4XM1A

N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the presence of cadmium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
VSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Metal binding protein
molecule keywords Uncharacterized protein
total genus 99
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm1A00
1Q74A 3DFKA 5B2EA 3WE7A 1Q7TA 4XM1A 4EWLA 1UANA 3WL4A 5B2FA 5BMOA 2IXDA 3DFFA 2X9LA 4XM2A 4XLZA 3DFIA 2XADA 5CGZA 3DFMA 3WL3A 4XM0A
chains in the Genus database with same CATH superfamily
3PB3A 4LTDA 1AUXA 1Q0UA 2I78A 3A31A 5G0SA 2ZJAA 3TLZA 4ND8B 2QR2A 1JNXX 3WKDA 5KNBH 1XDBA 2WE8A 1QPGA 2CNWA 3O92A 4P33A 1MJGM 2AS0A 3V7FA 3VZRA 3GFPA 3M6MD 2QE7D 3QFTA 3R75A 3IVRA 3PFWO 3TX2A 2A7XA 3RKUA 2H3EA 4HNVA 4FUTA 5F1KA 2PGNA 4N8EA 5D01A 2MSDB 2I4RA 3T5TA 1GU7A 2DKNA 3JR3A 4QOHA 5BSFA 1SBCA 3TZ6A 1KWGA 4WA8A 4BNHA 4TKVA 5ETJA 4B6QA 3KQHA 5BYAA 1VHLA 5I4KA 4IJ5A 2IJGX 2B20A 3BBLA 1BVYF 3AONB 1N2BA 3GNSA 1N7IA 5CYOA 1DEKA 3GIWA 4IOMA 4XCXA 4ZJYA 1HC7A 1KZ4A 1CEYA 1JWLA 3F6RA 4LJ9A 5K3OA 1EGQA 1GYRA 1E9FA 1QH8A 2YJ6A 2ZULA 3K31A 3SZUA 4ABYA 5BUSA 4NCXA 4IYJA 1QQTA 3DDZX 3RSGA 1OPXA 4BJHB 1FCJA 4OFWA 3RW9A 1QF7A 3LE8A 3TPFA 1UXKA 3NJ8A 4HUQB 2G5PA 4FSHA 1E2JA 3O8QA 4P7JA 1RQNA 5FNVA 1HLDA 4B76A 4EF4A 4P4UA 5AW7A 2ZE7A 4R3NA 3HDHA 4XA8A 4CBVA 3JQ9A 1IN4A 3PNYA 3WWYA 4R1TA 4UNNA 2Y1EA 5LC1A 1ULSA 1NIPA 2XITA 1Z08A 3ZWMA 2EAUA 1BVUA 2O1SA 2Q6KA 3OCJA 3QPBA 4QWMA 3TS1A 2BMDA 4AZ3B 2PZKA 3DAYA 4DIEA 2ADFA 2GPNA 3TJRA 4OJTA 4TWJA 3X0DA 2Q1XA 5LKAA 1SEPA 3SQMA 1SZCA 1X7ZA 1T4CA 1YS1X 2YS7A 2YXEA 1JDVA 2I6UA 5CT5A 4GKKB 4L2IA 4M0FA 3ELDA 3NDPA 2DHDA 2ZS7A 3H4VA 4TYYA 5CT8A 4O8CA 1UCFA 2Q9CA 1YZUA 3S2EA 1RM4A 4AL4A 4EP1A 1MAHA 1P91A 3DZDA 1J0EA 3TLKA 1TEVA 3HEAA 2QGZA 5TQ2B 5KVCA 1VPLA 2F1KA 5IUJC 4MLZA 2AFIB 3E9YA 4Q7LA 4CKCB 1XTPA 1E2BA 1K3TA 3DXXA 4AS3A 1MXHA 4CI0B 3FUVA 3DE2X 3WYCA 2IZ5A 1MN6A 5BSEA 2BOVA 1CETA 1GPMA 1ONNA 2Q7XA 4HXGA 1G5PA 5FTJA 5CVCA 2I66A 2PFKA 3GCDA 5DHAA 4B2IA 1G8PA 1TFUA 1FUUA 1UZLA 4P98A 2HW8A 5KSOA 2AFVA 1ORTA 2M6SA 5HFJA 4LI3X 5A6SB 4ZI7F 3WAGA 3QU7A 4XD7A 3B3FA 3OBIA 1QZZA 1WW2A 1V8BA 2FDXA 4NV0A 1NXOA 1UZUA 4RV4A 5AQEA 1JHVA 4ONEA 1J1IA 1M2FA 2D1RA 4BFSA 2HPAA 1E2HA 1XVAA 3D0OA 4WSOA 2X5OA 4X0EA 4XAQA 3GEIA 3AF6A 1NUSA 1SKMA 4KI0A 4YP6A 2HEGA 4C6TA 3M9WA 3UN1A 4OSPA 1BA3A 2HIMA 2IUFA 1Y98A 3IT2A 4MX8A 2QI9C 3KNZA 4MKGA 3RKSA 5KOHA 3ZJUA 1GTMA 2BD0A 2ECPA 2OPHA 2WZDA 2BTQA 2HHHB 2IEGA 4F60A 3DAGA 4MQFB 3VGJA 5A5VA 4Q18A 3EXAA 2PZEA 2RK4A 1Z8HA 3EGCA 3U40A 4DJJA 4KQJA 4DV7B 3BJRA 1KYTA 4DMFA 2FZKA 1BWQA 3TPZA 3AHIA 1R6UA 4HC4A 4MUMA 4WNIA 4TYNA 3EN0A 5EKSA 2YWJA 5ALJA 1XQ9A 2WF9A 1HDZA 3IV7A 1GUFA 3CUEF 1GYQA 1KI7A 3I83A 3VSDA 1S02A 1N2JA 1KVUA 3BB1A 1HV8A 5A1TA 5I47A 3FFAA 1VSUA 4RKWA 4HX9A 4X3PA 1VJCA 2QJOA 4EBFA 1A9RA 4XWWA 1VDMA 4QU0A 4PPGA 4QJ4A 5JD6A 2IYTA 1KKUA 4Y0VA 3LMKA 2Q3FA 5BWMA 2LIPA 3CWZA 2Z1DA 2AZTA 3T7SA 3R7SA 2OMKA 3JD1A 3ELUA 4LYGA 3U31A 4M2LA 2AWOA 5CPFA 5F64A 1QYXA 1YB1A 3TDKA 1JSLA 2D1FA 2V54A 2Z57A 1L6IA 4RPLA 4D9JA 2NQ2C 1FSFA 2VO1A 3BDAA 5GGXA 2BM1A 4MGYR 3L8YA 4NDNE 1I7PA 3DAOA 3UK2A 1L1QA 4CM9A 5KNCH 1D04A 2Q6IA 4LBZA 4EX7A 2V4MA 1OLUA 5ELXA 1NMSA 3D6NB 4MR8B 4ZICA 1PS9A 1Y4SA 1B14A 2HO5A 4DBLC 1REQA 3RSFA 2GAAA 4KQHA 4BGUA 2BGWA 1J0XO 5LBUA 1VSTA 1U2GC 4MI1A 4BJ1A 4BNGA 1WCXA 1E5VA 4LW8A 1HEIA 4QGFA 1D8AA 4WZBE 2B8WA 4PWYA 3HB5X 3FR7A 4JBNA 2OKGA 4EI7A 2VSQA 3NBUA 3L93A 2P62A 3RVDA 1CLUA 1Y63A 2GXUA 3B6JA 5E8RA 1JJVA 1TGYA 1CERA 1OVGA 1RJDA 2FZGA 3FOCA 3DUFB 5HKAA 1Y37A 3AWIA 2GARA 2UYQA 2PQMA 4RY9A 4HGZA 2IPAB 1ETUA 4JLDA 2NO0A 3QX9A 1TAHA 2HSWA 3BWBA 5C37A 5GADl 2ZCJA 4JJKA 4JJAA 1WZCA 4Q4JA 4YCSA 3AKEA 3M89A 3UUGA 1IZ7A 1R10A 4EKIA 1WBBA 3FDJA 2WFZA 3KXKA 2F1JA 1E8MA 3LCCA 1IH8A 2VT7A 5CX1A 5DN9A 1D5CA 1UPAA 3PCTA 3L7YA 4Y2PA 4D0RA 2PZMA 3DE1X 3YASA 4D6PA 1TW2A 2ILVA 4OLBA 4V3BA 4W8OA 4DDMA 3LKBA 3ETJA 4L4YA 2FSVC 1MO5A 5BNIA 3INNA 3C24A 3IQGX 3ETLA 3DOOA 3EF3A 3FPJA 3KKPA 3L7OA 2I8LA 3PKIA 4ZT3A 2O1XA 3STVA 1WHTA 3LLMA 3MGCA 3H0EA 4IJ6A 3V1MA 3KSMA 2AV6A 3DA8A 4FNGA 1DMSA 4XYBA 3HDTA 1O6GA 2OFFA 4NYJR 3BIOA 4XOIA 1H69A 1Q15A 2D7DA 3KQMA 3OT1B 5I7OA 5CVDA 5CLLA 3TW8A 1XKQA 4OVKA 1FQJA 1PSDA 3CINA 4N5MA 4F6LA 3L1VA 2IEIA 4TZTA 4EB6A 4ZYYA 4W9NC 3Q0EA 1AGRA 3FPGA 1P1IA 3WA6A 1H66A 2E37A 3GNLA 3W3AA 2NTYC 1LZLA 2WYIA 2Z4TA 4JBIA 3E84A 4NE2A 1XWFA 4TMKA 4X44A 1BCSB 1VJDA 4IRUB 4MGHA 3VNUA 2J7KA 3BGIA 4OHXA 4S1NA 3CR3C 3M6WA 2JW5A 1TL7C 3P9SA 2VOEA 4H6XA 1DRVA 1XA4A 3D6MA 4TKUA 3AVXA 1X8XA 5DRYA 1JDBB 1BCSA 1J70A 4YRGA 1WD7A 2JLZA 4RCYA 3SI7A 2B34A 5LSAA 3C3MA 4IV5A 2D1TA 4Q9DA 3R5KA 4UTOA 4HQ0A 1T1RA 1LPMA 2IYLD 5EIHA 2WY2D 2HN9A 4H0FA 3LTNC 1QYDA 3E1SA 3PNVA 4NU0A 5K3EA 2YXDA 1CLEA 4KAXA 4NH4A 1INLA 1R6BX 1EX1A 1J25A 3W06A 2BFAA 1PEYA 1RWKA 1ZOIA 5B3KA 3NDJA 1D1PA 1M6VA 4CLEA 2PLWA 5A5EA 4RY8A 1FC0A 2ZP1A 1DJOA 2MIIA 1T8WA 4TXJA 3EUAA 5ESXA 1M6EX 3E9QA 1X94A 3FPFA 1DC8A 1Z34A 2P6PA 3DMYA 3N8IA 3QLJA 1A7AA 4FOPA 4L4UA 4QTUB 3DB2A 4TKVB 4NC9A 3WB0A 1YS6A 1V6AA 3G79A 4YAKA 1U81A 4MMZB 2I7VA 2CNBA 3LAWA 1JQDA 1WMDA 2WSYB 3FB1A 2WNSA 4FR2A 2YRFA 4C0KA 3A28A 1AY0A 4I66A 1EX6A 1EWVA 4RPHA 5DM70 3RB8A 5AVZA 3MFQA 3KPYA 3G2IA 3MXTA 2RHOA 1KMMA 3BGOS 3UAGA 5DPMA 2PJRA 3RG8A 4BLPA 1ZRMA 5EINA 3SJBA 1XQYA 3KDPA 4GI3A 5GV8A 4K86A 1JF8A 3RS2A 3UCXA 1RHMA 2BFWA 1E8NA 5CG2A 3DTYA 4A0QA 3CR7A 2X5JO 3LY5A 2EGHA 4I1UA 4PAGA 4V0QA 3WZLA 2YFYA 2IOQA 3V4ZA 1V6SA 5FBWB 5A4AA 2CNOA 3GD7A 5BYJA 4TVSA 1I2MA 5BSHA 4WLEA 3UMMA 2YOFA 3PNOA 1HSOA 4DMKA 3U13A 2PMCA 3S8YA 2XUQA 5KU1A 4M1YA 2QUZA 3F8WA 5U9CA 1E1MA 1X87A 4RK4A 3I2FA 4DLSA 2PZ8A 1PT5A 1ZISA 4FR5A 1XZPA 2EOAA 4HEA1 4JHLA 2ZQZA 4G0ZA 5TMEA 2JDID 4DRZA 4PFKA 4DY4A 3WRXA 5MGNA 2F1HA 3D6HA 3KZKA 3SG0A 2HPZA 4OFXA 2UYGA 3F7NA 4B9AA 3AOEC 3I9KA 3TIIA 1KFKB 4IGKA 5EY5B 4PSVA 3WMWA 4AUEA 3R7DA 2O8CB 2R6CA 3EZYA 1J8VA 2Y1OA 2HF8A 2Y1XA 1P3DA 1PR1A 3B7PA 3BXZA 1GP2A 1X42A 4MUGA 5DYWA 2PA0A 3VKUA 2WJJA 1C8LA 3G7UA 4HAYA 4RKYA 2YX1A 3AIKA 3FVVA 3RR2A 4I5EA 3CNBA 2QMEA 1KS2A 2WVAA 3GGOA 4G24A 4KR2A 2J0SA 2FSVA 1FUKA 2ZJ7A 4RSHA 5BV1A 2G9QA 1O0BA 1R1DA 2AFRA 3HKEB 3DL2A 4RDXA 5C7IO 4C3ZA 3DKKA 3H84A 3Q7PA 1G9SA 3LYHA 3ME5A 1IHYA 2A67A 4B3IA 4CJXA 2C59A 2XMSA 2ZZNA 4H4EA 2WC1A 1U8ZA 1Y8RA 3DP9A 3KD3A 3C5HA 3OQ6A 2F3PA 4FMCB 5TJHA 1B8UA 4DEXA 2P0AA 1NXXA 1Z13A 5ENZA 3PX2A 4B6JA 3VR3A 1FYXA 1H05A 3GWGA 1F6BA 3SMQA 2DP4E 3HY6A 3U48A 2ZSHA 7MDHA 2C3PA 4NESA 3UT5A 1GFWA 4KTVE 5AVUA 2X9NA 5JBQA 4C7OB 4LZZA 4QVKA 1U5BA 3PPVA 2BFEA 3O73A 1L7BA 4WCDA 1CRLA 4G23A 3VHQA 1XALA 2GM3A 1FYDA 1NXVA 1S6YA 4K1LA 3MLBA 3I23A 4IKOA 1H2YA 5FUMA 5C35A 5CA1A 1F2VA 2H1RA 1MEJA 2RGDA 3QY9A 3MWJA 1AQ6A 3HABA 1X74A 4NP6A 4WDQA 2IUUA 4ESHA 4O4JA 5LXTB 1L5YA 1Y8QA 2XWQA 3OQPA 3CW2A 1SQ5A 1ZCBA 2CUTA 1KPHA 2GK7A 4O4LA 2HXYA 2YUIA 3FM9A 2CD9A 2BELA 3EOAI 2WVHA 4LX0A 2B1QA 4ZCMA 2QN2A 2VK8A 3G2MA 1X2EA 3AJEA 3D2CA 3LQRA 3RV4A 3WISA 4Z4HA 1P74A 1GM5A 5I9BA 4PLHA 1NP6A 2C8KA 2VQSA 3G5LA 2A9JA 4A4DA 3E15A 5DCLA 4BE7B 5HR5A 1DIHA 3I92A 4LZLA 5FNVF 3ED1A 3UA4A 4KPFC 4RTRA 3PF9A 1NF8A 3FAZA 1NC1A 1UFRA 1UPUA 2CCKA 3A58B 3G0CA 4GXNA 4P35A 2H85A 5GV7A 3CE6A 4QDOA 2XDAA 3H86A 4E15A 2PUEA 5JQWA 1JEJA 1G59A 4JR0A 4HH3C 2OD7A 1CZRA 1Y1KE 5HF5A 4J91A 5D5QA 2YNMA 2NPFA 3SIXA 1E4EB 4CETA 2KQUA 4I4TB 2HYDA 1AG9A 5BNFA 4KN5A 3OQIB 1CQJB 2FP4A 5HF8A 4JUIA 1EUDB 1WD5A 2HT6A 3NRCA 4FGSA 5AIAA 5GJBA 4BX3A 4KLZA 5DDIP 1XLUA 4KK3A 4AP6A 1ZM3A 2Q1YA 3PQ5A 5DN6D 5WRFA 1KBOA 1EP2B 1RPJA 5EQTA 1FDOA 3DHVA 2AOWA 5JXJA 3D31A 2VZEA 4LHEA 1L0BA 5EFZA 3DTVB 3WGKA 5LM3A 1F9AA 3EDRA 2PUVA 1U7TA 3HLTA 2QS9A 4JU8A 4L16A 3T8YA 4BZWA 1UXOA 2CHVA 3RUHA 2V55B 2HDOA 4AZSA 2E4UA 1K2VN 3DOIA 2Q9UA 3DHWC 4CU5A 3GLIB 1ZRHA 1O6CA 2FEKA 1DOHA 2ZJBA 1BFUA 3FNGA 4GX5A 2GYWA 3AMVA 1J24A 3UYKA 4D4LA 2IZZA 3LT4A 1VSVA 1PJQA 2MR5A 1CF2O 1MABA 1PEAA 2O2DA 2RH4A 3FNFA 2QR5A 3OOWA 3MMPA 1AB5A 2VDUE 4HEQA 3AEUA 3LQKA 4X93A 2G70A 4FYHA 3TK1A 3SBXA 4Y67A 3N7TA 1TFRA 4MVJG 1E1CA 3RKRA 3ZIDA 4G0XA 3HJGA 3KQWA 4J1TA 1Q1AA 3ELBA 2N46A 5B1SA 1FTQA 3QVUA 1QGZA 5IWAB 4ARIA 4P3XA 4Z51A 1U7WA 3ZN2A 1VLZA 2Z09A 3JV7A 3PGJA 4URFA 1Y1TA 3QA3E 3OQJA 5AJZA 1N7JA 4ZV9A 3DTNA 1WETA 4NABA 5E7MA 1YCDA 4WD3A 1G3IA 1NVTA 3V1UA 3WMEA 2YHIB 1GTL1 3V32A 1BA2A 5F73A 4CQMB 1TTTA 1W4ZA 2HFJA 2AG5A 1RWNA 4ZVQA 4BKRA 3KSUA 2Q5JA 3SF8B 1HNNA 2CV1A 3P2EA 1D0SA 5I8PA 2XUFA 1XCOA 1CZLA 3OIWA 2VQ6A 3KT8A 1H0KA 2W2LD 3KZCA 4XUDA 3B6ZA 5EUQB 1MC5A 3I76A 4AFNA 4LYJA 2QRVA 5EE1A 4D98A 2Q1WA 3PWKA 1ULAA 1NTOA 1OHHD 3SGLA 4GR4A 1J90A 4AUNA 3GP3A 5I9NA 1Q20A 1K6IA 1FDRA 1YE8A 3IBGA 3CUUA 3LPLA 3R5JA 4YECA 4N82A 2B1IA 4BFLA 2P5YA 4C76A 1BC5A 1QIDA 3DLAA 4M0KA 5EXSA 3UUFA 5JNWA 4RZ3A 3TKLA 4B6EA 3GVXA 3BB3A 4R3UC 5B3AA 5C5IA 2F9FA 1J8FA 3EFHA 1PT9A 3C3WA 4HYEA 5AJTA 3JQ7B 3TM5A 4CXMA 1CPYA 4H35A 1CQXA 4LOJA 1SD2A 3SC3A 5DLEA 5JVDB 5BUCA 4FMDF 4ZOLA 4S2EA 4A2WA 1DV2A 4D9MA 5FB3A 4C7VA 1JA1A 2P35A 1B1AA 1TEXA 1FY2A 1GAEO 1Q0HA 1OROA 1YOBA 3BCRA 3CLSC 3CLUD 3FYCA 3GLHB 2AE2A 3NYRA 2HD4A 3DZ8A 4HG2A 4I55B 4F9GA 3A9SA 3DDHA 2R68A 4WOJA 4A92A 1J39A 5FO1A 1Z0JA 4QRDA 4LXTA 1WB5A 5CTJA 1R9GA 3JSXA 5B36A 3UCFA 1IHXA 4NMWA 1TU3A 4LEIA 3CS3A 3K53A 5KWVA 3KM0A 3X1DA 5I7FA 5MN4A 4MQ5A 1JR2A 1YR1A 2QSJA 3D7RA 3EIQA 4QXQA 4XFJA 4Z4IA 1XRLA 2CMHA 3WLRA 4WAUA 1H3NA 1VB5A 4JUAA 4IDCA 4NBUA 4G5XA 1R4AA 1JBEA 1W4LA 3GRYA 4N0MA 2XUDA 1GL7A 2Y4NA 5HKKD 3UAXA 2FJ0A 3OD5A 2FUEA 3R4CA 3QYJA 2YHSA 4X8LA 3KQSA 4I36A 4BO9A 1KYIA 5D5HA 1XD2A 1GZ6A 2PH1A 1NV9A 2Q3DA 2IYPA 2VHEA 4S12A 2YMQA 4XIIA 5AK3A 5BN4B 3U7RA 5FPTA 4FFOA 3WO1A 3MS4A 3WG9A 4DR3B 3ZWWA 2JBWA 3DWFA 4KHZA 3PWSA 4YUXA 1EWQA 3O21A 3CH4B 5DBIA 2DPYA 2ZYGA 1RXSA 5B12A 5KOYA 2AZXA 3L6OO 1KI1A 1J9ZA 3LLCA 3BT7A 2CE2X 1U6JA 4P0TA 3RYFB 5DYIA 3KRTA 1HYHA 4TXNA 1U1EA 1ZA1A 2MSWA 4OX9B 5TQVA 3G9QA 3EVAA 2P75A 2C5EA 2V6IA 3SXJA 5E2BA 3UJ9A 1LFAA 2BZ1A 2ZJ6A 2IV3A 3WZ2A 4A6DA 1SH7A 1SHTX 3AJ8A 3CZRA 3GQVA 3IX7A 3T3PB 5ECDA 4A73A 3ZW9A 4BP3A 1T9DA 2HZBA 5EJ4A 3N28A 4MTLA 1YBVA 1JR6A 3ZPXA 4PZEA 1O54A 2P11A 2FVXA 5HE8A 1CRQA 3PHIA 5JAZA 4FE7A 3TTTA 2N1BA 5FEUA 1ZESA 5IT0A 2A5YB 3GN1A 5IG2A 4OI1A 5TS2A 3IXLA 1GPNA 4M99A 1IOZA 1ZUD1 2J6HA 4BB0A 2ZRGA 4O4HA 3C3PA 1QP8A 3PHHA 3VSEA 3MVEA 2OCGA 4XVUA 3T38A 4HUTA 4JI6B 3SLKA 4N7MA 2Q21A 4J1TC 2IW1A 2C94A 2ZYWX 3ASUA 2D0DA 4BN0A 4BQEA 4B81A 2A9VA 1QR6A 1X38A 3AGPA 4P31A 1NVVR 5EMMA 2X0IA 4NU5A 3U4AA 2IIPA 2O5EA 3H3JA 2Z3WA 1EUYA 1M83A 2ZWVA 2IYNA 3HXPA 3HYLA 1NF2A 3MS7A 1V9CA 4NZZA 1P45A 1AM4D 5HIMA 3RSHA 5HW0A 1FP1D 2GBGA 5D86A 4QE3A 4RAOA 4KUHA 1QCZA 3PDWA 4YRNA 3TUZC 1US8B 4BNKA 4AIIA 2QOEA 1M5UA 3ACCA 3VJRA 1BQEA 4LY0A 3UMSA 2HX1A 2B9VA 2QGFA 1OXTA 3DZHA 1E6CA 4WZAA 4EYGA 2D0OB 1HTWA 4RMGA 5DGXA 3D7KA 2PRSA 3G2LA 1C7ZA 3I8SA 3QFCA 3KPUA 5FT9A 4NWIA 1YB7A 8AT1A 2JB9A 5CDYA 3ML1A 3GAZA 4JBGA 1GG8A 1UP6A 4DGQA 2CZCA 1I5OA 1M7HA 4GXQA 1H1TA 5PGMA 4LZOA 4KRFA 1F8FA 3A6ZA 3NDRA 4A8JC 4B4OA 5C5EA 5ESWA 3VZQA 2C9ZA 3DMDA 4TRJA 3F3YA 3NDIA 1WMEA 1IBSA 2QWXA 4BQQA 3OFNA 1AHIA 1RLIA 1UBRS 1VIMA 4M0UA 3N2IA 1JYEA 4B0PA 1FUIA 2JFOA 3F7MA 3A37A 4I4TF 4EMSA 3VPHA 2B4QA 1OT3A 1IB0A 2ZWPA 3B60A 1XBTA 3K0AA 1SCBA 2WD8A 4IUYA 1AVTA 4XEUA 4II3A 5SZJA 5KYWA 5ALDA 3FUTA 2QRJA 4JOQA 1ZVQA 3BD7A 1UK9A 2B7CA 1TCCA 1YZHA 1HT0A 1QQ7A 2NYVA 2CYBA 2H2IA 1FFCA 3CG4A 2ISSD 3MOIA 2B21A 3P19A 4K1XA 4Y2GA 4ZZ2A 1PZGA 4M3NA 3K20A 5G3ZA 3S44A 3HCPA 2HUPA 1W5EA 1XTTA 4J43A 2Z56A 3CX3A 2JIPA 2ES4A 3BWVA 1HQYE 2Z8XA 4ES6A 4L22A 2FE1A 3PQ8A 1MX9A 1E32A 3TVTA 2G9VA 3I72A 1Q21A 4JX8A 3GLHE 1HEYA 1AUQA 4CM9D 4DADA 2PT9A 4RIHA 3TL3A 4UUAA 1ZU4A 3CGWA 4UVDA 5JBNA 4AY2A 4Y2UA 3NFYA 1X1CA 5HZMA 3LW7A 3ZGYA 5ICMA 3KYJB 3V8QA 1DKNA 1AGXA 5KTYA 3CF4G 5B7NA 4Z0NA 3W2FA 1L8AA 1TQDA 1PBTA 2NAPA 2R66A 1RXCA 2YJTD 3PENA 5BSUA 5ALNA 4DV2B 1KYZA 1ULTA 1Q95A 2NZ8A 2EQAA 2OQ2A 3KJZA 4RH0A 4BMPB 5I9LA 1L4KA 1NASA 2XUOA 3EZXA 1NN3A 3OQMA 3O9MA 3SEAA 2V59A 3INRA 5CT9A 1AKTA 2WKQA 3LVRE 4H1VA 4MS4B 2HZ7A 3PIRA 4JEHA 2RAFA 3U4QA 4O33A 5IJ9A 4OXQA 3TINA 4PG4A 2YWDA 4N18A 3V4LA 1K6MA 3HFRA 3NT4A 3PDIA 4JQYA 3EB9A 4X90A 1S8OA 4L9SA 5AKIA 2HMWA 1ESCA 5H5JA 3WYNA 4C14A 2F9MA 1AKEA 4IDPA 4C0AC 5GTDA 2IK8A 1QOPB 2VQFB 1XDUA 2P6RA 2Q6TA 5JU6A 2UUAB 2IOHA 5AIBA 4KGXA 3EAQA 4CM7A 3GAFA 3ADDA 4DT1B 3HSSA 4YV0A 4RDIA 2OXFA 2QUHA 4KOEC 2GHTA 4D9GA 5SZKB 5I3ZA 5C52B 1QGUA 2C54A 2DH6A 1X70A 5JDIC 1I5RA 4EFDA 3AEZA 4DMHA 3I8OA 3TR0A 1GT91 3K4PA 4HDQB 4LJRA 2F8TA 1G3RA 1HXHA 1YR3A 4DIBA 5JROA 4WZBA 3B48A 2PLFA 3BMQB 1ZD1A 3BWYA 2VC2B 3LY7A 2ZT6A 1SKBA 2CL7X 4N3BA 4GSLA 1Q84A 3WLAA 2P9JA 5ADHA 1E2MA 4ND3A 1KH1A 1GPKA 4KXXA 1GNVA 4PXSA 4QQKA 1SIUA 4WKNA 5KPDA 4RESA 3RSZA 1UAAA 4FI3C 5BWOA 3SYRA 3BMQA 1SG6A 1U7UA 4LC1A 4WV3A 4W6ZA 2IDMA 4U0JA 3WYAA 1M67A 1WU8A 2I1QA 3GLRA 3UH0A 2H2GA 2X8JA 2ZAYA 3JWJA 3PXAA 2C2MA 3BDVA 4I2VA 5CIQA 4C7MA 2O57A 1DI0A 1JDZA 4QOEA 3WMGA 4L5JA 4NU8X 2K5UA 4HBGA 4O4IA 3RO7A 3TIXB 5LU8A 4Z4EA 3LIPA 4NYMR 1JYSA 2Q07A 2X8JB 4Q1BA 1UWLA 1IXSB 2RK6A 2XDQA 1GTSA 2QDKA 2Q5OA 3IILA 2R1ZA 5K8VA 2ZBDA 5BWLA 4PAWA 1CQIA 1G7RA 1RZVA 4AQDA 1EFKA 1WUJS 1X77A 2EX4A 3QPWA 4A0HA 1KEKA 1EUDA 3GLGB 4AKTA 1VDZA 4HWGA 1RYNA 3Q6IA 4UNQA 4YT8A 1GQYA 2LUOA 5TT1A 1HM5A 3SJAA 3TLEA 1ZM2A 1RYEA 5KVQA 3T1VA 4ZMRA 4IUBS 4HFNA 4K0RA 1ES9A 4KE6A 3UJDA 2HT1A 2ONCA 4NZ9A 4X64B 2VUHB 3F96A 5EERA 2ISQA 3WA7A 3R6LA 1MVOA 4IIXA 2AI2A 4NBVA 3GCWA 3EQ2A 4XR9A 4F96A 3UMYA 2O0HA 3MPUA 2BFBB 3BHJA 1T2EA 2EARA 1OKKD 2WT9A 3UXMA 2YCBA 3R8FA 5TY0A 1U8EA 1O89A 4KR7A 4GIBA 1FRQA 4O2BA 3GXOA 2ZSKA 2GZAA 3DFZA 3O3MB 3C14C 4F3NA 5HSGA 2Z2YA 1P2VA 1N6OA 4Q7JB 2LD4A 5K3BA 3E48A 1EFLA 1ECLA 1XD8A 2C78A 2OO3A 3Q7SA 2M2IA 1D7AA 1TOAA 1EWTA 3ZVKA 4UMFA 3UWKA 3NIBA 4EPTA 1ISMA 1AX9A 4DUGA 4CGZA 1C8KA 3HVIA 4D6XA 3BWDD 3FHCB 3M4NA 4ID9A 2PZBA 4GYJA 5BW8A 3EIWA 3ZNPA 3D1VA 5EJFA 4BO0A 4XASA 4OQ4A 2VDPB 3K1AA 2GK6A 4Y9SA 2HIAA 1LSUA 4Y9RA 3FOBA 3F9CA 4JP2A 1GGJA 1NVBA 4UMDA 1P0MA 4Z0PA 3Q4GA 4M88A 3EBPA 1IY1A 4GAEA 2VLIA 4D74A 2FZEA 5EGNA 5ES4B 4MKIA 3ICWA 1L7MA 5FPHA 1MA0A 5K0NA 4G0NA 3CNEA 4N5DA 1OV6A 2YC4C 5FD8A 3A2KA 1BHSA 2GZ3A 1N5KA 4D46A 3A25A 2BDUA 4CGYA 3WWEA 1QZTA 1J8YF 2BJVA 2YXNA 1WJGA 1QRRA 5K6AC 3KVOA 4IV0A 1I2AA 2FW1A 2JCBA 1ZK4A 3VA7A 1TUEA 4MUYA 3RGWS 3PGMA 2QTLA 3LSTA 3VDMA 5JSZA 3KSBC 2W0MA 1PNTA 2YZGA 1KRXA 1WVMA 2RHTA 3K4QA 3QNWA 4QDJA 2BMWA 1MP0A 2GPAA 3QJGA 3X43A 3K71B 1C4KA 4QG3A 2YHAA 3UMVA 4FN4A 2W8BA 4PANA 3MB5A 1DRJA 1Z4IA 1H2XA 3SX4A 1T8YA 4Z0TA 5KX5B 1RM0A 4FGKA 3WVNA 1SZJG 2NXWA 4M38A 3RIMA 2GHRA 3OM1A 2P6OA 5FUQA 4KO8A 1M54A 4QT0A 4DBLE 3G89A 1JPUA 5IN4A 1JDTA 4W99A 5JADA 2OHXA 3ZGXA 3LLSA 1SXJD 1KJ9A 2CLCX 3JQ7A 1JLHA 1BX0A 4QTYA 3ANSA 1T8SA 5DCWA 2QG9A 3BFXA 3DVQX 5A9RA 2CL0X 3K6SB 1QKJA 1RP1A 3O82A 1E0SA 1VGVA 1LFDB 4A26A 2ZRHA 1NI4A 2PWPA 4PNPA 4HAIA 1G16A 2NV6A 2XI4A 2A14A 4K6GA 1P31A 5JDIA 1BGWA 1D6JA 4FB5A 1C9EA 3WLNA 5D6NA 1ZM7A 2RC6A 5HP4A 1YZNA 4KGZA 1QLJA 1I6LA 2JVKA 8ATCA 5B58C 2OV8A 3AI1A 2F17A 2Q9AA 3ISJA 4IVNA 4YJKA 1E62A 1O5OA 4CDNA 1S8AA 4IHJF 4OHVA 1BSVA 3UF0A 1ZKDA 5G2OA 3ZDFA 5CVTA 1ODCA 4ACBA 4QPDA 4Y8VA 4F84A 5K0JA 4RTJA 1NNUA 4K05A 5AI9A 2KX7A 1XDWA 4FCCA 4N41A 3WC4A 1R0KA 4CI9A 3OKPA 4QZVA 2BGNA 2ONJA 2W4IA 2J59A 3BXHA 4LZNA 2QEQA 2QTGA 5HF9A 3LJKA 1MJGA 5CVEA 2PSFA 3WRYA 1ZX1A 3D81A 5E2IA 4D0LB 2B4KA 4GPIB 3OSUA 3W4IA 5CW1A 4BB6A 4DW8A 3CZPA 5BPHA 3OCXA 3ZE9A 1DEAA 4R71A 1TCUA 2P2CA 1CUYA 4K9QA 5C1IA 1BEUB 5KUTA 5AW3A 2FWBA 1JN0A 5AI0A 1XU7A 3KSDO 4XIGS 4O2AB 3ONFA 1Z5PA 3TQTA 4CODB 2ZWOA 4QLBA 1O9HA 2GLUA 3ZTTA 1DKQA 3KAJA 1G8YA 3GNTA 1U0TA 1R5NA 3HO8A 4RQAA 4ZODA 3W5VA 1IK4A 4ALIA 4EYSA 4BNDB 4P3PA 1E5DA 5IWCA 3ZY6A 5JJ5A 5F3WB 4BTLA 2CNLA 2G1KA 3E7DA 3D3KA 4NU6A 1JMYA 1EK0A 1JPJA 2HDHA 3OBBA 4K81B 3T35A 1M1ZA 2UZ0A 4JLBA 1WABA 3H9GA 1GTVA 3F4BA 4RPJA 4TGLA 2ORIA 5EXDA 1P6QA 2DTXA 2RHLA 2KJQA 3K1ZA 4M0CA 4MRMA 3CZAA 3SOPA 2BFCA 4KE9A 3FPAA 1T6XA 2VP0A 3H9QA 1U5AA 2YIDA 3QUCA 2WYVA 1ACLA 4KLAA 2CXNA 2AWNA 1O08A 4EAAA 2QP9X 1HG1A 3LHKA 1DOZA 3RBAA 4DANA 4XRRA 1NNLA 2WT4A 3HO6A 1C9JA 1RYZA 4EA9A 1RPZA 3HA2A 4HUQA 2IH4A 1TYBE 2SICE 1ZJ4A 3VR0A 4EW1A 2VPQA 3H5NA 2YKGA 3DD5A 1NPTO 2CLSA 4HVAA 1K5DA 4EL5A 4UFOA 4K5QA 2XT9A 3D2AA 5KVSA 5K3AA 1ZXLA 4JBXA 2COKA 3BH6A 2YDYA 4TTTS 4LNUB 3ZV4A 5CIYA 3JQ8B 5BQ5A 4J16C 1RKBA 5AH0A 4L0MA 3WIBA 1E7YA 2Q3JA 1MBZA 2WM9B 3EARA 3I42A 3LM8A 1F5SA 4FI3F 4EKYA 1SZDA 3FPHA 1JXQA 4NRDA 3LUPA 2ZJOA 2EKZA 3DOJA 3CNNA 2HRDA 1M2NA 2IU0A 5LA6F 4OEHA 3OMLA 4MA5A 3IE1A 2Z58A 3MTIA 4GRIA 3SM9A 5JSYA 1OH5A 1W44A 2OUKA 3MTEA 4HK4A 2HGSA 3HTXA 4DR6B 3NBYC 1P2FA 3O47A 3HMKA 5L3ZA 3CPSA 1CDDA 5JY6A 4RK5A 2W83A 1ZI8A 1MIOB 3BJEA 1PU2A 1RLTA 3IQFA 4ND6A 1Z6PA 3DGEC 3TZLA 2TMKA 3UJBA 2IGTA 3D7SA 4MTCA 1PT6A 4AJPA 3AUXA 2X1VA 3VR2D 4GOKA 1ZEJA 1FLDA 2PUFA 1CB7A 4WN9B 1GCAA 1GRQA 2ZRDA 2EFJA 3OURA 1C4XA 2CUKA 2Q4RA 4J6EA 1YQEA 3RJTA 1CD5A 4S0ZA 2IBTA 1J1UA 3N75A 3L1UA 4ND1A 1Q1GA 2J9GA 3GYBA 3B85A 4ZQCB 5IM4A 4IIJB 4PO8A 3ZXYA 3N8DA 1ZVMA 2Z1NA 1CVIA 5LMNB 2IYEA 4UM9D 1Q7BA 2FEXA 2XDQB 4PGMA 2AF3C 5FWYB 3ZCPA 1UJBA 2FSFA 3UFXB 2MJLA 1RAHA 3QLVA 1VL8A 1VG8A 2DSNA 2V5VA 3RAPR 2ZB2A 1YVDA 3ZDXB 2X42A 5A0FA 1VE1A 4NY1A 1NF9A 1Z38A 2JEOA 3WNDA 4G5FA 4EAQA 2IU3A 2TECE 1V1MA 1PFWA 1CXZA 1G3MA 2QRHA 2V6BA 4PBTA 5EYPA 3V6LA 2C83A 2FP4B 3G88A 1IOWA 5COAA 1W581 5FWXA 3GEHA 4LJYA 3HE3A 5B2EA 5KYGA 1Q3KA 1YQGA 3GY0A 4D9BA 4RIGA 3UJ3X 3FCEA 4LJAA 2NUAB 4MUEA 1A8IA 3Q8MA 5T4FA 5A2QA 1Q91A 5B3JC 4CMIA 3JQEA 1IEVA 1Y89A 4DQXA 2IS6A 4X3CA 3FCUB 1A5ZA 1N1EA 2CCJA 2PGLA 3U0BA 1X8LA 4KREA 1VYUA 3HN7A 3KZXA 2O0KA 4YMIA 4ECAA 5EQJB 5KEIA 1BS2A 2VF5X 1L7DA 1FVFA 1XKLA 2Y1LA 3SD7A 2WV9A 4O5OA 4IR7A 4HBZA 1HQKA 3IBFA 5I8WA 5C7LO 4YRIA 1OYOA 1U3UA 2JHPA 2E0IA 3G9XA 3EH1A 1U2SA 5DWQA 1S1MA 4RZHA 3V5NA 5C8VA 2L2QA 4RTNA 2H5LA 5JVDA 2C8LA 6PFKA 3QUAA 2D1YA 4GOLD 1XDZA 1RFGE 3A14A 5LJIA 2C7RA 4I19A 3GPCA 3L8FA 1XVLA 4INOA 1NXWA 1I1NA 5E4YA 4EHFA 3TL2A 4YJFB 1PL0A 1IOVA 5ALYA 2PMKA 1IHUA 4FDTA 5BV0A 3F5DA 2VTDA 3BAFA 1G8FA 3GI1A 4ZN6A 4GBGA 1CCWA 5AW1A 4BVKA 2VAVA 3IPLA 4FVTA 2HB6A 4FYMA 3TOCA 4PZDA 1CY1A 1TRKA 1PKEA 1JSZA 1L5VA 3CO0S 3A26A 1SC9A 3KG2A 5DN6A 4B3HA 4ENTA 2BEVA 5I8ZA 2FPLA 3OUUA 3MJRA 1QGED 3DBRB 3EA4A 3OUTA 1S1CA 2AJDA 5BURA 3EMDA 3UM9A 3L84A 5BV7A 1W8IA 5DO9A 3KLBA 4JT4A 2YH2A 3OTWA 4DCPA 1U99A 4PGFA 3ER8A 3B6EA 4PINA 3HRIA 2FVYA 1IXKA 1AK2A 3DUFA 2QMZA 3PQ7A 1SUIA 4J3JA 4LXGA 1BFKA 1GG2A 5A4DA 3DR5A 4RM3A 4TQGA 3B9QA 3QE2A 4X8OA 1XK6A 4D56A 4KFUA 1G17A 4WINA 1LBQA 4QEDA 4HMOA 4IXDA 1MFPA 2DWPA 3GOHA 3M81A 3PR1A 4E5NA 2WU3A 1L3BA 3GLSA 3PQ6A 1SUAA 4UOQA 3CPHA 3UGJA 2VQEB 3LCUA 1J7JA 4OHBA 1V39A 4KNYA 1KOGA 1DAHA 2WJGA 4IYRA 2LKDA 3KL4A 4ALJA 3HEMA 1T6BY 1ZXBA 2HDNB 3KB8A 4CM6A 2PGOA 1VMKA 3BXPA 3O4JA 3WNBA 4D9CA 3K4HA 4OLAA 2UUOA 1M2KA 2R6DA 3D4OA 2FJPA 5IC5A 1S8NA 4EZEA 2DPLA 1YBAA 5CJJA 1H2RS 4TTPA 2BEUB 3AB7A 3F3SA 4CM4B 5L9AA 2VPWA 1CKEA 2GEKA 1Z35A 5IF9A 4BIIA 5AVOA 4AN4A 4EGJA 1PGNA 2BPOA 3WKAA 3CLTD 5JXHA 4F5YA 3SVZA 3C3CA 3HZOA 4NK4A 4NYIR 1JW9B 1NY5A 1NVFA 4FYVA 4GP7A 4PZZA 3RJ9A 4CPDA 4XWKA 3RU9A 2QROA 2VJMA 1QFMA 2LP4Y 4UPDA 1TF5A 5E4TA 1V2GA 2A57A 2FLVA 3NWEA 4N0EA 4NPHA 4AO6A 4DDWA 1QPZA 4OGLA 1QUEA 1LLCA 1WG8A 1W29A 3CRMA 3D2BA 2GN4A 4BV8A 4FBMA 4U7JA 3L4KA 5IANA 4OGKA 5IVIA 5A7GA 2BM0A 2WG0A 2L69A 1PEDA 2V7QA 3ZWXA 4J1QA 4LYDA 4E1VA 2Y0EA 3B38A 5FLEX 3CKYA 5TSDA 3L7JA 5CA1F 1YIAA 2Z0MA 2I2FA 5C8DA 3IFSA 4YJ2A 1XHLA 1V41E 2ZXEA 2HCTA 5DBHX 5JG7A 3OU7A 3M6FA 2R6FA 4AULA 1YZTA 2FUG6 2ZSBA 3QLVC 4M1SA 4TLAA 2QPAA 3LC7O 1FPQA 3BTVA 2R6ZA 4ZCSA 3Q7IA 1O95A 1XN1A 2XPCA 1DKUA 1U2QA 3K35A 2NVWA 3FN4A 4FFLA 4I46A 5F2EA 1DX6A 2WSSD 3OE1A 4A8JB 4BKQA 1D6MA 3PDCA 3THXA 4P7FA 4BLVA 4QJ3A 4WGFA 1DC5A 3O8QB 4PYKA 2CD7A 2WAXA 1J0CA 4ZO4A 3PNSA 4R2XA 5DYNA 4JYBA 5IC6A 1JPVA 3KOWA 4A5SA 2PWYA 3VO2A 4PM4A 1U2DA 3H1EA 3HUDA 2DT5A 4TKLA 3JARB 4HQFA 1ENOA 2AL7A 2IVFA 2ZRKA 4ARZB 5EIXA 1HT2E 4FGUA 1T5OA 4R9RA 5FORA 1Y7LA 1UOQA 4QDXA 2HM7A 3ISTA 4X91A 1AUVA 3AUAA 3PHCA 2IY9A 1QVZA 1R4MA 5EP3A 3PEUA 5HFNA 4CT4B 1A5TA 3EUWA 3UPTA 2QRGA 4DG9A 1E1DA 3VR3D 3ZWCA 3THOA 3JQGB 4XRGA 1YQ9A 1M8JA 5EIEA 5HX7A 1EDBA 4DJAA 1ILEA 2FK8A 4QGHA 3FAKA 3CEMA 1QYRA 2ZR0A 4UCFA 3OEED 4H0NA 1YB5A 2GXQA 5DU2A 4C4SA 3RIEA 2PJZA 1ARZA 3O83A 3U6BA 2D2VA 1LKZA 1YVUA 4LNUA 4BUZA 3DQPA 2G36A 2RB4A 1ZBQA 4C78A 2JAPA 5IKMA 1I0IA 2HQOA 5CD1A 3MEQA 3Q8LA 1F20A 1N5IA 3DXYA 3COSA 1MW9X 1IBRA 1LWOA 3KWFA 2XGMA 3FRHA 4CF5A 3PLRA 4HXEB 3KWJA 5AR1A 3M2TA 3DZIA 4GWGA 1V4VA 4RANA 1EX7A 2G1JA 2J4CA 2ZEJA 4JIGA 2GA9A 3K5PA 4WTOA 4YXWA 2L0XA 1D3AA 3I4FA 4LECA 3H1GA 5DHTA 3RSCA 4IRXA 3W3ZB 4V39A 2RHGB 4Y3UA 5EJ7A 5LDDC 4OHOA 5K20A 2R00A 4JGIA 1E3SA 2PNJA 2FKAA 4F12A 1ZONA 3JVUA 4OQEA 4IDHA 1F8YA 4LHWA 4FKMA 5TQ0B 4AY4A 2FZ5A 3OFND 3TAUA 5JWOA 1C9DB 4ZOBA 4BY9E 2PM8A 4O2LA 5LD2C 2JGIA 4OMDA 4BNYA 4BNJA 2JJ8A 4AJ2A 1BMDA 4BKOA 1O5TA 1V0JA 3K73O 3H8WA 1L1EA 1WBJB 3R09A 4J6FA 4JL6A 3BZWA 3I45A 4RELA 2DFTA 4TRNA 4WZZA 2GCOA 3DMFA 3GCZA 5K0FA 3KHKA 2P9YA 2BCEA 4Y6GB 5F7XA 1E8DA 3QXGA 2B36A 1GPUA 4MK4A 1FFSA 2VF4X 1ZC3A 2B5WA 3GUZA 4UHHA 4EELA 3KYCA 3GVHA 3U5TA 2XD4A 1KA9H 2FEMA 2ASVA 1SA0B 2IZOA 2NV0A 2JCVA 1IHDA 4OL9A 4KIWA 4XUCA 5CM2Z 1C30B 1KO8A 1XZ8A 1P1HA 4GS5A 1I3NA 3IH5A 2GO1A 2G3YA 1F0PA 4NBLA 2DYKA 4JP5A 1KEEA 5LYJA 3T94A 2QVYX 3GV0A 3HZHA 4L8FA 3EHEA 4NNPA 4QC2A 1GCUA 5KKCA 2EKDA 1DAOA 2O2IA 4G8CA 5IEJA 1MAUA 3IDAA 4IICA 4IV8A 5IABA 1ODTC 3HKDA 3IUQA 1ORHA 1JAIA 2PXAA 4XW2A 4ZO9A 2PN1A 4WN9A 1P4GA 2DOKA 3WK5A 1A2OA 4RIFA 2Z9DA 5A9SB 1RZRA 1MF7A 1H5UA 2OWDA 1P1RA 4NEQA 5T57A 2V7QD 4YCBA 2ZUBA 4BP1A 1I7DA 3H6KA 1LI5A 2CCGA 4PLGA 4D3SA 3RWMB 1UBNA 1KO1A 2ZJYA 3ZHBA 4AS2A 4DF3A 5FTNA 4DSTA 4B17A 1KO4A 4OU5A 2JFXA 4ZXPA 1L3CA 1LPAB 2GMWA 2WUEA 3RYTC 3U09A 1EDOA 4DZRA 1Z45A 1PNVA 2V7PA 3DHYA 3CEPB 1COZA 5H59A 1ISIA 3CJTA 1QQ5A 3JQAB 1ESEA 3LC0A 2FXIA 1S4QA 3D6VA 3CZMA 3RVKA 2V97A 4CF7A 2VDRB 4B6RA 1Q0QA 4J4HA 4LDPA 1B00A 5E2AA 5I4CA 1K5HA 4QXAA 4DR2B 4YLYA 4KR9A 1HT3A 2CXRA 4UAUA 1T9GS 3KQPA 4BNWA 1PX2A 1D2CA 1FBTA 1UK6A 2BW0A 3JQCA 4Z54A 2DY1A 2BJWA 5LZ4A 1TM7E 4C3UA 4ENQA 1XCBA 1PS8A 2BF7A 2BFBA 2H7CA 3PDJA 3RSOA 5ICEA 1Z25A 3OWXA 3UUEA 1SVNA 1Z33A 5DLQC 3ST7A 4BV2A 1JEQB 3FZGA 4NCAA 3WSWA 5KC9A 1YNSA 4TV8B 3J81k 1C7IA 1Q0SA 2GF0A 2ZREA 1FX1A 3Q7QA 3NR2A 3RU7A 2X3YA 4W5HA 1ZN2A 1EI9A 3LL7A 1YASA 3LBNA 1CZUA 1R0CA 2W71A 4V1CB 3O9VA 5AKGA 1OMOA 2AH5A 4ZO6A 3EXEB 1ZD5A 2VCYA 4B1FA 3D3WB 2EP5A 4R1SA 1F4LA 5DTQA 1U9IC 5F7OA 1DMRA 4X1OA 3LP8A 4EEXA 1YI8A 3D8SA 2QTRA 2P91A 4JNKA 3BA6A 3F7TA 3ROTA 3KV1A 2HHCA 5DMXA 1T34A 4DHEA 4YFYA 3QFSA 3QYPA 4RIEA 2WPDA 3A8TA 4GU5A 3TQHA 4WIAA 3KUXA 4G1MB 4Q7MB 2GFHA 1M1YB 4C0JA 4BQIA 1KXZA 2IUTA 1E2QA 1OR8A 2VIIA 1P0CA 3CKKA 2P8SA 5T8KA 3TTXA 3CY6A 2V98A 1KYQA 4L5YA 3ZQKA 3QEAZ 4HQLA 1SCQA 1ADGA 1T3GA 4TL7A 1CR0A 1D2RA 3N2GB 2IU4A 1NVGA 2MDTA 1IC6A 4BNTA 4R7GA 3I1IA 2VNIA 2TSYB 3WTCA 1UMKA 2OG2A 4KMMA 3P2OA 1DKPA 4Q19A 5C31A 2G9NA 5TMPA 1ZITA 4ED9A 3JASB 3F1LA 2IP1A 4XWYA 1Z5WA 2AQIA 4E2ZA 2YS6A 2ORYA 1BTOA 3AHGA 4HWPA 2BFPA 4QUBA 4X7RA 1VCOA 3OLWA 5DX1A 3VVCA 4E6PA 4RA6A 4RD1A 3RC2A 3WWCA 4QKQA 2A9PA 5JJIA 4IXTA 4IXNA 3W4KA 1ISSA 4RKEA 5FUWA 4DWVA 3OJWA 1PJ3A 3LA6A 4NTZA 3U7IA 3VVLA 2D4AA 5H81A 1CJBA 3HPRA 3WK8A 3OZEA 3Q40A 3DWGA 4MYDA 3UG6A 2ZK7A 4K9OA 3RVOA 5HGXA 1JHYA 2ST1A 1P3Y1 3OZWA 4EHKA 1G291 1RT9A 2P9CA 1HE8B 1E9SA 4JQSA 3LXMA 5E1DA 3ZWVA 5AVSA 4GLBA 5GVSA 2GPJA 3DNMA 3HVUA 4HH4A 4YROA 2ZRMA 4TTJA 1KDYA 3SDBA 1AO3A 2VRNA 4PZYA 4JS0A 4Q9HA 3RCBA 3TFWA 3PHLA 4JYMA 4OB6A 4CCYA 4HT3B 1WO8A 3SQOA 1N34B 2ZJ5A 4FFPA 4UFNA 4ZJUA 1E66A 1D09A 2CB0A 2QUBA 3M6VA 4HAVA 4HJRA 1T25A 1Z6XA 3HCBA 3UWMA 3LT5A 1XPOA 3ZU6A 4AQ7A 2EBWA 1KTVA 1BRMA 3L7IA 2PRYA 3EXFA 4LYFA 4XIFA 3ZU2A 2WIBA 1HDXA 4PTZA 4AZVA 2WD7A 2G09A 2J32A 5J23A 1CW2B 2IF2A 1N2GA 3V80A 4DV0B 4II2A 4EHLA 2C9DA 2HLPA 3GLTA 3BJMA 3M6XA 3WNQA 1EWKA 2O1EA 4KDFA 5H7XA 4NCKA 2R96A 4GGMX 3G0HA 4MUKA 3F6EX 3ETHA 4TYPA 1ODFA 1E79D 2W9XA 2A92A 1TF7A 4LGCA 4EDFA 4FGZA 3RYCB 1RRMA 4F4DA 1K7YA 3NHMA 1J5PA 2DBVO 3K8QA 3FE2A 4BPRA 2I9KA 3RQSA 4YNBA 3H2YA 3CF2A 1SG0A 2RHDA 2MU1A 3KB6A 1XRRA 2P30A 3AVTA 4MO2A 2QX8A 4IDAA 2M32A 3AIIA 2NU9A 1EZ4A 1QYCA 3SXUB 3IAXA 4R1OA 4A7PA 1MPTA 4M8LA 1N57A 3LWZA 3P1JA 2V7VA 1XJ0A 2WIAA 3H13A 3WDKA 1XXHA 4X20A 2CJXA 2Q28A 3M0EA 4I4IA 2G5CA 3N2EA 5IH3A 3VV3A 3S7ZA 4JKOA 4JSRA 1KJWA 1JPNA 3S2FA 4AMYA 1P29A 4ZVMA 1TLFA 1CC1S 1NN5A 3AVQA 5EPUA 5D8DA 1GRCA 1CE8B 1U9IA 1Z5UA 2IDZA 4H15A 3VVBA 1AJEA 1XRQA 4NCNA 3VTKA 1VPTA 1C3VA 1NFQA 2A1TR 4G4SP 1K06A 3U0VA 1TAUA 3JVEA 2P3SA 3QW2A 1W0KD 4E12A 4K9DA 1BQ3A 1GGHA 4HDNA 1NBWB 2G88A 2XUJA 3F9RA 4ZRMA 4D5EA 2J0UA 2WKSA 5CNJA 4Q3KA 5E8JA 3QNUA 5DFAA 2BKUA 1ODSA 4FXOA 2EGGA 1H0SA 1X7YB 4R2WA 4AIRA 1XHEA 1GPYA 3FLEA 4A0RA 4D4HA 3FWPA 3KB2A 4CMGA 3USZA 1AO0A 2NP7A 3C5VA 3D3NA 5CGZA 3C7DB 4ZEVA 3HJNA 1C1DB 3MTAA 4X63A 4UHBA 1T4GA 2J30A 1Y8AA 2BFFA 2ZAOA 1K4YA 4H77A 5C51B 4RW0A 4RU1A 1YVRA 1JKJA 1R18A 2C9OA 4OLFA 4CMHA 3WYFA 2B37A 1U7OA 3JQ8A 1B74A 1ZH2A 4PCLA 2Z6AA 3RAFC 2V45A 1MRNA 1KI8A 3TOXA 4JJGA 2BF4A 2GH1A 2GKGA 4NHOA 3FXAA 1TK3A 3DOUA 2VRCD 3PUZA 1OH6A 5E7IA 4KOAA 2QUAA 1KC3A 2QRUA 4MI6A 5DOVA 4BNUA 2VYVD 3QI2A 3GDHA 4MHTA 2GA8A 4D9KA 3RVPA 1TKCA 2A9RA 1GZ5A 2H4XA 2X2FA 3IAS6 2PL1A 5K3FB 4RENA 5LFAA 2UZ3A 2QAGA 1M8KA 3L6BA 3GGJA 5EC8A 2VSYA 3KBBA 4MUJA 2PX8A 4ERNA 3QVSA 3GHHA 3GRZA 1M34E 1GZUA 2VJNA 4FWBA 2VF8A 2PEYA 5HMLA 4ZEWA 4J0DA 2X0DA 5DF1A 1Z5OA 1MENA 1ZIOA 3I34X 3RVMA 2ZXUA 1B0PA 1PYGA 1WMFA 3LYAA 4UKDA 2F00A 3TSWA 5EJAA 2W6JA 2I1WA 2NPOA 6REQB 1I1HA 1N2SA 2GAJA 2WEKA 3GK3A 4CCWA 4ZCTA 1CIPA 2YXPX 3ZLBA 2CLMB 2GEBA 1Y4ZA 2XVAA 1YA6A 2I5PO 2J3JA 3PLNA 2P77A 3CX4A 1BWRA 4I5DA 4MAAA 1YACA 1A77A 1EQUA 1RJWA 4HCJA 1YJXA 2P9QA 1ZH8A 2H9AA 4TKMA 2J3KA 2MMCA 6ABPA 4CE6A 4RL4A 5H3HA 4O2AF 1EQAA 2ZTMA 2JGFA 4Y6SA 3I2YX 1FQWA 1GUAA 3DBHB 2H2WA 2MINA 3C8UA 4EZIA 4P82A 1P44A 2Q5HA 2V7EA 2XD9A 3SYMA 3IPCA 2A5FA 3ESZA 3PI7A 4PN7A 5ALXA 4FFMA 1WHSB 2AGVA 3W9SA 3MRSA 821PA 3DBHA 3SMVA 4TTRA 2PU7A 1V7ZA 1JG1A 4V38A 5J63A 5KQRA 1Y3DE 4XUGB 1PSWA 4G09A 3GO4A 5LD2B 1P18A 4KQKA 2WP8J 4LXQA 2CJWB 2OEPA 1JSCA 2ZVDA 3A2NA 3NHSA 4G0PA 2IXGA 5BQOA 3GQBA 3EXG1 1RQPA 5KINB 5L3SA 1RWWA 1Z7WA 1X1RA 2CHFA 3ITNA 1L5RA 2AI1A 2D06A 5A3JA 4IO1A 3L8ZA 5TF0A 4F97A 1H9BA 2NYRA 2R25B 4FDLA 4U4AA 5F2OA 3PITA 5ALVA 3MPOA 1EJ6A 3C6QA 1LW7A 1N2XA 2H51A 2YWGA 3F9IA 4GSYA 1W1WA 3T4EA 4MMYB 2I3AA 2XUAA 4YQZA 2UXBB 1VL0A 3OU6A 1X7WA 1LH0A 5HE9A 1GL3A 2VBFA 1N0HA 1SUDA 4BMOB 1OGJA 2ID4A 2GXAA 4YCNA 2HMUA 2Z95A 3DT8A 3LX4A 2HJWA 3ICVA 4W82A 1W4AA 2UUCB 1QZ3A 4BLQA 1OVMA 4FLEA 1EE2A 1MIHA 2FW9A 1USVA 2X3FA 3GEDA 1Z83A 1IN5A 2VP4A 2O3RA 1FPMA 3EQ8A 4IQ0A 3RVJA 2RKOA 3TIFA 4JLUA 2XE8A 2F90A 5JI2E 1C0KA 9ABPA 5EHGA 4W5WA 4D9EA 4KO4S 2WWIA 3O1LA 1JT9A 1WY5A 1E7MA 4RK6A 1R8XA 4YMSA 3TTVA 1NRIA 1E6LA 4N3CA 3TKYA 2R65A 4KRGA 5LQJA 1YU6A 3SC6A 3IBCA 2WOJA 4F6RA 4ECEA 2FR8C 2ID8A 3RREA 4RULA 3H2IA 1FZQA 1IATA 1LPPA 1NMEA 1Q12A 2QPOA 3EAFA 4ZI5A 4KXLA 3SJUA 5IULC 1V1MB 4CQMA 2OV2A 1FFWA 5T3UA 5CLIA 1X0VA 4B8ZA 3WGQA 2JFYA 3A7EA 4IHQA 3OX3A 4AROA 1OIVA 5EZYF 4BOYA 1ZINA 3OE4A 3U16A 4CQNA 3CVJA 2Q8QA 3ILYA 2IHBA 3PCXA 5CPBA 4RH1A 2EU8A 1ESMA 2DBYA 4BNZA 3DCIA 1F8XA 3TBKA 4KRYA 4B82A 3AU8A 3R1IA 4QGGA 1FSSA 1GCGA 4M8SA 4OKNA 2PKEA 1AC5A 3TYXA 3WJ1A 2XKJE 3HU5A 4LOKA 4H08A 2IHZA 1ZD4A 1ONPA 3EVTA 4J7AA 4MQBA 1GZDA 2H18A 4NIMA 5LZ8A 3AKDA 1TKRA 4I3GA 4R8KA 2AG6A 4KV9A 4EGCB 2X8AA 3JYOA 2ODPA 2HLDA 3NWOA 5A3SA 4UJ3A 1MVLA 3SR4A 3D6JA 1K6XA 1ADFA 3ZD8A 3ZLUA 2KI5A 5KNBD 1MNAA 3KQOA 5KMGB 4M22A 4DR1B 3D6FA 1PJSA 2CYCA 2GOYA 5FOSA 1TM3E 4CIYA 2I2BA 5SZHB 3A36A 4DRXA 3GLIA 3RK0A 4DMCA 4E0BA 2E4ZA 4E46A 4EHAA 2Q8NA 2JH9A 4ZQGA 4UVGA 1MO4A 2JLWA 1N6IA 2H07A 1XAIA 4UPVA 1PJ8A 2G8LA 1C3LA 4WBXC 4MUNA 1TC2A 1W5SA 2X58A 2XMBA 5D2CA 5T4BA 3W5CA 3ZGOA 4JJ7A 2EWWA 1E2LA 2WHYA 2BFOA 4KMOA 4LHSA 5AJXA 3GJXC 3GXBA 2QYSA 3O2JA 4CCAA 3BMOB 4X1YB 1L5MA 1J20A 2XB9A 1C3OB 1P7CA 1KI6A 4KUGA 3UW3A 2YWEA 5I6DA 1T13A 3B70A 4LISA 4Q3NA 3JAKB 1KWKA 4HNAB 4F72A 5LIPA 4KQXA 2CXTA 1SU4A 3NJRA 1KMIY 1RWQA 1V8DA 1R0SA 1SKYB 2J5BA 2W2KA 1WMBA 2GLXA 4AS1A 2ZJ2A 3EGEA 3P0JA 1WKCA 5KCZA 3WQSB 5JNUA 1NVUQ 4DHWA 2G71A 2ASEA 4ZARA 1A96A 1H23A 4B40A 4KQMA 3LCJA 4ML3A 4JIMA 4MLPA 4O5AA 3SLGA 1GUBA 3UMRA 5BORA 1D1SA 5DNCA 3TR6A 1NBMA 1C3XA 4YP5A 4ZQIA 5YASA 1UBEA 1V35A 3SZMA 3K0HA 2JFBA 5TQJA 3T0FA 2W2LA 3B3QA 3C8HA 4LQDA 5CDHA 2QQFA 3SKVA 4QGBA 5B6PA 4B4KA 2ZBFA 4IMPA 3ZU4A 4LWQA 1YQWA 3KR1A 4M4SA 3RLFA 4JL5A 5LNK1 2AFHA 4F1JA 4OP2A 1JEAA 2O2HA 2VEOA 3WGGA 4LMRA 1N2EA 4AXXA 1Z6YA 3CT6A 4YP9A 5JR3A 3A9RA 1KORA 3BIWA 1XTSA 2G06A 2XQVA 4IY1A 4XX0B 2R8RA 4YMTA 3L2OB 1VRVA 5LMUB 1LV7A 4YCLA 3S1LA 3FKSD 2WV7A 1CUCA 4KR3A 3I2HA 1XL0A 4HQ6A 4C0QC 2AEJA 5CVJA 4L8GA 3DKVA 2OCXA 1YZVA 1GNLA 1NI4B 1AD2A 5ALZA 1L5GB 3V8MA 3T52A 2BKEA 2PKRA 1Z4JA 4Y2HA 1LQUA 1M2VA 1GQSA 2VATA 3T1TA 2EBUA 2PSJA 4LRWA 5C9ZA 1VKNA 4RVUA 3ULKA 1DUVG 1KVTA 1TYZA 2KM1A 3DHEA 4EB8A 5KTMA 3EVDA 4B35A 1JKMA 3RFTA 3HCOA 3I64A 4GI2A 2QLJA 1NMQA 1RR6A 1B16A 3FHLA 4XM0A 3SYNA 5CEFA 1NE7A 3D0RA 1IQ0A 1K75A 3JSAA 4HLUA 5E7QA 4HYYA 4MA0A 3V4RA 4KH0A 2J0UB 5F2KA 4LXYA 1NYLA 5TMBA 3M7IA 5BXQC 3FMGA 1SM4A 2PUHA 4D3YA 5C4MA 1R5JA 4RDHA 1ISRA 3SC2A 1ZOPA 5FAXA 4R1UA 3K70C 1P9LA 2F8MA 1SWWA 3KJFA 1NG9A 2R7LA 2ISCA 3ZUGA 3L0PA 2ZSDA 2JGKA 1OI2A 4FOSA 4XOUA 1VPEA 1KFBB 2AR0A 2GDJA 3IDZA 4EI2A 3B89A 1TI7A 3EDOA 1FFEA 3IP8A 3QX7A 3X2FA 5GJCA 3M4ZA 5NLLA 4COOA 1UPXA 1TPYA 2OGZA 4HDAA 4FW8A 5CA1B 2YV2A 4KXYA 1Y33E 1QSGA 4YTEA 1I94B 3UHPA 3N2KB 2J9RA 4RYLA 1ZRNA 4FMBB 4HNUA 1J4AA 4ZQFA 2P4QA 3KT0A 4GECA 1EVIA 3TAHA 3K0CC 3N2KA 2OV3A 2XH8A 3OTQA 5A9TA 2J85A 2OXRA 3L18A 3JQGA 1VE9A 3E2IA 2QD3A 4KWTA 3WLPA 5KOHB 2OHGA 3L41A 3EC1A 4MLDA 3LHIA 4YN3A 5KNDA 1LLQA 2WVGA 5EEGA 4C4OA 4B4DA 4UASA 1RI1A 1RKXA 3T7EA 4OAQA 5EYPB 3AOEA 2XUHA 3IT1A 3WGIA 5KZMB 2W4QA 1U28C 5SICE 5G41A 2FE4A 3BWCA 4U6QA 1QHSA 2QK4A 4AB1A 1KOFA 5JMWA 1JU3A 1WNTA 2C4UA 2VHTA 1T0UA 1ZI9A 3AXSA 1DKMA 4OHKA 4EO4A 3HV0A 4HWTA 5THQA 4Q9NA 4G1UC 4XIJA 3TPCA 3OESA 3BK7A 4NEGA 3O9ZA 2HL6A 3CR8A 3OLCX 1MQ9A 4HFJA 1B42A 1ZGCA 5AJHA 1TU0A 1D9ZA 2WWXA 5L40A 2HADA 2C1XA 4YRTA 4JB8A 4JD5A 2JVJA 2ZR8A 4Q05A 2O5RA 2CL5A 2GK3A 4I5FA 1G5RA 4RVCA 2D3TA 1NZFA 1R12A 4DEYA 2WMOB 1V3QE 2ZJ0A 4NCIA 3SX0A 4ZTBA 5KNCA 5C4GB 3IAAA 3EW9A 1NR7A 1MABB 4YCDA 1M6WA 3E9DA 4DCMA 3ZDRA 3RVLA 2E4WA 5ALOA 4W7SA 5I3CA 5FFMA 2OSBA 2YWHA 4P3NA 3VU1A 3T3OA 4LOHA 4D81A 2QXUA 1SA0A 2B0CA 2Z83A 1N9ZA 3ANNA 1JH9A 4LC0A 1YDFA 1IG3A 1A9XA 2FOLA 2KE5A 2QTNA 1WV1A 1ZN7A 1Y3AA 4YBZA 2C42A 2PFGA 1FEZA 2XA9A 3CRZA 5IS2A 2RGUA 4OYYA 4MGEA 2CY0A 1A9YA 2QVXX 5DCYA 2PE5A 1EZZA 2D74A 4GHWA 5E6RA 2XYHA 2PH5A 2JDIA 3FWKA 1ZJWA 4Q4JB 4FYJA 4GNKA 1D5WA 1APBA 1L7RA 1XXHE 3WAKA 3TQCA 2GM5A 4Y1GA 1JIJA 1KAHA 3I39X 1W6RA 2VZ9A 3PVSA 2GVDC 5E4JA 3SSMA 3IHKA 3KSZO 3GH3A 1PVOA 4KPYA 5B6IA 5CITA 1VRWA 4V03A 2FW0A 4IZOA 2JC3A 2HRBA 4XH9B 1FTWA 1D2EA 5A1JA 2R5FA 4OJQA 4R40A 5C32A 5EZQA 1U9JA 1CS0A 1GRRA 1V71A 4R2IA 5JCOA 1NW9B 2JKVA 3U1BA 1WXIA 3QI7A 4PICA 1P1JA 2P6MA 3KKQA 4TMFA 5A6VA 1HYGA 1JI0A 5AOBA 2R3SA 3KHTA 4PHFA 5GMOA 1WOMA 4BVFA 1HE1C 2NNWB 2NZ2A 3IEKA 3JCZA 5DNUA 4P0PB 2NSDA 4YXWD 4NR0A 2XYQA 5CFOA 4PYRA 4FDUA 3Q5DA 1X1DA 1SHZA 1UBOS 1ZCAA 3TTUA 1PVVA 1ZQ1A 2XZPA 3OA2A 5JYBA 1ZNYA 1JQ3A 5DXJA 2WM3A 4KDEA 1UXGA 3EOBI 3TLGA 1T91A 2X6RA 3LBFA 4KPUB 5CVVA 2J7PD 3AW9A 3BIXA 2H0AA 3MAAC 3GZJA 4ARBA 3HM9A 2VJKA 2AT1A 4WNCA 3X1KA 4GOOD 3FW1A 3GEBA 3C3XA 2O3TA 3D3EA 1CQPA 1LDBA 3NWBA 3P2MA 1REQB 4DEVA 3DEAA 1C4OA 2QMUA 4WEQA 3W9UA 1VSBA 5LVAA 4HDOB 3CXUA 2IKQA 4W5JA 2JIRA 4L78A 3IQHX 3NIDB 1PR9A 3WIDA 2AKAB 2VHYA 2RAUA 1QVAA 2B3DA 2XNCA 4X95A 2GJAA 3LO8A 1PUXA 2QTTA 3H87A 3OEWA 3PGLA 2MSCB 2NZYA 1YRLA 4Q7KA 3RYIB 2W2QA 3NT2A 2P4SA 4M0EA 5BVGA 1H42A 3DULA 4OK3A 5FPYA 5JMPA 3GA0A 1AQUA 3JRNA 2OCKA 2HHLA 1HE2A 3RTCA 5HM6A 2DUMA 1NT2A 1TM5E 3OF2A 1CDZA 1P6UA 3FYUA 1H5QA 2A30A 2XE4A 3C48A 4QL3A 3VOBA 1WMSA 5AFSA 2WM8A 1Y4DE 4EJ0A 1BWPA 3CWQA 3IEIA 3U4HA 4Q4HA 5K3SA 5REQB 3A6JA 3Q7EA 1T1GA 3WGTA 4EATA 3ND7A 4HPXB 1M66A 3N70A 4MQEA 4KL8S 5ICFA 1B7GO 2FHPA 3PKZA 3TRFA 3ZE1B 1A50B 4PNZA 4AKSA 2V3CC 3BMOA 1KZYC 1LV8A 3W6UA 1FXWF 3C3EA 1B8PA 2Q0HA 3W3AD 1ZH0A 1Y1LA 2R8OA 4FYKA 4KYUA 3OLQA 4HGPA 5FXMA 3VAZA 3WBFA 2BM8A 1IYZA 5KQPA 1U9YA 5I9SA 3BD8A 4K8OA 2JI4A 4NJOA 3SSNA 3FROA 4S2UA 4B6FA 1AXGA 3OHPA 3TQOA 2I6SA 3WL6A 2PWBA 1C7JA 1U8CB 3GPDG 4G5OA 3SHVA 4CL3A 4W5QA 5F98A 3NCHA 2IF0A 4MPTA 1DEOA 2EWMA 3IODA 4Y1FA 3RRFA 1MW8X 2GWRA 3QRWA 3O95A 1E2PA 5ADWA 4XVCA 1Q1QA 1YDGA 3LHDA 4MOWA 4HAWA 3I28A 3PEEA 4I1RA 2XF8A 4OHFA 1A9ZA 2WHXA 3ZHYA 3OT4A 1PIWA 1SY7A 3UV3A 3TRHA 3PUKA 4MAMA 2ZBQA 5ED4A 4BTEA 3C41J 4QM7A 2QTAA 4TS9A 4C87A 3GUUA 3FMFA 1GDHA 2V7UA 3PS9A 1EKXA 2O2XA 4YRRA 1MORA 2GZRA 5B53A 4RTSA 1CUIA 2C96A 4C88A 1KJNA 2WSBA 1DU4A 1T6YA 1XCPA 2XE6A 4Y98A 4Z5XA 2X77A 4ZT6A 3D8HA 2Y1CA 3L8GA 4MR7A 3D6TB 4XTCS 3BHIA 4UAJA 5M04A 4TXLA 5HQ3A 2GLTA 1R4ZA 4O2BF 5CDGA 3ZWKA 1YL7A 3R7FA 1VA4A 4K3VA 2ZE6A 4JQZA 2ODWA 3OFVA 2GD6A 1BROA 3WYDA 3PX7A 2V96A 4EY7A 1TYAE 2QHXA 4WNYA 1M76A 2IS4A 5ALHA 2X76A 4Y9TA 3T1QA 3UB3A 4E09A 4QXRA 2NTVA 3TLBA 2AJLI 2C3UA 2RI6A 3FJYA 3O4FA 5JS6A 5TQ2A 3IIMA 4QAJA 4EA8A 1LDYA 5K2MA 1RWXA 1QPBA 3F6BX 2SHKA 3DEIA 1MTZA 3WWOA 3E6AA 1UZAA 4N7JA 5JATA 4AYWA 2FSIA 1GNSA 2J5QA 1R66A 2QR3A 2QKYA 3C3YA 2AZ4A 2VSOA 3CZ4A 3H3FA 3N8KA 4I6JA 4RV5A 5F51A 5AVWA 5HJ7A 1W75A 3H5TA 5JTTA 5IDXA 1FFDA 4NX2A 1QO0D 3P71T 5K3DA 1XMIA 4FM9A 5EG5A 1G5QA 3VH2A 3QVOA 3FVRA 4ZPXA 2YMLA 2X19A 3R41A 3FDZA 5FRDA 2AUMA 3ADCA 3GRFA 4IDOA 4KV7A 4R81A 5ALIA 5CFZA 1WBDA 3GLFB 4UNIA 2GN1A 3RBZA 4UEQA 3VTAA 4CRWB 2ZJFA 4JQOA 3GN2A 2JPDA 5ENDA 4L3VA 1VRCA 4GDMA 2AQHA 2CVOA 4N6GA 3RBXA 3IS3A 4A15A 4YRJA 2MSKA 3L92A 3NO4A 2KSQA 4JODA 1AB6A 1LVGA 3A4LA 1KARA 2JGMA 1TJ4A 2FTKE 2GM9A 3RROA 5EWMA 6GPBA 1C2YA 3H0CA 5E9WA 3IQXA 1U5CA 4PS0A 4NFYA 2BMAA 2IXFA 3FIUA 1KK1A 4GI1A 3X44A 1U8UA 3E7XA 2CFSA 4FBLA 2IEAA 4LGMA 5DI9A 5AXBA 3GG2A 3O5AA 2JD2A 4U63A 1T5LA 5HJEA 3IMFA 1L2TA 4OXIA 1IIBA 1FXSA 1PK8A 3G85A 5DBGA 1LJLA 2C9BA 1VP9A 3ZK7A 5B4UA 1AGNA 1XZLA 3OWOA 3PD0A 4D96A 2Q9BA 3O7MA 4H4DA 4Y2RA 3PFIA 4IHAA 2PZAA 4QNNA 4LRUA 1PHPA 3WK9A 3IL2A 3U60B 1W73A 2ZUDA 2OZVA 3HCRA 3OPYI 1JI3A 4ATNA 1MA3A 1KDPA 2NO5A 3A11A 2V8BA 1F3LA 3FFBA 4R1LA 4UTPA 3CWCA 1WULS 1UBHS 4GMXA 4YUZA 4MPJA 3WGYA 1F2UB 4MB0A 1WCWA 4RK1A 4E31A 3QE0A 1JDJA 4Z9FA 5ESDA 3VXKA 1SKQA 1SELA 1OXXK 2WJPA 1U6KA 3G8BA 3ENWA 2Y1KA 3K6KA 1FYFA 3PC8C 3K1YA 3DE0X 4K9LA 3CM0A 3ZY3A 1M72A 1YRHA 5CA0A 2FPPB 1YRAA 4FC7A 1VI2A 1ELOA 5JXWA 3FNBA 3Q85A 4EABA 5HBGA 1L6RA 2DQSA 2EZ4A 2XNKA 3T9AA 4FDVA 5L8VA 1JFFA 3EVEA 2ZDHA 3NMUF 4DUPA 5FOUA 1EA5A 9ATCA 1Y4AE 3JATB 3WDMA 3N6VA 1N77A 2ONKA 3CPJB 3A3NA 3QXSA 1KRWA 1XX6A 1NW6A 1P2GA 1WKVA 2QT9A 3KYCB 3OHSX 4KQ9A 1F14A 3FA2A 3KHSA 4M0MA 5IHPA 1KO7A 2WTNA 1URPA 3GBPA 4F46A 3GGDA 1G0OA 4IGEA 1EUQA 1LX6A 1IB6A 1XTIA 2WM2A 2J5KA 3B8EA 3CRRA 3KKKA 4U2BA 3RFFA 3TZKA 4AKIA 4EG8A 2W2TA 1P9OA 1PYDA 4FBGA 5C2JB 2C5LA 3NBXX 2AJBA 1NDHA 2ZIAA 4EH1A 2P9ZA 1P2TA 5C1DA 5CDSA 1TMOA 4C1BA 3NNNA 4BWFB 2XZOA 3NVAA 3KQVA 4UHCA 5CXUA 3DEHA 3BOSA 2PKYX 4H9GA 4IW3B 4O2AA 1U0OC 1VHTA 1N9KA 4MJ7A 4E5VA 3PHJA 4QYIA 5K5EA 2R8ZA 3GARA 4ZK2A 3UK1A 4TLBA 1G8MA 4I9UA 2OV1A 2D8AA 4WASA 2XMPA 3CUWA 4KCGA 1J7KA 2NSHA 2ZI7A 5DW3A 1C1XB 4F11A 1NM5C 2DB3A 1RWPA 3PC2A 1VJ1A 1UMBA 1G18A 3IPXA 3LY8A 1TD9A 2AYZA 4EI9A 4EUKA 4WY5A 5BRAA 3A6KA 3H9JA 4EITA 3F5QA 4EYQA 1TCVA 4M6WA 3GVPA 2P3OA 2TYSB 4HRVA 3G68A 3TI9A 4RD4A 1VLQA 2AQ8A 4F9EA 5BUZA 4DCCA 1U2GA 3BQ9A 4AJ4A 5AM3A 2CJFA 3O8DA 3KXLA 4DIUA 3T9EA 3DGFC 4EVRA 5AVKA 2X9VA 1IHPA 1ZNXA 3I4CA 2A1IA 1OA0A 2FWIA 4N48A 1JLLB 1DXYA 4YWJA 1YS4A 3AFOA 1H0HA 1JV2B 1RPNA 2ATVA 3PT5A 5G53C 3TW0A 1ZJJA 2PANA 2RHHA 1RPAA 3DCJA 3PNKA 1GIAA 3ESXA 2SCUA 3P5SA 5I48A 2QJWA 2CSXA 5IBCA 3C4JA 2Y1FA 1SRQA 2AMVA 1GG5A 3UXEA 5E6UB 1F12A 1RQLA 2XOKA 1DELA 4REQB 4R01A 1Y82A 2HU2A 4HYTA 2XSZA 2ZSAA 2ZSFA 2NXNA 1Z2NX 2X2PA 3Q0TA 4BKMA 2FYTA 3DTTA 4ZOQI 3UJNA 4YK7A 2I4OA 4JSYA 2GZDA 4MICA 4F2PA 3TCNA 4FHEA 1N3IA 5U1PA 3VFDA 5F3RA 4B34A 1EJ2A 3QX3A 1EFCA 4KQIA 2QBYA 4MWEA 4UPEA 4PHHA 4J1NA 1J21A 2PSEA 3HFSA 2XWBF 3AJRA 1UBJS 2FWJA 5F5LA 5BSWA 1I7SB 2R7AA 5CX1B 3CNOA 4RHFA 3L6CA 1KP9A 4N6NA 3T7KA 2DC1A 1OI3A 4NCJA 1ODJA 2NQ8A 2RHWA 3T95A 2ETVA 1Z4NA 3IJPA 3B9RA 1K4KA 1R9NA 1K8QA 4F38A 4AURA 3MELA 1S4MA 2QTWB 1T6ZA 2NZUG 2REQB 3ETCA 4MV7A 4CUKA 1U3WA 1YRQA 4QXOA 3T0IA 3JPYA 1BX3A 3N0RA 1H8EA 4B6PA 2D5IA 2DQ4A 4IJKA 4C6RA 1KDOA 4K6OA 2PT6A 4BLSA 4OYHA 3T61A 4EG6A 3MHTA 3UT0A 2CLIB 5EIOA 4BFTA 2Z04A 3ZWYA 1E5QA 2C1ZA 1RIIA 3HWSA 1POWA 4QEZA 1S7GA 2UVPB 3OCYA 4R7TA 2OFWA 3KOMA 3LIIA 4M1KA 3WK6A 2NZVG 3FVQA 4HWKA 2B4RO 1YDWA 1B6TA 2HJHA 4XD2A 3PT9A 2C7OA 3GJ8A 4RA6B 4PAQA 5TEVA 2N47A 1MTOA 4RWEA 4E5MA 1XMJA 3ELWA 2FPGB 3MWKA 2RBGA 3AG6A 1QK5A 4ZWNA 3DZGA 2UYHA 3FWZA 5HQ3B 4J16A 4KB5A 4FPXA 3KC2A 1N3YA 2JJYA 2ZJ8A 3FOFC 1SXIA 1ORRA 1G7TA 1O6FA 3L1HA 3MSCA 5AW8A 1EUCA 3JYHA 4CNQA 4HO1X 4TT8A 1UF9A 3ZK9A 2YBDA 3OZVA 3IDQA 1XTZA 2NO6A 3OTIA 3D8UA 4MW6A 4WZAE 5AICA 5DHPA 2E89A 3TNDA 3RG2A 5KTTA 2Z6QA 4F4JA 1XEXA 2I99A 2JAHA 3C97A 4MRRA 4KSBA 1VOTA 3MFYA 1K92A 4QDTA 4CCYB 3R4VA 1F6WA 4HUJA 2X4GA 2ZRJA 5HCNA 3IQEA 4KC0A 3RC7A 3VSCA 3W04A 4TUYB 5KHAA 3UJ7A 4KDCA 3SOZA 5JFOA 4PWZA 1EDDA 1PR3A 4XJVA 3A1NA 5CYPA 1NI5A 3U4IA 1M2HA 5BW4A 4RVNA 4EUFA 2J9FA 4WKCA 2W8ZA 1EVJA 3MTGA 4OHMA 4NMXB 3EVFA 1YZYA 2XCQA 2WKPA 3KQYA 3I62A 1KYWA 4O1MA 1DLIA 3HKCB 4POAA 3SYLA 4YX9A 1M2OB 1FFHA 1E99A 1FJHA 1UKVY 1KC1A 1XZJA 2QTVA 2BEVB 4X1KB 1GNPA 2OY0A 2BHSA 3TCKA 3F5MA 2A1TS 2Q45A 1E6MA 4LFCB 3JR7A 5CG1A 3MSXA 3NH9A 1GPDG 1UJNA 2HBZA 1IM2A 4MQEB 9LDBA 1US8A 1CEQA 3LU1A 4PZUA 1V5FA 3FYDA 2HQSA 2A0FA 3BKXA 1SOAA 1OU4A 3KJQA 2PRKA 3KV3O 4PYNA 3CCCA 5D1NA 5D3QA 5BN5B 1Z26A 4S1VA 2VDKB 2XWJI 2ZU6A 1HKUA 4PG6A 1V7QA 3OJOA 5H0IA 4LI0A 4ZVUA 4XSVA 4CKWB 5D3MB 3GX1A 4UUBA 5JNSA 1W49A 1TAGA 2H9IA 4GMGA 1MEOA 4MVYA 3PZRA 4O4JB 3C6ZA 4AMVA 1EXMA 4DLNA 3E8XA 5JHGB 3PYLA 1B76A 3HKBA 1QQBA 4WBNA 1XQWA 1U7PA 2Z4RA 4U6NA 3KQUA 5DP1A 2VPYA 3GJ3A 1DWOA 1TLLA 4LUCA 5DX8A 4E1BA 2AI3A 5LQMA 2HUNA 3KSRA 3QA9A 1VIVA 4RVOA 5EP2A 3RTAA 2JLYA 4D9IA 3JAWB 2B0JA 2A59A 1SIWA 2BBOA 4OHRA 1E20A 2R8BA 2Y1GA 3MMXA 5DHQA 5TGZA 2XBUA 3RC8A 2HCRA 4M86A 3NXSA 1OX4B 4OB7A 4CG3A 4ZZIA 1XTJA 2DLDA 1U7ZA 3W5HA 3LQYA 2IS2A 4WXYB 2EP7A 4IG4A 4JBHA 4ZRNA 5BNWA 3VR5D 2FPMA 4TTVA 2QN1A 2PYZA 1TB4A 1UFOA 1RRCA 5C8YB 1QONA 4L0QA 3H16A 3QSYA 4JI4B 1G1MA 4Q1FA 4LZPA 3Q15C 2XVXA 1UWKA 2ERXA 3QKTA 3GUCA 2C8JA 4M8IA 1OH7A 4YJHA 1PAUA 4CTOA 2E4YA 3KKMA 4G2NA 4Q4CA 3B1KA 5FLXA 3F5FA 4GQIA 4Q6WA 4FWTA 3I04A 1GITA 1X2BA 5DGCA 5AOCA 4N9QA 1UJ2A 2ZT7A 2ZDQA 3INGA 2J6BA 3C87A 3DO8A 4G3XA 3HJAA 3W1EA 2UZIR 3ASVA 3UY4A 2PGXA 1E3DA 2FPPA 1NA5A 4I2NA 1U3VA 1W4RA 3CSUA 5G0TA 4BQSA 4QOGA 3TVDA 1G5FA 3GJ5A 1DSSG 1AKRA 3MUFA 2XGOA 5KQMA 3GRKA 3DDSA 4DLWA 2AN5A 2C2GA 3AB8A 2ODBA 2X86A 3ANYB 3HA3A 3BEOA 4OYLA 3FGNA 4X1IB 5TQ0A 4DIKA 1C8BA 1PZHA 2CEKA 2PXXA 1BAPA 3WXMA 4JEMA 4V0RA 2C92A 4OMCA 1J07A 1ZEMA 2OC9A 1HMPA 2EEPA 1Q74A 2DM6A 2W48A 4JMPA 4K46A 4N01A 4UDNA 1PZFA 2WHQA 2N0SA 3K16A 4PG5A 4NENA 5AQ1A 1GYPA 5JD3A 4KLNA 4JVLA 2ZJ4A 1MB3A 5T3YA 1J6UA 5GM1A 1NYRA 1D9XA 4GG1A 4CKBB 3IIJA 4MVWA 5CB6A 2WTXA 4G01B 3LP5A 3ZTWA 4C0XA 4PYMA 1VYVA 2IIVA 5JARA 4KQCA 3VDRA 3I2GA 4B8YA 1Q7EA 5EVJA 5HNKA 2R4UA 2GF2A 3RIYA 2NYUA 1SVIA 2Q6VA 4RE6A 4U2DA 4M46A 3ZYCA 2HAEA 3KZOA 4XQ0A 5E7JA 3R5SA 2F1IA 5CCDA 4BC0A 3RVQA 4EGAA 4HVLA 5JV5A 3G2JA 3OF3A 5CEJA 3E61A 2B7BA 3K8ZA 3PUYA 2OXIA 1W5FA 3WQQA 3TSCA 3HGTA 5ALSA 2QJTA 5TPWB 4NI5A 4YRMA 2ZYHA 2QLBA 4H0CA 5DRTA 3D59A 1DXHA 3IAM1 4CEJA 2A0XA 1SCIA 1PL8A 2YJZA 3NC4A 4KH1A 2CN1A 1I6WA 1EP3B 2AXEA 1E9VA 3DOEA 3WGVA 4LXXA 2X3UA 4TLMB 4KQEA 3B8HA 3E2MA 3ABSB 4D4GA 3E0XA 4FCVA 2EIHA 2B83A 1C3JA 3WKCA 4PCUA 1F8GA 1D2NA 5KJEA 5BMVB 2C7PA 3QUBA 2JAQA 4BS9A 5K7SA 1ECFA 1XVUA 2A0YA 3H2GA 3T9CA 3CN7A 4G26A 4PLFA 1NM5A 3GUVA 1TIPA 1OAOC 2P1RA 2HQBA 4US2R 5EJEA 3OKAA 2XB2A 4FC6A 2HLNA 3IKVA 4HMQA 1H8HD 1BDMA 4ND2A 3F90A 2HXGA 4NOMA 4C30A 5HQTA 5JS1A 2CSUA 4BEVA 1UJ5A 1AKWA 2OFOA 2HMAA 3HB7A 4WXEA 4CMBA 1Q2XA 1TNDA 4K87A 1OWLA 4OL0A 4Z2YA 2UXCB 1HL3A 2QVBA 3JU3A 4G4JA 4KUEA 4GL4A 4DNOA 2VTVA 2J3IA 3FDFA 4GOJA 1PZEA 4M7OA 4EF5A 4CTMA 4B3XA 5CB4A 4HB3A 2O8NA <