1Z9BA

Solution structure of the c1-subdomain of bacillus stearothermophilus translation initiation factor if2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
NEFELGTRGSSRVDLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor IF-2
publication title Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 1z9bA01
3WBKA 4N3NA 1G7SA 1G7RA 4KJZA 1Z9BA 4N3GA 3WBJA 1G7TA
chains in the Genus database with same CATH superfamily
3JQ6A 3RYFA 1Q50A 4MVJE 1KJJA 3NFYA 4OHOA 5EJFA 3IHKA 3PNVA 3GX1A 4ND1A 2P2SA 3A1NA 1NUUA 3M3HA 1C9NA 1GPNA 2PLRA 4E12A 4JEMA 1D3AA 1DCFA 2X14A 4DA7A 1E77A 1SA0A 2PXCA 4P6VF 1OWNA 4RPLA 4DJEC 4E31A 5EXDA 2DECA 3FMPB 2WWGA 3O90A 2ZPAA 4JLDA 4RCZA 3ZWVA 4C7VA 4M22A 1FDVA 4PYRA 1M2NA 1XZLA 1MO6A 5FUBA 2IHNA 1SQSA 3RS4A 3UWDA 1IXKA 1QXSA 3KYCA 1X9GA 4AZWA 1AV7A 3AG6A 1GPKA 1W0KA 3IVMA 4FDMA 3B9QA 4NMMA 4RY9A 4E5VA 3AVUA 1KJ9A 3TPFA 1GPWB 1ZK0A 2JJYA 3MINB 4M0CA 1EYZA 4XLZA 3CUTA 5FPQA 3DLTA 3O1LA 3W4JA 5BWOA 3PUXA 3TLMA 2ZCUA 4CGZA 1WOYA 4EYQA 4BNYA 1TUIA 5L51A 4U7DA 2QVBA 1XEXA 1IU9A 4YMSA 2GO1A 2C3YA 3NUQA 5I9SA 1L8QA 3WJAA 4GRIA 1R88A 3OJOA 2PAAA 2LNDA 2GR9A 2JLVA 4BO0A 2FPMA 4B4DA 1NVKA 2ZIWB 4W1QA 3PDCA 3UUFA 3R09A 3CVXA 1JKFA 1QPZA 2JLWA 2ZJ0A 1ZOSA 1G5RA 2DY1A 2EV9A 1AQJA 1YGPA 3QKIA 4IVQA 3ZVKA 1E62A 2UZAA 1HURA 2IZ1A 3P20A 1ORDA 1SC4A 3K53A 3Q1LA 4JIGA 3FHCB 5EP3A 1Q12A 2PE5A 5GVSA 3HFJA 2AOUB 2XCRB 1M5RA 3DSRA 3R2JA 4KQFA 4D9GA 5JEDA 5LZ9A 4Z5XA 5ICEA 3WFIA 2W2PA 2PZBA 1RYFA 1EGQA 4JMPA 1QG4A 2C5HA 2O2CA 1YRBA 3KT8A 4EY5A 4UHJA 4YJFA 2PMKA 2EF1A 4BNDB 2CNWD 4H60A 4DG5A 4UQLA 2HAEA 3FUXA 3A27A 1DDOA 4MWGA 3AHEA 2VQSA 4MINA 3LAWA 1V16B 4YAOA 4DPKA 1PS0A 4HQNA 3VU3A 1M6EX 3GBPA 3OVMA 5I8WA 3UKJA 3OT1A 1C2YA 4N3BA 3ZOKA 1RW4A 3GJYA 3B51X 2PS9A 4TWBA 4DABA 2RCYA 2H1VA 1Y3HA 1E3LA 4MV1A 4TUYA 3JYQA 4K05A 1YHZA 1EA7A 5DT9A 1X7GA 1IZ7A 3RI3A 4IGIA 4CLDA 4AG5A 2JAUA 1FJ2A 2V03A 1OOEA 1Q6YA 4Z2AA 1JR3A 2ACKA 1M34A 3N39C 1JQ3A 1MTZA 2EFCB 4FOTA 3CVVA 5HW0A 1LK5A 1PW7A 3DCJA 2QXYA 4A0SA 1QMGA 2OHJA 3AMVA 3OWHA 4G8CA 3N6VA 1IFXA 1IY0A 5IDYA 4E5UA 1XPJA 5AO9A 1MV5A 2E3JA 3CTPA 4DNPA 5L3ZA 2A84A 2C8LA 2W8BB 5AKEA 2A5JA 5C80A 2VLBA 1CR2A 1Z0ZA 3WWYA 4Z4GA 2B83A 1IEVA 2GTHA 3K05A 1YUNA 4OVKA 5DULA 1PNOA 1YWGO 2GJAA 1U2SA 1N2GA 1XMJA 3MC1A 3NAGA 1ZH6A 2ZTHA 5I3ZA 3THYB 2ZZKA 5G0SA 2XTJA 2IYVA 4US2R 3B82A 3KRTA 4P7FA 2IU3A 5FL3A 3QFSA 4BN0A 3MJTA 2C4HA 1VKHA 5AJTA 3D54D 1GPDG 4EF5A 1JKMA 3GAAA 5LU9A 5TIIA 1QO7A 2QEQA 3LXUX 3VC3A 4M0UA 3SZMA 1PJQA 1VLLA 4QUJA 5BSRA 2X7HA 1QRUA 3ASUA 3HJRA 1RQPA 4Q6WA 4TTSA 1T2UA 3CRZA 5B4UA 4RKEA 4G5OA 3ZPXA 1SRQA 3I37X 1P5ZB 1XAGA 1XKQA 2PX4A 3IP7A 4TV9F 5CIQA 3I23A 1ZK3A 3QKUA 4HFNA 4L5IA 3VXKA 2OCIA 2PJDA 5KWIA 3HZZA 5IM4A 1XZIA 2WZCA 2XB9A 2XMRA 5KOHA 4PAGA 1IHOA 5EKTA 1KDOA 2I7CA 2W4IA 1PS9A 3KO8A 4N82A 3U31A 5LKRA 2J67A 1UPUA 2QI9F 1TF5A 4MV7A 3WR5A 3SJ7A 9ATCA 2IK8A 3RRMA 3NTRA 4OUKX 4W6QA 1ZRMA 2CJYA 2YJZA 4UQOA 4ZOAA 4PNEA 5CBKA 5DYGA 3TSZA 2P91A 3HY6A 4C0XA 3AF6A 4O08A 2PUFA 1Q57A 5CYFA 2JI8A 5CNKA 4LQCA 3PYXA 5JBQA 1Z5PA 5FD8A 5HQJA 2DBYA 1N2BA 1W87A 3KJHA 3PKZA 4BB0A 1O58A 4F96A 3BL5A 2EEPA 2CBZA 4QQKA 2PBZA 3WK6A 4LJYA 4U7HA 1CQXA 1LXCA 1ZBQA 4IL5A 4X60A 5BPHA 4MJ3A 3TXXA 5B36A 1VPEA 2XAAA 1X7ZB 1XWWA 4HB0A 4YCAA 2GGSA 2JFYA 4L3VA 1O9GA 1ILWA 3H9GA 4EMBA 4D81A 3MS7A 2QGZA 3K6KA 2EL9A 1PJTA 3OJFA 3ES9A 4B9AA 1BN7A 1BRTA 3I5MA 3B48A 4TMWA 5KYVA 1NNLA 2ZRPA 1RLIA 2G6BA 3REGA 5JFGA 2C8VA 4HZGA 4Q7MB 1SOVA 4B2PA 3RFVA 3TUIC 5HRAA 3GP3A 1WCXA 4YRGA 4ZT6A 3QV2A 4QX6A 5LQMA 1G7RA 3DP9A 1U1GA 2WV7A 1DJQA 1SK8A 3WK9A 2VQ6A 1H1LA 1TLLA 5BSKA 3HDYA 1NVTA 4LVOA 1AKNA 4JXKA 4NG5A 4I50B 2Z6UA 1USGA 2C3UA 4BZXA 1S2LA 1J21A 1TZMA 1OB5A 2J5BA 2O3RA 1TMYA 2WWXA 2CXXA 3BTVA 5I9TA 3DBLA 4PZZA 4CUKA 4ER3A 3ZDDA 1YVUA 2Q4EA 3ILSA 1V8DA 3KB2A 3LT1A 2W58A 4HXFB 5D51S 3T9FA 4BTEA 3N75A 1N9ZA 1PE0A 4BX2A 1G8MA 5AVVA 1JWLA 4KW7A 1VBKA 2OD9A 3H75A 4DRXB 5ILGA 2RH8A 1A5BB 4YCSA 4RQBA 2FSIA 2CXHA 3U17A 4BE9A 4ZPJA 5C53B 5F1KA 5DN9A 5BOSA 2O07A 1JHPA 3NDRA 2CMFA 3FI0A 2DPGA 3MTGA 2YIDA 3I04A 1WSDA 3IJPA 1U4SA 3SNHA 1XMOB 3C0KA 3P9PA 5DIZA 4DCMA 2EOAA 3A6PC 3IH5A 3Q3VA 1Y3BE 4LTDA 2XUFA 4HXYA 1VJDA 2QK4A 5DISB 5F2KA 3BMOA 1NOIA 1W0JA 1RXYA 5A7HA 5GADl 2G9ZA 1A9YA 3JVUA 3A4TA 4H7JA 1AK2A 3EC1A 4GLFA 3FKSD 2ORYA 3MQFA 1M6WA 4LOHA 4IIBA 2EZ9A 2YNMA 2QRNA 4L07A 1SIBE 2YHAA 2VPYA 4LJSA 2JLAA 2ATEA 2NQTA 1U0BB 1G8PA 5J2TA 2CYAA 3GAZA 3EXHA 4YN3A 2DFNA 1XL0A 1N6HA 1W9HA 2XUDA 2AZMA 1PFYA 1EBUA 3P19A 1RZ3A 5EJGA 4W1RA 4H1TA 5JY6A 2QR5A 4ID9A 4KEAA 1G9SA 3L8CA 4ZQGA 2GN1A 2C92A 2N1MA 2NU8B 1X0VA 2ZB3A 4LXGA 1U0OC 2CXRA 3GPBA 4KI0A 3AJ8A 4Y98A 5EJEA 3HYCA 1A71A 2IIPA 2RHBA 2YW9A 2LZ0A 1Z0KA 4JD5A 1ODCA 1HA3A 2QJTA 2P3LA 1PUXA 4MVJP 1KHHA 1J25A 1C9KA 3KEQA 4B3JA 2O06A 3BZBA 4B4UA 1Z37A 2KM1A 1JW9B 2OE2A 1N2OA 2DLDA 1LRKA 2PN1A 4O4HA 2NU6A 5DASA 3T7TA 4DQ0A 1CEXA 5I48A 1WBBA 1YZKA 5G41A 4U02A 4YT5A 2KE5A 4PLHA 3WIVA 3WL4A 3WLMA 1W36B 1DIHA 2FNAA 3GMSA 1PJCA 1XVUA 2YY5A 2EJWA 4RXTA 3TLGA 4F38A 2H9YA 5EE5B 4IMJB 2XDQA 3VZPA 1JBQA 5DJ5A 2OR3A 3KVYA 4KBGA 2QJOA 2J9GA 2I2FA 4RVDA 3TKLA 2B34A 4P5EA 1YB5A 2HRQA 3H0KA 4LMBA 4KUEA 3PC8A 2GAFA 1GL9B 2AE1A 4GFDA 1XD8A 4P98A 3C43A 3I52A 4DIMA 1IMOA 2ZRAA 3AIKA 3DMGA 3ESBA 3GVPA 2A35A 5CTAA 3A6ZA 3HUUA 4BKMA 3PYMA 1QQ5A 3PUVA 1ICIA 5ALLA 3BAFA 5KO2A 2VKQA 1R4NA 4XOUA 2P5SA 2WSYB 3QOWA 3TQIA 4F6CA 4FDLA 3GV0A 1AZWA 4LEIA 5IHXA 3AVTA 2HPVA 1DFHA 5HG0A 4DA6A 1RD4A 5JS8A 3CZAA 3MOSA 4LY3A 1MXHA 1QIHA 2FZCA 1NNI1 3WIBA 3T5AA 3SZUA 4PG6A 4RZ2A 2JF0A 4AC9A 2FPPA 4D3FA 5BN4A 1P7WA 2FUG1 1XT6A 4RTMA 2WM3A 4PAOA 3D6FA 1AZLA 3V1KA 3H2BA 1ZONA 2GKSA 1LDBA 5TGDA 3OSZA 5JH7B 4Y1RA 5K6RA 4YAEA 4RFLA 1IQRA 4F3NA 2FTKE 5J9FA 3MCVA 4U8GA 4WSOA 1EVYA 1ONPA 3K5WA 2PSEA 1PD0A 5FX2A 2ODEA 4PYLA 4H59A 5BN5B 1E60A 1BFDA 3LUPA 5CVEA 3TCNA 4M6WB 1TCAA 1B1CA 4OUDB 1WG8A 3ET5A 2GM9A 4F1WA 4D41A 1A69A 2P9QA 2IH2A 4KQ2A 4Y6RA 2O0LA 1Y8CA 3VZQA 2IA5A 2BR3A 3V5NA 3MYYA 3TSOA 2REOA 2P5YA 2GWRA 4RFSA 5GGYA 1R5BA 4IXNA 4LSWA 1E4EA 3HP4A 1TM5E 3NVMB 1E3MA 2BLNA 2J6HA 5G3ZA 4QYMA 4ZC1A 2V8BA 2BKUA 3IUNA 4YRMA 1EX1A 3LPMA 3PNKA 2OB2A 3CX8A 1UPTA 3H1EA 1SB9A 1UUFA 2D62A 2EX1A 1XRNA 3IUYA 4MYRA 4F21A 1E2JA 1OX4A 1RI1A 4WKOA 5GZ3A 1N78A 1V3VA 1IG3A 5IVHA 2WFLB 1KQOA 2Q8QA 4RXUA 1F8FA 1HEIA 1FVXA 1N6IA 2V6FA 1Z0UA 2R44A 4QYXA 1PBNA 4YP7A 3GLIA 1CY0A 2DC1A 3DEHA 1B0UA 1T5HX 1D4OA 1Q1AA 1Q74A 3N8DA 1WDKA 2ZE7A 1XEAA 4UUBA 1QX3A 1VL6A 5AKZA 4QM6A 1DAMA 2AYZA 2Z95A 3LE8A 1IQ0A 3UOWA 5FOWA 1L4KA 3DMFA 3RWMB 3MJSA 4WNAA 4EJ2A 1UK7A 5CCEA 1JIKA 2NAPA 2O8NA 3AB3A 2QPOA 3JQAD 3KPWA 2W6ID 1ZUD1 4XOIA 4MW9A 1G20B 3RFTA 3CF2A 4J29A 5C4GB 4L8LA 1I4TD 2ZJFA 4R1NA 4A4DA 5AI6A 3TXYA 4I55F 3KU4A 3VYUB 4D2IA 2YXPX 1FX0A 2CL5A 3JARA 1GU1A 1NAHA 1YIDA 1CIPA 2R47A 3NTQA 4HVLA 5H9WA 1KOGA 1NDQA 2CXOA 4N7JA 3RROA 1EHYA 3EG9B 2WWWA 3GRUA 4LZZA 3IAXA 2NNLD 2WM8A 3KVOA 3KHTA 3NNDA 2Y1WA 1F20A 1U8AA 3QVLA 4KI7A 3ZNOA 1XZAA 5CXSA 2VRCA 2NXEA 2QLMA 3ANXA 3EGWA 3OZXA 1BDIA 1GRRA 2X0JA 4BLTA 3U4DA 1NASA 4JR2A 4CV0A 2ZRKA 5I9MA 1U8ZA 3L1KA 1P7CA 2JCSA 1KJQA 2QNIA 4KBYA 3T52A 3T9BA 3UWOA 4IQFA 4DREA 1E9FA 4G9EA 3SF8A 5JYEA 3OURA 2PZLA 5CEFA 1ONSA 4UM5A 3W9BA 5A5GA 5JR3A 1IJFA 3A4NA 4A2QA 3DWEX 4J3FA 2FW0A 3OTIA 5CA1A 2XUKA 3MMZA 2GEKA 2CLEB 3X1MA 1NI3A 3R5JA 4S1WA 3KXDA 4HAOA 2PUAA 3SIXA 3AR5A 2ALJA 4LOAA 1UDAA 4P2BA 3RDPA 3H2IA 4BV2A 4Y6GB 1X7YA 4DAEA 4U5XA 3NM6B 4E08A 1JE0A 1SXJB 4K46A 1KAMA 2VEDA 1Y7TA 1B0ZA 3LCMA 1S8NA 3DFIA 5FA8A 2P68A 2JK1A 3MAGA 2EQ5A 4GDMA 1GIAA 3LLCA 4WINA 3SIRA 3BCSA 5EE0A 3KAJA 1A8UA 4I14A 4FCTA 1H0SA 4M7OA 1H65A 1ZDMA 2HQBA 2JI9A 2VQEB 4HDOB 3MF4A 3IYLW 2ZREA 2PL5A 2AG1A 5KX5A 5AVYA 1N4DA 2P27A 3PLAE 4ALMA 1TIPA 3ONFA 3VNBA 4GSYA 3H83A 3H5IA 2QMEA 2KBFA 2VP6A 3C1AA 3PE4A 1K97A 4TM8A 1TIBA 3RV4A 4UC0A 1J24A 1W6RA 3KOOA 4FS3A 2WYVA 2BEKA 1OX5A 4F6RB 1CUJA 2DWQA 3DO6A 1KQFA 4C05A 2V6GA 3MSCA 4R1LA 4XQ0A 2ADFA 4I4TB 4DAOA 2V7UA 5CNIA 2GPYA 2ZSAA 4K40A 5AOCA 4RTRA 4L22A 3O8DA 5EWJA 3EE6A 1QVRA 3U9SA 3LC0A 4QZVA 2AC2A 2BTEA 1SD5A 3EOZA 1XX6A 2AX4A 2LDXA 2V4UA 1T2VA 4FLMA 3TIFA 5IEJA 4DM4A 2LD4A 1W29A 1AHIA 1DKNA 1FFSA 2Q49A 2W71A 3K5HA 1NHGA 1UPFA 3OZSA 3RARA 3TRKA 1XCGB 1A9RA 1U31A 3ED5A 3EZFA 4QVKA 5J58A 1QGDA 2FGKA 5T8KC 2HA6A 3C6YA 1HQKA 1C1HA 1DG1G 4BN4A 1FFXA 4A8TA 2HLPA 3NYWA 3GGDA 4YLEA 1D2GA 3R3UA 2G40A 3FYSA 2R8ZA 3M5PA 4CMEA 3VGJA 2QT1A 3CNEA 2PBLA 3M5WA 4MDHA 1FXWF 4OP1A 1TQ2A 3E84A 3NP7A 3IUJA 3L7KA 4MKXA 3AY6A 1NW3A 1UAYA 1J0CA 2VDPB 3H19A 2NYUA 3I04M 3FDZA 4R98A 3ZD6A 5CT9A 3KKKA 1NJ8A 3UB4A 4KMMA 1L4MA 2H51A 3O3NB 2KYRA 4PHCA 4RJTA 4CL0A 4XXHA 1MEEA 4PWYA 3F98A 3K70D 1MDFA 3EF0A 2I6UA 1QPBA 2XYHA 3F5SA 3GVHA 3O8OA 1Y9AA 2MSNA 4ZRMA 1N6NA 2NAFA 1QRRA 3DE2X 3LPLA 4DG9A 4DBVO 4I9HA 4YO8A 5F5LA 4EF6A 4F11A 5JS1A 4GL2A 1TE2A 3WL3A 2BN4A 3F49S 1S01A 2LIVA 3TLKA 2PXAA 3Q5EA 4LAFA 4X8LA 2PT7A 1VLHA 3AF4A 4RZ3A 2VP0A 1TT5B 2ZETA 3PHIA 4D4KA 3FTNA 3ORYA 4QVIA 1A8SA 1QX4A 4MMZB 3LX5A 3E2PA 3ZCRA 3BE8A 2VF4X 4INZA 4W9MC 1MORA 4UBLA 4C6TA 1FRZA 3OU2A 2OAP1 5BSWA 1MPTA 1OH6A 3LQFA 4G1BA 3LT5A 2IDZA 5DN6D 5AK3A 1CYEA 1W75A 5HX7A 5JBIA 1BXGB 3AY7A 4BNGA 1HV8A 1NE7A 5KB3A 2ZZNA 1XAJA 3FMOB 4WIAA 2CUTA 4R0MA 4CM1A 2XYPA 3RAFC 4P58A 2P9HA 1JLSA 4M46A 3ZV4A 5EHIA 3LRTA 1X87A 3ABZA 2P6OA 3EEIA 2I3AA 4YRDA 5CVTA 5DMHA 3K9BA 3TNLA 2A2ZA 2CDBA 4XFJA 3I8OA 1KE1A 2IU4A 5BORA 2V6MA 4TVKA 1KF0A 3KWMA 4IG4A 3VPBA 3IR5A 3V46A 4FHFA 3IUSA 4QUEA 2ZYTX 1DEHA 2CLHB 4U8HA 2BVNA 1LD3A 1IYZA 2H8GA 1M6VA 3PI7A 4JLMA 3UJDA 4Q4CA 4MYUA 4V0KA 4YWJA 4PN7A 5C1OA 4FR5A 3PXBA 5AVTA 2OFXA 5AI0A 4YXWA 1GM5A 3O8BA 2WK1A 4MKGA 3W5SA 2GF9A 1NL3A 1HM5A 1RC1A 5HKKD 4C7MA 2DOKA 2CVZA 3JVEA 3OEED 5C37A 3F0TA 3O0DA 3BXHA 4A8HA 3E05A 4DDUA 4Q7KA 1KGDA 2X3YA 1SWVA 4P0TA 1REQB 5DYNA 2CNOA 2PT9A 2BELA 2JAPA 4BECA 4MO2A 1HDZA 3TDMA 3FPKA 3T3IA 5BSGA 3UHFA 4ZKDA 1D6MA 4AF6A 4LXTA 3IEVA 4OP3A 3I64A 2E4AA 2HADA 2ZB7A 1PD1A 4NXNB 1FMCA 5CD9A 4QXQA 4JENA 3HSSA 1NY6A 3DWFA 3AR2A 2E0IA 3P7MA 1NFQA 1RJDA 3OE7A 2F1KA 3QX8A 3G5TA 4FE4A 4RZXA 3B1YA 5FWAA 3CNBA 5LYYA 3ZY4A 1DVRA 3C98A 3I05A 4FYKA 4LCJA 3TAXA 3W6ZA 3ZW7A 3WXMA 1M2VB 3TD9A 3B3AA 1SBNE 1N5DA 1DQPA 2YWXA 2H9IA 1E59A 2BE9A 3MJFA 3QF4A 2IVFA 4HYEA 4N7BA 4C3OB 5ED4A 4IJVA 3D5QA 2PANA 3FSEA 4I0WB 4C0WA 4NTZA 1IVSA 2OV8A 3QVGB 1RE1A 2BI7A 5KYWA 3CW8X 1YMQA 3F9RA 2A5GA 2PWPA 4C2TA 4FQ8A 2GZRA 3V8NA 1EJ2A 1K2WA 1B4DA 4QECA 1SQ5A 1S8OA 4BU0A 4A0RA 1K92A 1E1RD 1NFRA 4A92A 4IDOA 3A1UA 3GJ3A 1DJPA 3OIGA 4J0DA 1AUPA 1HYHA 4MW0A 3ZH2A 3UMFA 4BATA 1JEYB 2CYBA 1JXAA 4Q9AA 1M8KA 4ZGBA 3I9V1 1T8PA 1TAHA 4FNOA 5DNEA 1AGYA 5F7JA 1U3DA 1J99A 1JAXA 3FNFA 4YP5A 4NU5A 3ZVLA 1DXHA 3W3AA 2GASA 1MCZA 1PQYA 2XJ9A 3AWDA 5DBHX 4NBTA 4O3FA 3SICE 2YJNA 2J3DA 4UXHA 4AKHA 2I4NA 4R9VA 4TZKA 1IN8A 4YTEA 4LE0A 2Z83A 2EGUA 1M1ZA 1ULZA 3QI2A 4N49A 4TL8A 4ZODA 1XZNA 1ENOA 3TQCA 3QX9A 3ZZTA 3QELB 3A0UA 4NOKA 5JISA 5LWQA 1LQUA 2QD2A 3ZY6A 1J22A 4Y1GA 4BFYA 2WJZB 3KKLA 2REQB 3HP1A 3UH1A 3HKEA 2J6BA 3OQIA 4Q3EA 3KQWA 2PO7A 1YS1X 1I7PA 3B12A 2YXNA 3WGHA 4MEAA 4EJMA 4NCAA 3CRRA 3WX0A 1NQTA 2QTZA 3HYLA 1JBKA 1I2BA 1ML3A 1PDOA 1QAMA 2BBTA 1XMXA 1Z2DA 2GOYA 5IH3A 3UA4A 4JELA 4DDWA 1TEZA 5KKNB 2QMUA 2EZTA 1XRSB 3G2NA 4G1FA 5CK4A 2W70A 3MB5A 1P77A 1XR3A 2CLMB 1FFEA 2PLFA 2QN3A 1U7OA 3C8ZA 4IDAA 4RGVA 5G02A 1AKVA 4F2DA 1DTEA 2V8OA 3W77A 2UUCB 2UAGA 2JFBA 3FNQA 1TK9A 1L7DA 1HOXA 2XMQA 3GJRA 4AJNA 5AESA 2EG9A 3FBWA 3OIYA 4P81A 3OF2A 4WTOA 5FUWA 3O9VA 2VAWA 1N8NA 2AGVA 3PGJA 4Y6PA 3LT4A 5CRIA 5CFOA 2VR1A 3Q98A 3DYVA 4XQCA 3FAKA 3HA5A 4BX8A 4E5NA 1XCOA 4H0CA 4MX8A 3VR5H 3JSAA 3ACCA 1GQOA 2WMNB 3CF4G 3QLVC 4OGFA 4U2EA 3UFXA 1Q1ZA 4KRFA 2LCFA 1NOJA 4LYGA 3O47A 2Z4TA 4J7XA 2YVQA 5JATA 1CEYA 4OQ4A 1D1QA 4R54A 1KERA 2F3UA 3DDNA 1EK5A 5ELLA 4ZALA 5J40A 1EQAA 1SXPA 3MTIA 1L7QA 2BZ1A 5F4ZA 4EHJA 1H2HA 2PL3A 3KOYA 3B9RA 4R1UA 1KL7A 2I71A 2OCYC 4OATA 2AQKA 1JA0A 1VRWA 2GXSA 4ZI7F 3CFYA 4L15A 1O95A 1KDYA 4CR7A 1ZZEA 4PPGA 2SKEA 1IHXA 1GPH1 4MQEA 2DFDA 3HKCA 4X85A 3AEZA 1FOEB 2ZBGA 4L8GA 1CY1A 3ZUGA 1HF3A 5KSYA 2DUJA 4TMZA 4D74A 1O5IA 4Q3OA 4S35A 3BUSA 2YNMC 5CAEB 3RUHA 3E22A 1LDYA 4YAFA 4Q4HA 3LC2O 3HNPA 1K68A 1G0NA 2IUEA 2O2ZA 4KVGA 4WDQA 5B64A 3N2GA 7AT1A 3N8KA 4A15A 4AZSA 1GDDA 4GPEA 1X86B 4DQDA 3DAFA 2COKA 1LC3A 3GARA 1WMDA 1CF2O 1N2SA 4XDYA 3F2IA 4O1IA 3RS8A 3H6GA 4B17A 5KMGB 4KPGA 2V7PA 1EDBA 2FOLA 3N2ZB 3OLCX 1XRJA 2PGNA 5LQUA 1Q19A 2HD4A 3O8QB 3OKAA 2WMOB 2ERXA 2JAQA 4FXPA 1RYMA 3B6EA 4NMWA 5SYNA 5TPZD 3C4JA 4ZCQA 1VRVA 3DLBA 4N18A 1BWQA 1Y9ZA 3QG5A 4OJQA 2ORWA 221PA 3G7SA 3NHRA 1YDWA 4KUHA 4CM7A 1K66A 4RWEA 3A25A 4H6PA 1Q21A 2VZLA 2L69A 3CRVA 2E37A 2HGZA 1ZX1A 3BIXA 3TZQA 1E5XA 1MQSA 2DWOA 3MBKA 3P9IA 3PSHA 4HTAA 4D6XA 5JAPA 1Y8RB 3IIKA 3HCPA 5NULA 2I2XB 3MIIA 4XSHA 3WHPA 1GG5A 4JLSA 3EQ7A 4HAIA 1MH9A 4JLBA 3NO4A 2N0SA 3KWFA 4ZQFA 5AK5A 5AM2A 1TO6A 3NGLA 2ZYVX 4H31A 4IOMA 4RZQA 4K6FA 5G3YA 1EP1B 3CH7A 1JXOA 4M1OA 1ZKDA 3F78A 2QZSA 2ZI6A 1FNDA 1JLLA 2VTDA 2ORIA 1VRCA 3PC8C 4YJGA 2HM7A 3IRVA 1WY5A 9GPBA 3AJEA 1APBA 4DV3B 5DWDA 1OLXA 3ZLTA 2E4ZA 4KACA 1ZUHA 3D1LA 3L01A 5LA6A 2F8MA 4KR6A 4D92A 1UJ5A 4I81A 1ABEA 1L3BA 1ST3A 2HPZA 1GQRA 1ZVJA 2B0CA 2YBDA 2EKZA 3N3BC 4CMJA 4C07A 4LWZA 3TIGA 1NGSA 3THWA 2HBQA 3M89A 5ADWA 3G9ZA 3QXSA 3X43A 5HOQA 4C21A 1Q2UA 3CEMA 5LIPA 1HT0A 1XQ6A 4ND8A 2ID9A 1OT5A 3MG9A 1V37A 1DS6A 1J9GA 5CNJA 5DLEA 4URHA 4ZVMA 2FWBA 4K6HA 2FLWA 2A1TS 4WZBA 4FZ5A 4O8CA 1IN1A 5J4YA 5IT4A 1QIMA 2R1VA 3ZU2A 3F97A 5HE8A 3UHAA 4CKBA 3UC5A 1HDIA 1XQVA 2XA2A 2QN9A 3HJHA 3TKAA 2FUG6 5DBGA 2FKNA 4OQEA 3EXIB 1VI6A 2NZYA 4JAVC 2BM1A 2VRWA 1BE1A 3FDXA 4XD2A 5CH3A 4AG3A 2FRXA 2A9RA 3SBXA 2V0NA 1Y1RA 2IX3A 3B5EA 4K1LA 4LJLA 3FRJA 2F17A 3SEAA 4AZ3B 1Y42X 3EUFA 1BQEA 2R97A 3KNZA 2DVMA 2WKSA 1P6QA 3I53A 4FDTA 4QSMA 4WQMA 3C7TA 2PV0A 1U5BA 1CQWA 1X80B 3IP1A 4KIJA 2B4RO 4OV6B 3ZOZA 1W2WB 2JIPA 4C4AA 1TCUA 1GRQA 4LXQA 3B8EA 1E64A 1DEOA 1I5OA 4HFMA 2X5OA 3V8QA 3PE3A 4KGXA 3CKYA 1B8UA 5LOVA 3UJ8A 2XMSA 3RR2A 2NYAA 5AKXA 5TQ2B 3UWSA 1Q2XA 4JB3A 1XUOA 2JHCA 5D5PA 3TGLA 4CM3A 1E8NA 2CLLB 2JGFA 3G2JA 5JNUA 3D02A 4RA6A 4JT4A 4Q9HA 3COJA 4AYTA 2Q6IA 1A04A 3OI7A 5KJCA 3ZQ4A 1QP0A 4QGSA 3PEUA 1KY4A 2AFHE 2R4UA 4MI6A 4Y6SA 4QBTA 4YX9A 4IM7A 4RELA 3FCUB 4F46A 3R7SA 2NVUA 1J20A 1I2ZA 2PWYA 4P08A 4BYGA 4C7KA 2XD4A 1CZRA 3W8NA 4BJ3A 5BUSA 3RW9A 3U4IA 2XCQA 4BFSA 4JXZA 4M8LA 3HVRA 3MB8A 1JEQB 2CFIA 1VSQA 4KMSA 2PMFA 4EF4A 3ZX4A 4OXNA 2LE0A 2PZAA 4B7XA 3AKZA 1Y4DE 2XBUA 2A9VA 2JC3A 3H04A 1OQAA 3OTGA 5E6UB 4KTTE 3C1OA 4YT4A 3AFOA 2X4LA 3DDCA 1OFHA 4NSNA 3VNSA 1G38A 3MTBA 4FNMA 2BFMA 4LGYA 4EB6A 4D02A 4HD8A 4RNCA 4DWJA 4KFUA 2ZIXA 2VPZA 5HF6A 3CG0A 3NONA 4V0RA 4PX9A 1ZIDA 3PPVA 3IOBA 3I2IA 2PEYA 2YICA 3WKCA 3OE4A 5AIAA 4WZAA 4ZK6A 1RAFA 5AKYA 5F2EA 1XQXA 4LHVA 2XUAA 4J0JA 1S1CA 2Q50A 1ZI9A 4QDJA 4U2CA 1YHYA 5BWCA 4I5FA 4AMYA 4FGUA 3DVQX 3K0BA 2V45A 1M1YE 2XPCA 2WHEA 1Z2NX 1W4LA 1A50B 1ELOA 3DP7A 4M1ZA 4ALJA 4NFYA 3ABOB 3C6KA 2AD5A 4JP2A 4JBYA 2C5LA 3FFBA 3HA2A 5AKLA 4KCGA 3MJHA 3SDZA 3EPLA 4N7RA 1NLUA 3AHDA 2WIJA 1ISHA 3EJ6A 5A2GA 1Y9DA 3QVMA 2I3DA 5FI5A 2ZM6B 4CMCA 2AD1A 3LQYA 1BJRE 2IPMA 4YBZA 3KP1A 2EGGA 1YFJA 1ANKA 3OIWA 2XYGA 1RQXA 1EUDB 3OZUA 3TJRA 1NQ5A 4YRRA 4B35A 1MC1A 3ND7A 4IKEA 1GDHA 7ADHA 2DWPA 2Y3IA 2Z09A 3X1XA 5HCNA 4MA0A 4F9GA 2CLOB 4YI5A 1LPNA 1NWHA 2AK2A 5GV8A 2EERA 3ZLVA 4KOAA 1A8IA 2BFAA 3JAMA 4EYSA 4TLDA 2NO5A 2ZDQA 5FFNA 3DEZA 3M6UA 4B3XA 1IQPA 1UJ4A 1H9BA 8GPBA 2DPLA 1L5SA 3FUUA 2AVNA 2R68A 4B84A 2PHZA 1YFKA 5TR9A 1OJ7A 5AKIA 4IV5A 4ER7A 1K7EB 1DTWA 2G5TA 2H1WA 4R8MA 4FCVA 4JSTA 2V7XA 4TXJA 1SELA 2FY8A 2JCXA 2KPOA 4B34A 1I80A 4RJLA 2FSFA 1CUGA 2Y77A 5F33A 3I4CA 1FS6A 3ORSA 1C3JA 2Q6VA 3E9RA 2YKGA 3C8MA 1MW9X 2PGLA 2PS1A 3A1DA 3F96A 4PIVA 4TQGA 4XQEA 5E4YA 5AR1A 3RNLA 4CIDA 5IZ4A 2W93A 1W8DA 2ZJ3A 5EYPA 1ZVVA 3Q3JB 1TZKA 3AERB 4ZO7A 1BD4A 5ALSA 1VP9A 1AGXA 2Q6LA 1H2ZA 5EIFA 3C7CB 4JT2A 3P2JA 1Q1NA 3OFVA 3ZE6A 3CURA 4M8IA 1D1PA 2P9FA 1E1DA 1UCFA 4RUKA 5L6MB 5AW9A 1U02A 3GVIA 2NQ8A 5H02A 2WOOA 4U39A 3EPHA 3P26A 1PR5A 2BM0A 4K9LA 8ATCA 2RH9B 2XIJA 3NU1A 3C8HA 3G0IA 3PF8A 1JAYA 4INPA 4CMEC 3N0RA 5DHRA 1E9DA 2AEJA 2EFHB 3F4BA 1EKXA 1Z6GA 3MXOA 2A3RA 1AKUA 4EHFA 4HMQA 4XH9B 4Z4FA 2PX8A 3P2KA 1V3UA 2NTJA 2KWIA 2KB0A 4RLFA 1YR6A 4WXMA 3UHOA 1JEDA 3MS4A 1SG0A 2PWAA 4A9AA 1PGNA 3HSKA 1RPAA 3VYSB 4R3UC 3PR1A 3FVTA 4YS6A 1XVAA 1MX1A 3LUJA 4Q47A 2WY2D 3UH0A 4U6SA 4R8KA 4YECA 1MEOA 1UZNA 4RKFA 1YC5A 3DEAA 4OJTA 2YDXA 5DI3B 5IKXA 4DR6B 1KI2A 1U8TA 3TB4A 4OD0A 4QOJA 4W82A 2E49A 4BCDA 1QQAA 1IEWA 4X9XA 4CQMD 3RC7A 1KI1A 1FSGA 2FETA 4BUJA 4FFBA 5TQ0B 1RXIA 4LKOA 3CLTC 4OMDA 2OKGA 3BA6A 4FN5A 3W5AA 4IMRA 4JASB 4TTJA 4DCCA 1UEIA 2ET6A 4KO4S 1WABA 4F4DA 5BVGB 2VHTA 3H5AA 1R15A 2WLTA 4F5WA 3ON5A 4DR1B 1UMDA 1B00A 1N6KA 3RFFA 1F48A 3ENNA 3KT6A 3ZXUB 1DPGA 1G3IA 4CIYA 1R5NA 3KBOA 5FI0B 1KA9H 1U2RA 5AJZA 2VTBB 2LDBA 4IDBA 5MN6A 2Q8NA 4DRYA 4MITA 1YXMA 2QVZX 2EBUA 3IVAA 5AFSA 2ZLBA 4JJ6A 3LT0A 2B4YA 2WUGA 3T9AA 1BTOA 1GQFA 3GRYA 3LPAA 1OBCA 4XASA 1MJHA 1SUCA 4Y3UA 1WUTA 3IHWA 4OK3A 4CG0A 3O1IC 1VHJA 3AW9A 3C5WP 4E4TA 1LGYA 1ZN8A 2QZZA 4MYHA 1GLNA 3L9WA 1R50A 1CETA 4UDNA 3P9NA 3QOXA 1Q0ZA 3CX4A 3KZVA 3AM5A 4XUGB 4TS1A 3LWZA 1PW5A 2CLFB 1XE3A 4E2ZA 3VISA 2ZUTA 3DTVA 4XQ9A 1ISPA 2I7XA 1QO0D 3CINA 3G1WA 3R7LA 3ET4A 3P9KA 4DM3A 5K8CA 4BXOB 2DZDA 1U0RA 4I08A 2QTGA 2QR2A 2ES4A 3FUWA 5EE9A 1OH8A 2EEZA 3PGLA 4Q1DA 3WWPA 1FE8A 3WZLA 4JUCA 3UJCA 1U81A 2IEGA 1UMBA 1AN9A 3QTBA 2R8XA 1HNZB 4BEJA 1Z6ZA 2EKLA 3CU5A 1P7PA 5A9TA 3SPXA 2XXJA 5F7ZA 5AIBA 4Y2RA 4DMLA 4EZEA 5JI3E 2QZJA 5FLEX 3BWCA 5M7EA 2JVIA 2P9BA 5EIWA 1MO5A 4LSGA 3BM5A 3KOUA 2E18A 3OQPA 4R1PA 3SN6A 2C88A 4FU0A 1TD9A 1RXEA 1QGED 2CC2A 2O05A 2CV2A 2Y8EA 2HCJB 1T36A 3UENA 2ORVA 4DLPA 1BS9A 3DBRB 3BOSA 5BSMA 3IIJA 4RGYA 2OZLA 5CW1A 1NMSA 3LHDA 2PYZA 3PJGA 4H4EA 1YB7A 2Q5OA 1UC5B 4QEZA 3N53A 2C2GA 5CMLA 4FZJA 2CB9A 4GVXA 4NMXB 4V2UA 1Y34E 1SCAA 3T38A 3L6RA 5C7IO 4HLDA 2IUTA 2BMFA 2I0FA 2Z9BA 4UBMA 2ROQA 3VYTB 5IRCD 1E3IA 3VSBA 3HI6A 3A8TA 3H5LA 3JQQA 4LYEA 2ZR0A 3HBMA 4CWAA 1YFLA 1AS3A 5CHEA 3I09A 3BMCA 2Z3WA 4DIKA 4P2GA 4PEVA 3FFXA 2XQKA 1V9LA 4DBZA 4ZCIA 3G2IA 3WIUA 2JDIA 3FNBA 4J1NA 2UYQA 5B6JA 3GLGB 1ATZA 4YGXB 3KOZA 1RLMA 2DPYA 3WHLA 1HLPA 3OO1A 3UAVA 2DFPA 4ZRDA 4H3KB 2XUGA 2G8NA 1SBQA 3QF7A 3TR0A 2WIFA 3OY2A 4YYZA 4C7JA 4UZEA 5IDXA 2X42A 2M6SA 1TMKA 4ZDKA 2PGAA 4ZYWA 5LCXA 2CHGA 5DYWA 3I9V6 1BDBA 3L06A 2VZ0A 3W5VA 3ISTA 2JJ2D 2O14A 3OZEA 4CEHA 4PAMA 1Y9EA 3OBIA 3RAGA 4PC6A 3TFWA 1S3IA 1QYCA 2GSDA 5EXPA 2B1IA 1E99A 3BIFA 1QH0A 2GARA 5GONB 4B3RB 3GJTA 3BBLA 3DVSX 2GEBA 3VVMA 2J0QA 3SLRA 5EIXA 2IL1A 1H23A 3S2GA 2Z2XA 3AJ9A 3R0VA 5K01A 1T0UA 3RSFA 1QHHB 3LSTA 3LVQE 4JUAA 1PFWA 5TQJA 4CTMA 2QT0A 2GM4A 1N2IA 4Q3AA 4Q00A 2A1TR 4D8VA 2XLBA 4HWSA 1PQUA 3ENZA 4F1KA 4AZTA 2NZWA 1X8KA 4MV9A 1J8MF 2HUPA 2PMBA 4XWYA 2X8JA 4KVAA 5B3JA 3JQEA 3V8MA 2VQFB 3J7AC 4Q0MA 2HSWA 4P7BA 3WIOA 2HA0A 1OTYA 1JV2B 1T4BA 3AR4A 4QT0A 1VJCA 4CT4B 2ACVA 4BWVA 3VPFA 5CCXA 1Q5PA 1IOZA 2WT8A 4KPUA 1SCNE 2XKBA 1XB2A 2C1EA 4FN4A 3CJTA 4OFXA 3KOWA 5F52A 2D7DA 1MKYA 4MV3A 4AUEA 3VJRA 2VNKA 2ZRMA 4Z9XA 1G42A 1DG9A 1ZM7A 4Q7LA 4V24A 3GEHA 4OHYA 1JIQA 3WNBA 4CT5A 1AU9A 3IC5A 3BCHA 2I7DA 3TO5A 2NTVA 3KEMA 4DUYB 3SFZA 4NH0A 2JLXA 1KZ6A 4I4IA 1ZMBA 4HDKB 1XMVA 4I8IA 3Q8KA 1UBNA 2BDTA 3OZFA 4UUPA 4RJKA 4DIBA 4FNAA 3NHLA 2A33A 4EGSA 2ERYA 4YHHB 1T5TA 3QWFA 4MPTA 5AW6A 1VI5A 3EA4A 1TPYA 1U0LA 3QE0A 4IQ0A 3TS1A 1OLSA 3AR7A 5F1YA 2PRJA 4GUAA 1O9BA 4URZR 5A4IS 3EIFA 1AMOA 1QV6A 3GEIA 4O2AF 1Z25A 3ZCXA 3GG2A 3UAGA 1MJNA 5C1PA 1O95C 2O4CA 5ALEA 2X1HA 3QBVA 1JEOA 4QQNA 1M1XB 1S96A 1ZCZA 2J4DA 3LP6A 3EFEA 5KAMA 4Q18A 2ZJ1A 1PZGA 3E3MA 3JD2A 1H5QA 1RIIA 1W4BA 3FSJX 5ALDA 1N57A 1OASA 5I45A 5JVDA 3KXKA 3VTKA 2JFPA 4UAVA 5G0TA 3RJZA 4EW6A 3ANTA 1JGTA 2H2FA 2QL9A 2H4FA 2X40A 1L4LA 1N9GA 1HE8B 4U00A 2I7TA 3CNHA 4D9EA 2Q07A 2PQ0A 4R5MA 3Q2IA 2Q29A 3QPBA 4EDHA 1YI0A 2A5YB 2H06A 3DKKA 2I87A 3KBBA 2BFBB 2BHTA 4KK3A 4IIJA 1ZXXA 4MW1A 2RHLA 3K4HA 1SULA 4FJ1A 3O6VA 4Q1AA 4V03A 1AQIA 4FI3C 1X13A 4Y2XA 3M8KA 4BASA 3K6SB 4BBAA 2DETA 3IIEA 2BGKA 2WVJA 4XYEA 1PGPA 2EWWA 2ZGVA 2QE6A 2PKEA 1LZKA 4P83A 5DW3A 1XZDA 1U2QA 2DJIA 3PVSA 2YC2C 4ZYVA 2IRWA 4JCCA 3UBTA 9ABPA 2YQ4A 3VR3A 4CEJB 2GZ3A 2C95A 1ZVQA 2PRZA 4UOEA 4A2PA 1E6EA 3BE5A 4BS9A 3PFCA 2QAGC 2AOVA 2D1YA 5ESDA 2EHDA 4QJ5A 3RVKA 1M6NA 4C7OB 4HP8A 2KQUA 3CN9A 2ZXFA 3R76A 4CPDA 5JZSA 2J8ZA 5ITZB 3MWDB 3TYXA 1KP2A 2IHVA 1CUVA 2OC4A 4L0CA 5DBEX 3U4GA 3W04A 4RAQA 3EBOA 2JFZA 4L8VA 5G0VA 3ZLBA 2ZRNA 5CB4F 3NJ8A 2ZJOA 4IRXA 5B57C 5CM8B 4R2LA 1J0XO 1QQTA 3QEKA 4EENA 1OXSC 1NJ5A 2V55B 2H5IA 5BWLA 4EI2A 5BXQC 5KSZA 3F46A 4RS4A 4E5MA 4RIFA 1XVVA 3PNLA 1G9TA 4C89A 5DLDA 4XB6B 1E9BA 4GKBA 1QH8B 2JRCA 2ZE5A 5FPTA 1YKSA 3R41A 1M2KA 1JMYA 1OBFO 2CNLA 3EIQA 2G82A 2IHUA 2HW8A 4ZEOA 5ALUA 2VXYA 3BWBA 1KMNA 2FW6A 3HL0A 3FKQA 1U6KA 1GGMA 3KR9A 3ZIAA 3C16C 2I55A 1D2AA 1V1RA 2WNIA 3PJFA 2C5FA 2X41A 4IVPA 4KFCA 2CLDX 2ZJ2A 4X66B 3TDKA 3FWNA 3ROTA 2F48A 3T5TA 1EGAA 3RG2A 2P4EA 3OKCA 4PYOA 4DV5B 3EGIA 4B3SB 2NLOA 2IUUA 1PEAA 4YWHA 3CNLA 3GN2A 3RIMA 3RYIA 1GPJA 1WB6A 3GHYA 3H9BA 4JP1A 2JGAA 4GOLD 1SVMA 4EIWA 3ORHA 2BL4A 4PXYA 4LWQA 4XM2A 4F3KA 4BLVA 3GLFA 2PAFA 1U8EA 3LFHA 3WQRA 6CHYA 1AD2A 4BP1A 4Q19A 4OU4A 2Y99A 3LP5A 3O95A 1W88B 1CYDA 4A27A 4C3UA 3H1TA 3SDSA 3LWNA 3L0YA 4NH4A 1RIFA 1U5AA 4FFLA 3ETLA 3FGPA 3E8MA 4KQJA 4RVUA 4L5BA 3NX4A 4INJA 3M9LA 4KMRA 3GFSA 2J3MA 3AFGA 1N1MA 4M98A 1TOAA 1L5KA 4LF8B 1RFLA 4ZXFA 1TJNA 2BR5A 1KZHA 4E2FA 2H17A 3PQDA 2C0CA 2QP9X 2XQJA 3R9XA 3HSYA 1W5AA 5CJJA 2X15A 2B2NA 1O4VA 4FSDA 2PGIA 1G41A 1Z6YA 4QDTA 1A5SB 4IHJB 4K1XA 1GTL1 3K2EA 4QO7A 4Y9RA 1NU8A 1X1CA 3VBEA 2A1IA 3S8MA 5EI5A 2QA5A 1S89A 2P90A 4XA8A 2FX2A 3D3QA 3FZYA 5A4AA 3NIDB 1UZMA 5BSTA 2HMYB 3JZIA 2TMGA 3A4VA 3W8EA 4KPEC 4BPBA 2ILVA 3EY9A 2O0HA 1QHGA 2X8WA 4CFYA 1XNHA 5FWDA 3AGQA 1J0DA 4ZCPA 3I6IA 4EB3A 3V1MA 4Z1OA 4GZMA 1UM9B 4ARIA 4P84A 4Y2TA 4GMFA 4NEGA 3DMRA 4GMKA 2YR0A 4L9AA 4MB0A 2JK0A 4NICA 4P7KA 3FRIA 3ZWNA 3TG8A 3NEAA 3PCXA 4BB6A 5JDIA 1PSDA 2WIAA 3N5KA 3UC9A 4UTNA 1X7XB 2AKYA 4RD4A 2NPOA 2F55A 2XH8A 1I7DA 2WDPA 4RVSA 4BWFB 1HY3A 2Q7XA 3V1TC 2HMUA 3K94A 1CQPA 1M54A 2QM8A 3E3NA 5K8TA 2PIAA 4M38A 1AZSC 4ZVOA 2EWVA 3RWOA 2X2PA 2GVZC 4V0NA 1OYVA 2XHEA 1EQ2A 4J16C 3TNFA 5JJ5A 3Q8MA 3PGVA 1J97A 4GM4A 1PL7A 2XVYA 4HDSB 2OMKA 3D2CA 2YHBA 4MR7B 3PGMA 5C8XA 2PMWB 4WI1A 1E1CB 4J2HA 3H5RA 4DKXA 2OTCA 1N3YA 1LI4A 4FFWA 3E7FA 3IVRA 5ALMA 4YPFA 5BP7A 5CT5A 1CZUA 4ED9A 1YJ5A 3GRKA 5I7HA 3CRMA 4NHEA 5K3AA 3K0FB 2WSSA 5BV1A 5KVAA 2BH9A 3GRCA 4HCJA 1DV2A 4CTKA 2XVXA 4C88A 1Z74A 2ZYSA 3FHTA 3TTXA 1VPTA 3G0OA 3HNOA 4WCFB 7REQA 3JCZA 2RGRA 3W5UA 2GS9A 3DZIA 4NOMA 5H0IA 3EXFA 3HBNA 5L4SA 3UAOA 2BD0A 1SUEA 4ZZ1A 1MV8A 3IEXA 2QORA 3M5DA 5KOYA 5BRNA 4NULA 2I33A 4A82A 1W6UA 2IYWA 4FD2A 1LB1B 1JILA 5B53A 4OYYA 2AN3A 1YR8A 4AD8A 5ELXA 3E5HA 1Y5RA 2NNWB 4I9NA 1ZWKA 5AD1A 3HVKA 5C34B 1Q1BA 1D6JA 2OZPA 2QE7A 5K3DA 4FYVA 4QOFA 1UBFA 3OWOA 4N5DA 5G4KB 3QOYA 2XE4A 4X44A 3TCKA 5A5VA 1VL8A 2H1LA 4NX2A 3JWJA 3INNA 1AZTA 2MU1A 3L0CA 4JGBA 3BMQA 2AG8A 2Q3DA 2WHPB 2V96A 3CT4A 3HB4X 2JI7A 3HKBB 1H2XA 3COYA 3UOGA 1VLJA 3K9FC 1BIFA 1QE5A 3DZBA 1W19A 2P9EA 2JD2A 4Z3OA 4ZYUA 1P44A 1QFJA 1DHTA 4XRGA 4QOIA 3KQKA 1N8SA 2OXEA 4JLOA 1NV8A 2LV8A 1CUHA 5I01A 1WSAA 5M34A 1N7JA 3FTPA 5K05A 1DELA 3HI4A 2BKAA 3M9WA 2VHEA 4J91A 4OJNA 5KKCA 1WUJS 2I1WA 1T6BY 1NA5A 3H5NA 1YQ9A 3SYKA 5JXGA 2QDKA 3MA0A 3TQOA 1D5CA 4WKPA 4DMFA 4C0KA 5A6SB 5LIRA 3RG8A 2YVLA 2DB3A 1P81A 3NAQA 2X1VA 3QQPA 2F62A 1SHJA 3BRWD 3DT9A 3GT7A 3V6LA 5HP4A 5BY2A 3AEQB 3BYZA 2W2QA 4ND3A 4FYPA 4Y0VA 3ZHZA 2WUFA 1I2MA 5KVQA 4PC3A 3WK5A 1YJ8A 1P2UA 5JAHA 3Q9SA 1W25A 4XGIA 3HS3A 4WA8A 2TMYA 3T4EA 3NHBA 3T9CA 3ZDZB 3C3DA 4D26A 1SCBA 3R6WA 1H1TA 1CNEA 4HADA 3GH1A 2B94A 2Q2VA 4PYNA 4MYDA 4XLLA 4HVAA 5LXTF 1C4WA 5HDQA 4JLJA 4CLRA 3L4BA 4ME6A 4JJ4A 1JEJA 3AEXA 3CZQA 1BHSA 4ENUA 4DUZB 4GKKB 2JVKA 3O0TA 3O4RA 4WXPA 5KHAA 1Q0SA 3M6LA 4RV9A 4XGNA 4DYVA 8ADHA 4PG5A 2YMQA 4GE3A 4JYMA 3UV3A 4K0KB 2F64A 1L4BA 4JJFA 4M8KA 5EZYB 4WK0B 3FOBA 3IT0A 5J4HA 4IIEA 3U4MA 3M2TA 1DGQA 3PRJA 4PZDA 1IN5A 2NUAB 4GNRA 4NPCA 5ENDA 3TECE 4WBNF 5ARBA 5L45A 2FR0A 2RC6A 1GTJ1 5KOJB 4CMHA 2Y1DA 5A7FA 3ZWAA 3GRZA 2PPLA 4BVLA 3WLPA 3L0ZA 4J2TA 3CR3C 1G63A 4C6RA 1DAEA 1MO4A 3R6DA 3CNQS 4QXMA 1YU9A 1ZGBA 3CG4A 4RQAA 5CA0B 3MCAA 3TLCA 2YZKA 3QYPA 2GZDA 3OE7D 3PQ7A 4G5YA 4HXEB 2MIIA 1CK4A 3I3SR 3HDTA 3JY6A 4KQ9A 4RPJA 1H3NA 2BZSA 2ICAA 4E1BA 2WE7A 3GQBB 4A8PA 2GLTA 1GNTA 4MB2A 3LY9A 2ZBPA 3ZCUA 4AS1A 3NEYA 3VU8A 1TRKA 2V6IA 3T7AA 4EB8A 3A1FA 1OZAA 2C3PA 3QGMA 7MDHA 5IJXA 3E58A 1V0JA 4CETA 5IYZA 1KVRA 3RODA 2OGUA 4D8XA 4LJRA 3ZD9A 5C5DA 2HXSA 2QIPA 2GA8A 5FOQA 1UPXA 3WV4A 3FJ1A 3CNOA 3S2SA 1PFQA 4EARA 4PZLA 3SEFA 3RUEA 4AAYA 1XTUA 1KAGA 5H80A 4BMVA 2VJMB 1JEEA 5T5QA 3PYLA 2NUTA 4LZWA 1RJ9B 4MKFA 1RM0A 1JQJC 4MVJG 5HFAA 4DSUA 1JG6A 4YRBA 5FTNA 5FUMA 3BTUA 1DBVO 1J07A 1ATIA 4AYXA 1YS4A 4ARZA 2VCEA 1J7KA 1RQLA 3INYA 1VG1A 3OQHA 2A5DA 1RRCA 3PUYA 3V1UA 4FLEA 4ZZIA 5KQSA 3WYCA 3HLKA 1HT1E 2E85A 5M5BA 1Y7PA 1LJLA 1EWYA 5B55A 2CD9A 4D3ZA 1SQGA 1GA6A 2VCYA 1D4AA 3COPA 3O4GA 5FEMA 1XZBA 1KK2A 4FOSA 4B4KA 1JZTA 3CX6A 1U1FA 1KXZA 4KWIA 1MRNA 3AJDA 1KARA 3R5XA 3RE1A 3SMQA 2X2EA 1K3UB 3ROQA 2FFQA 2OLEA 2RGGA 3I1JA 4PQEA 4YRZA 3QXGA 1IB0A 4O5AA 3SSNA 3L7OA 3ROXA 3MZ0A 1XRMA 3RM3A 4B4OA 3BPSA 4KIGA 4ECEA 3H5VA 2J6CA 3LQQA 5GPBA 4E14A 1FW6A 1ZU4A 3PTAA 3MJDA 4M1TA 4N3GA 2Q28A 3H87A 2PNFA 3EFOA 3GXBA 2CCGA 4UNNA 3QI7A 1ISJA 2PZJA 1Z8FA 3J81A 2H5LA 2QWXA 3HJCA 4EHBA 1L7BA 4REQB 1GPLA 6LDHA 5IJWA 2QTLA 1Y6GA 1CEQA 3G0CA 1EP3B 2OC9A 3DBIA 4G41A 5KOIA 1U0EA 1CQJA 4FMCF 3NOQA 4FNGA 1AO3A 3WQHA 2MSLA 3MSXA 3PBKA 1YRHA 4BMPB 1LLCA 1N2XA 5AUNB 1T9KA 1U8FO 5B7QA 3QITA 4AFNA 5JC8A 2DBVO 4LF7B 3UQYS 1GEGA 3K70B 2FA9A 2IU6A 1UQTA 3HCOA 4FHZA 2HEGA 2VDMB 3EZNA 3H9QA 3EMVA 4FYYA 2QM0A 4G2NA 4OHUA 4UNPA 5PNTA 3TW8A 5E6SA 4NP6A 1OLUB 5B3LA 4CM8A 2JJ8A 1HR0B 2PSDA 3D3WB 4MUFA 3DTYA 2H9AA 4MRVA 4RSHA 4WA7A 5FWXA 2RSLA 4KIUA 2ZJYA 2E4XA 2ID8A 2CL0X 4WE3A 2H48A 2HMTA 3D4LA 3GJSA 4GMXA 5FNVF 4K28A 4L5CA 1SXHA 4Y2UA 3FHLA 4UHKA 2ZS9A 4ZOBA 2W2NA 4EUSA 2ZTUA 1MNQA 3DDHA 3O1JC 1NI5A 2ZYRA 3GLKA 4JJ7A 1DKLA 4Z0PA 1NVWQ 1GVNB 3P4XA 3F9CA 2P5TB 3LDFA 4RD2A 3ZU5A 4AZ0A 1OA0A 5DDIP 3UPDA 2BF7A 1HUQA 3A9RA 4P38A 1WX1A 2HRRA 5E0OA 3A32A 5H3LA 5LL6P 5K99A 1Z8HA 2Y92A 4XR4A 3DE0X 2IHBA 3RB8A 4MMXB 1MC4A 1MRSA 3HABA 1E32A 4ACAA 3DLPX 8OHMA 5JMOA 4DDMA 2YN0A 5LN1A 3H4TA 4PVDA 4AN0A 5B3JC 2ATCA 4GI3A 1XO1A 4TM7A 2VF8A 2BGTA 3DZHA 1ZEJA 1ECBA 2HWUA 4HMOA 3IP6A 3NUGA 3WLLA 4JROA 1TL7C 2BE7A 5C18A 1CF4A 1VJRA 4PSUA 4YCJA 2NZ8A 3GJ0A 2C5GA 1O97C 1M2EA 4K9MA 2AZ4A 3W2EA 4OLBA 5CTJA 3B52X 2V7EA 4UEKA 4YP0A 1KZ1A 4ACBA 4AO7A 2QL6A 1OU4A 1P8AA 1ULHA 5BV0A 3VZSA 1UBGA 1RQ2A 4D8UA 5ADUS 1AK9A 2PKQP 1L5YA 2W6JD 2OORA 3H84A 3MWEB 3OO0A 3OJXA 1L7PA 3F5MA 4OHVA 4PANA 3KDPA 4KR2A 2OAGA 4IQ4A 2QJWA 4WKGA 2IT1A 2VL7A 4BNLA 2PFSA 4QUBA 4WY5A 1RSZA 1NI4B 1M7GA 1Z6AA 2WRZA 2DKOA 1F0KA 2I29A 4NBKA 4S1VA 3UGQA 1NG9A 1PFKA 3AESA 2BSQA 1IXZA 1TX4B 2Y76A 3E7PA 1Q11A 3ISJA 1JJVA 1IRIA 3N9IA 4PM4A 4HMPA 1WDLA 1A76A 2FX3A 2KJQA 2O2XA 2BGJA 2W6MA 2X9GA 3AFNA 3FNGA 4YRPA 4DMKA 4MDEA 1V6AA 4JCOA 1T43A 4M9UA 1HLDA 2DH5A 5C81A 3P71T 2GCOA 3UXHA 2YRFA 2Z3ZA 3OCXA 3VU9B 2YC4C 1J9ZA 1JG7A 3FPEA 1VIVA 1N5IA 4NDAA 3FR8A 4DLBA 2DUNA 3WNDA 4O0LA 4C78A 1XPRA 4CCYB 3I30X 1WNFA 3L6EA 1FSZA 4Y1FA 4XLTA 1XK7A 2A9FA 5LC1A 16PKA 3SX0A 1QANA 3SZLA 1LWNA 3UB3A 3QEMA 1SBTA 5EGSA 3DMPA 1AHHA 3RC3A 4TV9A 4Q9KA 4G1EB 2PX2A 4G2TA 1NF9A 2AXNA 3UY4A 5JS7A 1NLFA 3KTAB 2G7MC 1U2GA 3BAZA 3KB1A 4M0PA 3AR6A 4M8SA 4MUKA 4DRZA 4EA8A 4YT8A 3AZPA 1W7AA 2I4RA 2I91A 1EMDA 1TUGA 3OA0A 3R0IA 5E3HA 3HXQA 1H22A 1HLGA 4X20A 3TIXB 1W4RA 1ENPA 2AF3C 2Y1XA 3OTWA 2ZP1A 3WWOA 4QREA 3F1KA 1WMAA 4BNUA 3DAGA 4HYYA 2GETA 5BO5A 3W5CA 4JWKA 1HI9A 4DV2B 4CM9D 3V8PA 1WW8A 3DV2A 3LMKA 3G0HA 4BO1A 2CMKA 1AE1A 4NJEA 5FBLB 5FLYA 3UT5B 1XTTA 4I3GA 4B6OA 3FROA 3AIMA 3AEYA 3EEQA 2I4IA 5ALVA 2NUPA 4R51A 5EE1A 3DPIA 4L73A 4KYUA 4UMVA 5D6OA 1YC2A 1XAHA 4RORA 2EP7A 5A3RA 2JBWA 1RAHA 2ZI7A 4MQFB 4DBLE 3CT6A 1ML4A 2B30A 4DCVA 2CT8A 4B44A 3NKVA 1KYTA 1U9JA 2E4UA 3V4RA 3VKHA 2QVXX 3D9QX 3E2MA 3UCFA 3DR5A 5A6VA 4CZ2A 4PZ9A 2AIRA 1W4AA 2ILTA 3HKDA 1A95A 1QTNA 3BGSA 4QOHA 4WASA 5G1PA 4Q4LA 3DZGA 4JLPA 4MWSA 3RVPA 5EKXA 1EHIA 3L4SO 3A9UA 4KLZA 4EK9A 1EBFA 1L4HA 4QDOA 5CNMA 4EL5A 4IEEA 4MP6A 1EFRD 1L5MA 1PDWA 3VJLA 4D56A 2G07A 5AI9A 1X8JA 2G08A 3WGYA 4EPWA 5AVWA 2O8BA 1QGUB 4OXRA 4QHYA 3EA0A 1DZIA 1WA5A 1AF7A 2AUTA 2J9FB 3AU8A 2HNKA 4TQ9A 4LHEA 3VQTA 5CFQA 3V7UA 4MVJF 1AKMA 5BMVB 4YVFA 1CUWA 3WGVA 3GBVA 4GBMA 3PFBA 3DZCA 5LYJF 3IIMA 4Z6KA 3S99A 3U7GA 2M2IA 3NXSA 2IQIA 4R3NA 4B3HA 4ZHQF 1HKHA 2VHJA 3VJMA 5A0TA 3VO8A 2JEZA 2FP4A 2XIQA 3L49A 4PICA 4K9DA 5LP6F 1XMSA 2FFRA 2QYSA 2VZ9A 3S44A 4TWJA 4MUJA 2NU7A 3U49A 3K9CA 1OYYA 5LLSA 1TB4A 2OV3A 3NATA 2HA7A 4KFRA 3HPQA 2ZUEA 5EJ4A 1NF8A 1GXSA 2DT5A 5C35A 1U9ZA 3C15C 3G5UA 2E21A 4P0PB 4HX9A 3AILA 3RRNA 3T5GA 2HQRA 4KQ6A 4L4XA 5FT9A 3WGOA 4EAAA 1O96B 1HBJA 1S2GA 1TPZA 1U7WA 2K2WA 3G23A 1GU0A 4LA4A 2R3SA 4PNHA 4RKYA 4TX1A 4C2AA 1RS0A 4MYTA 3SLKA 1M2OA 1DOAA 4AJOA 3EN0A 3C41J 1A9ZA 3DOIA 4RMJA 1IEXA 1GR0A 2H08A 3RIYA 5KI6A 2P2DA 5GP1A 4EW3A 1VXRA 3ZWYA 1B6SA 3CUEF 4LMAA 2OCGA 4N3CA 4CKWA 2X0EA 4ZIRA 4B80A 4BMDA 1JN0A 1Q7RA 4GR4A 5DM70 4OA5A 4FX5A 3IVXA 3F6PA 3IO5A 4G0QA 2VDUE 3B7PA 1H2FA 3D8TA 1AKYA 4BQQA 1KP9A 2IXAA 2NU9A 2JIRA 2VDWB 5A0FA 4B3BA 2RHDA 2XADA 3C5CA 4PSKA 2PUEA 2R1TB 3GT3A 1VL1A 1C3OB 3WDSA 3U7JA 3QKTA 2J5RA 2C03A 3DE7X 1P4RA 1E1QA 3ICVA 2VSNA 2FMXA 4BV3A 1CUDA 1NXSA 3EZ9A 3IRUA 3P0EA 4F3CA 5BVHB 2HKIA 2W4QA 4JOSA 3WGMA 4RD0A 3ZWWA 1LLUA 3DNFA 4CLOA 1XTPA 3S55A 2D1SA 2FQ1A 4GYJA 4NV1A 3RU7A 1GAWA 1XRRA 2R7NA 2WDZA 4GOKA 1HL3A 3SMVA 8ABPA 2DE0X 3OIVA 4BVAA 4J07A 4Q1FA 5JCZA 5F76A 3EIWA 1O87A 2G88A 5JI2E 2MINB 1K6JA 1H0HA 3E1KA 3IKLA 3SSMA 3H13A 3A31A 3NRBA 3CO5A 3C4VA 5ED0A 5UKDA 1PTJA 5IJ9B 3ZZMA 3HH8A 1YFZA 2A5FA 2IXDA 4TLEA 3JALA 2IZ6A 3KFVA 1IXYA 2R60A 4HHEA 4C20A 1QLJA 3SQLA 4F5DA 5KNDH 2VEOA 1WXIA 1BD3A 4IS3A 4WESB 4O2BF 1CXZA 1OUMA 1FQOA 2WSBA 3DQZA 5J23A 4AF8A 1VHDA 2DAPA 3K35A 4REMA 4W63A 2AOWA 3PNBA 4MJLA 4ZOLB 3SXUA 2YJ3A 5MHTA 4JN6B 3WGNA 4N7MA 3HR7A 2VRNA 3WK7A 1XCMA 1ORVA 1NXWA 1QG6A 2IYUA 3H5WA 4GVPA 5REQA 1I1HA 2ABWA 2C57A 4NZMA 1RDFA 1YCDA 4X84A 3D8BA 4Y2PA 4FCWA 3I2HA 2Q1TA 3HZHA 2GEUA 3ASVA 2XUJA 3MJRA 1PV1A 4XX0A 4UNQA 2D2VA 2MSEB 4O4HF 3SS8A 5CCDA 1KXJA 3HG7A 4FLFA 5EUCA 3ZXYA 1Z56C 5K45A 3IPLA 4G4GA 3UMYA 1T6ZA 3GFQA 2E4VA 1DZ3A 1R10A 3IURA 5FADA 1O6FA 2R8YA 2QTVB 4X91A 4QHTA 4ILEA 1ZUNB 5AW8A 3HWRA 4N9QA 4QIHA 5DM4A 4MDYA 4AP5A 2E87A 5B4VA 2W5UA 3ZG6A 5ICMA 3BGVA 1UWCA 9LDBA 4ZVKA 9MHTA 3FE2A 3FMGA 2GBGA 3ZD7A 1WY7A 4AMUA 5JYDA 3SZOA 3WGTA 2JIOA 1JR2A 1FMLA 2R25B 2WAXA 3RFCA 4UTRA 4Z51A 2WA1A 1L5HA 2IZZA 3G59A 1PHRA 1KNXA 3UV7A 4LQLA 1L3IA 4RJ2A 3PXEA 1GFIA 1JX6A 2OGZA 4RHFA 2JGNA 3HUDA 3CR8A 4B2IA 3A6DA 4XB2A 1BXRA 3PXDA 3VDMA 2FHSA 4MS3B 1KZ9A 3SOPA 3I2JA 4U6NA 3RSLA 2F43A 4CYMA 4G1VA 4YMUA 2OFWA 3O9ZA 1IY2A 4DCOA 1C7QA 2XKAA 2R8OA 5AMXA 4IHAA 5LSAA 1OIVA 1E58A 3ADDA 5TMEA 3L7MA 4IDHA 3FD8A 3GLQA 1VFNA 2EFDB 4D44A 4F84A 3ZWDA 1IBMB 4BNKA 1MRZA 1IHUA 3HGMA 1UP4A 3I9NA 1BC5A 1OTXA 4JC8A 3SM3A 3OLXA 1U0FA 5CURA 5F7OA 3WWZA 1M76A 4R9NA 2VPQA 2ZSEA 4IH4A 4FCCA 4PTZA 3I73A 1IY1A 3AIOA 3DE5X 4IJ6A 4KO1S 4EWLA 2FUKA 1VG9B 1LH0A 2PD6A 3DA8A 2HOQA 3AHGA 2J08A 4QPZA 4B7UA 1SGWA 4I1IA 4BNJA 4I55A 1W1WA 3S81A 3HCNA 4WLEA 1Q1QA 4DFDA 3O4FA 3LBNA 1DKQA 4S2UA 5FL7D 4BFZA 4L7QA 1MABA 2JANA 4HQKA 3ANSA 4RK7A 1TYAE 4J0EA 2FN8A 4HRVA 4V38A 1J8FA 2WBLC 3IS3A 5AKKA 3ZGVA 1ZHHA 1RYNA 2P6MA 2RGBA 4ON9A 3S2EA 3TKYA 2QX9A 1A2QA 3GRFA 1T8YA 3FA2A 5TVGA 2SKCA 3BMNA 1XZQA 3L5OA 3TVDA 1EFVA 2J31A 3CXRA 3SU8A 2JLUA 1DUIA 3E82A 4XFKA 2DUMA 1ZL2A 3KQSA 2IS6A 1JU9A 2YIVX 4Q9DA 3VI3B 1NT4A 4QLAA 4JI2B 4ABTA 4YCMA 5DNAA 4A0FA 3PDUA 4UZFA 5AVOA 4ZCLA 4X65B 2YZMA 1U2PA 2IELA 4MPDA 1QQBA 1NM5A 1U7XA 1T0JB 3D7KA 3DULA 1G21B 4I1YA 1KJIA 3HADA 1HE4A 2XRMA 3DD5A 4WLOA 1K4YA 4B3MB 1L9XA 4H6WA 1CUCA 2OAQ1 2XUQA 1A2BA 2PKWA 2YJTD 3HYNA 3L6DA 2CJFA 2MDTA 2FR8C 4R69A 1S3FA 1SHKA 4PQYA 4U9HS 3QPDA 3DYBA 1XDWA 3KZKA 3HB7A 2O48X 1RHQA 5EJMA 1LTQA 1NUSA 1E2GA 1RMYA 3G5AA 1CIVA 2ZJAA 3K0AA 3KSMA 5DXAA 2V7TA 3GUVA 4IDFA 3SE7A 3PEEA 1BSVA 1UBOS 3DOOA 5DU2A 1DCKA 1QC5A 2BKXA 1ORHA 2WHYA 4HTFA 1GPBA 2W2VA 5B4TA 4TTRA 3NBKA 2JH3A 1B15A 3IA7A 4RDXA 1TDJA 2JRLA 2OO7A 1TQ6A 1RRVA 2C2OA 2F9MA 1P19A 2YV3A 2P41A 3RYFB 5IANA 4D9FA 4UTOA 2VYVD 2FPGA 1DG3A 2P3OA 2P9JA 5KYYA 2REBA 4LVUA 1AG9A 4RM3A 2QUKA 1RLOA 2RHOA 3I32A 3ZHOA 1OFUX 2RK4A 1Q7BA 2VVTA 4ASUD 2OOSA 2MHCA 2VH1A 3QVWA 1AY0A 1PR6A 4TMYA 4D46A 4GD3Q 2WAMA 1SHUX 3BWYA 4JEIA 4G9GA 3PQ2A 4I8XA 4DV1B 4MA4A 1D2EA 2OVBA 3OESA 4LJ7A 2OYCA 4RF5A 3GPCA 4ZVQA 5AUQA 3CZCA 4BFXA 5IAEA 2WIDA 3SD7A 3RF7A 2ZSJA 3KYCB 3AF2A 1Y5LA 2FN9A 3LGSA 1T5SA 3ETNA 3AV0B 5B7GA 3KQNA 1J90A 3T7JA 5JBNA 2WT9A 1EFPA 4L75A 5B1IA 5A3SA 4M9ZA 2JLRA 1I51A 3TNDA 1W35A 3RRYA 5E0KB 3PC7A 3ONEA 4KRGA 2I80A 3SEQA 4D80A 1XEXB 1H2YA 2LR0A 5K3FA 3DZFA 1RLJA 1I3OA 1KQGA 3IV6A 1J1UA 2IEYA 3QP9A 3D2LA 1WZEA 2PZMA 3NIGB 4X8OA 4KLNA 5DGCA 3U3KA 1YTLA 2VLIA 1KS9A 1QRDA 5T6MA 3CLVA 2NXJA 2W43A 3GEPA 1EXMA 2VPXA 3PP8A 4G26A 1FXWA 2WTBA 3HBAA 1GTMA 2JHPA 5H4HA 2B98A 3EPKA 4M89A 3I4LA 1JDVA 3DVRX 1N1DA 3ORRA 5C7OO 1SUDA 2HF9A 3RNOA 1IK4A 3UG6A 4I7EA 2P77A 1W73A 2ZULA 3KOMA 4X3CA 3CMMA 1E1NA 1FFCA 5GM1A 4QUAA 1F0NA 1F0YA 2ERCA 4ZO6A 5E7IA 5F23A 3GROA 1ECJA 2I2BA 2CUNA 4ZGWA 1WRBA 2FQYA 2JEYA 4YJFB 5A02A 2O59A 3E61A 2PUJA 3D1VA 2PIDA 2D2EA 3DAOA 4WK2B 5JPCA 1YZFA 2A0KA 1ISFA 4DSOA 3THXA 4KH0A 2BGGA 3O7WA 2FHPA 3F47A 2I7VA 5GIOE 2AJLI 4KE7A 4A26A 1P61B 4ADSG 3I5XA 4YK7A 4I4LA 1JF8A 4L76A 1JDJA 2ZI4A 3NHFA 4TLBA 3OT1B 1OXUA 3B70A 4H3HB 2BFDA 2LCIA 5DO9A 4WPGA 1KDZA 2EFGA 4DILA 3G2KA 2A0FA 1EK2A 2FZEA 1D0IA 2WVHA 2C4WA 3PQ5A 4NFSA 4TUYB 1CJUC 1WCYA 5TMPA 2RI1A 2CKDA 1T34A 4CLHA 4D4JA 4TMTA 3OJCA 5THXA 2GEFA 4J0CA 2C7VA 5EIAA 4EJ6A 2ZI3A 4UHCA 4QUKA 3PNQA 5JZVA 2E5LB 2GLXA 2HDHA 3IAUA 2X6TA 2DKNA 1QNFA 4V2IA 3R3ZA 4BLUA 5CBPA 5IULC 1HX7A 4HSGA 4WX2B 2OXCA 4G1UC 2CFTA 3TI9A 3R5KA 4N5IX 5EWMA 2OQRA 2Y1KA 5CH5A 3VPHA 1D0VA 3B1WA 4GSKA 2PVSA 2YMLA 1M72A 2EHJA 3EB9A 4HQ6A 4DPMA 4ZAGA 2W2LD 5B6IA 4CV1A 5JAUA 2ZRLA 4ZO8A 5JSZA 3QUCA 1SR8A 1KI3A 4JJAA 4UEWA 2A9OA 1C0PA 3VVCA 5CEJA 2AB0A 4PONA 4YUYA 4KXMA 1ENZA 1Z2PX 1N8TA 3HA3A 1DV1A 4MRPA 1SU6A 1KKUA 4UJ5A 4WERA 2AXPA 3LC1O 3RHTA 1AQYA 4KNYA 5AQEA 3ELYA 4PZUA 3ZI0A 1EVIA 1VIDA 4OM7A 3TOZA 2B21A 1PAUA 3EWSA 1COWA 1MU0A 1PCXA 1LRLA 2VJCA 4FFSA 4MIYA 1CF9A 2R7KA 1CDOA 3EOBI 3KVRA 1FXSA 1YUBA 4UJ3A 3V7WA 5KBYA 2AS0A 1TVKB 4E5DA 3K09A 5FTLA 1YVPA 1KMMA 1A9QA 4LHZA 4OXKA 3A9SA 2HDWA 4ZMRA 4EYGA 3DE6X 3HB9A 1HYEA 4LY6A 4HNUA 1N1GA 3DTNA 2HFKA 2OT3B 4G01B 2VK1A 3PPWA 3K5PA 4N5MA 4BMOB 5BW6B 4FHEA 1BCRA 1RRGA 2Q41A 4G0WA 4BNIA 1Z63A 2HIGA 4GMGA 4KTVE 4FYIA 3WGZA 2OORC 1YOVB 2Y66A 1WZIA 3FCOA 1ODJA 1THGA 1UZLA 2X5XA 5KOHB 1I33A 1XNJA 1Y37A 1FDTA 2AKAB 4QDZA 3DE1X 2P35A 3KUUA 2UVQA 3A2KA 2Y67A 3DEFA 5I7FA 1H3FA 4AWAA 2AQIA 4HQFA 5SYAA 4EAQA 3JR3A 5JMWA 3V2GA 3U44A 3CNNA 3K92A 1ZCBA 1EVLA 1PQWA 1A27A 3NDIA 1ABFA 3FDFA 3OCWA 5CLIA 1KK1A 2J32A 4XUCA 3CTMA 4OQDA 5DHFA 1ZCAA 1ZOIA 2J33A 2P0YA 3VC7A 4BO7A 5K8LA 3CSDA 3RRZA 5JC1A 2H92A 1E4VA 1B6TA 3U9LA 3G79A 3R3SA 4TZTA 3RS2A 1DOHA 4AUNA 1DINA 2INGX 1XELA 3LWBA 2GD1O 2V59A 3GLHE 3OZGA 4RZIA 3WHKA 2NO9A 3C6ZA 4RIGA 4BZZA 1QCDA 2Q5JA 3FWHA 4HNAA 3IVGA 3H9EO 2ORED 5EPOA 2P78A 2R4QA 3C6QA 5CB0A 1JKXA 4DEYA 4K87A 4TTQA 4PSAA 3IKMB 5KNCA 1K06A 4M83A 2EBWA 4WBXC 4CHTA 2HWWA 1U2GC 4LVNA 1IQUA 4JT8A 1SBYA 4NCHA 2IYSA 4DARA 4TLAA 4KJZA 4QKQA 3EK2A 3G7UA 1UBSB 2A4KA 3W2GA 5GJWC 4XCQA 5IUJC 1JIJA 1T8SA 1GGHA 3CJRA 2X0KA 3L77A 4CUJA 2RGWA 1J2UA 1H1LB 2AI1A 2OV2A 1C3EA 2J5KA 2P69A 3EIOA 3DF7A 3IT2A 3OPVA 4JA0A 4RJJA 3T5MA 4BGDA 1FUEA 1AS2A 1E2PA 1NZDA 1XN1A 5FV7A 1K6IA 5FR1A 5HXAA 5K7SA 2QBYA 1F51E 3DBLB 2O3TA 1R0XA 3TIIA 5JQGF 2D2IA 5J5VA 3KYJB 4W5OA 3P9SA 3A1SA 5JSUA 1PGJA 3B85A 1BJTA 2YZGA 1KJ8A 3EG5A 3KT0A 3VHQA 1EWVA 2C1XA 3U26A 1P4JA 1YGYA 1ZJ6A 2DPMA 3GD5A 1KTVA 3PFIA 1QGYA 2VQ3A 2ZVQX 4MZXA 3ZHCA 3IULA 3ZKWA 4YUWA 1B7GO 1WOMA 1ZM2A 2VAVA 4H6XA 5TGZA 1GT6A 2R96A 2W2XA 2QSJA 5ERGB 4LJ5A 2AG0A 2AFIE 2GJ4A 5JSKA 2HDOA 4QBHA 3BJMA 3FMFA 4LXXA 5EIBD 5HRCA 3HJBA 2F8LA 1FB5A 2VRBA 3IUQA 3N8NA 3PE6A 5JNWA 1DE0A 4YHBA 3BMOB 2J0EA 1NKTA 1EBBA 2R86A 2X0RA 5D2CA 1Z5WA 2WWFA 2V0GA 4QDKA 5EQFA 1WV0A 2GYUA 4FGKA 2PUWA 4CR8A 3IIIA 5G4LA 4WXRA 4EEXA 3AI2A 4H7KA 2WIGA 1CVRA 1SQ6A 3B38A 5TF4A 3HNRA 1Q3KA 4JL5A 3AR8A 3PS9A 2V65A 3PRHA 3F4KA 2I22A 4A23A 1V47A 1QS0A 5J2TB 2PU5A 1XRLA 3GFRA 3R0JA 1L5FA 3EXHB 1KEWA 3ILXA 3GYBA 4I1UA 2JIMA 5JNSA 1KEEA 4A3SA 4CFZA 3S5JA 5C4MA 2P40A 3B9PA 1RWOA 1WEKA 4EG5A 5JLAA 1U3CA 2GCEA 2HREA 4MWCA 4GDFA 2GEJA 5AHOA 5J4KA 1M0EA 2MSWA 5CT8A 4GEKA 5JRZA 1OXXK 4PPYA 2XWBF 2G09A 1E6KA 2PGJA 2HCRA 3A2MA 1L4YA 1A82A 5BSHA 2P7HA 5TC4A 1U7UA 4ZJYA 2M6LA 4DLRA 1EUZA 5JMTA 1SBIA 1VG0B 4ZI7A 4WVFA 1QIEA 1RYDA 3AKYA 1LDGA 3BH7A 4V39A 4Q21A 4J7CA 2XQIA 5GWXA 5CFZA 4WJZA 5LZ5A 2OLJA 3SVZA 1PLKA 2NU6B 2XV1A 1JLKA 2Q7DA 4KB5A 3HE3A 4E11A 3OLVA 4MUIA 1R12A 4EG4A 2NVBA 2I54A 3TLGB 4BQRA 3ZU3A 3L92A 4NOJA 4Y8VA 3OWXA 5TX7A 1DIRA 2G9RA 3OFNA 4KE6A 2XDQB 2CE2X 4MQMA 2FSHA 2QN2A 3RANA 1IDOA 4LZLA 3TGPA 4EUFA 5I7EA 3RC9A 1GU7A 3P0IA 4J0GA 2DH6A 3E4DA 1TEVA 3HO6A 3HXTA 5JO0A 4P0QB 1BEZA 1CE8A 3OTHA 2NT3A 3CV3A 3MLAA 3TLJA 2NMVA 1OHHA 2CSUA 4TTPA 1MX3A 1XCPA 1MX5A 1R4NB 1VE9A 5J5AA 1OROA 2W9XA 3LPCA 5EXSA 1USUA 4Z7NB 2SECE 5GMOA 3FF1A 3BT7A 4D4HA 3FCCA 3VVLA 2IGTA 4LRUA 1YZ3A 1DXOA 3UAZA 1D8AA 5JD6A 5TVKA 2ZE8A 5KTMA 2AC7A 1LK0A 1KI7A 4IDQA 5KEIA 1A5ZA 4QXAA 2FPPB 5BN4B 3TEMA 4CDRA 5BR7A 3LX6A 1A96A 3O26A 2GJKA 4JB0A 4RKQA 1YZUA 1WPGA 2ZRFA 3QXJA 4OA8A 1SU8A 2Q1SA 3HRKA 4AT1A 1U3GA 4Y1RB 4RDCA 4S12A 2PRKA 5A9SA 5IFKA 2O5RA 3ZE7A 3W9YA 1I7NA 2ODNA 4GLJA 1DX4A 4NCJA 1MB3A 3TOCA 1JI3A 4Y2YA 3BGIA 4IGEA 4P5PA 3OIFA 4P36A 4QFMA 1IRXA 3LXMA 3OJWA 3IBTA 2NT4A 2D06A 1PTJC 2OZEA 2VT3A 2WTAA 4ID3A 3WSWA 2FWIA 3N8HA 4C3VA 4NYMR 5B1YA 2X9NA 3GFFA 2UVPA 3IAS1 4LYHA 5DNUA 1PHPA 3H05A 4CLXA 1QE3A 1QLHA 2NADA 4AXXA 2X77A 2F1JA 1N7GA 5J63A 1JSLA 2PWZA 4PPQA 3U7QA 4RFSB 1YO6A 4Z8YA 1E4EB 2I2WA 5IW8A 2VAPA 5LMUB 1UXHA 1P6XA 1R0LA 4ETIA 3AVVA 1L7MA 1M6HA 1VM6A 3ND6A 3E9EA 4JOCA 1OLOA 4EFKA 2XNKA 1WS6A 3PICA 2ZYDA 4C14A 4FI3F 1W36D 1DC7A 4LNHA 5B58C 2XXAA 3PWKA 2R62A 5FOUA 1OX4B 1VKJA 2IEBA 2XWQA 2G4LA 1GV1A 3EDYA 4H2DA 4IZ6A 4RHCA 5JARA 1RWQA 5K09A 3KT3A 4LX8A 5ALRA 3GLIB 4MWBA 121PA 3G68A 1ZISA 4FEAA 2R11A 3LSYA 2DR0A 2DPXA 4GYYA 4RDHA 4B73A 3QVVA 2B6HA 4GYKA 1VCOA 4DCTA 4O4IF 4DBLC 5IFLA 1PK8A 4WNAB 2OA0A 4RF4A 3MUNA 2FV8A 3ZWBA 2PBFA 3FFAA 3O2SB 2WTMA 3PUIA 4F45A 3DBHA 4FFNA 2ZWMA 1DFIA 3OCYA 2ZDGA 5K4AA 2V74B 3LX4A 4HNHA 2IP1A 1I7SB 4G5XA 1A9SA 2WPDA 2QENA 4L9SA 1FX0B 5C1IA 1VYVA 4AVYA 4Y6OA 4EMSA 3JARB 3WLOA 4J75A 1PEDA 1TYBE 2QX6A 4UE2A 4WFIA 3X3HA 3QLJA 4FUQA 3BN3A 4BMSA 4DANA 3O4JA 2OOKA 4UATA 3QY0A 3UOAB 2CFSA 3QPAA 3LCCA 4WN3A 1NPYA 2WABA 1H93A 1KC1A 1KGSA 2V9CA 3I12A 3JQ8A 5CDUA 2NX2A 1ZAYA 1Y8AA 3ADPA 3FM9A 1G2PA 1AV6A 3NJ4A 1WPQA 3FOEC 3SF8B 3FUTA 5BV7A 4FDUA 1N34B 4FFDA 4XJSA 4OM8A 4EVQA 5HQTA 4B7AA 4BX9A 5ARDA 3THOA 5ARCA 5CA1B 4JR0A 4LPKA 1IBCA 2FG7C 1WZUA 4BYMA 4EATA 1H85A 2ZJ4A 2O2IA 3A9TA 3AM4A 1II9A 1ZIPA 1ISSA 1YZHA 2JIBA 2VHZA 2CVOA 2GD0A 5HM8A 3S0JA 3JASB 1X7YB 3FDIA 2XUIA 4FW9A 4HAXA 1OB2A 5AWFC 1EPUA 4OL0A 1G2OA 2JGMA 4CMBA 2F00A 4YRQA 4F7DA 3TL6A 5KQRA 3JXEA 4Q05A 4XVCA 5FEUA 2RARA 3IEMA 5TLSA 1AKEA 2CY0A 2QN7A 4FSHA 3QU5A 1NBIA 4CKEA 1WCV1 1UXOA 5IZCA 3SQMA 2AOXA 3TD2A 1TGYA 3F7OA 4ZCRA 5JASA 2O2GA 4NPAA 3SR0A 2EG5A 3HLYA 2PO5A 1QVZA 4JLNA 3QLEA 4J43A 1MX9A 4H7IA 4L8WB 5GGXA 3TLBA 3A4LA 3KTFA 2VXCA 1G291 2AHOA 1EE9A 2H1IA 3H65A 3HFSA 4WT7A 5CT4A 5DM2A 4ER6A 2ZT7A 1SBZA 2XB4A 3PNSA 1IN6A 1KR5A 1V3QE 2GVDC 2PVPA 2QW1A 4L4SA 3FSGD 4A0QA 2XVZA 4O29A 1NM5C 2VXOA 4WGFA 2BZ0A 5E1OA 3UFBA 2GK7A 3BFKA 1YVDA 3R0XA 4MNTA 1IIBA 4O8ZA 3KR1A 3AHIA 5F64A 2HV9A 3MWYW 2B4KA 2V7BA 1P5HA 1RVV1 1U8UA 5SZIA 1PT7A 1ZRSA 2BLLA 3IB3A 3CCFA 3UYKA 1O94A 2CJXA 1T35A 3LQKA 4JU9A 3RU3A 5KDDA 1NYRA 3DPUA 1O0SA 5EWJB