1Z9BA

Solution structure of the c1-subdomain of bacillus stearothermophilus translation initiation factor if2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
135
structure length
135
Chain Sequence
b'NEFELGTRGSSRVDLQEQRSVKTRVSLDDLFEQIKQGEMKELNLIVKADVQGSVEALVAALQKIDVEGVRVKIIHAAVGAITESDISLATASNAIVIGFNVRPDANAKRAAESEKVDIRLHRIIYNVIEEIEAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-2
publication title Solution structure of the C1-subdomain of Bacillus stearothermophilus translation initiation factor IF2
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Translation
total genus 20
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11987 IF-2 Translation-initiation factor 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10050 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor IF- 2, domain 3 1z9bA01
4N3NA 1G7RA 3WBJA 3WBKA 1G7TA 1Z9BA 4KJZA 4N3GA 1G7SA
chains in the Genus database with same CATH superfamily
2WI8A 1PJCA 3JCZA 1D4ZA 4M6WA 1L7PA 4C6HA 4KREA 3GFTA 3NJRA 2WDPA 1NATA 2HLDD 3HKEA 2KB0A 4QIHA 1I4TD 1XQ6A 2A7QA 3RLFA 3Q7TA 1UK6A 3OIUA 1AUXA 3P9QA 1EWQA 4H15A 3HCAA 2IOFK 4U6SA 3STWA 3HJFA 1UKCA 3C3DA 3CUWA 4C6TB 5KVVA 5J59A 3FNFA 1UKZA 3MTDA 1FSFA 4BVEA 5HM8A 4U9HS 2O0LA 1AKUA 2RBGA 2QAJA 3KSAC 1WOYA 1G5FA 1XKQA 4RW0A 1N32B 5HZMA 4EJMA 1OOEA 1T4DA 3IB3A 3NT2A 4YUAA 1J0XO 1A5TA 4IYJA 1NC3A 1L5SA 3REGA 5HS4A 1QYIA 4DKXA 1SKUA 4LVCA 4E4RA 3RF6A 3WIUA 4CMBA 3LM8A 1M6NA 2QA5A 5LIPA 5G3YA 1RAFA 5IKPA 2O3UA 1VE6A 3I73A 3IAEA 4QGGA 3O8QA 4M53A 3VVBA 4LJ7A 1VDMA 4C2AA 2GN8A 4D4LA 1J2UA 2VQ3A 1R0YA 3R8XA 3ZE8A 1N9GB 3NC1C 1PGOA 2XAUA 3F3KA 2WJJA 1JQDA 1YQ9A 3RUPA 3WLAA 1NF8A 4KR2A 1S3FA 3A7DA 3MWLA 2VPXA 3TSOA 1NJGA 4TLCA 2CEAA 4ZOEA 1FFBA 4F4FA 2ODQA 2MTBA 1R16A 3FOAA 3FGPA 3IBTA 2VP9A 1B2RA 2DU8A 4FTWA 4RK0A 1HRKA 2HNBA 2XQKA 3DUFB 1NMEA 4TLMB 2QUZA 2WM2A 5FOXA 5GJVC 3RG8A 4A0GA 3MXTA 2F1RA 1NU8A 1OREA 3I0NA 5C4IA 1MOZA 1M54A 4DLRA 5KTNA 1YMUA 3TZEA 4NMLA 3AWIA 5BNIA 1RWNA 1LDGA 1X1AA 2PL3A 2VOEA 4BQRA 1MAWA 2CVZA 4E5VA 3M3DA 2WF9A 3GQVA 4ICIA 4MW6A 1DQPA 3RUEA 1WF3A 2HBRA 4Z1OA 3CEHA 1R4ZA 3RU2A 3BDVA 2D2IA 3R5FA 4L0CA 4ZI7A 3FUXA 1XELA 2XD9A 1BDBA 3WIOA 1TTHA 3QPCA 2JI4A 2X77A 2WJIA 4CNQA 3T1YB 3UMVA 3IAXA 4MPPA 2CKDA 5FYQA 3UFXA 3I04M 1OFHA 2FSUA 1D5CA 2FQQA 4MUYA 3I9OA 3QTBA 4NPHA 3AUFA 1V8BA 3D7SA 3SFVA 5JH7B 1R5BA 2B7BA 1MX3A 2OHXA 1OXXK 2EBFX 3G5TA 4KSBA 3DCNA 4I4TB 2H7XA 1GUFA 4H0FA 3OQVA 1Y3BE 4Y1RA 5IVIA 5K5EA 3B1XA 1RACA 4RLSA 4LC0A 1JHQA 1GYQA 2C8JA 2HHJA 1RRPA 3L0OA 3C6YA 3BSFA 3DE1X 3FCEA 1GD1O 1XC7A 2D1SA 1OZFA 2BM1A 3WI7A 5LMZA 1Z4OA 2AQKA 4EJ2A 1FDRA 3PDIB 1E77A 1CVIA 4QJ5A 4GM1A 4HDNA 5E2BA 3ZD8A 4B83A 5ALHA 3L43A 2Q1WA 1GRRA 2R3SA 1Z8HA 5MFPA 1ZXBA 1FYFA 2Q6KA 1Z36A 2GRAA 3DDHA 4TWZA 1R0ZA 1K5DA 3TSAA 5K8TA 3ML1A 2BGGA 1DV1A 3R0VA 4EECA 3GBSA 2G0NA 3CW2A 4CDNA 1G0NA 2Q5CA 1BKSB 1IL0A 1NVBA 2AR0A 3TH5A 4J1NA 3KQPA 4OXQA 2XA9A 4J1TC 1G4UR 3OE5A 2VP4A 2H1WA 2H8KA 2BZ0A 3RYCA 5DHRA 1WCXA 3MT0A 2EFHB 3BAZA 4QU9A 3S8MA 3H1BA 1DEHA 1N6NA 1XZJA 3QVGA 5DM60 2J07A 3O82A 3C8HA 4B7ZA 4GMFA 4ODIA 3ZHQA 3URKA 1OROA 5KSPA 5CBKA 3CT4A 3VJRA 3T7TA 1W59A 3KYBA 1K5PA 1O57A 1CE8B 5EUBA 1KHTA 4KRYA 2C9OA 1TTQB 1WPQA 2F2TA 2PQ6A 4IMJB 4C2UA 4P5DA 3LDUA 1SK8A 4J3FA 3WTBA 3UUGA 1E3QA 5L3SB 4YDSA 2ZRQA 3QMMA 5EMNA 3GCGA 2BKVA 5AICA 1SXHA 2WEKA 2CL7X 3L6OO 4B3SB 2AXEA 4Z3KA 2D0DA 3OUZA 4FZRA 1OT5A 2G3YA 3N8IA 1E20A 1O08A 1ZK1A 1DIHA 3P26A 3DEJA 1RVV1 3GEPA 5ITZB 1JPJA 4UKDA 3M6WA 2C2GA 4LVUA 1UEIA 2RG1A 4NFHA 2VTVA 5LP6B 1RI4A 3IERA 1ZIXA 2PT7A 4RH1A 5CGQB 1ZGJA 1ZY2A 2BSXA 4X44A 4Q21A 2BM8A 2PLWA 1PBNA 1VKRA 2AFVA 3BQMB 3F6SA 5L45A 1CUDA 1JPNA 1Q0UA 1WF6A 1KVUA 1UF9A 3EZYA 3LRPA 1LLFA 1X7DA 4AN4A 3GLFB 3EVDA 5JYBA 1PS0A 4HDRB 2IGTA 5FJIA 3S1AA 2BN4A 3WGHA 3GRRA 1CRPA 5INTA 4KR3A 1KJ8A 2JIPA 5JS8A 5MDHA 2R11A 1DWOA 3KSMA 1W0CA 1KOJA 1HBJA 1VECA 2Z95A 2FSSA 3RC8A 5IHPA 3HUUA 4NBUA 1XZFA 4MR8B 3U1BA 1SVMA 4Q1DA 1JSZA 3UCFA 4WGGA 4QL3A 5EFZA 1KXZA 3FYUA 1IM8A 1FS6A 3OU7A 4MVXA 3PDJA 5DM4A 5IXSA 3JAMA 4KWHA 1E63A 4YP6A 2OV4A 2X0FA 4QOSA 3TW8B 4BC0A 4C7XA 4X62B 4KQMA 5J1SB 4HZUB 1X9GA 1AMNA 1W44A 4II3A 2B5OA 2O0JA 1BRMA 1ENPA 4WNAB 1Z88A 2AN1A 2ZK7A 3LT2A 1TIKA 2Q62A 3VI3B 5JXHA 2I33A 1FRNA 2VBCA 4JUIA 4WY8A 5B58C 1RPZA 2DFPA 1T4GA 3ZZ1A 1E3MA 2EFDB 3FNQA 1SHJA 3BBPA 2B8TA 2P4HX 1Z0ZA 1FBNA 1H5NA 6GPBA 5FWNA 2ONJA 4ETNA 5JLAA 2JLWA 1T25A 2J3QA 3GWGA 4WD3A 4IINA 4UBKA 4GZLA 3MJFA 3FLBA 5EERA 2ODNA 4D5EA 2G4LA 4MUMA 5JXJA 1LLQA 2QW0X 2UDPA 4HAIA 5F3DA 3RYFB 2YHAA 1WDKA 1GP2A 1D7OA 5DTJA 1SUWA 2CFTA 2P5SA 2XSZA 1AK9A 2YXDA 2JGDA 1C9EA 1NV8A 2SKCA 3P2YA 5DBEX 3TDNA 4BP8A 2XCTB 4LKRA 1B16A 2VHXA 4NQRA 2PAAA 2JPDA 4DUZB 1EAYA 1UKAA 2F3PA 1GSIA 2ADOA 3SVZA 1GDTA 1OIXA 1CJUC 1LJUA 1OAKA 3L7YA 2J09A 4MARA 3UYKA 3ZJVA 1A7AA 2QTGA 5C5CA 1G17A 2AWNA 3Q0TA 4OATA 2P5UA 1QTQA 4Y1EA 1UC5B 3E15A 5J4LA 4DLNA 2CNKA 1UJCA 2OZKA 5LPNA 2PWPA 2GEVA 3H1GA 2IH5A 2DR0A 3IUNA 1DX4A 5BMVF 3LTEA 3EDQA 1XD2B 3PC7A 4WZZA 2W58A 4H6PA 2QQ0A 3D81A 4RSRA 3USZA 3V3KA 7ADHA 5K3EA 3RVPA 3GLFE 2W48A 4HQFA 2XVYA 4BATA 4D42A 1OZAA 1CZRA 3I8OA 4BKMA 5BN4B 1ODSA 4BNTA 3U7QB 1XWIA 3BGDA 3KFXA 4X92A 2EX1A 3MG9A 5LBTA 1SHKA 4E30A 2C9YA 2V5VA 5ALQA 3LQFA 4EY5A 3BIJA 4NONA 3QEKA 3GC6A 4H31A 4H6WA 3D3WB 4MI9A 3KDAA 3FMIA 3CISA 2L42A 3M3HA 3BXZA 1D1QA 4JENA 1JEYB 2CF5A 5CGZA 2XUKA 1MH1A 2C0CA 3WBFA 4TTJA 3VXKA 4CG0A 1JVSA 1PJAA 4TLLB 1Y4DE 2APJA 4EO7A 4F12A 5DMXA 1ZWLA 4MWBA 5JTTA 3ZJ4A 1E5VA 5FULA 4DTIA 4YX9A 2VHEA 3DPUA 5EQDA 2GBFA 2H16A 3FB4A 1CULC 2XRFA 3SX4A 1Y3AA 4UNNA 1JAHA 2POQX 3R3JA 4FYHA 4KUHA 1H2YA 5IP5A 4BFZA 1YOVB 4DR7B 2EWVA 2PL9A 2WDZA 1CR6A 1GGKA 4R41A 4WLNA 4I19A 5JQGF 3HFRA 2NSDA 2VF4X 2JAXA 1P2SA 2WTBA 2P2YA 1CK4A 3GJTA 2CHUA 4OA5A 5IULC 1HTWA 1S0UA 5HKKD 1YE5A 4AAYA 2GEDA 4HDMA 3A9SA 4XB2A 3RC9A 3C8DA 3SDZA 3CIOA 4L2IB 4ZAZA 2WJ6A 3TOZA 3E7PA 3GEDA 3AEKA 1GN9A 1DIAA 4F5DA 4BNYA 1Q3TA 5IK2D 3AB7A 7ABPA 1FFXB 3V9PA 4ZU1X 1MPXA 4MWZA 4GGMX 2CUTA 2J08A 4GKBA 2O07A 2IUEA 2Q5QA 1MQ9A 3LWNA 4JBNA 1QOQB 2BFEB 1E2FA 1F0YA 2PQ0A 5ALLA 5AM5A 5AK0A 1Z0SA 3DBLB 1VE1A 3NETA 2I3ZA 5F7ZA 1LJLA 3BIFA 4XE5A 3SXJA 1T91A 4PZUA 4Y0AA 1RBQA 5KAMA 4N5IX 5DWVA 2HRRA 1L5LA 4NCBA 3Q6NA 4IIJF 2QN9A 4B43A 3JQ9A 4AP5A 2Q4EA 4ZXFA 3EAQA 1KEPA 1YQWA 2WY2D 5TF0A 4Y6LA 3DA8A 4BMPB 1XQWA 3DT8A 2XZTA 3MD9A 2X2EA 3VO9A 4OHZA 3AVVA 1M2KA 4CW7A 2FP3A 1OX4B 2FQXA 5DIFA 4DPMA 4M54A 4OOFA 2CDBA 4UHJA 4YTEA 4CDMA 4BVBA 5DEOA 2J87A 3MC1A 1FSZA 4Z6KA 5A1TA 4E7OA 2AR9A 4X6XA 3T3OA 3UQZA 3ETCA 4PIVA 4XQ9A 4LQ4A 3GGGA 3U19A 2IJGX 2D4HA 3ZDDA 2WAOA 2GTPA 3DKRA 1UK7A 3PR3A 2FWAA 3FDZA 4DUGD 1LF5A 4HTFB 1FMTA 3F9IA 4QDTA 2FQWA 3TNDA 4N8DA 5FRDA 3EHDA 2ZIFA 2C84A 1QKKA 4RHYA 4W5WA 1U04A 5AUQA 1XCGB 1EHCA 4CXMA 2AN4A 3PF8A 2HJHA 3WLTA 1CY8A 4IIEA 1J2JA 1N33B 2ISQA 1ZD2P 3V9AA 4GE3A 2GJKA 1Y42X 1DCMA 3ESAA 3IDSA 4GE0A 4XIGS 3N75A 3U7RA 2JCYA 1OXUA 1RXWA 5GV7A 2OMEA 2VNJA 3WOHA 4WBNF 3QWHA 3KJNA 3PFWO 1ONSA 4B7AA 1PK8A 3PEYA 2ECPA 4R6WA 5AIAA 3VC3A 3VPCA 3KKKA 7MDHA 4GDMA 4JJAA 1GKKA 1LV7A 2IL1A 3GT7A 2G5GX 3ISVA 4RADA 4URXR 2RH9B 1UM9A 1VGQA 3N3AC 4EY8A 4K9RA 1TL7C 4RULA 1XRNA 1ZN2A 3S8YA 4XPZA 2J4CA 4HH3C 4BX9A 2AS0A 1FNBA 2MIIA 2DX7A 3LYLA 2HA3A 3EGOA 4GR4A 5DNEA 3UUFA 1P2VA 1PDOA 1AKYA 1UKEA 3FCXA 3ZIAD 5JPCA 2Q2OA 1GVNB 4GLFA 4M8SA 5ENVA 1N25A 4O2BA 4RDIA 1II9A 2P4QA 5KYGA 1U7TA 4L5CA 1LPAB 4O6VA 4OMDA 1ECLA 4RZSA 5IH3A 4G23A 3UHJA 3ZUPA 1U1FA 4OJNA 1R7RA 2Z6QA 2RB4A 2EFGA 4OHOA 2A14A 2ECOA 5AKGA 4O1MA 3F7MA 1FSSA 1GT91 4CZ2A 8AT1A 2GVDC 1F7UA 2QTVA 5F33A 4NE9A 3UJNA 1SFRA 2GAJA 1KFCB 1K2WA 1N1EA 1XCJA 1Z63A 3FGNA 3A2LA 1V1MA 1K6XA 4BAUA 5AW1A 5I7VA 2Q5JA 1OXVA 5BQXA 5CH3A 3RWMB 5HUQA 5FKJA 3ZOKA 3INRA 2BPOA 3C3AA 3GA5A 3G9XA 3VV2A 1TB4A 3TOVA 4AF7A 2WT9A 1YDWA 4CRWB 4ARIA 2QMOA 2ENUA 2H1CA 2WINI 1K6IA 1UDAA 2Q6LA 3IDFA 1ZZGA 1GAWA 2GN4A 2LRHA 4A4DA 3ZHYA 5DFAA 4DEVA 4NYMQ 1I33A 4XIYA 1XPJA 2HWUA 3E4CA 1IQPA 2SECE 3OEED 1WBDA 1Y0BA 2X8AA 4P7JA 3U7GA 4HVLA 2VHTA 1AKVA 2W6IA 4G8JA 5HTKA 3RVKA 4NHOA 1Y7PA 3ICQB 4U2EA 1NF9A 2EL9A 3C2QA 5HVNA 5CT4A 3OLWA 4D8WA 4LHSA 3UHPA 1Y63A 2R9VA 3UWMA 4X90A 4KRFA 4K8OA 5CLHA 5CT5A 3M6IA 3OJWA 6NULA 1HQKA 3ZXIA 4EA6A 3RYHB 2VPWA 5KCZA 2W0MA 3ESYA 1TTTA 1SVKA 4LZJA 1G1MA 2WP8J 3OZXA 3HBLA 4Q66C 1MNAA 3C7CB 3NS7A 5DN9A 4D41A 2O8DA 2DKOA 2R2GA 3G89A 5FWYB 2WYOA 2PZKA 4V0NA 4F6RA 2DZDA 3L07A 5FTMA 3KTDA 5B1YA 1ZD1A 1DTSA 4O4IF 1BIFA 4DB2A 4A6DA 2WTUA 3E7XA 3ZEAA 2Q41A 1YUBA 3NI2A 1U7XA 3VPBA 5CFOA 3RJ9A 3EVAA 3H5LA 3JQBC 3JRNA 2ZTLA 4ZAYA 1G8MA 2XTZA 1ODTC 2XKBA 3KSUA 1AQLA 1X7GA 3D4LA 3R7WA 3VJMA 1OWPA 4A9AA 1C7EA 4RVUA 4CQMA 3H9QA 1LH0A 2XEXA 3F7NA 1M5UA 3OIYA 1OBOA 2YXLA 3BWDD 4PO9A 5CTJA 5F7XA 3Q87B 3PNYA 1BH6A 1AN0A 5D84A 3FOZA 4CMKA 1JW9B 2YYYA 4WX2B 4NBSA 4YCMA 4NXMB 5A6VA 1AURA 1SVLA 3LQKA 3RK4A 1OXBB 2PKYX 2FXVA 1IRIA 1L1QA 4M9ZA 1GZVA 3GLTA 4DRYA 2PDAA 2G1PA 4MB2A 1YF3A 3DQQA 3RBAA 1H2WA 4DV6B 4XJXA 3B12A 3G9ZA 2WJHA 2C57A 1FQJA 4KWIA 1Z0DA 3ZE1B 2FJUA 3I92A 2JGNA 2IU3A 4LBVA 5ER9A 1ZSVA 2FHPA 3IVGA 1NMSA 1YWGO 3A10A 3RVLA 3DBHB 3PNKA 1W73A 3FN4A 1GCIA 3G7UA 3NIWA 4O4LA 4CKEB 1TLLA 4UOEA 1J25A 5BSKA 2YBEA 5GAJA 5K6AA 3JQAB 2F3SA 3R75A 3PUVA 5AESA 4I8DA 1AQYA 1C29B 4OL9A 5EYPA 3U4DA 3TR6A 4NFLA 4DC9A 3GJ0A 1FLNA 1NTOA 4PN7A 1YVPA 2XD4A 2KBEA 1F5SA 3WLOA 1K08A 1U94A 2BR5A 4I5GA 5JRJA 6REQA 3T38A 5LOVA 4WKBA 4KFUA 4NE2A 4CQMD 4OQFA 4I1VA 3NIFB 2ZJ6A 1DT3A 2EATA 4JK3A 2NZXA 2KJQA 2DJ5A 3C8ZA 4DMKA 2Z3ZA 4RMJA 2J9FB 2JVJA 2OXCA 4H16A 3EPHA 3DAYA 1GRQA 1OWOA 3FNGA 4RSHA 1KEZA 2MSNA 2OCGA 3FPJA 3PR1A 4P98A 4Z9BA 3T41A 1RLMA 2XDQB 2KW5A 2OXEA 1A82A 2XQJA 2IELA 2WFMA 3A6HA 1DHTA 4IJ6A 2VJMA 4D6YA 3H7AA 2OV6A 4MAAA 3D5QA 3PXDA 1EK1A 4R8KA 2OPHA 1CZKA 3CVOA 3L7BA 2F9LA 3I6ZA 3TUIC 3VPSA 3S2ZA 4CMJA 4ZQCB 5DNYB 2DUWA 1DGQA 1XJ5A 1RNLA 1RQPA 3LK6A 5I9BA 1VIDA 3WL6A 4F9FA 2C7QA 4F4IA 3S2YA 3NM5A 1XHFA 2V3VA 3HN6A 4E5SA 1ZW1A 2SKDA 4JROA 4YUYA 4EGFA 5JD5A 1B8UA 2GZ1A 2VZ8A 4G5QA 2VRBA 4X1YA 4B81A 3N0WA 4Z4CA 3G2QA 4V03A 1KYWA 3LW8A 4L9WA 2Y1LA 4F72A 3HS3A 3D3QA 4L9RA 2OCIA 4DWOA 4TMVA 3WAKA 1R66A 2IX3A 1XTUA 1F4VA 3HCEA 3VSBA 2J3IA 1SGWA 3FNEA 1IJKA 2H00A 4JVLA 3WSWA 1GNLA 1IULA 1KC3A 1A0OA 4RS3A 4LY6A 2F43B 1YO6A 2WNHA 3MMPA 2PX6A 3MUNA 4HDSA 3EARA 5BV0A 3ORFA 3HU1A 4M0PA 2AMLA 4G86A 3RKRA 3SYNA 1K3TA 1QTIA 1EGAA 2X3UA 4IRMA 4IVNA 1W7AA 5AVJA 1E5QA 5TMBA 1L1EA 3RC1A 4L27A 1CY1A 2O3SA 3BWVA 4LOIA 1TVCA 2GAIA 2MHCA 4Y6QA 4ZHQA 1EP3B 2VQDA 3QGMA 5JJKA 3VU9A 1W30A 2ZLBA 2COUA 2FUG1 4L5JA 1JA0A 4M4SA 4Y9RA 3T99A 3UH1A 1LUAA 2C88A 3DEFA 3TEMA 2D6FA 4C0XA 2XMQA 4FFVA 3H6GA 3KQQA 3RGWS 1XTQA 2XWBF 3TL6A 3G49A 1QGUB 3B9QA 3VH3A 3IDOA 4WN9A 3SHWA 5TC4A 3BJZA 2BI4A 1WY5A 3GFFA 2HCFA 5FPPA 1YRWA 3SKXA 3UMMA 1J07A 2XPCA 5KNBH 3T54A 1UFVA 2HJVA 4GLLA 4MQFB 3BMOA 1T5HX 1YQTA 4DV4B 1YRYE 1HNXB 2YJTD 5AO9A 4GBED 5SV2A 3SHTA 1N2OA 4PPFA 3IAM6 4P3NA 3EEIA 3NCTA 2WABA 3WFIA 2WPNA 1XZMA 4EB3A 3W8NA 3IDZA 4LKOA 4JODA 5BUCA 1YE3A 2COEA 1ORIA 3EVEA 4PZLA 3V4SA 4YUWA 4NZZA 1UT6A 1JU3A 5FR1A 2E87A 2QRGA 4K9SA 3SHFA 5F76A 5FLEX 1Y8RA 4A2WA 2YCLA 3CSUA 5A2QA 2WU0A 5TMEA 4OSOA 1E3TA 3LJKA 2WYVA 3DVRX 5CT9A 5CVCA 2WYHA 3NHAA 4V1CB 1XU7A 5B3JC 1QH9A 5AHWA 4XFDA 2ASEA 1E2GA 3MCTA 4US0R 4L4XA 4V38A 2RBEA 1EFRD 2EW2A 4IG4A 3RQIA 3IHTA 3UFBA 5ICEA 4RTJA 3VO8A 1FXWF 2ZYHA 3H2GA 1RM5A 3NYIA 2D1YA 4XJTA 3ZU6A 4DV7B 5FHRA 2Z43A 1YB1A 5ALXA 2GPWA 2PUVA 2UYQA 3W3AH 4C7OB 3ZC3A 3F5FA 5REQB 3V1LA 1IG3A 1OC4A 3G2HA 3IQIX 2AQHA 3VJLA 5DPMA 3AM1A 2R1VB 4X8LA 4YJGA 4JMLA 4E1BA 4LJYA 2I1LA 4UOQA 2PYZA 2HIAA 4HJXA 4BJHB 4QU8A 4C0WA 1LSOA 1DBVO 4BGUA 2ZITA 1JPVA 5F64A 4PQEA 3OI7A 2OFPA 4NJMA 5CAEA 3KELA 3D31A 2HBZA 1H2ZA 5CYFA 1AUQA 4FEAA 2XXBA 4YGYA 5JATA 3QK7A 2NYVA 5SZIA 2VKTA 4H1WA 5LZ7A 4J2OA 3OJXA 5BNWA 1XZKA 3DBOB 1T9GR 1K7SN 5FB3A 1HE5A 4KK4A 1TKCA 3HWSA 4H7KA 1IY8A 3E3NA 3RO7A 3UOWA 1E2JA 3I9V6 3MNFA 1IWPB 2B37A 1JSXA 4G8BA 3E2IA 4PANA 4LJLA 2F17A 4RVCA 4TMTA 5CA0A 3SKYA 1WXWA 2WU4A 3TJZA 4A8JA 3PHIA 4D8TA 2QYSA 1TFRA 3DOJA 1IPFA 2HY7A 1XEXA 3FF4A 5DTQA 1B1AA 1B42A 2MSDB 4M9QA 3DHNA 4NYIR 1N2CA 1C9YA 4RTMA 3MWYW 5K0LA 4QU5A 1P9RA 3LVBA 1PL7A 5L95A 2RMKA 2GX6A 1YASA 1GUZA 4I9FA 4Q39A 4RETA 4IGFA 4YJ2F 2K7FA 1JQLB 2RHMA 4KX3A 5FPKA 5BN3B 2EWWA 5JMOA 2Z6AA 4IGAA 4OHWA 3ZD7A 5GJBA 2A5JA 1V6AA 1A2QA 4LS3A 2PLAA 4NTZA 1ADBA 3RIMA 3IKVA 3NBMA 1QM5A 1Y5RA 3B13B 3EF0A 2R6DA 4NCNA 3RVQA 4JT4A 3ZZUA 3FCYA 4HN9A 3K6RA 3C3XA 5L3QA 1E66A 1QG0A 4GWGA 1N5DA 4RKWA 1UFKA 4C43A 3ACCA 1JLMA 2VIIA 1AB5A 4U3JB 4TKZA 1MX9A 3MIZA 3S2IA 4RA9B 3DPSA 2YVKA 5JANA 4AXXA 4ERNA 1XVLA 2FSHA 3GYBA 4BB9A 4QG3A 3RTCA 3WLLA 5JW6A 1U90A 3CB4A 4WHMA 2VQEB 1G6KA 4FFDA 3HJAA 3K9GA 2P7HA 2GNPA 2HMVA 4DJAA 3W9UA 1IY9A 3LPCA 1XMVA 5IG2A 2PZMA 3K9HA 1I1OA 2AR7A 1XTKA 2K4MA 3JSAA 1YONA 2GCIA 3KJQA 4U6QA 1COZA 3UG7A 5IT0A 4CMGA 4N7RA 2MR6A 1WKCA 2I5PO 2QY9A 3PB3A 5BMOA 3G6KA 4IMRA 3HHEA 3TL3A 1I9GA 4RPJA 5CH5A 4GDFA 3TZQA 3QI2A 4IHJA 4J1SA 5ED0A 3EFHA 5B7PA 5FORA 1EM8A 3WGOA 2G4VA 4G81A 1ICEA 4DZTA 3P0HA 1P3JA 1ZUNB 2HPZA 3C7DB 1I5OA 2OM6A 4LW8A 2C00A 1AY0A 3VNUA 2G8LA 1FP4B 1EBBA 2IXAA 3DM5A 1YI8A 3NTUA 4JIMA 2JK1A 3H3FA 1Q3KA 3TEFA 4CM7A 2R79A 1SA0B 3F8SA 2GVZC 4QATA 4BKRA 1Q1QA 1RMYA 3CCBA 3D6UA 2EWMA 4BQFA 3C43A 3ZV7A 5K51A 1H93A 2Z8ZA 4OJTA 5EKXA 5BWMA 3NTXA 3H8JA 2FF7A 4Q3DA 1JECA 1QWSA 5TPZD 3GI1A 4TXHA 3KXDA 3IAS1 5GM1A 4F1KA 1KDZA 3L79A 3TECE 4GEKA 1Z6XA 4QTUB 3DE3X 3GEIA 2DFNA 4N47A 2J5RA 1Y8ZA 1YA8A 1IWBB 1T2AA 5LMNB 2J3HA 2FZWA 3FTDA 5LZ8A 4H17A 5F7JA 1JKXA 2XRMA 4DILA 4EHDA 2ZB3A 2HU5A 1X3SA 2AKEA 4FX5A 1YDFA 1IJBA 3OTWA 2DT5A 4BO3A 2Q0XA 3IAFA 4XB1A 1GG5A 2GSWA 1K2VN 1NSTA 2VCEA 2GZ2A 4PHCA 4UHCA 3RHZA 5YASA 2WRZA 3T9CA 4CTKA 1X7ZA 3PFIA 3HV2A 4D7AA 2OYCA 1M5RA 1OLUB 2GNOA 3EGCA 2H5IA 3KUCA 3M5DA 1CQXA 3QG5A 2HD4A 2E21A 3RS2A 1HMPA 1NKSA 1ZLXA 3R6TA 4ZZIA 2NXNA 2HSDA 3A11A 1W4LA 3GG9A 4R9UC 5ENDA 4YLGA 5KTMA 2H2DA 2BFOA 2CW5A 3RUCA 4BU0A 1TMKA 1C2YA 4G0UA 4AYXA 3JVUA 5FNVA 3TTWA 1EHIA 2RSLA 4NMWA 2BSQA 4CTNA 1KTVA 5ILOA 4MKZA 2JCXA 4FDVA 3OWHA 4AM8A 1CYDA 2C2KA 8ADHA 1VRCA 3RS9A 1U2PA 2BEVA 4IV8A 1FMJA 4I55A 5LQUA 5ITVA 3IURA 4UDYX 4Z49A 2NN3C 4RD2A 3GRPA 4JI6B 2X4GA 4K5QA 3MBKA 4EO9A 2GASA 3TLCA 2DFKB 2VHUA 3JQQA 1Y5IA 3JRWA 1B23P 5IM4F 1H85A 3FUWA 1JJVA 2ZJ2A 3N2YA 4IHKA 4PSCA 4MZXA 1GCGA 4JFAA 5LCXA 4OI0A 3Q3IA 2V7UA 4IH9A 1IN1A 2GUWA 5BMVB 2GM3A 2WU8A 4B3MB 1ULTA 1N2IA 1NURA 1I80A 3HRIA 1THTA 1RQNA 3O4HA 3OLYA 1EUCB 1TLTA 4GFDA 4BJ5A 3JRXA 2PLRA 2ZIAA 4N7JA 1ZEMA 1XZLA 4YP9A 1GGMA 1QHHB 5B1EA 1TK2A 1TQ4A 4KIFA 4B3GA 3VBCA 5IC4A 1BTOA 10MHA 3M1LA 3ZWWA 2HQBA 1LQUA 1MEOA 3HO8A 3ZHBA 4A92A 1PG2A 4R8LA 4QSHA 5CVVA 4N8EA 4PX2A 3H9UA 5AP9A 3HL4A 4NQZA 4E5PA 2ISSD 4LE0A 3NQ41 5JNUA 2NQ8A 4UULA 5L7TA 3BH7A 3I3OA 2R48A 2F6RA 3ZLVA 2O8BA 5CT8A 2QK4A 4Z7QB 1I6KA 1IU9A 3A05A 3GFSA 1NLUA 2BEUA 1U0RA 2BISA 3JQAD 3PNBA 3DKVA 3BHJA 3QI7A 3QY0A 3TLYA 1AUVA 5DLPA 3RS5A 5B3KA 4DV5B 4FEYA 4BVLA 2HUPA 1N0WA 1CY4A 3IUQA 3TD6A 4BLVA 1VCNA 3RIYA 3P9ZA 1HM5A 1LFDB 2RI1A 1DC5A 3EAGA 2HTFA 1YXMA 3MS4A 4ZKEA 5KNCH 3PLRA 2J9XB 1A8IA 1WHSB 4LEIA 3R9XB 1QK4A 3ESQA 1W4AA 2VTEA 3C0KA 4RY2A 1TTPB 4ZC8A 1U6IA 4XWWA 4K3VA 1YH3A 2FN9A 2I80A 2Q5LA 1Z8NA 3RAFC 2AYYA 3HZOA 2YBDA 4EI2A 3HYSA 2B99A 1ZRMA 1PT8A 3JQGB 1OU4A 3IH5A 1GXSA 1P0IA 3THRA 3PSHA 3KZKA 1ESNA 2B94A 3DDCA 3QUSA 3SEQA 1TNDA 4NYJQ 3T7SA 1RWKA 4ZAFA 3ZE7A 1XRMA 2P9FA 1P6UA 3NWOA 1G59A 4IFEA 1QMPA 1OBVA 1QG6A 1JI0A 3ELUA 3JS5A 3PGLA 3Q7QA 5LUBA 3VPDA 4OXKA 1Q2UA 4P93A 2AW3A 4C01A 2XZPA 1KEWA 4I9GA 1E1MA 3B6JA 2F64A 1KJWA 1R50A 4C7JA 5I51A 4MIYA 2XZOA 4AZVA 3EWIA 2IY9A 3O75A 4IIJB 4RHTA 2JLRA 3EQ7A 2QJTA 1LSUA 2OXRA 2QN3A 1JV2B 1R0LA 2OK8A 2MU1A 4IQFA 4LX8A 1DAEA 3T5MA 1Q11A 4Z5XA 3AGPA 4NOLA 1EUZA 1IZZA 3IP6A 5I47A 5FWDA 3UM9A 5ALVA 4OUDA 4GZ5A 4FMDF 4BEVA 2NUTB 1UDXA 3LCCA 2NU8A 3MELA 1UOPA 2AK3A 2NPOA 2XGGA 2XTNA 3DMRA 2PXHA 3FR8A 4FNAA 2G9NA 4CLHA 4BO7A 2FPPB 3H84A 1ZU5A 3BCUA 4V0RA 1XQXA 2VDNB 2WBLC 4BTLA 3KT8A 1I94B 3BA1A 2YUIA 5UKDA 1VG9B 2HCRA 4YBRA 1FP2A 4XGKA 1EIZA 2H2AA 2A84A 3LFUA 2GCNA 3WRYA 5DSXA 2EEPA 1C3LA 1YTLA 1GPNA 3U49A 1BE0A 3ONFA 3Q12A 3VHLB 5JWHA 2Q7XA 3CA8A 3LUGA 5K8CA 4RIIA 2H1VA 2VDPB 3G2KA 3VR2D 2FSFA 1WLSA 4DT1A 3EG5A 4A10A 1TF2A 1BE6A 1U3WA 2JJ8A 3KYIB 5DYYA 2C2BA 4RXMA 4WBNB 3GDGA 4PG4A 5IJAA 4YHBA 4OAOA 1XMQB 1JLSA 3WISA 2BEWB 3W6NA 5KZMB 4U4AA 1K5GA 1K06A 1FVHA 2A88A 4LDQA 3LQRA 1JQAA 3CX4A 3DYIA 3QKWA 3VTAA 5EESA 4YRSA 5A4IS 4NV3A 5FBWB 3EUFA 1NW6A 4HQKA 3DAPA 3OTHA 4Y6RA 1EBFA 4JYMA 1D8TA 4OGKA 3KETA 3CLRC 4G0PA 2JFWA 2PSHA 3NHYA 1Z6TA 2CJYA 3NNDA 4M76B 3N59A 4YXWA 4BGEA 2QN8A 5AI4A 3IOBA 4DSAA 4MRNA 2G8NA 2ZT5A 3HY6A 1DRVA 4Q4HB 1SOVA 2BJWA 2X0IA 1KNXA 4TS4A 5BPFA 2JGRA 1QH0A 2R6GA 2NXCA 2QRKA 2NO5A 2WG1A 2XV1A 3CCCA 2I78A 4CLXA 3FUUA 4IHQA 3HEBA 1NP3A 2G06A 4AWAA 1ZK2A 3LI2A 3UKDA 3DC2A 5E95A 1HYBA 1KNQA 2YQ4A 4MYUA 4P54A 1EFPA 5I7HA 4YWHA 3JQ6A 4KOEC 4QBTA 5LN1A 5GZ3A 1LVUA 4U7PB 3PUYA 4Z51A 1YJAA 4HWGA 4JL6A 1DO8A 2ID7A 2OSBA 4ND5A 3TQOA 1CUIA 1TT5B 2GBLC 3MINB 4DSZA 3DFUA 4KVZA 1DAIA 1ECGA 1N3LA 4AULA 5HGXA 3D7LA 4RDHA 5E6SB 5K2OA 2EP5A 1V8PA 3MYYA 2PZEA 5DIZA 3IKJA 1LXCA 3AV3A 2WVJA 3HKDA 3W1EA 2J0QA 3ROKA 1MC1A 2G88A 2WIGA 2ZSKA 3I1YA 5DGTA 5FI3A 1SVNA 1AKMA 1AHIA 3MTQA 4TXNA 4N40A 5FADA 2B2CA 3EIXA 1RXCA 1B00A 1J8DA 2MSLA 1R8SA 3TEJA 1M2JA 2D7CA 4POOA 5J2UA 3C3JA 3CEMA 4M9XA 1PEKE 1D2NA 3MA0A 5KYUA 4JJ7A 3SC6A 1P4GA 2PN1A 1F2UB 4OU4A 5JQGA 3H17A 1HDCA 1OW3B 1KC1A 1GUAA 1ZONA 4RK5A 1BKDR 1YBHA 1X2EA 2NPFA 1NN5A 2A9PA 1V3UA 3UA4A 1HYHA 1ULZA 3SP1A 2H2FA 2ZDHA 4OXNA 3WAGA 4RH0A 3FY4A 3HU3A 4GZ3A 1WCYA 1N6PA 5F77A 2TSYB 4E1AA 3E5HA 1MIOB 4AC9A 3DTVB 5FLXA 4K6KA 5FBQB 3BB3A 4YUVA 1NHGA 1AZWA 2BLLA 1P7YA 4B32A 1GLGA 2ZI6A 4DIKA 3T1TA 2C2XA 5GINE 1W36D 5AI5A 4HRYA 3B70A 4WECA 3UAOA 2C61A 4TV9A 4IYRA 1EGMB 1M2HA 2QS9A 3A0RB 1H5UA 1NLMA 3C24A 1F0PA 3FWYA 3HJBA 1F2TB 2Q6TA 3L4SO 3PXEA 4TUYF 4XM0A 5IKEA 2GN0A 3A6FA 3K1AB 4ND6A 4B09A 3E9YA 2PGXA 4RELA 3FPAA 2C42A 2HWKA 3OZVA 2WWIA 2IYFA 1E1RD 2HXYA 3D6MA 1N0UA 2WOJA 4O4IB 4O2AB 1N7GA 1TVKA 1JH8A 4PQRA 1QNLA 3IVCA 1FBTA 1XZPA 4W7HA 1WU8A 3K53A 3TD9A 5JZSA 1ML3A 2PRKA 5AVTA 3PU6A 3SQLA 5BSWA 1P4SA 4Q03A 4BU1A 5KEIA 1SEVA 2NV6A 3JR3A 3O93A 4UE2A 2J0SA 3C39A 4R3NA 3STUA 4DWJA 1Z15A 1XLTA 2ZKLA 2YYSA 3HUEA 1RWVA 1VP9A 2VN8A 4YAWA 4CM3A 2CDAA 3PGA1 1BGXT 3QVMA 1ULBA 3ZCRA 4C05A 1F1BA 1MBZA 4B3RB 2LV8A 3QU2A 5B1DA 4EJSC 5AKJA 3K6KA 4MQEB 3PIDA 3ZU2A 2E4ZA 5E6RA 2YN0A 3CWZA 2OHOA 3WJ2A 3ZCPA 1I1NA 4B2PA 4UBIA 4RTRA 2XLCA 2JFPA 2G28A 1RCTE 2Y6UA 2RGBA 4J0HA 1OX5A 1OB5A 4OH7A 1EE9A 1MFPA 2KBFA 2QJRA 3F78A 2Y1DA 3B6ZA 4UEJA 1P72A 1PF7E 4HFRA 4RS4A 1Q20A 2CFCA 2HDNB 4M1EA 4PWZA 2JFNA 1SELA 3C6KA 1H3NA 4GOMD 2FZCA 3DCIA 5J9FA 5EXXA 1U28A 2A2ZA 4B31A 3VPGA 3I2KA 3N2KB 4Q12A 4M36A 2P9CA 4IDNA 4BX3A 1AQ6A 2D3TA 2VDLB 1RC1A 4RKFA 4BCCA 4YV2A 1SHUX 1HDGO 2YV4A 2CB9A 3SS8A 4DBLE 1SVSA 3B3JA 2UUCB 4M1SA 1ESCA 4DA0A 5C18A 2FWPA 3GL9A 1CUJA 1EFTA 3OHPA 4ZJUA 4DZZA 3PFBA 3T3PB 4YAJA 5C3MA 1KRHA 2XCQA 3DV0A 4LGMA 1BW9B 1AM4D 2ZPUA 4TYYA 421PA 2X23A 3FUVA 4NNJA 4PAGA 2IS4A 2I2XB 4V3CA 5L40A 3MT7A 2VP5A 4IIVA 4ML3A 4FWTA 2JGAA 1Q16A 3PNOA 4BB5A 4AURA 4XM2A 4YS6A 1T4CA 4RFLA 3O9VA 4IDFA 1EFVB 2HK7A 2C7BA 1SULA 4C0JA 5SYMA 2WUWE 2PTGA 4CN8A 2WM9B 1G8PA 1Y4UA 3FXAA 1MABA 3IESA 1JYEA 1XAHA 1DE0A 2G9UA 3TO5A 4A16A 3H86A 3P2EA 2QIPA 4P6VF 1VLZA 3QELB 3W5IA 5A5VA 1I2ZA 5J5CA 2ZJ1A 1JYFA 1DVRA 1JAZA 5DM1A 4IWYA 2J6BA 1GKUB 4OSPA 1NT2A 2PT6A 4NH0A 3BGIA 4QEZA 5SYAA 4BDSA 1XP5A 2C78A 4G0MA 1L4YA 1GU1A 2X2PA 3R24A 3ZPXA 4A8PA 3FPEA 4P92A 4RM3A 1NN1A 3D8TA 4Y1GA 3ADKA 3L40A 4B9AA 1SH7A 4RE6A 1KKUA 4KVFA 4RAQA 4TTSA 2VPZA 5AM0A 5GP1A 3P2OA 3V00A 4DS3A 3OEWA 1MO5A 1VL8A 3A3PA 4XW2A 3U7IA 5IX8A 3C5CA 3M9WA 3TBKA 4KIWA 4NBKA 1PTJA 2QX9A 5J5AA 4FNOA 5BWLA 3TNYA 4OHPA 4JBYA 1Z2PX 3LHIA 4MA0A 3UT0A 5JROA 3MTIA 2R8BA 4UD2A 4A8TA 1R10A 2PGJA 2Z3VA 1S1MA 2Q2VA 1H66A 3EIOA 3GF4A 3RGGA 3MJVA 3ZQJA 5A5EA 1SOMA 4NV0A 2GEJA 5CD1A 2DPXA 1WULS 1FDIA 1VJ0A 3AOEC 5H1YA 4D9FA 4AJ2A 2OCXA 5HCNA 4HN2A 4Z1MD 3Q8XB 2Y92A 3HKBA 1H0KA 4RHCA 4WN3A 4KQHA 3IMKA 1NW5A 4ETIA 4WFQA 3ORHA 1MO4A 1ZJYA 1JL3A 3UF0A 2CGEA 4Z86A 1N36B 3OQ1A 4JSRA 1TJYA 4G25A 1M9NA 1J21A 1NXQA 3L3BA 1NAIA 1CQIA 1LDEA 3HJGA 3BMQB 3DXYA 5TB5A 4QYMA 2XYVA 4JQZA 3WRWA 2Y77A 2JCVA 4F96A 4NZMA 3THWA 3VNSA 2A57A 4QO8A 5C1BA 4YT5A 3CGGA 2OPBA 1SQGA 2IHKA 3OLVA 4KJXA 2IF2A 5K4GA 1FX0B 4EY6A 4O4JA 5I7EA 4QM7A 4D4IA 4XVUA 1SIBE 2R7LA 1XTSA 4B74A 3GW8A 4ZVRA 5CDFE 3QH4A 4HMOA 4D3XA 1GZ7A 1YAHA 3EIHA 3UTDA 3KKPA 3IFSA 5AW0A 4G6ZA 3OHMA 2C5AA 2AFIE 1P73A 2XXAB 1WCIA 4EK9A 2H06A 3DXFA 5LNK6 5EHZA 1RJWA 4EY7A 5EP4A 3EC1A 4PZ0A 3SM3A 1RPTA 4J91A 1V5FA 1A88A 4KJZA 3WZ2A 2Z08A 5IYZF 4ALJA 4DCSA 2GWHA 5CVJA 4EPYA 3GRVA 2WU1A 5J47A 1ZINA 5JNSA 2DQSA 3IQZA 5LB2A 4EAAA 4KQ6A 1JVBA 4Z99A 2HA7A 1N3BA 2O0HA 3PXAA 4IY1A 2DULA 5CLQA 3WVNA 3IE0A 2HTEA 3WB0A 2FMXA 1FOEB 4INJA 1DV2A 3DXXA 4N5HX 1EHYA 4DIUA 1OIWA 1J00A 1POWA 4CL3A 3BIXA 1M6EX 4FP9A 2QN6A 1E0AA 2BFDB 4X3OA 2QMEA 4JR1A 4NCXA 4Y2QA 5E0KB 3QPWA 4INPA 1QCYA 1RRVA 3ONDA 4PM4A 3X1XA 5HGJA 4R1TA 5EIWA 5JI3E 2J67A 3CX3A 1G8GA 1BJTA 2EOAA 4NJEB 4DQDA 5B55A 2AMVA 3VU0A 4GMKA 4ZODA 1QUEA 2BMFA 2OB2A 3ABIA 4NAVA 5FUMA 5LDDC 4YREA 3NKLA 3Q7IA 2GCPA 2JI6A 4UM5A 5IRCD 3HBJA 2J7PD 4ZGWA 2DETA 3G2IA 1JVNA 3UGTA 4TV8F 4RQBA 2PH7A 3AUUA 3P20A 5BRJA 1NDUA 3VR5H 4YR7A 4P1ZA 1DKLA 1US8B 2ACKA 1L7AA 2OC9A 3C14C 2C31A 4NL4H 1IZYA 4Q5IA 3VZDA 4C4SA 4C6RA 5BUQA 1VLQA 2CLCX 4RJ2A 2WSBA 1T8YA 2OG2A 1NZFA 1O96B 2XWSA 4HMPA 2VHQA 4JL5A 4WXYB 2JJ1D 1ZYUA 2C5EA 4Y2HA 2OFXA 3JARB 4FS3A 4ESEA 1P0MA 4F3YA 4ROTA 3ZGNA 4BCBA 1IHUA 1QF6A 2G6BA 1F48A 1JB1A 3K1JA 2ZS7A 4BCDA 5JI2E 2QTMA 3FG9A 1U0HC 4OLBA 2YRXA 5JAHA 1Z6GA 5DBHX 4DCNA 3T1HB 1DKPA 1R9JA 4XWTA 4YJ2B 4CV1A 3IT0A 4C76A 3Q2OA 2AQ8A 2XH8A 2ZSJA 1QTRA 4TLAA 1WA5A 3OP1A 1W94A 5CBPA 3C7TA 4DJEC 2IXDA 2IYOA 3ZVRA 3JYNA 3TNJA 4HSGA 5FQOA 3DNFA 5ANRB 4OFWA 1P5FA 3QLUC 1QV7A 2R5WA 2B8WA 1E2KA 1KU6A 4AECA 3CLKA 1YR7A 2XNHA 3AVQA 5EIBC 5JTUA 2Q4TA 1MEJA 4TWAA 3UG6A 1Z2OX 4BE9A 4N8SA 4AKIA 2Y1XA 2GJ4A 1UZUA 1Y3FE 1ZKMA 1X9IA 2J1LA 2ZVJA 3HA3A 4QGSA 4WPGA 2L2QA 2A35A 4PGHA 3SC4A 4JA0A 1SPXA 3CE6A 3U9SA 2Z2ZA 5B2FA 4YMGA 1SKBA 2OR3A 3I28A 4BTEA 2JFOA 3MJRA 2GB4A 5H16A 2RK6A 1TO2E 1BHSA 2W8BA 3PIIA 3QWFA 3TW0A 3EVCA 4CODB 3TLAA 5B7QA 3DZCA 1D7AA 1P1CA 2CLDX 1P9WA 3G5MA 2E82A 4E11A 3ZHZA 4OQQA 3VKFA 1X74A 1NWCA 2KLBA 2ZUUA 3AUAA 4G9GA 3MRVA 3BXEA 4M0KA 4ZVOA 4BRUA 2XECA 4CIVA 5IZ4A 3WFJA 3EISA 4ON9A 4BMNA 3SOPA 2E0IA 3KFLA 4EMUA 2XUQA 3VC7A 3HSSA 5AVWA 4E5KA 1SHTX 3C15C 2H4ZA 1VCIA 5K8JB 5HS6A 1I6LA 4KBYA 5IWAB 3V8BA 2VK4A 1NI4A 1F60A 1XDDA 2PMDA 3LCUA 2AG8A 3ZD6A 1M2WA 2NTJA 2RG7A 3FCUB 1GAJA 2FPSA 3ASYA 3VTFA 5FV4A 3FH0A 3G23A 4N6NA 3OF5A 5EAIA 5IJ0A 1Y5LA 2VCYA 2VJBA 4BX2A 3E9RA 3AB3A 3A1SA 4H0CA 4EUHA 1RXIA 3HM9A 1IDN1 4XAQA 4CR6A 2ZSEA 3AR7A 3Q1KA 4TSFA 5A02A 3HVKA 2G9RA 4G5XA 1WM1A 5A04A 2A4KA 3HBMA 3RVMA 4L16A 1QV6A 1N8KA 3KAJA 1FE8A 1WMFA 2ZULA 2RHRA 4OYYA 2HSJA 1IB6A 1OGIA 1I30A 1X14A 1KETA 2KYRA 3FTNA 4TRNA 1KZHA 3RRYA 3SC2A 1X7HA 2WJYA 1BDIA 3LIIA 4JI5B 2FDRA 3RKSA 3RVRA 3ZW8A 2RHHA 4IO1A 3TZLA 2GN2A 4UEQA 1EJBA 1UBLS 2JRLA 3LE8A 4P4GA 2OTCA 2ZR9A 4KWCA 4CKCA 4NFSA 2C3YA 3DTVD 3LAWA 3TJRA 2Z4RA 1J1UA 4A7PA 1S89A 2CVFA 1L8OA 2QWXA 3VV3A 2H31A 2J4FA 1SUEA 5F23A 4P3PA 3DVSX 5F35A 2AYZA 1TM4E 1WE2A 2DRIA 3VPHA 2W6PA 4W7SA 3WIEA 1HQDA 4ND1A 2WSIA 3WDMA 3FRIA 3KHTA 3D2BA 4I4IA 3T3IA 1GZ4A 1YCGA 2PNJA 2WWRA 3I12A 3IA2A 4G1CA 5HKAA 3ZXUB 4PHFA 5CX4A 1IHYA 2QIOA 3TPFA 3BCSA 3TTSA 2BGTA 3UW3A 4HXEB 2H4WA 3ICPA 2P3OA 1QFJA 3D1JA 3BRQA 1WUJS 2HJRA 3QQ5A 3JY6A 3NWEA 1I51A 2XOKA 4ZU6X 3ULKA 4UNRA 5CG1A 4JUDX 1KZGB 2J48A 4JU9A 5E7JA 3S7TA 4MGIR 4MICA 1UPAA 2JLCA 1K63A 4BAGA 1I3CA 4S1OA 1O94C 1XALA 2JKVA 2ZZKA 2FW7A 1L4LA 5F4BA 2PUWA 1FXUA 1Y37A 1HLDA 1I3LA 4O2LA 1VE9A 5IUNC 3ZKWA 4FHDA 4RZ3A 1P6QA 4R0MA 1I32A 1CJMA 1VHJA 2VFAA 2BF7A 5EJ6A 1DDGA 3F74A 1R6DA 2WMDA 3L8CA 1G60A 2BFNA 1KEVA 5K3FA 2ZUWA 3TLXA 1T13A 1I2AA 4HNAB 4UUPA 5JZOA 3O21A 1QXSA 1STOA 1RM4A 5JIBA 2MINA 3SLGA 2R8RA 3KLMX 5AKIA 1DXHA 1UJNA 2HV9A 2V98A 2H4YA 3A1NA 4J1QA 3WMEA 4KL8S 2MCFA 4JLMA 4KN9S 4G5RA 1EBUA 2SBTA 3G6WA 1WQ3A 1NW3A 4URVR 4F7WA 4OXYA 4DSOA 2H52A 3N8HA 2V45A 3GJSA 1B76A 3OE7D 1EXMA 4EHBA 5A5FA 4MV3A 2IKSA 4P4UA 4AWBA 5IS2A 1EM6A 1RI3A 2RAUA 2P11A 5LA6A 1Z6ZA 5AVZA 3QE9Y 1YB6A 1OH8A 1W581 3LX5A 2IUTA 2XUJA 2YFKA 3BZUA 4WZAA 2CCJA 2YY6A 1HEIA 2IUYA 1YIDA 3QKSB 2DY1A 5CCBA 2WW8A 2DFVA 5JSQA 4B6JA 1OXTA 2YFQA 3WE7A 1TADA 1UBGA 4PHTA 5F12A 3SJCA 3ZWPA 2VSOA 1Y1SA 4D9IA 1UPFA 4IUBS 4CEJB 1L7NA 2GXAA 4L0QA 3NXKA 2A92A 4ZYWA 3A4MA 4CCAA 3OOEA 2EXXA 2JZNA 4AU1A 1XHEA 3LNCA 2AT1A 1LU9A 1RWQA 5A3JA 2O8VA 4WK4B 3GP5A 3UCEA 3MMZA 3R09A 1P77A 5EWLB 4RPHA 4EI9A 9LDTA 3ZJTA 2JH8A 4E2FA 1H6BA 1LA2A 5K09A 1YZHA 2JJ2A 4X1IA 3D1LA 2G71A 1IE3A 1GTL1 1JTEA 1NVWQ 2Y2VA 4C0KA 5CFRA 3ESDA 1CV2A 1PW5A 1Z7GA 3EF1A 1AK2A 3IXMA 4FN5A 1E2DA 2X8LA 5I7SA 4W7IA 5EP1A 1CUHA 3JQDA 4KXXA 4WEOA 1P2GA 1KAHA 1ZM4A 3WXMA 3T5AA 3M2PA 3RFVA 1JIIA 4R2XA 5AFSA 4IVQA 1U7DA 2V6GA 4RIFA 5J2TF 3AP2A 4D0NA 1KJJA 5AVRA 3CJTA 1V2GA 1R0CA 2EW8A 3RBZA 2ZJOA 4H3HB 3L7DA 4HSEA 3FNRA 1MXHA 4WOBA 1ZH6A 1OPRA 3O74A 1TQ6A 1R4AA 3NDIA 3AKEA 4FMDB 4PBRA 1TKRA 1IOWA 5EZYF 4EEZA 4RH3A 4FBMA 2CLMB 3DE4X 3OPYA 3ANTA 1UINA 2QSZA 1BWSA 1J2EA 5T4EA 4AF8A 1CZLA 4N7BA 4O0LA 1R4MB 3GELA 1EVZA 4PG6A 3QBVA 3BXFA 1YS6A 2IRWA 2V4UA 2ATVA 5K6RA 2X6RA 4MVJI 1P74A 3D0QA 1G8FA 1DBIA 1ENZA 3HJCA 1M0TA 2FOLA 3L6EA 2J3MA 2BLNA 1IEWA 3MTEA 4G0QA 3W9YA 3DD5A 4OXRA 1R0KA 1W8IA 1T4MA 1E61A 4FHEA 3SQOA 3WQRA 2PVSA 5BW5A 5DF1A 5LZ2A 1TK3A 2AW5A 1L3CA 1ZH0A 4DCVA 4E21A 1JDJA 1WHTB 2WFAA 3U3ZA 2PA3A 2Z5GA 5HXAA 1JLLB 2I7VA 4KGVA 3RVSA 1HT2E 2W90A 4RORA 5B4UA 4YCCA 3QTLA 3CZ9A 4E2WA 1YBFA 2YCBA 2IYVA 2ZRJA 3AFNA 4GMXA 4ZCTA 4Y2JA 3N6VA 2VT2A 2CXPA 5BT8A 1DIBA 3K3PA 1DAGA 1PR5A 1SC9A 5LL6P 1WQ4A 1DKMA 3HB1A 3I39X 1XA3A 5T6BA 1C7ZA 2W6JD 5JCOA 1BSVA 4WFJA 2NUAB 3P9YA 2IE0A 2SCUA 3DV9A 4Z9AA 3RSQA 1HEUA 4NVRA 5BSVA 4AS1A 3GVIA 3W06A 3G3EA 4Q3KA 1UJ5A 1D9ZA 5CB6A 1PR6A 1ZMTA 4FDLA 2P9QA 3HO6A 2ASVA 2ZUDA 1R8YA 3ZIUA 4LYHA 5JNLA 3A6ZA 2ZE5A 1C1DB 2DC1A 4J0QA 1A2KC 2ANBA 4TVSA 3HSYA 3OICA 1DXOA 3PV0A 3PQ8A 3GCDA 2YXPX 5B1IA 3SDBA 5A62A 3GGOA 3UICA 4HV4A 2XUDA 3AEUB 4CUKA 3BQNB 4A0FA 1L5ZA 1R0RE 4HY3A 3GLGE 3WB1A 1T26A 1YIAA 2FSIA 1NI3A 2PX4A 1V9SA 1V48A 4J4BA 4EKEA 3EVGA 1E3EA 3N2LA 1W0KA 2SNIE 4JMPA 4REOA 4YPOA 2WJAA 1FFWA 3GUUA 3QBJA 5JBIA 1KYYA 3H6KA 3OTGA 3RWOA 3U13A 5EWJA 4PQFA 2FUG6 4TRJA 3I3SR 4TS3A 4GT1A 3WICA 4BMOB 4LC1A 1A9YA 3QUAA 4PAQA 1ZR2A 3GN1A 1JGTA 3OZ7A 3TINA 2RONA 3V8MA 5AJUA 2DCMA 2GVNA 1TM2A 1KMNA 4DC0A 5M2QA 2K6GA 3RQSA 5ULLA 1M1NA 1WP9A 1TF7A 4C7KA 3RJTA 3A6JA 4LBYA 3OKAA 2H07A 1E9CA 1NR5A 2OHVA 3TCKA 4FOOA 1G9TA 1G64A 2H1HA 5EMKA 3EMVA 1QORA 3RFFA 1WSBA 3B53X 3H04A 2Y0PA 3CPJB 3AVXA 2H8GA 1JJ7A 3JWGA 3ZLBA 2UUOA 1XRJA 4CIBA 3Q3EA 3PDIA 3KVNA 4J0IA 4WVLA 1V37A 1TM5E 1Z07A 4RENA 2BMJA 1P6XA 4KQ2A 1YVRA 2VAPA 4KHZA 3I6BA 4YRJA 1FDTA 3QA9A 1VXRA 1E5XA 1WV1A 2I3GA 5DH9A 5KWVA 1RC8A 4IXTA 2WG2A 4JBXA 2B7LA 1FQWA 2A5YB 2Q3JA 1P3DA 3K0CA 4FXOA 4CN9A 3KVOA 1Y9ZA 5M3BA 4JL8A 4LF5B 1NVVQ 2OXTA 1T43A 2VHZA 2ZE8A 4RCYA 2QNIA 4ZICA 1E2UA 3SQDA 4TUYB 3T7IA 2PKRA 5DNVA 2TYSB 5A4FS 3I5XA 5SZJA 1CUVA 2VC2B 2BW0A 3W3AD 5JHGB 1QH1B 3HXQA 1NHWA 3U4CA 4QYXA 2D3WA 1W0KD 3OD5A 1EZ4A 1A8HA 1OXKB 4PVCA 2HT6A 2WD7A 5KNDH 1K89A 1KA9H 2ZI4A 1ZC3A 3ZK9A 4F93B 2JLVA 3SC3A 1RRKA 3I9NA 1L7QA 2JJMA 5KBYA 1TDJA 1ZOSA 1FYDA 4I66A 3E48A 4WK0B 3FCCA 5BUZA 2KI5A 4LVOA 1UPBA 2PV0A 1Z0KA 3G0BA 3WJAA 2ETVA 3UMFA 1SRRA 1ANKA 5LZ9A 3GFQA 4QWWA 1Q1AA 1WDWB 4HFNA 4KPGA 1QHNA 2IF0A 3PXGA 4Y6GB 3AHHA 1JHMA 3ETJA 5KOJA 4PC1A 5DISB 3KV3O 4ZOLF 4FQ7A 1U0SY 3AEQA 3AM4A 5ITZA 2XCSB 1YRBA 3SX2A 1EVJA 4YAFA 2YASA 1OAAA 1CIPA 3ZLTA 4P0PB 2JGFA 5A6SA 2IYZA 3B5IA 3FPHA 2DUMA 5TPWB 3SBOA 3GD7A 4XUDA 4CUZA 4PRYA 2Z0MA 2HN9A 3DT6A 3AERB 3KD2A 3DR5A 4UXIA 3R7SA 5CFQA 2EJTA 2W6OA 1I4OA 4KQEA 1KYQA 5DGHA 2OFWA 2BZ1A 4CIYA 2IU6A 4XKJA 3EZ7A 3IEVA 2CB0A 2O8NA 1T9AA 3C3BA 2OMKA 1DKUA 2I4NA 3KE9A 5KJ1A 1UFRA 1HC7A 2I7XA 2IE8A 2WJGA 2ZI9A 3CV3A 2I76A 3IHWA 4OYHA 2JAOA 3KM0A 4UQLA 2ZKIA 1I8TA 3PTAA 5EIFA 1PVOA 1QCZA 4QRHA 1ZJJA 3IO3A 2A33A 2ZWMA 5AOAA 3STXA 4EATA 5C4MA 3G5LA 3ABSB 1PR9A 3HBFA 1TMOA 4M0LA 2O2EA 3TLGA 1BCRA 4BC1A 2GF9A 5A4JA 4HLDA 1U0BB 3OFSA 1IOZA 5GONA 4NBLA 2CNWD 4RJTA 2HIMA 2CFOA 4S2UA 3U4GA 4C7BA 3KR2A 3FYCA 2H18A 3I2JA 4IOLA 4MVJA 1WXQA 1YR3A 4ZEVA 1QFYA 3V4OA 3K5PA 3HY4A 3L18A 3LZDA 3L6BA 3C6MA 4Q7QA 4N01A 4YRCA 5B7GA 1H9CA 3QM1A 1QH8B 1T5LA 5HCIA 3ZBUA 3LOUA 4L78A 1CQWA 3FAKA 3QV1A 5DT2A 5T67A 4C0QC 3EGXB 2CV2A 4QXPA 4YJFB 1N9KA 4KB5A 3REFA 3VUEA 1JJBA 3N2GA 4D9CA 3AV0B 4B6GA 3IVXA 1N0IA 2FXIA 3KVVA 4EW6A 1EFUA 4WESA 4EL0A 3CR8A 1KIAA 1TO6A 4O8ZA 3FFTA 4WXMA 3RSGA 4P9NA 1RJDA 3NB0A 2F7SA 1V6SA 2BM0A 2FN8A 3FKQA 4JJEA 3GUYA 2XGMA 1YNSA 1ZI9A 5B4VA 4X1OA 1DOAA 3G2OA 3OCXA 4BEBA 4Z2AA 3T7EA 4LA4A 2E4YA 4MW7A 3SICE 2FZ5A 4FFBB 2H85A 3MM4A 4A23A 4ALMA 1NW4A 1QFSA 1CF4A 4EHFA 5IBCA 4MPJA 4PR3A 5GY7A 2WLSA 4FK8A 1I24A 3AF1A 3AHEA 3OT5A 1W85A 2I8LA 3V33A 1CT9A 1UQRA 1JMVA 3ZDXB 2RGXA 4L57A 3HTXA 1X7YB 4BNNA 4FM9A 2ZYUX 2FK8A 1W9HA 1ORRA 4GICA 1DG3A 1V7CA 3GIWA 4J07A 4BBJA 2ZRMA 5KI6A 4Q4JB 3AZOA 1YJBA 1LNSA 5AW3A 4R4JA 3OETA 1K7FB 2X13A 4PLTA 3LTNC 3G17A 3AETA 3EY4A 4AUNA 4DC1A 3FUTA 4D1YA 5EXDA 2V6FA 2PY6A 1GZSA 4LSGA 4RF2A 3DFIA 4FDUA 3B48A 2L82A 3AIIA 4BGIA 1Q2XA 2YVAA 5JC1A 4P36A 4QAJA 4G5HA 4AJ9A 3HC7A 3H83A 4FN4A 3THSA 1AQJA 3QRWA 5CFPA 1RHJA 4B6SA 1AS2A 2BD0A 2QUIA 3L4BA 4AP6A 1FFYA 1KY3A 2VYVD 3I45A 4ZARA 3WAJA 3GGCA 1ZCBA 4R2IA 2ZBVA 2YIVX 2C96A 2CMGA 3LP5A 4FNMA 4HAOA 4KMOA 4TOIA 1R4NB 5HFAA 4RLQA 1R37A 4RFVA 5IYZB 4TYNA 1NBWB 4ZOAA 1PE0A 1SU6A 3PYLA 2OORA 4H7IA 3WLKX 5I9NA 1D6NA 4AJ4A 4HUTA 4M2LA 1DQSA 2NSYA 4HNQA 1BXRB 2R4QA 3THOA 2RGUA 4MV0A 3PL1A 3TMAA 4RCVA 4AYWA 1K27A 1YOVA 3FVWA 4MJ3A 3ZIDA 4RTPA 3BHMA 2JA2A 4IGEA 3OJ0A 2J46A 2R97A 3FFWA 2AXQA 1GPMA 1PGNA 3KPUA 2HQ1A 3ANYB 1T9ZA 2GF0A 2IHUA 2PKQP 4RMHA 4U7HA 2XW6A 4ARZB 2IH4A 1V1JA 2C4HA 4M1TA 4Y1FA 4UVHA 1JG6A 2X42A 1U7OA 3HG7A 1ADYA 4L2IA 2BFBA 3GPLA 1YZ3A 1EWYA 2B61A 5ECGC 4ZVKA 3RARA 1KRWA 4RMNA 3TTYA 4GOOD 3UJ8A 1F17A 1VHLA 3KFVA 4GC9A 5I4BA 3CKMA 1L5MA 1XA4A 2I87A 2HXSA 2FWJA 2R0QC 5EJIA 2VUHB 3UOAB 3QF4B 4GPIB 3CB2A 4GLOA 5DBGA 3NP9A 4KDFA 1IOLA 4JLSA 1G5IA 3DV2A 4LFCB 3VQTA 3SHVA 2V6IA 3ASVA 1TUEA 3JD0A 3RRXA 3K0FA 1T15A 2ZAGA 4BGDA 4I50A 1O95A 4CF5A 2DWUA 4TV8B 1SZPA 2C2OA 1PFWA 4ZALA 5AXAA 3DDZX 1WTAA 1U3FA 2FWRA 2IYQA 4GX1A 4HZGA 3TSYA 4A5OA 1TK9A 2O2HA 2C03A 4MULA 3C6BA 4QSMA 3UGQA 4OFBA 4WLFA 2FMKA 1V26A 4RM2A 3UTCA 1HV8A 4OQZA 5CJ2A 4KAJA 3ETDA 5JDIC 3HYTA 3KJHA 1ECPA 4EHJA 1L7BA 1ZD4A 5HF8A 1N5OX 1Z5VA 3NTQA 1N7HA 4NE7A 3KT6A 3EH2A 3V4LA 1KF0A 4TMWA 3EULA 4XJSA 5KNCD 2OO5A 3WQQA 3OC6A 4ZVPA 2ZYVX 4C29A 1Y7IA 3NNNA 3T9DA 1J97A 1M0EA 1UZMA 1PFQA 4DABA 5KQRA 3T4EA 5EP2A 1T8SA 1WSWA 2CBGA 2AMFA 4UDNA 2YHIA 3TCNA 1PS8A 5D3QA 1BFUA 3KJIA 1YFJA 3E27A 1JWLA 1ZZEA 1B73A 2WHXA 1Q7GA 2GJAA 3IPXA 3VISA 2C9DA 2GCEA 1R3DA 1VE7A 3DUWA 2AE1A 4D97A 3TJMA 4IRXA 5JRDS 2B78A 3KPJA 2KE5A 2QE7A 4MMYB 4P86A 4EYKA 4FE4A 4ACAA 1YRAA 2IEAA 4D4KA 2VQFB 3R4VA 4M87A 2PGLA 3MJTA 4AKEA 1ZIPA 1YA4A 3K5HA 4N7MA 4WFKA 2KX7A 2ZXEA 3FJ1A 4D45A 2FFHA 5JPDA 5AW2A 1WEKA 1DC8A 2ZIUB 3MB5A 4LWQA 3OMWA 3VGPA 2UYGA 4LIPD 2WG0A 3SGLA 1RYZA 3VYTB 1N6OA 5FT9A 2ZYAA 3F4BA 2IXFA 4M89A 3HPQA 4WW0A 1HE3A 1RAEA 2RGEA 3LRXA 3NFYA 4JWTA 3SR4A 1AHHA 4EJSB 3UMBA 4F9EA 1W4RA 1FRFS 4MS4B 1U2EA 1UDWA 1W76A 3NHKA 4JJ4A 3QTTA 3VDMA 2UXBB 1T8WA 2QENA 4JVSB 2AI1A 1VBFA 5CW1A 3IQFA 4CLRB 2WK1A 5IHXA 3QX9A 3ACDA 4MHOA 1C1XA 2AEEA 3EFOB 3LO8A 1NU6A 1VCHA 5T6MA 4ETMA 2FZEA 5AUNB 3ER9A 2PMBA 1BHO1 1WWKA 3AL3A 2KSQA 3G8DA 3ZKAA 5LUAA 1NZJA 1OFTA 4QJ3A 1HDRA 3INNA 2WILA 4X8OA 3UNXA 4FOSA 2B8NA 1L7OA 4R1SA 1TCUA 2JGLA 2FR8C 4BLUA 1QHEA 2P4UA 4F3KA 2QRJA 3EQ2A 3PXBA 1AMUA 1P39A 1WKVA 3A25A 4MW1A 5DGXA 2J6HA 1F7VA 1IVNA 5LJLA 1P1JA 4QUKA 4CF4A 4YACA 4RX1A 4DLSA 5ARCA 4QBIA 2GYVA 2X3FA 1W5FA 1ZIOA 4JEUA 3HB4X 4RA6A 3B78A 1L8AA 3TF5A 3GCXA 4E12A 1RI2A 2FUNB 2I7CA 3V80A 4X8HA 3WQBA 2A94A 4K9NA 2J3LA 3TB6A 4G36A 5CXQA 4CETA 2D5LA 1XO1A 2OBLA 5F98A 5K7SA 1D4AA 2Z30A 2Z6UA 2JHPA 3OQBA 3JQ8B 4QUGA 3ANXA 4P53A 2C7RA 4W4TA 2ZJ5A 3CT6A 5EE1A 4DOMA 4DLPA 3BXGA 1JA9A 2BMWA 3KOMA 4G0YA 4UUNA 3MWFA 3U7EB 3UV3A 2D00A 3M9LA 2ZTSA 1J0DA 3F47A 3PT5A 3UWOA 3C87A 4LTMA 1UOQA 1LDYA 4CM1A 4E4YA 2CE7A 1RJ9A 3SWWA 4KR7A 3ZI4A 4LQDA 4LX0A 1T5IA 4NCHA 5LYYA 3KKOA 4PCLA 2QW1A 3U4MA 1EP9A 4TZKA 5FTJA 3K5IA 2X7HA 2J9ZB 2XVAA 4LZAA 4LWZA 1ADFA 4NICA 3EUWA 2IIVA 5I5GA 1PN3A 3U44A 4TT3A 3T1OA 2K2WA 4U7WA 4DDTA 3TOXA 4HR7A 3V4VB 3WQHA 4XSVA 3CG0A 4I9HA 4UEOA 2VH1A 2WZDA 4QJBA 3LUBA 1Z0JA 4RQUA 2QVGA 3QYJA 4BO4A 1FF9A 4IAOA 1ZLYA 5BV8A 2IYEA 4RVNA 5TQ2A 4D3FA 4EENA 2OCYC 3CR7A 1ZGHA 4MV6A 4ZTBA 1MOPA 3BXHA 1PGPA 3X1JA 2JI8A 4AFNA 2V7BA 1FYVA 4ZVUA 4UM9B 1QHIA 2DFDA 3D6NB 1JTVA 5SY4A 4B5KA 2JAQA 2Y3IA 3KQNA 2HJ9A 3CMCO 5ISMA 2O2CA 4YB8A 5BN5B 5LKAA 2OG1A 3QOFA 3FRJA 4REQB 1U8ZA 1Z7BA 2QV7A 5HOQA 5K0GA 1HE2A 3RU7A 3M6FA 1UMKA 2NZJA 3AKCA 5D8DA 4ZYTA 1VL6A 1UAGA 3F2IA 2A9OA 4MWGA 1RAGA 3VR3D 2E3JA 1RBYA 1E4VA 5HF9A 2E5LB 1LC0A 5JNWA 3OEYA 2CSXA 3Q3HA 2LKDA 4PS1A 1USIA 1YBVA 4R1OA 3UN1A 4M8KA 2IT1A 1YS1X 2IYSA 3L8FA 3GOQA 2GJSA 3O4JA 4I4CA 4RSGA 4KDRA 3T95A 1S2MA 4M1YA 2H51A 4PNHA 1D04A 1JT9A 3TL2A 2BGKA 3PR2B 1O1YA 3AGQA 4COKA 5K8VA 1SCBA 1LB1B 4AKHA 1B93A 2HK9A 4HBZA 4QPNA 1F0KA 4XX1A 3SLRA 1RCUA 2DYKA 4MUBA 5MFZA 2XITA 3I42A 2X0EA 4MHSA 1ONOA 1D6SA 3NGXA 3ZWOA 3BRCA 5E9WA 1NW9B 3AR9A 1VMAA 2O7RA 3OAAA 4F3CA 2GCOA 1E1CB 4QRDA 1E79D 1LK5A 1PQUA 3W05A 1GG2A 1GPH1 5A9SB 1XQ1A 1XF9A 3CQ9A 1DDIA 1WB9A 3QIVA 3R6GA 1Q22A 4FHFA 2JDID 4YJHB 2F8TA 1ZESA 4IPTA 1QAOA 4DY4A 2B82A 4Y0VA 2IYLD 2QP3A 1J23A 3QNUA 1DRUA 2BIFA 4AP9A 1ZM3A 4OQYA 3SBEA 4IUDS 1M8GA 3Q41A 1WB4A 2R6JA 4LDNA 2NAFA 3P45A 3K0SA 3H3XA 2G77B 5BOSB 1VB3A 1U1EA 2FP4B 2EX4A 3SZOA 2ZBUA 4RD6A 2PLFA 1R6AA 1CRQA 2QZPA 2VKQA 5H3HA 4LF8B 1PIWA 1G41A 1QZUA 2OQVA 3TQHA 4DR1B 2Z2JA 3AG5A 3WIDA 4CM4B 1JR6A 5EOVA 4MPDA 3QFHA 4IOKA 4X5OA 1UCFA 1XRRA 1SUAA 2QAGA 1XTBA 4HRVA 4UOZA 3WK5A 5C32A 1E64A 3O8DA 1KJZA 2C9MA 2IHJA 2QE6A 3LFHA 4PAMA 4I6EA 2R7MA 4R40A 1P31A 4UBNA 2GYWA 4XD7D 4CT5A 3IAUA 5FFFA 2RB5A 3D6VA 1HDIA 4OX9Y 1ODJA 2N42A 3P94A 4FUTA 4NKRA 4TLBA 3CUUA 3TIGA 1U8FO 4X64B 1K8QA 1NBAA 1PQYA 5FTKA 5BR1A 3HCRA 3IELA 1U8AA 2Y8EA 3O4VA 3VC1A 5ADVA 4JA2A 2C7OA 1L5WA 4MEBA 3PNLA 1WEHA 4PLVA 1ZRSA 5JYCA 2F67A 1ZGZA 1U1DA 2EG5A 1KZ1A 5LLTA 1PL8A 2FCAA 3PQ2A 1WU7A 1V9CA 2ZJYA 3DOHA 4OG2A 2PVCA 4JB3A 4RE5A 3DBRA 3HCNA 5J63A 4PAOA 3X2FA 5KTKA 5J2TB 5DJ5A 4MKXA 1GPBA 1T6ZA 4WEQA 4QT4A 1T36A 4E5UA 3ENNA 3KZ1E 2GBCA 3WL8A 5F9HA 2D06A 1LBQA 5CVUA 4W5HA 1GEGA 3UGJA 3EA5A 1VHDA 5EZYB 5B64A 3ZZ0A 4EQ6B 4LNHA 2WPDA 1GAEO 4FNGA 3AY3A 1X8LA 4ZTZB 3H2JA 4KYIB 1KY5A 1JT2A 1NKVA 3LQ1A 3IOMA 2IQIA 1G6HA 3AY0A 3SKVA 5JBNA 3GLVA 5AW4A 4ZPJA 5KVCA 1FA9A 2J5BA 1RWWA 1U0TA 2OC4A 2R2AA 2P3SA 4QEDA 4BPBA 4MUJA 4JI4B 4PSAA 1K8RA 3P4YA 4U5QA 5CNJA 3V2GA 1NVKA 4LV5B 1TUIA 3G82C 2IW1A 4XEHA 1B2LA 3ZDBA 1KBOA 2Y0DA 1XCLA 4UHEA 1Z0FA 1QKJA 1P2FA 2O23A 1OHHD 3JATB 4PYIA 4FB5A 4ASUA 3MWJA 4R1QA 3UK1A 4X41A 2YZMA 4QUAA 2O20A 1SUCA 3C3EA 5LD2C 1SIUA 4DYHA 1YULA 3LSYA 3LZCA 1C4OA 3MWEA 2E5WA 4EY4A 2BKAA 4TQGA 1W1WA 1IIBA 2CXTA 2HF9A 2W2TA 1ZH2A 3FDIA 3TKAA 5HKOA 3B5JA 4BO5A 1L5HB 1U9IA 3C45A 4MEJA 5DHAA 4DMFA 1BVUA 3PPYA 4LYYA 3TB4A 3VC2A 5J23A 4Z0NA 2P9JA 3KQMA 3OSZA 2QY6A 3S2FA 4AQ7A 2UYHA 4US1R 3DEYX 3SBDA 1V8FA 3GROA 1HTTA 1L4UA 1L5RA 2Q29A 4JC0A 1YS9A 4AN1A 2ZB4A 3SZGA 4EELA 4PC2A 5IJWA 3CLRD 4CF3A 3UJCA 1WSAA 1MAAA 3NHPA 4V1CA 4BY9E 2P1ZA 3FYUC 5D5PA 5JCZA 2XXJA 3CW9A 4GOND 3DONA 4C2TA 4MO9A 4O4HF 4Z8YA 4AMYA 1U11A 4ZO6A 4ZT6A 4ZJYA 5THXA 2ZYDA 5GGXA 3VDXA 5ALDA 3H5TA 3QVWA 1K92A 1ZHHA 1HLPA 3PQ4A 1BOFA 1G19A 2HWWA 2C7VA 2RIPA 1F8GA 4JUAA 4LV6A 4MUNA 5E3IA 4G1BA 4BAZA 5A4MS 4GR5A 5C8DA 4C4RA 2LZ0A 1S01A 3U4QA 5TVKA 2DH6A 1DADA 3CLVA 4LXUA 1YL5A 4TM7A 5FH9A 2YV3A 3BMCB 2D2FA 3DB2A 4MIEA 2IXGA 2I2WA 3DZ8A 1G7SA 2CXOA 1PCXA 2F8MA 3T9AA 1ES9A 2BMEA 3VR5A 4Z7NB 1AZSC 4GX0A 1Y4ZA 5EPOA 2EJBA 4PC3A 3ROEA 1OBCA 3LT4A 4S2EA 1I2BA 1PZXA 3QKRB 2ZT6A 3M1YA 1PI3A 1UMDB 4D0RA 1OJLA 3BQ9A 2HA4A 1D03A 1Z8DA 1ESZA 3QVTA 4YLEA 1E69A 1GDDA 2FZKA 3KO8A 4NZYA 1NM5A 3H11A 4EG4A 4FS8A 3H8WA 3J7TA 1J5EB 1J1IA 3FYHA 4FBGA 1GZHB 2KMLA 1RJFA 1MB4A 1JDSA 2G5TA 1JDTA 2OKCA 4K7JA 4IZHA 5FTNA 3RWBA 4UTRA 1S6YA 4DCTA 1V4BA 4X66B 3NTLA 4OB8A 1E9DA 3CU5A 4B4WA 3OKPA 2HNKA 2G72A 1PZNA 3E3OA 1T6BY 4D9KA 4YR9A 1FQOA 5KDOA 3SG0A 1UMCA 2FPIB 1W93A 3ZWBA 2LGJA 3O3NB 2P2CA 4O33A 4R54A 1LDNA 1LLCA 1MP0A 1XOIA 2X0RA 4OL0A 4BJ6A 3UZUA 4G2TA 5GVRA 5HFJA 4DLLA 4Q3CA 1BQEA 3R41A 4XYEA 4HO1X 2JIZA 3O8BA 1QHSA 4QXAA 4U5XA 4ZXPA 5A5GA 1SWWA 1Q77A 4ENRA 2R1UA 3DEIA 3IR5A 1NOKA 2C8VA 2X2OA 1KE1A 1JIJA 3K9NA 1DLIA 2QDKA 2F9FA 5EJ8A 1QX4A 1ZNXA 1ZC4A 2XYPA 1Z2AA 3RDPA 1Z5PA 3ENZA 4TL8A 4BZQA 4CDRA 3NV7A 3N8GA 3B60A 4PU0A 1U4OA 3URMA 1F6DA 2PUJA 4YI3A 2DPYA 3WNBA 2C4NA 4KFRA 1RAHA 3PCRB 3SSNA 4IMIB 3SEFA 3PS9A 3GFRA 3GMIA 3WKBA 2V6JA 4LSZA 4AMVA 1P0QA 3M89A 4JJKA 1VJRA 2J33A 2JC3A 3EOZA 2HF2A 4KK3A 3DZHA 4KR9A 2QM3A 4I9NA 2XOXA 1ULUA 4ZOLB 1UZNA 5H5JA 3RS4A 1TD1A 3PUJA 4KFCA 1HY3A 1PJ3A 3B52X 2Z58A 3ISJA 4WUVA 5ILQA 1Y8CA 4UCWA 1GO2A 1FVFA 3LQ4A 2BKXA 3IDQA 3A3OA 4HDQB 2O2YA 3ZQ4A 4L72A 2C20A 2WIDA 2R00A 4XX0B 5K6TA 3KCQA 4RGVA 4CEIA 4DLTA 2CHQA 1C14A 1VHWA 3MRSA 4XTCS 3JU3A 3WLFA 1U6JA 3ZHRA 4H9GA 1FLDA 4LK2A 3F8TA 3KWFA 5ITSA 2R6AA 4IM7A 1QC5A 4EDHA 2YZ7A 4MVJM 3WWEA 1TC2A 1V5GA 4TMZA 5JJ5A 1P5JA 2A1UB 2EARA 3MEQA 3ADCA 2O2SA 4AL4A 1DO0A 2EKZA 2JIZD 2OQRA 3O73A 4DDMA 4DNQA 2OHIA 2OEPA 4ISCA 1GKIA 4ZI7F 2P69A 2ZM5A 3IJ5A 4FR5A 3WA6A 5AQ1A 5DHUA 2B4AA 3ELBA 3E6AA 2OO3A 3G7SA 3QA3E 4K9LA 3COSA 5I9MA 3FZQA 1DFIA 4N0MA 4TYWA 2IBMA 2P9GA 2DT8A 4ND3A 2IA5A 4LF9B 5BVHA 1NT4A 2RGCA 2XNSA 1Q92A 3OT4A 4DJDC 3JPWA 2AJ8A 3VFDA 1VHTA 5U4XA 1UH5A 3HUDA 3K8YA 4FFLA 1GCAA 2FPGA 4FGUA 2PT9A 3K30A 3SQWA 1UMBA 4NU6A 4UD6A 4MRMB 3BMNB 1T1SA 3DTNA 3BERA 4JKYA 4TMXA 3PC6A 2XR1A 4OQNA 5A5DA 1AQIA 3QU9A 2J30A 3QOYA 2W83A 1N2BA 3H1EA 5FCDA 1H05A 1XDGA 1KS9A 1PGQA 2PD6A 2ZB8A 3BFVA 2QHXA 3DL4A 3L5KA 1R0WA 3LOQA 3R3VA 2O2ZA 5KYVA 4C7VA 1Z25A 4W1QA 2QB5A 5AJZA 1J90A 4RDXA 3QVJA 1F5NA 4PTYA 5F5LA 2ZUEA 2F48A 3WMFA 3SYLA 1X80B 2GD0A 2C4TA 2WSLA 3E05A 4KI7A 4PLYA 3VVLA 2GZMA 3M4NA 2FFRA 4YV1A 4ZVLA 3GZTB 4KBFA 2X2FA 2WHQA 3ZS9A 4EFLA 4CKWA 2CNDA 3FHTA 1D8AA 3INYA 1UBNA 2IZ6A 4MR9A 4K0KB 3KXKA 3OM0A 2ZWAA 2OKGA 3NC4A 1T2NA 4GF5A 3F9CA 1V4NA 3TD2A 4ZMRA 3SIRA 2ZIEA 4JASB 4UM9D 5K1ZA 1YQEA 3T3HA 1JNYA 1ILWA 2AEMA 1G4HA 2ZSAA 2HIGA 1Q1BA 1LBHA 2JBWA 1H8HD 2CXRA 4PZAA 3TLJA 4FGWA 3JZIA 4ZAXA 1YI1A 4KNWA 3LKVA 5F9MA 3AL0C 3RREA 4QVIA 3TAUA 5I7AA 5BMVA 3GHHA 3Q8MA 1LRLA 3IUPA 1GEEA 4UZSA 3TQSA 5MGNA 3ROTA 3QE3A 3RVBA 1CDZA 2QN2A 5KCMA 2H11A 2XF2A 3C8MA 4NBNA 4LBZA 1BE1A 2I2DA 2Q4OA 1WZCA 2IU0A 3TW4A 1M8KA 5HZKA 5TIIA 3ZDRA 2G67A 3MZ0A 3AW9A 2AFHB 4L4ZA 5C7LO 2CVQA 1YVDA 1U65A 1LWNA 5SYNA 4OB7A 2QL9A 3R3HA 3BK2A 3JYHA 1NQVA 1CIVA 3B6MA 1VI6A 5ILGA 2Z83A 2EKQA 5HQ3A 1PT9A 3R1IA 4W5TA 5A3VA 5HIAA 1TPYA 2WU3A 3MT8A 4YY3B 3N7AA 3ORSA 1DI0A 3PX2A 1B7GO 4BFWA 3PFCA 2ZIVB 3MB8A 2DWQA 2Q1SA 4CIXA 2A9JA 4DYVA 4ZT7A 2UVPA 3YASA 1RAIA 3PPVA 2IGBA 1D0IA 1WJGA 1W5SA 4GKAA 1U0LA 5AWFC 3GDFA 3T1VA 5KNBD 3FOCA 5EI5A 1NKTA 2NT3A 5K8LA 1HR0B 4Z53A 2XBUA 1BNCA 3R9XA 4URZR 5IW8A 4CMIA 1K7XB 2Q3EA 2X5JO 4K03A 3N39C 4J4TA 1P8JA 2HU7A 4J7XA 4CCWA 2XVZA 3IUBA 1ZOOA 5KIAA 1O58A 3KB6A 4BO8A 1MJHA 5KQGA 1YQDA 2I4IA 3L1UA 3H65A 5KSWB 621PA 4Z4FA 9LDBA 1PV2A 3WX0A 2NAPA 2F4NA 1NRXA 5DXAA 2QPTA 1PBTA 3U09A 3WLMA 3S4YA 5LYJA 3LF2A 5EPUA 2H29A 3KLNA 1IJFA 1EUDA 2DSTA 4TQUS 1UWLA 3QP9A 1HDXA 1ZM9A 3BWXA 1RLIA 3CLTD 4AQYB 3LBAA 4N3CA 3BTSA 1Z6PA 4K46A 3ZY5A 3ZW9A 4II2A 3SXUA 1TECE 5C5EA 4XDZA 2OFOA 5J58A 3F0TA 1QYVA 2YXEA 1JEAA 2V7GA 4L6AA 3TM5A 3Q88A 1E1YA 1MW8X 1OR8A 5GTDA 2GN1A 2X9QA 5EKSA 1WXEA 3GX1A 1T24A 1H94A 3PRKE 4XQGA 3RT1A 1UBJS 3L9WA 3NBUA 4R84A 4FGZA 1TRKA 3UB4A 4GKKB 3DLAA 3HDJA 1KI4A 1VDZA 4YN3A 1AKQA 4R2WA 4JD5A 4YO7A 4D2IA 4EW3A 4QYWA 4BNDB 1XNJA 1X8JA 1GNVA 4DWWA 4E15A 5FD8A 3A31A 2JS7A 3RNOA 4DCJA 3F6RA 3AQIA 3EXEB 1KQFA 4WKOA 4DLVA 1V1RB 1EVKA 1T35A 3EA0A 4DIDA 4EYEA 4WNCA 1LLUA 3T7KA 2X8JA 3ZHUA 1ZAYA 1FUUA 2OQIA 1ULHA 1AGYA 3AJDA 2E48A 4UREA 5L3ZA 5B12A 2XQIA 2AFHE 4IGIA 5KYXA 1GPUA 1N8TA 1F1JA 4LRWA 3MVEA 4CMHA 4CM8B 3FSRA 1U2TA 1XVIA 1C9NA 1SJ9A 4GRDA 1GCUA 4GOJA 4JQOA 1NBME 5ALIA 4BLWA 1PJ8A 1UADA 2XJ4A 4HVAA 3QKIA 3FBGA 3IR7A 1CDOA 2ZBGA 3OIGA 4NEGA 821PA 5BXYA 3IEXA 6YASA 2CNNA 3MRTA 1T9GS 9MHTA 1JEQA 2H3EA 5CDUA