5SV2A

Toxin vapc21 from mycobacterium tuberculosis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
135
structure length
135
Chain Sequence
TTRYLLAKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC21
publication title Crystal structure of VapC21 from Mycobacterium tuberculosis at 1.31 angstrom resolution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase
total genus 48
structure length 135
sequence length 135
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5sv2A00
2BSQA 1XO1A 2H1OA 5L6MB 3IX7A 3Q8MA 5ECDA 3H8WA 1UL1X 3H8JA 2LCQA 1UT8A 1V96A 3H7IA 3QEAZ 1TFRA 1W8IA 3QE9Y 3ZD8A 5SV2A 4WA8A 3ORYA 2HWXA 3Q8KA 5HP4A 1O4WA 3ZDCA 3ZDBA 1V8OA 2H1CA 1BGXT 2QIPA 2MDTA 1MC8A 4MJ7A 2DOKA 2IHNA 1A77A 1YE5A 3H87A 1B43A 1UT5A 4XGQA 5HMMA 5K8JB 5HNKA 5H4GA 1RXVA 5ED0A 3QEBZ 3I8OA 3ZDAA 3H8SA 2WP8J 1EXNA 3ZDEA 3TNDA 5HMLA 1Y82A 5ECWA 5L6LB 5FV7A 1TAUA 4CHGA 1TAQA 3DBOB 3Q8LA 2FE1A 1RXWA 2HWWA 5ECYA 2IZOA 3ZDDA 1V8PA 1A76A 2HWYA 3ZD9A 4XGRA 3ZVKA 5H4HA
chains in the Genus database with same CATH superfamily
1TVKA 3GMIA 3A4IA 4L76A 2FEMA 1DLJA 3W78A 3WK7A 3DZHA 4Y0AA 3JAKB 2AQ8A 1XO1A 3NV9A 3SK0A 3V9PA 4KOEC 4EFLA 3RT9A 2ZI4A 3IBSA 3CFYA 4ZGGA 1MNAA 2WF5A 3G17A 1EGMB 3OTOB 4PLPA 3W2IA 2GS9A 2JK1A 4DNFA 2QY6A 1ADYA 5AJUA 1YDWA 4PYKA 4LHXA 5IC4A 4JT2A 4D4JA 4I46A 2B9EA 3ROXA 1XN1A 4MVJA 1YS4A 4IZOA 5KJCA 1GXSA 1Z4KA 2GX6A 3D3KA 3OQPA 4L15A 3SQDA 5DB4A 1JR3D 4UEOA 5DASA 2PQ2A 2EDCA 5C7OO 1EG2A 2CNDA 5AI8A 5E9JA 1M54A 1SBYA 1WXWA 1QTNA 3DAGA 3KCNA 2D4HA 4REQA 5CM9C 4IH9A 5FUQA 2IOHA 1IBMB 3AUFA 3F4BA 3PJDA 1X3LA 4M9RA 2V74B 5JEEA 3UPUA 4KQGA 1U9YA 3L7CA 3OQBA 4WFJA 1NDUA 2XODA 1UK6A 4LF5B 1K86A 3H9UA 3RIXA 2XB4A 2C84A 3RRXA 4JXXA 3F2IA 2P79A 1CQJA 2O2YA 4AG3A 2WSSA 1CUHA 1O6GA 3LCUA 3WTBA 4CKEB 3FTEA 4M7RA 1GCIA 4MWOA 2YY6A 3O84A 1PNTA 2OD2A 3ZGVA 4K9KA 4B73A 5BV8A 1W36B 1ST3A 3P9NA 3MVEA 1VBMA 4M54A 2KSQA 2QRVA 4ZOCA 2FZVA 2REXB 1BD4A 3W9BA 2WFMA 3LUGA 2ZVJA 3ZYCA 4UZEA 1LPAB 3M5WA 2PJDA 5EOVA 4R7ZA 1EVIA 1R8QA 2UV8A 1GIAA 5EMLA 2C7VA 3JQEA 1K7YA 1X0XA 1F3OA 2FJUA 1GNVA 3ISJA 1LTHR 4R6WA 4TSFA 1EUCB 1R3UA 1TECE 4QZVA 1LUAA 1N7HA 4GMGA 4DA9A 1U8YA 1ZITA 2E4WA 4H08A 4F3YA 5FULA 5BT9A 1MEEA 4HAZA 5KYGA 2VJKA 5IKMA 4PYOA 4H18A 4RY9A 3NJ4A 1EGQA 2Q0HA 3OE4A 4F3CA 2VHXA 1HRKA 3I2FA 3AR6A 3WICA 1AKYA 3LX4A 3OIVA 1QLJA 4DLSA 4W1SA 3UJPA 1U4NA 5B4TA 1B23P 1WW8A 1TJNA 3OQMA 2XNDD 1U9ZA 1Y8QA 2SCUA 2PT9A 1ZD4A 2ERCA 4KWEA 4NBWA 2JAWA 3PI7A 5K4AA 4A1FA 4NIMA 3JQBC 3Q3EA 4ENSA 1BRMA 1S8NA 1Z8FA 1S8AA 1WBJB 5G1NA 1OA0A 4BIMA 4D98A 3A2LA 2WP0A 5KCZA 4JBIA 3CB4A 5JVDF 4MA0A 1IZ9A 2IH2A 3V8VA 1BWSA 5E2BA 1X94A 3RIYA 4C4ZA 4RCZA 3L2OB 4OLJA 2HN9A 4QXAA 5LJIA 4PLFA 5ICMA 3CA8A 4ND6A 3FZEA 5TMPA 3HKEA 3O75A 1TQHA 2MCFA 1OJLA 1VC2A 4MHOA 3OOJA 5JHGB 3SJAA 2R1UA 4RAOA 3RCBA 3D6NB 2IODA 2HRRA 2OHOA 3QRWA 3TIFA 5A62A 3HRIA 5C52B 3HVRA 3P9CA 3PGKA 3FUUA 3C8UA 4GG1A 1YZGA 2EG9A 3OTHA 4LC1A 4QECA 4V0QA 5LUBA 4YJ3B 1P19A 1VL8A 3WGVA 3E23A 3FWPA 2EZTA 4Y30A 3RFCA 1P2UA 5H9WA 3ITKA 4QQFA 4M9XA 1MQSA 3IQDB 1E2MA 1K6MA 3BMNB 3IAS6 1TM3E 2B6NA 3L7MA 4E22A 3FJ1A 4O1MA 5KYWB 2EEPA 2PXXA 3QYJA 4WOPA 3T95A 1A9SA 3N8DA 2WWHA 1A2BA 3MRSA 1JHAA 5C81A 1OH8A 1F5NA 3KQMA 3PQDA 2ACWA 4X1OA 3ML1A 3R7WA 4D0RA 2OY0A 4EW2A 1IXKA 1SAYA 4YQZA 5JD6A 3QVOA 1XCBA 1ENYA 3QEAZ 1P1RA 1TFRA 1WL8A 3QXSA 2FF7A 1M8JA 3G2IA 3ISTA 3O5AA 1D4AA 4DZZA 4Q7MB 1RDFA 4M38A 2HGSA 5BSGA 1NVTA 3ZBTA 4B17A 1A96A 1N3LA 1EHYA 4D99A 1KSJA 2PNJA 4IUYA 3BMQA 1Z6XA 5EZ5A 4N3NA 2QORA 4FNOA 2PVPA 1KMHB 1KBQA 4JUIA 1F9EA 1KK1A 3L8DA 1NE7A 3OQ6A 4UOEA 4Q9HA 3CTMA 5J5CA 1EBBA 4HFNA 4G1FA 1J5PA 1KMQA 3B1FA 1VB5A 1OASA 3E8XA 4GRIA 3O91A 2BE7A 3V33A 3V7FA 4CMKA 5LLDA 3JWEA 2ZIXA 2GK7A 3QU7A 3W8NA 1F8UA 1OC4A 3GP3A 4K9MA 3L7AA 3WBFA 1E6EA 3CJRA 3E9RA 3KUXA 1HZZC 2BTQB 2XMPA 1KZYC 3JCZA 5CG1A 4IO1A 1WWKA 5EI5A 1SC6A 1PW5A 2X0JA 4Q48A 4QJIA 5JCOA 2VXBA 1ZNQO 2HRZA 3PR2B 3SICE 1YBFA 3LBIA 4LY3A 1PT6A 2Y1EA 4HGRA 2ZW9A 4OJQA 3TVYA 4R3WA 3BD8A 1VBNA 3C7TA 1Y5LA 3FNEA 1BX0A 1O2DA 1JE1A 4DIBA 4JYAB 4JL5A 5ALPA 4CEHB 3A10A 2A9RA 1PL6A 5HZKA 2OFFA 4ZKDA 4ZREA 2VSFA 2A9KA 5JUWA 3B38A 1YZYA 4C21A 3B52X 4YTEA 3TTYA 1KQFA 3K6RA 1ZGGA 4BVEA 5LC1A 2F3TA 4CV1A 2B82A 3ZYZA 5LYJA 5IJ9B 4GMFA 4L7QA 3ZZNA 4EGFA 2J4FA 5JY1A 1S0UA 4FWTA 4XX0B 2ECOA 2W6CX 3C1AA 5B7GA 2BFDB 4KIUA 4M7PA 4PHCA 2V96A 3T41A 4HEA6 3DMTA 1QFSA 1VZ3A 2I8CA 3BD9A 3EMBA 3QWAA 4INOA 2HMTA 4N0DA 1T3LA 2WM8A 4IMJB 1G20E 3O9MA 4QDUA 2CUKA 2GEUA 3A28A 3ZIUA 3EEBA 1SOMA 2FZCA 2X19A 1D07A 3LP6A 2IDZA 4M0CA 3KKEA 4UHHA 3UCFA 2HMVA 3MELA 1I1OA 2WJ4A 2HJVA 4K9QA 3BQMB 1MJGM 5D3MA 5H82A 3KQTA 2P6UA 1JI0A 2BM0A 4H27A 1WHSA 3TLJA 1R6UA 2RGUA 1C9EA 2PFSA 3L8EA 5KTTA 1XVTA 3FSJX 2B8NA 1C4OA 3PZRA 3K70C 3I58A 4HBZA 2ZRLA 2A9OA 1OXUA 4X8OA 3K09A 5KBYA 3COJA 4X64B 2KYRA 1L1FA 1P62B 3IAUA 3VYUB 4GDMA 2FZWA 1KARA 3JQFC 4UARA 1PK8A 2IYUA 2V7XA 1O0SA 3LNTA 4XQ9A 5FUYA 3C4JA 4RE5A 3SGLA 3DL0A 4YRGA 3RRMA 4W82A 2FPUA 3R7NA 3GEIA 2ZR9A 5LP6F 1DP4A 1FVFA 2G76A 4IDOA 4F6RA 1E1YA 1KWGA 3EPLA 1Z06A 5DLPA 4TL6A 4CMBA 4DOMA 4YRKA 2WSIA 1GXSB 4HH3C 4MQ5A 1QMGA 4CDNA 3GQBA 4OKIA 1YR9A 2GYYA 3VSAA 4K2AA 5CH5A 1JEEA 1AHNA 3O4JA 1ISFA 3PHBE 3DBVO 1H66A 2A5FA 1AD2A 4HRAA 4C7MA 3H8WA 4I5FA 4X24A 2OMKA 3K2BA 1CR2A 1F9AA 2GK6A 3OCVA 4P38A 2JCVA 2WC1A 1BN7A 4E4TA 1BKYA 2VLIA 2ZKIA 3MJCA 5FO1A 3CVJA 2B5OA 1QKJA 2AQKA 1GSIA 1OAOA 2IYYA 3R6GA 1CQJB 1LBQA 3AB8A 4FN5A 3SQXA 1G7SA 4X7PA 3K2QA 2DETA 3TYXA 1OZ0A 1X6VA 2ODTX 1FJXA 5KSWB 3UOGA 3MUEA 4CFZA 1U3VA 4X3PA 3TGLA 2IZ6A 5JALA 3D6MA 1JYSA 3CRW1 3C4VA 1MENA 5C1IA 2WE7A 2QRVB 3AJAA 5M34A 1E3WA 4QFBA 1N5JA 1QDLB 1ZI6A 3MEQA 3T0IA 2J0UA 4Q1FA 1IHUA 1LPBB 1OC2A 1KYVA 3G9UA 3PQ8A 2XMQA 1EKXA 3A2KA 3OZEA 3Q5GA 4BNIA 2K7ZA 1AH2A 1YA4A 3HB4X 3ZHYA 1FP1D 1T2DA 2XIJA 3FCCA 3EW7A 3TTWA 1AY0A 4H7KA 3U7EB 2CEKA 1J2YA 1LNSA 4IVPA 4CM6A 1MR3F 3EMVA 3WOVA 3KWFA 3EXHA 1OBHA 4IIJF 2WB4A 2WINI 4F4UA 3LQRA 4PFJA 1MIHA 2XNKA 4OHCA 3RVKA 5KVQA 4V0SA 4UJ5A 5SZKB 3UV7A 3UWKA 1CEYA 1FJ2A 1QYXA 3RT1A 3OFKA 2GCEA 5KOIA 1QRAA 2XA1A 1AUOA 2AFIE 3H9CA 4R7GA 3PCTA 4M86A 3KKPA 3JYHA 4TTVA 4YP6A 2V54A 1Y8QB 2SCUB 5BUCA 3NHBA 4EY4A 2YDXA 1PHPA 1E9RA 4G1CA 1B7GO 5F51A 3IUBA 4WOBA 3QFHA 4FWIB 1OLSA 1EFTA 2E1PA 2EGUA 3G2JA 5K0BA 1UQRA 2IHVA 3WGQA 5CITA 2AZDA 1DWQA 4LYDA 2VAXA 4MUBA 1S4QA 1H69A 3HE3A 3JARA 5TVGA 4AS2A 5AVZA 5H5JA 3HKEB 4XEUA 5TEWA 5EPOA 3UJ3X 2XRYA 4FGZA 4MV7A 1N6PA 3JVUA 3H16A 3K8ZA 1YOBA 3ZCVA 4AB1A 3WMWA 1M0EA 4FGWA 1RRPA 5CH3A 4R54A 1QIMA 5KAPA 3TVDA 3O4VA 2J46A 2ENWA 4EB3A 2DYKA 4DB4A 5KTSA 2VJCA 2ZANA 2FPRA 2PXCA 3LU1A 1M34A 3MCTA 2H11A 2PX8A 3NUZA 3QNUA 1F6WA 4TVOA 2G7ZA 3KOXA 1CY1A 3UW3A 3VAAA 2OBXA 3WKDA 4UEJA 4Z2AA 2VCYA 3MRVA 3BTOA 3DFFA 4L7VA 2QLJA 3DZIA 5JJBA 1ZHOA 3R7WB 2F9LA 5C4MA 1Z6QA 4FC7A 2HF8A 1DRUA 2H63A 3GJ4A 4KGDA 4Q34A 3IA2A 2XCTB 5DHFA 2H57A 1FDTA 3LBNA 4GYJA 4B7ZA 1KYWA 3FCXA 1XA4A 1E0KA 1N2EA 1PFKA 2EJBA 4N4AA 4W5NA 4JVNA 3TW8A 5A5EA 1TVCA 3LP8A 5A3SA 4MQ6A 4BJHB 4IJMA 1FUKA 2CLMB 2YXEA 4JLPA 121PA 3INNA 1JLKA 5BWCA 4X94A 1M6NA 3DKVA 5B1YA 1VL2A 2OCXA 4Z1MD 3ZWNA 5C35A 1IBLB 4JXZA 1WS6A 1U2GC 5K8VA 2NAFA 1NOJA 1NUTA 1O5OA 4HS9A 3IVCA 5EHZA 4PCUA 3GF4A 5FT9A 4M1KA 4XSVA 4ZCLA 3OJCA 5B58C 3MLAA 4M9CA 2XRFA 5IJZA 1I7SB 3HV0A 3TOCA 4WEOA 2AC4A 2G0NA 3QKIA 1OJ7A 4P8RA 5DP1A 4EJ6A 1AJEA 2AWOA 5DWDA 2IEDA 2QUJA 1QX4A 1ULTA 3KJQA 3OPYI 4LXYA 5AVOA 3VH3A 4C43A 4YI3A 3WWZA 1U6JA 4IIBA 2X86A 4MKRA 3K15A 2FN7A 4IRMA 3DCYA 3DOFA 4NJMA 3P2YA 1DL5A 2R8XA 2QJTA 4GNRA 1V4BA 2JKZA 3O4GA 4UHFA 2G9ZA 4C6TB 2I2BA 2VF7A 3F5QA 4ZI7A 2Y9PB 3CW9A 3EYWA 5B30A 4MV5A 1KO4A 3S40A 3P7MA 1E4VA 1YL6A 5BP7A 4LX0A 2IYQA 5LQDA 2V9PA 2PX4A 3VDXA 2E6KA 3S2YA 1PFGA 1ORVA 3FHCB 4GH5A 4DAOA 1JXAA 1OBOA 1ORHA 2C2ZA 3HXQA 4KBFA 1F8XA 3L79A 1JMKC 2VXCA 3ONVA 4HAYA 4L8VA 4AFNA 4EJFA 3ETEA 4V38A 2ORIA 3PGMA 2O5CA 1Z34A 3TIVA 5LYJB 3A3NA 1HE3A 2XYQA 2VNJA 5J63A 4CKBA 3VNRA 2F1IA 4PR3A 1AGPA 4G5YA 3MJHA 4O5OA 4A8JC 1JEYB 3ZQKA 1Z7EA 1KVSA 5FJIA 1KVQA 3G9TA 1U8AA 3NDPA 3VPDA 3ZHRA 4C0JA 4DCSA 3O21A 2A5LA 3KXLA 1K0UA 5A03A 2BFOA 4FU0A 5G0WA 1S2OA 1L3IA 3WQQA 3GMTA 2ODQA 4GQIA 3UQYS 2C59A 1X1EA 2XNCA 3LUPA 4QT0A 2XUQA 1GU0A 3C5VA 3EA0A 3NBKA 5F7JA 1GRCA 2G07A 4CW7A 1TM7E 4KRFA 3O8CA 2NP6A 5EQFA 3FSRA 1YQWA 2Z2JA 3INRA 4XWGA 2ZIUB 3UBMA 4ESEA 3FGPA 1K9VF 1Y5IA 2FSGA 2HXGA 4BNYA 4GX1A 2F8LA 3KTDA 4GPAA 3AU8A 4YNBA 1JHRA 1T8RA 3ZCSA 2F90A 1YIOA 2B1RA 2R96A 1X39A 4QICA 4AYXA 1NUHA 1U1DA 2WIAA 3UHOA 1Z63A 4EA9A 1LH0A 5B2ZA 2BI8A 4F6RB 2JGRA 3H2IA 2CJYA 5EE3A 4CG3A 4EG7A 2HA2A 4GIBA 4MUMA 2V55B 1C7JA 2IE8A 2ONYA 2PLNA 4NG5A 3GQBB 4Z2YA 5HHTA 4MIYA 1A8PA 1T9GS 1YVEI 1NBOA 3DTNA 4Y7DA 3BA6A 3T35A 5JJ5A 5JZVA 1SPXA 2Y71A 3OICA 4Q9NA 3R7LA 1BEZA 3QK7A 4DNQA 2P7IA 4JLBA 4Q3NA 3VO9A 2O5VA 3F3MA 2O0HA 1A97A 2PN1A 4G5GA 3RJZA 3M6LA 3T06B 4G37A 5THKA 4DDVA 1KOGA 1VE1A 2G1JA 1JI3A 1RPNA 2WF8A 4LJ8A 1KH1A 5E8RA 1AKWA 5JEDA 4EVRA 3LLCA 4RPCA 3F4KA 4A0HA 1XD9A 2O2XA 4LHYA 2GN9A 4IHAA 2QAGC 5JNVA 3C3XA 5T6MA 3SZMA 2ZSHA 1ESEA 3ED5A 2W2PA 2EBUA 2M6KA 3SDSA 4AZVA 2IIVA 4ZDJA 4BMDA 4ZAFA 3K1ZA 1LJLA 2Y1OA 1O4WA 2FZ4A 2V1XA 2LCIA 4EJSA 3L7IA 3P96A 3UYLA 5FR2A 1E3WB 1PFYA 5DTIA 3C6BA 1FK8A 3UH0A 5LZ4A 3LY7A 1VIYA 5KCMA 5B1IA 1L5WA 4KREA 4WAUA 3KHUA 3N6XA 4POAA 1ONNA 2I33A 1XL1A 3L77A 4RFLA 4EG0A 5KYKA 4HJXA 1P1BA 5HTOA 2VQ3A 3EXHB 3NZEA 5FWYA 1SURA 5TS3A 3KSUA 1T9CA 5T57A 2QOEA 1KJZA 1COZA 4QARA 3MHTA 2ZI9A 2JAQA 3NAZA 4OCZA 1XDWA 3UY4A 4Y2XA 2C4NA 1W36D 2H51A 4Z0PA 3CR8A 1R66A 2ZPTX 4P6VF 2GPBA 2FDRA 1NM5A 1U7ZA 1JU9A 2AZ4A 3KOZA 1O1YA 2H2AA 4AO8A 4D4LA 3EVZA 4QPDA 5IZ4A 3PICA 3VDQA 2PWBA 1O94A 1W76A 2AB0A 3FFWA 1EGAA 2UYOA 4RDHA 1OLSB 3ZU3A 5KVVA 4E51A 1DAPA 4PY2A 2P9CA 2ZBVA 3VPXA 1II9A 2DUWA 2G17A 3MXOA 1HG0A 2NV2B 4AJ9A 4CMCA 4K1LA 4DIKA 5F7OA 4I19A 1NUPA 2D1RA 1GAEO 1OU4A 4UBLA 4NENA 2XMDA 1AK2A 4XUDA 4RTMA 4RMIA 1RXSA 3JU3A 3MCUA 1HDZA 2W4MA 3DWFA 4GZ6A 1QHSA 2CZGA 4R5HA 1V6AA 5GINE 4CJXA 4ZGWA 1KQ3A 1Q1AA 2YRFA 1M2EA 5CJJA 4PAWA 2A58A 2QJFA 3ZY6A 4BO6A 3T3NA 1FX1A 2PKEA 2XAUA 4URHA 2MYTA 1YL5A 1YUMA 3JD1A 1C29B 3M8KA 3TLYA 1KQGA 3PL1A 2HK9A 3HJTA 1RQPA 4PGMA 3U7GA 4OH7A 5JH7A 4CHGA 8GPBA 4ER7A 3D6JA 1SBQA 13PKA 1TZBA 3HM2A 1TUEA 4BYGA 2Q2WA 3P94A 1M34B 2OWEA 2IGTA 4QULA 4IWXA 3FUVA 1SZCA 3RK4A 3H5VA 1CBUA 3H19A 4FOOA 3T3MB 1TU0A 2Z8XA 2WPDD 4FHEA 4QGBA 4BV2A 1B2RA 4ONEA 5A0TA 1SOWA 1IZ0A 3F71A 3DF7A 4IIYA 4LRXA 4RFSA 3BK7A 1S2LA 4DW8A 1WB9A 2AC7A 4RJJA 1ZGZA 2J6HA 1AB5A 1E3LA 2W70A 3DAOA 4HHEA 4ZOLF 4ZAWA 4M8NE 2ZQZA 1OYWA 2R84A 2ZIWB 4L02A 2OO3A 2QEQA 1N5DA 3EFEA 1RC1A 1EXDA 1QG2A 2D2XA 3L8CA 4B34A 3KR9A 3FHLA 1Q77A 1Z0UA 1CT9A 4PC1A 2V7BA 1P18A 1KXZA 4BGVA 4YRSA 5JDIC 2AVDA 1DV2A 5K4GA 1PEDA 4G0NA 4IJVA 1P5JA 2I2FA 2OG2A 3SYTA 4H3KB 4KXFB 1X9HA 5BV1A 1F1JA 3ZDFA 2B8WA 2ZJ2A 4TRRA 3KQHA 2XXAA 3WJ7A 5CDFA 2BGLA 1WTAA 3A7DA 5C7IO 3OZXA 1VGRA 1NMYA 4BIIA 5HP4A 1ZRNA 1LRLA 2Q2QA 4OQEA 4R9RA 3L1HA 3W4KA 1S1CA 3H1TA 5EGSA 5CT4A 4HYQA 4NJMB 5L95A 4L50A 1Y3IA 3ZHZA 3BHNA 1NBEA 1QR6A 2P27A 4XR4A 4G97A 1QX3A 2OL4A 3CMCO 4F86A 1ZX1A 3R23A 5KPJA 1GPUA 2YWDA 3GARA 1RADA 3KQQA 4JB3A 2QRNA 3MJVA 4XDYA 3B3GA 3PK0A 2XH8A 3VR1A 1WOYA 1COWD 3KSBC 1DJOA 1D1QA 4U2BA 1BDBA 3ME5A 3I61A 1FUIA 2Y1GA 2WTMA 2K4MA 2YJ4A 3A25A 3QEMB 4G5RA 1B6SA 1A04A 3NV7A 3NIFB 1HL3A 1EE2A 1XK6A 2K5UA 3B1JA 3HDVA 3K5IA 4JFAA 1XBTA 3NTOA 4L9RA 1XHFA 4X6YA 1DCFA 5COBA 4C4XA 1B16A 4V3CA 3PNQA 4ZO4A 2BDEA 4BMNA 4CKBB 1XALA 4LA4A 1N32B 3DZDA 2QLBA 2WUDA 3DW3X 2XMRA 2P2CA 2ZFUA 3HEBA 2OO5A 1XEFA 1TJ5A 3OT5A 4ENUA 4MGZR 2HD4A 1FYDA 5C5CA 4DCTA 2VT2A 2FPKA 3RVNA 4YALA 3IAXA 1KZHA 1HX7A 2C98A 1BU5A 4MWTA 2O2GA 3OX4A 3ZHUA 3IKJA 3CE9A 4M22A 3VPBA 1UDRA 2XTMA 3L92A 1AA6A 4OGLA 1YACA 3ENNA 3PUJA 1N6KA 1KFBB 1E2FA 2I1QA 2QW0X 2HZ7A 3HR4A 5JC1A 3GT0A 4O3MA 4KRGA 1U90A 1TIPA 5IRCD 1VE9A 1URPA 3JYPA 5KC9A 3F6PA 2UZ3A 2NYUA 1QXSA 2B36A 3FPGA 3IEUA 5DCUA 1MRSA 5DP2A 3CVOA 1LC0A 1YA8A 1CQIA 3SF0A 1WBBA 2B30A 4FZ3A 1CDOA 1TD9A 2ZYHA 1XR3A 4YAKA 2DUJA 2YBDA 1LDEA 2HSDA 4L8FA 5EZSA 1T26A 3EGDB 4BGIA 1DSSG 3SEQA 3MWLA 2QN6A 1QHNA 3R2JA 1PTJC 5FTWA 4ALJA 5KWIA 3JSXA 3O9VA 2D6FA 3BRWA 3A4YA 3RDPA 2EZ8A 2J5KA 3X2EA 2ODPA 2AA3A 4L75A 3WK6A 4MVJE 1O08A 2NO7A 1NQOA 1BE6A 1EUDB 1QKIA 4L28A 1GGJA 3UMSA 4B76A 3ONFA 3PC3A 4ZTUB 3U7JA 2AKEA 2D4AA 2YW9A 3NNSA 1U6KA 4Q39A 1W25A 1XCLA 3G9ZA 4PTLA 3I53A 4UTRA 3A1UA 3I42A 3G5MA 2HIMA 4U39A 1JT9A 3FFXA 1IL0A 2VPYA 4HY3A 3D6FA 2FW7A 3W5BA 1BA3A 4TRNA 1JG2A 3EH1A 3SS8A 2BF4A 3RF7A 5DI3A 5JIBA 3TR0A 2IH4A 1EVYA 3UCEA 3WRXA 1MFZA 2XZPA 2GYUA 4J2TA 4Q7LA 4MVJD 1TC1A 5D85A 2AR7A 4GMXA 1T9KA 4O4LA 5FBWB 3UW1A 5JNUA 1Q1GA 5JCJA 1R2QA 3M1IA 1RFGE 3KS9A 4EJSB 1I36A 3E81A 2P7HA 2R6GA 4RZSA 4IWYA 1HYHA 4UM5A 4DLVA 1M2VA 4PIMA 3J81k 2BR4A 3QV1A 2I34A 3AJEA 3MJTA 4YRTA 4K81B 1XDUA 3K3PA 4QLBA 1F0PA 3FIJA 4NF2A 2OCYC 5LLSA 3NQ41 4DL9A 4DCMA 4B79A 2G3YA 2VO1A 5CYGA 3R3WA 2PQMA 2UZIR 1P31A 5LD2C 1F0YA 2CLEB 1C1DA 2WWTA 1Q1QA 1ZCZA 2WSSD 1EVEA 3F8TA 4IVNA 4J4TA 1ZHFA 1VSQA 4TS1A 5FWYB 1V16B 3ZE6A 4XJTA 3VJLA 3TLXA 2PFGA 3L0PA 1G4UR 2OGWA 2IPXA 2RHMA 3GUZA 5BSRA 1R8JA 4IXMA 3D3WA 3O73A 1XAGA 1SHLA 1YQXA 4CM7A 2HSEA 1YI1A 4DYHA 3ICOA 4MCAA 2BMDA 3N39C 3GDGA 4IXTA 3DMRA 2D1SA 5CFNA 2Z4SA 2VDWA 2ES4A 3DEIA 1WV1A 2W11A 3UMBA 5F2NA 1MT3A 2Q6OA 1KEEB 1NR5A 2VJOA 3A6HA 3ORFA 2JGFA 2O1EA 1IM2A 3AGPA 3QTLA 4CLRA 3RU7A 5JSHA 2XPCA 4NZOA 2NG1A 4R2KA 5TF4A 1YB4A 4TSFD 2ZE5A 1OMOA 3HL0A 2FP4A 2ZRIA 4RZ3A 4LZZA 3TUJC 3V2GA 3KD2A 4G07A 3NYWA 1JPJA 4NENB 4EPRA 3IKLA 4G4GA 4EKYA 1VFPA 2X76A 1C0IA 1T4GA 4ISBA 3HCNA 2ETXA 4BFTA 5JG7A 1J8DA 1G63A 1L5YA 4BAGA 2PFKA 1UC8A 1HFKA 1PYOA 4GPTA 4JGGA 4DJJA 4IWNA 1DO8A 5T4FA 1OFGA 3LUDA 3UATA 3T52A 3U5TA 5JH7B 3BFVA 4HAXA 4MQEA 1B3RA 1CJSA 1OY1A 4I8IA 4QPJC 4S2EA 1FUUA 4DILA 821PA 4QDZA 1Q7TA 3RTDA 4M0UA 5JNSA 2Q27A 2DR2A 5F2EA 1WA5A 3WWEA 4IFIA 4KXYA 3TCNA 3PNOA 2OQVA 1RCUA 3NDIA 5AXBA 3GRVA 3I64A 5FLYA 4DJFC 4RFSB 2OAQ1 3HK2A 4HMPA 2ID9A 4ZEWA 4BJ3A 1S1MA 1UK9A 2PR2A 1Z16A 2LKCA 2LIPA 1LDBA 2WMOB 3F7OA 4M7OA 4Q7EA 3T7DA 1T15A 2BBTA 2HRCA 3PVCA 3SQNA 4LF7B 3K9BA 5HK9A 3CF4G 4X97A 3PDHA 4YJHA 4IKOA 4R31A 1QZ3A 3BWVA 3HBFA 5C5DA 5LJLA 2IPOA 1G8JA 2VSYA 2W83A 4BP3A 2KLHA 2ORWA 4C29A 1QC5A 1RAFA 1S5PA 1T4CA 4IUDS 3QYFA 2G80A 4IDFA 1MJHA 1EUZA 2VTDA 4EYKA 2J48A 3G85A 1RYDA 3KB1A 4IXDA 4PS1A 4BU1A 2XXAB 3HRKA 1D7OA 4EHLA 1CXZA 1KIAA 1P17A 1KYZA 1P9RA 1JKJB 3WHIA 1ZONA 2UZ4A 3V4VB 2NTNA 2ZATA 5EZYF 4DXAA 2BD0A 2QLFA 4IDGA 4A5OA 2IE0A 5AUNB 3PA6A 1GKLA 1IB6A 2FWRA 4QXPA 2VDKB 3ASVA 3KYBA 5E7QA 4JI6B 5BSMA 2JLXA 4AKHA 2FQ1A 3X43A 2RH9B 3IMKA 4BFXA 3QA9A 2PRSA 1HXHA 4M87A 3ESDA 3HM9A 4X8LA 5HUQA 4Q4LA 2Q4RA 4R8LA 1FDIA 4BEVA 1I33A 1X3SA 7ADHA 4BNJA 5A4FS 1HK7A 1DWOA 2JBAA 3T3GA 3GGGA 1YE8A 4QTTB 3X3HA 4BVFA 3NH6A 2BWJA 4ZT6A 2OQ2A 5EHIA 4OXKA 2O1XA 1AZWA 1JRLA 4GLLA 3VZCA 3D5TA 3A37A 3L41A 4QA9A 1FVHA 2DKNA 4HKTA 5EL0A 3SX0A 3VH2A 4M53A 4PYJA 5GPBA 4CMAA 4OK3A 5C8YF 2E1RA 1D9XA 1R9JA 2OORC 1F8GA 2XVMA 4LRQA 3MTGA 2LNDA 4MO9A 1OXXK 1SRQA 4P5DA 1ILEA 1C8BA 3RUDA 3URKA 1WIWA 4B4UA 1ZW6A 5TPWA 4P4GA 2L82A 4RTSA 5EP2A 3N0TA 1ZKDA 3SZGA 2XXJA 5KPDA 2PHZA 1WSDA 2ZXUA 5K7SA 4BV3A 1EBUA 2PR7A 2F62A 2WJ6A 5CB4F 1LQUA 2C83A 3FCEA 4QC2A 4ZYXA 3QGMA 1WUIS 3C0KA 2YWXA 3GUUA 2X22A 3OTQA 1F60A 1ID8A 1QGOA 2EERA 3QEOA 4RO0A 4RMJA 1UANA 4W6QA 3F5FA 1OXKB 2Q1UA 4KWIA 1CQIB 2QNRA 4QDXA 3TXAA 4F4DA 4XRGA 3RRZA 3K71B 1GEGA 2DHDA 2JIQA 5H81A 3VR5A 3WDMA 5EHQA 5ECWA 1NC3A 3UK2A 2XWQA 3OQHA 4B40A 1UAGA 1VA4A 5IDQA 1DCMA 3QMMA 2VJQA 4DLZA 4LDRA 3HHEA 3FTNA 3FYUC 2C77A 1FFAA 4RLSA 5D51S 3W0LB 4P54A 2CKMA 5IJWA 4LHVA 1OE0A 4NU6A 1XTBA 2FE1A 3FNRA 5J5VA 4E6EA 4YPFA 1JDJA 1CE8A 1Z73A 1GSHA 2NACA 3DOEA 1OFUX 3AGQA 4ZTBA 4A1OA 1XTUA 4Y3UA 4GOKA 4EJ0A 3OKFA 2A0XA 1Q3TA 2FPXA 2QZPA 4IMRA 3ZVNA 5HEKA 1AN9A 1TO2E 2H48A 4MVJM 5KOJA 1GPH1 4F4JA 3GLFE 3IAS1 3QMPA 2VCEA 4RX1A 4XIYA 1LZLA 2GVZC 1IJKA 3FCOA 4YP7A 2EX4A 5DI3B 1X7GA 1MN6A 2VWGA 3VNAA 4B6GA 3R0IA 5K0GA 1VXRA 3M6WA 3FWYA 4G8DA 5BXQC 3RI3A 3MA0A 4J9VA 3FR7A 5DTQA 3U3XA 1IMJA 4GGPA 4F5EA 1SU7A 4O4LB 5DLYA 2FDCA 4JROA 3O3NB 2BKVA 3I2HA 2YRWA 4KUGA 5TJHA 3ACCA 3IT2A 4I6JA 2RBGA 2XKAA 4CCSA 5LU8A 4EF6A 2CBZA 1M2VB 1QIKA 4OJNA 4YAFA 4XYEA 3UAVA 2P6MA 1JIKA 4RPIA 2WWWA 4B33A 1NAIA 3KEFA 1O6ZA 4ZWNA 3LW8A 4I50F 3UHPA 4FEYA 5AI4A 4AD8A 2H4ZA 3W34A 1ZEMA 4NARA 1N2CA 1E7WA 1NLUA 4KMSA 4OIFA 1D03A 1N75A 3ND7A 1C1DB 1G8SA 3RARA 4FUTA 3RV3A 5DCYA 1L9XA 1PKXA 1S2DA 2ZVDA 3CGWA 2GJ8A 4HNQA 3F9RA 4MITA 3QOFA 2GDZA 1DEXA 2PU5A 1RJ9A 1UM9A 2EX0A 3QG5A 4C0WA 4DCCA 6NULA 3TEMA 1WPRA 2BC9A 2BSXA 3ESRA 1YJBA 3D3WB 3NUQA 4MI1A 1IOLA 3DUWA 4D2IA 4K0KB 3AM3A 2RJOA 2FKAA 3HMQA 5K3AA 4CLDA 5ULLA 4D5EA 4GYKA 3UZUA 5H7XA 1MCZA 3AM5A 4BWYA 1HYGA 1O96A 2A6PA 2F64A 1Z37A 2FWPA 5SY6A 5KYUB 1EUQA 2JRCA 1E9FA 2ZJ1A 5KYYA 2POCA 4IIGA 4PZ0A 4BMOB 4Z3OA 1K89A 1PYDA 2PKYX 4MQLA 5KKNB 3TAXA 4UTVA 3NEYA 5AKYA 3ESYA 4WCFC 4F3NA 5CNMA 1UIRA 1PGPA 1E3TA 2FP4B 3R3UA 5AJHA 1XB2A 2A7XA 2Z30A 4IZIA 4OXNA 5CW1A 3OSUA 4G2NA 2ZREA 3I83A 3I1FA 3KZ1E 4E94A 1K98A 1ZA1A 3LBAA 1E2NA 1IN7A 1DRJA 1DT3A 4HEA1 3WQRA 2A9JA 2CDRA 4JQCA 3TFOA 1CDZA 1MIOA 4CF5A 3MERA 4V0NA 2BEUA 2GRAA 4EP1A 3A04A 3IYLW 4MQEB 2F2TA 3PQFA 3KQUA 4Q93A 3DMFA 5LQRA 3RTGA 3GJRA 2FMHA 3FNFA 5D5HA 2IYXA 1KKLA 3K9CA 4P22A 3ZLBA 1ARZA 1Z13A 4BO2A 1ZQ9A 4C0BA 1B6TA 1M34E 1QVRA 2IA5A 4DCOA 2QAIA 3GAFA 2E4XA 1EP2B 1QIFA 4RVCA 3AIKA 4RH0A 5A5VA 2YWBA 4M1SA 5DK4A 1XZJA 2Z83A 3KSDO 3LPNA 3ZV4A 4NS4A 2FK8A 5ALHA 4JLMA 3R9WA 4QPPA 2Q7DA 3TE7A 3K32A 4ZEMA 4YJHB 1A5BB 2NV6A 1Y7LA 2P78A 1DELA 4G0WA 3IULA 3V48A 3WZMA 2IEYA 4F0JA 1TCAA 1QC5B 2EKBA 5ALWA 1T4CB 3BZWA 2FGJA 1LLUA 2AXNA 1TRHA 4IHJF 2OZKA 4R9SA 4BEWA 4GM0A 1OZGA 1TL7C 4KH0A 1P0QA 2BKXA 3D2LA 3CH7A 2CXNA 4U7PB 5AHKA 5FP0A 2R5WA 2I8AA 1C14A 3O2QB 5D5PA 3W3ZB 3TPCA 5JC8A 1G1MA 2ZZNA 1H93A 3JQ6A 2GJKA 4I9FA 3RAJA 3WISA 4B6SA 4C4PA 1GYRA 4MQBA 3V4PB 4AJ1A 3AIIA 2DSTA 1H0KA 4BQIA 1RZUA 2ET6A 1Y6RA 4E0BA 2HA6A 3FX2A 2E5WA 4PIVA 3GJQA 1T10A 1USUA 5J40A 1VMKA 1NIJA 5CNIA 5JWHA 3QVTA 3GFFA 4ZCQA 2R79A 3PUZA 1M67A 5U1PA 4F8YA 4QM7A 3HO8A 4X8MA 2PUEA 3BREA 1UJ2A 4GQBA 2XUKA 4IP0A 4QODA 4OHPA 1YKGA 1XLVA 3RANA 3ZWPA 5B7NA 1NKVA 3PGXA 4QEZA 1E3QA 1JJFA 2YYAA 1RKQA 4P32A 1RI2A 4LDPA 1PL7A 3MGBA 4UUAA 1Z56C 3G1UA 5BOVA 5I3CA 1J1IA 2JBAB 5JZMA 3RLIA 2C7RA 1W49A 1ZI8A 2EJVA 1TYAE 2WTBA 3BXXA 1PRYA 3FRHA 1Z2NX 3FWNA 5AI5A 3SKYA 3KWLA 1WY7A 4QU0A 3EVAA 5IWCA 1JHXA 4NMXB 4WK6A 2BH9A 1YONA 3NR2A 1JWAB 2IPAB 1KDPA 3LPCA 1C7FA 3H97A 2NSJA 4TT3A 1EM6A 2JZCA 3CX4A 4G86A 2OXTA 1ZL2A 5JPCA 1L8LA 3CZAA 4NCKA 3I3SR 4EZIA 2HCJB 4Q0MA 4P31A 4XIGS 4F8JA 1HDCA 1RPTA 5TS2A 3S2IA 4RA6A 4TS4A 5EXTA 4BGDA 5TPWB 4QNMA 3HCRA 1P80A 1ZD9A 4OTZA 4P86A 4AJPA 2CFCA 3EPRA 4TLDA 4UVHA 4QUDA 4ZO6A 1YVRA 2C8VA 2ZR7A 3EVTA 3FBTA 2QN1A 3I9LA 2M6RA 1K75A 3VTAA 2FZGA 1M33A 1LI7A 2NU8A 2PGOA 1MP0A 5FQNA 2IYOA 3RGWS 4DJAA 2P9TA 3AI1A 3OX3A 5H4GA 3R5SA 4ZAGA 3SKXA 1GZSA 3OJOA 1V95A 2HX1A 2P68A 2PV0A 4OFZA 4RMGA 3SHVA 3BBPA 5AXDA 5G02A 3V8BA 4E5PA 1BHJA 3QU2A 1LPPA 2D2EA 3ZW8A 2RKWA 4D3FA 3ENZA 2VNAA 1XRRA 4TXJA 3WGJA 1J8VA 1LA2A 1P7YA 3BBLA 4IGAA 3T9CA 4NBLA 3WL5A 4FIDA 1E6LA 1QHEA 4G26A 1A27A 1EBFA 1JQDA 4CQNA 3BAZA 3CSSA 1RI1A 4I3FA 3KPVA 3TQRA 3W5AA 4Y0VA 1PZMA 1B0AA 1CE8B 3KHTA 5B12A 1SHKA 4WKNA 1H4TA 5ITZB 3PIDA 2COEA 1ZRMA 2VPPA 4QHYA 4BO4A 3SVTA 5KOJB 1H4VB 5F3DA 1YJQA 4K6GA 5JNLA 4CM9A 3MBKA 3DHVA 4PS0A 4BV9A 3E1SA 3VKFA 1O77A 4GM1A 3M6VA 4BEBA 1T34A 1PS8A 3ZGNA 3IDZA 3IDOA 3LKBA 4RZQA 1RKXA 4F1JA 3MOGA 3IOMA 3VNVA 1M10A 3PNYA 4NC9A 3ZTYA 2G5TA 4QDOA 2FU5C 1GQSA 4NCBA 2NYRA 1PK7A 2VDJA 3QLVC 1WUTA 2I2CA 2IVZA 1S3SA 3D8UA 5K3FA 4B2LA 3G49A 3K1AB 4GLJA 1VDZA 3A3PA 2EYQA 3BJEA 1BJTA 4ZRDA 1NE2A 4KB5A 1GWNA 4AN0A 4L2IA 2QHXA 5KI6A 1G6HA 2O5RA 1V41E 2ATIA 1R12A 4KQXA 1HV8A 3HB7A 1GLGA 4Y6PA 4C4OA 3UMYA 3SC3A 1N6RA 4I36A 2NTYC 4J7UA 5BOSB 1IJEA 2VBFA 3GFGA 4NATA 4QBFA 2KB0A 1E6KA 5K3DA 2A0FA 1PT5A 4E1VA 2G9NA 4V03A 1RJ9B 1UM9B 1E61A 5FL7A 5BSWA 1X92A 4BC0A 5IU6A 4MRRA 4RPJA 1M83A 1W36C 4D4IA 5LBUA 1EFVA 4ACBA 1CTQA 3KT8A 2FUCA 2I6UA 3HKBA 4G5QA 4RLQA 4WWHA 3MFQA 2Y67A 1AKMA 2ISSD 2V6GA 3IHKA 1Z8NA 3QOXA 3R09A 1SM4A 4FILA 3ZGOA 4E5YA 5IKEA 1D04A 1EE1A 1AKQA 1TPYA 1G59A 3MFYA 2JIPA 3UTDA 5KYYB 2QD1A 1EK5A 1UOOA 3DLCA 2DTDA 3P9SA 4N3AA 4XLTA 1WETA 1C8VB 4GT1A 5TQJA 1SUEA 2I4TA 3H4IA 5TQVA 3IILA 2EFJA 2I54A 3ZGYA 2OV8A 4HZUA 2OPHA 3TR5A 2NADA 1TCVA 4N40A 5JLAA 2R8YA 4KQEA 5DYTA 4BASA 2ZI7A 4H35A 2OMEA 5AM0A 3MXTA 5KTMA 2NUPA 3LC0A 4S1NA 3NHLA 2ZRJA 5KO2A 2IZ7A 2VP4A 1YRYE 4BO5A 1XCOA 2X0FA 1MIOB 3CBQA 1G2IA 1L3CA 2BEUB 3B9PA 3GZJA 4EG5A 4PAGA 2B9VA 4ZU1X 4EPVA 1ZR4A 1TZMA 2L17A 4CDGA 2XOXA 1E1KA 2PL1A 3UTCA 2IEBA 3FROA 1EP1B 3QJ5A 1O94D 2TMGA 3MCAA 2H1LA 4BKQA 1X2EA 2IF0A 3VM6A 1HDYA 1L4HA 2I4NA 2PRYA 2YDYA 4O4JA 2AD5A 4OAQA 3U4AA 1HDGO 2B4RO 3IPYA 1GNLA 1VLZA 3COVA 3DQZA 5GJVC 4PBRA 1JEJA 5L8VA 3D43A 4YIKA 2CV0A 2CW5A 4X66B 4W7HA 4JBYA 3N2NA 3KTFA 1E1QA 4IZ6A 3W2FA 3ZWBA 3NOXA 3DDSA 1W4BA 1J97A 2WWYA 1Q2UA 5J2UB 3S29A 3TZ6A 2J0QA 2EWVA 1YT5A 1ZD3A 1Z62A 2B99A 3B85A 3C3WA 3INYA 1OXVA 1EJ2A 1Z18A 1BFUA 2B35A 2CUZA 1NDQA 1U0SY 2ZRFA 4L6IA 4O2RA 4F85A 4F8EA 4HRXA 4A9AA 2ZTSA 4KQIA 5KINB 1RYBA 5C8DA 1VXOA 2P4EA 1ZEJA 5FYDA 3D3EA 4HRVA 3LCJA 5L7WA 1CUFA 1UCFA 1DJQA 2HA4A 4URVR 4NPHA 2J4CA 5AICA 2I5PO 2F4NA 3K9QO 4IDAA 4C4RA 1G3QA 4WDRA 5L4LA 3HPQA 3VDMA 3KB2A 3ZS9A 4E08A 1N34B 2HCTA 3IHLA 1RXYA 2EW8A 4GBED 4PPQA 4WNCA 1IJBA 5CDFE 1XX6A 3SDZA 1Q7CA 1WHTA 4QGSA 3I32A 1K5GA 1MNQA 4M1QA 1GJRA 4HEHA 4LOLA 5DGTA 5IARA 3KJZA 3LLMA 2I4LA 4RHFA 4PAOA 2NU9B 5FDFA 3O1HB 4CKCA 5EWJA 3JQCA 3C48A 3SLKA 1WCXA 3ZLVA 1GAXA 2I4IA 3F9CA 2IOQA 1C4KA 1O9HA 2YASA 3ESCA 4MW5A 6GPBA 1M1XB 2F4VB 2P9GA 5AJWA 2C7GA 5SV2A 2PAAA 1XGKA 3P9RA 3FOZA 5AVQA 3VO1A 2IS2A 1ZUWA 1JU4A 5G3YA 3TK1A 3PPYA 3DP7A 4N6NA 3QHPA 3U4QA 1TJ4A 4UXHA 3FAZA 3IFSA 4MPPA 4ATNA 4US2R 4E30A 5E3HA 2V6BA 1OU0A 2CB9A 2C9YA 3RS3A 1PL8A 3Q9NA 2RGGA 1J9GA 2QP3A 2XBUA 3K96A 3T15A 2YJZA 1Z12A 1GPJA 1OWMA 5K45A 2GFQA 4OSPA 2PRZA 1FU4A 3W3AA 5JR3A 1SBHA 1ZK2A 5HM6A 3NJ8A 4KYIB 4RA6B 5HBGA 3OIWA 3CB2A 1Z4MA 1GSOA 1H0HA 3W7BA 1G4AE 1XP8A 3AHEA 4S1OA 5T41A 2GESA 4EF5A 2PS1A 1I80A 2ZRMA 4DMCA 1QANA 5K01A 2BZ0A 3WMEA 1EK1A 2AG0A 2BVNA 4HDSA 3LC2O 5DKFA 3L9XA 4DUGA 5T3YA 1DXQA 4TUYF 1CEQA 3I37X 3FWHA 3QX8A 4FJ0A 3GG9A 4MB6A 5FO0A 1R0BA 3H87A 2DERA 4GR5A 1UJBA 2B1QA 2XCUA 2Z9CA 4UNPA 3TW6A 3RSHA 2Y0EA 4LNAA 4WIAA 1HOXA 3RVOA 1I7DA 2JIMA 3EZYA 4ZRMA 3NUGA 1MQAA 3STUA 5FH9A 2IYEA 4FZVA 2YUTA 5KWJA 3IRUA 2XWPA 1CR4A 1P7PA 3GY0A 4LJKA 1UBEA 2NYAA 3EVBA 2Y0BA 1ZMRA 4MYCA 2BKLA 4URYR 5CBPA 4KKXB 2NQ2C 4C20A 1IN4A 1DKLA 1IIBA 1Y81A 3FZGA 3AONB 3LL7A 2DTXA 3KT0A 2XMGA 3CXUA 3BE8A 1CHNA 1R4MA 1R74A 3USES 1FS4A 5BUQA 4PG6A 4BEJA 3CVVA 3DZJA 3ZJVA 1OI7A 4TV8F 4YI5A 1PJAA 2O3QA 5JARA 3A1EA 5F5XA 4TKUA 1Z07A 2VUHB 1XWWA 5I4CA 3OHMA 3SZLA 4D45A 4RIIA 3SJCA 4E5VA 2FPIB 6CHYA 3QELA 5F33A 4FNMA 5EJAA 3VYWA 3M1YA 4DXDA 1B8NA 1YZLA 1ND6A 1KO7A 1TAQA 2X2FA 3JPWA 3KZVA 4FZ5A 4D0GA 1JLRA 2X9NA 4XVQA 2R7KA 3GLRA 4HXGA 3BRWD 1AHIA 1PIWA 1ZN9A 1DEOA 3ITNA 5D5QA 4ZICA 2C9DA 5IXYA 1D2CA 2MMGA 4JDPA 4IGKA 1E94E 4UU0A 2ZUFA 1QQ7A 1P2DA 3EAFA 2EC5A 2C1ZA 2XYVA 1PGOA 4G84A 2XYHA 2FTKE 4TM8A 5K3FB 1JPVA 4ND8A 4YB8A 2WKWA 4E14A 2IV2X 2FI1A 2WILA 2CF5A 3EUAA 3B6IA 3C70A 1NMZA 4FSXA 4FM9A 4L2IB 2CJPA 1UZNA 3BRSA 3ENKA 7GPBA 1ORRA 2FQXA 4ZMRA 2WTNA 1GVHA 3BMOA 2RKOA 3C97A 4QJ5A 1A9PA 1GR0A 3C8HA 3G0OA 4PRKA 3CCCA 1ODSA 3MMXA 4MCJA 1TMYA 4KXUA 4D0LB 5BN3A 1K3UB 1H65A 1L6IA 1N2OA 2PUTA 2VBCA 4Y2RA 2XVZA 2LCQA 4CR7A 1BXKA 1FIUA 4RVOA 1CY7A 2IHZA 5CB8A 2RGCA 3OF5A 1FNSA 1YDMA 1EFVB 4FDLA 4QU8A 5JCJD 1XFDA 1WLSA 3HKBB 2IBMA 3IGFA 1Z47A 3P0RA 1KDYA 2RHOA 1SCUA 5IJAA 1Y1KE 2P5UA 2ZJBA 3NTQA 3Q9LA 1SA0A 3OLXA 4ITRC 6YASA 4RTPA 3KETA 2R6ZA 3GA0A 2AR9A 1DC7A 1AZTA 4AJJA 1PG2A 2E4AA 1XOIA 5JS1A 1GKYA 2XGOA 1W88A 3T61A 1IXYA 2C9BA 3LX6A 3ZZ1A 4LDAA 3GRRA 1E1CA 1M2GA 1W5EA 4MYUA 2X40A 4IV5A 4HZUB 5A9RA 4TPKA 1MOSA 3FPKA 3OC0A 3SBDA 4ZYVA 2DU8A 4LDQA 1Q6YA 4P58A 2XGSA 3Q1KA 4Q7KA 1D09A 1U04A 2QNBA 1P60A 3CZ5A 5IC6A 2QVYX 1UPBA 2I3BA 2VP2A 4FQ7A 4XR9A 4EG1A 3JD4A 3AM1A 3ESZA 1TB4A 3GIWA 1EWTA 4MW0A 3EUFA 4NKRA 3TDNA 2AG1A 2CL0X 4ABYA 4H3SA 1QS0A 2D00A 3DO5A 4EFDA 1DIOB 3DULA 2WJAA 3IJPA 3K16A 4LK3A 2F9FA 1I5EA 5LU9A 1T5LA 3ND8A 1UQTA 1QLWA 3ICVA 3LCCA 1A4IA 1ZG3A 4KCGA 4TWRA 2PMBA 1GZ6A 3GEGA 4O4JB 4PEVA 2G25A 4DY6A 5AQ1A 1T5DX 3FPBA 2OGTA 1P3Y1 1EFPA 3TZKA 2Q0XA 4D79A 2HK6A 3AO0B 3OZSA 1TAHA 2PAFA 3D6TB 2EJWA 3O8LA 3IBFA 2VT7A 4L4ZA 3H2HA 5IN4A 2HDNB 2R8OA 3RS4A 3DWEX 5I7AA 1GUYA 2X3UA 2PWPA 1PWYE 1YQDA 1CUZA 1W87A 4Q12A 4ZQGA 2X4LA 4GOJA 1M6HA 4K6MA 1QVZA 1S8OA 4M1YA 1L2TA 1CY4A 2PEZA 4KX5A 1Y4UA 3OIFA 2BF7A 2I3ZA 1K8RA 2ZGVA 1RM0A 3CZQA 4YROA 2WSYB 3E8SA 4CUJA 2WTUA 4RV9A 3NYIA 4F5WA 4G89A 3FN4A 5E2IA 3KVYA 5FCDA 4CMHA 3UGKA 1V25A 1Y7PA 4W6ZA 3DKPA 2JB9A 4XLZA 4DUPA 3NVMB 1JG3A 3CPSA 3H2SA 3DDZX 1DMRA 2QG4A 4BVGA 4KR3A 5IVIA 1RXWA 9MHTA 1A9OA 4B6FA 2ZQ5A 3ND9A 1YDHA 4CFYA 4DSNA 2LGJA 1VHWA 1MB4A 5JSFA 3Q10A 4DHEA 1WHTB 3U44A 1TCBA 3IPCA 4EKDA 4UFNA 2F1KA 1R64A 5A6VA 4KAXA 1U7WA 2D0IA 3ZV5A 2Z3WA 4AJLA 4OQQA 4PLYA 4B82A 4B5KA 4CKCB 1C9KA 3NHAA 2QW1A 2O3SA 3AEUB 4LE0A 1P1KA 5CPBA 5EWJB 1AK1A 4A10A 3OJEA 5IJ0A 1OB2A 5IM4F 1FFWA 3WAJA 4I4NA 1VPDA 2I0FA 2AMFA 3P0IA 2IU0A 1XSEA 1BE8A 2QVBA 4KDFA 1BCRA 5KMGA 3BS4A 4BL5A 3CKLA 3EIFA 1D6JA 1V71A 2FEAA 3DM5A 3GGOA 3LOQA 3OJ0A 4QTUB 1S2NA 2VJMA 1UBFA 3U4QB 1WVIA 4PNPA 3KEQA 4LFAB 2EKQA 1ATIA 4DG8A 1PBTA 3PUWA 5A05A 4Q3AA 2UDPA 1ZK3A 2E5FA 1H6DA 3CO0S 4G0YA 4QPNA 1TM1E 2F48A 1ZIYA 4B7XA 5JCOC 4ZA2A 3O4IA 5AK4A 5G1OA 1F2UA 3WK9A 1D0IA 1GPKA 1U5BA 4UUOA 3SYKA 4HLCA 2IKSA 4LN1A 3T3IA 3AU9A 4P08A 1EM8A 1T1JA 1EUYA 3DCNA 2DPMA 1GV0A 4HMOA 1RW4A 1XWFA 2XF2A 1UZAA 3BSSA 4I4CA 4ND4A 1K4YA 3KDAA 1IBKB 2IX9A 2Q5JA 5EY5B 3VGPA 3CKYA 3OPVA 2F59A 3IP9A 1MLDA 5ABPA 2PZJA 3HA3A 1REQA 3CGGA 5HILA 3Q9UA 3OECA 2MTBA 4Q21A 5IAAA 5DNUA 4HDSB 4HVTA 2VFAA 1JILA 4OHXA 2VPIA 2L0XA 4HEJA 5BW8A 2UYHA 2VPXA 3EH2A 4DDMA 1VI6A 1V4NA 3KVOA 4BUCA 1A95A 2Z4RA 3LDGA 1GCGA 2VXOA 3P4UA 4ZRNA 3WTCA 3DMTC 3MBOA 1GRRA 3NRCA 3OPYA 3OJLA 4D6YA 2BJHA 1AS0A 5LR6A 1E2QA 3C43A 2JKYA 1YE5A 1XA3A 1HETA 1E99A 3CX8A 3Q7IA 2CE7A 4WD3A 4NG4A 2Q46A 1UT5A 2J85A 1K08A 1B74A 4UTOA 3U13A 2JKVA 3ILSA 3TECE 1OI4A 2ZP1A 3KR2A 3VDNB 4CG2A 2GCPA 5I7WA 4ZT4A 4QELA 3ECAA 1RBZA 1T2AA 2Z1DA 3RS2A 3TXYA 1R4MB 4J1NA 4LRUA 4BBJA 5C80A 3K09C 2QDKA 1I3OA 4Q19A 5B3LA 5L3SA 1P45A 4FR0A 3A0RB 4JP3A 4C4AA 4C30A 2YVUA 3UOWA 4FT2A 4IX1A 4F96A 1A5ZA 2IUYA 2X5XA 4UUPA 3WRYA 1SD2A 3G7SA 2XQFA 3V8NA 2AI2A 5HS6A 3VR5D 3FRJA 4EPYA 1ZYUA 2V4MA 3HCCA 1SKMA 2O7NA 3I1YA 5CFRA 3SVLA 2C7QA 2NNLD 3D8TA 1XXHA 4PPYA 3KQPA 2GF2A 4Y9RA 3VYTB 4BRWA 5BW4A 4G25A 2C3UA 1ECPA 3N0RA 2C8KA 1E6UA 4UZSA 4ARUA 3KE8A 1ZDMA 3QEJA 1Y3FE 3D4PA 3HCEA 4CN9A 2XGJA 1JVSA 3AXTA 2HU8A 3AJ9A 4K40A 4QGFA 5EVJA 1HT2E 4XH9B 4ND8B 2QE7A 2X1HA 4JGIA 3EPJA 1M1NA 1XNRB 4K9NA 1ZH2A 1E8DA 3A6GA 1ESMA 3SMVA 3SXUB 1P7VA 5G0UA 3WV4A 3DM9B 3IESA 3ZVKA 4RY2A 1U2TA 4B48A 3MWFA 4E46A 3PSAA 1U3UA 1KYTA 2V97A 1A9YA 2CMHA 3BMOB 3FWKA 3L8GA 3P5SA 3T1YB 1OAOC 1UBKS 3F5DA 2WJHA 2WU4A 3NWJA 4HVLA 2X0IA 2QL7A 4DJTA 5KNCA 2GKOA 1NJ5A 2Y6VA 3AY3A 3VPCA 5BSFA 4D82A 1CY6A 3R3XA 2RI6A 3B36A 4G5XA 5AYVA 1ZBQA 3WAKA 5BN3B 3IAM1 1A4RA 2QN3A 4UC0A 4DJDC 4EI9A 1SUIA 1Y48E 3FPSA 1RAGA 1MO5A 4PSUA 3ND6A 4TTQA 1HQKA 2YWEA 4J0EA 1R5OA 2C04A 4NYJQ 3SJZA 5ECDA 3A7EA 1I14A 3DBHA 4MSUA 5JI3E 3GNQA 5HIJA 4U7TB 3WL3A 4AS3A 2K7FA 1XQWA 4JI0B 1SA0B 1SXGA 3IAHA 4CQJA 4BCBA 5EJEA 2BCJQ 1FP7A 1YFZA 3B6KA 2XNSA 4B75A 4DRYA 2XIQA 2B83A 1H1TA 1PNVA 1UBOS 1W88B 2VRCA 3K0AA 3WQBA 4KGXA 1PJBA 2NN3C 1E1CB 3M82A 2I2XB 4LCJA 2V59A 4WDQA 3W8DA 4B3HA 1L8OA 2DBRA 3WGKA 4J4HA 1PVDA 2AXQA 1LD3A 2AS0A 4F46A 1ZH0A 4F4HA 2V6FA 5I7EA 2BH2A 2WDPA 4YECA 3ER9A 3K4HA 4YCAA 5JJKA 3JQGB 3BMXA 1VPTA 1M2JA 4JYPA 1B8PA 3AEXA 5CU7A 3S1SA 3CG4A 4X84A 2QX9A 1PVVA 3PE4A 3QIAA 1CZUA 4C0SA 2PGJA 2OA0A 1Q14A 1QS0B 2P90A 3PWZA 2JLZA 3AVPA 1HNWB 2WF9A 3F4LA 3CLVA 3BCRA 3G79A 4BNDB 3TLKA 3NYRA 1DJMA 4CBVA 4WXEA 1TEZA 4M1WA 3NNDA 2D3TA 2YVLA 2RHJA 2Y1LA 1L4YA 1ZW1A 3EQ7A 4AL4A 2DPYA 1SFRA 1YMVA 2J31A 3DXZA 2HCBA 4OI2A 4OQXA 3VC2A 5JXHA 1NN1A 1KSHA 2LRHA 4ALKA 1XZCA 2FMUA 2YFHA 4OXQA 1EFPB 3BHMA 4KI0A 5I8WA 3SJUA 3D5EA 3FHTA 3ZOZA 1Q0HA 1DAOA 2X13A 4JZKA 4LBYA 3ISVA 4PFQA 2CLSA 3WIBA 4IG9A 1MRNA 5BURA 1E32A 3ZS8A 4HDRA 3LNCA 5HNKA 4KACA 4QAJA 2FYTA 4KAAA 1LSUA 1AQYA 5ALKA 1A8UA 3V00A 1CU1A 1WVMA 3T9DA 1SCQA 2GSWA 2M1ZA 4GPD1 5E3JA 2XECA 3H86A 1J0AA 1WXFA 2CDCA 2IY7A 2ZTHA 3M9XA 4D9NA 1L3BA 2R7NA 4J29A 1ZUIA 1YQ9A 4R8VA 3TD2A 1Y7IA 2HA0A 3FPEA 1JA0A 4GZLA 3N53A 1RKVA 4MS1A 4PTYA 2CLIB 4PR0A 1WBDA 4KHZA 3W5IA 2GNPA 5CFPA 3QHAA 1XCPA 4I3GA 4N3CA 4H1VA 4UBNA 3TQTA 4B2YA 2YHIA 2AK3A 3DCJA 3AETA 4GKAA 4INJA 5F5NA 4N0PA 1HGXA 2IEAA 2MHCA 3PWTA 4RH3A 5IF3A 3EZ6A 1BXZA 3TLBA 4ZYWA 1XQVA 3IALA 5HKLA 1KFKB 3EXFA 1F4PA 1XN4A 3N86A 3N5KA 1EK0A 1V1JA 5KKAA 2HSZA 3U44B 3L4EA 1KH2A 4J7XA 4Q1DA 3Q8LA 2HHJA 3PF8A 1XTPA 3FYSA 1FTSA 4JX9A 1PEAA 4RZIA 1XEWY 4MAMA 4DA0A 2I03A 2XD9A 2YUIA 3OC6A 4H31A 5IJ0B 3HZOA 3CS3A 2ZUVA 2D2VA 2J67A 4TXHA 4ALLA 2Q1XA 3SWWA 1JQ3A 5KMGB 3OZGA 1YZNA 3SS7X 3OZVA 4PGHA 2QLTA 4BMXA 2B7BA 2BFPA 1LTKA 2Q4EA 1B93A 1UT6A 3HCPA 4PINA 1QNLA 1OHHA 2VJMB 1C7RA 4RTOA 1R50A 5JNRA 2FB9A 1WSBA 2JHCA 3IEVA 2H0AA 3ESQA 3M1LA 4HNSA 3DTYA 1MD9A 4LYAA 1VMEA 4AULA 1KJJA 4FI3F 4W8OA 5DM1A 4OHVA 3FE2A 2Q50A 1SBTA 3H13A 3KAPA 1X80A 3FFTA 1F2UB 1FE8A 2JAPA 1GQFA 1EP9A 2G72A 2TRSB 3E3AA 3H9GA 1E1MA 1POXA 4I55A 1MOZA 4FYVA 4LJ5A 4TT8A 1WUKS 1EM8B 3FKSA 1SWWA 3RWOA 2AQHA 4MYTA 2WJ3A 2P9YA 2Q41A 3KVRA 5CX4A 5BNTA 5C8VA 1YBHA 2ZB4A 1T2UA 3QE2A 1YZUA 1JJVA 1KZ4A 1PV2A 2YQ4A 1RACA 3Q2OA 3CNEA 4IIUA 4D9FA 2IP2A 1REQB 2XT6A 4HMQA 1I4LD 3FSGA 1N5MA 5JS2A 2OB2A 4R2WA 3EA5A 5JISA 1OQAA 1TDJA 4LBVA 3X1JA 4U8GA 1XJCA 4K86A 5BQOA 5CIYA 2G71A 2R5FA 1U3FA 3I4LA 3OPYB 1THMA 2FW9A 1UWLA 1JAYA 3AINA 3E3LA 4UNNA 3ZBPA 4B6PA 4E33A 1YFKA 1L0BA 2P8SA 2GZ3A 1RWXA 2H1WA 2QXYA 4TT3D 4G4IA 3WIOA 2ZJ4A 2WM2A 3FHOA 3CG0A 4AKGA 3R77A 3G2QA 4BNGA 4P7FA 2E4UA 5IYZF 3GDFA 3QW2A 1CC1S 4GVXA 3HYNA 1I3NA 1Q0LA 2QTNA 3C3KA 3LT2A 4ETMA 4S04A 1YTUA 3AR7A 4NV0A 1X8JA 1JHYA 2ZAOA 3FYTA 5FPPA 2C61A 1QK3A 2QUIA 4J1SA 1G1AA 4RKYA 1GKUB 5H3CA 1C81A 3I4FA 2DH5A 5EKTA 4QUEA 3S7ZA 1XMXA 1V1MA 3OCJA 2GPSA 3BGWA 2I7CA 1P9LA 4QL3A 3BJIC 4DEXA 1JS1X 2B8EA 3N2ZB 1KWKA 2F3QA 2WNHA 2X8LA 3NAGA 4PCAA 4OJTA 4JLVA 2AX3A 2WHQA 2NUBA 4IR7A 4CIWA 1Q7RA 1AG9A 2R8BA 5LYJF 1ABFA 4TOIA 1W93A 1NWHA 4ZCRA 4LV8B 4LV5B 3AILA 3DDCA 3UJBA 1G3RA 3D7MA 3EXIA 4WKPA 4PICA 5E38A 3GN2A 3D8HA 2M6LA 2VK1A 3M9LA 3HYCA 2C8JA 4IIDA 1JWBB 2BEVB 4R1NA 3RK1A 2HNKA 4JLKA 4B6EA 1UBNA 3JQBA 2C92A 2DPLA 4B3DA 3S2SA 2REQA 1XIVA 3MHPA 2F8MA 4AUNA 4J0FA 4LYYA 3K0FA 1RJGA 1M1NB 1ZOOA 4WK4B 1JX6A 3BD6A 3O94A 3O8DA 3GBPA 4X1KA 1CFJA 1JSLA 2BHRA 2XNJA 1K27A 4LC0A 5ALRA 3U62A 5L3QA 1NTOA 4PC2A 5JZBA 2BMVA 4CM9D 1M73E 3EMKA 4MI3A 3E9ZA 2R62A 1SCDA 1FF9A 1X1SA 2E87A 3L0YA 4YRFA 5BWMA 5JNTA 2NUAA 4LYJA 3FETA 5AXCA 2PS9A 2Q6VA 1PU2A 2AJ8A 5IVKA 4DC9A 4BNNA 3L7BA 4ZOAA 3W06A 1AT1A 4U2KA 1V3TA 3ICEA 3LZCA 1XCGB 3VPSA 3PXCX 2IZ5A 2P1ZA 4MHSA 2G4LA 2AJBA 4EJSC 4DR5B 3DBHB 1N3YA 3EWSA 3S81A 3VJKA 1K6EA 2P5SA 3GPIA 3CWQA 2FKNA 3OJFA 4OMDA 4RFVA 2I2DA 3IV7A 3L6BA 4HFRA 1XTJA 1H3FA 1QK4A 4KLNA 4Q1AA 3C3PA 1T4DA 3DV0A 2BFCA 5B1HA 4YS6A 2DAPA 3K0AB 4GPBA 1F06A 2MWMA 3KR1A 3DVQX 4ER5A 4G41A 1N2HA 1FLAA 1LJUA 1Q15A 1Z3CA 4TMXA 2R6JA 4F71A 4TRMA 5K2MA 2IHYA 2RC5A 4EGSA 4BQNA 3ZWYA 3S99A 3B2EA 3A36A 3L49A 5FL7D 3UG6A 5JDCA 4I1IA 3AKYA 3PD7A 3PT5A 4YN3A 1PO7A 2R87A 3KJNA 3DLPX 2G5PA 3ORQA 2V6JA 3FNHA 1U7UA 4RKWA 3FB1A 3JSAA 5DW0A 4DLYA 2ZE8A 4DMMA 3UQZA 3H8VA 3TF5A 3DMPA 3E48A 4B7UA 3E3OA 1RCTE 2C9OA 1IK6A 2ZB8A 4JHLA 2NZYA 3E2MA 4K9OA 4U9IS 1HZZA 2BKUA 1MX9A 3D2CA 3I04A 3KHSA 1G2PA 3OTIA 5FL3A 2I62A 5LXTF 1L8QA 1QM5A 3GN1A 1VL5A 4WJZA 4TV9A 5K03A 4E2ZA 3Q3VA 2BN4A 3LKDA 3JRWA 4IJWA 3W2HA 2YN2A 3WKBA 1DC6A 1IHOA 4GI3A 1V0JA 3VFDA 2OENG 1Z5PA 4GECA 4YK7A 3KFXA 3LM8A 3OPMA 3RVSA 3WOHA 3AK4A 4Q3BA 2I99A 3JWHA 1UZUA 4MAAA 1RMQA 3LE8A 2ZWOA 3EVFA 1M8FA 2A30A 4Q37A 3ROEA 4JP1A 2G1UA 2IEGA 3NRJA 4GX2A 4KLCA 4NYIQ 1Z5ZA 2O8VA 4C03A 5TSDA 4OV6B 4MKXA 4MS1B 4AP5A 2F7SA 4PZUA 2NSDA 3R76A 4BNLA 4N5IX 3OUUA 1V8DA 2GAIA 3CH6A 1S96A 1MA3A 1HDEA 2WHPA 2YHIB 4FCTA 3QF4A 3AETB 3ZQUA 4XJSA 3JWPA 1YZFA 4KQJA 1V8BA 1N4DA 2DHRA 2QQ5A 1E1QD 3EXFB 4REOA 4EK9A 4M9QA 1P2BA 3TZQA 2XQIA 1NMQA 2DLNA 1T91A 4DV2B 1VHTA 3WL8A 3AC0A 4RV4A 2VVTA 2O0JA 3RVLA 2A1TR 3M9WA 1N1DA 5H8WA 1RSZA 3Q7EA 4ECEA 4W9RA 1MB0A 5KOYA 3WLRA 4TMZA 5GZ3A 3ZZUA 3BJRA 3GT4A 3NTLA 3E9NA 4MKFA 3I0MA 2RAUA 4KWTA 4ENWA 5AW8A 1YRAA 4ZVKA 1JXOA 1INLA 4C7OA 3R5JA 1E7MA 3I5UA 3QYPA 2YC2C 4MMYB 1N1GA 2PH7A 5JXWA 1JALA 2HCFA 3OY7A 3U4GA 3DXYA 4XCXA 4QOIA 1NY5A 5F9HA 2C9ZA 1RYYA 3U2QA 1TVMA 4OBWA 3L1JA 3ZC3A 1LQ2A 4G4JA 4UZFA 4QBGB 5LWQA 2HY7A 3Q3JB 1QG0A 1G291 4M21A 3SYMA 1ZJWA 3OEEA 2QF7A 2ZRDA 2RHHA 1XVAA 1GPNA 1X80B 2YNMA 3JALA 1U80A 4NYJR 4XB2A 4BB6A 5BN5A 2O1WA 1UBHS 4WBNA 4R1LA 4F21A 2GPTA 2FSIA 1PJLA 2E55A 4JLNA 3C6MA 4I55B 4PG4A 3AYXB 4K3VA 4PXAA 5EUQB 3L1IA 2WWRA 4H9GA 4RTKA 1KI4A 3MJEA 1AGNA 1J0XO 2GBCA 2SHKA 2Y1DA 4MULA 3TDKA 1VTKA 2ZJZA 3IE1A 2AUTA 2PL3A 2PNFA 4UAGA 2A33A 3FMOB 5ER9A 1CR1A 3WWDA 1BVYF 4YV1A 3EIXA 4BLSA 2YJ3A 4B3GA 2V98A 5IPFA 1YJCA 1FDUA 3JXEA 5JCZA 5IHPA 1Z4QA 1XKLA 4DLUA 2DJIA 2JCBA 1XZGA 4HTFA 1P0FA 3MINB 3HXOA 3DFMA 1P2TA 2CDNA 4GBJA 2X0EA 1KOJA 3LUJA 2HU7A 4PO3X 3N76A 2VP6A 3PFFA 4PHFA 4BZQA 2QW8A 2CEAA 4DYDA 1V35A 2WEKA 1SKAA 2JLRA 1AKVA 2OO5C 2WG2A 3SE0A 4JB2A 3UCXA 1Q1ZA 5ETJA 2WYWA 3DYIA 1JHZA 3PR1A 3MM4A 5FFMA 1Y0BA 1SUWA 4BLWA 1MJNA 3W3AD 5I7FA 2ZUSA 1ZR2A 3AHIA 4BOYA 2VTKA 3P2EA 1G2OA 1NW7A 1B0ZA 5AKXA 2B92A 1XD8A 3S55A 5BV2P 3MTDA 4XQ0A 1C9NA 2J1LA 3J81A 1YHNA 4A8HA 1E2EA 4IQFA 4TYMA 4PPGA 1JHMA 2FRDA 2GN8A 2WJVA 1RBMA 2A88A 2GO1A 3EIUA 4M37A 4TWZA 1R4AA 2A57A 2XVAA 3AUKA 4NAVA 3MD0A 3E9DA 1P0IA 4DUGD 1GNRA 3FCUB 4RK1A 1L4KA 2ZBEA 2N75A 5BWBA 3I9V6 4HT3B 3UWPA 2XE7A 3QVVA 1EX1A 3LGSA 1KZGB 3FOFC 1DBIA 3I30X 1BWQA 3EXIB 1E3IA 3G8DA 3PFNA 4DSZA 3AKDA 1N36B 4UCWA 5BQFA 2HXYA 4PW0A 2HA7A 4G81A 1SBZA 2E49A 5HF5A 1AUVA 3KQLA 3I01A 1KPIA 3L04A 4OQ4A 2HLNA 4HOYA 3SYNA 3TTTA 2EZUA 1V5IA 2I80A 3DVLA 2REQB 2VG8A 4ITUA 3K0FB 4CEIA 1ENOA 2A9VA 2Z5VA 3B1KA 3CC8A 1VMIA 4IMPA 3TGPA 2WJIA 1QUFA 1C41A 2CGEA 3QBTA 4X1KB 1NJGA 4LE1A 4W5RA 3HXMA 1CWUA 4IJUA 1ZVJA 3HWX1 1A2QA 4Q4JA 5L3QB 3MQFA 4XLLA 2QMHA 1U0GA 2WFZA 1GGNA 1TYDE 1UKZA 2VBIA 2XCIA 2YXNA 1XCMA 5CXSA 1DC5A 2YJGA 3O3OB 3R3YA 2NUAB 4KFRA 4X62B 3PQ6A 4HH4A 3WRXC 1NXVA 3S4YA 3OAAA 5BW5A 1OXTA 3HJGA 3MSXA 4EGJA 2F3UA 2RSLA 5LLTA 2EJTA 2QROA 3NOOA 1V9SA 2CUTA 5EIBD 2VUTA 3HSKA 3H6HA 1HYEA 1QG6A 2YBEA 3NDRA 1CUIA 1HE4A 1X9GA 2WV9A 2XWJI 3GGCA 5JI2E 1P1IA 1SB8A 4F06A 5H16A 1OWNA 3WGUA 2JA1A 3G8CA 4FBGA 4ZZ2A 3W8RA 4AN4A 3ESBA 3LCRA 2BFCB 3B12A 5L7TA 3E7FA 4C2TA 3HFRA 4OHWA 1PEYA 2P9ZA 1XLWA 2ZJ5A 5DYGA 4OA5A 4YRJA 3KKZA 1FOEB 4DNPA 4OATA 1JQAA 5A9SA 1UOQA 3L7JA 4KWHA 4G8CA 4RL4A 3ZKAA 1LVGA 2PX2A 4ARIA 2EBWA 1YVDA 1U2GA 3EY4A 2P9QA 2X6RA 2YZMA 2YN4A 4HB0A 5FA5A 1U0TA 2H9AA 4JNKA 2V8BA 3B3QA 4PHHA 7MHTA 3Q8KA 1GGHA 2GXUA 1DG9A 3CZ4A 2I6XA 1E7YA 3U0VA 4FPXA 1HH4A 2NPFA 2NZ2A 2GEVA 4I08A 1A69A 1QZXA 2UYGA 2FFQA 3L4SO 1E5VA 3PFIA 4OK6A 2DXIA 3ZD7A 4FJ1A 3NWOA 4M8LA 4F2DA 1SULA 5B3JC 2UYCA 3FJOA 2HPAA 5EPEA 3UM9A 1V8OA 4QT4A 1G8GA 4ZODA 3IAFA 1VJGA 1U0EA 2HMSA 3PX7A 1LFAA 1VLQA 2JFVA 3K31A 5EJ8A 1SHTX 1OIXA 1S3IA 2BBSA 3L3BA 4OYHA 1BVUA 2C3YA 1IZ8A 1RJDA 3KTOA 3OF2A 4NU8X 1ZC3A 3DW1X 4DMKA 3OEHA 1F0NA 2O2JA 3O8NA 2R7LA 3BHJA 2DFTA 4NVRA 4A16A 2XJ4A 1V26A 2HPZA 1HTBA 5ILOA 2QX6A 4MW4A 2JFWA 2BFBA 2LDBA 4DUYB 4LOIA 3WSVA 3ZY2A 4X61A 5KAMA 3HB1A 4NJOA 3GCGA 1J5XA 3K0EA 5IM5A 1F8YA 3TJZA 3UK1A 3V7YA 4F60A 1M2FA 5ITVA 1ONOA 2QRMA 3LUFA 5E95A 2WHPB 3S2GA 2CCGA 4BX2A 3QF4B 3S8YA 3K9FC 1IZZA 1Z2PX 3AVWA 4YPVA 5J2TA 5ADHA 3R5KA 4EEKA 2XDQB 4FGJA 4WOJA 3H8SA 3ODGA 5CK5A 3FYHA 3ERCA 1G7CA 4R0MA 3I5YA 3R44A 1CZKA 3FDJA 3H5IA 4NCXA 3RJTA 4EO7A 1Y9JA 1VI2A 1WEHA 5DHUA 2YV2A 3A0UA 2G9UA 3F3YA 3KB8A 4KN6A 2M6SA 3KQOA 4I2VA 3K70B 5E4FA 2GD6A 3KO8A 4DDUA 1H2AS 1T9AA 4KJXA 2XX3A 3H9QA 2NSHA 4XJXA 3VHRA 2VF2A 4RQTA 4LVCA 3DA8A 1NYRA 2SICE 3MLBA 3A1SA 3GJ5A 3SEZA 3ZY4A 4NE9A 2ZJ8A 2FSSA 1E3DA 1PLKA 3DHYA 1Q91A 1IQ0A 4MRAA 5F4ZA 5IDWA 5M5BA 3WA7A 1AKRA 1JJ7A 3FF4A 5KEIA 4MS3A 4Y0NA 1GG9A 2VUIB 3KTAA 5CHYA 5F23A 1B41A 2XAAA 2PPLA 3WE7A 4II3A 1I7NA 1WXHA 3JALB 3JYQA 4RHUA 5BN5B 2I7TA 1NVFA 2PVSA 3UGJA 3BH6A 3DCIA 2EF0A 1NHGA 1V3UA 2AEMA 4MDEA 3M5PA 4PZLA 4HATA 2QMYA 3L0CA 1LSSA 2XOKA 4NICA 2Q5FA 4EUNA 1OR8A 3AR9A 3AUUA 1YBVA 3AUJB 3P4XA 1PFQA 1YJAA 3OKAA 1N0VC 1NQVA 5DM0A 1I7QB 3NOVA 3DXFA 4KQWA 3DQPA 2Q3DA 1L5LA 2W2XA 2GARA 3KV3O 4FGUA 2CXQA 4HTFB 1BMQA 4L5BA 5K9ZA 4GOLD 3RSCA 3QVJA 1F7VA 1WQ4A 3R0QA 5JFTA 2HADA 2DF8A 1TU3A 2OQIA 5FUXA 1Z29A 3F7TA 3G2NA 2O2HA 4EBBA 2JFXA 1KYYA 2SKEA 1EX6A 4FDMA 3VQTA 1TADA 1PJZA 3Q7SA 4MVXA 1ZM4A 2NP7A 1PJCA 3ZNNA 3K0CA 1JFRA 3NP9A 1E20A 3PEWA 1YKFA 2EFGA 4EX6A 5MN4A 4KQKA 1OFUA 4LQLA 1EVLA 4ZYTA 4LGVA 5JBNA 2QJWA 1AVTA 4Z7OB 4HNHA 1P1CA 1HDIA 3UJ8A 1M6EX 3IQEA 1A9ZA 1UBUS 4DBVO 2BBWA 2GA9A 3NRBA 4FHGA 2JI9A 1PJ4A 3OZCA 3PXUA 4PSDA 4QOJA 1NYLA 2G0AA 1XPJA 4S3MA 4C76A 2I3DA 3AW8A 2EWMA 3NFRA 3QW4B 1QOQB 2D1QA 4K7JA 5JAZA 4QUBA 5AHXA 3T7EA 3OQOA 2W6MA 4RM3A 1Q0ZA 3FCAA 2BGGA 4NV1A 5KJFA 1QF7A 5J4HA 1CUUA 2NTEA 3DV9A 3PT9A 1RTKA 2A59A 2RJ3A 2RHTA 3N0VA 3PNKA 4G0PA 4PQGA 1NXTA 1P1JA 4KR0A 1QLHA 4J0IA 3QUCA 2O8DB 2JIZD 3ZNQA 1ISMA 1LPSA 2JASA 2G08A 1TQ6A 4UEWA 5A4JA 4B2IA 1Z4IA 3D4LA 3ROKA 2ZJFA 3IIIA 1OYOA 5TJ9A 1RIFA 3WQHA 1HNNA 3RHFA 3T3EA 5A0VA 2AOUB 2H7XA 1EDDA 2PZKA 3BB1A 3R7DA 1MG5A 3AL0C 4HWGA 1X1AA 2ZQYA 2CUNA 1I1NA 1ATZA 1B14A 2AZTA 3NIDB 4G67A 1FYFA 1KU0A 4IOJA 5AKHA 4QLOA 1BU8A 3EGVA 5F1PA 2DEUA 4RYDA 3KALA 4Q4JB 4RVSA 2VHVA 3AOGA 2DGDA 4IAOA 4UVGA 3LJKA 2Z6UA 1W46A 4GKVA 1Z7BA 2WQ6A 2EV9A 1Z3IX 2BGTA 4JBHA 4DR1B 1DQZA 1BGWA 1QKKA 4PQYA 1NW5A 2O14A 3G0CA 3IBTA 4ZI5A 4F9EA 5HF6A 3ROZA 3NCHA 4GRDA 2G9QA 2JC3A 3FTPA 3PUKA 5ALSA 3BQ9A 2IV7A 1WCV1 4EG4A 5FOVA 3FY4A 5GJWC 4Q16A 1EB9A 1W29A 1EX7A 3I73A 3P9IA 4LVUA 3E5RA 1U0BB 3U5ZB 2QE7D 4MUKA 3VPAA 3QFRA 4CLOA 4CV2A 1ADGA 1DVRA 2LVBA 2Z58A 1SQSA 3ZKWA 4FTWA 1FBTA 2YZGA 2W0MA 3QUAA 2VNIA 3OWOA 2GHTA 3KZCA 4YDRA 3WLQA 2XWBF 2V3VA 4BNKA 2Y92A 3G1WA 3KG2A 1RQ7A 3CW2A 5EJFA 1JHUA 3VR2A 2YV4A 4DE5A 5KNCD 3DYBA 3GJ0A 3HNRA 4NOJA 1WZUA 5L6MB 1H2XA 4YONB 5JADA 1QONA 3IX7A 4WJLA 4WNIA 4YGXB 3ZX5A 3CKKA 3QUBA 4IOLA 4WASA 4P0TA 3HB9A 3K35A 1R15A 4ZI7F 2ON6A 3G23A 4OF4A 2OQRA 4Z4EA 1E0AA 1R5JA 1E9VA 4DMHA 5BORA 1K3TA 4IJ6A 4X1IA 2DTEA 2WUVA 3D54D 4BUJA 4CKWB 4FYPA 1II8A 4TS3A 1FSPA 3KPUA 3EW9A 2NW6A 4DWWA 5KOHA 2O06A 3FDIA 3OLYA 1O54A 2IUTA 2J3HA 4H1HA 2VRCD 4IOMA 3QFSA 4EI8A 1I94B 3JVIA 3JPYA 4QRHA 4D25A 1T29A 2B0CA 4W5QA 1UKCA 3LQ1A 3SG0A 2XB9A 1H3EA 3O03A 3VC7A 2UXCB 1MX5A 2QSUA 5EJIA 4FXPA 5KUTA 2WWXA 3GRZA 4TZTA 2OECA 2PX3A 4C2UA 2Z2YA 1SCNE 3BICA 3LP5A 4W1QA 1YA6A 3ZY5A 4UTPA 2V45A 3JQAA 5JJCA 2IQ5A 4DM4A 4Z54A 3IKMB 3FVVA 4BNUA 2AX4A 5IDXA 1KQPA 3H2GA 1QV7A 2QUZA 5CYOA 3V2UA 5ALZA 4O4IA 1DBSA 1ZD5A 3KFLA 3DZKA 1L7RA 4DQLA 2BFBB 3JD3A 2NO6A 3L93A 3DE7X 1Q0SA 1EK6A 5IKOA 4B3MB 4JR2A 4LZJA 1N5KA 2UYQA 2KX7A 2ZK7A 1G5TA 2XE6A 3I5AA 3LXXA 4GWKA 2OSBA 4MYRA 1JTVA 2GKSA 3IJEB 1OV6A 5D3ZA 4A8JB 1MB3A 5A3QA 3WXMA 5J2TB 3MAGA 1K6XA 3IUYA 1BXGA 1DAKA 3CF0A 3T9AA 1XEWX 4YJ2F 3VJMA 4F84A 4Z0NA 3PRKE 4OA8A 3U4CA 2O8FA 1NURA 1EX9A 1PGQA 3A1VA 4IICA 3CLRC 1C50A 2P4HX 1LJ8A 3M4NA 4ZVMA 3WJ1A 3WZ2A 7REQB 4JBWA 1Y6JA 2H3EA 3GPCA 2OCPA 1QCDA 1KHTA 1I8TA 1UPCA 1ZK0A 3AI7A 5BV7A 4FP9A 1ML4A 1RP1A 3JY6A 1C2YA 3R5FA 2Y1WA 3KEOA 4FWBA 1W19A 5F2KA 2JCGA 1ECBA 4ETWA 4G5SA 4FZJA 3L07A 4DQDA 1ABEA 2EGHA 1JQKA 4D6PA 4TWBA 1Y4ZA 3DNPA 3CLSD 1NU8A 4Y2UA 5BUZA 2JEOA 3VU0A 4PSKA 4C5AA 4YV0A 1DUSA 4JLSA 5HBRA 2FEXA 1FFCA 4OHBA 3T3OA 2QVZX 5CT5A 4HUQA 1PTJA 3G8AA 3L1KA 3LBYA 4MS3B 4NV3A 2C95A 4WXMA 3KTAB 2GEBA 5B7QA 1AO0A 3HVHA 3EGXA 4PYQA 2D0PB 4K8OA 1QYCA 3EC1A 4PNZA 1N4AA 4ZJPA 4F93B 4KIFA 3LZDA 4HDOB 3WK5A 1W4AA 4JZYA 1RRFA 3UC5A 3NHSA 4WT7A 1X1RA 5IBQA 1RVDA 1P74A 3CEAA 3EZ2A 2I9PA 2FZ5A 2RFLA 2ZRPA 1FDRA 1DTSA 2IITA 1MX3A 3GRYA 1M72A 5K8TA 5CDUA 2OC9A 4XA8A 1GP2A 1OHHD 3ZIDA 2ZCVA 1BOOA 5CJPA 4GOND 4F12A 5A5FA 5AVWA 1O5TA 2PUHA 3UXHA