5SV2A

Toxin vapc21 from mycobacterium tuberculosis
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
135
structure length
135
Chain Sequence
TTRYLLAKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease VapC21
publication title Crystal structure of VapC21 from Mycobacterium tuberculosis at 1.31 angstrom resolution.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 48
structure length 135
sequence length 135
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5sv2A00
3Q8LA 2BSQA 1UL1X 5ED0A 2HWYA 1A77A 3ZD8A 4XGRA 3QE9Y 3ZD9A 4WA8A 1EXNA 2FE1A 5SV2A 1RXVA 5HNKA 5ECYA 3ZDDA 5HMMA 5ECDA 5L6LB 5FV7A 3ZDEA 1RXWA 1UT5A 3H8SA 2IZOA 3IX7A 2DOKA 1BGXT 1TAQA 3H8JA 4XGQA 5HP4A 2WP8J 1TAUA 3Q8MA 5K8JB 3ZDCA 2LCQA 2HWXA 4CHGA 1V8PA 5ECWA 3QEAZ 2IHNA 5HMLA 3TNDA 3H87A 3H8WA 2QIPA 1TFRA 1V8OA 1UT8A 3ZDBA 3DBOB 3ZVKA 5L6MB 1XO1A 2MDTA 3H7IA 4MJ7A 5H4GA 3ORYA 1W8IA 1MC8A 2H1OA 1B43A 1A76A 5H4HA 1Y82A 3ZDAA 3I8OA 2HWWA 1V96A 1O4WA 3QEBZ 1YE5A 3Q8KA 2H1CA
chains in the Genus database with same CATH superfamily
2VUTA 1IQ0A 5IT0A 4OI4A 3WE7A 5FT9A 2WYHA 4QHYA 3NUGA 4BNZA 3MUEA 1FP1D 3ODPA 4QUDA 1E0AA 4FFWA 2DHDA 3W5IA 2PUCA 3AWDA 1GM5A 1ZRNA 3L49A 2DTXA 4YH1A 1WMBA 3UUGA 3HBLA 1KOGA 3HGTA 4C03A 1CUVA 1DV1A 2D8MA 5C1PA 2O19A 1G21E 4FC7A 4KIJA 1WG8A 4YROA 4XYMA 1NT2A 5DCYA 1JECA 1EX6A 4K46A 1V16A 5DYIA 4DKXA 1R0SA 1NYLA 1VMDA 3DVQX 2JI6A 5GOZA 1YHNA 3LP8A 4BLUA 4BMYA 4EG8A 1T3ZA 2Q6KA 3WQQA 3HADA 1PUXA 1IZ8A 2BVNA 2D06A 3C3JA 4JL8A 4Y2XA 3H9BA 4ENUA 4X63A 2Z3WA 2ZJOA 3PGKA 4N4AA 5CRIA 4Z4CA 2RGXA 5JEDA 4XLTA 4XEUA 3TDMA 1YBMA 3PE4A 2ZFUA 1VIYA 1XZKA 4G63A 3L8GA 1PFGA 3MJFA 4QQFA 4GMGA 4CM3A 4CKZA 1ZI6A 3TM4A 1X2EA 1X38A 4EHHA 1TEZA 3PTAA 1AKEA 4DILA 3W79A 1JPVA 1P7WA 1K7FB 3FPGA 5JSQA 1P75A 3CRMA 3UH1A 3HK2A 3IA7A 3KSBC 4JLOA 1X94A 1MTZA 5B1DA 4BLRA 1X92A 3K0KA 4UNNA 4WINA 1PK9A 3ECSA 2PGDA 1YSCA 2IYRA 4NAUA 2FLWA 3G2JA 4QUIA 3RWOA 5GVSA 3QZUA 1NW4A 1JHDA 4LOIA 1Q21A 4KLCA 2VBGA 2OV6A 1JFSA 2ZIVB 1KETA 4HR7A 3UTCA 5T4HA 1L7XA 4H27A 1L8XA 3GLGE 3MMZA 1X7ZB 5KNCD 2A9PA 3TTTA 1CJTC 2ZS9A 3ORFA 4MROA 1E2UA 2A4KA 3C3YA 3OT1B 3EY4A 3L7BA 1Q15A 1BEUB 3G59A 3VHXB 2HMAA 2O23A 3QPAA 4F21A 4UHFA 4R8MA 5KZMB 5ADVA 3HFRA 2HF2A 3NFRA 3WNVA 5A7FA 1BOFA 1XZPA 5FL7D 5JJ5A 2ISSD 3KQPA 1W4CA 2ZWOA 3TRKA 1XK7A 2GWRA 3JQFA 3WL4A 4EW6A 1L0BA 1AGNA 1NULA 2RGEA 5IJ0A 2VHZA 3HJTA 3L1JA 4I5DA 5E2BA 1BDJA 2KPOA 2FMUA 4DDKA 1DCTA 2C8LA 1K5HA 4JJKA 3L5KA 3V1NA 1EB9A 3GH3A 4ZAYA 3SDZA 3JYNA 4CPDA 4MPJA 3MIZA 2V54A 5UKDA 3TQSA 5JXIA 4LJYA 4IQGA 1UWLA 3AVQA 3GYGA 5HJ2A 3JALA 3BORA 3FR7A 4G5QA 3L06A 1U9CA 3LLUA 4ZHQB 3HYNA 3G85A 4Q00A 1O94D 3ESCA 5LCXA 4AK9A 4DPKA 1Z45A 5B6JA 2VHUA 1USVA 1NSFA 3TOVA 2WUFA 2ZULA 3DGFC 1ZX1A 3EY9A 3MAGA 3TZLA 3EGEA 3WQSB 4WADA 3NBMA 2Q46A 4K9LA 3CO0S 5JV5A 4O0MA 4CM8A 3LUHA 1NLMA 3O1JC 4KUHA 4KHZA 1SB9A 3OZTA 4NCIA 5SZJA 2J45A 2MR6A 5KINB 3EIQA 2ZI9A 4GQIA 4M55A 4QUGA 4BZWA 2QOEA 2WLSA 2ZR0A 4UNRA 3O1HB 4UHKA 1ISGA 3UH0A 1MZPA 1KR5A 3DXXA 1NKSA 3FE2A 3U7HB 1QHNA 5KNDA 1OYVA 4D46A 1S8OA 2HBQA 1ADYA 1WRBA 2FN4A 2PSFA 1ZNQO 4P84A 1AUQA 1CETA 2LCIA 1YWGO 2H7XA 3HKDA 4B6SA 5B30A 1Y63A 3T3HA 5K0GA 2Y92A 2WVJA 2HQSA 5AVJA 5GV7A 4NBRA 2FX5A 1B41A 3DFZA 4FIZA 4UZSA 3GY0A 5ER6A 1V11A 2PZFA 1B8UA 2M6LA 3VPBA 3ZDRA 1GG2A 2HIMA 4RHCA 3VH3A 2B7LA 2WBLC 1IJBA 1KMMA 1NVVQ 4HQ6A 1TYAE 3TO5A 3G5AA 4PR0A 1XRQA 4XDHA 1TYCA 2R8EA 5F77A 4L8VA 3R5XA 3QUTA 3G8CA 2ZANA 3TX2A 3WGVA 4C3ZA 1FVXA 3OPNA 1D6SA 3G88A 3K9WA 4MIEA 3BFPA 1QTRA 2ZI4A 5DHPA 2M6SA 4DN6A 1OZGA 1AGPA 5A5DA 3WG9A 5A9SB 1GTL1 2EEZA 3B7GA 1EFUA 2K6GA 2RGUA 9LDTA 5JYBA 4EUSA 3UMRA 3VOSA 5JRDS 4GLOA 2J3JA 2NOAA 4YMGA 1HE8B 3ZWWA 1S7GA 1XRMA 3JQBA 1H4TA 4GVLA 3GNTA 1OFIA 4U9HS 4TTSA 4XEHA 2I3BA 2BRUA 2OFOA 2C77A 3GA0A 4S1WA 4HFJA 4TT3A 4YYEA 3Q8MA 5C2JB 5DNUA 1XUOA 1MJFA 1UOQA 1G7TA 2PT9A 2RC5A 2QG6A 4HMQA 2F1OA 4Y9SA 3RRNA 2JGNA 5EIWA 2RGDA 4PC6A 5FV4A 2QPOA 1XXHB 1SXPA 3KDPA 1ZMBA 1XAHA 1QS0B 5T8KA 5IVPA 1K8YB 4GKKB 1FNCA 1MB2A 4LHVA 2XRFA 2VWHA 4L4UA 4QLAA 5ELLA 5FORA 2R2AA 3A2MA 4C88A 1GSHA 1OLUB 5E6SA 5J4HA 1B1AA 5JY1A 4DKJA 1ZH8A 1C5KA 3H99A 1SPXA 4M1MA 4XVQA 4AU1A 5TEWA 3X0DA 1VKOA 2YUIA 3BF7A 5AXCA 4V0KA 5JO9A 3UB4A 3ZLJA 1KYWA 1UZLA 1GRQA 3HV2A 2ABWA 2C5GA 3ZUGA 4A3SA 2C58A 2PKRA 3THYA 3ZEIA 2VYVA 4XX1A 2DZDA 1PL0A 1T5BA 3ZWAA 4PGGA 4NYMR 1AQLA 3B1FA 1ELOA 1R8SA 2YRXA 4KX5A 5FUBA 5TVGA 3U5TA 4FHFA 5HKOA 2WUVA 2GPBA 2ZTUA 3QKIA 3UPTA 4MH0R 3AF6A 2YZ2A 2X8JA 3FXAA 4W9MC 1FYXA 1M1YB 2FEAA 2VDRB 1NDHA 3F4BA 1N2BA 2LDBA 1TZJA 1UJMA 3K09A 4KQ2A 4OSOA 3AEQA 3Q6NA 1KK1A 2QGNA 4YK7A 3U80A 4XRGA 1BS9A 1U02A 3DE6X 4GEKA 4EB0A 1ZM2A 3UOAB 3VX3A 4EGCB 3G8DA 2X0JA 5GZ1A 4OYYA 5J4KA 2Q0XA 2O2EA 2WAYA 3N0XA 2RBGA 3UHPA 2PH3A 5KWEA 3K71B 3A2KA 1A9ZA 1FX1A 4QU5A 2W98A 2H2AA 16PKA 2XLBA 3ZWCA 3OPQA 1NFRA 1A9RA 3CX3A 2XYGA 3LPLA 2BZ0A 3BC1A 2GBFA 1QV7A 3N2YA 2R7KA 2P79A 1R12A 4K87A 3WXMA 1WEKA 5IBCA 1B6GA 3FPSA 4RMIA 4WNAB 1G6KA 3ILYA 3NYQA 2VCEA 5A9RA 4KVZA 1DJQA 2JJ1D 1I5OA 3RH0A 2N1BA 3KOUA 1KI6B 3FZQA 3MHTA 3EAQA 4Q9AA 4Q6BA 2AG5A 4K1XA 1G3RA 5TB5A 3L7MA 1O5OA 3IRVA 3V33A 4LAFA 1QVRA 1U3DA 4I4TA 2XDAA 2DLNA 2K5UA 3FMIA 5E4FA 3I5AA 4B31A 4L85A 1AH2A 3P52A 3PFFA 3F6PA 5HF6A 1Z0SA 3EUEA 2ERCA 2PGAA 4JOBA 4X64B 5BT9A 5IF3A 4B3CA 3PUYA 3FHTA 2PZLA 4YDRA 2XVYA 3IVGA 2J3HA 2ZIWB 2FQQA 2Z8XA 1H22A 4HFNA 4M1ZA 3U7IA 4V1CI 2BYTA 3UYLA 3V2IA 2YOGA 4B6FA 4FW8A 2UZAA 3I83A 3G9QA 2CUZA 3ROXA 4F5YA 4LOKA 3PL5A 3CNQS 1EU1A 4JD5A 3R4VA 4JQYA 3N75A 2PKWA 4D9FA 4ZOEA 4ZRMA 1PV1A 2YV2A 5KCMA 3D43A 5H0IA 4UATA 2OM6A 2ZVPX 2FPPB 1O7JA 3NYRA 4Y2YA 4YJFB 3U7GA 4CMIA 121PA 1M34B 3GLQA 3NJRA 2PUHA 4HQLA 1BYIA 1RVV1 2WJGA 3SS8A 4MR9A 1FNNA 1WW8A 1E7YA 1ZDMA 2IXDA 3M1IA 4EM6A 4HV4A 3JZAA 4XIFA 2I3AA 1GQFA 1TQ2A 1AKTA 2P4SA 1Z88A 3AIKA 3RVNA 1TCUA 4YJGB 1PKEA 1QO0D 1MJGM 2GEFA 2R25B 4GR9A 3RQSA 1WEHA 2IHKA 1TUEA 4E2YA 2RKWA 4ITVA 3OU6A 4C89A 1II0A 3IP1A 5MN6A 1BA3A 4DB2A 4HUQB 4D8UA 2OVFA 4CM5A 1F2TB 3I28A 5BSUA 4MV3A 4A92A 1JKXA 3IQWA 3PHJA 2IU6A 4K28A 4L5BA 4LYHA 4RZ2A 4DUGA 4COOA 1KJZA 1SRRA 2AV6A 2LRHA 3IBYA 5JNRA 4F5EA 3KBOA 4BQPA 3UJHA 2FZVA 4D1YA 4PRKA 3VYWA 2ZR9A 3QI2A 3ZX4A 5A3SA 2FDCA 2BE9A 2CLSA 2ZLBA 1EK2A 4FOPA 3I9JA 3F4KA 4NHEA 1F7UA 1W48A 4RZIA 4HSGA 1NC1A 4KJZA 5EI5A 3UMBA 3EC2A 1ZJ6A 5FOWA 2ZRQA 1UFKA 3UBTA 2QS9A 4L08A 2WD7A 3CG4A 3U4HA 3ZHBA 5KKNB 3ANNA 1RMQA 5J5AA 3WI7A 2QR5A 2GCOA 1YE5A 1V4NA 3ELBA 3I2KA 3JQAA 2ODTX 2QPLA 2PUBA 5DNCA 5FB3A 3ZHZA 3TTYA 1W47A 4N7JA 4LF6B 2REOA 4NJMA 4Y9UA 1QP4A 1VGRA 4X3OA 2WHPB 4L3VA 2WIAA 2F17A 3OE7A 3KZ1E 4MWOA 1HYHA 4IIJB 3S40A 1M0TA 1MJGA 1DOAA 1U2GA 3G89A 1N1EA 5DEIA 4EEXA 1YKFA 1Q7TA 4C0BA 3OBBA 2QN8A 3KZXA 3S5UA 5AM5A 3DTTA 4P3OA 3CF4G 3K20A 4YECA 5DSZA 3L4SO 4FWTA 1SKMA 2PHZA 3PQDA 4AZWA 1HPLA 4OFZA 4I08A 4P5DA 3RRBA 4JMPA 2NGRA 3FY4A 1OXTA 3C4QA 4JB8A 4KNVA 1ZHOA 4KXXA 1BC5A 3WLPA 1PR3A 3L8EA 1UDCA 3W5UA 5KOJA 3FJ1A 1DADA 3CMMA 4EKYA 3QVXA 4GOXA 3NEJA 2HV9A 3LBYA 4BJ5A 1N9GA 3RBXA 2PEYA 3RKSA 2RH5A 3UUFA 1ZJJA 2HQRA 5A5EA 3H4VA 1GQ2A 2VKQA 3UIEA 4HDAA 4HUJA 5E6RB 4EGSA 2AMYA 5E2IA 5AT1A 2QTGA 4HRVA 4HVLA 2Y66A 4LKOA 2CL7X 1CP3A 2CNWA 3NOXA 3W7AA 1AU9A 4RFSB 4TKMA 1UT5A 2HU5A 5ALUA 3E3LA 4X1IB 1KY3A 2AEJA 2GCPA 2I6TA 2R85A 4RSMA 1NL3A 1LI4A 5TGTA 4E5VA 5C8YB 5FLXA 2BGWA 2I7DA 2JLCA 2J9FB 1AF4A 3L05A 4CDMA 4TRRA 3TD9A 2ODAA 5CYGA 3P9SA 4FMPA 2GCGA 3H16A 3C6XA 5AI8A 4M0EA 2AN9A 4FHZA 1P2FA 1F1BA 5F7ZA 1EUCA 3JW8A 2WNHA 3LQRA 2ZROA 1ZQ1A 3E3NA 5EJ2A 3ZWXA 2ZM6B 2IT1A 1XA3A 2V1XA 4P22A 4Y2PA 1QO9A 1BS2A 3UA4A 1P9NA 1TUIA 4HB2A 1Y3DE 2AG8A 3BILA 5AW5A 3C4VA 2A57A 4WVLA 3QA3E 1KMIY 1U8TA 3TTWA 4HDQB 5B57C 1AQIA 2AL7A 5DMXA 1UBUS 1ZITA 2XOKD 2BMVA 1HMYA 1UMCB 2AD5A 2OBBA 4LSGA 4FGWA 1IDOA 5KYKA 2PL1A 4X0EA 3ZKAA 1UMBB 1T2AA 2RHMA 3IDQA 4RLHA 1Z12A 5LZ2A 2H2GA 3E61A 1ZUIA 1BROA 1NVDA 4KFRA 1CUHA 2GDJA 2XNJA 1ZEJA 1GGMA 1JEQB 3HCWA 3V2GA 3PUVA 3ZS8A 1L7QA 5KTPA 1CU1A 5JHGB 2E82A 2C4MA 3TOSA 4GSKA 3HM2A 4GPZA 5CT5A 5K0BA 1NYTA 4J16C 3LZDA 4K9NA 4MUBA 2E55A 2P9QA 2GBGA 2YYAA 3V55A 3JX9A 4C21A 4UM9B 4MS4A 4H3VA 2CNBA 3QHQA 4KE6A 4Z9XA 3RBZA 1WXQA 1FVFA 2R62A 1QG6A 3FN4A 1GYQA 3MYRA 4IFEA 4MV6A 5FUVA 4YRNA 1CRWG 2QYOA 1T6YA 4HWTA 5ENVA 3DFFA 3EH1A 2LR0A 4TOIA 1B15A 3L0CA 4FFMA 1VIAA 2AQKA 2F7SA 4DDMA 3QJYA 2QBYA 5EJGA 3VMFA 4FYXA 1TL7C 1BJKA 4GI1A 5JSZA 1Z5UA 2WLTA 4PSCA 2HBRA 4MVJE 3GH1A 1Z2OX 4MUMA 3Q8WA 2NT4A 4S12A 4O2AF 2DUJA 3GWZA 5KSZA 2C42A 1B8OA 2NO9A 1A82A 5A9TA 3R9KA 4JVMA 5BV8A 3AL3A 3GPCA 3HPRA 3HBJA 1Z83A 2XE4A 1UBLS 2AQHA 3FF1A 2R6AA 4LX0A 4ZVMA 1Y1QA 1ZM7A 3HZHA 2M1ZA 1JPJA 1KU6A 5IZCC 2O8CA 4FNMA 4EW2A 3ICCA 1CUEA 3PZRA 4Q37A 4BUZA 1Z47A 2V7WA 5KQGA 1DJMA 5FNZA 2OVBA 2O7NA 1KVRA 2GRJA 3I12A 3IHTA 3ENNA 5DN9A 1CP2A 2O1WA 4Y9RA 5L3VA 1MMFB 3T7AA 2C9MA 5ERXA 3CU5A 4YRPA 1JLRA 4QXMA 1J21A 1LX7A 3FTCA 4KRGA 2Q5FA 3D2BA 2PAFA 4EF4A 4R8VA 1FTQA 3EDYA 5IDQA 2XKAA 5KNBH 2Z5LA 4E08A 5IKEA 4BAGA 2WHQA 4QREA 4KK4A 2XUZA 3GUYA 3KKOA 1OZFA 3GD7A 4UCFA 4ZT6A 4EFKA 4N39A 1C3LA 1REQA 2PYDA 2I03A 1X6VA 3PDWA 5CA0A 3WK6A 3EHEA 2WYVA 2IY7A 1CIJA 3N59A 5B4TA 1LQ2A 2P65A 2A14A 1YXMA 4IAOA 1Y1RA 4LWQA 3ICVA 5AM0A 1VLHA 1BWRA 1XAIA 2GAJA 3FKJA 3T7DA 1NQAO 3OOJA 4JODA 3R3UA 2HWXA 1XWIA 4N18A 1KEZA 1PYOA 1BHJA 2HRDA 4FN4A 4ZCLA 4DV2B 2NNLD 3IAUA 3NKFA 1M2JA 1XEXA 1YFZA 1L5WA 4FS3A 2O8EB 2VHWA 1HETA 1Q14A 3F71A 3USZA 4YAIA 5JJLA 2H00A 1QYDA 1BXRB 1JFLA 2V6MA 2Q4EA 3CR7A 1B26A 2PSEA 2DWQA 3EODA 1MQ8B 4BFVA 2UUCB 2XEDA 1SEVA 1U6KA 1JKJA 3DZHA 4GKVA 1V2HE 1OVMA 2IYNA 1D09A 4Y6SA 4OUDB 4ASUA 5LOVB 4M83A 4MZXA 3WTBA 1Y7LA 2EVWX 2ATIA 4AYXA 4ZJPA 4TLBA 1B6RA 3MWKA 1PJTA 3GLFE 2RHHA 3HRHA 5JBIA 1SG0A 4I9HA 1CF9A 3TQCA 1D2EA 3SQOA 4AKTA 4WGFA 5CURA 3RTDA 4C43A 4EIWA 4P4SA 1RCTE 1TQHA 2G09A 1EUZA 4L8WB 3WSVA 2GZ3A 1PS8A 2HMSA 1PZFA 4I66A 4ME6A 4NV0A 3HU2A 1HTWA 1T9DA 2DPXA 4Y2TA 3RB8A 4P53A 1DOZA 3OOYA 1G7CA 2GHQA 3LVFO 4BNVA 1HQDA 1GQRA 2D1RA 4LYDA 3TSAA 4CMJA 2JLBA 5A4DA 3RODA 4Z4HA 3U1VA 5ALVA 1H9AA 3B1XA 4MUKA 1G6OA 2PX8A 4F1JA 3STYA 2VP0A 5IYZB 2XQIA 3QYJA 4M7WA 1IJFA 1ZOSA 2HRCA 1IZZA 3OTWA 1NC3A 3AB3A 3W6OA 2ZUSA 3RADC 3ZCSA 1GCGA 3VR4D 3N74A 3WGJA 1VCMA 4HADA 4MV4A 2HA4A 2H0QA 4IZHA 5FA6A 2ZP1A 1Z8NA 2VPTA 4MXDA 3TGPA 4OCZA 3MXOA 1H9CA 2W2XA 1OHHA 2A84A 5U4XA 4YT8A 2R7MA 3OQ6A 1EQAA 5AJVB 1UXHA 5IC4A 5IAGA 3K6SA 3R9IA 3DMRA 1JHUA 2WYOA 2YJNA 2A9KA 3DAPA 3E8MA 3FPCA 4YDSA 5KQRA 2GTPA 4PE5B 4B43A 5LMZA 4LYFA 4P8RA 1Z16A 5BSKA 1G8YA 3F7OA 1YU6A 4I1OA 1I30A 4LI0A 1Z22A 1V6SA 2YRFA 3AXTA 4J07A 3THWA 1JZSA 2HF8A 2Q07A 1GDHA 3EIHA 3QBEA 4ZQHA 2RGNC 2O7VA 4M1WA 4I5EA 3QYPA 1A4IA 2P67A 4GXTA 3ABSB 5EJMA 3KB8A 1O57A 3KFLA 1LDNA 1NVVR 3I6YA 3S1AA 1RXVA 3OZGA 2HZBA 4EB8A 5J1SB 3U44B 1SBIA 3WGLA 3ZWQA 3WIUA 3DBIA 1KS2A 4JKIA 4UW9A 5LIRA 3BFJA 5EIHA 4PSUA 2AMVA 2YVQA 4ZAZA 5A3VA 2WU0A 4R2LA 1R9JA 3CLTC 4ZOLF 4C1BA 3HU1A 5AESA 2JFXA 3OOSA 2G36A 2ZSFA 1O94C 2CXNA 2VH2A 3ICQB 2V74B 1QOQB 5DF1A 3RS5A 2ZUBA 4W1SA 5I9BA 1QLJA 3ZE8A 2VYFA 2LIPA 1RWPA 3AFMA 3BERA 4B73A 4D97A 5I3CA 3WGIA 1F60A 4NU5A 4A23A 4A7PA 1YNSA 2QZJA 4UNPA 4YJ3B 5EWMB 3PUJA 1ZD9A 3D8BA 4OQFA 2B5WA 4KDCA 3SZUA 1V37A 4PICA 4D0NA 3G1WA 1Y5LA 5BMVF 2EIXA 2HF7A 3ICOA 4Y98A 4D6YA 3AR8A 3CRVA 2WJJA 1CEEA 2CNLA 3OIWA 1VP9A 4N3BA 1PWYE 3CSDA 3TNDA 4Y9DA 4RE6A 1BWPA 4DNQA 2PH7A 2CYCA 3K0FA 3HXKA 3SKYA 2O5EA 2Q5QA 4QPJC 4ALLA 2MCFA 3DZJA 1E3EA 4O5AA 1GVNB 1D4ZA 1BVYF 1CQIA 2Q5LA 1U9ZA 3AP2A 3PUZA 4CF5A 4DWWA 4HLDA 3HXOA 4RY9A 1KXZA 2CLKB 5JS2A 2DR2A 4G1FA 4XUEA 2YYSA 3LRXA 2AX3A 3BX1A 1WXDA 4RQUA 4BNTA 3T7EA 1KKMA 4MWDA 4B76A 3Q3VA 2BFFB 1YCDA 4E15A 1Q17A 4N5NA 4OL9A 1LQUA 1GPNA 5JWHA 1ODFA 2KSQA 1UBTS 1XRPA 2Q6OA 4MV9A 3ROQA 1ES9A 4V0LA 2EIHA 4B33A 1YCGA 4MHSA 3LVBA 3NOQA 4J9VA 4L9SA 4F8JA 4ROTA 4PAGA 1AV6A 3CS3A 2Q7OE 3G9UA 2C99A 2FLVA 2IHYA 3QEKA 2Q4DA 4RK1A 5H4HA 1IOZA 1PU2A 2HUNA 3E58A 2BKVA 1MGOA 1SCJA 4IIVA 4AZ0B 4LFAB 1NPDA 3BMOB 1CWUA 4YA6A 3M6LA 1E4OA 3E9CA 2DFTA 5H83A 1TIKA 4AMBA 4CNQA 1K6XA 3IAAA 2AXNA 4RKRA 1X7YA 3HZZA 2IV7A 1L9KA 2FMIA 3PRHA 4WZAE 4KV7A 1VJGA 1UM9B 5DLEA 1XU7A 2I80A 2JI9A 4BNXA 1Y42X 2MYUA 3OPMA 3K30A 3K70D 2A1TR 3E5NA 1D2RA 1KNQA 3UHOA 1GFIA 1NN0A 4G0PA 4Y6LA 1LWOA 2GF2A 3BKXA 3LY8A 4IICA 1L7BA 4L28A 2MSKA 2X3YA 3MFYA 4H1TA 5CD1A 1VLQA 3QOWA 4AC9A 3IKJA 5TDHA 1SCUA 3TL3A 1NXVA 3HJRA 4DPLA 3NO4A 3NBFA 5CH3A 4B5LA 4DDHA 1DIOB 1NBIA 1ZK2A 4TYNA 4JQSA 3RS2A 3URMA 1K1EA 1PQ4A 3U1TA 2QL9A 5ED4A 4ECEA 3WLLA 1SQFA 3IIKA 4M49A 2E4VA 1NFQA 3CG0A 3CRNA 1JTFA 2FN3A 4AJLA 4BE4A 3BIFA 1Y3BE 2FK7A 2O9JA 4P4UA 4KPYA 3OH8A 2XUKA 2Y2UA 1UMDB 2KLHA 3GAFA 3GV0A 4BTVA 5HKBA 3G0HA 1SIOA 3DR3A 1CUBA 5CT4A 2R9VA 4B46A 2FPOA 1VHDA 5JIBA 3A36A 3MWJA 3FRIA 3KB6A 3VR3A 5I7VA 4I6JA 1TCVA 2D62A 3SZMA 2PIDA 1PTJA 1H69A 1GAQA 3FSGA 3MMNA 4JYBA 5F5XA 3RVRA 1TMGE 4X7MA 3DBVO 1JG4A 3D81A 1MO4A 4P38A 1EH5A 4HDMB 1ORWA 1T9BA 1U3VA 2P2NA 4E09A 5C9ZA 3I2HA 3F90A 1AURA 2J6IA 1NF3A 1EJ6A 3CWQA 3IR5A 3T0FA 3DT8A 3ZWPA 3EUFA 1UWKA 1KZ4A 4R8SA 1FFXB 3WLEA 1TTHA 4YLEA 3T1VA 2EGGA 5FOSA 2YW9A 4EJSB 5TMBA 4M36A 5JCOA 3JZMA 4FUQA 5KDLA 3SC4A 4KPEC 2W8BB 2WVHA 3D4BA 5DEOA 3Q9UA 1XDUA 4N3GA 3I9MA 2MSNA 4YMTA 1F0PA 4YBZA 2JF0A 3D4LA 3BDIA 3CKLA 4OU5A 3BSYA 3VOAA 5BWLA 2QAGC 3PHGA 5JNLA 4A2CA 1N6RA 5DTIA 1VGQA 2YIVX 1HDXA 2XUAA 3PC7A 1AS2A 2PRYA 2W00A 1W5SA 4DC9A 4JXJA 1YHZA 1I33A 1FXSA 1XZQA 1YJQA 2IITA 4JLJA 2AN1A 1DVRA 3L4KA 4L5AA 5TRTA 2BTOA 1WIWA 1DJOA 3E2IA 1ZOPA 2OXFA 4V03A 2AWNA 4H0CA 1PJCA 3HI4A 5AVKA 2H7VA 4LQCA 2DP4E 4BAZA 2RHDA 4OAPA 5ADUS 4YAKA 1KPHA 1RRVA 3G8AA 5DWQA 4MAMA 3KVYA 4RZQA 2C31A 1IULA 5EZYA 1J8YF 3FNQA 1IY8A 4BBPA 4KLRA 2IDKA 1L4EA 1LDBA 2JIMA 1OWOA 2W4QA 4E4RA 4FB5A 1GSOA 3M6MD 1RYMA 4J90A 4X91A 5K2MA 4DPMA 2XWSA 3GJSA 2DETA 1SG9A 4CLRB 4I14A 5AK0A 2ZS7A 3PI6A 2FV8A 4GFDA 3C5VA 4Q7JB 4RK5A 3VGJA 4CFZA 4EMSA 3K92A 1YAJA 1Z36A 1P2UA 1X14A 4R2WA 2NU8B 3RJ5A 1VE3A 4E12A 4M9UA 2CFOA 2H4HA 3GLIB 5AVZA 1JHMA 2EFEB 1DIGA 2R8RA 1CERA 4M53A 3ZY3A 4E70A 3IKVA 5B3AA 4Z5XA 1C3JA 1OVGA 4FFVA 4YRMA 3TMKA 4IV5A 4Y3UA 4ZDWA 4PHTA 2I55A 1JWAB 2XKKA 4RMHA 5CLGA 5AHXA 3OTOB 3HDGA 2CVFA 1LLFA 1H2WA 4X1KA 1FRFS 4ZPJA 5JECA 3NNDA 1OIVA 3DC7A 1FRVA 2XUFA 1PG5A 2AWOA 3CW8X 1SIBE 2IYFA 3BE4A 4RTRA 4IH1A 1RRGA 5K09A 1EP9A 1BGVA 4WCFC 1CF2O 3FPLA 5KYTA 2JJMA 2JLQA 3KAQA 3NIWA 1A1SA 3DAFA 4DV5B 1VPEA 1YZLA 1LK0A 2P6NA 3PR2B 4PYQA 5FBZA 3ZHQA 1I9CA 1NVGA 5JFGA 2IH4A 3DMPA 1A9OA 1SBNE 2FVYA 2RAUA 3QWBA 1DBPA 5EHGA 4CEIB 1V1MB 1YDHA 3D6AA 2GBIA 2HJRA 3OSUA 5ARDA 4XR9A 4TYYA 4V0QA 3V7UA 1NHWA 3DDSA 5TEVA 1PYDA 2W48A 1OAKA 3PHLA 2XWQA 3HO1A 1SVMA 3PQ6A 5K3EA 5MGBA 5F78A 3N8GA 1CX9B 3QLUA 4YYZA 2H16A 3L0DA 2AYZA 2BFBB 4D74A 4AM8A 5DN6A 4PVDA 1E3SA 2MR5A 1EK0A 1PUJA 1ATIA 1IAVA 4JEIA 3VM6A 2DAPA 2I6GA 5L6LB 3OEHA 1KOLA 1KARA 1HG0A 4ZT3A 5FNVB 2B92A 3GIWA 1B00A 2WA2A 1XTBA 2ZRFA 4N0DA 4DV0B 3U7RA 1WUJS 3EXHB 4NARA 4PY2A 1QWOA 3CX8A 4PXSA 2OILA 2P3SA 4QODA 3SIWA 2JFWA 5LQDA 1SC4A 3D6NB 2Y1LA 3WIOA 3KCNA 3UMSA 4C22A 5EIOA 4R51A 3B60A 2GPAA 1S8FA 1TAUA 4G9BA 4M86A 5G53C 3IJRA 3KVRA 2VDMB 5SZHB 3U7QB 3NETA 3W90A 3M4JA 1DG1G 2NXWA 1JIJA 1X13A 4ZAVA 4OXRA 2XB9A 3GXBA 1U5AA 3TIVA 2XT6A 4G1BA 3UG7A 5KPDA 5EERA 4JZKA 3KC2A 4QTZA 1UZUA 4V02A 2NMVA 1YRLA 2GO7A 3B85A 1IN4A 4K26A 4MYHA 3OZCA 2QRNA 3A3NA 3TLMA 4MGEA 1SNYA 3HNOA 4YAJA 4IWNA 2NTJA 2E49A 2HFKA 4Q7KA 2JLZA 3B13B 5CXSA 5B4VA 3VKHA 1I3MA 1ONNA 5KIAA 3IDOA 3MILA 1U0FA 2RHRA 1ARZA 3BDVA 4G6ZA 1YTUA 2OV3A 1U2SA 2C2XA 2HT6A 1ZA2A 5AJZA 5FTLA 3P8ZA 4DR7B 1KZYC 2OBLA 3W6PA 4EGAA 3O9VA 1P5ZB 4LHEA 4WPGA 5IS2A 2RG1A 3IE0A 3VU9A 3M81A 4CV1A 2XECA 3AVWA 1PHPA 2PUWA 2RAVA 3AVTA 2Z2KA 4X8HA 1VE5A 2WPDA 3K6JA 1NQWA 3NAQA 5B58C 1N7GA 1GDTA 3OOHA 2OYRA 1DO8A 4QOIA 3ZDXB 1PT7A 1TGVA 1V96A 1U4OA 4Z0PA 4LHXA 5FYDA 2VXYA 1YF3A 1Z4JA 4L95C 4N3AA 4KBFA 2ZRJA 2PX5A 2YW2A 3LLVA 1JKMA 2EJVA 3OTHA 1IATA 1G60A 3HFGA 4U9UA 3V4FA 3I42A 4CR8A 4E7OA 4IHKA 4G8DA 5BN5B 4XPIB 1JRLA 3KELA 2EXXA 3VAAA 3FIJA 2FOXA 1JYEA 4D2IA 5EPEA 2EBWA 5HHTA 1J56A 2OGSA 3EG9A 1R88A 3FYUA 1PFUA 2ZZKA 4O6VA 4QFCA 2ZRIA 3LQQA 4QTYA 3QE9Y 1XN4A 4D5GA 3QQ5A 3LF2A 1W5AA 2JFUA 3AVVA 5CAEA 3T5AA 2V7VA 5F76A 3O84A 3NOOA 5KNDD 1H6AA 3IURA 2V55B 1NUPA 3TSYA 5K4GA 2Y1FA 3TCXB 3TM5A 1A4RA 4ARZB 2I91A 4Y7DA 5JDCC 1S9DA 5JC1A 3WK7A 3D8RA 5JMPA 5TX7A 2XMBA 2HSWA 4BB6A 4D9CA 3IBTA 4MVJD 4F71A 1T1RA 1PR6A 3BJRA 4PNPA 1KDTA 3T12A 3OEWA 5JAMA 2UYHA 1DT3A 2IYPA 2WWRA 3EBOA 5AJXA 3UYKA 3IUNA 3RYCA 1LFAA 4URUR 1QRUA 4N5HX 2FSVC 1E6LA 3UJ3X 1NW6A 1IAQA 1VLMA 4R54A 2R65A 2OP1A 4NOJA 3HSKA 1JE0A 2I2CA 4LW8A 4BRSA 4YCNA 2QT0A 3HMKA 4US0R 4ZOLA 3DZKA 5C7OO 1XMIA 4L5IA 2QTNA 2FYTA 5D01A 3KR9A 1FFEA 2DLCX 2I9PA 1KMHB 4MW7A 4A0HA 2Z6AA 3W8RA 2QG4A 2FI1A 4R16A 1A8UA 4CN9A 2WT8A 4BVEA 1K2VN 2O3TA 2Y4NA 4LDQA 3VDQA 1RLIA 3K1AA 3DCNA 2FAXA 4TT3D 5C35A 3DM5A 1BEEA 1M33A 1UQTA 4NYIQ 4R9NA 4ZJZA 3FZNA 3WWZA 5BMVA 2GBLC 4RGVA 3GJ7A 3H9GA 5CD9A 1ANKA 2QSJA 4WBNB 3L3BA 1F8XA 4KX3A 4BGDA 2DERA 3JQ6A 4DRZA 4WY8A 4DMMA 4KI0A 4MQLA 3MELA 3CJQA 2I6FA 5I48A 4OV6B 3ZBTA 1NMQA 1LA2A 2BMJA 2JJQA 2QU7A 2X0IA 3R7WB 1KFEB 2D0OB 3GQVA 5ES3A 2X4DA 2G4CA 5DULA 2UXCB 1JBQA 4LBWA 2HEGA 1U7ZA 3TZHA 2JD1A 2PJDA 2QZSA 1AUVA 3KPJA 5KVVA 3CIOA 4ZTBA 4CM9A 2H2IA 3CVOA 4QE3A 4BKRA 1IN8A 3PDHA 4IWYA 2II6A 1BYUA 1UWVA 3M9XA 1OE0A 5KU7A 1POXA 1IK6A 1VJ1A 2FPIB 2ORIA 4O3MA 1MC8A 3EOZA 2PUDA 1NXQA 1TVCA 2VYVD 3WIEA 3D4IA 3F8WA 2QR2A 4IGEA 2GN8A 1I3KA 4R7ZA 3WOHA 3OC6A 4Z6KA 3ER6A 4AS3A 3B6MA 1MA3A 1JDBC 4RTOA 1XDZA 2CNDA 3ET4A 4IR7A 3K94A 3ISTA 1SVKA 5GPBA 2Q9AA 2BBOA 1MHPA 2WQ6A 1Q3TA 4PW0A 5ARBA 3CF2A 3EMVA 4N40A 3GZ4A 2IYXA 3K9NA 1JYSA 1QKIA 4G5FA 2CKDA 3GP3A 2DBRA 5KSYA 3FSEA 2ZDQA 1JJ7A 2VN8A 3QVMA 4HTFB 1B16A 4NTZA 5J59A 4C07A 1LV8A 1ZI8A 1QBKC 4DMCA 5EVJA 5FEMA 2I7VA 4NOMA 2X15A 4QUBA 3CVVA 3VNUA 4I55B 4D9NA 1L5ZA 2QGZA 3OAAA 2VDVE 1JUDA 2BTQB 1XVTA 3WOVA 3JAWB 3AHGA 4LY3A 1JH8A 2MINA 2HZ7A 2ZBPA 2EX0A 3NEYA 3B3FA 3N2KA 1NLFA 1FLDA 1YB7A 3PXAA 1T1SA 2OLKA 1GITA 1LPNA 1RPTA 5B1SA 4RTQA 2B5VA 2B9VA 2EZTA 4IJQA 1KJQA 1MH1A 3OJOA 1EXNA 4BGEA 3CZMA 5IF9A 3D1LA 3DBLB 2ESRA 1TTQB 2G80A 3IP8A 1EBFA 1GADO 3NHFA 5REQB 2D74A 4J1SA 2G1PA 4OGGA 4BMOB 2CB9A 2LVBA 2UUBB 2QP3A 2P9YA 1QGZA 2CCGA 3FCYA 3R2JA 4G25A 3SQDA 3I61A 3HWX1 1VPDA 5ALRA 4CKCA 4ZMRA 4JWTA 2FVXA 4PS0A 1P6UA 2AR0A 5EWLB 1E2LA 1FSFA 3COVA 5KYVA 2G9NA 4B7AA 4PHFA 2YN0A 3RBVA 3NBKA 1ZN8A 1QYWA 1L7NA 3COYA 3M0EA 1XA0A 3HKCB 2W7TA 4UTXA 5E1BA 4ZZ2A 1RRFA 1T2DA 1SO8A 2YXPX 4J29A 1ZL0A 4PZDA 1QTIA 1ULSA 3VJLA 4EG4A 4OHYA 4IRMA 1J2YA 1H8ED 1K27A 2Q8PA 4YUWA 1FK8A 2UZ3A 3AG6A 1T0BA 2PS0A 4IHAA 4II3A 4NEQA 4ZZ3A 3GVCA 1R10A 3JASA 2VP3A 4YJ2F 1XJ5A 1X1BA 2XMRA 5HGJA 5IC6A 5AJHA 2DR3A 2G28A 3TYXA 4CHGA 2FP4B 3RF6A 3FNBA 1GHTA 4S0ZA 4BPRA 2YY7A 5AW6A 4WK4B 4FPXA 2HCJB 2BEUA 1RYHA 4O4HB 1YASA 3M1AA 3IPRA 3IT2A 3UWSA 2CV1A 1DAHA 3GMSA 4A6DA 1J2UA 3AUFA 3BWXA 1L5KA 2IIPA 3EQ9A 1Y1TA 2V4UA 2WV9A 1UC9A 3R6GA 1P3DA 2GETA 4KREA 2R60A 3S2SA 1JB9A 3GRRA 5BNTA 1MX1A 1TQ8A 4BX3A 8AT1A 3RUDA 2UVQA 5LDDC 5GJCA 4TKZA 1WS6A 2WYUA 4TZKA 4WE3A 2OSBA 3QY0A 5A3JA 4L16A 3RU7A 2ORVA 2BY4A 5HCNA 1SQ6A 4TWRA 4KO3S 4DUGD 2W2OA 2YHAA 3PR3A 3AK4A 4OKNA 3RVMA 2VCYA 2C4KA 1KP2A 3QE2A 3GJ6A 4D9KA 1FDIA 4CZ2A 2AZXA 1Q11A 2X23A 4NYJR 2CGEA 3A3YA 5ENZA 5ALKA 5HDQA 1IDN1 2IODA 4MW2A 4NEHB 4QYXA 5E9QA 3U4QA 1XIVA 1IONA 2ZU0C 1N5RA 5BVGB 1DEAA 2OOSA 4M22A 3N0RA 4MYUA 1W35A 2XVXA 4H15A 5T4FA 1NATA 3F2VA 3VC3A 1R8YA 1W0KA 4NQZA 1A50B 4TZ0A 2BWJA 4TQUS 1UZNA 5EMNA 1Q57A 1RWXA 2FB9A 2HK8A 4KQ9A 3WKBA 5KCZA 2E37A 3OLYA 4JKYA 5CGZA 2FEPA 3T5GA 4DSTA 5HE9A 3RJTA 3NVKI 3HUDA 1K8QA 3NEPX 4PSKA 4HDCA 1H2ZA 4H7KA 5KPJA 3B3GA 5JSUA 1RQ2A 4JJ6A 3U0VA 3OE4A 1XU9A 3B82A 4FCTA 4KC0A 2Z4TA 3W8EA 1TZ2A 3F5SA 2E2WA 3E84A 4LRTB 1VSVA 1F4PA 3WX0A 4NFSA 3JQRA 1EJBA 1QCCA 4BKQA 1FTGA 3OE7D 1T9CA 3GMDA 5DASA 4N5LA 3JQCA 4KMOA 1DKRA 5EHIA 5GMOA 2R5FA 3WP1B 2XYPA 3IP3A 3NBYC 4GMXA 1EDZA 2GNPA 3L1KA 2V98A 4LOAA 4A5OA 2J08A 5TS3A 1THGA 3O0TA 4G8BA 4C29A 1KI1A 1G7RA 2P2YA 3DXZA 5CCDA 4H18A 3BA6A 2EKBA 1JQDA 2FR0A 2EAUA 2FY8A 1Y5RA 1YJAA 2QRVA 3BMQB 3O74A 3PQ3A 4YGYA 3VRHA 4HNUA 1IHOA 4RGQA 3RYIB 4C01A 3EVFA 3JZIA 4M7RA 4URYR 5T57A 1OXSC 1J7JA 3UCFA 4B8YA 4D79A 4OMCA 3IPCA 1BMQA 4LHSA 3SY8A 4C5AA 4RFSA 2IZ0A 4RZXA 4KYUA 3KT6A 5F73A 1NXXA 1X2BA 2HJ9A 1KJ9A 2EJCA 3DZDA 3K9LA 4E7PA 4HDKB 2QDKA 5LLDA 2IBSA 4WQMA 4REMA 3UG6A 1ACLA 1VECA 2DCUA 5AI5A 1ZRSA 4X1YA 1KEVA 4KGVA 1C30B 1S2MA 2ECFA 2Z8ZA 5KSWB 4IIEA 4ED9A 4P4LA 3GJ4A 4B4OA 2P9CA 3E2MA 5D8DA 1D4AA 4Q7QA 1D2NA 2CNWD 1BHQ1 2OYSA 4YBRA 3D7SA 2O54A 2NU9A 3I9OA 4BEWA 1D0VA 4TVOA 2GH1A 3A9TA 4UBLA 3HE3A 3CB4A 4HYYA 1NI3A 4WN9B 3SZRA 2OQVA 3QU5A 1YQEA 3MB8A 1ECLA 5CVUA 3HN2A 1IH8A 5DU2A 5T4EA 4RD4A 3S3TA 3CYFA 4LTMA 5FFMA 3E3MA 1XGKA 5JSHA 4CCYA 4MVJI 1T9GR 3AWIA 3EW9A 3D3JA 1X9IA 4JFRA 1WU8A 4Y2QA 3HCBA 4I36A 5KREA 5HCUA 4L50A 1GCOA 2PZEA 4DRXA 4EW1A 2KBEA 2GXQA 1W34A 3UAZA 4QU0A 4TM7A 4K3VA 5DIFA 1C0IA 1MORA 4HZUA 2JCXA 3B1WA 3GZTB 1VLZA 5IHPA 1KAMA 2CXXA 2ZTVA 3CNHA 2PXHA 4XQCA 2JH3A 3UZUA 3ZK8A 1DRVA 1C14A 4QA9A 3G0BA 1N2GA 2W37A 2XVAA 5A7HA 4E5PA 3I6ZA 4D3FA 1CXZA 5GOTA 5SZKB 2X5KO 3S5JA 4DYHA 3QX8A 1VSQA 5C81A 4H1UA 5JALA 3VU0A 1SBCA 4ER0A 2X1VA 4Q3BA 2C7OA 3UFXA 5FPYA 1FSSA 3DXYA 4KWIA 4U1RA 3ZR4B 1MABB 1RR6A 1XZEA 1MNQA 5HTOA 4D92A 5K3BA 5F1OA 1V0JA 3ZKWA 2IU3A 2VJYA 1P29A 4KFCA 1OBOA 4EDHA 4U7FA 2N46A 2P1ZA 2P6MA 4O4LB 2YASA 4GWGA 5EE3A 4EFMA 3WLIA 2FK8A 3L7IA 4DJ5X 5TVKA 1Z5VA 1FFWA 1SR8A 1RLUA 3PC3A 5LMCA 4AJPA 3W0LB 4FDLA 1ULHA 2BHRA 2PU5A 2JANA 5AW1A 2QA5A 3AR5A 2X7JA 1P0PA 4W99A 4ZU3A 1WMSA 4JI8B 1MT3A 4B3SB 1CY6A 2BKUA 4DS3A 4U3JA 1ADGA 1QRAA 2GERA 4YLGA 4ZC1A 4NZPA 4CG0A 2XF2A 3MTDA 5LYYA 5D00A 3AEUB 4D42A 4FR5A 3WR5A 4LRUA 3PA8A 4RY8A 3L7NA 1W581 1EDEA 1EBBA 1NBMA 2HXGA 1VCNA 4WESB 3BN3A 1AZLA 2W22A 3T5BA 4ERNA 1G8PA 2FZ5A 6GPBA 2I76A 5GIOE 1TUBA 1NI5A 1E7RA 2GILA 4AG5A 3C48A 4QNMA 1YQTA 1I51A 2PUEA 1J24A 1UKYA 4DCUA 4YO8A 5K6TA 3TDNA 4LE1A 1OH7A 4JLPA 1EK1A 2Z95A 2F3PA 2EG5A 4F46A 4Q05A 4KQIA 4YWJA 3A4LA 3LLCA 1CUFA 2OEPA 1NNUA 3QKRA 2OPBA 3WJ2A 1XU4A 3ZX5A 1SK9A 4TLAA 3DPIA 1KFJB 4RCZA 3M6IA 3BD7A 4YLYA 1NVAA 3VSEA 3UXHA 5TT0A 2HJHA 5EHQA 4BFXA 5FLYA 1YI0A 1R27A 1GO2A 3PTZA 2X40A 4CEHA 1Y8QA 2FW6A 3HY4A 4M8LA 1RXIA 5DHRA 4WASA 3RUIA 3OCUA 1ECBA 6AT1A 4RVOA 4X7BA 1AX9A 2ATVA 5TR9A 3WDKA 3WYNA 1UXJA 3IP7A 5L3SA 1YU9A 5IM4F 3IO5A 5DXAA 1VYHA 3AI7A 1VGVA 4ZYZA 3M6VA 3V4VB 5CT9A 1U9IA 1GXSA 2WYWA 3I6IA 3M89A 4WK0B 2IEYA 2ZJ3A 3A9SA 4XGQA 4DL9A 3OIDA 4EA9A 3DL4A 4XJTA 4TMXA 7AT1A 1NVEA 4HL6A 4JT9A 5A6VA 3A11A 1N0UA 2WFLA 3DYBA 3IHKA 3T0GA 2O2JA 3RCBA 2R5WA 3BD8A 4AJOA 1S3IA 1SUBA 3K1YA 1ESCA 4YCBA 1DG9A 3H87A 3K2EA 1P91A 3BIJA 1Z0UA 2DJ5A 4QBKA 4XAQA 5EXSA 1K97A 2IY8A 4ISCA 1GL3A 2ODEA 2B69A 2W2MA 2Y2VA 3ZDBA 4ZICA 1I9GA 1ORHA 2IOFK 3DBRA 1VM6A 4BNFA 2OCLA 3RYTC 5EFOA 4BMDA 4FFDA 3UENA 1RRMA 3WLMA 2YS7A 2ERYA 2VDWA 1ZZGA 4RKYA 4GE3A 1E3MA 1X7WA 5D87A 3V8MA 4KXWA 3GEDA 4ASUD 3O93A 1M2FA 2AJTA 4BB5A 4BJ1A 2L69A 2YVLA 4ZAGA 3SK0A 5EJ7A 1MQAA 4QU9A 5HOQA 1CR1A 3DZGA 3L0OA 1R4ZA 2X1LA 3IAXA 3EB9A 2JI4A 1NZFA 4RPHA 5TSDA 3ZGXA 5EXPA 4FWBA 2OZLB 4K9RA 4I19A 5AK5A 2P5SA 8ATCA 2Z9DA 4PFKA 4B6GA 1HNZB 2AYYA 3DQZA 2QXTA 1G20E 1NM5A 1XCPA 3EQ8A 3FLBA 1WXIA 4ID9A 2TMYA 4BO6A 1E3LA 4QARA 1XZCA 4NZYA 4JIGA 2F62A 4RSHA 2GYVA 2XCIA 4IH4A 4PX3A 3U0BA 1V9CA 4G5RA 1XQWA 4LGYA 2A9QA 5AHOA 1XLWA 3D6MA 4L0CA 2PZMA 1TCBA 2V8BA 4ZYYA 1C9YA 1JI3A 1G8HA 1KH2A 2GPWA 2Z3ZA 1L8QA 5BRAA 2OZEA 5C37A 5TF0A 4NESA 3CQ9A 1ZD5A 3NTLA 4QGSA 1YVRA 3I34X 2ZWAA 1EFPB 1M8GA 3ZIAA 4JB3A 3QITA 3CVYA 1VRVA 1ZP6A 4QUKA 3NAMA 4WEQA 1ISHA 3A06A 3QOXA 4BFCA 5K20A 1ZGHA 4TX1A 1UJ6A 4LBVA 4IDEA 3H6KA 3FROA 4MRNA 5FQNA 4AMGA 4IDGA 2PA0A 2XMZA 3HI6A 4KVGA 1OHHD 1Y1LA 3F7MA 3AJ8A 4LZJA 1NYQA 1QHEA 3GN2A 4OP1A 1ZJYA 4RHEA 4UHJA 1D5CA 4LY6A 3I09A 4NCBA 1TM3E 1OSNA 4ZYLA 2Q9CA 2WWFA 3SYRA 4JJEA 2Q3EA 3AY3A 2APJA 1Q6ZA 1ZAKA 2HU7A 3DEFA 4Q4AB 4YUAA 2J3KA 5K6AA 3MGAA 3Q5GA 3PC8A 2AKYA 1RYFA 3HL4A 3AVXA 3QFSA 4N3CA 4ZI2A 1UC5B 5TIIA 4WNYA 1HGXA 3P9XA 3U61B 4OI0A 2J30A 1IHDA 1UINA 2VPYA 2UKDA 3DFUA 4LBYA 1VJCA 2ZSUA 3O4VA 4EJ0A 1JIXA 4D9JA 1NW3A 2WWXA 1EGMB 2MJLA 3ZV3A 4LPSA 4ETMA 3EFEA 2NVUA 4JS0A 2V0GA 4FLFA 1QRSA 3VTFA 2NZ2A 1YVDA 5DK4A 3F96A 5LWQA 2DULA 1MRZA 5F2NA 3R0VA 2Q1TA 1DDIA 4H4EA 3UB2A 1UFQA 2OFXA 2NUTB 4D0RA 1E3DA 5A0TA 2GN1A 3HY6A 3IO3A 5DKFA 3LP6A 1KWKA 5HIIA 2F9FA 1EZ4A 4YREA 1EBUA 3O4RA 5LLTA 2J0UA 2NX2A 4O63O 4PF1A 1QH8A 4WERA 2A9RA 3REQA 1T8SA 4JJFA 4E13A 3NI2A 3CUEF 3JQDA 3NM4A 1WL8A 2PS9A 5E7MA 4DIBA 1QO7A 1BA2A 4EYOA 3BMCA 5J4LA 4JN6B 4KDFA 1C9NA 1FTWA 1KZGB 1Y5IA 1J23A 2JAQA 3GNSA 3LBFA 5HILA 1N7IA 4H7FA 4MOWA 3UJDA 1EVQA 2Q6IA 3ZS9A 3FAZA 4DCPA 1PS9A 2VS1A 5L53A 2AG1A 1DBIA 2SICE 1XF9A 2WKRA 1GLVA 4QOJA 4DUZB 3T4PA 4YJ2A 3ND9A 1USIA 4F3CA 5COAA 2IBMA 5AI6A 1DC4A 1CRZA 3P27A 1GDDA 1KEWA 1MJHA 1I80A 5ESRA 3WZMA 2A1TS 2ODNA 3OZUA 1ZAYA 2FRVA 3GW8A 1MPTA 4G84A 4M0FA 4QAJA 4R1LA 5LVAA 3BXOA 5AK3A 1ISSA 3CZAA 3AU9A 4Y2SA 1U6JA 5HTKA 3ZY6A 1FFDA 3SJCA 3V8EA 3OOWA 3VPCA 4B6PA 3RSCA 5BP7A 5E95A 3H1BA 2DY0A 3DCYA 4PC2A 1XDSA 2H08A 5DV9A 2QYSA 2PQ2A 5C1BA 2FDRA 3K96A 3BXZA 2PLRA 1T3TA 4LVCA 4BRUA 2AOXA 4BXOA 2P5YA 1OX4B 1WULS 4MMXB 1MJ5A 4AYWA 1YA8A 2FW8A 3DAGA 5HIAA 4NZMA 3D7RA 1KZHA 2C5FA 2ZB2A 3LDFA 4B3HA 3ZJTA 3RUHA 1OREA 5GM2A 4KDEA 2JBAB 4ML3A 4CM4A 1II9A 1TQDA 3DFMA 1VMEA 1G55A 4KOEC 1C7QA 4EEKA 1QX3A 2IYQA 3GGOA 3FAKA 4C7OA 1ZUNB 1Z2DA 1OXMA 4E22A 3L6RA 2EZUA 3MUNA 2H4YA 3BSSA 3T1OA 1KNXA 4E1BA 2I71A 1KQFA 3H9QA 3MMXA 4Q9DA 2EFCB 4TXLA 2HWYA 1B76A 3NX4A 1C8BA 4XTCS 4YX9A 1BE1A 1NN3A 1P1JA 3JQBC 1SBZA 3RV4A 1SVLA 4RLFA 2Z2YA 2PWZA 3GEPA 2BRUC 4MPTA 4D99A 5CXUA 5ITSA 4JJ4A 5EC8A 1C7JA 3L1UA 1AS0A 3QXXA 4GOND 3HPQA 2F4NA 2OCBA 2AEEA 1WXEA 2HA0A 1YQXA 4PG6A 3B2NA 3A6EA 2DMRA 4FMDF 4EKEA 1NUSA 4M9SA 3GUUA 5T8KC 1DRWA 1F2DA 3TIIA 1RAGA 4YR9A 1TVEA 2R6R1 1RHKA 1VPVA 3IEKA 4OGLA 3RYFB 4II2A 1M1NA 1Q0RA 4JVNA 4MP6A 4JDUA 4WOKA 3ZZ1A 4EZEA 1OB5A 2QD3A 1QLWA 1LPPA 2Y1WA 4U8HA 5AXBA 1NRWA 1S4QA 2V9CA 1RHUA 2YWBA 5DBEX 1SOMA 2BGUA 5BVHB 3DV9A 1U3UA 4IQ8A 1JA9A 5I51A 1WHSB 3LQKA 4KO4S 1XZJA 5GAJA 4RY0A 1KVTA 3MCTA 3S8YA 3PD0A 3OCXA 2BD0A 3ANXA 2EBHX 2ZYAA 3IUYA 5D7BA 4C2BA 4JLAA 2OG1A 1IHUA 2JPDA 2V0CA 3VR3D 4ZDJA 3IAHA 1CUGA 1FQOA 5CHEA 2O5VA 1L5NA 1WB9A 3H5WA 2F3SA 2EFDB 2BFDB 3B7WA 4R6XA 4G0WA 4XJXA 5DX0A 2TMGA 2QQ0A 3VPXA 3MRSA 3PX3A 3CUWA 2ZQ5A 2YVKA 3H3FA 4WCVA 1NJGA 1T1JA 3U16A 3MOIA 3LQ4A 3Q7EA 4IO0A 2FEKA 2VWQA 3K09C 4F3KA 4MI9A 3ZDCA 4J0JA 4RHXA 3QFTA 4O4JA 1ISFA 3EASA 2OFPA 1IM2A 5K8VA 2XXJA 3ED5A 1E96A 1WCWA 3JD2A 3QXGA 4KQWA 1H66A 3RVOA 1HNXB 1YRHA 4UUMA 3S27A 2RD2A 2HPZA 2A5JA 4GZ3A 1AXRA 2IE8A 3JWPA 3OWOA 4FT4A 3LVQE 4FSXA 2ZUVA 4MYTA 2IELA 4ALKA 1JSZA 5FTMA 2JK1A 1IVYA 4KITB 4S1PA 2NZVG 1WMAA 2OCKA 3WYFA 13PKA 5EMJA 5EJ8A 3EXEA 3K32A 1MLDA 1YBFA 4R71A 4Q9LA 1NQXA 2AB0A 3U3MA 3EZXA 2FJ0A 1M2OB 1T9HA 2TRSB 1ENYA 3RK0A 1X70A 1AUOA 5CTJA 1E69A 3OIVA 2QTHA 3TLCA 4HK4A 4AP6A 4BWVA 1GUFA 2VF4X 3B89A 4CTMA 2QW8A 2ZRKA 1NE2A 3RROA 1G1AA 5FWDA 3F6CA 1R3DA 2JZOA 4J2TA 4G5SA 4M88A 4YO7A 1FXUA 1RFLA 3EQZA 4HQOA 1KQNA 4BO5A 5F7XA 2H1SA 2ZYVX 3F6SA 3ONNA 2EX4A 2V7XA 4MRSA 4GLLA 1QTNA 4QOGA 4F84A 1UXOA 2IHBA 3VKGA 4LK3A 5LA6F 3C7DB 1ISJA 2GTHA 4Z9YA 2GEJA 5I9LA 1HE1C 3NLLA 3QELA 4FDMA 1Z28A 1W76A 2IPAB 3RIMA 3L4BA 3WGMA 1USUA 1P61B 5ESDA 4A03A 4V0SA 4JLNA 5JI2E 3KEGA 5EP3A 5AKGA 3T7SA 3LGXA 1ZY2A 4ADSG 4KQFA 5BW4A 1NIJA 2G9RA 4X95A 5HJ5A 5I3ZA 9GPBA 4A9AA 3R0ZA 2XHZA 3K1TA 4YPFA 4X60A 5AVTA 1V47A 3NH9A 1Q0TA 1VMIA 3W2GA 1GNVA 1KO1A 2FGKA 4UFPA 3ELYA 2P9BA 1IB6A 2VF7A 5E6UB 1IG3A 2C84A 1JXMA 2B2CA 1OT3A 2V3WA 3EFHA 4MLCA 3BKWA 2C8VA 2ZRHA 1Z8HA 3GPDG 3ETLA 4MI1A 2O5CA 1Z68A 1E5VA 1EMDA 2AC2A 3IC5A 4P83A 4CKBA 1TKAA 2PD4A 3BH0A 3D6JA 4B45A 1W2WB 1JLMA 4DLBA 1UK9A 5SV2A 1E1RD 1G19A 2OHGA 3R44A 4NPHA 3BH7A 4C4PA 4NONA 1DU4A 1H6CA 4Q3EA 1DV2A 1M8JA 3OETA 3Q1LA 5HMMA 3VPFA 3WADA 4DUPA 2FPKA 4K9MA 4OHUA 3ETJA 4K8RB 4GGPA 5JDIA 1XX6A 3A4TA 3ZTWA 3L6EA 2QVGA 4BNYA 4CF3A 2XV1A 2JGLA 3CTMA 3S7ZA 1ZSYA 2E5WA 2WTAA 2WZQA 3KU4A 1Z6GA 4GRAA 5FWXB 5CDYA 5DN6D 3WA6A 3HYCA 2BH2A 1G4AE 3EF0A 3LH5A 4RO0A 4RORA 3S2YA 4NS1A 4BN0A 1DDGA 2J0EA 3SJAA 1ZVKA 1JL3A 2OXEA 4DMFA 2YFQA 2P62A 2YL2A 3DLAA 3OEHD 1H0HA 3SQWA 4I5IA 2EKZA 2GF9A 2CHUA 4BZPA 1NOIA 1TT5A 3D31A 3X1XA 2PLWA 3KOYA 1GKLA 4PFSA 5IM4A 2Q1WA 3HQ4O 5C51B 1HFKA 3PBKA 5I5GA 1I4EB 4KN5A 1VHQA 4CQMA 2BFCB 2FN9A 3UAOA 1T36A 1EQUA 2BFNA 1NX6A 1RSZA 2EOAA 4IUCS 1U1GA 2ZRNA 2QMQA 1DIAA 2DBYA 3BM5A 3ADOA 4F45A 1M5UA 2OGZA 1VE7A 2WD9A 3OIFA 2J31A 4UMEA 1Z06A 2F8SA 4M1KA 2MWMA 3BCUA 3EGIA 3GFVA 3OJEA 5TS2A 3THRA 1U2GC 4US1R 4BMPB 1UBSB 1Y4AE 3QW2A 3L6BA 5JCJA 2CZQA 3CVJA 1S9HA 4YWHA 1Q16A 2VAPA 4L4SA 4I8IA 3RIXA 3SG0A 2FFRA 2PL3A 4CV0A 1HDZA 1C50A 2WJPA 4HNTA 4L6IA 4P82A 2IYAA 1WTCA 3W5BA 1PNTA 2PJRA 5CMLA 1RNLA 1SWWA 1UKEA 2WE7A 4MKXA 4W7IA 4TMVA 1D6NA 1T4GA 2QAGB 3G0DA 4P9NA 5IAAA 2QPAA 3NOVA 4ZFNA 4CEHB 1X1QA 3ENKA 3PIIA 3MSXA 5DGDA 3PL1A 4IJVA 4LF8B 2UVPA 4AF7A 1A8PA 1C0LA 3HV0A 3FLMA 2ZQZA 4XYLA 3KVVA 3UWPA 3KWMA 5BN5A 3ON5A 2B61A 1EE1A 4MS3A 3S2EA 3QJGA 3WWCA 1Q1BA 2Q3JA 2D2FA 2H1RA 2WPDD 4ZN6A 2XTNA 1DWQA 1ZWLA 3SQNA 1G8MA 1Q12A 1EK5A 2YWJA 4NZZA 1UEIA 1I0IA 2GJAA 5HSGA 4WKBA 2HHHB 1JXAA 1TF5A 2FTKE 2J67A 3OIYA 2DH6A 3PFNA 3LQ2A 3L7AA 1Q0ZA 4M6WA 2QYHA 4OJYA 4W1PA 3T1TA 3WYCA 2CV2A 4Y6PA 1SXHA 1R3UA 1O9HA 1THZA 1B2LA 4OBEA 4BFYA 5LXTB 4YQZA 1O77A 1PFYA 1CYDA 4CUZA 5H82A 5DRYA 1J33A 4CIVA 4YXWD 2IX3A 1O0SA 2JA1A 4EARA 1A8HA 3GT4A 1UXGA 2BGNA 4FGUA 1A72A 1OROA 5EJIA 4YT4A 1P1IA 4AROA 5HJ7A 1K3TA 2A6PA 2YJ5A 2XNSA 3MYYA 3O94A 3K0AB 4MQEB 3SEFA 1VFNA 3BAZA 2Z6VA 4R01A 2RHWA 4P4GA 4YIKA 3PX7A 2OAGA 3NBZC 3VR5A 4GAEA 1Y4ZA 3UC9A 3P9YA 3AFHA 5EJEA 2OAP1 1VL6A 1SUIA 3HVJA 1DZIA 4WCFB 1N5LA 2P4EA 2DKNA 2H1HA 1MIOB 2YTZA 4J7XA 4CLOA 5TLSA 1ZN7A 3E7WA 3SLGA 3LG2A 1TW3A 2BUCA 1GIAA 4AJKA 2F1HA 4EUKA 3B7PA 4XB2A 1WOMA 4H6PA 4MIKA 2PMFA 1Z6TA 3HN6A 3TI7A 2VH5R 1CE8B 3GJXC 4RUKA 4MUAA 3PWSA 1FL9A 1GRVA 2M2IA 1P4AA 4JXKA 1Z33A 1G8GA 3C45A 1S2LA 3KO8A 4LJ6A 3EVEA 3VAZA 1V6CA 3NBAA 3N39C 5JCXA 4RABA 4XIYA 5HP4A 3V8QA 1BKSB 5BOSB 2WZDA 4I81A 2QN2A 1FMJA 4M98A 3CZRA 3EMBA 5AM4A 1FFAA 3NGMA 1G5PA 3AM5A 2GJ4A 1FYEA 4FBLA 1VI2A 1JAHA 2RH9B 4XJSA 1XA4A 2FCAA 4YNBA 5ECWA 3WB0A 4LVOA 3ZI0A 1LDYA 1X8LA 1U7DA 2KM1A 3A7EA 3QPVA 1HQKA 3R9WA 1J1IA 1ULTA 3H0CA 4OB7A 1OFVA 4LVUA 1A95A 4X20B 5DXJA 2H63A 2JHAA 3WL5A 1YA4A 3F5DA 4LCBA 1N7HA 2X2OA 3GA5A 1XG5A 4B35A 3INGA 4JR1A 3GDFA 4DJEC 5C1DA 3X1JA 3OPYA 1DC7A 3K4PA 4BC1A 5IT5A 4KAXA 1HT2E 1X9GA 2HYIC 3AETB 5IASA 1SCDA 4TYMA 2BKEA 4FIDA 4IDHA 5LP6F 5J4VA 1XDGA 1WB6A 2P9HA 2IWHA 4MRPA 5DMHA 1E2IA 3UN1A 3R5JA 1SEPA 2ZVJA 1V5FA 2RH8A 4OLFA 4DWOA 4I46A 1DXYA 1ESZA 2QX6A 4LV5B 2BZSA 2ZUUA 2W5UA 3GVPA 2N3ZA 3R5HA 1T6NA 3LX5A 3KQSA 4FOLA 4AX4A 4XVCA 2AW3A 1K7SN 1R6DA 3OE5A 5M5BA 3P9RA 3TVTA 4CM9D 1F3LA 1NVUQ 1T8TA 1WW2A 3DE1X 4KFSA 3OZRA 2IEGA 3F9IA 5EP1A 5ILQA 3FTNA 3R3HA 4HYEA 4J03A 1LY1A 2Z30A 2C03A 4RHUA 1RIIA 3AC0A 2QVZX 1XD2B 5JBNA 2N9UA 2UU9B 4G0OA 4BJHB 3DZBA 2KX7A 2E4AA 2AF4C 3RT7A 5M2QA 4LHWA 5AWFC 4RCYA 5HBGA 2OCGA 1N3IA 1NUAA 5C0OE 2FOLA 4BP3A 4KI7A 4N0MA 4X90A 5IAEA 4BP1A 1FP6A 2M1XA 2V6IA 3AB8A 3G2KA 3BGOS 2WIDA 4J0HA 4ZO4A 2VPWA 4D80A 2IYEA 5D5QA 3EYAA 2QR3A 4IIFA 5HIJA 1PGNA 4GXRA 4R9SA 1MOSA 1ABEA 1M8PA 2C3UA 5HBRA 3UMJA 2OORA 3DD5A 1Y7HA 3NHSA 3Q5EA 5HVNA 4ND8A 5DBOA 5FOUA 2H59A 4JUFA 3AUSA 1HSOA 1N2CB 1TM5E 3MLBA 1RJ9B 1NMSA 1SKYB 3OAAD 1R6VA 4LUCA 5JNUA 1OZAA 2CHGA 1XWWA 3RTEA 2ZJ1A 3D4OA 4L72A 1NOKA 1QOPB 5KTYA 5LQJA 3K0CC 1NJFA 1RYDA 4EHLA 4XZ3A 1NQOA 1VYTA 3GCDA 2WMOB 2M32A 3GQBB 2HV8A 3K8OE 4JDPA 4MARA 4QGGA 4P1ZA 3GZNB 2JLRA 1W87A 3HWRA 2ZJ4A 1Z2PX 2OCAA 3EULA 3OTGA 3QPDA 4EMTA 3GP8A 3E82A 2FPGB 1NNLA 4CDRA 2HA5A 1RP7A 4GICA 1O8CA 2E1PA 3LQYA 5AM2A 3OUTA 2HR1A 3A2LA 4YMUA 1GV1A 4RIFA 2UXDB 5IEJA 5E7IA 4FYWA 4GG1A 2IPOA 2ZJ8A 2O06A 1H2RS 1PR2A 4UAUA 1YDWA 4EZBA 1YS1X 3JWEA 5SICE 2QTVB 2XH8A 4C7XA 1EDBA 2HLNA 3QIAA 3RAGA 1XD9A 2I8AA 3TAUA 3C8DA 3WDLA 4D5EA 4E32A 2AT1A 1C0KA 1XEWX 1TAQA 1BXGB 3CLRD 1Z4MA 2G83A 4JITA 4YMVA 5U9CA 2AFVA 4LDZA 2D8AA 2GK4A 3W3ZB 5JR3A 1MV5A 2WP8J 3H9CA 4OXYA 3ER8A 1KC1A 3PWKA 2GAIA 2VA9A 4BTLA 3HKBB 2Z83A 1U8ZA 1BDIA 1U81A 2WEKA 4F6RA 3CCBA 1FP7A 2XXAB 2OC9A 2QRHA 2WJVA 2OD7A 1L5VA 3B6ZA 3PC2A 4R3WA 5K0LA 2QE6A 3IGFA 2ZDGA 4MDYA 2PKYX 1JR3E 3EGDA 2IHJA 2VZ0A 2RGYA 3FCXA 4JP2A 2Y6VA 1O95D 4PFJA 3VOTA 1E2MA 1OB2A 1VKNA 4BLSA 2YDYA 1V25A 5KTNA 3W7BA 2EBFX 2IYWA 3KE8A 2IUYA 2VDQB 1HKUA 1SVWA 4JI7B 2P91A 1N0WA 3EF3A 4ND3A 4FYMA 3EIXA 1WV1A 1KTIA 1NR7A 2VATA 1TCCA 2DGDA 3A4NA 3AIIA 3C7KA 3H2JA 1Q95A 3WBJA 1XHFA 4MRAA 5GJVC 4QGHA 3RSLA 4QG3A 1P9WA 4OBBA 1YR8A 5ER9A 1KQOA 1QDLB 4E2WA 1BAPA 2EYQA 1LLUA 5T3YA 3CXUA 1M2VA 5J5CA 2B4TO 1AF7A 1SUAA 4K8OA 1BGWA 3ZIUA 3JSAA 3M83A 2DPHA 4BQEA 1TD1A 1L7VC 1ZVQA 2J7PD 4MRVA 4TTJA 5JARA 4UPDA 3I1YA 3MM4A 4KRYA 1ND5A 1Z6YA 3N7TA 1EA5A 1G63A 2K2QB 5C32A 5K8LA 5CDHA 1L5HA 1FY2A 1U0SY 1Y33E 5AKZA 4KN6A 4HH0A 1FDSA 4H31A 4RIIA 4FYKA 5JZMA 3HO8A 5DIZA 3TW8A 2Y1OA 3JVVA 1A9XA 4KR7A 3HR7A 2XGSA 3JATA 5D6OA 4RA9A 2Z9BA 4DEYA 1D4OA 2EP8A 3OC0A 1T0HB 3ZHXA 1QP0A 4F06A 1TEHA 4BZZA 2ORYA 1Z73A 2HSEA 5D1HA 4D3ZA 3P45A 5HFJA 2JJ2A 4IIXA 4Q1AA 4WEOA 3OKCA 4D3SA 4UDOA 4ODIA 4IILA 4QTUB 2I6QA 2WNIA 1W1WA 5IARA 4BKMA 4CG1A 3EVZA 1IEVA 4OOFA 5EIXA 1Z7BA 4LS3A 3TW6A 5J4YA 2CVHA 4FUTA 3GGPA 2EW2A 2RSLA 2FWNA 3O91A 1Y6GA 4Z1OA 3L4EA 1RWMA 4ERXA 3SXPA 4HX5A 2IYVA 2V6GA 3RASA 1QZTA 4KBYA 3A6ZA 3D8NA 1BE6A 4GMFA 2YHIA 4OKIA 4LJSA 5BSRA 3SZOA 3NU1A 3PICA 1C9EA 4LDRA 1IBLB 2ZUEA 1WZNA 2PM8A 4LZNA 3KE9A 2YJ4A 2ZIXA 3TQHA 1YIOA 4MRRA 3NBUA 1W36D 3I3OA 2CUTA 1DAGA 2EWMA 1AS3A 2I3ZA 1SB8A 2ZCUA 3OO1A 5EXXA 5B37A 4CV3A 4DV1B 1IHYA 2UZIR 4ZOQI 3DMTA 3KQUA 3H1TA 4QVKA 4YP0A 3W2EA 3X2FA 4FZVA 4QDTA 3EC1A 3NYIA 4UXIA 4BX8A 3GRUA 1F38A 2ZRPA 4IPTA 2J9XB 2VSNA 5G2OA 1O6GA 2RHLA 2VEOA 1XYGA 2FWRA 4IIJF 4XX0B 3UJ8A 1OBCA 1SQSA 2P4QA 4B3TB 1YGYA 1J1UA 1U6IA 1SVOA 2R44A 5A6SA 5T4BA 1RZVA 3IUPA 3HGMA 4ZEMA 3VU1A 2W9XA 4LJ7A 4AQYB 3A9RA 2OKCA 2WJHA 3NUQA 4IXTA 4M76B 5JAIA 3IOYA 4IXWA 3G0GA 4LTDA 4M54A 1WKCA 2M9MA 2B8WA 1UC8A 4MGKR 1U8CB 1ECFA 1UM8A 2D1QA 2P35A 2GO1A 2PL5A 4AXXA 3KUXA 4F5DA 1FUYB 3FMGA 3K2BA 2Q7XA 4CL0A 1M2EA 1YULA 5IBRA 2CBXA 2I5PO 4LMPA 1J0CA 1EGQA 3M8KA 2O8DA 1XP8A 1YZ3A 1FS5A 4KIWA 1MX9A 1GPMA 2AVNA 2VZEA 5KQSA 3H8WA 2Y71A 3PX2A 3U19A 3DDCA 4TSFA 3DE3X 3QE0A 3OFND 2V3VA 4DAEA 2WJYA 2FWAA 4P98A 2GZ1A 3N2GB 1L8LA 3NC0C 5TQJA 2Q3CA 1JP7A 4WZBE 4CCWA 1N3LA 3F9CA 2IK8A 1HL7A 3PWZA 2NV6A 4BB9A 4KIGA 3AV0B 1VBNA 3BICA 4MHTA 1XNRB 2O0HA 3S1SA 1N5DA 5EE9A 1H2EA 3NHYA 3BWCA 5L3QB 4RVUA 4V24A 2BI7A 4RMGA 1GPUA 2D7DA 1V7ZA 2E4WA 2PX4A 5C8YF 3A2NA 5CFNA 2ONJA 1W2HA 2A1UB 2VUSA 4IL5A 5AVOA 1SXJA 1TLFA 3FBGA 3L93A 1CJCA 4PBRA 5DP1A 3RVQA 3UPDA 3HDVA 2CVPA 2C7QA 3URKA 1PR5A 2BM8A 4OY3A 5EJAA 5PNTA 5KOIA 1VYVA 4JH0A 1A98A 1KJIA 2KE5A 3H6GA 1U7OA 2ZWIA 3IAM1 4IJWA 4TKUB 1LRLA 3R3JA 5ILGA 4ZZ1A 4UAVA 1BDHA 3E18A 3ROTA 1JT9A 4ESOA 4XLLA 1PTJC 1R4MA 1P62B 1NE7A 1ZC3A 4GI5A 3SHOA 1KAHA 4MS1B 1G8AA 5JNSA 3P9CA 4HGPA 1RC8A 3MINB 2PT6A 4H0FA 4KXMA 1NR5A 3NHAA 4Q3CA 4EG6A 2I9KA 5CEJA 4C87A 3DDZX 3GO4A 1R8JA 1S2DA 4CDGA 3L43A 2ZEJA 3H65A 3LI2A 1Z6AA 3VPDA 2UUPA 1TE2A 4NICA 3ZE6A 2H52A 3BJMA 3NGLA 4NU6A 3IV6A 1FFYA 2FX2A 1GGNA 3MJHA 4MVYA 2BP7A 5EOVA 1JSRA 5JCOC 2GZHA 4D4IA 3LM8A 4EY5A 2ZBDA 5D84A 3AY0A 3L02A 2G7MC 2OLJA 3M5DA 3BA1A 2H2FA 4GO1A 3FZGA 1XTPA 1NBMD 1TXGA 1W5FA 4AMUA 4RAQA 4WAUA 1ZCFA 4ENRA 1GRCA 3AHCA 4GOLD 4D8WA 5FUQA 3V4RA 5AW3A 2FE1A 5JXGA 2WT9A 5T7BA 5J9FA 4P3PA 4JC4A 4EECA 2X86A 4RK7A 3VO2A 1T1GA 1T8WA 2FF5A 1DBRA 2R8PA 3TXXA 5CLJA 3LSYA 4LOLA 4UUOA 1IUKA 2G4VA 3NM5A 4ZO7A 1QR2A 4K5QA 1FP2A 5B7GA 1Q0LA 3CEAA 5BXQC 1KY2A 2HOQA 2WJ6A 3AZOA 3FDXA 4NBLA 2JFNA 1Y4UA 3R5TA 2PGJA 1GGFA 4OP2A 2E18A 2HU2A 1AZWA 2PZJA 2V8OA 3OM1A 1COWA 1L5QA 2X13A 2X0NA 3ABRB 1PVVA 3PNMA 1L5OA 1N6PA 4X66B 4MO9A 3WIDA 5F5LA 3W2HA 3SSNA 1SKUA 4ITRC 1H5QA 5KYGA 2XZTA 2ODPA 1VCHA 2ZT6A 3WQRA 2JGRA 5AVYA 3T1YB 1AZSC 4R8RA 1LXCA 1Z7EA 3AIOA 2XTMA 2G06A 1FTYA 3GVHA 3PTLA 4M46A 1E9SA 3KUCA 3IDAA 1R0WA 3F7TA 1CY7A 1R4NB 2UZ1B 4TWZA 4UXJA 3JARA 3VNAA 2C07A 3Q0TA 3VKWA 2ATEA 3C3MA 1XCGB 5E9WA 5IM5A 1ZA1A 4M3NA 1J22A 1XVIA 1RE0A 4MDHA 3UICA 2IEIA 4YRSA 3DOOA 5I7FA 5KQLA 1G4HA 4C3VA 2XD9A 2HSJA 1HK7A 2UYQA 3BH6A 1H05A 3C14C 1USWA 2ZE7A 1WPGA 3IB6A 4MRMB 5KEIA 1QK5A 3CJTA 4CKCB 4A73A 1AXEA 1EUDA 4FBMA 1YS4A 1FS6A 4J4TA 2VJKA 1ICIA 1VCOA 4BQOA 2C7PA 6REQB 5H02A 4DREA 1Y1KE 2OZKA 5DRTA 1QHHB 5A06A 1NP6A 4JY7A 1FLNA 5JVDB 4PNEA 1IE3A 3UV7A 4M0DA 5CX4A 1G5TA 4QFBA 1N0VC 3CKKA 3G8YA 2PBLA 5C3UA 2EFJA 4H08A 3VKFA 3SM3A 1LWNA 1QYRA 2DCMA 2QVYX 2ARKA 2NU6B 4B84A 4D82A 2HM7A 5TGDA 4RSGA 1QFJA 1T0PA 4PCLA 5JH7F 2WK1A 1PT9A 2FMFA 3ZE1B 4BVHA 1ZMOA 2YWGA 3ILSA 1SRQA 4P7FA 2FEOA 4P92A 3MAJA 4RLQA 5JFOA 2ZOSA 3QLUC 3KP1A 4U2KA 2NO1A 3ID6C 4IZOA 5A71A 2D1SA 2WAMA 2RGRA 3VTAA 2Q2OA 1YK1A 2OCPA 4GWKA 3KD2A 5GY7A 1JWBB 1P5RA 5I9TA 3W4KA 2C2WA 1OXVA 4J16A 3RS8A 1N8SA 1RI3A 4EG0A 1UH5A 5HRAA 2F64A 4RVCA 1F20A 1HF3A 4A8JA 2RIRA 1PX2A 5LOVF 1Y8RA 1X1RA 1ZBDA 5LP1A 4K6OA 4R1SA 1TVKB 3PXBA 1E7QA 3OZIA 5NLLA 1WOYA 3QMPA 7ADHA 1U5BA 1UQUA 1D3AA 1L7RA 2IF0A 2PR2A 2VF2A 3ZIAD 1KQPA 7GPBA 3RRFA 1T8UA 1NDQA 4OG2A 1GOTA 1F06A 2X0FA 1VL2A 1YIAA 1U0HC 4IEFB 2AFIB 2W6JA 1YR9A 2ZU6A 2BEWA 3P71T 1N6LA 4LG1A 4CU2A 5ECGC 1QU2A 1WP4A 1GU0A 2CXTA 5BN1A 3P2YA 1ZD3A 3UA3A 1HNWB 5AW7A 4HAXA 3TB6A 4FE4A 4MWCA 1D8TA 3WDMA 3KZMA 3I52A 1ACJA 4B6QA 2WUGA 4F4UA 1QFZA 2PGNA 3IXQA 1DHRA 2PX3A 4WLFA 4UVGA 2AHOA 3ROKA 2IZ1A 4YJHB 5JWOA 4IMJB 2PLAA 1PZGA 1CR6A 4FLMA 2XT9A 5IZCA 2BM1A 3C8ZA 1M6YA 3T1NA 1PR9A 1AVTA 1EZZA 2LP4Y 4L5CA 5DBHX 4YCLA 1NF2A 4D3YA 2QRLA 3HSSA 4HXGA 5DHSA 4CIXA 2PH1A 4LZWA 3SLRA 2E4UA 1L1RA 2Z57A 4LTNA 3QBJA 3PFWO 5EJ4A 1CEQA 1Q50A 4DBVO 3IR7A 1ZMRA 3Q9SA 1PNVA 4M0LA 3M33A 4PQRA 1KEPA 4S1OA 2REQA 4AN1A 2BT4A 2OM2A 2ZPAA 3F67A 2XADA 2I1QA 3AILA 1T3HA 1Z7GA 3GJ3A 2ZSEA 4JIMA 5FWYA 5LWHA 3QLVC 4UVEA 5D3MA 2WJAA 2Y1EA 4BE9A 2P6PA 1NWHA 1PX0A 3WNDA 1GZ5A 1HEYA 3KUDA 1Q84A 4GDMA 4XUDA 2B4YA 4F91B 4MAAA 1W9MA 5EWJB 5EYPB 4Y30A 4KOAA 3ZJVA 1JAIA 1AN9A 1R66A 3A31A 4UHCA 5AKYA 1I94B 3Q3IA 5DGIA 1LRJA 4CIWA 5ITZA 1TFRA 2QTFA 1J0BA 3CF0A 3VOBA 1NW9B 2X9GA 4P58A 1N36B 1O8BA 1TKCA 2XUDA 3IQFA 4PO9A 2NQ2C 3RSOA 3MJCA 3PF8A 3V8BA 1RZRA 2JFPA 1KE1A 3FYUC 4B3MB 2OB1A 1GSAA 3CEHA 1Q2UA 3QXHA 2G5TA 3UW3A 1PAUA 2VR1A 4QDOA 4WN3A 2B0CA 4BZXA 3NVAA 3TDKA 3SYKA 4V1CA 2J9ZB 2Q49A 1QR6A 2Q9UA 4FEAA 4P80A 1CR0A 3WS7A 4Z2AA 3R0XA 1G9XA 2F6RA 5AUPB 1TPZA 4Z8YA 3EBLA 4G1MB 3N6VA 1AD2A 4DLVA 5CEEA 4F2PA 4PRZA 4RZHA 1CFZA 3FHLA 2EV9A 4GW3A 421PA 3HBFA 5JYDA 4YTEA 1K8RA 2XE6A 1ORRA 1UJ2A 4UEQA 4LNAA 1NTOA 5GM1A 3P0IA 3LC7O 1KC3A 1M7HA 3GZJA 4XCVA 2QMYA 1SVNA 5A04A 1W46A 3DL2A 1Y48E 1XB2A 4PX9A 4KIFA 5CW1A 4BO3A 2B4AA 5FA8A 3T94A 2CXQA 4YAWA 5AH0A 1SCBA 2XOEA 4QEZA 2BR5A 4HQKA 2CLHB 3LZ6A 5IC5A 3TCKA 4C0WA 5JO0A 2AOVA 5AXDA 2VDPB 2MSLA 4KMSA 4K7JA 3LYAA 4U0JA 1V16B 3COSA 3TNFA 2ZUFA 1E9EA 2EL9A 3OZEA 4M99A 2VTBB 3D8HA 2E4XA 3RYHA 4CQLA 2JA2A 3BZBA 3P19A 5LZ5A 1EFRA 3TW4A 3TGLA 3KR2A 5CB4F 5JS6A 4RFLA 3ZYZA 1EA7A 4F85A 1PV4A 1GZ3A 2IGBA 3ASUA 3IT0A 4QJBA 2ZBVA 3TQRA 5J43A 4J2HA 1TCAA 5CNJA 2V7GA 4J7CA 2ZM5A 1KZ7B 1YQUA 2VWPA 3QM1A 4PO8A 1NONA 4D43A 5KNCA 3CX4A 1NVKA 2ZYRA 4IJ6A 4OQ4A 2IBTA 2BDTA 2PAAA 1IPFA 2Q5IA 4GX0A 1DQYA 4M0KA 1XPRA 4CEJA 1JW9B 1WZEA 1XZHA 2LWIA 3EWIA 4WH0A 4B0OA 3S2IA 1YA6A 1T35A 3ZWOA 1JQJC 4PRLA 1EAMA 1B8NA 1SQGA 1ZGBA 2JDID 5FPTA 3ZY2A 1UDBA 3ZLUA 4HJRA 3PC4A 1V5GA 3I8XA 3H9JA 4MEJA 4M9XA 4Z7JA 4AKEA 2ZE6A 5IJAA 3TJRA 1Z4LA 3B36A 4HQFA 4YONB 3W3AH 2XCRB 1QGYA 4OQEA 1T0JB 1J39A 1OX6A 4FI3F 5EY5B 3SFZA 2FZEA 4YQFA 2IYOA 1MUUA 3WHPA 3U81A 1HFJA 4D96A 1RXWA 1QPBA 5FTWA 3RARA 4LQ4A 4G5XA 2C5BA 4X41A 1XCJA 4PN7A 2VFAA 3FWHA 4TV9F 1DGQA 3T3IA 3WQBA 3ER9A 2I7TA 3RJZA 3S2GA 3MT7A 5IJZA 3LRPA 1Z82A 1N34B 1JJBA 2Q0SA 1FIUA 2HFJA 2Q5CA 1SCQA 3O4JA 4DCSA 1TPYA 2Q7DA 1P17A 4UMFA 4BFZA 4YRKA 3A0RB 4AL4A 1GZSA 3LZCA 4FB4A 1XTSA 4F8YA 5IJ0B 3NWPA 1JHVA 3TN7A 1G6Q1 1PL6A 5B7PA 2QRJA 3N6RA 4KHPB 1Y8AA 3EGXA 1KI8A 3TNJA 3HY3A 3EEFA 4GH5A 4M0PA 2VP9A 1K8ZB 3ZNPA 3ZU6A 3ERCA 1R9GA 2XITA 3C3DA 3OA2A 4TRJA 4D41A 4K9SA 4AULA 4BS9A 5IVHA 1HH4A 1KAQA 1ODTC 3GXOA 3BWMA 4MQ6A 3JALB 3SFTA 2KBFA 4C3OB 3FNFA 5KX5B 1ZN2A 4EBBA 1P5HA 3JTEA 1AKYA 2B8EA 1SXJE 4ZT2A 1OA0A 4WVFA 2HLPA 3IV9A 2YFYA 3CB2A 4RY2A 1WNTA 3B5EA