3PXBA 5BSGA 4IUYA 2RAFA 1EINA 1NC1A 1XD2A 2DSTA 2WJ4A 2WYUA 3L0DA 4R7TA 5BVHB 3ESRA 3KYCB 4KODA 5IKEA 3LIPA 2OZKA 3H9JA 1NXTA 5DZSA 4FGLA 2Q2QA 3MGCA 3ZCPA 3I9V1 1QUFA 2GN4A 5CYFA 1X80B 1OWNA 4DQUA 3W8DA 1C8KA 3T6KA 3SQOA 3ZPXA 2IX3A 2Q1TA 4JU8A 4C7BA 5FBRB 3MUOA 3WG9A 1QFXA 3V46A 2PU7A 1LX6A 5JD5A 2P2DA 3MWDB 3NX4A 4RMIA 2C03A 5FPQA 4ABYA 2IW1A 2ZU0C 3QFCA 2IXGA 2H59A 5TV2A 1Z4OA 3TVDA 1YCGA 1O5OA 3HCBA 5KOHB 4PYOA 3DO5A 3QI2A 2ECPA 1BAPA 2H4YA 2IUFA 2V1XA 3WB1A 1I9GA 1HH4A 3PHCA 1QHGA 2Y99A 3CH7A 4HUQB 1FLDA 1B26A 2EZ8A 3MQ2A 5B2ZA 2XITA 3VU9B 1O97D 2J4CA 3GLHE 1FUEA 1YR6A 2A1UB 4WK0B 3CZQA 4XIJA 3UJDA 1GAXA 1JJVA 1EUCA 1HMPA 4EB8A 5IFLA 3OO0A 2LD4A 2VTKA 2JI6A 3C43A 2EU8A 3KXLA 5EMMA 5EG5A 1P2TA 4RW0A 4XVRA 5C8XA 2EWVA 5EMJA 5EWJA 1DELA 3QVMA 3GFQA 2PFKA 4CMHA 1L5SA 3F6YA 3LX5A 4HH3C 5MDHA 1ZUNB 3DAOA 3FLMA 4B7CA 1XBTA 3DAGA 1MO6A 4R1TA 5LP6C 4B75A 1V7ZA 3LYHA 2QAGC 4BO4A 3MMPA 4Q4HA 1G5QA 3ANXA 5TXGA 4CDGA 1CR0A 1CB7A 3W6OA 1V6CA 2PNFA 4Y2TA 1IDN1 4MDHA 5TQVA 2YL2A 3ON5A 3O8DA 3DD1A 4ZAYA 3R0IA 4DA4A 4YV0A 4WSOA 4KREA 3C5HA 5KDDA 1YE5A 1JYSA 3CCBA 3RBZA 3QKIA 2JJ1A 2RHLA 4RY2A 1VBNA 1II8A 4WA7A 1FTWA 1REQB 4GOLD 5FCDA 2NWQA 4G07A 3EVNA 4E4TA 4RTNA 2BCGY 4KO8A 1MA3A 3C7CB 4BNZA 3GMDA 1YIDA 3HKDA 5KX5A 1M66A 4GQAA 2XMCA 5ARBA 3G23A 5A2GA 5AK4A 3VO9A 3TLEA 1CY7A 3NYWA 4XUCA 4B87A 4CMBA 3WNZA 3ZV5A 1LJUA 2F1KA 4TXMA 3L7CA 4D9NA 3AL2A 3CJRA 1CWUA 4XFDA 5DOVA 5A9TA 5JUWA 1N9KA 2OD9A 2Z9CA 1XTQA 1GTG1 3RK0A 2QUBA 3TCNA 4HNQA 5BR1A 2AG1A 1BN7A 3QMWA 3AKCA 4K9DA 1H69A 5FUBA 1NGSA 3D6UA 2F62A 2XQVA 1W48A 1Q0ZA 2J3EA 3M1YA 4H1HA 4HNSA 3KE9A 4LGVA 4E5YA 5EJEA 1P4HA 4BUJA 4MS4A 3F8SA 1NMZA 2PZJA 1OAAA 1D8AA 1XWWA 3BG5A 3GAZA 2HMYB 1FX0A 3DFFA 3WICA 4ACAA 1W36C 2CLLB 2HMVA 1QTNA 3AERB 4FR2A 3ZU4A 2H4WA 5JMTA 2ZM6B 1I2CA 2YJ4A 3MELA 3OKCA 2J6IA 4KQIA 2YZMA 2VSYA 4OK6A 2OCPA 5DM0A 4F5WA 3Q7IA 4CQMA 2GBIA 4YCBA 4ZQIA 1YZ3A 3K0BA 4F4DA 4UD6A 3BWVA 4CEHB 2JI8A 2R11A 1ULHA 4IGKA 3I4CA 5KREA 5FUQA 5IZCA 3I34X 2ZWPA 1FEZA 1H3EA 2ZBDA 3G8DA 2O7QA 2VYND 2GYUA 2IEBA 1RRKA 4GMHA 2HLPA 5C18A 1ST2A 4NBNA 5IM4F 1IJBA 2GM4A 3CUWA 3IURA 2I33A 2OSVA 3B70A 4FMPA 4NCKA 1GCUA 2DPMA 4JY7A 2YXNA 3P9YA 4NZ9A 4GYYA 4KPUA 2O52A 3AMVA 3MTGA 1PNTA 5BRJA 2LDXA 4NU0A 1UOQA 5JAPA 4FHFA 4CKBB 1CSEE 1WVIA 2G8LA 2O19A 3FJ1A 4COOA 2NSYA 1J8YF 4TLAA 3WJ2A 4AZ3A 2OXFA 4B79A 3OU2A 2GHIA 5TNXA 1JFRA 1XNQB 3VKUA 2OO7A 1YVDA 2VZ9A 2IEIA 2GK3A 5AOVA 1QZTA 1TD1A 3TI7A 2GETA 3P97A 3R3WA 4XX1A 3GH3A 4QGGA 3L1VA 5G3YA 3TW8B 2HADA 5DRTA 1C5KA 1WVGA 1HE1C 3FR8A 1GCOA 3IRUA 1I1OA 3IQIX 3CEMA 4H2DA 4MUAA 2C95A 4S35A 4G5QA 3D5EA 5DOZA 2EFYA 3LTNC 3OEHD 5HZMA 4WCFA 1GSOA 1ZCZA 2H9IA 4I1IA 3CBQA 3STXA 3I52A 2WQ7A 3W5DA 4NL4H 4AQ7A 4JFRA 4MLPA 1P1FA 4OQPA 4DZRA 2V4UA 1E1QA 3DC7A 4MLZA 2PYIA 3RAEC 2P9QA 1TEVA 3TM4A 5T4HA 3RJTA 2J9XB 4DKJA 1GZSA 2H07A 3L77A 3KELA 4I6GA 4U3JA 1DXOA 4W8GA 1Q14A 1H2BA 1T8PA 1YZGA 3G0OA 1JT2A 2Q6KA 1F20A 3QEMA 1O8BA 2HJVA 4JLDA 3EUAA 4QZVA 2N42A 1HE8B 4X5OA 1Z29A 2GQ0A 2C2HA 5CLHA 4M2LA 1HMYA 1OREA 3E9MA 5FADA 3B2QA 4L4RA 5AVRA 1BCRB 1DEKA 2HSWA 4LFCB 3DZFA 4N0DA 4D3XA 4DV5B 1EFTA 2P2YA 3GU3A 3EZXA 4NHOA 2COEA 4YECA 4CLOA 5JQGA 4GKJB 3T3EA 3FDJA 2JBHA 2BC9A 4D3ZA 2WFAA 1JLSA 1ZSVA 2EDAA 3N05A 3LM8A 3LXRA 3ER6A 2JI9A 3L5KA 3USZA 1XO1A 4TV9F 5A04A 4MGIR 2NV6A 3L02A 2RHCA 1FCJA 5EIAA 1IQPA 5EKSA 3HR4A 3WGYA 3IDZA 1W8IA 2XUOA 4CV3A 3A25A 2HCRA 2PL3A 2MINB 3BHNA 5CPBA 1Y5NA 6YASA 2VTDA 1MT0A 1E2DA 3QM1A 4OJQA 5E8RA 2ZJBA 5BXYA 1OLUB 5JNLA 3ONWA 2NMVA 3UWPA 1YS6A 1K5GA 3UWKA 6PFKA 4OX9B 2EW2A 4JUAA 2CDRA 2I67A 5K9ZA 1VCMA 3UMRA 2O7RA 5T3UA 2HWYA 2I2CA 3V42A 3CWQA 3VPDA 3MEQA 3WFJA 1EXVA 1CP2A 2RCYA 1JBKA 3PXXA 2CJWB 1W6RA 4HNGA 3U62A 4TTIA 4GX2A 3U0BA 1RWVA 2A14A 3WYAA 4G0QA 3H5WA 4QVGA 2Y0PA 1OZ0A 2H4FA 4M83A 4YUYA 1A27A 4PW0A 4AU1A 4X0EA 2DHCA 4BS9A 1VIVA 4F4HA 4AQYB 1L7XA 1XCMA 2QVZX 2ZYSA 5AM1A 4E07A 3QKRB 2RD2A 4TTSA 1NBHA 4P38A 5HMMA 3LFUA 3H5LA 2JFUA 4XTCS 5TB5A 2R7NA 4C4AA 3BQNB 4YUWA 5JASA 5DLPA 1X1TA 2YV1A 4QODA 5BR4A 3ZLJA 2BKEA 4MUHA 3A1FA 3I6ZA 1PJ3A 1MAHA 2HRDA 3K73O 1AGNA 4NS4A 2OAP1 2VDWB 2WJGA 4WE3A 4TL8A 1ZS9A 2E6UX 3WO0A 2K7FA 2A59A 1EZZA 4MR8B 4KYTA 2RGGA 4A16A 3ETDA 5JDIC 2G08A 4ARSA 1RRVA 2PH3A 3NLLA 1Z39A 1NR1A 3NQ41 4A8PA 4KUGA 4TMKA 4B0PA 1I4DD 1Z5NA 4OYRA 4QWWA 3L8YA 3VR2A 2FW7A 5C32A 2WJJA 2QQEA 3I92A 3O4VA 1WMEA 4DVGA 4BO2A 4HGOA 6LDHA 1E7WA 1NVFA 2JAQA 3I9MA 2BFMA 1R3DA 4ECEA 4RKQA 3TPZA 1E6CA 3TTUA 1VIMA 3SQLA 5A0VA 1WHTA 2I2AA 3C5EA 1U9JA 1YL5A 2QAIA 1QYDA 2IUSA 5FPKA 5U9CA 4YR7A 3B38A 2E5WA 4PO9A 1SVKA 4YPVA 1GARA 2X0IA 3HEAA 4BFUA 1SPBS 4JITA 5C53B 4KO3S 3A7DA 2A4MA 4D2IA 2DCUA 4GM4A 1U5BA 3KALA 3D6TB 4F6LA 1GPYA 3FMGA 2VT7A 1ULSA 5TIIA 1G20E 1DJQA 2GYYA 2PGDA 2PXHA 4FT2A 3AUKA 3P2MA 4K9PA 4NPCA 3KL2A 1C3LA 4J6FA 4WZAA 3IQXA 1DNPA 2E5FA 3KAQA 4LDPA 2CVHA 4JLBA 5ECDA 3DCYA 5G53C 1CNFA 2DHEA 2HDNB 3BOSA 3Q11A 4KIJA 4A10A 4ENRA 1J9GA 3GJ0A 2IU6A 4RNDB 1RXVA 1Q15A 4PC2A 5T4EA 4ERXA 2YMQA 1N8KA 3BTVA 4NMMA 3RIXA 1E6MA 5DX8A 2A84A 1EVJA 3DA8A 1T3SA 4ZEXA 1XAIA 2AMJA 3BRSA 3V7UA 3ZLTA 1QMGA 3DAPA 5JISA 3GB9A 4C4YA 1X13A 1KO7A 2EGHA 4M9RA 4RIFA 2FRDA 3O3MB 1L7AA 5AI6A 1RXUA 3WMRA 3V1LA 3BFKA 2G9ZA 1JFLA 2REQA 3K1YA 3KR2A 4JLAA 4LZWA 1XXHE 4UPVA 3BMOA 1MMFB 1CB0A 3ESYA 5F4BA 3IAHA 4EJSA 1CLEA 2XNCA 5HOEA 4OQXA 2MMCA 2NVUB 3L04A 5KJ1A 1JS1X 2AYYA 1DKLA 1N9GA 2NT4A 4F4FA 2IX9A 3K9WA 1TK3A 2AMYA 4JLVA 2X2OA 2EJUA 2D00A 3IP5A 5HIIA 4JQYA 3T35A 2PKYX 2LCIA 3Q5DA 2X13A 2XE8A 4JVMA 1U3CA 1ZGCA 2QN7A 4D57A 1KYZA 1OA0A 4V0ME 3T3IA 2WM9B 3FHOA 4D74A 5JOQA 3OWOA 3ZDAA 3CO0S 4TX1A 5EMHA 4D4GA 4BCCA 4EVQA 2QZZA 4W99A 5SYAA 1TFUA 4CU5A 2CZGA 4PS1A 5JS8A 4BMZA 1FA9A 1XQ9A 3PR1A 1VJ0A 3LQ4A 3ASVA 5AJWA 5ERYA 1SUIA 3E35A 4TLDA 2XKJE 3H4IA 3VAZA 4EB3A 2IDZA 4FGJA 4PIVA 1N7GA 1JKMA 4MYHA 2VJQA 1OTYA 2PS0A 1NSYA 2XQJA 3FCYA 3JARB 1Y4ZA 3CX4A 3KOZA 4JVLA 4MVWA 4NV0A 4RPCA 4C04A 3FRJA 4RVFA 4L8YA 5H1YA 3KQLA 3C14C 3HRKA 2QX7A 5FOSA 1DO0A 1GZ6A 5DM4A 4HDQB 1CJKC 5GJWC 1YO6A 3CT6A 4R8MA 1H0RA 1YZQA 4ZO6A 4JJKA 2WF8A 2XB8A 2WTAA 1RKXA 1U3GA 3EGXB 2O23A 3UHJA 4HYQA 3AR4A 4KRGA 1N78A 5ARCA 1V25A 4NE9A 1GP2A 4Q24A 1UQRA 5L3SA 4NOLA 5JAMA 1E1CB 1R4ZA 4MB2A 4H1WA 3MCTA 1QP7A 1TZCA 4OQEA 4KR3A 2WZBA 5AKKA 3VQTA 5CG2A 3PT9A 1C0KA 1RPJA 5EE9A 5ANRB 3SIXA 3VNQA 5INTA 3N9IA 1RE0A 2HLDD 4XPIA 2QYSA 2I6GA 2VP3A 3E70C 3QOXA 1EH5A 5K45A 1U7PA 3UXHA 1OH5A 1E2FA 2E4AA 1RPZA 1E2BA 1RRGA 4KSYA 1G0NA 1QQTA 3I42A 3VR0A 5JJBA 2BBWA 2FPRA 4O0LA 2RGBA 5ECYA 1ABBA 5I7EA 1KERA 1SB9A 1PEYA 2ZUSA 4ZVOA 1N6KA 5KVVA 2FDXA 1QC5A 1SAYA 4RPGA 2PSEA 3S2EA 2IZZA 2R8OA 4PWYA 5A6SB 1DBVO 1NN3A 3H17A 4RLFA 4GSKA 5EHNA 2C7GA 2LPMA 4BLQA 4I66A 3JWJA 4UEWA 5I7AA 4YX9A 3HO1A 2VBCA 4AWAA 3A4TA 2C61A 3PUXA 4QJ4A 3EC2A 3Q8XB 1PJ2A 1JLRA 1LRLA 4TUYB 5KTTA 5G0SA 5GY7A 3K9FC 4P84A 4B4DA 4QBHA 5CYOA 1O96B 4HX2A 1E2LA 1N2JA 1ZOIA 3D0QA 3I2HA 3ICOA 4P5PA 2QRMA 5DV9A 4KVAA 3UV3A 1HXHA 2XZPA 3KUKA 4QG7A 3ZU6A 1LRKA 1WKVA 4YJ2B 2JFYA 1Q0TA 4UE6A 4EJFA 1KK3A 1YS7A 2ZRIA 3M4YA 1UDRA 3OHMA 3VR4A 5E6SB 4GUDA 1ZO8A 3QX3A 1XJ5A 4LRXA 4TWJA 2HJSA 1HG0A 2GEFA 3PFIA 3DZ8A 3OCWA 4BVGA 3MQ4A 2BELA 1NX6A 5J2TA 2CCJA 3G2MA 1UT5A 4IIGA 4L27A 1GO2A 4LBWA 1SCAA 1PR5A 4ISCA 2NZUG 4YAWA 2MSLA 1X7YB 5FJJA 4C3OB 4N3CA 3JVIA 3VU8A 4C89A 5LA6F 2FPSA 4A2QA 1QCYA 4I1UA 3UXYA 3HDQA 4DTIA 5JH7B 4XM2A 1YJ8A 2CF6A 4G97A 3IT3A 3DL4A 1DG9A 1DOHA 1VG0B 5K0JA 3F96A 2ZE5A 3I8XA 2BP7B 5F9MA 5HG0A 2DETA 1J0EA 4FQ8A 4G0VA 1Z4MA 4ND5A 3SJBA 2CHUA 2YV3A 3BHJA 3E6AA 4BRUA 5B6JA 4NK4A 1K8ZB 1HNNA 1Q3TA 1KYIA 1UCFA 1EFRA 1WULS 3BILA 2DQZA 3CNHA 5F1KA 5F5NA 5FA8A 3T7EA 4TQGA 5DNEA 1W5TA 2EDCA 4MUXA 2VHUA 4XEUA 3I5YA 1QGUB 4KRFA 3DUWA 3ZZTA 1S8FA 2A33A 2P5YA 4MI6A 4ZODA 4DWWA 2C8VA 3C24A 2JHCA 2J1LA 3DBLA 3ZZUA 4LSWA 2GXQA 1FTQA 1UINA 3GEMA 4LJ6A 1A04A 2PMWB 3OJLA 1XN4A 4PYNA 4WJKB 5LBUA 1JMKC 3QBTA 1PFWA 1ODLA 2XTJA 1FP7A 1TRKA 2OC4A 4TXLA 2WTXA 3TMYA 3OUZA 4MWOA 1DLIA 5AXDA 4EG1A 3D6HA 2E4YA 3WLSA 1ZWLA 4EA6A 1E5DA 1N5RA 3GRRA 1SVLA 1YC2A 2ORWA 1V8FA 2P6PA 4PY2A 4QTZA 1YKSA 1BU8A 1Y48E 1Z34A 2WM3A 3LP5A 2Q8QA 3MD0A 3MFYA 3OTWA 4K0RA 3FZNA 2HK8A 4B73A 1NIJA 2VJKA 3WNVA 2C1XA 5CVTA 2H31A 2AFIB 2KBEA 4L0DA 3O75A 1QFZA 5HFNA 5C8DA 3A1SA 5EIHA 4A5SA 1B6RA 5L40A 1JEAA 4LRWA 4YAEA 3GAAA 1K6JA 1S2DA 4CETA 5K20A 2G83A 5F77A 4QUGA 1M2KA 2IXFA 3WK5A 3VV2A 5TF0A 3NIFB 4BXOA 1QRUA 1JU3A 4IIJB 4N9QA 3AVOA 4Q03A 1EK1A 3INNA 1WD7A 4M9CA 1A8QA 4MKRA 5I4BA 4FINA 1X1BA 2IXEA 1DUSA 1YOVA 1JKJB 3CE9A 1Q1EA 5CVUA 2ZRFA 4YMLA 2IEDA 3ELDA 3W9BA 5AICA 1ZD8A 1Q0UA 3OE7A 2PSSA 4DPKA 3C8UA 1DT3A 2AN1A 4EVIA 1TU3A 4L9SA 3PK0A 4YCMA 4RDCA 1E2EA 1VPVA 2F7SA 4RLSA 4RK4A 4FXPA 2MCFA 3VPCA 3JAKA 1CF2O 3K5IA 3PRYA 5J40A 5EAIA 5FX2A 2PWPA 4M76B 3E9YA 4NZNA 4AJIA 3D7RA 1QV9A 4N8SA 4EUSA 4MJ7A 4M0PA 2WP8J 4RFLA 3MWYW 3ZDRA 2XNDD 2VHQA 1UFOA 4CV1A 3Q8MA 3AUSA 3IQEA 3IDOA 2HWKA 3U4QB 4MRAA 2QBYB 2W6JA 2IXTA 3VH3A 2ZIVB 2BCEA 3KR0A 3P19A 1UC4B 3DH0A 2JLSA 4L3WA 5IXYA 2GF0A 5FOQA 3KLMX 4II7A 4DR2B 2VDJA 2PEYA 1PUJA 4KMSA 4CEIB 3UK7A 1HYEA 1WCIA 3VBCA 4G8CA 1ML3A 2B34A 1J56A 4HNVA 3PT5A 2YHUA 1I5EA 1MT3A 3Q6MA 4ZREA 3WK4A 4YR9A 1QYRA 3E3AA 3E5MA 4P34A 3RG8A 1EBBA 4UW9A 5EKDA 2QS9A 1DXHA 1EX9A 4YHBA 2UVPA 1WOYA 4LOJA 2CHGA 3K1JA 3W8FA 1L2TA 4P80A 1XRPA 2M2IA 2YIJA 4OM8A 1N2CA 3OMXA 1ABEA 3AWIA 4MW9A 3URMA 1KZGB 3SHTA 3OZXA 3R5FA 4N5IX 4JU9A 4AYXA 2WZCA 4MQLA 5FWNA 3MAGA 2EEPA 4LZAA 4P54A 1TB4A 2VUUA 3K96A 1X1RA 3PPWA 4YAUA 1PJZA 1QVRA 3E1SA 3FDZA 1QHFA 4EJ0A 3EJWA 1EVEA 4NE2A 3DV0A 4MV7A 4JGGA 3TAUA 1L7VC 3JW8A 1DJPA 1Q1ZA 4QBKA 3VR6H 3WR5A 5KOJB 3KSBC 1V45E 3OPQA 4L0QA 1N8SA 5GONF 1QE0A 2HGSA 1C7ZA 1DIHA 4F3RA 2P7IA 4MQFA 3JQBC 2O3UA 5KTRA 4MDFA 2Q0QA 3LXUX 3N87A 3AQIA 1SKYB 4G5RA 1H93A 2WOJA 2B30A 4K28A 3TFQA 3WNBA 5IRCD 3UAYA 3NONA 5AVVA 1RAEA 4S1OA 1NVWQ 2IY8A 2NIPA 2Q3FA 2X7JA 3BHMA 1ZQ1A 1T0JB 1CUVA 1K8RA 2XA9A 1YKGA 1QYIA 3NRCA 2ZXEA 1W0KA 4HWOA 2BEJA 4MWBA 4ITUA 3WKAA 1EIWA 1E92A 3AU8A 5LP6B 4U2GA 1CE8B 4LQ4A 4OLAA 3B3AA 3NT5A 2QAGB 2E21A 5TEWA 2BMFA 1ULUA 3PFNA 3Q41A 3Q3VA 1J24A 1SUPA 2VAXA 4MUFA 4RPKA 3DTYA 3OM9A 4BKQA 3EXEA 5FR2A 4LDZA 1WCV1 5REQB 5T6MA 2B83A 5LZ5A 1EFPA 1VA5A 4NI5A 1CNEA 3GLVA 1MF7A 5JARA 2XYGA 2ZJ3A 1L9XA 3UK6A 5A0FA 3RYCA 2NU6A 3PHBE 1MC5A 2XVYA 4AUKA 5CXSA 4I2NA 4R98A 2ZIZA 3I6QA 2JLBA 4EEKA 1Y5RA 3EQ7A 2X3UA 3OFNA 3Q3HA 3RBXA 5E3HA 4EGJA 2Z1MA 3A6DA 3ED5A 1JDTA 5FBVB 1ZM2A 2IIQA 4HDRB 4DRXB 2HXYA 3W3AH 5JNTA 3C6MA 2W6QA 1E0DA 1YDFA 1W0CA 1V41E 4MKIA 1C29B 3ZCRA 3CRNA 4DDWA 4IGIA 1YIOA 1VLVA 2ECQA 1R9MA 1ZM9A 3I2FA 2BZ1A 2ZSFA 1WA5A 1IEWA 3CHYA 4KLRA 2CUNA 1X2EA 2WWTA 3PWTA 3HXTA 3ULKA 4E5NA 1ZD3A 1U3DA 3HHPA 2QMOA 2OE2A 3O6VA 4LQCA 3IBCA 1U3UA 4LZLA 5I6DA 3BM5A 3FXAA 2IA5A 2Q5OA 4ZYTA 3HZZA 3GJ7A 3SVLA 4RS3A 3ZVMA 1O0SA 4UUNA 2ZW9A 4CNBA 5BMVB 1ORTA 4ML3A 1CY0A 4N82A 5AJTA 2EX4A 4YT8A 2OV1A 1O95C 4KKVA 4D9EA 1W36B 2OWEA 3PQFA 2AOTA 5BORA 2DRIA 2O8VA 1H8HD 3C85A 2J9FA 2CB0A 4MROA 4DCCA 4EF5A 4XJTA 1E58A 4R41A 1NE7A 3HEMA 1GXSA 2YRXA 3B6JA 2OOKA 2G8NA 1WXXA 3I61A 4G2TA 4PZDA 5T5QA 1DJMA 4EM6A 2O1WA 4KSBA 4YREA 2GN8A 3DE6X 3H3XA 1KI2A 4TRJA 3U6BA 2DERA 1ICEA 5IULC 1PNOA 1VLQA 2AR7A 3H1BA 4BVEA 2EBFX 5E1MA 2JL1A 3QP9A 2UAGA 3PTAA 1N0HA 2PD6A 4JBLA 4WK6A 1B6GA 4FEYA 4W5WA 1BFDA 4AG3A 1DQNA 2XGJA 3WNQA 1T5BA 4CF6A 2Z6QA 3TTVA 3H5VA 4FSDA 3AR3A 3UO8B 1ZN2A 1MX3A 3SKYA 4BNKA 3MRVA 3WLOA 3NTUA 3R0JA 4AO7A 4IEFB 1NUQA 1GPNA 2QVYX 1NWCA 4EENA 4UHFA 5T4FA 1N6IA 1P6XA 1DIAA 1Q2XA 4FR5A 3WZMA 3DB1A 4Z1OA 2BEWB 4M54A 3ENWA 3DG9A 4EB0A 1C1YA 3N2YA 3O4JA 4W9NC 1I80A 1QG2A 3DBVO 3G7UA 2B0CA 1FZQA 2XMPA 2RGXA 4X8OA 4II2A 4O4JA 4V24A 3ZWKA 1IBLB 1WU8A 1KI6B 3P9ZA 3RWMB 4N48A 5BWOA 2B82A 2UYOA 5C35A 1EHYA 1GGEA 1ZGHA 1BD4A 1SXJA 2IHBA 2YCBA 3GDOA 5AJYA 1C7QA 4JCCA 1I7DA 2PYDA 4FFRA 5IH3A 2DY1A 1NVVR 2Q8PA 3UJPA 1JQLB 3VSEA 4C7XA 1QHNA 4D3FA 3IQFA 4E5PA 1E3DA 3RAPR 2R751 4EGCB 5LQRA 1CYEA 1NATA 1QG0A 2QN3A 4ZT4A 3OZAA 4OHFA 3VR6A 3K0AB 5FORA 1YI1A 3BIOA 4YRPA 4IX1A 4LQDA 4L51A 4KMOA 1B23P 3RRNA 4UTPA 3X0DA 4K1XA 3LT5A 4UARA 4ZU3A 3KO8A 1RU3A 3Q1KA 2VH2A 4MWSA 3ENKA 3QRWA 4N47A 1HX7A 2WF9A 3DF9A 1ZESA 2O2XA 2IUUA 2GVNA 1GPWB 3LV8A 5I5EA 2HA5A 1OHHD 3GRAA 5M04A 3RC2A 1R8YA 1ZR4A 2C78A 4GXQA 4E2XA 4ZCLA 1PZGA 2BFPA 2C0PA 1F2VA 3BCSA 5DTJA 3W2IA 2NUPB 1ACJA 1JHUA 3ENQA 3GLSA 3K20A 4GMGA 2FV8A 2JCYA 2GS9A 1N1MA 2MYPA 3G5TA 2ONKA 3GP5A 4WUVA 4M1TA 5DYIA 1KOLA 4LZZA 3GJSA 3W6UA 4KJZA 4NABA 1P6QA 4F8YA 4QXPA 4IYJA 3IEIA 4ZAGA 4OJMX 2FK8A 3GEPA 5K0ZA 2CV2A 2F1JA 4KBGA 4RHEA 4FFMA 4R7GA 4GMXA 4YJKA 4ZPJA 3FIUA 3CW2A 4R3UC 4ALIA 5JAIA 4O25A 1XCBA 1ENPA 3TQFA 2FEKA 1RLOA 5HHTA 1KAHA 3I4FA 3G17A 3W9SA 4D4KA 1J2TA 1AQUA 1HDYA 2Z5VA 3R6DA 5B58C 3GVXA 1IC6A 3G1UA 2JC3A 5BSEA 3W3AA 4WLUA 3VSCA 3MW8A 1GTJ1 4M9XA 2FPGA 3MS7A 4U8HA 3DV9A 3AEKB 4UAJA 1Q7EA 1WQ3A 5DGCA 1XMVA 3R4VA 2ACKA 2NO6A 3AFOA 1JQBA 4YNBA 2HBYA 1NL3A 4F38A 1XPRA 2VPTA 2QLMA 4L2IA 4PFSA 1C30B 2O2GA 1TUEA 1PL7A 2QG4A 3DXFA 1QBGA 2XQIA 4GKKB 1QVWA 1T15A 5C37A 1B0PA 4E22A 1C1XB 3CC8A 2ZI9A 1PNRA 1XLUA 1OX4B 4GC9A 2VAVA 1IZ0A 1M2OB 1OBHA 1HSZA 1W5AA 1BOFA 1VLJA 4L9WA 4G1CA 3DMNA 2J45A 4S1WA 1LPSA 1S8AA 1M34B 4WIAA 3UXEA 1OW3B 4Q3AA 3ZGYA 5BV0A 3KHSA 3KU1A 3FUVA 3DYBA 1SFRA 1KAEA 2XXAA 1ZAYA 4GH5A 1SOAA 1TXGA 1U4NA 3N2KA 1P9OA 5IAGA 1R0LA 2FR8A 1D2GA 3OY2A 1R4AA 3PKIA 3QUSA 3ZE9A 4B82A 1N5KA 2O06A 1JQDA 2BR4A 4RXUA 5LXTF 1EA7A 3C1TA 4P3OA 3D6FA 3I30X 4TWBA 1UJCA 1GR0A 2Y0BA 5CVVA 4QPPA 4WNCA 5LJIA 4ZQHA 4BKUA 4PHGA 1OZFA 2QMEA 2ZAGA 4LYYA 2C5EA 2I66A 1HZZA 5AR1A 3WBJA 3HU1A 3X1WA 1GD1O 1PSWA 4O3FA 2FWIA 4IIYA 4ZCQA 1A9XA 3NDPA 4TLEA 4YRKA 2A7QA 3W9YA 4B6OA 2P0YA 4KGXA 2C98A 1WWKA 1F4PA 2ZB3A 3BWXA 4EITA 3PUWA 2CT8A 1OX6A 2D0OB 3H4MA 3HABA 3N39C 1ZLYA 3NKLA 3P32A 4G4JA 3AU9A 5U4QA 3TGPA 3LCVB 3PNYA 7YASA 1M1YA 4G1UC 5CM8B 2YZ2A 4KGDA 4ZVPA 3H83A 5TE9A 5MF6A 2I87A 1TCVA 1XTPA 4OVKA 1VJRA 1T6NA 3U16A 4EPTA 1NVTA 1JE1A 1M0TA 3R3ZA 4YP7A 3QU5A 3LT0A 4UHDA 4OMDA 2J9GA 4K1LA 4N5MA 4BO0A 4XQ9A 4LF5B 2AZTA 4NNOA 5TQ2A 3RLIA 2P2SA 4GDFA 1T43A 3GQVA 4JK3A 4TZTA 2LDBA 1RRCA 3GEGA 3ZI4A 2ARKA 2XYQA 3EMDA 1M2NA 1G1AA 4YP1A 4JT9A 4RJKA 2NYVA 3NM4A 2WVAA 4MRVA 3BH6A 1GPH1 4GOND 2HPHA 1U8XX 1ZZEA 1Z7YA 1XHEA 3KSZO 5ALKA 1LDGA 3W5SA 3A04A 1KR5A 3ZJ5A 3EVAA 2JH3A 4GRDA 2PUBA 3IAS6 1RM0A 4CIVA 3U7GA 2RDMA 3PCXA 4L1KA 4OP3A 1UADA 4K7JA 3TX6A 2NYAA 4J0DA 4EYEA 4M0FA 4Z7NB 2YQ5A 1SOWA 3ABZA 5HIMA 3SHWA 3EVTA 1SCJA 2C97A 4W82A 1YI0A 4AS3A 4XIIA 3LW8A 1SCUB 1UBJS 3LKBA 2UUBB 2BCJQ 1J7KA 3I39X 4L6AA 3ABSB 2ZYWX 4MQEB 3RC1A 1GV0A 1N77A 1U7TA 1UM9A 3H1EA 3FOZA 3MN1A 2ILTA 2ERCA 3J80A 5L7TA 2DPYA 2I3AA 5DBEX 1P2DA 3QE4A 3IAFA 2X5KO 3PJFA 3SKVA 3UMVA 3GRUA 4P4NA 1ZR2A 1GTSA 1AXRA 1A7AA 2X8JA 2ZS9A 4MKFA 3M4ZA 1MDBA 2Q0SA 2VF4X 2QUKA 4OXNA 1ZIYA 5FTKA 1HUQA 3VBEA 1NU8A 4YRRA 4DSNA 3CW9A 5KYUA 2EC5A 2WZDA 1O4WA 1M2GA 2X8LA 3FYDA 3H9EO 2LGJA 1X94A 2UXCB 4PFJA 3VC3A 3A6FA 4EO7A 4N12A 3RC9A 1KI7A 5E4JA 5KKAA 4MW7A 5DF1A 3SZGA 1OXVA 2F9MA 1EAYA 2IPMA 2QJRA 1D3AA 2YIMA 3N2EA 4XUDA 3EIQA 1YZYA 2JRLA 4G86A 5IC4A 1F60A 2O2HA 3NGMA 1C0LA 1U0FA 3FJYA 1FYEA 2W8ZA 5BNFA 1Q7TA 5FPYA 1CS0A 3LUHA 2Y71A 4INJA 4XD2A 2EJCA 5G4LA 1WNFA 2J31A 1JJ7A 4W8HA 3B6MA 1VE3A 4RFSB 1R4MA 2BZSA 2RHHA 3GARA 3S0JA 3HSSA 5HKOA 1AHPA 3HRIA 1JIVA 4CCYB 1K86A 2PJDA 1BVRA 3PQ6A 4ME6A 3P2YA 3IMFA 5BNWA 3GD7A 3ORYA 5BVGA 4RULA 2G1PA 4ZTBA 3ZWOA 2QGFA 3QWAA 1ZOOA 1NI5A 1AZLA 4Z7JA 1D7OA 3FYUA 1VIDA 1DRVA 4PLZA 3FG9A 4TL9A 1AU9A 3AVYA 1EWQA 4PCAA 4DIDA 4JMPA 2J0VA 1D04A 2IGTA 4XKJA 5BQ5A 3T3OA 1FSGA 1QR2A 2FR0A 3B36A 4JI2B 1VGVA 3NVMB 4HXGA 1NUTA 4UEQA 2VYFA 2YHIA 3DFKA 1DC7A 3QKSA 5AKEA 3SZ3A 4H1TA 4AJPA 2XUKA 3Q98A 4BVFA 5A1TA 1SXQA 1Y8QB 4XGNA 4TTVA 4QXQA 1RKVA 1W5SA 2LUOA 1Y1KE 4UDOA 4BWGA 5HIAA 4BLRA 5AQEA 1JR3E 1E9CA 2LBPA 1MX9A 2VYNA 3QU2A 4R8LA 4YCJA 4EGQA 4KXLA 4DUYB 2HF8A 4HGYA 3USCS 4NARA 1RQRA 3LNTA 5H16A 4AC9A 3T7TA 4UTRA 2VHTA 1AMUA 2R1ZA 3M0EA 5H9WA 1RT9A 2ZP1A 3AB7A 3EZ9A 5HRUA 1ZD9A 2WG1A 4QIHA 1GPBA 1PQ4A 5HKBA 1ZONA 1EG7A 4HDSB 3ERCA 2FSSA 2WHXA 3NUZA 1YS1X 4TMVA 3GT3A 3TTSA 1NYTA 3ZE2B 4GUAA 2RH9B 1DL5A 3ETJA 2X8WA 4UHEA 1KFKB 3SYMA 2YZ7A 5HQTA 3OPYB 3UHFA 4KYVA 1DE0A 2PTGA 2XUPA 5L3RA 3OIFA 3BIWA 1S1CA 4UMEA 4LF7B 3AB8A 1YK0A 4TQAA 4C05A 3ZS8A 1IOLA 3TQTA 4KAAA 5JD4A 3GV0A 1ZJJA 2V7BA 4XLTA 4B35A 3G0HA 5CAEB 4YT2A 5HRCA 1X19A 5CVEA 4B80A 3L7LA 3ASZA 5KOIA 4ZI7A 4H6PA 3VJKA 2CSXA 1OBOA 5JSYA 3U19A 5LD2C 1H6AA 3H5AA 2IV7A 1F0KA 1CUXA 3HY3A 5KHOC 3OEED 3RRXA 3HGQA 1KEEB 4J29A 3OEHA 4YY3B 1OX5A 2P67A 1LFAA 1LLQA 5L3QB 4YMUA 3NBUA 3BMQB 5ISMA 5KNDD 1KA9H 2NSLA 2Q3BA 2YXBA 4M0LA 3I09A 2H65A 3RVMA 1RIFA 1ISRA 1BZYA 2AX4A 4TV9B 4YJFA 4BMVA 1V48A 1AK2A 1GUFA 2O20A 3V80A 1DWQA 3Q87B 4MOWA 1JA0A 1M75A 5AOCA 2H0QA 2WY2D 4X92A 4K40A 3RYIB 2R6AA 5TR9A 5AKZA 3WRXC 1XZDA 2ZSEA 3O8NA 5BSUA 3E3MA 4MICA 1U1IA 3O84A 1YUNA 2BM0A 2O2DA 1C3OA 3O8OA 3T7AA 1IOVA 3S2ZA 2V6MA 4CMEA 4DM3A 3CBGA 2I34A 2VP9A 2WC1A 3SX2A 3FSRA 2YX1A 3SSOA 5ED4A 2X23A 4P0QB 3HCNA 2NOAA 3IA7A 3L6BA 3G1WA 4BYMA 4G1EB 3CYFA 3AV3A 1EK2A 1D5CA 1DDGA 2WTBA 4YUVA 2DVMA 4LHVA 1HE5A 2NGRA 4OAPA 2PD4A 1JXOA 2AVDA 1XU9A 4BNHA 1ZCFA 3ZCXA 2W83A 3JD3A 1PQPA 5JI3E 2RHTA 4N5DA 5BW8A 3ZBTA 1FE8A 1ZKMA 4C20A 2OD2A 3THOA 5CCXA 1ZJWA 4OKSA 3OKAA 1JBQA 2E55A 3IP3A 1QHIA 1G64A 2W5UA 3P96A 1UIRA 3B6EA 5FOTA 5LLDA 2K2QB 4LHYA 1H9BA 5DHRA 5ENDA 1ADYA 2YVAA 3I9JA 4RF4A 1S3SA 5EZ5A 3O93A 3QFFA 2VRNA 5M29A 1E61A 3EZGA 4XWKA 4S24A 1Y7LA 3CZAA 3GA7A 2VNHA 2IP1A 1IZZA 2X4DA 3N3BC 4X66B 3FTNA 3K6RA 1L7EA 4HH0A 2DH6A 2QX6A 3R3VA 4X8MA 1W9HA 4KR0A 4HB3A 1XYVA 3EVBA 2HU5A 3ONFA 4JEMA 4FIDA 4HPWA 3STUA 5K6RA 3AESA 1BDJA 1SO8A 1TW2A 3IIEA 4GRIA 3MERA 3H4TA 4UUMA 3T7KA 1DZ3A 2H1WA 5IHPA 3EMBA 4YI3A 2P2CA 2AWOA 1Y9DA 1JDUA 1XFAA 1YBMA 3BCRA 1SURA 5EERA 3A9TA 5JTUA 2FPUA 3ZCUA 3ECSA 1GDHA 1GNPA 4QYXA 2PGJA 2QW8A 1CDZA 1I6LA 2G82A 3O4HA 3H1TA 2B4KA 3NJ4A 1KXJA 1GU1A 1RYYA 2E87A 4Z9AA 2ISCA 1Q6YA 2E4WA 5LDDC 3ROGA 2TS1A 1T0IA 1IRXA 2X86A 3ZD6A 1TNDA 2QB5A 2EG5A 3HWRA 3WWCA 4U7GA 1NRWA 4EOGA 4I08A 2E48A 2W2VA 5TEVA 2C2YA 5JT1A 1PZXA 3H18A 2VO1A 3FTDA 4CKXA 3JU3A 3PSAA 3Q7EA 3FW1A 3DZIA 3G1TA 4M9QA 4K0KB 2ZSHA 2FZCA 2PO7A 3BAZA 3KYJB 3L8FA 4RAOA 3TSWA 1PFGA 1M8JA 2V6JA 3WTCA 2ID7A 1GAEO 3A11A 1PSZA 3FFXA 4PHHA 3CRMA 3SLKA 3R44A 1Q7BA 2E4UA 4PR0A 4UEOA 5K8LA 4CR7A 2F1HA 4P98A 1HQCA 3MS4A 4Z54A 3ZHYA 1QPZA 2MOKA 2J0UA 1PTKA 3FPFA 5CD9A 4U2KA 2LKCA 1N1EA 4J8PA 3T12A 3O1LA 4J1TA 1YDGA 3DXYA 1I4LD 1BWPA 4IHJA 3WB9A 2WD7A 3ZZ0A 4ZCIA 3FUWA 4HEA6 5SY9A 4KPFC 2D7DA 3EGVA 4OHVA 2M6LA 5FWXB 3CRQA 1CHNA 4G4IA 4J3FA 2ATXA 1AO0A 2P1DA 3K05A 5SZKB 2PH7A 1QF7A 4WRRA 4Y98A 1BX1A 4KQFA 4WXEA 3V8MA 2CV1A 4XH9B 1Q2UA 3G2JA 1POXA 4HRAA 3KZNA 3QEBZ 4TVKA 1JEJA 2JH8A 3HKEA 5G41A 1F4VA 3HEBA 3ILVA 1O94D 3OQ6A 2OXEA 3RUCA 4TYNA 4AWBA 2QL6A 1ADCA 1EMDA 3QV1A 2FSVC 1VJCA 3ZU2A 1PQUA 2BBTA 5EP1A 5JEDA 1P8AA 1RQXA 3B3GA 3O4RA 3Q9UA 4BVHA 4C0WA 1JQEA 3GRPA 1DEHA 1G2PA 1JALA 1CV2A 3VZPA 3OM8A 2VYVD 4DT1A 1F0YA 1YRWA 3CISA 2QMQA 4GPZA 4OIFA 1TLLA 5BUZA 1LDNA 2BJHA 3EEYA 3SXUA 1ZKDA 1ZM3A 4D9IA 5AH0A 4C4TA 3LLCA 1KMIY 4RV9A 1DTEA 3EDYA 3EXHC 3U81A 4EZBA 3QW2A 2MR6A 1Y9AA 2OCDA 1OZAA 3LFTA 4WK2B 4YLEA 5D5PA 4ECAA 4X71A 1HFWA 3C3MA 3QV2A 4XB1A 1H8ED 4O4HA 4RD1A 1NBOA 2Z04A 3BEDA 1PR6A 4XCVA 3W5UA 1E1KA 4X90A 2QYTA 5KQPA 5IN4A 4O4LA 5FTNA 5ADVA 2ZT8A 3ZWMA 5DE3A 3TSCA 1CQPA 5LDHA 2I2WA 4KLNA 2QTWB 1X8JA 4U7TB 2QP4A 1IXSB 4FMDF 1BDMA 1M6WA 4J16A 4C87A 1NXOA 2OV8A 1BE8A 1K98A 3QJGA 4KFRA 1B0AA 5AHOA 5JPCA 3WKEA 2XUHA 3EVFA 4BZXA 2JF0A 3IESA 1FQOA 4PPQA 3EIOA 2WU4A 1YR3A 1IVSA 3WOHA 1X7DA 1EJ0A 1AS2A 3C4VA 3U61B 1N2XA 1J33A 1RHUA 2BONA 3V8VA 4IBOA 1WXWA 3ZHCA 4CPDA 2ZVQX 3BMNA 4DCMA 3L8GA 3K5PA 1F6WA 1I8TA 4DREA 3QU7A 3E9ZA 3TLGB 3OESA 3H8VA 1AUXA 4GMKA 1NYQA 5BN1A 1WD5A 1UKZA 1SCBA 3FROA 3FUXA 1W4LA 3I2GA 1CP3A 1LQTA 1JLHA 3LUCA 1RM3A 3TBFA 3VOSA 1OH8A 1GZ3A 2JGLA 1I4OA 3QVVA 1DADA 1K6MA 5H02A 2X4IA 2HLDA 3CNLA 1M2HA 1OA1A 1NQUA 3GEIA 5KQRA 2BL4A 3LKZA 1BQ3A 2RIRA 2OBFA 3DOHA 4JX9A 4LC0A 3DZKA 3O2SB 4ROTA 2B1JA 4EHFA 4F84A 2WYHA 2FN8A 3TBHA 3UANA 3WSTA 1JWAB 1QLWA 3U3DA 1TPZA 3ZZNA 3I4LA 3O5AA 5C1BA 4FQ5A 4PPGA 2JGEA 1TFRA 3KQTA 3KYIB 4QAJA 4TLBA 5AHWA 3FAZA 1C9YA 3I2IA 3VO1A 1I3CA 1YI8A 3CM0A 3HCFA 4BBAA 1NBIA 1H1DA 1YZVA 5AVYA 1TCUA 4F1KA 4BFYA 2P9BA 1RBMA 4PBRA 3ZD8A