1Z9BA

Solution structure of the c1-subdomain of bacillus stearothermophilus translation initiation factor if2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
NEFELGTRGSSRVDLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Translation
molecule keywords Translation initiation factor IF-2
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 1z9bA01
1G7TA 3WBJA 3WBKA 1Z9BA 4KJZA 1G7SA 1G7RA 4N3NA 4N3GA
chains in the Genus database with same CATH superfamily
3ABZA 1AN9A 1GUYA 2JPDA 2X1VA 3PJRA 3ZDQA 2BD0A 2IX9A 2JCGA 4FNMA 1Q77A 3BN3A 2O8VA 1L5SA 4O4JF 3RUFA 3CH6A 4IIXA 4U7WA 3PVZA 2WINI 2I3GA 2WMNB 1Y1SA 4M22A 3IFSA 5H59A 1XDDA 1RWPA 1T6YA 4L6IA 4DIMA 4IOLA 4YYZA 4OIFA 3RJ5A 2XKJE 4JC0A 5BP7A 2Y2VA 5LQRA 1LCIA 4RKQA 3B52X 4NCKA 2ACWA 3DT6A 5G0UA 1SUCA 5THXA 4DEYA 4F1WA 3U26A 1OI2A 2DJIA 5A7HA 1Y7IA 4K6OA 1H2YA 2F59A 4FLEA 3KZNA 3T7AA 2ZBDA 4Q7EA 2ZSJA 1JEAA 1GGVA 4D4GA 5JZBA 4PTYA 1T8TA 1E6UA 1W94A 4RSRA 4RW0A 1XZPA 4UARA 3UJ8A 4E51A 4KQIA 1XNRB 3COWA 3QLEA 1W46A 1C7RA 3EF0A 3OJOA 3WK4A 4GXNA 4NYJR 2XUIA 4JWKA 1MX1A 1CBUA 1L4MA 4MMZB 4AF6A 4HDNB 1GN9A 4TKVB 2V1XA 5FWXA 1PDOA 5FXMA 4YC7A 2I9PA 2RC5A 4Q7JB 1RR6A 3NASA 1WVGA 1E8NA 3O75A 3PGA1 3EMKA 2V0GA 1N6HA 1R4NB 4ETNA 2JLZA 3ENVA 3GLGE 2Y4NA 1G9XA 2ANCA 5E6RA 1FFEA 1HMPA 3IUQA 4IX9A 3A06A 4RM3A 2GK7A 1M76A 5ALRA 3WHKA 4NPCA 1JSXA 3IO5A 5DDIP 1N7IA 3RSQA 1QF9A 1HE5A 3DUWA 1N6LA 2P6UA 3FJYA 4FYPA 3TLGA 1N5JA 2C58A 2WIFA 3TLXA 1WMDA 1FTQA 1I9CA 2WWIA 5KYUB 3N8GA 4U00A 3U2QA 4F5YA 1D04A 4ZVPA 3FCXA 1XKQA 2QORA 1USKA 5DCYA 4G07A 4FCTA 3TR5A 4V39A 4KR3A 4HF7A 5K0BA 2X5XA 3I1FA 1E9DA 1JV2B 2ECKA 3FZYA 4PX2A 3E23A 1GYRA 5A71A 2HIHA 5JH7F 4JNCA 1EUDB 2JGEA 5E0KB 3FRHA 1L9XA 1G8JA 2G7MC 3ICQB 1ZH8A 3VH3A 1GCAA 2A0FA 2XBUA 3DZDA 3I9MA 4LWOA 1JHZA 1K7SN 1PV4A 5ES3A 5KYWB 3NBQA 2Y0EA 4JYPA 1TQHA 1J2TA 2J6IA 4PHCA 1BQ4A 2I1QA 2LUOA 2W6OA 3DV9A 4QSHA 4DXDA 2M1XA 2ZYTX 4GPBA 1QOZA 2YXDA 1ESMA 1TK2A 3FWHA 3K4PA 4EFNA 4FGUA 1A8SA 2C9DA 2JD2A 1T4DA 3MLBA 4G8BA 4L6AA 3SK0A 1I94B 4DIEA 3GXOA 4UHBA 2Q2VA 4PZZA 2O7VA 4HZUB 2FN4A 2ZRHA 2VTEA 2JH9A 3OEWA 2QRJA 821PA 2WM8A 1NU8A 1NXPA 3FMGA 4OGFA 1Y8RB 5AR1A 4RACA 5F7JA 2WHQA 4M0CA 4BHTA 4DIUA 1DXQA 4AX8A 3A14A 4AS2A 1Z17A 5SICE 1V7ZA 3LPLA 1IONA 3L0CA 4WUTA 2C42A 3FSGA 3IOBA 5TE9A 2ZDQA 1ENYA 1N6OA 4UVHA 2ZB8A 1B43A 5AXAA 2VQ3A 3KWFA 3NOXA 4EY6A 4RJKA 4JFAA 1P18A 4BKOA 2BHTA 3UYLA 3O4HA 5K0EA 1N2CE 3BGOS 1FTYA 4YMIA 1WW8A 3BH7A 4QNRA 2W37A 1R8JA 2ZYRA 3IXQA 1P0PA 4ND8A 3VO2A 1KVTA 1XTZA 5F73A 1BDMA 1EFPA 5FTJA 2OV2A 1LDBA 3ED5A 4GHWA 1ORHA 2I8LA 3NORA 1LPAB 3D0QA 2GDZA 4GRIA 1BCRB 1J8DA 1SJ9A 1Y7TA 3D8NA 3D7KA 1KK3A 4IS3A 2XRYA 3QE3A 4UTOA 2B9VA 5CNJA 4EHJA 4MGHA 1V4VA 2H4XA 5E9JA 4J0CA 4ME6A 1C4KA 5JCOA 1L7EA 3FETA 4YRSA 4K9NA 1DC7A 1GGJA 1KWKA 3FPCA 2QMHA 2Y1FA 3BGIA 3H65A 1AHHA 1BWQA 4D9EA 3GG9A 3HR4A 1HF3A 3EA0A 3P0IA 4BNVA 2UVQA 1W93A 3DF7A 1DNPA 3LIPA 4EZBA 4ZJUA 1SVLA 1JFVA 4DR6B 1L4NA 2ZLBA 5CNKA 1UBUS 4BFZA 4B5KA 3F8WA 1H2HA 2NSYA 4J6EA 3Q5GA 2IHZA 4BGVA 1GNRA 4ZT7A 4L27A 4UHFA 1CZOA 1JPNA 1TAGA 3TSCA 1BTOA 2VJCA 3OBBA 5IS2A 4RTOA 4KRGA 5GGYA 5JZOA 2B99A 1ULZA 2G80A 2H63A 4O3MA 2C9CA 4EG8A 3SIWA 1EK1A 2A5YB 4ND3A 4YYEA 4ZTBA 4BP1A 2YRWA 3AF3A 3B8HA 2FPRA 3WDKA 1OI3A 1RHKA 2L17A 2LRHA 2H1OA 3MHTA 2I6UA 3LQQA 1QTQA 2QX4A 3FHOA 3FCAA 4DT1B 3RGWS 3LF1A 4B87A 3HA5A 1KDZA 4C01A 4CBVA 4ZYUA 1CEEA 5C2JB 2XDYA 3KLBA 5CDSA 4XX0B 5EJAA 1PFKA 3TNLA 2HYIC 1JI0A 1TZ2A 5JY1A 1BRMA 4I5EA 1D3AA 2ZQYA 1FRNA 4EPVA 3MD0A 2G83A 4YAKA 5C5EA 3WBFA 1VJ0A 2QN7A 3AC0A 3MS7A 1QYDA 2C7PA 3S44A 5CDUA 3MCUA 1J99A 2QN8A 1X7WA 4ZQFA 1DDGA 1OVMA 1VJRA 2IE0A 5BV1A 2VP0A 2WWVD 5AM3A 1CJTC 1P6XA 3R0JA 3DHVA 4NCAA 1P45A 2PUTA 3O1HB 4NJOA 5F4BA 1Q83A 3WE7A 4CM4B 1X80A 4R2LA 3NWOA 2X19A 3PLAE 2Y66A 1NVUQ 1ZI9A 2JCXA 3HXOA 3DLBA 2G0TA 1VYTA 1G7SA 3NZEA 1IZYA 3KYJB 2QRQA 2WUVA 4O0LA 4P3XA 3ZE8A 2UVDA 2N75A 1T35A 3LVFO 3N6RA 3HYSA 3ZY5A 3WFIA 4GBGA 2YOFA 2VOJA 4HYQA 4Y1FA 2JGDB 5AI5A 1IHOA 3VBEA 3R6TA 3VOAA 3L4KA 3BULA 3IJEB 2CXHA 3QUBA 4AS3A 3WAKA 3U6BA 1UBLS 2FEMA 3LVBA 3M81A 5DYTA 3DH0A 1J49A 2FKAA 2GZHA 3N70A 5U9CA 4P98A 4ED9A 3U19A 1U1GA 2W70A 4QRIA 2H7CA 4TKZA 3Q10A 4FSHA 4TS4A 4M76B 2Q4DA 1JR3E 4QFMA 4LGYA 2GFQA 3EDRA 1I30A 3B89A 5KO2A 5G1OA 3DLIA 3QY0A 3CR7A 4XQGA 2AF4C 2M32A 4QUBA 4ZQEA 3C7TA 2FOLA 2VT7A 2WJ3A 1OYWA 4RF2A 1ORDA 2CXRA 2W90A 2IHJA 3DL4A 1PQYA 4R9NA 3OJFA 2I80A 1DFIA 4M0LA 1I32A 1W2WB 1T1SA 2OFWA 1CT9A 3AR7A 5EXXA 1ANKA 3V3TA 1ZQ1A 1G4UR 4DLNA 1DZ3A 4M21A 4MWCA 1V8DA 1F6BA 3F49S 5GOTA 2ZI3A 4Y2HA 4B8WA 3MRXA 5C3UA 3GLFB 3MT0A 4UHJA 5TQJA 2JJ2A 1II8A 4FPXA 4G0QA 4MROA 3F97A 3HL4A 2IH2A 4K5QA 3HXLA 5FOXA 2AI2A 3DE3X 1G3IA 1W1UA 3C6KA 3OLWA 4YDSA 5JUWA 5KOHB 1YSCA 1JQAA 5K8VA 2HIMA 2ET6A 1YE5A 4G1EB 2IUUA 4AIRA 3WIUA 4CM8B 2W4QA 1RPZA 5LZ4A 1CQJA 4GL2A 3OIYA 1NTOA 1YC2A 2PZGA 4RZUA 1J20A 1LI7A 3UTCA 5B2FA 3B53X 3UJ7A 1BFUA 2F6RA 3M4JA 2HHHB 2ASEA 1CUGA 3R2JA 3ZWYA 1SBCA 4ZCIA 2AC7A 1CQIB 3G9ZA 1S8FA 1NQOA 2RAUA 2NUPB 2XMBA 5J23A 3CEMA 3IOYA 5JFOA 1NT2A 4Z1OA 5F21A 3RC9A 2FZKA 3N7TA 3ZDEA 1GNPA 4XRRA 4AD8A 1QHNA 2Z8YA 3UYKA 2A5LA 2X2OA 2WSMA 3JS5A 4PU0A 4UJ5A 1SH7A 4XIYA 3IAS6 4ZKDA 2HJ9A 1QLWA 4JJIA 5MFZA 5THQA 1S96A 2FCRA 2QRKA 4C3ZA 2QXYA 4PBSA 4FN4A 2Q9BA 4TT3D 1G8GA 3OEYA 4P83A 1J1UA 2D1SA 1J2RA 2YS6A 5NLLA 3F74A 3N8DA 4F3RA 2C9ZA 5KCZA 1FOEB 3P9ZA 1KRXA 3PHHA 3ZNQA 4I1PA 4YTEA 2KLBA 3ANMA 1Q16A 4HPXB 4QJ3A 3FOBA 1E1MA 2QIOA 3FBWA 2ZJZA 4OB7A 5KJCA 2HF2A 2I2FA 5T4FA 5KHLB 3TFOA 3Q3VA 1QGED 3MWEB 2LWIA 1KSJA 3B6MA 1DDOA 5CPBA 3SZMA 3TQQA 5EWJB 1EVLA 2IH5A 1XR3A 1CW2B 3H2HA 5JNSA 1ZI8A 2DRIA 4E1AA 1T4CB 1FU8A 1EJ6A 2H4JA 3DDNA 3QMMA 5KYNA 2OCGA 4UM7A 3G2QA 1TM4E 3D6AA 2WYHA 2MYTA 1GHTA 2YXLA 3D2BA 4GM4A 4CM5A 3KQKA 3FUCA 4HZGA 2BFAA 4OQNA 4YAJA 1YMUA 3T41A 1W4RA 2DQZA 2XTAA 3PEWA 1BXGA 1ZAKA 1L7XA 1IM2A 2GYYA 1H2EA 2CT8A 1SIBE 4Q24A 4I8XA 1XO1A 2QWXA 1L9KA 4FMBB 1FP6A 1RC1A 3D02A 2WVAA 2IGTA 4REQA 4AJNA 2LIVA 2TS1A 1OU0A 1RBQA 2CCJA 1AURA 1XKXA 4PSKA 3LBHA 2JFZA 1ZPDA 3O92A 3ZY6A 2I4TA 3SC3A 4QDXA 1JWLA 3ICPA 3VDRA 4AMZA 1L5WA 4M37A 4A7PA 4C0BA 4OBXA 2OBNA 1DX6A 1UCFA 3LDGA 3TJMA 2WYUA 1A9ZA 2D00A 1Y3IA 1XYGA 4JZYA 1VPWA 3TG2A 2C9YA 1FYEA 3QXJA 2BBOA 3A4LA 5HFNA 1NURA 4TZ6A 3C8ZA 3WIOA 3ZNNA 2SBTA 1E1LA 5EL0A 2OD7A 3OM1A 3OZVA 1YZUA 3UUEA 3T95A 1OV4A 4YCCA 1UMBA 2RBEA 4EFKA 3TQFA 9ATCA 5DCUA 3GD7A 4BKMA 4QLAA 1WU7A 5HRAA 4IIVA 4FQ7A 3OJCA 5EIOA 4ZVKA 1RXWA 1RYFA 2H1HA 2OM2A 2VT3A 1HI9A 2LW7A 4KN9S 1DAHA 1VHQA 2JFBA 5FWYB 1MJGM 3ZV3A 5LN1A 1Y6QA 4US0R 3V55A 3LX6A 1QDEA 1UP4A 4IVRA 2I6XA 3NTVA 1XZ8A 1QYRA 3AR5A 3RYCB 2A3RA 2BBSA 1VGRA 4G65A 1RSZA 1BKYA 5AKZA 3UUWA 1WZNA 3UMVA 1UFVA 1XVUA 2VPXA 2X0DA 3DCYA 1AG9A 3DFUA 2EFJA 2H2FA 2OWDA 4UPVA 1CUXA 1NBEA 2KQUA 3IAM6 1P5RA 3L18A 5EWLB 3UOWA 4CT0A 3L4BC 1XAHA 1Y7LA 3EGOA 2GT1A 3KFXA 4WINA 3OA0A 3V2HA 3VUFA 2YN4A 2I33A 2CLIB 1C7FA 1YB7A 3ZGLA 5A9SB 3FPKA 1OVGA 1T8SA 3DLTA 4QUKA 1RQ2A 4EWLA 1UJNA 1LU9A 5L3SB 1FZTA 3VR2A 5L7TA 4KO3S 4NONA 1M33A 1X13A 2BEKA 3LA6A 2OXTA 2XRZA 3IVCA 4S1TA 4ER0A 2ODTX 2BOVA 2HSWA 3OE7D 3S2GA 3SX0A 5FI5A 3CVWA 1XG5A 2H06A 2QQGA 4CRWB 5ALLA 3SBEA 1FFDA 3G9XA 4IH1A 3DXFA 5EUQB 3G5LA 1J42A 5DI3A 3RBZA 1JLSA 3U4CA 2VDRB 3GWZA 4E6EA 4KMRA 2H11A 2G28A 1HM5A 4PIMA 4HVLA 1IHXA 1AKMA 1QH8A 5HM8A 5SV2A 4LA4A 1KRWA 1OIVA 4JLDA 4MAFA 2JNWA 3K8OE 1JEOA 1XZLA 3IVMA 1QIMA 1I0IA 1DKPA 4YP7A 1IUOA 1DBRA 1UKVY 1E7SA 2ZJFA 2ZJ4A 4JLPA 3A28A 5C8VA 1ESNA 1NVVQ 2DJ5A 3BZUA 3A3KA 3WGQA 2BEUA 1XEWX 4ZPXA 2P75A 1BA2A 2C0CA 4JSTA 5FNZA 4PE5B 1FVFA 5EERA 1TX4B 3O4VA 2HTFA 5D5HA 1ISPA 3K16A 5CRIA 3E48A 5FUYA 5ILOA 1W25A 3TUJC 5KNBA 4NCNA 1CYDA 4HDAA 4O33A 1DBSA 3GVPA 2C7VA 2NNLD 4UDYX 1GZ6A 4RULA 1CCWA 3CPHA 1JAYA 4UZEA 4ZAXA 5ADHA 5ICCA 3IDFA 2EQBA 3LGAA 3JWIA 1TIPA 3OTIA 4JGIA 4TQAA 4OB6A 3IKMB 1ZG3A 4ENRA 2A84A 4DADA 2A1IA 2QMYA 1N5RA 1IZZA 4IM7A 1Z25A 1SRRA 4TV9A 1G5FA 1KOFA 1ZOPA 1U3FA 3DB1A 4BNIA 1MFZA 3DKRA 4K9OA 3CJQA 5D51S 4D9BA 3WLAA 2NUBA 5K8UA 5TQ2B 4P7GA 2F48A 1XTVA 4K6GA 3V80A 1FW8A 1RWOA 4JQCA 4MGIR 3T61A 3DOHA 4JQZA 4C03A 2EGGA 1MB3A 1C0IA 2V8BA 4V0SA 3RFXA 3H2IA 3ECAA 4PSUA 4JV5B 2O2EA 1B1CA 1KYVA 1Q0UA 2OCLA 4V38A 4W82A 3DEHA 3UJCA 3WYBA 4WLUA 5DH9A 3C5HA 3LI2A 3TGLA 1G7CA 2JI8A 5F1YA 5M34A 3LS2A 3HCDA 4EUKA 1H5UA 4KVAA 5TQ0A 5LYJF 2EP8A 5ELXA 3ZVLA 2QU7A 4NCJA 16PKA 2IV3A 1T3GA 2DUUA 2P3LA 4AMBA 1QP7A 2IS4A 4HDRB 4MS4A 2IC5A 5GZ3A 1G0NA 1JKFA 3C2QA 1TTHA 1NX6A 1V1RA 3W6PA 4JBIA 2EF1A 5FNVA 3K9BA 3RYFA 1BH6A 3A2MA 1NJSA 2NTVA 1COWD 5EY5B 5IDVA 3EF1A 4C7BA 5FD8A 2WHPA 2WV9A 1XF9A 1UBMS 2K6GA 1OKKD 3KHSA 3EGWA 2F90A 1SOWA 4DTIA 3RUAA 5CM8B 4ZOCA 1PT9A 4BNYA 1MAHA 2WEKA 3LT1A 3IUYA 2HLDD 3AEXA 1EX1A 3R6WA 5LXTA 1CRQA 3F3MA 3QXCA 5CVJA 3V32A 3I5YA 1RPJA 2HHAA 1BMTA 1GEEA 2O8CB 1X0VA 3U37A 3LZCA 4E11A 1GPJA 1JWAB 5GONB 5KDLA 1XDBA 1NPDA 5C5CA 5I7EA 1GGEA 1OZ0A 2Y1KA 3FPSA 1KETA 4LBYA 4HWRA 4QARA 3ZHUA 2FPGB 1H4QA 1Q2UA 5IJ0B 1CIJA 4TVKA 1EFRD 3VVLA 3WKDA 2R8BA 1JVSA 1L7AA 3B2NA 4QDJA 1N0VC 1DKUA 3OWXA 1DIBA 2FSSA 4C2BA 5BUSA 3GLFE 2XZDA 2ZS9A 3SLGA 5L4LA 2DETA 3KD3A 4DCCA 3IHTA 4UULA 3CRQA 1XZKA 3V4VB 3EK2A 1KZHA 4MR9A 1ZKDA 3DDHA 2GN0A 2GQ0A 1RAAA 5F78A 5JRZA 1M1YE 2G8NA 1T2NA 4GRAA 3U7RA 2CNOA 4GIBA 4HXYA 4TLLB 1NFQA 4RIEA 4BRWA 3MMSA 2POCA 4JC5A 3EX7C 1IUPA 3UQYS 4N8SA 4EMUA 4Z4QA 1ZNQO 5JY6A 4W7IA 2FETA 1M1UA 3TXXA 1YI0A 4X00A 2CFOA 2Q1TA 3D4LA 3IP7A 3VU0A 1I0LA 4H16A 2GEVA 3UH0A 3EAFA 4U9UA 2NZYA 3AKDA 2QZJA 4GKBA 3AHDA 4R81A 3V6MA 1Y1KE 2FVYA 5JFTA 1A95A 1OAKA 1N1MA 2ZKLA 1JSLA 3NIDB 1RTTA 4WKPA 4JB8A 1EB9A 2MT9A 2RIRA 2GLUA 1FTNA 3H5OA 2A9QA 2XE6A 4PLWA 4WJKB 4BTVA 2ZRNA 4Z8YA 4KYVA 2HA7A 2WFLA 2VJKA 3AR2A 4OLFA 1GPH1 1SELA 3WL3A 4HO1X 1U1DA 1IMJA 4L1KA 1U2ZA 1P74A 4QT4A 2RB5A 3W5VA 4R01A 5AP9A 4RQBA 5D8DA 3ZNPA 2JLRA 1XFAA 1R8QA 3TX2A 1EWVA 4KV7A 2W6ID 5IVPA 2YHIB 1C7QA 1F2TA 1IG0A 4W5TA 4G4GA 4ILKA 2V3CC 2WKPA 3JV7A 3NFYA 4PC6A 2O20A 3USCS 3QYPA 1PQ4A 4XEUA 3H8VA 5H9VA 4EPRA 3D4PA 3PX7A 1O1YA 2JFOA 2XMSA 1PYOA 3H1GA 3E8XA 2OC4A 4X6XA 5JAZA 1YVRA 4E22A 1HRDA 4FW9A 4L3WA 2D2EA 3LYAA 2YZMA 4R3UC 1OH8A 3I5MA 1U2GA 2K2QB 4Y9UA 3FSJX 5EIBC 3CEJA 4DMUB 2RGUA 4OMUA 4HBZA 2CFIA 3U4GA 4GWGA 3BIFA 3JQ8A 1TLFA 2I1VB 3FUWA 3A6JA 5HRUA 4QPCA 3EXAA 5KJFA 2Z83A 3VDNB 4A8PA 4ARVA 2RE8A 1NLYA 3AUXA 1ATZA 3JYPA 3RK1A 4M89A 1ZIXA 2C83A 2W98A 3MERA 4QUDA 2QX8A 1X19A 4AI6A 1V11A 2C99A 2ACEA 2CHUA 1X7XB 3U7IA 3K05A 2VH2A 2I3ZA 1A5BB 4JVNA 3K32A 4R2IA 3AERB 4D5EA 4F46A 5M2QA 2PX6A 3H05A 2VI5A 3HEBA 4O1HA 1P2FA 2ZUUA 1H2XA 2XUKA 3KUKA 4Z1MA 3U7QB 5TMDA 1SUDA 1UIMA 2WW8A 4MPJA 1U7TA 5A5EA 1UAAA 4YO8A 1CY1A 4HDSB 4BNNA 1RLJA 3V1TC 2JW5A 4JJEA 2COKA 4O4LA 4YJ2B 5ALWA 4D42A 3NHLA 3V46A 4JR1A 2AZ4A 1KQGA 3VSEA 1N36B 1DO0A 3W5DA 1XMPA 4Q1VA 3GPLA 3ZIAD 3RU9A 2JGNA 4LDNA 2F1RA 4URWR 2J3JA 3DTVA 5BPFA 3GBSA 3K96A 1KERA 4RV4A 2OHGA 1A4UA 1VCNA 1D1SA 4P08A 5JOQA 4C7VA 1D0IA 3RTCA 1A7AA 1ONOA 1UPUA 3K5PA 4IHJB 4OM8A 4NEGA 1V47A 1NV8A 3KJFA 4V1CB 1LBQA 1YZQA 2ZJ0A 1IBSA 2DQ4A 3EEFA 2KE5A 4XVQA 3OCVA 2Z9BA 4QPJC 3ZLJA 3H5TA 5FTLA 2VNAA 2VIIA 3F98A 3FGNA 1MQ8B 2CE7A 1FCJA 3PTZA 1MF7A 1WPXA 3FMPB 4PF1A 4D44A 5KPDA 3AI2A 2HU7A 3BMXA 4B6OA 4NOLA 1T2CA 3FWYA 5IAAA 1GRCA 1R9NA 3B1FA 1LC0A 1YI8A 1KPIA 2ZYUX 3BK1A 3IQHX 4RANA 3UKOA 2GD0A 4TMFA 2WIAA 1U7UA 3FMFA 3GARA 4X92A 1HFWA 3R3VA 4L07A 4A2QA 1XMQB 1DJPA 1EQ2A 4IKEA 1L1RA 2CZGA 2BSQA 1WV0A 1PT8A 1E79A 4EG0A 2WUFA 1OXKB 4D45A 3HPQA 4YJ2F 1KAHA 1PS0A 3GJTA 4L9RA 4GC5A 3O8CA 3D81A 4W5JA 1RAFA 2H9IA 3GLIA 1U2SA 1RJEA 2KHZA 3L7KA 1ISRA 2W8BA 3IHWA 1QQ6A 4QU8A 1PUIA 4IJ5A 1PS8A 1DQYA 1ML3A 1FFCA 3W8EA 1A69A 5AQEA 1YZLA 5LWHA 5C52B 4RADA 3EIUA 1W29A 3AUTA 3E3MA 3OAAD 1IZ8A 1NJ5A 2QBYA 1ECJA 3TK1A 4Q4CA 4KUEA 1MBZA 3UHFA 3D4OA 2ZSDA 1XD2B 2HHCA 3H0CA 4AZ0B 2Y0CA 3O4FA 4MDHA 3SF8A 3KJQA 2F3SA 1HDRA 1N2BA 1QH1A 1YA4A 2FUG6 1X7WB 2DPGA 3L8MA 4AKHA 2Q8QA 3I58A 3V1NA 2GJKA 5JMWA 1SWWA 3T0GA 1J70A 3GJYA 2CB0A 2GTIA 2Q1SA 3DEYX 3ITNA 1M72A 1FLAA 2CMFA 2W2KA 3ITKA 5F1PA 8OHMA 3IKLA 1VL5A 1YRQA 1K92A 4X7RA 3NIBA 1XRJA 1CY6A 2OZLA 4HMPA 4PM4A 2PY6A 4MV1A 4FEEA 3ZWXA 2W9XA 3VRHA 4PC3A 4E07A 4RDIA 5L3ZA 1HURA 1KJZA 1RYZA 2B35A 4FBLA 3CZRA 4UEKA 1V2GA 4ACBA 2A9PA 5A03A 1YA8A 5JDIC 2XCOA 1T6ZA 1JLMA 2R25B 3QPWA 3JYQA 3K15A 2FHSA 1RYYA 1RC0A 4JJ7A 3AF5A 1DXOA 2UXCB 2HF9A 3TL6A 2W8BB 2FI1A 3KRTA 3HJAA 4HDRA 2EV9A 1PDVA 2DFTA 4O5AA 1B76A 3T9FA 2AXPA 5B1HA 2J9XB 5CA1A 4CR8A 1GZ7A 1B73A 1EVJA 3K53A 4I55A 2WTAA 5FBWB 1R4ZA 1Y1LA 4Y6QA 3MGAA 1AQIA 3RDPA 4R1SA 4N7RA 1JG6A 1VQ1A 4YQYA 2OV6A 1ESDA 2QZZA 1M1YA 1L1QA 2VP6A 3CM0A 4KMSA 4YR7A 1J25A 4N5MA 3KEFA 3L6OO 2HBZA 2VZ8A 4MAMA 4NENB 4RQAA 3ZUGA 4DIKA 1WCWA 1YH3A 1ID8A 2GK6A 3L7JA 5BYKA 1ULTA 4Z99A 3DC7A 3I0NA 2QENA 5KKNB 3ICVA 3DTNA 4MWEA 1I7PA 1KO1A 2QVCA 5AOVA 1Z0SA 1Y42X 3N2YA 3ANYB 4GQBA 4MW2A 2GERA 3O73A 2D5CA 1TYZA 4HMOA 3QVLA 1PDWA 3FNIA 3V8MA 1SQGA 3UXHA 2YHAA 3OUUA 1A7JA 3JWJA 2VA8A 4O4IF 1SCKA 1IY9A 3L3BA 3JWPA 2WU3A 1X7XA 4K9KA 4KPGA 5FEMA 1VHLA 1II9A 2BKAA 5AW9A 3GP5A 4F3YA 4OMFG 3GLUA 2Q29A 3BIOA 1RXCA 3U09A 4X24A 2ZXEA 1QV6A 4W5QA 4EHKA 3AIOA 1SQ5A 3HV2A 3UB2A 2BSAA 4L50A 4JBYA 2N47A 3W78A 1A8HA 3FW1A 1Q3TA 1TF7A 3O4IA 1NOJA 4X60A 1YZTA 2WFMA 1E2PA 2O6LA 5AVTA 2PWBA 4R1NA 3QBTA 2OCBA 1MPXA 3TKYA 1U3DA 4HFRA 4PWYA 2HA0A 3BZWA 3HS3A 4YP9A 3VJRA 2ZCUA 3ZZTA 4ZAGA 3GZNA 3BMCB 2FPUA 4G5YA 5KU7A 1AKNA 1Q7RA 2SHKA 2XIQA 2UZ1B 1PK8A 1ODCA 4KSYA 5ALGA 2C98A 1NJGA 4KXMA 4O4JB 4KOEC 3S99A 1Z2PX 1T2AA 1Z22A 3IHLA 2Q7XA 1NA5A 4DDHA 1PK7A 1GIAA 4POAA 3TCNA 4R83A 4MVJF 3UMMA 5I5EA 2WJGA 4TWZA 4QLOA 3LBIA 4MYTA 3WB1A 4ZREA 3DE6X 1AKYA 2A0KA 3D7SA 3GEIA 1GG2A 1KFKB 1KBOA 2P6MA 3I8SA 4HVCA 4G0PA 1FRQA 5CEEA 5EZYF 3P2MA 1QAQA 1KBZA 4I4LA 4Q9AA 5B12A 1RLTA 1SY7A 2PYIA 4JWTA 4A6EA 5M3BA 4B47A 4FGLA 4WJZA 1O0SA 1ECBA 2FMXA 3C70A 3MBOA 2AQKA 1X1BA 3PYLA 2QTNA 2XLBA 3R40A 3WGYA 4ADSG 1RBYA 3ESXA 2WJ4A 3VTKA 5E6SB 4QPZA 4DTCA 3E5NA 1ENPA 4X9XA 5I9NA 4JXXA 4QOHA 4M60A 2UZ3A 3ZWNA 2W2LD 1Y6RA 1ILEA 2FPSA 1VPDA 2DTDA 1SCJA 4XB2A 3V7YA 2IYWA 1Y4SA 1X42A 1PGPA 4RWEA 1US8A 1I36A 5IK2D 4WKNA 1U0JA 1EGMB 4LDQA 3MMNA 5FTMA 3STUA 5TLSA 4P35A 1LBSA 3KZMA 2J1LA 2I8AA 2WQ7A 3EUAA 5LJIA 4Q37A 1RWQA 1ISFA 3VZDA 2C2YA 1RWXA 4GVXA 4B2PA 4R69A 4YP0A 5KQPA 2YHIA 2O2HA 1DWUA 5KYYB 2XAAA 1NRXA 1T3LA 2VAMA 1Z7BA 3HMKA 2M98A 4RK6A 4R84A 1W4ZA 1CRLA 2P9EA 3Q1KA 4WZAE 5EJ6A 1J8FA 3S29A 2CFSA 1RLOA 5C8DA 3AU9A 4HH0A 4F6CA 2H2HA 4YBRA 1PV1A 3D0RA 2W6IA 3IB3A 2VDVE 4ZT3A 3HR8A 3K6SB 4MO2A 5KPJA 4MZDA 1AXEA 3PLNA 3HQ4O 1L8OA 4BO7A 4KQEA 1XTSA 2E4UA 4J0EA 1ND5A 4N5NA 1BCSB 4BKRA 3C3PA 2GPAA 1DUIA 2EGUA 1CIVA 1O5TA 1YZYA 3B1JA 2CMDA 4X54A 4DDWA 2VP5A 3K0AB 3SKVA 4ZARA 4HN9A 2BP7B 1VHTA 4Q7KA 5JT1A 4NCBA 4CI0B 1LF0A 3Q7IA 3DVAA 1IVNA 1AKQA 1R5NA 2NZVG 2NLOA 4J1TC 3K9WA 1PBNA 1JZTA 3OCJA 3JYNA 4PS0A 2QTLA 4PFKA 4FT2A 3O83A 2G9UA 4H7PA 1CZHA 1EESA 4KFRA 2J0EA 2IS1A 4QHYA 2Q4EA 4IEIA 3JAKB 1X7GA 2HSEA 3I2IA 4EIWA 4R71A 3HCAA 4N54A 1JJIA 1ORTA 2Y0BA 1F14A 2WHPB 3C7CB 3L0BA 1QFZA 3B6KA 4KSBA 4B4VA 1HEIA 1CETA 2BCJQ 2RHTA 1PL0A 1QR2A 4KNVA 4E14A 2R7AA 3VI3B 5C1PA 3I42A 1GFSA 3LVRE 3K30A 5ESDA 4POOA 4UFOA 3GFFA 4RZIA 1T4CA 1EX9A 3CIFA 4RHUA 3EQ9A 1N4DA 4FI3C 4NRDA 1W88B 2GPJA 1JX6A 1M6VA 2BBWA 2FK8A 3FDZA 5BQXA 4V0KA 3O9ZA 4C4YA 4EFMA 2CDAA 1HR0B 3GHHA 1YL7A 3AFOA 4DUZB 2O19A 4PG6A 2DZDA 2ZIWB 3FJ1A 5L6MB 5ALDA 2IGBA 3UXYA 1UZUA 4FHFA 5LKAA 1WNTA 2WG2A 1VLMA 4KO1S 1HDOA 2PZJA 3WISA 3X1MA 3EC7A 4BLOA 5BOVA 4FC7A 1K3UB 3DZIA 1X74A 1LSSA 1TDJA 1SVWA 4GPAA 2ZB7A 3KV1A 1XRNA 4P81A 1JJ7A 3EXHA 3A11A 3GRFA 3M3DA 4OHKA 3S4YA 3KELA 2ZQ5A 3WGHA 4DJ5X 4HQRA 4MZXA 4RE5A 3WGIA 1T4MA 1U0SY 2O9JA 5CP8A 5KJ6A 4OQ4A 2AK3A 3N2LA 8MHTA 2O0LA 2NU9A 4LF9B 3GROA 3D8SA 1WMSA 3GT4A 1RHQA 4ZAFA 1O95D 5E0OA 2DFKB 4DV4B 1U7ZA 4FSXA 2WYIA 2JLXA 3LY7A 4MJ7A 5JNTA 3F8SA 4B4OA 1FY2A 4K87A 3W6UA 5KC8A 1J7KA 1DKLA 5FA6A 3A26A 1ZSVA 3W9UA 2ZM6B 4CU5A 2JFPA 3GCGA 3T3GA 2W93A 3X1ZA 4EJSA 3W3AH 2IOYA 4FE7A 4MQEB 3ZZ0A 1XZEA 2E2WA 2O3TA 1KOJA 3PDWA 1TJ3A 3TEJA 3QBEA 3U7EB 3B1ZA 1ORRA 3B1XA 3BWXA 1DCMA 3I2JA 3RNLA 2VPPA 4PZUA 3CUYA 3UFXB 4ZYWA 1ZGGA 1SCDA 4B3TB 1JYFA 2B36A 2QT9A 2XZPA 3EPKA 5AESA 3GEHA 2PLAA 3PNYA 2XYVA 1GO2A 1SEPA 4IJMA 4H7JA 3VH2A 2RCYA 2AWNA 2M2IA 3S5UA 1VPTA 3OPYA 4JLVA 3WICA 2ZIUB 2CWDA 4HXGA 4MVJE 2H07A 3KAPA 4Z9AA 4G0OA 2LPMA 1E20A 3QV2A 3UMSA 4N0QA 3B1WA 4UD6A 5B3AA 4J7CA 2QG4A 4BFUA 1SCQA 3QHAA 4MVJM 4E09A 1CVLA 4ND2A 4U2KA 4UREA 3LOPA 5JZSA 1QVRA 1MAWA 4PNHA 3HCNA 4XLLA 3BTOA 3O31A 2OLJA 1QR6A 4GNKA 1E5TA 1PJSA 2HGSA 5C4MA 2DVMA 5C5DA 4JZKA 4LCBA 4YP1A 1PSWA 4GM1A 5BYJA 1JH9A 3AVVA 4CIBA 1N2CB 3ETJA 1DFGA 4KXYA 3AM4A 1E4YA 3ZDXB 2CN1A 3JZDA 1XGKA 3DNMA 4RVHA 2AEJA 3R5KA 3ZV6A 4E2YA 1PR2A 4L02A 3LX4A 3GFGA 2QSJA 2ZWPA 4QECA 1CUAA 1B2RA 1JIQA 5CLIA 7YASA 5EJ9A 5IUJC 2NSDA 1WVIA 2AG6A 2YN2A 2G4CA 1P9WA 1NBAA 3AUFA 1E3JA 4HS4A 3VHRA 1N77A 3QBDA 4YI3A 1VPLA 5CAEA 3FXAA 2OUKA 2ZPTX 3KPYA 2JCYA 3QI7A 2IQ5A 4S05A 5GONF 3I61A 1U63A 3VYRB 3BTVA 1BIFA 4NC9A 4AQYB 4UUMA 4RLQA 2B4YA 5ESRA 4QZVA 4IV8A 1F2UB 4YMHA 3KQVA 1HEYA 521PA 4DF3A 1G3QA 3EFBA 4PLPA 2RCNA 4D4KA 4LV5B 4MV5A 1DG3A 2W2XA 3F6CA 1FL9A 4ZDIA 4UBOA 2CL7X 2B61A 2Q5EA 1DU4A 2XBMA 3H99A 1CJBA 3EIXA 3WZMA 2O8CA 1I2BA 1U2GC 1SXHA 1A3CA 1U9YA 2BF7A 1V5GA 2G82A 3D2LA 3MIZA 2YHUA 4LGVA 4A4DA 4CDRA 4J0JA 1E1QA 1E2NA 1ZNZA 4KH1A 4L5JA 1II0A 3ZV7A 1KEVA 5EPEA 1PRYA 4GOLD 5BNIA 2P91A 2JFNA 3B5IA 2BEWB 3I6BA 3T3EA 4WW0A 1E96A 2W83A 5CLHA 4DDMA 1W88A 1GN8A 1PJ3A 1ZOIA 4FXOA 3MS4A 3REQA 3TSWA 3MCTA 1QGDA 3WLFA 3PS9A 1RMYA 5GADl 4DXAA 1W1WA 1YR6A 4I1OA 4WT7A 1X7YB 5CYFA 3RS4A 4U0JA 3QEOA 1MAUA 4TYMA 4P5PA 1GPLA 1RQXA 2QI9C 2H1VA 2HHLA 2IYFA 4DBLC 5LOVA 4GZMA 2ZIGA 1G21E 1MORA 5TQ0B 3VJMA 3GJ4A 2EQ5A 2PFSA 3BKWA 3W7AA 4DJTA 2YBDA 2IYPA 3IHKA 1EIWA 3MD9A 2ZBPA 1P17A 1DBWA 1H66A 2OUIA 1TUEA 4W63A 3PENA 1IVSA 3D8HA 4PBTA 4KDCA 3GLGB 2GN2A 3T5MA 4Q9IA 1B6GA 2QD3A 4IDCA 3H4VA 4CG0A 4LF7B 1A7KA 4C6TA 2WWYA 2AV6A 2WZQA 5KWVA 2ZR7A 2JANA 1Y98A 2A5JA 2Z9CA 4P38A 3VU9A 1SOAA 1JKJB 1KJYA 3EZNA 3LIIA 4JI8B 5LQCA 1C1DB 3SIXA 1CF9A 1XDZA 4DNOA 2QT0A 4KLNA 3VPXA 3BCHA 3IIJA 2GHTA 3OZIA 1NHWA 3NTUA 4REQB 1KARA 2HPAA 2I22A 4XI9A 5IPFA 5EE9A 3GD5A 2WC1A 3V4ZA 3VR0A 5DM70 2REQA 2AKYA 3CZ5A 3IYLW 2NT3A 1JHQA 4A0HA 1CY0A 4IH9A 5ECYA 3OPXA 5IF3A 5DM2A 2VPZA 2JRCA 3FKSD 3M6LA 2BH2A 4EZIA 1G8PA 3GFTA 4O5OA 3RI3A 2I9KA 1FX1A 1HSZA 2J7PD 5L7WA 1XZAA 4KIUA 3VSAA 4AW9A 4D9JA 1L4EA 1IK4A 2PX0A 2WF8A 3BB3A 5GY7A 5C53B 4W9MC 4A15A 2VYQA 3FE2A 3K9LA 4MW4A 3I0MA 4G8DA 3G8BA 1EGQA 4BVFA 1RYEA 1GWNA 1Z2DA 3H9GA 2R6AA 3WHPA 3PWTA 1QH8B 3DM5A 4WZAB 5JMPA 1JZQA 1QX3A 4C87A 1TEVA 4F6RA 3COJA 4AYXA 2HCJB 3S1SA 1NJFA 1RBMA 4C5AA 3K09C 1IAQA 3W4JA 2H4YA 3UB3A 4JYBA 3M4NA 5BW4A 5F52A 5I9BA 3MLAA 4OI1A 2DFLA 3ZJTA 4NI5A 3W9YA 1YS7A 1E2EA 3E3OA 5EUBA 4B7UA 4D9MA 3ZVNA 2R44A 1PJLA 2MIIA 4PS1A 1YT5A 3IPCA 1LVHA 2DWQA 2NZXA 3Q2IA 4TX1A 2IH4A 1C0KA 2R2AA 4IV0A 3LW7A 2P41A 1ZR4A 5EZYB 4HPJB 3I9OA 5H81A 3UCFA 5WRFA 1MW9X 4M9SA 5IKXA 4KXVA 4R7ZA 2ADMA 2D5AA 4WZAA 2IZOA 2IDMA 2YWJA 3QLJA 3U49A 3KEQA 2IOQA 1G7RA 2WFZA 4D9CA 3KQQA 3CKYA 4RETA 2OQRA 2VAPA 4H4CA 1J5XA 5GJBA 2VUHB 4CCWA 5BWBA 1IG3A 3EG5A 3B6ZA 6PFKA 5JXIA 5D6NA 2QDKA 3N59A 1BNCA 1YDWA 1BVHA 2NU8B 5B1EA 5J4HA 4BY9E 2PD3A 2YBEA 3LRXA 2QYOA 3P9NA 4MUFA 3U4MA 3RC1A 2HLHA 4BEJA 3P0RA 3A1NA 2BEVA 3CX6A 3FRIA 4LCEA 4QELA 4ZO7A 5H68A 3C6ZA 3R8CA 2X42A 3UG7A 3W06A 3GAMA 4IIDA 3IQDB 3J80A 4KXWA 4G1BA 3ZOZA 3KQLA 4AMGA 3Q8KA 5DLYA 1JGTA 1TCBA 1U31A 3AIKA 4UUQA 1Z5ZA 3DDOA 3WK5A 2R6GA 3EBOA 4WOBA 5AW4A 1QRAA 2C2BA 4BE7B 3PUVA 5AVJA 2NXJA 3RBAA 1KOLA 4J7XA 3ISVA 5THKA 4ZCMA 3FZNA 1EUQA 2PWYA 4MPDA 3H8JA 2C2ZA 1QYCA 4V1CI 3GV0A 2EU8A 3ONNA 5JFGA 1W8DA 3VZRA 2H2DA 2J0UA 4HAYA 4M1TA 4P2BA 1K6IA 4MIOA 5HQJA 4YRBA 4QGFA 2C3MA 4DGSA 3FHLA 4R98A 4OOFA 1UF9A 3R3HA 1M2KA 3IC5A 1VIVA 3DBOB 3KG2A 4RXMA 5FR1A 1R0BA 1RQPA 2V7PA 5TR9A 4EA6A 4UEQA 1ZC3A 1AE1A 4QDZA 2D3TA 2AN5A 2QUKA 3VH1A 4QT0A 4DT1A 3HYCA 5LL6P 4Y2TA 5I4IA 1K27A 1O7JA 3EVFA 3S1AB 3MG9A 5JSUA 3VKHA 5J63A 3QHPA 5K99A 1ZK0A 5LOVB 1LRJA 1RHJA 5T4HA 1VKJA 1ZITA 4H7FA 3RS2A 2Z5VA 5LA6A 2DECA 4RZQA 2OEPA 3IRVA 2BFEB 1T9HA 4PZEA 1XRPA 1F2DA 1YNOA 4HD8A 3T52A 1K8QA 2C4WA 3E0XA 4BKQA 1XP5A 2OD2A 4YRJA 4UXHA 4M0FA 4CKBB 2J8ZA 1PVOA 1XVVA 4PAMA 3IEVA 2QN3A 2WOJA 4X41A 3TMYA 4N0EA 3AILA 4ZVVA 3BD6A 4M1EA 4W5RA 1YCGA 3DEJA 4MKHA 1BO6A 4B09A 5AK4A 2V7QD 2OBBA 3PFGA 4HVAA 4HYTA 5G0TA 2E4ZA 2GFHA 3HB5X 4JBGA 1U0LA 1KEZA 4QULA 4F6LA 3K9GA 2JLSA 3GNTA 1NLMA 1U0NA 1AC5A 4AP9A 4DQVA 2GEFA 1L7DA 1MA3A 2WT4A 1E98A 1RLIA 1CDDA 3WIVA 2OO5C 4BUCA 2JKZA 2BTEA 5C7IO 1XK6A 4YLGA 4RTJA 3CVVA 1H2AS 2B7CA 1JEJA 3FYHA 5LLDA 4ZU3A 2JASA 1AXRA 2X4LA 3WX0A 5J5AA 3B9RA 5DK6A 1F38A 1T2EA 2P3SA 4XUDA 1K68A 1Q7GA 2AFIA 4LNHA 1IOVA 4KQ1A 1YS1X 3IP5A 1ZGCA 5KTNA 3RLIA 2OG1A 3MYRA 2JI9A 1TEXA 4RH0A 3C1AA 2O1XA 4R8LA 3TTYA 2CF6A 1X94A 3N5CA 5JANA 4IRUB 1WXXA 2BM8A 2IPNA 3LJKA 1WTCA 4FGKA 4XM1A 2BGGA 3LNTA 3K9NA 1LQTA 3PC4A 2P9HA 1Y48E 4FZ5A 5HZMA 2VXCA 5JBNA 5AFSA 5GZ6A 2R8RA 1XOIA 3BRWA 3OZEA 1HDZA 3B7GA 3TQOA 1EJ0A 1FW6A 3MUEA 2IZ1A 3Q2KA 5JAIA 4D3ZA 2FP3A 2WYWA 4REMA 4TL8A 4MB2A 3UFBA 4ZCRA 3TMKA 2O48X 4A9AA 5HTOA 1HYBA 3EB9A 1MUUA 1YONA 4KU4A 1CY2A 5KYXB 5B7QA 1QJCA 4J0QA 4E94A 3SZRA 3T7JA 4AYTA 4DHWA 2GO7A 4S1OA 4A6DA 1M2WA 3QFHA 4HWGA 3LYUA 4IKOA 3W6ZA 2RKOA 4AJHA 1F06A 4NG4A 1BX0A 2GTPA 4HTAA 1V96A 1YU6A 4FGJA 4BEWA 4CKZA 3DZFA 2ZVDA 3P9SA 3BC1A 2FY8A 1UAGA 2BEVB 1XT6A 4QYSA 1W85B 2C7BA 2POQX 2FOXA 4U2BA 1DP4A 3GFBA 5LZ2A 2QMEA 2ESRA 4TTTS 3BXFA 4YCAA 2AWOA 1Y4ZA 1QH0A 3ZNOA 4JOCA 1P3JA 1OFVA 2UVPB 2VDPB 1U1FA 3BMOA 3Q3EA 1RP1A 4NAVA 5JD5A 4QBIA 1OWLA 3AESB 3FOAA 4N7BA 4FHCA 3KLOA 4H17A 3CH4B 3MWYW 1F1BA 1LK7A 2QV7A 3W79A 1NKTA 1N0HA 3DTVB 2B6NA 4I8DA 1WP4A 3DTVD 2P9YA 4NYJQ 3GLIE 3OEHD 1ZDMA 1U3CA 2NU9B 2EBFX 2TSYB 3BL5A 4PPQA 3L06A 5IANA 2QMZA 2AUNA 2MYNA 3PEVA 3TO5A 3WFJA 1RCTE 4JT4A 1P91A 5HXAA 4EKIA 5BPHA 5CYGA 4HDQB 1EUCA 3KAJA 4J0GA 5BNFA 2XMCA 1MVLA 1RHMA 4PO8A 3GQBA 3Q15C 1B8VA 1EFVA 1EUDA 3RNOA 1L8AA 4XWOA 1GPBA 1ND6A 3DC2A 4A0RA 4AXBA 5JSZA 4R1UA 4DR3B 3HUTA 1PZFA 1AUOA 3Q3IA 4Z3KA 1Q7EA 1KZ7B 3FCYA 4H1HA 1T8UA 2RH5A 5A4IS 3PC6A 2FUG1 4OQQA 5BWLA 4XFKA 4YCLA 1C0LA 2YX1A 4WD3A 1F9AA 1TYEB 1V71A 1JFFA 4CLXA 2D59A 2ZZMA 2FJPA 3E1KA 1XZGA 3A3YA 1DLJA 1QO9A 3BFPA 4LYAA 3NV7A 3BCUA 4X65B 1MIOB 3LCUA 3WQSB 3M5DA 3R7FA 3MQ2A 4I4CA 4A3SA 3OT5A 5HGXA 1SHKA 3TOCA 1QWSA 1WHSB 4OVKA 2YW2A 1LS6A 3B48A 1CF2O 4OUKX 5HDQA 1TT7A 1ZGZA 2VCYA 3VR6H 1BWRA 1WU8A 4JDPA 2UU9B 3W04A 1R4NA 2XCUA 3CLTD 1BHJA 1KBQA 3EZXA 3PGVA 4HN4B 4IW3B 5CYPA 4LYFA 4A73A 1PKXA 5JLJA 3I28A 5LP6B 1F3OA 4A2PA 4Z5XA 1UP7A 3DOEA 2Q2NA 1LV7A 1Z2AA 2HZ7A 2CHFA 1SZDA 2WUDA 1M0SA 2R00C 3I72A 3KBOA 1Z15A 3Q1LA 4ALLA 3X44A 2YWDA 1R0LA 3LOQA 4PSCA 5AXBA 4DUYB 3ZDDA 1P9LA 4RHYA 2JAQA 3EARA 1YZVA 4YMTA 3H86A 2GLXA 1CUHA 4KDEA 1FYDA 3JD0A 4H3VA 3ND5A 1IOLA 1K5GA 3LUJA 3SZOA 1KY4A 4BX3A 1U6KA 3GO4A 2HW8A 3KKLA 1O08A 1H65A 2O3RA 4G6ZA 4I1VA 4DZZA 4NFSA 4E5UA 5FUXA 2Q7DA 1YIOA 3MAAC 1L4UA 4UM9D 4WOKA 5K6RA 1DAKA 1QIFA 3MJSA 5DNVA 1GAXA 2YDXA 4H6WA 4IGAA 5KSPA 3WLRA 5DM4A 5G0SA 4UU1A 2V59A 1K5PA 3E18A 3OFSA 1BCSA 5FI0B 4JSYA 5CHYA 1PU2A 5F1OA 5BSEA 5IDXA 4ABTA 4MRNA 1UBNA 1LW6E 4M1SA 4KNWA 2J3LA 1BN7A 2I67A 3OU7A 2FB9A 2OE2A 1KVRA 4UUBA 1PQUA 1JJBA 1RLMA 1C1HA 3BCRA 3AG5A 4FHGA 4B2IA 2L0XA 4TZTA 1ZOLA 1W5TA 4GAEA 2VOEA 1R74A 1MLDA 2BUCA 3A27A 4JS0A 2OCPA 4F3TA 1LPSA 2C3OA 2ZBFA 5L3VA 5AHXA 2FRDA 5KOIA 1S3SA 2QZSA 3ND8A 1T36B 1PGOA 4C9BA 2J6HA 7REQB 5DPMA 2XSZD 2WR8A 2QYHA 4M9RA 3UPUA 1TCUA 4M3NA 3TL3A 4LX0A 1KKLA 1S02A 3S2EA 1LPOA 2CJYA 3C1UA 1C8BA 2KW5A 4FP9A 3ZBTA 1JA1A 1HBJA 5C1DA 2ZIVB 2HMAA 3JTMA 3GT0A 4OHMA 4XQCA 5KYVA 4QRDA 3SEQA 3HHEA 1QQ5A 3TQSA 3QNMA 4EY3A 1I7DA 5G3YA 4FYWA 3GN1A 4LMRA 3K72B 1G6OA 2OCIA 1SVUA 4CI9A 3Q2OA 4O08A 2QPOA 5C1OA 3MUOA 4JQYA 1Z6QA 3AHIA 3VC1A 1MGPA 5BMOA 2O8FA 4AL4A 3HBLA 1DTSA 3DCJA 2DBQA 3GP3A 2VQEB 2AI3A 1A8UA 2XHZA 2VATA 4LZZA 4LSZA 2BMDA 2EBHX 3JCZA 3NRCA 1F9EA 3K1JA 3WIEA 4JJFA 1H6CA 2J09A 1CVRA 4WLOA 3K7EA 2P11A 3ROQA 3ST7A 1L5FA 3DOFA 1GY8A 1OLXB 1QIJA 2WJAA 4MIYA 1QH9A 2GYUA 1BDJA 1PFUA 1MIHA 1ZRHA 2H51A 5I7AA 4L4SA 2XWQA 1EK5A 2IOFK 1C1YA 3NV9A 1UJCA 1UH5A 3RFCA 4DBVO 3DO8A 1Q92A 1QQ7A 3F1LA 3H5VA 4CF7A 4P53A 5B3LA 2QJRA 3HYTA 2VRCD 2FPIA 3RHFA 4EKDA 1NC1A 4OI4A 1IXZA 4L6CA 1MO2A 1Z0JA 2CVPA 4CUKA 4DDVA 4CEJB 1W96A 5DNYB 2FN9A 1JFTA 1MABA 3QBJA 1Z4IA 4OMDA 5DNUA 1IN8A 1P0IA 4AX4A 3CX7A 1RPTA 1WXFA 3GK3A 5TNXA 1SHJA 5DWQA 1E3WA 5T3UA 3DXXA 3RK0A 4ICIA 1RQLA 5H02A 2MINB 5A4AA 5IJ9B 2SECE 1MRZA 3ASZA 3QLUC 4JBLA 2C29D 4Q18A 1X1QA 2VAVA 4B7XA 3UPTA 3W05A 2ZCJA 1ETUA 2GTHA 1J90A 1M73E 2W8ZA 4PZ9A 1E9AA 4CM3A 2ZJ6A 4CV1A 1IY1A 3KOOA 5IH7A 1XLWA 1YQWA 4KITB 2IITA 3LSYA 3EG9A 3B3QA 4QUIA 4AJLA 4DR5B 4C6TB 1SKBA 4U5XA 4CT4B 3KLPX 4QODA 5E7IA 5DM1A 2VO1A 4ZGGA 4L8YA 5IASA 2PQ2A 3EBPA 3VKGA 4RPJA 1OXBB 3UMFA 5CFPA 1XHFA 4TL7A 2EHDA 4BPBA 2QUHA 3MTIA 5U4XA 2J6BA 4K26A 3O21A 4JI5B 3EE6A 1LF5A 2EX1A 2WIKA 1GLNA 2V6FA 2LD4A 1VPVA 4DV3B 3WGUA 1CB0A 1CS0B 1LNSA 3C3AA 1TTPB 1PEDA 4I1SA 3TQRA 2JAUA 3EEYA 1ICEA 1GZSA 4AMYA 4H7DA 2HU8A 1K8YB 1B74A 3VKFA 1SKYB 1AJEA 3MEQA 1JYSA 1QKKA 4XD7D 3DVQX 2GSWA 1V8PA 4TS3A 2JGRA 4M36A 5GM2A 3PKIA 1VB3A 4LZWA 2CFTA 3K0KA 1X7DA 1BQ3A 1RXIA 4G4IA 4Y6GB 4D4IA 3J7TA 3KQSA 1DWQA 2ZOSA 2W42A 2EL7A 3ZXUB 3IQFA 1BZYA 2NVUA 1ZIOA 4YDRA 4Y9DA 2B8NA 2BKVA 2F64A 3QLVC 4QQ8A 3OZRA 1FQWA 2ZT8A 4B3BA 1LSJA 2V74B 2VHWA 3BL8A 5EUMA 1WMBA 2OZLB 1SG9A 2GMWA 2ZT6A 1ODIA 2JLUA 3RRZA 4TTAA 2HN9A 5ADVA 3HYLA 3OLCX 1W49A 5J58A 4J49A 1S0UA 2PPLA 4LK2A 4MRPA 4LRXA 3MWGA 5DXJA 2CGEA 2V54A 2GPTA 2A9VA 2X8JB 4Z0NA 3RT7A 2BBTA 3EQ7A 5C8YA 4BB5A 1NNLA 4ZMBA 1P1HA 4PSDA 3PQ3A 5HYVA 2VA9A 3HUFA 2PZKA 2CYBA 4IEFB 4JBNA 3A7DA 1K63A 1N6NA 5DBOA 3IBSA 5K4AA 2C4HA 4OUDA 1E5VA 2CYCA 2OORA 4LJ9A 9GPBA 1QCDA 2WRZA 3MTDA 4DLKA 3BXEA 4YPFA 3INTA 3PG5A 1P5HA 1NONA 1OZAA 1GNSA 1NASA 3R44A 4A36A 4GMKA 1PGNA 2WIDA 1XD9A 2FDXA 4W9NC 5JD6A 2I66A 2Z3ZA 1SMKA 3KUUA 4D0LB 4N48A 2LCFA 1G20A 2Z4TA 2Y1DA 3CLHA 3FTCA 4XGRA 1WCV1 4HG2A 4OA8A 4MB6A 1QKIA 4NPAA 2QZPA 4GECA 5EZ5A 3X2SA 2FX2A 4XARA 1QRTA 2E18A 1WLYA 1FFWA 1N9ZA 1G4HA 2O0HA 4X66B 1OWMA 5AVVA 2QE7D 3R9KA 5HRCA 3F9CA 2VXOA 1YVUA 2PX8A 5FUWA 4EPYA 5ED4A 1RAHA 4UEOA 3H5RA 1Q1GA 1Z6ZA 3QKTA 5AUNB 1J8MF 5F7OA 5JG7A 2GXUA 3H2GA 3B1YA 2DQSA 3O2NA 1Z38A 2F1OA 2OPHA 5C46F 1LXCA 5AM2A 3EMBA 4EEKA 4KR6A 4XEHA 3N76A 1UDXA 2C9OA 4PAQA 1M2GA 1WCIB 1HZZC 2QUAA 2UYCA 1E32A 3ER8A 1Z2OX 2GZSA 2H7XA 3KPJA 2CJWA 3W0LB 2VCEA 5IZCC 1E5QA 1UZMA 1Z73A 4L5BA 4OFWA 4FFSA 5CIYA 5A0VA 4MKIA 3ONFA 3F8TA 1P5FA 1B15A 3I04A 5FL7D 3IA7A 4HZIA 3PPWA 1G9TA 3NWBA 1P2VA 4MARA 5KTKA 1PSDA 1N6IA 1JU3A 2PXAA 3NAGA 4HDKA 3WDMA 5IAOA 1KVQA 1O5IA 4NXMB 4DQXA 2FPKA 4E5SA 4KQJA 2ZB3A 3PHJA 1U1EA 3AEQA 3LM8A 1HZJA 5CT5A 1V35A 5CA0B 3H6GA 2VYVD 4OV6B 4K0KB 1QX4A 2PGJA 2FQWA 4G81A 5JALA 1R64A 5T4BA 1Z2CA 1XTKA 4Q3EA 3CE6A 4XASA 4XSHA 1M6EX 3WLQA 1YRBA 4B3HA 5CCEA 1ZKMA 3DHYA 4O4LB 4YJ2A 1Y3CE 3R8FA 2ARKA 1F8FA 1V5FA 3AT1A 4BFTA 2XTZA 3T5TA 4ITUA 3FB4A 3TF5A 4YMGA 2EZUA 4MJXA 5JW6A 4JXKA 4FIDA 4U5QA 4EUSA 1K8RA 1RT9A 621PA 1OV6A 1DQPA 5J2UB 3EZ6A 3M4YA 1T0HB 3PNVA 4IYJA 1YCHA 5J2UA 3RS3A 1LDYA 1R18A 3EVGA 3GXBA 1N75A 3Q3HA 5DYGA 5F12A 4DMCA 2V6IA 4BB0A 4HBGA 1V11B 2YVQA 2VP9A 3HNPA 3ETHA 5DGCA 3ETCA 3TLYA 1EVKA 4EFDA 5CB8A 2MSEB 1H05A 1Y5MA 3HDVA 1D6JA 3P2KA 3RFUA 5CD1A 3E7FA 1A9QA 4Q48A 3ABOB 3ZEAA 2P4UA 4AURA 2HK7A 1E2MA 1PJ8A 2MMGA 3DV0A 3KUCA 2NG1A 1YS2X 4WNAA 1L5LA 1L5ZA 3NLLA 3ZS9A 5DN6A 1UK7A 4PRKA 3NWEA 1GNQA 4H3SA 4OI2A 1K08A 1VB5A 3IAHA 3DOOA 4KREA 2PLWA 2NPFA 3QTLA 4NYIQ 1BYIA 1RXYA 4WBSA 1FDVA 5AQ1A 3NKVA 1A2OA 5EOVA 5JEDA 3I3OA 4HAZA 4INOA 3U6KA 3NX4A 2IDKA 3AJ8A 4Z3OA 3EGXB 1Z74A 5E4JA 5C1IA 2Y9PB 3CFYA 1VYHA 3N58A 4CMGA 3KXDA 4W7HA 2EZ9A 1R37A 3RE1A 2P69A 3SP1A 2AMVA 3E7PA 1G8MA 3KVYA 2ZI7A 3EHDA 3F7NA 3B70A 4Q7LA 5C8XA 1UQRA 2ZJ2A 3IOMA 1T24A 2C2MA 3VO9A 3TG8A 1A9XB 1I3CA 2AJBA 2JBAA 1NMXA 1L5OA 4QFBA 4DSNA 2BP7A 3AGPA 3D1VA 1DUSA 2R7NA 1DAOA 3QFCA 1SG0A 2GASA 3W5HA 3R4CA 2P6RA 2C00A 3BBLA 3K31A 1E9VA 2FF5A 5GM1A 4C6RA 4L72A 2PLNA 1N5DA 2GB4A 2VTVA 2WTXA 1H0KA 3PZBA 3V4SA 5A7FA 1N2OA 3QELA 2R7KA 3TOXA 1DQSA 3AEZA 3E7DA 2CK3D 3UZUA 2BIFA 2FYTA 2SNIE 4B43A 2I4MA 4NZOA 3C87A 3HDJA 3QF7A 1KAMA 1KC3A 3DGEC 2ZUTA 1NG1A 3F5FA 2GETA 3ROTA 4MS3B 4X6YA 1HQCA 1XTTA 2PKWA 3TECE 5BN1A 2PSDA 3R5HA 1XQYA 3PUJA 4O2BB 1VIMA 5AVYA 1Y3HA 3F3SA 4CQLB 5LCXA 1JDTA 3KXPA 5IBCA 3THRA 3RF6A 1WDLA 4YV0A 3A6ZA 3DAHA 3ZIDA 2NO4A 2WWHA 4HNAA 4R8MA 1RHRA 1ZVMA 4AS1A 3D3NA 4NMWA 4TMWA 4UNQA 5G1PA 2OC9A 5FPHA 1QRSA 1E4VA 2AYXA 3HGTA 2J41A 4AULA 1NVEA 1D4OA 3QMPA 3AVTA 2JIZA 4P0TA 1JDZA 1ZK1A 4LVOA 2HAEA 3H9BA 4ZJPA 2HIAA 1XPRA 1BU8A 1I6WA 1LVUA 1OC4A 3EEQA 3H3FA 2FKNA 3A9TA 1UC4B 2FPGA 2P9CA 3EXIB 3PDUA 3D31A 2CD9A 4H15A 4ND7A 5FP0A 3LWZA 2X23A 3ONWA 1U7DA 2XNCA 3MTBA 4BMOB 1DC3A 1RRGA 3V9AA 3WSVA 4EMSA 1T5IA 4I4TB 3WKCA 3BCSA 4BNGA 1VLLA 2OZPA 3FKJA 3HCFA 4GLJA 2Q6LA 3HKDA 5ESWA 3UGJA 3D7RA 1I7LA 3CKMA 3DAPA 3PXXA 1HE2A 3C6MA 4U7FA 3HKBA 3M4XA 3OF3A 2GBGA 1ULAA 1WG8A 1PR1A 4GMDA 3C48A 4IOJA 4LJAA 2C95A 2HMYB 3LUFA 4O4JA 5G4KA 3CF2A 2VJYA 3QF4A 4M9UA 5G0WA 1KEPA 2H48A 5DHUA 4ZVTA 1DXHA 3EDCA 4JKIA 4ZCPA 2YY7A 2YQ5A 3A3OA 1DBQA 2FWPA 3PF9A 1P3Y1 4BJ5A 6Q21A 4Z4IA 1NXSA 4M4SA 4OGGA 4UCQA 2HPZA 1L5RA 1AK2A 1KZ9A 2O5RA 2YV2A 1Z4NA 3E5RA 3IESA 4GOJA 4NIMA 3ER6A 1PLJA 4PYOA 5EJFA 4YRLA 3HXQA 4DV0B 2J7PA 1BJTA 3E8SA 3U44A 1XN1A 1NR5A 1SKUA 2JL1A 2JA1A 4A82A 3PB3A 1A97A 1U2PA 3CW2A 4G5GA 4C43A 1AHNA 4PZLA 4QATA 3MJRA 5EPUA 1X14A 2RHCA 1N9GB 2ZM5A 2QYTA 3D6VA 4O2AF 1JDNA 3ZD7A 4QD3A 4WK0B 2UZIR 1BHO1 3TBHA 4N8EA 5DP1A 2D7DA 4B4UA 3UK0A 1J22A 2CXQA 4RTNA 2C77A 2Y1LA 3AP2A 5ALHA 4TL6A 3G79A 2VJQA 4M1ZA 2WHXA 4KOAA 6ADHA 2PU5A 1X9GA 2ORED 3DBRA 4V0MA 2C5FA 4C7MA 4U7GA 4YCDA 4AWAA 5CDFE 1MX5A 4KG7A 3F6RA 1J0DA 5COAA 1OYVA 2Z9DA 4I5FA 4U2CA 4CMCA 1EEHA 2LXNA 2WKQA 1D03A 2AOVA 3LMKA 5D7BA 4LFAB 3AWDA 4WDQA 1LI5A 3H4IA 1CKEA 1EE1A 4MVCA 1JG2A 1E1YA 1W4CA 3GDFA 3RVSA 4CUZA 4PX3A 4CN8A 1VL2A 5JCJD 3RANA 5SYAA 4H6VA 4KIJA 5JCJA 3DL7A 1OFIA 3BMQB 2Q0HA 2HMSA 2QRNA 1IIRA 5HA5A 3P45A 4Q3NA 1OWOA 3MFYA 4UMVA 4R0MA 1J4AA 1O8BA 4EK9A 4RFVA 3HB9A 2A58A 4O59O 1YASA 1UK8A 3IUEA 1KQOA 4Z49A 3ADKA 3F6SA 3BHIA 1LBHA 3ZWQA 3LUDA 4DCPA 4KVZA 1U2DC 1IY2A 4KAXA 3ROGA 5ENZA 4ZZ2A 3VR1A 1YC5A 1QFXA 5TXGA 3ZGOA 4BMZA 4EI8A 1P2GA 2VDLB 2GPSA 4L9AA 4DV2B 2CMKA 1O6BA 2QF7A 4FUQA 5AKHA 1JHOA 5DT9A 3HB0A 4MQFA 1UBJS 1DC8A 1JEYB 4MCHA 2X9VA 4O4IA 1QHIA 3GGPA 4LY6A 4YECA 2YHBA 3UNXA 2OENG 3BERA 5IT4A 4MUAA 3SEZA 5KYWA 1DEXA 4IZ6A 4K05A 3LPNA 1W5BA 2HJSA 3ZHYA 3QPBA 1Q0RA 3ER9A 1A2BA 1CUYA 2P40A 4ZOBA 4BASA 5K8IA 2PUAA 2EW2A 4Q9NA 3FHTA 4DR7B 2C8VA 3WHIA 3SHQA 1TVMA 4IQFA 2CW5A 2VXBA 1YQ9A 4TWJA 5TVGA 1JDJA 1PJ4A 2BGIA 4EYOA 1HQYE 3C3XA 3DE0X 5EXTA 2DP4E 3EXFB 2YJ3A 3JRNA 3JQFA 4L75A 3V4LA 2WMYA 5EHIA 1U94A 1KMQA 4NNJA 4CNQA 1IFXA 3ZWPA 1BW9B 2G5CA 5AT1A 1FUKA 2J4DA 3ZXIA 1Z0AA 4TT8A 3OJWA 4XGKA 1G41A 3VNUA 3FWPA 3HO8A 3RKUA 1OPRA 3JARA 3VX3A 3U4IA 4KV9A 4UTXA 4CMIB 2B5VA 3HR7A 5JS2A 4E5NA 5IM4A 1OWPA 1E61A 3ILXA 3UVEA 1P7ZA 1CEYA 4CNBA 3AF4A 3KT6A 3H9EO 3VPSA 4MA4A 2ERCA 4MVJP 2QXUA 3STXA 3RVNA 3BIXA 4G63A 3CKLA 4IMJB 4NBLA 4IIEA 1IWOA 1KHHA 1WXHA 3NH6A 3RAJA 3H87A 3V5NA 1T9BA 2X7HA 2ZU6A 1CUZA 3N3AC 5CMLA 2M6KA 3TR6A 5CITA 3AGQA 3ZS8A 5L3QA 4K9RA 2PVPA 4QHSA 2J3MA 3AVPA 4Z4GA 3ZKWA 3QGMA 5K0TA 4MDEA 4YHBA 3E61A 1MG5A 1AS2A 5IAKA 4E1VA 2HXSA 2DOKA 3I64A 4KDFA 4TWBA 1S8NA 4NNPA 1ZD9A 4XYMA 2WDZA 2BTQB 4F5DA 3AHJA 1QHFA 1RIFA 2YFQA 1V7QA 3K1AA 2YVAA 4HGNA 1T8RA 3PF8A 4J4BA 5LB2A 2QAJA 3HCPA 1XQ1A 4J43A 4I81A 3GGCA 4AK9A 4EHDA 3V7WA 5EE5B 4Q7QA 1TGVA 3QVOA 4HGQA 4P2GA 4QM6A 1XEWY 2F1HA 4XCQA 4LG1A 3F47A 3QKSA 2G88A 4TLAA 4C1BA 2FDCA 3SS7X 2HZBA 2VUSA 3RAEC 2IK8A 4KWCA 3OFNA 1QJ4A 3O94A 1D2CA 1UBEA 3PNMA 4XTCS 1NC3A 5TQ2A 3CO0S 1T0IA 2YXBA 3VTZA 5I7VA 1UZLA 2EDAA 3I1JA 5AIBA 3PX3A 2YIMA 2OMEA 4BCCA 1QFYA 4KXNA 3VC3A 2G5PA 2VRWA 5EJGA 3RFTA 3ESRA 2YJ4A 4MRMB 4D56A 1QU2A 4MS1A 1PR5A 1MFPA 2YWRA 3EXEA 2IYNA 1N4AA 3WGNA 5IBQA 2VNHA 1TMOA 2O8EB 2W2LA 1UADA 5EC8A 2G1PA 4IBOA 1PL7A 3IBGA 2CXPA 3U3XA 4L9WA 4X1OA 1YU9A 2WM9B 5ADWA 1MO5A 1HO3A 3MJCA 4GI2A 4HLDA 3O8LA 1N78A 3P9IA 3I73A 3Q9LA 1O4VA 3I9LA 3MQFA 3H1AA 1Z0ZA 4RA6B 1ZJ5A 2J45A 2OFFA 5I3CA 3LCMA 2P9JA 4DLYA 1WVMA 2JGAA 1QCCA 2Z1MA 4QVGA 4M6WA 3R3WA 1F4VA 4C6HA 1EX6A 2Z8XA 4UXJA 1TQ2A 1QZZA 2QM8A 3L79A 4ZEWA 4FKMA 3UMGA 4MQFB 4UTPA 3QFFA 4TSRA 1AH2A 1ISMA 3G5UA 3DEIA 4H3KB 4WDRA 4PNEA 4IG4A 4RTQA 5FNVB 3ZX5A 3IR5A 3DT8A 3KTOA 4IOKA 1E6EA 3KX2A 4IIHA 3N0RA 1KYXA 1J0AA 2MR6A 2GRAA 3FKQA 3GRYA 1X8XA 3KO8A 4HGOA 1CV2A 1M2EA 3AETA 4AN1A 3LDUA 4HOYA 4MDFA 2C2OA 3GNLA 1D7AA 4NE7A 2ZFUA 3GT3A 2XV1A 1WX1A 2WUEA 3FYCA 3N6XA 3SJAA 1SVSA 5TC4A 2PBFA 4OXKA 4RHEA 1JBQA 4ZYVA 3GPIA 1FXSA 3O8OB 3RADC 4P7BA 1QHXA 2GBPA 2AUMA 3OT1A 1NKVA 1LRLA 2JGKA 4A92A 2WU4A 4I7EA 2IXAA 1XRMA 4FC6A 4LIPD 3SKYA 3UJHA 2PKRA 3TLCA 1KEEB 3KC2A 1PD1A 1CJUC 3EDOA 2Z08A 3L0YA 4NFLA 4KI7A 2PMEA 1P1CA 1RZ3A 3FROA 4LWZA 3AO0B 1Q0PA 4IL5A 3A7EA 4LSMA 2R66A 4U7DA 5IMSA 3QE2A 2E7ZA 4MTLA 5FAKA 4RA9B 1D6SA 3D1LA 2IP4A 4WNCA 1O94D 4IDDA 5D3MB 3IURA 3KOYA 1QMGA 1OIXA 1X92A 4YAGA 4NENA 1J21A 2HJWA 5K8CA 5IT9A 1M2HA 1DQRA 1UC5B 1GQFA 4MR7A 1E3WB 3NBMA 1GU0A 1WD5A 1I4TD 2VR1A 4G37A 3AWIA 5FFNA 3HA7A 2WJJA 4O4HB 4OEHA 1VE6A 1W9MA 1A8PA 4UAGA 3UAWA 5KWEA 4B44A 1M83A 1NWHA 3WJ7A 4G0ZA 1M6WA 1PJTA 1ONPA 4PYRA 4FLMA 5CDFA 3X1JA 4B8ZA 1U2RA 2WTMA 3EZ7A 1XHEA 2YY5A 2VLIA 3K92A 1EXNA 1GILA 3A0UA 3AUAA 4EGCB 2K7FA 5LSAA 1ISJA 2A0XA 1M66A 3QBVA 2NUAB 1XDWA 4J91A 3B51X 1CY4A 2FEXA 4UNRA 3O8QA 4WN3A 5EIEA 4MVJA 3F7TA 3NHAA 1JB1A 3WVNA 4IX1A 1C3VA 3RFVA 1XAJA 1R9MA 3PPIA 5J4LA 2YJZA 3J7AC 1D2RA 4RJIA 2QGNA 4KWHA 1WSDA 2EKZA 3DFZA 3T9DA 5FADA 3G23A 1M1ZA 4LRTB 1RMTA 4KKXB 4EJFA 5FBVB 5E8JA 1ETHA 4IVNA 4FKBA 4MW6A 3MK31 4M99A 1V8FA 4IVQA 4TLDA 5ALQA 3DQPA 5HBGA 4CJXA 4LJ4A 3CRW1 3T5BA 2EWVA 1WMEA 4ER7A 1N3LA 2FSFA 4QLBA 1EWQA 2PKXA 3FNRA 3EPLA 4BOYA 1JB9A 2P3OA 1SCUA 5JU6A 2YVKA 4FILA 3O7MA 3UO8B 3ADPA 4JOBA 3FDXA 5F23A 1HK7A 1SU7A 3SJBA 4GUAA 5LXTB 4PXAA 3IV9A 4YA6A 3A58B 5KQRA 2PSEA 3VISA 3QSYA 1IB0A 5EWLA 2QSUA 3GA0A 2RAFA 2X22A 3UBTA 1ARZA 1X8JA 3BEDA 2WNSA 2WQ6A 2CMHA 4CIDA 3HY6A 4NE2A 3IEIA 3BT7A 4BVAA 2NVUB 4KZKA 2ECQA 3WR5A 1VYUA 2IL1A 1NJ1A 4NU8X 5AD1A 3MTEA 4PZYA 3IUBA 3ONDA 5SZJA 3S28A 1NMSA 2C82A 1JZSA 5J2TF 1QO0D 3CNBA 3RIMA 3CTPA 3LY5A 3IV7A 5FT9A 2V7BA 1J00A 1FFXA 3M9WA 3DP7A 1C14A 5JAUA 3OESA 1F17A 2CJXA 1GTJ1 1YZKA 3WL8A 1A82A 1AQUA 1D7OA 4ZEVA 3HJFA 2Z1DA 4EHAA 1ZUWA 1SXJB 1KI7A 1Y6FA 3OSZA 4UAUA 3IAAA 3F5DA 1IULA 4Y8VA 2EFDB 3NTQA 4YRQA 1P60A 1IQPA 2PV0A 2X5NA 3BD7A 2W0MA 3QUSA 2HT6A 3AONB 3ESCA 3TI7A 1DJMA 4P4SA 1TAHA 5HVNA 1TVKB 1UWVA 2F8SA 1QTNA 2WF6A 4BVLA 3Q7TA 1ZSYA 1DVRA 1GL9B 1QVVA 4A1OA 1MQ9A 1YB4A 3I04M 3UV3A 1I13A 2NU6B 4JJ4A 3RYHA 4ABYA 1A9TA 1G42A 4LXHA 3RVKA 3TLEA 4P3OA 1LA2A 1EAMA 2EZ8A 3H8SA 1SC9A 2RGBA 1RW4A 4UTZA 1YJQA 4FVTA 4MWOA 4DSAA 1B14A 4PGHA 4M8KA 4BYMA 1LSUA 3VHXA 4JITA 5HQTA 4N47A 4CLHA 1Z5VA 5AUQA 2ZTUA 5J43A 3FVTA 1TZBA 3O8OA 3ASYA 3R0XA 4X71A 2CNKA 1W36C 1E3SA 4JP1A 1Z6PA 4CV3A 2FMTA 1NMZA 3QG1A 4DR1B 1DRUA 2HA5A 4KTTE 4JKYA 3MGKA 2DFDA 1SNYA 3WYAA 1N32B 1PR3A 1RHUA 4DA4A 5JYDA 1Q0LA 3MXOA 5F3WB 4PNPA 4B35A 5ALNA 2I4LA 4DVJA 1LPBB 3CUTA 3KOMA 4D9GA 2IEYA 4GU5A 1SVOA 3NOVA 4KBYA 4TLCA 1VCOA 3D5TA 2B8TA 4XIIA 4B0PA 5LP6F 2ZXUA 5CXUA 1WUTA 3DEAA 3KKMA 2WIBA 5H3HA 1JPJA 3H5LA 3ZU6A 2B98A 4L95C 4DCMA 2FEPA 1BJRE 3C7KA 4QX6A 2NO9A 1CWUA 5FV7A 5B6PA 2R4TA 1UMCA 2O7QA 1VJTA 3BSFA 4Q0MA 2W58A 4TXJA 4PANA 2NO0A 3L7NA 2QTCA 3FIJA 1GVHA 2VBCA 2QUJA 2OBYA 3OMLA 2VSQA 1EFVB 3VOSA 4R9RA 3SNKA 2B3DA 3L8FA 3W77A 4J0FA 2WF5A 3KVNA 1EDEA 3D6NB 3P96A 3H2SA 3DBLA 4I08A 2G8LA 4JK3A 1P5ZB 2I34A 3CINA 3DMHA 3OQIA 1KDRA 1YTUA 1F8YA 1KTVA 3V1LA 2O8BB 1BKSB 3M5PA 4I9NA 5KKAA 4WRRA 1JLHA 4WGGA 1B6TA 2H1SA 3ZVRA 1WR8A 2I3DA 3DYIA 4M54A 3N53A 4ZICA 3D3KA 4FMCB 3ZE7A 3IE0A 4KRXA 5FYQA 4NABA 2B4TO 2BHNA 1S2OA 2QQFA 3V4FA 3J81A 4AWXA 2QBYB 1L4GA 1UXIA 1SZPA 1H9BA 1ZY2A 4PCLA 3K9FC 4IGFA 4Q4AA 2AZTA 1RJ9B 1LRKA 4J29A 5DIZA 2AZXA 2VHEA 1XVLA 3I53A 3RC2A 4EG1A 4RHCA 1C3XA 3AUJB 3DA8A 4X1YB 2A7QA 1WA5A 3QKSB 3OPNA 3PKZA 3FYDA 4RK0A 4P4GA 1CJSA 2P4HX 1GQRA 1OZGA 4FHDA 1ZXLA 3VYVA 1OTHA 3MRSA 4KN5A 5DBEX 1YUBA 3TAUA 2YNMC 3DFMA 5HX7A 1QORA 4G5OA 2WF9A 4KBGA 1V9SA 2G0AA 4Y6SA 3HB1A 1HDGO 3ZDZB 4EL5A 1AQJA 2WFLB 1LJ8A 3B60A 3KZXA 4HUTA 1C4WA 1IBMB 3K0HA 1AKUA 3HM2A 5FLXA 3EIFA 3BD8A 4M0KA 4RWZA 2FCAA 1XAGA 1EINA 3UT0A 3T5GA 5BOSB 5KZMB 4KE8A 1S2MA 1M54A 1MCZA 2R9VA 1Q1EA 5AM5A 2ATCA 2PRSA 2I7TA 2QQ5A 1H1LB 2PA3A 2KJQA 2PEYA 4KUGA 4WESA 3KL4A 1EAYA 2PD6A 5ER9A 1S7GA 2FLWA 4YJ3F 1X38A 2E3JA 1N2EA 1TQ4A 5ULLA 3NUGA 1BROA 5D5PA 4MH0R 1AZLA 4RY8A 1NYRA 4I36A 4WKBA 1D5WA 4LF8B 1E0JA 1D6MA 5CG1A 1GCUA 1K9SA 1CB7A 1U04A 2PU7A 4JHXA 4ND4A 4TYPA 4WMLA 3WGJA 4C20A 1GNVA 2ODEA 3I9FA 4JY7A 1DX4A 1FFSA 6YASA 2HV8A 3KKPA 3QQ5A 2XTMA 5KIAA 5LNK6 1MC5A 4XWWA 4A0GA 1Q5PA 2PAFA 3FOEC 5FOVA 3U3OA 4YP6A 4S0ZA 5KMGA 2Z6UA 3QTTA 4OX9Y 8AT1A 4HEHA 2J3KA 3T9BA 1X80B 4G1MB 3ULKA 3W2HA 1KEWA 3X2EA 2GUGA 4IHQA 2PRYA 3O2JA 4JT9A 3ECCA 1J7JA 3L41A 5A0TA 1E2GA 5BRNA 3X2FA 2ZP1A 4HLCA 4AUEA 5K45A 3ZVMA 4PLGA 5EWJA 5JPCA 5D86A 3W9SA 1GFIA 1F5NA 2BEWA 2ONCA 3KL2A 4RJTA 4DCOA 1OILA 5GONA 5L51A 4II3A 4Q9JA 4ZAWA 2PUCA 3LKBA 5BMVB 3ZY4A 5IVIA 1EBBA 2FMIA 4LC1A 3QITA 4L51A 5ALPA 4HTFA 4EF5A 4FD2A 1B3BA 1GZDA 2C9MA 1JQJC 4P22A 3TKLA 4NX2A 4I19A 3T0FA 5AKGA 2AD1A 2XUAA 4QAQA 1I3MA 4X3CA 4MKXA 3NTXA 4WKCA 3WHLA 4EA8A 4UCXA 1O54A 1P2BA 2PGIA 2A9OA 4WFKA 2I8CA 3OIVA 4ZDJA 1M5RA 2YYSA 1RQ7A 5CB4B 4W9RA 2GZ1A 4RD3A 4ND1A 3RYFB 1O9GA 1KJJA 1WF6A 3R3UA 4QQNA 3GQVA 4J0KA 3ADOA 1G3RA 4M9QA 3VKVA 2MSCB 1XIVA 3CIOA 3K0FA 5JZMA 1A9OA 3AUUA 4MS4B 1INLA 1T9AA 1NSFA 5T8KA 2X7JA 3AMVA 3LY9A 5B6IA 3F2IA 3T15A 1GTSA 5D5QA 1ZWKA 5AW1A 3NNSA 4PPNA 3OTOB 3L6BA 3MF4A 3UJPA 2HK9A 4Q47A 4WA7A 3CNOA 1UEJA 1GEGA 2GM9A 2LR0A 3OLVA 2ZIXB 2OO3A 2V5UA 1IOZA 1XB2A 5F3DA 2IDJA 4KPEC 2C1ZA 1REQB 4EYKA 2ORWA 3UHOA 4MLDA 3VR3A 5ER6A 2EP7A 4WNYA 5DNAA 2L19A 5F1KA 1XEAA 4ZYZA 3SX4A 1X8KA 1SKYE 4IJUA 4EKEA 2FJUA 4MRRA 2MU1A 5EESA 4BWFB 4WPGA 2EVWX 2IXGA 4C1NA 1WBBA 4O3FA 3PDJA 2FZ4A 1N2XA 4Y30A 5DGTA 1J33A 1V3QE 2Q1YA 5TY0A 5KS2A 3F96A 1XFDA 1UPTA 4E5MA 1RWVA 3TLAA 2WSIA 5JYCA 1KO5A 3O5AA 1HZZA 1ZHFA 4TSFA 1UBOS 2HBYA 2HH9A 2X5OA 4Q3DA 1GPWB 3RKRA 1QVWA 2Z2ZA 4LISA 4BGDA 5FEUA 4EO9A 2RHMA 2HA4A 3FWNA 1T6BY 3PCTA 1TJ4A 3Q7QA 1SAYA 1KZYC 2Y1EA 3AHGA 1EZ1A 2ZULA 3QLVA 2JHFA 4O4HF 1Z5GA 5IC6A 4CEJA 3FPFA 3W1WA 2ISSD 3JVDA 4H18A 3BD9A 1EFLA 2YH2A 3DKIA 2PHZA 2I4NA 2VJAA 4IGKA 4CN9A 4BUZA 4CKEA 4XVUA 2NN3C 4K6FA 3TVYA 4GD3Q 4P58A 4FKZA 1DJLA 1OHHD 1L5YA 3GH3A 2G7ZA 2RHWA 1WXIA 1G66A 2EEPA 1Z8NA 2WWFA 1SZCA 1J09A 1ZOOA 1KSHA 3NEYA 5CX1B 3R3JA 1EFHA 2AFIB 2CNNA 5ADUS 3FTPA 1R6DA 1RPAA 1E1NA 2WZBA 1IEWA 1VKNA 5HF9A 3VSDA 1VSQA 4EAAA 2Q49A 5JMTA 3QE0A 3CZ9A 3N5KA 4WY5A 3RB8A 4DEXA 1R5BA 3OURA 2YZ7A 1AKWA 2PZMA 4N7MA 1JR6A 3CLRC 3KOZA 4YRZA 5BN5A 5TMPA 1TU0A 3MWLA 1F0NA 1KU6A 1TUIA 2C4NA 3KJEA 3NKFA 1F5SA 4GRDA 5KCMA 3NIWA 2B4KA 3L8CA 2COEA 2DPYA 3IEUA 5B6JA 1FX0B 4BAUA 4UCFA 3HTXA 1C7ZA 2X0EA 2CBGA 3ZQKA 2CHGA 3F4LA 2IU0A 4PYKA 1JBEA 4B6FA 1EXDA 4Y18A 3QEAZ 3LSTA 3N2GA 1BDBA 2QG6A 3F9RA 4I9UA 1V3VA 5L8VA 3ZWAA 2G4LA 2C84A 2WNIA 3EJWA 2K5UA 1XQ9A 1P4JA 2P4SA 2UYHA 4JUBA 3GRVA 4CHGA 4Y1GA 4P6VF 2VJNA 1QG4A 2PMBA 1FIUA 1KGDA 3PC8C 2Q3HA 4IIJF 2WJPA 5BN4A 1QU3A 2PWAA 3C8MA 2EGHA 3F3KA 1RWKA 4H0CA 1R0YA 3P32A 3LBAA 2BH9A 2B37A 1IIBA 2NQ2C 3O84A 4GKVA 5DO9A 1I6KA 3WMRA 3DQQA 4HNAB 3EZGA 3GA5A 3I2YX 4LF6B 3V4OA 3QLUA 3Q8LA 4Y9SA 1UP6A 3SC4A 2FMFA 2JGLA 3GGGA 2OBXA 5G53C 4NJMA 3R7LA 5BSMA 3AL3A 2AIRA 1J8QA 5E2IA 2QROA 4DZTA 2R84A 1R7RA 3S7ZA 3BWBA 1NY6A 2ST1A 3KSMA 2C0QA 4Q4DA 2Y67A 1H5QA 2O3SA 4K8OA 3RAFC 2R87A 2VUIB 2XGJA 1J0BA 5BVHA 3AB7A 2ZITA 1XPJA 1NV9A 1LNQA 2BHRA 3LBYA 1NIJA 1VM6A 2OQVA 4F91B 1ZBDA 1K5HA 1WM1A 1CR0A 2WLSA 4ARSA 3OD1A 2WTEA 1AZTA 4I9HA 3N39C 1IY0A 1K97A 1JU4A 3GFSA 3PFFA 3DKPA 3QPUA 3A1UA 5DSXA 5HF6A 1N3BA 3OO1A 1MH1A 1DKQA 1XXHB 3WK9A 4MPPA 1H1DA 1FK8A 5HR5A 4H77A 4KR2A 1L4YA 4GBED 1I3OA 1EFDN 3P0FA 5ILGA 1EFKA 3OQMA 2QYSA 2ODBA 3KKZA 4LOHA 5ESXA