1Z9BA

Solution structure of the c1-subdomain of bacillus stearothermophilus translation initiation factor if2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
NEFELGTRGSSRVDLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Translation
molecule keywords Translation initiation factor IF-2
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 1z9bA01
3WBJA 1G7RA 4N3NA 1Z9BA 1G7SA 4KJZA 1G7TA 3WBKA 4N3GA
chains in the Genus database with same CATH superfamily
1ODTC 3KIPA 1VGRA 2YIMA 2XCRB 1NXWA 1A4XA 3ESZA 3RIYA 4ETMA 4EPTA 2HGSA 3FUCA 4X0EA 4RTLA 2DFKB 3QOWA 4MA0A 4UEWA 4ENVA 5JALA 5KX5B 3B9BA 3IP5A 1BMTA 1UJ5A 2QM8A 2CVFA 3KJFA 4EEXA 5C5CA 3WSTA 1BFDA 1M8PA 1AQYA 4OO3A 5LD2C 1OR8A 1RWPA 2B0CA 4NEGA 3Q7RA 5TC4A 1QHIA 5BT8A 3IP9A 4KNWA 2WSSD 2WWTA 4PAQA 1NRWA 1DBWA 1WCWA 1V9LA 2Q1XA 1ADJA 1V5EA 3RANA 3JWGA 3KETA 1MHPA 3D4IA 2HH9A 5DYNA 3BJZA 2IZ6A 2RHRA 3MTAA 1DJQA 2MINA 3L0CA 2CDBA 4LHZA 3TN7A 3WICA 1BDMA 1CDOA 1OTYA 3FLMA 3U48A 5E38A 3PGJA 3NHSA 3RS9A 3TIIA 3QFHA 5JC1A 1OROA 1DSSG 2I71A 1X13A 3CLVA 1SVNA 1ULAA 4B09A 3PKJA 2RAUA 7YASA 2PMKA 1EG2A 1FNSA 1QV7A 3IC5A 4HRYA 3OJLA 1HL7A 2B4QA 2IHKA 2HQSA 3FUXA 1J9GA 4CT4B 1BROA 3D3QA 4XJSA 4EA7A 1AB5A 5KSZA 1JFSA 3ZKWB 1PNTA 3M1AA 3MMNA 4RBNA 3NB0A 3WLTA 3KKQA 2QXYA 1P4SA 2OCIA 4TMYA 4RV4A 1H2BA 3THRA 4YREA 5CDYA 2BEVB 4OXIA 5FD8A 4DSAA 4N4AA 1YIAA 3IOYA 2ZB8A 3KKOA 5A5EA 1G1AA 2ZJ4A 3VV3A 2QYSA 2L82A 1JF8A 1SG6A 1YDGA 3T0FA 3VC1A 1SOWA 2YV1A 4M8KA 4EY5A 2O8FA 4RA9A 4TLCA 2PFGA 3HJAA 3TINA 2XKKA 4OX9Y 2EKLA 4KAJA 3B1ZA 1GIAA 3A2LA 3ASUA 1N7IA 1JEAA 3GP3A 4MW5A 5AMXA 4FE4A 3VR6D 5LP6B 3BBPA 1NXQA 1FFAA 4M1WA 1T35A 1NFFA 1M1ZA 2BFMA 2D0DA 2EV9A 2X8WA 3LUDA 1EYZA 3A4YA 1KYVA 3DMNA 3DTYA 1JEJA 3UBMA 4O8ZA 2VQFB 1YZGA 4OIFA 4D57A 4HXFB 1T29A 4KN9S 3C3BA 3NUZA 2NZWA 4OXQA 4RDXA 2P77A 2IEZA 3AR5A 3EIEA 4N6NA 4OHWA 3A28A 2K4MA 2I7CA 1W85B 1DAKA 2B78A 1RXEA 1S8FA 2XGSA 3FYSA 4LZPA 2J32A 1QTNA 3HKEB 3NC0C 3COSA 3DBLB 3PIRA 1DB3A 4YTEA 5EQJB 4Q18A 2FMFA 2PBRA 3FCEA 4CODB 1BWPA 1N6PA 3UMBA 4DWWA 3R6WA 2GEJA 3AGQA 3FPGA 3UYLA 4GXNA 3GLKA 2F3SA 5DNWA 5ULLA 3VKUA 1B0ZA 2Q6TA 4AJIA 5HUHA 3R5SA 4LI0A 3AI7A 5A2QA 1TCBA 4Q1CA 1UP7A 5KSYA 1IBMB 3DFKA 1TJ5A 3A6LA 3GGCA 4B6QA 3L92A 2V7QD 2CLOB 1LRJA 1Y98A 1RZUA 1K4MA 1GPBA 2Q6OA 3OQJA 2GBCA 1HRDA 2Z8ZA 4QGHA 3VNSA 3TL2A 4F4HA 2IU3A 1OLXB 1W30A 3LWNA 1L4LA 4MSUA 1Z45A 3OUTA 1Q1AA 1Z2DA 3AEUA 5CB6A 2OO7A 2C97A 3O93A 1P2FA 4UU7A 4N3NA 2Z9CA 4UDYX 3E0QA 3T34A 3SKXA 3C4VA 4Q21A 1ODKA 4FI3F 5ERGB 1NASA 4ZAYA 4WFJA 1QMPA 2H5JA 1D4FA 3D31A 4OQEA 3NHZA 5CNIA 3P9SA 1OBHA 1BGVA 3IDAA 5E6UB 3L7KA 2Y4NA 2PNFA 3U7IA 4D0SA 1VJTA 2QN3A 1AKMA 1FX0A 5D86A 3TTVA 4DTCA 1OLUA 3B6IA 1SU8A 1PGPA 1GR1A 2XAUA 3NAQA 1FXWF 4OQLA 4MW0A 4QXRA 2HA7A 2YS7A 1J9ZA 4N7JA 1WXIA 2W2VA 1QFSA 2XF8A 3S70A 2H1IA 3VKFA 3LY5A 2XKAA 4DIFA 1D5WA 5BOSB 3QI7A 3VKGA 3SX2A 5JC8A 2GBLC 4GMXA 4OQXA 1YZ3A 4CTMA 2XZTA 1CZHA 1RTTA 2RIPA 4CKBA 1QCZA 2GPAA 3DOIA 3VO1A 3A8TA 4LJAA 1XZFA 2H85A 3T94A 1ZSNA 3EW7A 4UD2A 5FR2A 3AESB 3HEMA 2PUHA 3AUAA 3TR5A 4Y67A 5JNWA 1APBA 2PVSA 4AK9A 3QMVA 3I3OA 5I4BA 4H18A 4YJGA 2AOTB 1I6MA 2QE7D 2CNNA 5ER9A 2VRCA 4KOAA 4Q9AA 3TZHA 2JI7A 4KQWA 3MJHA 4LDNA 1NG9A 1FK8A 3RWBA 5A1JA 1MKYA 1NFRA 1J20A 3IVRA 4H7DA 5DM4A 3RUIA 1PR3A 1QNLA 1YXMA 1ZGJA 2DECA 2X4IA 3I1JA 4Q3KA 4QXPA 4R1TA 4FR2A 4LF8B 3VISA 1UKVY 2VHYA 1PQ4A 3CRZA 5EUMA 5BSTA 3VR2D 2GK4A 2EW8A 5KWJA 2Z8YM 1H4SA 2BHTA 3RJMA 2K7ZA 4IS3A 3M3HA 4B3CA 1FP6A 2I9PA 4S05A 3BPSA 3JQQA 2WQZA 1DBRA 1NGSA 3MMSA 3GLHA 1E2DA 5KU1A 5IKMA 1KNXA 4FFPA 1R4ZA 2OQVA 4C06A 3GRUA 5CYPA 3AVWA 3MGCA 1RAFA 1MLDA 3UT5B 5HZMA 3R7BA 2Q1WA 3DP9A 2X19A 4FHZA 4C2AA 2NYRA 1LS6A 1NM5A 3D9QX 1KEPA 3PC8A 5SYNA 1X19A 3ISTA 1HDXA 1DRWA 3CT4A 2F8TA 3FYUB 4ISBA 4JK3A 2PBLA 2BWJA 2RH9B 2OECA 4FDTA 1SKAA 4KK4A 3VO8A 8LDHA 1O58A 4TV9B 3H04A 2ZAMA 3IT0A 1QRUA 1TAUA 1BWRA 3GN1A 4DA9A 1JV2B 4OHXA 3MUFA 1JW9B 2DHCA 4PHHA 3IMGA 4YY3B 1CETA 4H27A 4MXDA 5G2OA 4B3TB 1NMXA 1SHZA 1E1LA 4ENWA 4IF6A 4KWEA 2Z95A 4KQGA 4OSEA 1ZK0A 5HQ3B 1MG5A 2IYOA 5HCNA 1MFPA 5T4BA 2CHQA 1QKKA 2INGX 1DG1G 1SUAA 4Y30A 2ZBQA 1YKSA 2XUAA 1IIBA 2FWMX 4EB8A 2WHXA 1XRLA 3LC7O 1HR0B 3V1TC 1U2TA 5AVSA 3VPSA 4UBMA 4WZZA 5F7JA 2EARA 3GN2A 1KEEA 3EXIA 3TVDA 2XGMA 1JLLB 2D3WA 4ZA2A 3UC5A 4HGOA 4CIXA 4EHNA 3CRRA 1G8JA 2XNDD 4ALLA 1U3UA 3H2JA 4L75A 3ROQA 3UY4A 5JJBA 4ER3A 4EQ6B 5AQ1A 2AXNA 3DEHA 5KJEA 1OXMA 5LZ4A 5H4GA 3K0EA 4XPZA 1CUXA 2H00A 3JWHA 3MRXA 4OI2A 3NHKA 4UCFA 4QFCA 3GDFA 4YRQA 4DC9A 3U6KA 1Z7EA 3CZ9A 3H5VA 5JHHB 3G2NA 2TRSB 3ER9A 4IV0A 4JGBA 3IR5A 4PG5A 4IQ0A 4JBNA 3RAEC 3L9XA 2E2WA 4BQOA 1I4WA 1GGKA 1HT0A 1C1HA 1CSEE 1NX6A 1ZNXA 3AERB 5K6AA 1TECE 3BTSA 5FULA 4G3XA 4Q6WA 3BX1A 1C4XA 1RLIA 3QMPA 1RWQA 4HS4A 5CLJA 3T7DA 1JT2A 4P0PB 1PFKA 2DHRA 4PU0A 3WS7A 3CRQA 5ALTA 3I9FA 2WZQA 5C31A 3EXAA 1ZSVA 4U2EA 3X1MA 4FCCA 1YJCA 4KXFB 1NF8A 1PG5A 1UZUA 1EK1A 4Q7KA 1Z5OA 5L3ZA 3AVUA 1LNZA 2O3TA 4CM1A 3MAAC 2BHSA 4PR3A 1T24A 1UDRA 1IJBA 1HQCA 3RABA 2OOSA 2RAPA 4AP9A 5BSEA 2WFLA 3QPWA 5HNKA 3COJA 1DBQA 2VSOA 3TKAA 2G9UA 1T2EA 4D6XA 3W6NA 2AKYA 1K5GA 1TM7E 2IEBA 3E9YA 4RD2A 3HK2A 3WV5A 3I30X 4U3JA 2PL9A 3H1AA 3B12A 3GRKA 2XXBA 3B9RA 2AEMA 3DJFA 2GILA 1IBKB 3WX0A 4XFKA 3ANYB 1KMIY 1MHTA 1ZUNA 3NOXA 4HWPA 2XLCA 3VNUA 5LPNA 4DM3A 3FD8A 3OZRA 3RI3A 2Q0XA 3VDNB 3T5PA 2UXDB 1KTVA 1IQ0A 2WJYA 3P71T 4II2A 4XUEA 2ZRPA 4AS1A 1U31A 4B6RA 3OEYA 5HIAA 1HMYA 1RHQA 2F6RA 2EIXA 4CMGA 1X1SA 5CDUA 1OI7A 5SYMA 1XTKA 5IT0A 1DAGA 4TRNA 1IEVA 4UJ5A 3VH3A 1LPNA 3BXXA 1T1SA 1U5BB 4BJ6A 1ZGCA 3PGMA 4QM7A 1ZWLA 5D2CA 4MVJG 4DMKA 5FTMA 1IWOA 1LQUA 2XX3A 1Q57A 2RBKA 4XRGA 3EVFA 1R3DA 5F52A 1P2DA 5JAOA 4A4DA 3IR6A 2J87A 2RGCA 1AXEA 3W5UA 4JT2A 4WI1A 5B3JC 5KVVA 2FN4A 2FUG1 1M0SA 2BE9A 2J3MA 4B7AA 5JNLA 3K32A 2C8JA 2G5PA 2J41A 3DL0A 1QTRA 1OLSB 1Z5ZA 1FDWA 4FFMA 1L2TA 2RHOA 3ETCA 3NRBA 4M99A 4IMJB 4NJEA 4KSCA 1UDBA 2UUOA 2XSZD 5JE8A 5CM2Z 1KDRA 3U44B 4AF7A 2YC4C 1AMNA 2ZBFA 3KWFA 4RY9A 5EMKA 2I99A 4HLUC 2MWMA 2J3QA 2KHZA 3AEKB 3IMKA 3KOYA 4Q3CA 3ICPA 3H0EA 4ZXFA 4LYYA 4WQMA 2IFTA 4AQ7A 1G5HA 1V7CA 2AEFA 5EE3A 2R0QC 1KYYA 3V2HA 5B36A 4UCXA 1EFVB 1P33A 4DWOA 3CYFA 3Q7IA 3WK8A 1P2VA 4DIOA 2G6TA 2I8AA 1T9GS 5J1SB 3Q85A 1W581 1RW4A 3DD1A 3U3OA 1Q0SA 1JFFB 1DKNA 5BYAA 4EI7A 1Y81A 4C6RA 1X77A 3GEIA 3N75A 3JQGB 4WZBA 3HS3A 1P74A 5BQ5A 3EA5A 5CGQB 5LQJA 3VAYA 3IJEB 4PIVA 4DRYA 1F17A 4IM7A 1PR0A 4G67A 4D9MA 3R3SA 3A1EA 2YNMD 1A9PA 4MIOA 4OYHA 4FYJA 4X92A 1MXFA 1FMJA 2OBNA 3Q72A 4G8CA 1K7FB 4RH0A 1UPTA 3VR2A 3VPBA 4G1EB 2AR9A 3VR5D 1FP4B 5C7IO 3COZA 3SPXA 1WDKA 2OBMA 1VB3A 2ZE6A 2A84A 5KNBA 4J3FA 2DFPA 2FYTA 3AY3A 3PPIA 4P93A 3OFSA 5TEWA 1L7OA 3TKLA 1YCGA 1MB9A 3NCTA 1CVIA 1G7CA 4W9NC 4P7BA 1N5JA 1R6DA 2Z5GA 2PGJA 3NDBB 1ZRNA 1BX3A 1OU4A 4I7EA 3X1DA 1EUCA 4F2GA 4J7XA 3AJRA 3ICEA 2F62A 3BDAA 4FR0A 1QVWA 2GX6A 1G2IA 1Z4JA 3WAGA 4DAOA 3H5LA 1NVXQ 4S0ZA 2Q2NA 3LQRA 2GA8A 2R6HA 2WTBA 1P1RA 4PHCA 1BA3A 1YZQA 3CCFA 4M9RA 4DM7A 1ZK4A 2FEPA 3AQ4A 2PL5A 3AFGA 1LK0A 2EHJA 1A4RA 4FOPA 3AZPA 1YVRA 2B4KA 2J46A 4YGXB 3TIVA 5CITA 1DZIA 2CNDA 3V2IA 2C84A 2E1PA 2GB4A 3U4HA 3ZE0B 4ZV4A 2I4TA 5MF6A 3Q3GE 1XCGB 1JDZA 2OORA 5JCOC 3V4FA 1U7XA 2BSQA 3THXA 1JAHA 5L6MB 3GJ5A 1MC5A 3FNIA 5FADA 1QQTA 4YP9A 2HIMA 3KR0A 3NM4A 3HNOA 5ESWA 1EHYA 1PTJC 4H0NA 1T5BA 3CGGA 4IEFB 4XWTA 3G8AA 3FY4A 3PX2A 3WRXA 2Q3LA 1NNLA 1QZTA 2DHQA 4PGMA 1SCAA 4DVJA 1SXQA 1V8PA 2IUEA 3FNQA 3R3HA 4TTRA 2P4HX 3A9WA 1HZZA 1VRVA 3M3DA 3OQIB 4NMXB 1JDBC 1SXJC 2JFGA 3TE6A 1U7ZA 1JKIA 3W5JA 3AFMA 2HOQA 5JADA 5DM70 3W5AA 1K5DA 1J49A 1F0KA 1I5EA 3HXTA 1Y3CE 3HZRA 4FLFA 2B4YA 2O7QA 2V7QA 3GLRA 4NJOA 4KQ6A 2JFQA 5FKJA 2JFFA 3N1UA 4P36A 2BRUA 2ZI3A 5AKEA 3WRXC 4K0KB 1VXOA 2Z2KA 3HRHA 1SZPA 1GQFA 1I0IA 2AYXA 3CKYA 2QUHA 3G2KA 1RLTA 2BFFB 4N8SA 1CBUA 2OCXA 1CWUA 4WJZA 3IO5A 1OHHD 4ZMBA 2FI1A 4F45A 1JDJA 2GH1A 3BILA 3MWEB 1QPGA 4LHXA 3EBOA 1HTWA 1UQTA 2POCA 1M8FA 2VXCA 4Q3BA 3KQNA 1N92A 3ZLJA 3S8MA 1IBRA 4X63A 3QVWA 1F9EA 2ECFA 5AW6A 1MC4A 1CQJB 1WZEA 3QWIA 2JASA 4IEIA 4G5FA 4JJAA 2VBGA 1MOPA 4HAVA 4KRFA 3ABZA 3BEDA 3VNRA 2O8EA 1X2BA 2O2EA 4ARSA 3TUJC 3OEED 1EINA 1Y6ZA 5FBZA 3L7CA 2XCUA 5FPQA 3J81k 1W1UA 2FXVA 4BDSA 5JJKA 4AX4A 5IXYA 1CQJA 1XA0A 4JIGA 1AKTA 4MVJH 4NATA 1E1MA 2A0YA 3EASA 3WMXA 1WV0A 4E4RA 3ENZA 4ZQIA 4I0WB 3BULA 4K9DA 4Q7MB 4LUCA 4P3NA 5LZ8A 1QUFA 1G5TA 3UJHA 2D2XA 4AU1A 3JY6A 4LHYA 4CI0B 3FCXA 1DBSA 2OR3A 2CUKA 3E9RA 4MKXA 3TKYA 4B46A 2NLOA 3V1MA 5EHNA 1CJSA 5FNZA 3QW2A 3OFND 1DG3A 1DXHA 1RBQA 2HRBA 4Q05A 1C7JA 3K5IA 4UTOA 1SKMA 2A33A 4R6WA 4X20B 5KJ1A 4XUCA 1JU9A 5EESA 5EJ4A 1P2UA 1SURA 1ADFA 3PFBA 3BGOS 1K5PA 3KSDO 3U9TA 3AL3A 5AVWA 1TLTA 4R0NA 3RO7A 1H23A 2X2OA 2IK8A 4RF3A 4XFJA 4XDHA 2Z1NA 3QBJA 4XPIA 5H59A 4K86A 5FOQA 2OXTA 3BMOA 1STOA 1KP2A 4R1SA 2R1TB 1YONA 2AR0A 2FEOA 1FRZA 1EKXA 5DYYA 4BO3A 3R9WA 1X1CA 1UBNA 2FGJA 4MDFA 4RZUA 4BVLA 4ZJZA 3GAFA 4X8MA 2VA8A 1YQWA 3A25A 2JLQA 1UOOA 3ZD7A 2X8JB 2XHZA 1NKVA 3AYXB 3JYNA 1FYFA 3AEKA 3JZAA 1YHNA 3FBTA 4RANA 2X4LA 4Y2XA 3WLNA 4OLBA 1EDEA 1LLUA 3VI3B 1SMKA 3STWA 5JV5A 4L28A 2OHIA 2OV6A 1IEQA 1VL1A 2UZ1A 1ECCA 3V8BA 4ML3A 2YDYA 3H5IA 3LSTA 3ES9A 2YJZA 4TT8A 3FI0A 3AQIA 3V2UA 1L5QA 1OI3A 1PSDA 3ME5A 1VIAA 1GFSA 2GR9A 2HXGA 3C24A 4YH1A 4OBEA 2OAP1 4F9EA 1M1NB 5FFNA 1CY4A 1TU0A 3EQZA 1LVGA 4JP8A 4E1BA 2ZZNA 3NRCA 3LQ2A 3MTIA 1ZC3A 2EF0A 3KAJA 2LNDA 4RH3A 3GFFA 4NOLA 3RUAA 2BLNA 1DBIA 5EAIA 5TT0A 1RQ7A 4TLDA 3RRXA 3VOTA 5K3AA 4DJFC 5LP6A 2CLIB 4F2DA 1HNNA 4B43A 1QBGA 3OT5A 1QQAA 3VBEA 1E77A 1PFYA 1UMBB 3KLBA 3DTVD 1G21E 3R40A 1B7GO 4HWKA 1KETA 5GIOE 4FXPA 1HYGA 3IXQA 4Z4EA 1GPLA 1O97D 3KEQA 4EF5A 5H7XA 1JDNA 3P2IA 1CUJA 3L7AA 5JRDS 3C48A 1JQ3A 3I4CA 1NWCA 1TMOA 2ZBVA 2HFKA 2J48A 4Q3NA 5EIFA 3QKUA 1JFLA 2WPDD 5AW5A 3TDMA 4MV4A 1XA4A 2V54A 3G89A 2AFRA 1CUDA 3C6MA 3L7YA 4YJ3A 5CTAA 4BQPA 1QZ3A 1WB9A 2NPIA 5A3QA 4NJMB 2KMLA 3GA5A 3CNBA 5D3KA 5EN4A 2I6UA 1ECJA 5IT4A 3A04A 4PVCA 1QYIA 2QW0X 4NS4A 1M2FA 1IHPA 4GEKA 3NBKA 3NFYA 1NU8A 4I2VA 1H6CA 1WCIB 1ZOOA 1DCKA 3LCMA 5C8YA 3QLVA 2WG1A 2HKIA 3RS5A 4KLAA 1L4YA 3DMRA 1VLVA 4YFYA 3VYVA 4L5BA 3GJ3A 4BLUA 3NOOA 1Z0ZA 3P8ZA 1Y80A 4FKZA 4ZPJA 1PR4A 2BEKA 2I62A 3AWDA 5DEIA 1YF3A 3F5MA 3DE0X 1IQPA 1NLYA 1QX3A 2B8NA 4HZUA 1V5GA 3K8QA 4LRUA 2XGOA 2N1MA 2ZBGA 4XGKA 1CC1S 2EQ5A 4PNPA 2YYZA 1JJBA 4GUAA 4KOEC 1GQQA 1G3UA 3MB5A 4TV8B 2FN9A 4MIEA 2A6PA 2ZSUA 3RUPA 3GCXA 3LHFA 4RS4A 3SEAA 1CNMA 4UM5A 2SHKA 4NULA 1FW8A 4OL9A 4WX2B 2BGRA 2BM9A 3F7TA 2IHTA 4LHWA 5JOQA 4Z4IA 1Q5PA 5L45A 5TMEA 1TYEB 1ZVJA 4K6MA 3ZEAA 1XFDA 3N6RA 3K70D 5KTOA 4ZJUA 2QZZA 5IBCA 1F6WA 1UJ2A 4MS1A 3ZHUA 1UP4A 2IL1A 4P22A 3RV3A 4RS3A 4QAQA 2X9NA 2IGBA 3Q3EA 3OTWA 4WK6A 5DTIA 4XD7A 1D4OA 3EIOA 1BC5A 1KI6B 4KEAA 3F67A 3EJWA 1F06A 4ER7A 3DUWA 2RGBA 3QELA 4FYXA 4NMLA 2QR2A 4K81B 4H6XA 2BLLA 2UZ3A 2EL7A 2XUIA 2UYQA 5D01A 4F85A 1LWNA 4HGPA 4EYEA 2FW9A 2C8LA 1GUDA 1UR5A 1C30B 3OP1A 4K9LA 3UQYS 3DV9A 4DMGA 4WEQA 4EZBA 1S3IA 4RLFA 2F3PA 3GCDA 3CZAA 4LJYA 3WWZA 1KJWA 2ZXFA 1FVFA 1VKJA 2A9JA 4TXJA 2E6KA 4D6YA 1MNAA 1X1BA 4TUYB 4U0JA 1WBJB 4ZQHA 5C8YB 3G0HA 1TKCA 1DKOA 4HGZA 4KQIA 3IALA 1BAPA 3PDIA 4GI7A 3SQNA 4KMOA 2BDTA 3H0KA 5IC6A 4TKVB 4XCXA 3E2IA 5TVGA 3AY7A 3OJFA 4W63A 5DXJA 2J3IA 1SQ6A 1IY0A 3D2BA 1NBMA 3L79A 4GGMX 3DR5A 4JBLA 2O57A 4B4OA 4EF6A 1MJGA 4FJ1A 1DO0A 5HSGA 4NIMA 3UHFA 3U3RA 1T1JA 2CXHA 1I1HA 4L95C 4C4OA 1NUAA 5AI0A 1H22A 4RQUA 4UTPA 3M6VA 2GA9A 4QFMA 5L3VA 2QM0A 1SD1A 1EXMA 1J2JA 2GM5A 1VHTA 1CP2A 3DEJA 4BMZA 4AS3A 4F3CA 4ZYVA 1DKMA 1YB2A 4EKIA 2IIQA 4G1MB 5H4HA 4QVGA 4XB1A 3UUGA 4CMCA 4L0DA 2ZWVA 1HEYA 2QTBA 4ZO8A 2JBAB 1L5HA 3JAKA 5AK5A 4ZO9A 3DXYA 2HNKA 3GMIA 3R8XA 1EP9A 5JMOA 3KQHA 3LUGA 4PC3A 1YZFA 2B20A 5EGNA 4QDOA 3ZZMA 4ZGBA 4KR6A 4E51A 1H8HA 4R9VA 6ABPA 4AJHA 2Q9BA 1I32A 1RZVA 3Q9SA 4NDAA 3HHPA 4HDSB 1XP8A 2VXYA 3SSNA 4RFSA 1HO3A 2YY7A 3FUTA 3T5DA 2HQ1A 4A7PA 4I5IA 3LI2A 1KFCB 2AUNA 5I5EA 1WBDA 5JNVA 4OATA 2G36A 3I53A 3P0HA 4RCVA 3AHIA 3CNHA 3E15A 3SJAA 3FOEC 4JZYA 4PZ9A 4HVTA 2OD9A 1NZFA 1CUEA 1X0XA 3X0DA 4LXIA 5A5FA 5CT9A 4KQ1A 3BDIA 4CMBA 4P4TA 1GNQA 4G0VA 1CUSA 1T4MA 2YWJA 3WC4A 2FFJA 3FCUB 1HEIA 2YMLA 1AN9A 4PTLA 1OBFO 1F7UA 1J8DA 3AR3A 1OAOA 3H5WA 3KDSE 4YRFA 4DLPA 1A5AB 3PHGA 2ZI5A 1K0UA 1PX2A 3IIJA 3NORA 4WTOA 3F2VA 4YFVA 1SELA 2YHUA 1KDVA 5EMMA 1LNQA 1D03A 4RPGA 4DW8A 2CZCA 3JX9A 4Z7QB 1NW6A 1DU4A 1CR6A 1SPXA 2QVYX 3REFA 3ZK9A 1JI0A 3TW8A 5IVHA 4YLYA 4QE3A 1DWOA 3OC6A 4HMPA 3AF4A 4WKGA 4WZBB 3RAFC 1NVDA 4Z4GA 3RVBA 3SLRA 4NNJA 2EX0A 2P6UA 4CKXA 1P9OA 2CXOA 3N0XA 1DIBA 1GXSB 2PYZA 1YRQA 4J07A 5AKIA 3BWYA 1D1QA 4OY3A 4EZIA 4A2WA 1KZ1A 1QLHA 4B82A 3RRZA 3VSCA 1TTQB 1RMYA 3USZA 1A8SA 1KIAA 2GCNA 1HDCA 3DOOA 3RYIB 2C20A 3ZXSA 1V6SA 1HUQA 2QBYB 4ZYYA 3G9UA 1VJ5A 2JIDA 4BIMA 3OKCA 3PJFA 1Z2PX 1GSHA 3PXDA 4O02B 2V5UA 3R0VA 5EI5A 1OYVA 2IDMA 4HFNA 1JHAA 4JEHA 2WYOA 2B94A 1KQNA 3NATA 4MYSA 4CJXA 3SOPA 1G6HA 2CLKB 2ORED 2ZJ8A 3DLAA 3GP5A 4L76A 4PFKA 3T9EA 3M2PA 4AMBA 2O5RA 2VH2A 4KR9A 2CJYA 2D1QA 4FYMA 4B8YA 3HN7A 3EGEA 4HDKA 1WCV1 2OLKA 2ZAIA 4A26A 2EBFX 1EFRA 2YRXA 2FWBA 4HQKA 2O20A 3EZLA 4YXWD 2D3TA 2OV4A 4IH1A 4AF6A 2CLFB 3DB1A 3NEJA 3P2EA 4RZ3A 1DXQA 2VK1A 1YDMA 4G37A 3RIXA 2LCQA 4IGEA 2PFKA 1RAGA 2GWRA 4ONEA 3OPQA 3M1YA 3TQSA 1FUEA 1E8MA 4LOJA 4XLLA 5BXQC 2W2NA 3E9DA 3DKPA 1J24A 3EDMA 3NP7A 3FYUC 3TEJA 2LDBA 3MC1A 4MRRA 1R5JA 1UT6A 2F90A 2PV7A 3E9CA 3D1LA 2GNAA 3FOAA 3I32A 3IOEA 3OHSX 3FMGA 3C14C 3LBIA 4MI6A 4MKZA 1GSIA 1Y3DE 5B4VA 1SVLA 3TQIA 2PJZA 2JA2A 3GBSA 3KDAA 5DGXA 4DRXA 3T7TA 1GA6A 1Y7IA 1EUDA 4UTVA 5KYUB 5LOVF 4AY4A 1R4MA 1M2NA 2VS1A 3I39X 4IDQA 4GR5A 1FNDA 2Q3MA 3BSYA 5KJ6A 1UK9A 3IOCA 4Z8YA 5F51A 1PSWA 4TVOA 3O8OA 3SVLA 1JJAA 3O4FA 3MJEA 3TO5A 1QO9A 2NO7A 2FEKA 4I1SA 1PGOA 2A1IA 2I4RA 1I80A 5EP3A 3ULKA 1M83A 1UBGA 4MGEA 1GNPA 2YWRA 2TMYA 3ASVA 4XYEA 3NUQA 5K8UA 1DMSA 1QRDA 1XYYA 2XNSA 2C88A 2QU8A 5JCJD 3JV7A 2GHIA 4LGYA 4BTLA 1BA2A 4KR0A 5BN1A 4YRJA 1CY8A 1WG8A 2HSZA 3QLTA 4YJDA 5EVJA 3UTDA 3TG2A 4H08A 1JLKA 3ZJUA 1RPNA 4LXUA 2R62A 1KJJA 3LA6A 4F7DA 3N8IA 5DTEA 4EA9A 2PSEA 1KMCA 2IJGX 1N25A 5EIBD 3X1WA 1MAUA 4MWEA 1PJBA 4X6UA 4NBSA 4DA7A 4JMLA 5KHLB 2C54A 1R0XA 3WIEA 1KVRA 3DPIA 4RVSA 4FKMA 5DEOA 4M9QA 4AS2A 4YCBA 3S5JA 3NEPX 1QP0A 2HHHB 3O0TA 5T8KA 3BD8A 3UWSA 5LIRA 2HF2A 1DE0A 3SZ3A 3AEXA 4F1WA 5FI3A 3AO0B 1VLQA 2I3DA 2VTEA 2F3QA 3PUKA 4KE8A 4NYMQ 3V7FA 4EVIA 2XCSB 3NBMA 4J1TA 4CEIB 1H3NA 2G0TA 3DYVA 1II8A 4KXYA 2SKEA 1RACA 4MV3A 3IP3A 2X5OA 2FZWA 1Y6FA 4P3KA 2MCFA 3GFGA 7AT1A 4PZAA 4K28A 4PSDA 1IDOA 1Z6YA 5HJ2A 1CS0A 3E9NA 1JJIA 4O4IA 4WJLA 1AK2A 4BFYA 2IDKA 4NBTA 5AW3A 3LL7A 4TTSA 4OJTA 5TB5A 5DHFA 2O5CA 2PAAA 1RM5A 3CISA 4LEIA 3EIHA 4ZAXA 1KVQA 4ZVQA 5HF6A 1HX7A 1JDBB 2VF4X 1IQUA 2P1ZA 4JBIA 4M3NA 3GCZA 4ZVVA 2JNWA 5ANRB 2DU8A 4CM7A 1CZUA 3H9EO 3JCZA 4G5QA 1WETA 4NP6A 5F7XA 2WSMA 2IV2X 5TGDA 1FSSA 1L4UA 1J39A 3CEJA 3OCJA 4GMHA 3WFJA 3QUTA 4PPQA 4UPDA 1Y5MA 4KV9A 4EAQA 4FYYA 5BW4A 3QOYA 3GJ7A 2VZLA 1GHTA 3GOHA 4LZWA 4M53A 3UWMA 1X92A 2ZYGA 3FJ1A 1JJ7A 2YFYA 3OF5A 5H8WA 3VR6H 1U8AA 1UM9B 2KM1A 3AR9A 3IDFA 4K46A 2JF0A 1MRZA 4JZKA 4L7VA 4OH7A 4E32A 2OZKA 4MJ3A 2C0PA 2OZPA 2BBOA 3ND6A 1YTLA 1C50A 2NG1A 1MN6A 2B69A 3AF5A 2V9CA 4AROA 2NYAA 4QUHA 4DWVA 1O94C 2AWNA 3LBYA 1F2UA 2BBWA 4IDOA 4MAMA 1Q7EA 3MWGA 4J7CA 3C43A 3VVMA 4I50A 4CLDA 3C45A 9GPBA 4XWKA 1IVYA 2DOKA 4B71A 4IWYA 1GNLA 3E7XA 1I3LA 1JECA 1YFKA 3SN6A 3SYNA 3IVMA 4B5LA 1AC5A 2DX7A 4IFEA 1C9JA 3TLAA 5B30A 1KU6A 5D3MA 4ICIA 3PDWA 4PNHA 3PRHA 4M60A 4CN9A 3GU3A 4K2HA 4GLOA 3DAPA 2IS6A 1HL3A 2Q0QA 5DHQA 5LN1A 2ZSAA 2ZB7A 4EKYA 2DQYA 2QVXX 4DCUA 5FTJA 1LTKA 4MVWA 4F8EA 2MYTA 3GUHA 4G1CA 4UCWA 5E6RB 4F7WA 3KCQA 4CVNA 2V3CC 3MFYA 3QZUA 1QYVA 3ROTA 2REQA 2V0NA 4GLLA 2WJVA 3TGLA 1TYBE 2PUGA 5JH7A 3GRFA 4Q4AB 1A2QA 2GUGA 3PIDA 3M83A 5ICMA 2EL9A 4BLTA 3H4IA 1IN1A 5EP4A 5ETJA 2GQ0A 2XMPA 4LVOA 3NJRA 4NG4A 5ALKA 3DDWA 1AO0A 4RQAA 2X5XA 1OPXA 5BN5B 1FNNA 1SXJB 3UOGA 2HT6A 3C8UA 4GC9A 3D4NA 3NOQA 2ENWA 2B4AA 2EBHX 1K3FA 1H8ED 1ZRSA 3LK6A 4ZKEA 1HA3A 2FK7A 4IYJA 2VJKA 4H35A 4KBYA 2WABA 4FSDA 4OLFA 4UQPA 3URMA 4DIBA 3FUVA 4JL5A 4MW1A 4R1MA 1SXIA 2WIFA 1ID1A 1PZNA 2PSFA 1N2CE 1W34A 2WU3A 4JU9A 4E2YA 4Y2JA 4ND2A 3KYBA 5HMLA 3ER6A 3T5CA 4B2IA 1HE2A 3OSUA 3QHQA 5FNVF 1RIIA 2YHIA 3U49A 4A03A 4B3IA 4ZI7A 5MGNA 1CEYA 2I4IA 3EPPA 4HQFA 4K26A 2F3TA 3MK31 1G21A 3KYCB 1AQUA 3OZBA 3PXBA 3Q2IA 3QITA 4XQ0A 2EBUA 1MAVA 4H1VA 2WM8A 4D1YA 1XMSA 5BXYA 1FZTA 1X7ZB 4IHQA 1N9GB 3K0SA 4EPWA 5I4IA 1GU0A 1KVSA 4FIDA 1A8UA 4F86A 4YCMA 1D0VA 1LGYA 4C7JA 3ET5A 3B2NA 1Z74A 1Y5NA 1KO5A 3HBNA 3N2EA 2HWXA 2NU8B 1I3KA 3IVXA 4FDVA 2JFXA 3CV3A 4PGAA 1OILA 2REXB 2AI2A 3D0OA 4QDUA 3EB9A 4OP3A 1K89A 3HFGA 3QWBA 3GT4A 2Y1EA 2C83A 2Q8PA 4FXOA 2PZAA 4K6OA 4RXUA 4W1PA 2KW5A 3KL2A 4CR6A 4DLWA 1MJNA 1WVMA 5I9SA 5HVNA 1YU6A 4OCZA 1K6IA 2AQIA 1HXHA 2BR5A 1Z7YA 2QTFA 1NDQA 2AA3A 3GDHA 3R76A 1H2RS 1G8SA 4EFKA 2PT6A 3AVVA 4YQZA 5IK2A 3I9JA 4AQDA 3VR5H 3ONNA 3RYHA 1BCRB 2P1RA 1GCGA 2FZ4A 1L4NA 2YWDA 3W4IA 1QC5B 4OFBA 1G2PA 1V45E 2O1SA 4GZ5A 1YUBA 3ADPA 4OJQA 4BE7B 1U7PA 1ES9A 1UBTS 1ZISA 2R6ZA 5A4FS 5IS2A 2VUUA 3IUQA 1E1DA 1N5MA 1GOTA 1N2HA 1BDJA 1XTBA 3FCYA 3OT1B 4Q37A 1FQWA 3HLYA 3OLWA 2D8AA 5J5VA 3SI7A 1VSQA 4R1PA 4UBLA 4ZOBA 3FRHA 2ODBA 1K7SN 2JL1A 4DDVA 2D8MA 4PLHA 2C7BA 4C6HA 4JCOA 1JBQA 1E6MA 1N6OA 2NU9A 2NV2B 2Q1YA 4JDUA 1ECBA 4EW3A 2EKZA 5NULA 3LOUA 2NXCA 1V25A 4TSFD 1K08A 5IDQA 4Y9UA 1H2FA 4TX1A 1IE3A 3LHSA 4CDMA 1JG1A 2F9LA 4UHKA 4ZI2A 3A6ZA 4MQBA 4W9RA 1YJBA 1X8JA 2ZBEA 3BWVA 3PNKA 5THQA 1G9XA 3G8YA 5HZGA 2XGGA 3CZ5A 2O2IA 3FIUA 5JARA 1XOIA 2OM2A 2II6A 1B0UA 5DTQA 2WJ6A 1D2RA 3RTBA 3H05A 3U3JA 4E07A 1B8UA 4EY4A 1MPXA 3ADDA 1YHYA 5C1OA 1ZRHA 4KQJA 2GETA 3MWEA 1XZHA 2F2TA 5C7LO 4GKKB 1YGPA 1XVLA 4FQ5A 1IN4A 3JATB 3L6UA 1XWWA 2Q6IA 4I6GA 4TROA 1O54A 4EWLA 3EIUA 3LXRA 5JFGA 5LL6P 4ZXPA 3I62A 1OFUA 2FQWA 1X8LA 4FZJA 5AKGA 3D3EA 4EX6A 4CQMB 5JTUA 3NEAA 3S8YA 3QEAZ 3W2HA 4NBRA 4AZ0A 4R0MA 3LX6A 4CFYA 2JLYA 1BRMA 1C5KA 4XXHA 2H9YA 1V43A 2R8RA 4R1QA 3A9UA 3Q1LA 3MTGA 4FFWA 1F8XA 3OQ6A 3DEAA 3B7PA 3WSWA 2IE0A 4FEAA 2W48A 3UM9A 4RABA 3J7TA 3BXFA 1POWA 3A6GA 1AS0A 2EJTA 2J3KA 2H4WA 3OQVA 5GIPE 1XU4A 2G63A 3H87A 3OHPA 3UAYA 2J1LA 4BO4A 5LP1A 4AMVA 4HAXA 4CCWA 4A9AA 1L7XA 1WHTB 2NSDA 1U63A 3RHSA 5M5BA 1G0NA 3JQEA 4JSTA 5T6BA 5JQWA 3IT2A 4Y3UA 1JWBB 1QIHA 3HEAA 4IO1A 1XNGA 3CR7A 5EHQA 2AT1A 4DCPA 2EJWA 1J23A 2QWXA 1YR8A 5EFZA 1KVUA 1QGZA 3BH7A 3BXZA 3JASA 3DMHA 1L7NA 4IEEA 3KJIA 5JZSA 2GUWA 1E59A 3BTOA 3EXHA 3LT0A 2AF3C 1SNYA 1O9BA 3MS2A 1ZCBA 5C34B 1EG7A 1NQWA 2C9OA 3QLUC 4MEJA 4ZI5A 4RTPA 2CD9A 1GNTA 3DZDA 3JSAA 4X90A 2LUOA 2POQX 4TVSA 3ZOZA 3DLBA 4IJWA 1RPTA 1C1XA 3H6KA 4NBKA 3G82C 2PMEA 5EWMA 5KS2A 1T5TA 3AHDA 5JH7B 2ZFUA 1KNQA 3JZDA 4Q16A 3PDHA 1Z4OA 3OT4A 1T8WA 2P5SA 3BIXA 4ZAVA 2FMIA 3E27A 4HI0E 4WPGA 2P9GA 5FX2A 4U00A 5FAKA 5KREA 4XKJA 1CUAA 1XAGA 3R7FA 2P65A 4QXMA 2BSXA 1R0WA 3ECSA 4A23A 3TTYA 3V48A 1UWLA 3C5HA 3L4SO 4FC7A 3VZBA 2VO1A 4R4JA 3U9LA 3PDUA 1Q3HA 1C9MA 1VJ1A 1ZCZA 1ZWKA 2ONYA 2PS3A 3RYTC 4MK4A 3C8MA 4ND7A 1Q1EA 3DF7A 3FJOA 2JJ1D 4H4CA 4ER6A 4V1CI 5K5EA 1QIEA 1QU3A 3EQ6A 2ZTVA 3H86A 1ZFNA 1OF1A 1SCQA 4RHTA 3TOXA 3FNFA 3PICA 3DMFA 3F5QA 3HCCA 4Z5XA 3IP7A 4CEJB 2J6HA 3EPLA 2NQ8A 2VZEA 2CW5A 3N0VA 2QP9X 3OY7A 4FMCB 4K6HA 5DW0A 1SUFA 3UOWA 4MDYA 4YUAA 4B0PA 1ZH0A 4O0MA 5TGTA 2H5LA 4CI9A 3JQFC 2IXGA 3L1UA 5LQRA 4KAAA 3H1GA 2VAPA 4C3OB 1T8TA 2NUBA 2RCNA 5JMPA 1Z0IA 3HO8A 1VZ2A 5CT8A 2EC5A 3VU9B 1RKQA 2ZRNA 4E13A 3VDRA 1WUIS 1RWOA 3L01A 2G9QA 4BKRA 4DKXA 5JLJA 2ZU0C 1JLMA 1U0JA 3INRA 3L49A 5TRTA 3N2KA 4EUSA 1CIJA 3UMMA 2XRYA 2HK9A 4X24A 4AWAA 5FOSA 3O4HA 4PZDA 4D4GA 1W7AA 2GTHA 1BCSB 1P8JA 3FF1A 4CT5A 1LSUA 3HWX1 2FFRA 2OV2A 1AUXA 5T4EA 5D5QA 1DKPA 4EO9A 3LBAA 4HH1A 2RGRA 1ADCA 4K6FA 4KXLA 3QFFA 2YKGA 2Q1TA 4PLPA 1SWWA 5CPFA 5H0IA 4K9NA 1YQEA 4DSTA 3KV1A 3K0AA 1SHLA 1ZMOA 4CHGA 3T3OA 2LWIA 4W8OA 5EE5B 1WCIA 2QTMA 1YS6A 3A4LA 4RA6B 5SZKB 2QLNA 4OSOA 1M2OA 1ZHHA 3TMYA 2Y0BA 2QSZA 1UMDB 3DMTC 3HZOA 3GD5A 2JLXA 3QFSA 1UDWA 1MDBA 5INTA 1PJZA 5HKOA 1XDWA 4BY9E 3SS8A 2X1HA 4JWTA 1GRRA 2C4HA 2NUAB 2BOVA 2QTAA 3LRPA 5DHTA 2W93A 2MSDB 4MJLA 5BMVB 1NTOA 2X40A 2JPDA 1ZM7A 3U1BA 4TYNA 5BOVA 1NPYA 4JAVC 1P5JA 2ICAA 4LQLA 5LQMA 4UW9A 3IHLA 5C35A 3O2QB 4Y0NA 2O8BB 2WICA 2JAWA 3H9GA 3QYPA 4L73A 3IV6A 3O3CA 3T6KA 1ESZA 1PJCA 2QK4A 2ZK7A 4OP2A 4AJEA 2GRJA 2C77A 2JS7A 2OQ2A 2R8EA 4NMHA 2H1HA 4BWFB 2C82A 3OECA 2Q4EA 4D4KA 1MW9X 3DDZX 3HYNA 4O4HA 3WNBA 3OIUA 1Y4DE 1QH8A 2FWAA 2ORWA 3C70A 3IQFA 3QP9A 1G7RA 2Y1LA 3ONDA 1MAWA 1OOEA 1BSVA 2HWWA 2YN0A 3ITNA 1QHXA 4PBTA 2HAEA 5CPBA 2ZJAA 3KD3A 5BN3A 1U1GA 1I3NA 3BKWA 4LZNA 4M36A 4LDAA 1PO7A 4OBXA 3A4VA 3K9BA 4EPXA 4QG7A 1GKLA 2BZSA 1PJLA 2EOAA 1SB8A 2OILA 3PTLA 1G6OA 2L17A 4HG2A 5MGBA 4JI2B 1L6IA 1B6TA 2VRNA 1QK4A 2BF4A 1V8FA 2VP0A 3T95A 1BGWA 2Y66A 1HE3A 2I67A 1EH5A 4OLHA 2N42A 2FMXA 4RE6A 1EIWA 2JRLA 1NW7A 5UKDA 3V55A 2I2AA 3LUHA 1LPPA 1X1EA 1Z5WA 3M81A 3DGFC 4TS9A 1A8PA 1I7SB 2RJ3A 4IIHA 1VCOA 1Z7BA 2CL0X 2FOLA 2WYUA 4ASUD 4EHFA 3AVXA 4DHWA 2DUWA 4BNHA 1BE1A 1SCNE 2G5CA 3FR8A 3K5PA 3PZRA 4RD6A 4TS4A 3HTXA 3OQOA 2QTNA 2G9RA 5AI6A 1KJIA 1KI9A 1YRYE 3AB7A 2X1LA 3OU7A 1ULBA 3UKJA 4UTRA 4ENQA 5B6JA 1GL6A 4GX5A 4FEYA 4ZYXA 4AQYB 4I9HA 1IWPB 5CFZA 1ONOA 2GZ3A 3WHIA 3DWGA 3AIOA 4EUEA 5DXFA 4WKBA 2ZRHA 1ZNZA 4UAUA 3ZW8A 3GQVA 4WOKA 2BM8A 3ERCA 1F2DA 1UBLS 2ZBPA 2Q7DA 2QRGA 1L4HA 1FFDA 2V7GA 2N1BA 3OTGA 2NZVG 4N3AA 4C6TB 4FP9A 3IEMA 1X6VA 2ZIWB 2M6KA 1N6RA 3RAPR 2FQYA 2WT4A 2BSAA 4GIBA 3TSAA 3AL0C 2VDWB 5FL7A 3RUEA 1R7RA 4CW7A 3I72A 2C1ZA 3F6BX 1NLZA 4M1YA 4QUDA 4TKMA 4W5WA 2CY0A 1NF3A 1TM5E 2FCAA 1C7FA 3GDGA 4F4JA 1IBLB 4DGSA 2ZQ5A 1FRNA 4LVUA 1XG5A 1UF9A 4W6QA 5AI8A 1SCUB 3COYA 1RMTA 3RNOA 1F12A 1WW8A 2JZOA 4BV3A 3H11B 2A7XA 4G5HA 4QJIA 3CC8A 3B2QA 2W2QA 2W4IA 3LVFO 3E8SA 4B4KA 4R8RA 5DOZA 3TZBA 4EM6A 2Z5LA 2QUKA 1HT2E 4U7FA 4YIHA 5HQJA 3HA3A 1U5CA 3QQPA 4PGHA 3P5SA 4WY5A 4EHIA 2QSYA 5LNK6 1OAOC 4DIUA 4DC1A 3KSAC 4F1KA 1VPLA 2C03A 3JALA 4P4GA 1U5AA 4R2LA 1M0WA 2ET6A 2W00A 2OYCA 4RFLA 4XGNA 4AJKA 1X1TA 2OCLA 5LD2B 1O7JA 2VDJA 5CEEA 1GY8A 3PENA 1XL0A 6Q21A 2X41A 2P9QA 5D84A 4B6OA 2XZPA 1AN0A 1GZHB 2YVLA 3DTTA 2AN9A 4D9EA 4ZIRB 2EF1A 1FFXA 5KYYA 3UJ3X 5HG0A 4CL0A 4AZ3A 3AEYA 3DBHA 4FHEA 3O8LA 4HYYA 5JSYA 3ZCRA 5AVJA 3KU1A 1VKZA 1VMAA 3LQQA 3AI1A 1DGQA 1O3YA 1UBCA 1Y9AA 1YULA 3KUKA 4TM7A 3SFZA 3L6BA 3WFZA 4BFWA 3NAGA 3G8DA 5T64A 4JGIA 2R4TA 3COVA 5JYDA 1Z6XA 3G0IA 3ESAA 5LQCA 2VYFA 1IYZA 2NADA 3UB3A 4IIUA 4MUYA 3W4JA 4BUCA 3LECA 5KTSA 1PNOA 5G53C 3NTUA 3QX8A 2JGKA 5I9MA 1FA9A 1NF9A 4C7OA 3PJRA 3MINA 1EJBA 4IVNA 1DAEA 1T1RA 5BORA 4AWXA 4LKOA 2RH8A 3H2KA 2X3UA 3HBFA 4PGGA 4HDMB 4E22A 3IP6A 1GNRA 3PFGA 3TQOA 1IXSB 1T6BY 3TAUA 3TECE 4CM8A 4RIGA 3RE1A 4ZV7A 1EVLA 2PLRA 1MB2A 1OLUB 2HA2A 4OSPA 5A9SB 2JBAA 3PYXA 4OI4A 4B3GA 3E3MA 4QJ3A 5JCZA 5LKRA 2P68A 1VIYA 2YW2A 3CJRA 3PU6A 3ZYZA 2QJWA 3B9QA 4KX3A 4XIIA 3UMCA 1J25A 3UGQA 1FMTA 1K5HA 3QSYA 1CXZA 2PD3A 4FCWA 3UPTA 3CINA 5CIWA 1KBQA 2GRUA 4CUKA 4EVQA 4EKEA 5LUAA 1XTZA 3OPYA 3QRWA 2C7QA 3AOEA 1TPYA 3AR7A 5BWOA 2R1VA 2GJ4A 4KB5A 1THGA 1WOYA 5J40A 2ZDHA 3AMVA 3EHEA 4GX1A 4J75A 5HW0A 3R4VA 2ZAGA 4K8RB 5E3JA 2JFOA 2Z1MA 2DCUA 4QWMA 4FJ0A 1NYQA 3QHPA 4ZCTA 1WTAA 4DG8A 4V1CA 1JXMA 4EMBA 1G5QA 1UXOA 3TPCA 1L9KA 2XOKD 2I6XA 3TIGA 1USKA 1T6ZA 5HKKA 2E9SA 3G5LA 1PEAA 4JVNA 4LPKA 4U7TB 4RGVA 5CA0A 3O8OB 2BUAA 3GUYA 1N75A 1VHWA 2XOXA 3RUCA 2XEDA 2G7ZA 1V11B 3IKTA 5A0TA 4FQ8A 2XCOA 4JFRA 1G19A 1DAOA 3ORFA 4K9QA 1P1JA 2O5VA 4HUQA 2JFUA 2P8SA 1Z4QA 4QOGA 1GL3A 2IHJA 4QM6A 1Y1QA 2CYAA 4HEA1 2ZRKA 4B4UA 2D62A 1DRJA 1PSZA 2GK6A 3BICA 1CJKC 1QH8B 1DKRA 5I51A 1YKGA 4R31A 1E9DA 1U9CA 821PA 1F5NA 3FNGA 4HDOB 2W6QA 1D0SA 3P9ZA 1PEKE 3AUUA 3LO5A 3GCGA 3MWDB 4J94A 2EDAA 3FYTA 5JDCC 5BN3B 3H8JA 1OZHA 2IVFA 2HPVA 3FWZA 2AZTA 1NSTA 3OOEA 4WXYB 3T61A 1DC8A 3JD3A 4XLZA 5AW9A 4YMUA 5AVTA 1FFHA 3OOWA 4EELA 4G0XA 1ZL0A 2RIRA 3FNHA 2C8VA 4FUQA 5G41A 3V4VB 2VNSA 3K1AA 1YA8A 1VPEA 4BXOB 5CTJA 3H42B 3LKVA 4MV7A 1MZPA 1SQGA 3PGLA 3ABRB 4OI0A 3P2MA 2YV4A 2H8GA 1NV9A 3FZGA 5T57A 1JXOA 2OZEA 5EE9A 4IZHA 2OUKA 3AWIA 3MUNA 1T1IA 1VYHA 2Y1XA 1DQYA 1KRHA 3SIRA 4MS4B 1Y7LA 2J3EA 4KYIB 2OXEA 4ZYLA 2WKQA 1CF9A 3LMKA 3LOPA 2XWQA 2VNIA 1Y1TA 4XX1A 1BRTA 1OXBB 2B4TO 1VQ1A 4G2NA 3R9XB 5CXSA 2QD2A 4M0EA 1TYCA 2NU6B 5FOVA 3ZVLA 3EG9A 2HU7A 1UADA 1GGMA 1E96A 5I4KA 3SZOA 1B76A 2VQ6A 4KQHA 1RE1A 1C2YA 1QFJA 3BMCA 1H69A 1FFGA 4IOMA 4YJHA 4CKCA 2Q4OA 4Y6SA 5BY2A 1ATZA 1D1PA 3O31A 1J99A 4MCIA 1RQRA 1GKYA 2ZYIA 5GV7A 1TADA 3WL8A 4C9BA 1RM4A 1XLVA 3AC0A 4JQZA 2QDXA 2UV8A 1IEWA 3ZQ6A 2IY8A 4FGKA 3VPCA 1G63A 1G55A 5FWXA 4ZI3A 4DE5A 1J8YF 1QYXA 2Z98A 4PPGA 1NJSA 4LHVA 1ZK3A 5D3MB 1ZZGA 5AJYA 1JHMA 1V95A 1XLTA 2YWFA 4WKPA 5FOUA 5MHTA 4K03A 1MV8A 1S8AA 3P4UA 3GGPA 1GPJA 2VJLA 2Y99A 1AT1A 5JS2A 4Y2YA 4DUGA 5JMTA 4HOYA 1GGHA 1W4LA 4NAVA 4C87A 3ODGA 5AW7A 1ZH6A 5TMBA 3R7WA 2QTZA 1TVEA 4JA2A 4UQOA 3S1LA 4XQGA 1I3MA 4XDZA 1TQ8A 3ND9A 4C04A 4PPFA 4YV1A 3PHJA 2X22A 3SEFA 5A4JA 3PL5A 4XH9B 3LF2A 4L16A 4HPWA 4KQCA 3O8QA 3OEEA 4BFUA 4B32A 6REQA 2JLAA 4XTCS 1DTWA 2MSWA 4HZGA 4INJA 5E7QA 3NJ4A 1NMEA 1NW3A 4AKTA 5WRFA 4UTNA 3WB1A 3ZI7A 1ULSA 1ZAKA 1VMKA 3EGXA 3C6XA 2QLJA 1DBPA 2E48A 2O2GA 1UBRS 4HV4A 3WLIA 3T7RA 4JJ7A 4YALA 3T4XA 1FVOA 5A7GA 2YWGA 5EKDA 2BBSA 1WPXA 4X7PA 2IY7A 3HYTA 3I73A 2GBLA 1TUEA 3OX1A 1WZIA 4FHCA 4BVFA 3KTOA 4OJNA 3OQNA 2ZITA 3H83A 4MHTA 2BFBB 2DH6A 2PO5A 2PWZA 4JL8A 4Y98A 1BE8A 4AKGA 3R5FA 1Q15A 4N0MA 1GU7A 3OMLA 4G9GA 3RCBA 4IJVA 2G71A 1XMVA 1TJNA 1ZPDA 3QKIA 4Q1DA 5IF3A 2CBXA 1OVGA 1LB1B 1PR6A 1B8NA 2HF7A 2QVGA 2VR1A 3O9VA 3PLNA 3PQ6A 4TQ9A 3TLEA 1UAAA 5F9MA 1GT6A 4D4IA 4QOEA 2PMDA 1NMQA 3EK2A 4AMUA 4YRIA 5KWEA 1U90A 2ZT8A 3WLKX 1ONSA 2XB6A 3DBRA 2NV0A 3IEIA 3I6QA 4KCGA 4LWPA 2PMWB 3DWFA 3QUSA 1QAQA 1EWTA 2JDID 1CJUC 3AKYA 4FWIB 3TNJA 4QGFA 4CQLB 3VC2A 4D26A 5K05A 1CIVA 2C2BA 5H3LA 2PX3A 2CSXA 1NR7A 5JAIA 1D07A 3U4MA 1KRXA 2CJWA 4KTVE 3WWPA 5TJHA 3PXEA 3UHAA 1M2VA 2YQ5A 2OK8A 5FWYB 2OB1A 4YK7A 3R3XA 4XARA 4TTTS 1EFLA 1V2HE 3CFYA 3DS8A 1DO8A 3H5AA 2F1RA 2W4QA 4YASA 2LPMA 1P2GA 2LXNA 4IG9A 4JXXA 3ER8A 1NVKA 2Y9PB 3ITDA 3W9BA 2HWKA 1ISHA 3Q9UA 4DMCA 2ZWMA 3OFKA 3RT7A 1VYVA 3R0JA 4YAEA 3OOHA 2RKOA 2HMYB 1R0RE 2JKYA 5AK0A 1A9SA 3U5TA 4FINA 3R0QA 2X7HA 5K3DA 2E4XA 3WK4A 3ZCSA 4E5MA 1PBTA 4TTVA 1RR6A 1IXYA 1UFOA 4NYIR 3D6NB 1XJWA 1KC3A 1RWBA 3BSSA 3CLUD 3JRXA 2B3DA 2PQ6A 4URXR 1PJ4A 4ZVMA 2GAOA 2A9OA 1Z26A 4IKOA 4MVJF 3EGCA 4IOJA 5DSZA 5IUJC 5LJLA 4XRRA 2JI6A 1YBVA 2OV1A 5F35A 1FXWA 3VR5A 4FN5A 4QZVA 1I4EB 2HQRA 1X9IA 4KXNA 5JS7A 5H82A 3JWIA 3MIIA 2ILTA 1EQ2A 1LLQA 2CLEB 1ENYA 4R7TA 1NQTA 1ZSYA 3AU9A 3RJ5A 1SKYE 2YNMA 4AZTA 3ZIDA 1YNOA 1ZO8A 2PTGA 3IIEA 3U7RA 3QWAA 1I4LD 2X15A 4FD2A 4FMDF 3ZLBA 4K8OA 1NVVR 4RHYA 3JYPA 1P0QA 3COPA 2IYYA 3JQAD 4INZA 3VTFA 4K6CA 4PFQA 1CS0B 1XRPA 5KCMA 5BR8B 2ZKLA 1M1YE 1R12A 3A11A 4X3OA 4H3VA 4PNEA 1G3QA 3DT9A 2AOUA 3LT4A 5DIZA 9ATCA 1N36B 2BFDB 3EHDA 4K0RA 3CS3A 3P9YA 121PA 5D7NA 1K8RA 1XHLA 4CL2A 2P0YA 2VSFA 1VL6A 3NHUA 3QPVA 3FPBA 3RHZA 4IOKA 3V4RA 3REOA 1CQWA 1TTTA 4KQFA 3DXFA 1W5EA 3EDYA 5FBRB 2B9EA 5LM3A 3QIVA 4D02A 1O6FA 5FL7D 3UKOA 4S12A 1VJCA 4XSHA 4KO1S 5IN5A 1NT2A 4NPCA 3KOMA 4IUCS 3Q3JB 2BDUA 4F21A 5A5VA 3VFDA 2XXAB 5TDHA 4GF5A 4KDCA 1R6AA 1Z5NA 4JC8A 5CURA 4ZCPA 1NNEA 3BORA 3P9PA 2GN9A 4IOLA 4OGWA 3HXKA 2R751 2Q50A 4GM1A 2EZUA 2IYUA 3CEAA 1KAMA 3GJRA 5GGXA 2HHJA 5KHAA 1T9BA 2HJVA 3EZYA 2ZJBA 3NRJA 3RGWS 5IKEA 5M34A 1MFZA 3JVIA 4BZPA 4MQEA 1WOMA 2J3LA 4QDXA 3TSYA 4H3KB 1WBBA 1ZESA 2X42A 4S24A 2H1RA 1ZL2A 2NAPA 3FROA 4FONA 2X0FA 1TT5A 2M98A 3EEIA 3CVVA 1RYBA 1XPJA 3R9XA 1M1NA 5DWVA 5KQRA 4KPYA 4GH5A 1K86A 1PWZA 3ENKA 1UJ4A 4R6XA 3UKDA 4ASUA 3QNWA 3GP8A 2RHBA 4MNTA 4A8JA 4BBZA 3W7VA 2QA5A 3KEMA 1DIAA 1COWA 4P58A 4H7HA 2H9IA 3EZXA 2ONZA 1EHIA 2VEDA 1RE0A 3VPDA 4D0NA 2Q3CA 4PAOA 1YDFA 4MVYA 3VGJA 2WQ6A 1UC5B 1BU5A 2R1UA 4BMXA 3VZCA 2O19A 3R09A 5IJ9A 2X8LA 3QLUA 4WLFA 3CN7A 2B8WA 2EX4A 2LR0A 2YOHA 4GBJA 4E7PA 4F8YA 1V4BA 4I19A 2ZRQA 3T3NA 4IMRA 4G9EA 4CDRA 3BMQB 3QU9A 4ECEA 1XMXA 1KJ9A 2P9YA 3EGOA 4A8JC 4DUZB 4M1SA 4XASA 3UUFA 1KS2A 2PT9A 3QG1A 4A36A 2FMHA 3PFCA 1JYFA 1CFJA 3I4LA 4RU1A 5DX8A 5A71A 3FDXA 1IXZA 1RWXA 1T3TA 2WJ4A 3AUJB 3Q2KA 2OGZA 3DWIA 2L18A 4PTYA 3VRHA 4DSNA 3RYCB 4HB3A 5KYYB 1VLLA 2IYWA 3E70C 3JQDA 4S0XA 1VKRA 1LV7A 1P62B 2GEVA 2PRSA 3PRYA 1XEWX 3O91A 4JJGA 1JHVA 2JCBA 1SVOA 4X6XA 2W83A 1SXHA 1VM6A 1DG9A 4EB3A 3FFWA 1L7VC 1SHKA 4WCFB 1U9ZA 5AM1A 5F9FA 4YAIA 3FBGA 4PRYA 2HYIC 1YA4A 4CQLA 2VFAA 5J59A 4LTNA 3PUXA 3A1CA 4C05A 4DCJA 4TWZA 4PQEA 3D8RA 3U39A 2XNDA 1IAQA 2EEZA 3K6SA 5C8ZA 2MR6A 1SC9A 3E6AA 3TOVA 2OFFA 4YMVA 4CF7A 2GPNA 3A7DA 4XUDA 3SY8A 3INGA 5EL0A 2FFHA 3KSUA 4MVJP 5CG2A 4WJKB 4YCDA 5CR9A 1YOBA 1DEHA 2PXCA 1T91A 3L46A 4HYQA 1KYTA 2D59A 3VZPA 1XCJA 3HUFA 3O8DA 3VU3A 1EGAA 1RU3A 2PH5A 3KZKA 3K3PA 1XLUA 2IUUA 2OL4A 3ED5A 4F71A 2IP1A 3QNMA 3WMGA 1AGRA 4RVNA 1X8KA 4YV2A 4AM8A 3DBVO 1ZOSA 3GLIE 5CGZA 2OLEA 3Q7TA 5HRCA 2HCFA 4WK0B 3HMKA 3K6RA 4E5NA 4PSVA 1K7YA 2DJ5A 2FSVC 1LX6A 1FQKA 3D3NA 1JB1A 4CQMD 4I9UA 1G7TA 3C6BA 4AAYA 1P1IA 3EFBA 1YFLA 4LK3A 1HYHA 1TQ2A 5ALSA 4J0JA 1BD4A 3PFHA 2ZETA 2YWBA 3IHKA 1K8XB 1D09A 3BFVA 4DLSA 2H08A 4H31A 2X0KA 2YYAA 2GF0A 3EXHB 4MUKA 1Q20A 1ZMBA 3RTAA 4OAPA 1JLLA 1NBME 2I2FA 2O2CA 1FU8A 3D54D 3DZCA 1ZUD1 1BX0A 1T36B 3O1JC 3CNQS 1P1KA 1SOAA 1UK8A 2AJBA 3N2NA 3CZCA 4BGEA 3ZLUA 2EJCA 1GEGA 3LFHA 5I5GA 1B43A 4YROA 3KPWA 2PWAA 4NFYA 1WW3A 2P3SA 3JS5A 3GLFB 3ORHA 4PG4A 1L5OA 4ZK6A 1VKHA 5A4AA 4HEJA 3BC1A 4INAA 1KSGA 4UVDA 1DKQA 3TJZA 3W5SA 3WTCA 3GL9A 4UXJA 1YL7A 4DCNA 3O2SB 5FA5A 4ZHQA 3KLOA 4C4YA 1IJEA 1CJTC 3W2IA 1P3DA 4NX2A 4W1RA 3PC3A 4YRKA 1CEXA 1DC6A 1DX9A 4WN9A 3HCOA 4B9AA 1KSHA 2YQZA 3AETB 4BMSA 5BNIA 2Q5CA 2I6GA 2JVKA 2C2XA 4NARA 4I55F 1J8QA 1W25A 1JEYA 3OKPA 3HVIA 1IY8A 3L06A 1X9GA 3NBYC 3QUBA 4IHJB 5GJCA 3TM4A 4UULA 3MCAA 4RKWA 3EE6A 1WXEA 1SM4A 3VI4B 2PFSA 2YRWA 3B6MA 1Y6JA 1JNXX 1H9CA 5TGZA 4K5QA 4CL3A 4MPRA 1J0CA 2IYLD 3EVAA 3QV2A 4GYKA 1E9EA 1PCXA 4H3HB 1TQ6A 2QV0A 2DZDA 1P19A 4CIWA 2FHSA 3WGMA 3ZBTA 1P2BA 1EZ1A 4I5FA 2BJVA 1EUDB 4WFIA 4D3DA 3TLGB 1CRZA 2A9KA 1Z36A 3L7NA 3U61B 1S4MA 4HAZA 2OG2A 3G23A 1YDWA 2G4LA 2QMEA 4P0QB 1U0BB 1XZPA 2MSCB 1YR9A 2JARA 2WA1A 5CHEA 4I55A 4OLAA 1FDTA 4X66B 4BFVA 3LSYA 2P27A 4LJRA 4KMRA 2VBIA 1W48A 2RGUA 1GJRA 2I03A 4URUR 4N76A 3GZJA 5EA2A 1CUIA 4X1IB 3D4PA 2YWHA 2Y05A 1KXJA 4MUAA 1E5LA 3M4YA 1PX0A 2YJ4A 1WEHA 1ZEMA 3QELB 3FPEA 4OM7A 4XI9A 3ZU4A 1EQUA 1N2BA 3W4KA 1H85A 3CXUA 2BGTA 5AJWA 5ALWA 1KK1A 3RC3A 4RTRA 1AGNA 3L6CA 2C7VA 1SJ9A 5I7SA 1FSFA 5JS8A 2GPTA 3BMQA 3EWAA 4BQFA 1VBKA 2IVZA 1A98A 1D3AA 1W5AA 4LG1A 5CT6A 4ZJPA 3W2TA 3GGDA 1OB2A 5CM9C 1TT7A 1G98A 1Q7GA 2NWQA 2YWXA 1XC7A 2JFWA 4JL6A 4X1KA 2EGHA 3FPSA 4UM8B 3SWWA 4O5OA 3RG8A 3TFQA 1OH5A 3WLPA 5B58T 1RYMA 4P4UA 3RYIA 1Y7TA 1Y6GA 2QRZA 5LXTA 5E2BA 1N2GA 1E62A 2FWRA 3IV9A 3SC2A 5HIKA 1AY0A 2AE1A 1XKQA 4PCUA 1U65A 4O2BB 2OG1A 4BO0A 2Q3JA 4IIFA 5THKA 1ZD1A 3RDPA 2OV3A 3OAAD 4MGKR 1HOTA 1N6HA 1SUBA 4M7OA 2QLMA 4TTPA 4RGYA 1XA3A 2WC1A 5F64A 1IBCA 4EHJA 3U09A 1BX1A 2EYUA 3M4ZA 4R16A 4DIEA 5LDGA 2GZMA 2P6NA 1EMDA 3WLHA 2XAAA 3B3AA 1W4ZA 4D8XA 2BR4A 1N1DA 5EZ5A 2G8NA 2FK8A 2H29A 4PLTA 4TPKA 4LJSA 3GLGA 4IINA 3L1KA 3PR2B 2LV8A 2GT1A 4S1OA 3B7GA 1GUAA 3TGWA 4X1YA 3QPAA 4YP7A 5EJFA 3GUZA 2P4UA 1T2UA 2IV7A 5ARBA 1EBBA 2MYNA 3PB3A 3DBOB 3R20A 2I6TA 3R1IA 4GU5A 2AE2A 4MULA 1KKLA 2NO5A 3TTUA 3A1WA 2LCFA 1DEXA 1KQOA 3K70B 2QVBA 1RJ9A 2P3LA 4BO8A 1UXHA 2GWHA 2Z2ZA 3GV0A 1VA5A 3C7CB 1DVRA 4ZOLB 1C14A 1OLXA 3MJCA 5HFNA 3P26A 4FOOA 4DY4A 3EUFA 1SY7A 1ULTA 1SOMA 4BB0A 1J0EA 4ZVOA 4HH0A 5CYGA 1H0HA 3EARA 2HDHA 2QI9C 3KE9A 1SU6A 3NWEA 3OQMA 4FQ7A 1BH6A 1BS2A 2A5GA 4UTZA 3F47A 3DOFA 2IZ0A 1GSAA 4J3NA 1L0BA 4GWLA 4OOEA 4S1VA 4R2KA 4XJXA 4TYWA 1RAHA 5JJCA 1VG9B 4K88A 2R2AA 1AKEA 3WHPA 2FZ5A 4FLMA 1UZLA 5TPWB 3I4FA 4MR9B 4P7JA 4WZAE 3PD1A 4KP7A 3D5TA 4IXNA 5FPHA 3DCIA 3DV0A 3SEZA 1R4MB 1K27A 4MWOA 1TFRA 4Q4JB 3KG2A 3BMNB 2WSSA 2WAXA 3F7MA 4ID3A 4M6WB 4PONA 1NUTA 3LDGA 4PYIA 3KB8A 4AYTA 2P9BA 3WWOA 2O3QA 3I92A 4CM4A 1QRAA 3CRVA 2JIPA 3JVVA 1NUSA 4C0LA 3RRFA 2XD4A 1IL0A 1Z6GA 2VHUA 3LX8A 2HV8A 4JP5A 1YC2A 5G3ZA 2OBXA 1FJXA 1ZUWA 2VK4A 3LTNC 3FNEA 1H8EA 2SCUB 2VYNA 5IJWA 3F5SA 5F2EA 3U4DA 5D51S 4XIFA 1EESA 3UCXA 4DSOA 2H1LA 4CWAA 4TTQA 4AZ0B 1O57A 2V3WA 5I9TA 1QG6A 1QLJA 2ZLBA 2CJFA 5LU9A 3OBIA 5L4LA 3RT9A 4URWR 1JHXA 1OFGA 4N03A 3RFVA 1E3LA 3FKSA 3ZDAA 1ODFA 4RZSA 4HN9A 4FC6A 2OE2A 4YRRA 3F6EX 1P2TA 3KC2A 1E9VA 2ON6A 5AFSA 3DDSA 5IZ4A 2XITA 4LYGA 3WGGA 4DANA 4HNVA 3QEMB 3TI7A 1ZBQA 1PR5A 2CNOA 4MUNA 2QUJA 4MVJM 4XM0A 4X20A 2VF8A 1CQIA 4OHMA 5LNK1 5LOVA 2G0AA 4Q0MA 4LHEA 1OI4A 1WSDA 3CHYA 3KTAA 3RYFA 2PUDA 2HV9A 3A6EA 4X7RA 3ZZ0A 2B61A 3QU5A 4WBNF 3MF4A 3QU4A 5DNYB 2EVWX 3CU5A 5DT9A 3G8BA 4JEMA 4DTIA 1XTSA 2ZUBA 1QNFA 5JZMA 1EU1A 2ARKA 1NBIA 1GPAA 3JARA 1A97A 3K8YA 1YIOA 4UBKA 2P0EA 4CIDA 4EVSA 3IBCA 4K40A 3Q6NA 4D3FA 2WZBA 4NBUA 2FR8A 2PGAA 4ALMA 4N0PA 2JGMA 3CR3C 4Z1MA 2ZPAA 4N41A 2XXAA 2XYHA 1Z6QA 1I94B 2A9QA 1H0KA 3LL4A 3ZE2B 4W5OA 2ISQA 2R6DA 3N2GB 4PSUA 2FVYA 2FG7C 4GS5A 4U8GA 3B1KA 5EIHA 2ZCUA 5DI9A 2PMBA 2WSIA 3D5EA 4IHKA 4BMNA 1JMKC 3F9RA 1VECA 1PFQA 3A58B 2HA0A 1OX6A 3IAM6 2YCLA 1CQXA 3KQKA 2QD3A 1RYZA 1ULZA 3L8YA 4M0CA 1A7JA 4FT2A 2OCDA 4UREA 1XZKA 2I1VB 4IQ4A 2KB0A 4KIGA 4RXTA 2IOQA 4WBXC 4GRIA 5EEGA 2G3YA 1WQ1R 1GZSA 3B3JA 5EWLA 1U0EA 1WY5A 2IH2A 1DUSA 2W2TA 1W96A 5TQ0A 1QX4A 1N3IA 2AR7A 3F90A 3GT3A 3MUOA 4NZZA 5JO0A 2UUAB 1GPWB 1MGOA 1P9WA 2QRNA 1GR0A 2HCJB 2XF2A 3LY8A 4RSHA 3W7AA 2YNMC 1TFUA 3AVQA 3MWFA 3E9ZA 1G6Q1 1T5OA 2XMGA 1R6VA 1EVZA 3GEGA 3CEMA 2G25A 4GOND 4OQDA 4RHUA 3PPVA 2R1VB 4GI3A 1YQ9A 4QUGA 4C7KA 2L69A 1T8UA 4P3PA 3SOZA 1S5PA 1UCFA 3F49S 4JJ4A 1Y63A 1IY1A 1QGED 3ANTA 3NDIA 4IY1A 3BRSA 1PZFA 3KZ1E 1ZIOA 2NNWB 5EGSA 2Z6AA 1E8DA 3AM1A 4CNQA 1KARA 1ZHFA 4LXXA 5DI3B 2QTVA 4DZTA 3AFHA 5LB2A 1SCKA 3FOCA 2BC9A 2VUIB 4EI8A 1E94E 1ZAYA 4FCVA 1ZIYA 3LPLA 5D5HA 2PZFA 2R00C 3K09C 1HFJA 3G0CA 2OORC 5JCOA 3N9IA 1Y4UA 1OIXA 4M37A 4BIIA 4NJMA 5KDLA 3BJRA 1C7EA 2GD6A 2IHNA 1Q50A 1RKBA 2Y1CA 2FQXA 4I8IA 3RRYA 2ST1A 5HJ7A 2PXAA 4C20A 1M74A 4F4UA 5K8LA 1EX7A 2IBSA 3D4BA 2VNHA 1R2QA 2FZLA 2IDZA 2XQJA 2BEUB 4JROA 3DFZA 2VTKA 3ZWDA 2JFPA 3A37A 1J8MF 3OD1A 5HE8A 1SXJA 1SIBE 1SKQA 4AFNA 1RJFA 1T1EA 3PGXA 1FLDA 2YZGA 3PE6A 4ODIA 1HSZA 1T8RA 3JQBC 3ID6C 3RRMA 4WCFA 4KIJA 5JCJA 3WQQA 2BF7A 4EJSB 4EX7A 2GM4A 4Q03A 2HZBA 1ZUNB 3HQ4O 1SFRA 3ICVA 3P27A 1QP7A 2O8CB 2WUGA 2P62A 2W6MA 4PHGA 1MCZA 2JH8A 1JDVA 4G65A 3OE1A 1ZY2A 5JZVA 2FF7A 5AI4A 4Q3OA 5KCZA 2DCMA 1I33A 1H5QA 1PS9A 3PK0A 1HYEA 2WWYA 4AO8A 3BD7A 4LE0A 5JO9A 2CJWB 3OTQA 4L0QA 2H4FA 4Q3LA 3P9RA 2R8XA 4HGRA 5DZSA 4DIMA 2V4UA 2RK3A 1U3GA 3TQTA 3WL7A 1FZQA 3G2MA 1YR6A 1C3EA 2J9FA 1ZIPA 3IUYA 1B93A 4FT4A 1AXRA 4LTDA 3OQIA 3PNLA 4AUMA 3KLNA 4GKBA 1WX1A 4TS3A 13PKA 1W0CA 1XPOA 4CM4B 2XTJA 2HMAA 3PNBA 3K70C 4NOKA 2XJ9A 4FLEA 4V2IA 5EPUA 2ZXEA 4POAA 3N2LA 2XWJI 1FSZA 2CWDA 4TV8A 3KALA 4DDHA 4DSUA 2Q8NA 1G20E 1ZH8A 1E6EA 1DRUA 2C78A 2FLWA 2O2XA 3S1SA 2IYVA 2H2GA 1QHGA 4IXWA 3BDVA 1N5RA 2CFSA 1IM5A 4KL8S 4G5XA 2WG0A 3A26A 4L8WB 5CA0B 4YRAA 4PC7A 1JIQA 1FNBA 1XZLA 3B1JA 3ZTWA 4OXNA 2DQSA 1A8IA 1X94A 2C9MA 3P2OA 4FGUA 2FV8A 3U9SA 4TWIA 2IHVA 4HWSA 1UFVA 4N6GA 2CV1A 3S1AB 2WPNA 1ENZA 2O52A 1FBTA 2D1SA 1GG9A 3O6VA 4HR7A 5DLDA 4QG3A 2GXSA 1YMVA 4IH4A 2ZTMA 3H4MA 2J59A 2FR8C 2HM7A 3N6VA 4J0KA 2VDKB 4UM9B 5JNUA 1R66A 1Y42X 3HI6A 3ZVKA 5IZCC 1VL5A 3LIIA 1GLGA 4FDUA 1CDZA 1R0BA 1XKTA 2PSJA 3LLMA 4KVFA 4IW3B 5T4HA 2Q4RA 2CXTA 4R7ZA 2Y1GA 3I52A 3K4QA 3U4QB 1E2LA 3VYRB 4EITA 3CUEF 3HJNA 1EM6A 1ZCJA 1ZUHA 4Q39A 2B2NA 5B57C 2FRVA 1BXRA 2D13A 3B8HA 3MCVA 1A5BB 5HXAA 3NT4A 4M0UA 3JYHA 3HJBA 2DUUA 4OX9B 1PW5A 3FZEA 4LMRA 5F4BA 4E33A 5EQDA 3RFFA 5J2UA 4UMVA 4OA8A 3SQLA 3HCEA 4W7HA 4P2GA 3MS4A 1KF0A 3HB7A 1VIMA 2PEZA 2Q3FA 4ZYUA 1AQNA 3QLEA 3EZ7A 1RQPA 2H0RA 3FCSB 1XPUA 4UFNA 2FMTA 3N7UA 3FPHA 4GPBA 2Q46A 3HCNA 4QUEA 5K8VA 4DA0A 3BGSA 1RYFA 5HCUA 5E1BA 5K0BA 2R96A 3O84A 3HRIA 2VHXA 4UDOA 1JA0A 4NU0A 4PHTA 2XW6A 1FUIA 2GARA 4KGVA 3ZD9A 5ITWA 1D6NA 1JHPA 2WHYA 4ARZA 1BDHA 1M1UA 1Y3HA 4BASA 4BMVA 3LHIA 3TXAA 2G88A 4BRWA 4C78A 3NYQA 3D6AA 1D2GA 5FO0A 1TAGA 4ZRNA 5J2TB 2OCGA 1YQGA 3TLXA 3OO1A 4EABA 4EJ0A 4EL5A 4Z9YA 4GSKA 3EFOA 5EZYB 4AECA 2HDOA 2DBRA 2NPFA 4AP6A 4DILA 4DLRA 4KUGA 4W1QA 3RJTA 3LDUA 4HHEA 1CFZA 5JCPA 4TWRA 1PDVA 4HEHA 2LKCA 4KZPA 2BJHA 4J3JA 1RMQA 3GX1A 3L05A 4A92A 2DWUA 2EP8A 1RQNA 3IS3A 2J0SA 3LUFA 1Q21A 3AESA 5L4SA 3T7KA 3HGQA 3U5ZB 2XQKA 5ECDA 1CY1A 2XY4A 2ZRLA 2WUVA 3NV9A 3H16A 3H6HA 5IJ0B 1E6UA 2HCRA 5FHRA 5H83A 1PFGA 1PFUA 1QE5A 2NUAA 3NP9A 1LC0A 2OA0A 1C0LA 1JU4A 1QYWA 3GDWA 4LE2A 2GKGA 4OYLA 1ZJ5A 5JANA 2ERXA 3SMQA 4FD3A 2PCLA 5F1OA 3ETJA 4KRXA 5EJ9A 4KKXB 3LV8A 2PX2A 3NONA 3P9NA 4CDGA 4O5AA 1RZRA 2VTVA 4N48A 3E84A 1NUPA 1EUCB 2J0UB 2OENG 4KYVA 1DRVA 1WA5A 3MRVA 4OF4A 4EUFA 2VKTA 2HEIA 3R8CA 1OSNA 1JVBA 5IU6A 3VR1A 1SUCA 4B87A 3D2LA 2QRLA 5CJJA 3ABOB 4YP5A 5IC5A 3DFUA 5KOHA 3KPVA 5CCDA 2COEA 2WJ3A 5EMJA 3RBXA 4Y2PA 4E3ZA 4J1SA 1Q1BA 2C95A 3QVOA 3ZXIA 4EKDA 2YUTA 1CRQA 4EG3A 2HDNB 2JH9A 1A2OA 4TQAA 1S2MA 2CFIA 4LZLA 5EJ8A 4YBRA 2HHAA 5A0VA 3JAWA 1D0IA 1XKXA 3F3MA 3O92A 1E1QD 1WKCA 2JH3A 3TZEA 4B3JA 1L8LA 2ZJ5A 4L08A 1JEOA 1N2SA 4ZCSA 4OK6A 4AMZA 1C9DB 1MRSA 3H7AA 3BF8A 5T41A 4HLQB 3HV0A 1LLFA 1LH0A 2R68A 3LDFA 3JQPA 3X1YA 2H59A 1JRLA 3BJMA 1WXDA 3OIFA 1J2RA 3GFSA 1J1ZA 3R0XA 3RHFA 2AL7A 1II9A 3PQ8A 4JJIA 3VM6A 4GGOA 2YQ4A 4AURA 3H5OA 4FFOA 4M49A 3E7WA 4WD3A 4D46A 4GXQA 2O23A 5LP6F 4A8HA 2BKLA 2GKOA 3IPXA 4IJKA 4JQOA 1AO3A 3NC1C 1G2QA 2IEDA 1FF9A 4MQLA 5DP1A 4QVKA 1IHUA 1XD9A 3ND8A 4KLCA 4ATNA 1XZAA 4DJAA 2PGLA 3CW2A 1WPRA 3OP4A 2REBA 2O7VA 4ZV9A 3OIGA 1Q14A 2OSVA 4GT1A 5CK4A 1NQUA 3WKBA 4RVUA 4M76B 3TTWA 3LWBA 1EE2A 2XNKA 3K05A 3VZRA 4R1OA 3NHRA 5MFZA 3BMXA 4JENA 1A9YA 2Q49A 3VX4A 4R8KA 3ZE8A 3PPWA 4D74A 4OK5A 5HIJA 2SNIE 3O73A 3WQRA 4DJTA 1KP3A 2A1UA 5ICCA 4OQNA 1AF4A 1CE8A 3PNSA 1TKRA 3D6VA 3P9QA 4UU1A 4BEWA 4QHTA 2VDOB 3ACBA 3F46A 2QX7A 4WY8A 3ROKA 3U7JA 5EHXA 1PGQA 1NOIA 2JAPA 3EAQA 5DF1A 1LDBA 3LC0A 1OC4A 1OXUA 4KNYA 2JLVA 1SVKA 3MTDA 3SP1A 2FGKA 1UKZA 1PRYA 1R6UA 2OUIA 4UATA 2Z2XA 1COZA 1NN0A 1SEPA 4KN8A 2JEZA 4JC0A 3HBMA 1F14A 1LCIA 1OT3A 1NMSA 3WL6A 4YRSA 1N6KA 4ZT7A 3RSLA 3SQDA 2DT8A 2ZUDA 2DAPA 4O2AA 1JKFA 2X5JO 1L5KA 4F4IA 1ETHA 3T7IA 2P67A 3DBHB 5IBPA 3KAQA 5CBKA 1NXTA 4XM1A 4DLAA 4IGIA 2B1JA 2O3UA 1OV6A 3QVLA 3X1KA 4D9FA 2ZE7A 2W98A 3BM5A 1NXOA 2QN7A 1H0RA 5CH5A 2DFDA 1YSCA 1QBKC 2DFVA 2AD5A 2X5KO 4H0FA 1T9CA 1N6IA 4I4TA 4OQQA 5JD4A 3QXXA 1RS0A 4M38A 4UAGA 5FPPA 5HYVA 4P8RA 4BC0A 3DKVA 3DTVA 3GVHA 3AT1A 3EXHC 4RTMA 1KRWA 3FDFA 1FNMA 1GCUA 3KT3A 4XYBA 1LKZA 5HR5A 4MOWA 2WSBA 2EP5A 4G25A 5KNCH 2Q3DA 4G0OA 3JQGA 4IDGA 3SM3A 2D2VA 3AEUB 4ZODA 4TZ0A 1YT5A 4XR9A 1UFKA 3ZD8A 1AF7A 3F5FA 5BSMA 4DJJA 2JAOA 1J21A 2VSQA 3GFTA 1QDUA 5JDIC 4H7EA 3WWEA 4B7ZA 5F3DA 1ZVQA 2A92A 3HCDA 4U2GA 3IVGA 3ZBQA 3L1JA 2YIJA 4KAXA 5I7OA 2CCGA 2PANA 3PLRA 1N1EA 2Q9CA 1KGDA 1M2WA 3HNPA 1S2DA 4Q34A 2JFBA 5TQ2A 2QLFA 3EPHA 4KV7A 2Q5OA 4WNAA 2PKXA 2XQFA 7GPBA 2I5PO 4AP5A 2J5KA 3FTEA 4TT3A 3STVA 5E9JA 1WRBA 1J9EA 4ZARA 3IAXA 5EJ2A 2GSDA 4DQDA 5JJ5A 4TN5A 4X84A 1DJMA 4YJ3F 4QBKA 3IA2A 3TZCA 1QR2A 3MJFA 5IK2D 5KQMA 5JI2E 4XGQA 1KI8A 4FK8A 4YR7A 4M0MA 5T8KC 2QDKA 3FZNA 2DR3A 4QO7A 4WOJA 1MOSA 2F48A 4FFBB 3SE7A 4CG3A 4RA6A 4UJ3A 4WIAA 4FBMA 4MLDA 2G1JA 5BNTA 2YX1A 3Q7QA 1MO4A 2FAXA 2QJOA 2YVQA 4CF3A 1V1MB 3AI3A 4J6FA 4RIFA 3H8VA 4Q4CA 2DRIA 4HQRA 3QW4B 1CUHA 2J5XA 3ZHYA 2HA4A 5IBQA 1SQSA 2PH7A 1CF4A 2XBLA 3AILA 3OLQA 1U6KA 1ABFA 3CMMA 3AVYA 2JLSA 3OF3A 1G64A 3LPMA 3RIEA 1U7HA 1XTUA 2ERCA 1E18A 3UG6A 2W9XA 4QU0A 1WF6A 3O47A 1ZQ9A 4QJ5A 5HILA 1PQWA 1WXHA 3BGIA 4G09A 3RSCA 1GPMA 2Y93A 3WLRA 2PYIA 3HPRA 1KO1A 4GNRA 5M2QA 3IBTA 4RIEA 4Y2QA 4BCBA 1SIWA 2GFQA 4UHJA 1ZW1A 3R3UA 3KT8A 4WXHA 1XVTA 3TCXB 2FQ1A 4FFDA 3UK7A 2C00A 2V3VA 5C4IA 2BDEA 3DOEA 1VL2A 2DYKA 3F3KA 2ZSHA 1U2GA 1A5SB 3K7EA 1NULA 4GE0A 4YO7A 4CGYA 4EFDA 4A16A 2QD4A 3IAM1 1DQSA 5IG2A 3EQ7A 3AP1A 4J1QA 4TYYA 1WZCA 4GQIA 1T4CA 4FWTA 2I7TA 4IICA 5C51B 2WD9A 3GBVA 5ENDA 5K0CA 1VXRA 2X2PA 4N3BA 3PRJA 2V55B 3FYUA 2GN6A 5F3RA 4ND5A 5EUQB 3D8NA 1PLLA 2A35A 3H8WA 1JEYB 4OHRA 1XK7A 3ECCA 3KUUA 4ACAA 1YWGO 4F6RB 2HQBA 5F23A 5JRZA 3PVSA 4A10A 2D2EA 1OWPA 1BMDA 4YT4A 1LF5A 1LS1A 1R6XA 2CXXA 2FCRA 2V6JA