4XM1A

N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the presence of cadmium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
VSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
total genus 99
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm1A00
3DFMA 3DFFA 2XADA 3WE7A 1UANA 1Q74A 5B2FA 4XLZA 3DFKA 3WL4A 3WL3A 3DFIA 5B2EA 5BMOA 1Q7TA 2X9LA 4XM0A 2IXDA 5CGZA 4XM2A 4XM1A 4EWLA
chains in the Genus database with same CATH superfamily
3ORQA 2VL7A 3CLRC 5KYXB 1G18A 1FY2A 1A82A 4L07A 2FOXA 1E4YA 2QXTA 3MS2A 3K5WA 4TSKA 5DXJA 1JT2A 1P5RA 3TKLA 3JVIA 1FUKA 2VK4A 3KWJA 3N2YA 5KTPA 3TPFA 3IS3A 5LR6A 3IHLA 3E9NA 4KREA 1ZJJA 1TNDA 1YQ9A 3LU1A 5EMLA 2FPUA 2LPMA 4QGGA 1KI9A 5C4IA 1M2VA 3HCFA 3RABA 3NBKA 1XGKA 4YQEA 1O8BA 4D5GA 1XTQA 3RJ9A 1E63A 2DGDA 4O6VA 1MW8X 4D6YA 2ZFUA 2VK8A 1IOWA 5H3CA 2OHJA 1NQXA 4KC0A 5G0SA 1QVWA 4YAGA 4ABTA 3ROEA 2PT6A 1X7ZA 2JFFA 3A3PA 2L0XA 1M7BA 4EYOA 1EMDA 3GEGA 4DV2B 2H4FA 4RV9A 1NW5A 2VQ3A 3R09A 3RWOA 4D9JA 1OX6A 2FP4A 3TJZA 4KHZA 1EWRA 4PZCA 1AZSC 3MD9A 4GOXA 1KIFA 3RVRA 1QE3A 3OI7A 3WGMA 1V8OA 3D0OA 3U3DA 1CUHA 1HR0B 3LYUA 1EVJA 4M99A 2Z5VA 3AVYA 2Q2NA 2DU8A 1SGWA 3MRVA 5F1KA 1U31A 3QIAA 4TQAA 3VGJA 2C3OA 3PJFA 4C4YA 4E6EA 1Q12A 2AVNA 4I1OA 1NUTA 1P62B 4FYJA 4OGWA 5AVRA 1KZ7B 2PGOA 4UVIA 3ZY4A 2XUZA 1DQRA 4V24A 5EI5A 5H4GA 5KC8A 3LX5A 4R05A 5F78A 4BLTA 4FTWA 5I8ZA 2D6FA 1NF8A 1OY1A 4ZZ3A 2PZLA 3EQ6A 3H5OA 3CGGA 2FWNA 1DHRA 3A6HA 2G6BA 3EWNA 4O4LB 2GJ4A 3QVKA 4V02A 5K4GA 5BPFA 3BGOS 3N2GA 1ADCA 2REOA 2YINC 5DSTA 3CBQA 1BMQA 4ZHSA 3KQVA 1T2EA 3MT7A 3DLHA 3DBIA 1ZITA 4B76A 4IZ6A 5GONB 3D43A 2WWWA 3PX2A 5COQA 3NUQA 2YOGA 4RHFA 1E99A 4AU1A 4Z3OA 2P1DA 1FSFA 1RXEA 3OQNA 2WHYA 5CA0A 3T4EA 4O2AA 1LPSA 5AJWA 3CQ9A 3HFGA 3DV0B 2PANA 3HWWA 1ODFA 3OQVA 5BOSA 1IAVA 3CF6R 1HLDA 2YXDA 4UHHA 1Y1RA 1UEIA 5A4JA 3AK4A 3F49S 5G4KA 1LQ2A 4JLAA 4OIFA 1X7YB 4HDAA 5IBCA 4P7BA 5B12A 5IVHA 4BKQA 3WB0A 4J49A 5DCWA 1DAPA 3I28A 1R8XA 5GPBA 2BEVB 3WLAA 3NLLA 1E60A 3MINB 4DIOA 1V5IA 2ATVA 1OX4A 3HBJA 4QE3A 4UDOA 5H9WA 2P65A 1JV2B 4XWKA 3TW8B 2OCBA 2VT7A 3I32A 1XA0A 3M5DA 4DOMA 4UEQA 1C80A 3F4LA 1XWWA 3SLGA 4CFSA 2QZPA 4FS8A 4HO1X 3JV7A 3SPXA 3EPPA 1PTKA 1Q2XA 2YOHA 4V2IA 3RC7A 3DCIA 2UVPB 3WLRA 2C8KA 1X1SA 4BNIA 2YY7A 1NBMA 3O1HB 4BGIA 2NT3A 1KZGB 1TYCA 2PUVA 3C6MA 4G5HA 1E89A 1E0DA 1RQRA 5HP4A 2QVLA 5IK2A 3JVEA 4PY2A 1TMGE 1I94B 5ADUS 3QQPA 1QV9A 4HZUB 1Z37A 4NZYA 4D3YA 5EIXA 1BCRB 1P0MA 2XE8A 1E64A 3G2HA 3LQRA 3S2EA 3ZN2A 2GR9A 4CIWA 3SKVA 2G4VA 4L8FA 4OH1A 1CF2O 3KOMA 4XASA 4UULA 1RC1A 3EGEA 4N8EA 2R6GA 2EV9A 2RG1A 1EVYA 4P7JA 1MIOA 2VNIA 3AJEA 4Y8VA 1UQUA 5TPZD 2WZBA 3GXBA 3W06A 3AIOA 5CYOA 3OZEA 3RT1A 1NIJA 3L07A 4M1OA 5DMXA 4LDAA 5DNYB 1O2DA 1OSNA 5F1YA 1H22A 5K3CA 2HJ9A 3CGWA 4MB6A 2EGGA 4U2CA 3VSBA 5KJCA 2XOKA 1E2HA 1EP2B 3AUJB 5FUBA 3FG9A 4IDHA 3V33A 3M1AA 1MJ5A 1M9NA 1PBNA 2ZQZA 1RU3A 4X45A 3TUJC 1OW3B 4XOUA 1J21A 3GARA 4CJXA 1PQPA 3JQFA 5EHQA 2Y8EA 3FTPA 4CUKA 1A8QA 3MMZA 1NR5A 3IR5A 5F12A 5G3ZA 3TQIA 8ADHA 1U3GA 1X8LA 2AOUB 2Z2IA 3FYUB 3HE3A 4FZRA 4K9QA 4PZLA 3LCJA 3PLAE 1DADA 4QTYA 3LBFA 3QVSA 2F62A 5BP7A 2KLBA 4MP6A 1CD5A 2VS1A 2FWIA 4ZEOA 5D5HA 1JHPA 3Q7PA 4L4UA 1CJBA 3UMRA 3F0TA 4L0CA 3SFTA 1X7HA 1E3JA 4HV4A 1VLMA 2J6CA 3G5AA 5C34B 3QLVC 3RFXA 4FLMA 3IILA 2XWQA 3BJZA 4R2WA 5BURA 1ZHHA 4HKTA 3K6RA 2DWUA 1L5ZA 5F5XA 5K8IA 2LIVA 1JBKA 1RXYA 3E5HA 2TMKA 3VZBA 2G88A 1E98A 3HVKA 3ORHA 3DMPA 2WIAA 4QNNA 4ERXA 3ONWA 5C4MA 4I36A 4IIFA 5FCDA 1D6MA 5KSPA 4XIGS 1PG0A 1NKVA 5M5BA 4US2R 4Z7NB 2PS0A 1V3VA 3CTPA 4UPDA 4K26A 5BSHA 1YD7A 5TF4A 3GLIE 1M1XB 3G0BA 1QTNA 2E1RA 4XIYA 4Y9DA 3VR6H 2J59A 1D4AA 3FNHA 1J0DA 1IM5A 2A1UA 2DQSA 4B84A 1UT6A 1U7DA 3ZCQA 2EG9A 5BR7A 1Y80A 4N5IX 5JO0A 3V42A 4F93B 2P4HX 3FR7A 2GEVA 2HK8A 3G85A 5CJPA 4F6RB 3PT9A 2QV0A 4IDDA 1I9GA 4HRXA 1N0VC 4NTZA 5FL3A 3N6VA 3K71B 1GRCA 1N25A 2FPRA 3ND8A 1RRPA 2QPTA 1TZBA 4E5NA 5BMVF 1W29A 1ZOOA 4HMPA 3OOSA 5C0OE 4QAQA 1F14A 4ZJPA 1NDUA 2GO7A 4F6CA 4F3CA 3JZFA 4R7GA 1KMHA 3EEYA 4FKMA 3ZHTA 1W4RA 4NFSA 4AO6A 2I6UA 4G23A 1V6AA 3OCZA 2R0QC 3GCDA 4ROSA 1LC3A 5AJZA 3STUA 3AM5A 4P93A 4N47A 2BGTA 2IHJA 2B7CA 1R5BA 3GJ3A 3TL6A 2AOTA 2W4IA 1SUWA 2C2YA 5K8VA 3NDJA 4JI0B 1LC0A 2HZBA 4EG3A 3FKSA 2QX9A 1RVDA 4LVUA 3GFBA 3KUCA 4H17A 4M6WA 1OH7A 4NEGA 1WHSA 2ADMA 1SA0A 5E3HA 4EKEA 1M34E 5CH8A 4OKIA 2QT9A 3W9UA 3FCYA 1K3FA 2DBVO 1LW7A 5AJHA 4P3NA 3FPEA 2ZUCA 5GOZA 1GNTA 2FPIB 3P94A 1ECBA 4CMBA 3GLFB 4LTNA 1WPQA 4WY2A 4GZLA 1A7AA 4FHCA 3V3TA 4AS2A 3LBIA 1J8DA 3VR1A 5AVQA 3H04A 3H75A 4DSTA 1K6JA 4JYZA 3DNFA 1HYBA 1KVRA 4MVJG 2ZUVA 3AGQA 3NXKA 1GUFA 2LV8A 3JYHA 3TTYA 2QUBA 5LXTB 2EYQA 2FSFA 1D2AA 2OHXA 3M3PA 1IXSB 4M36A 2JGAA 1OILA 3Q9UA 4U9IS 2MYUA 2PFKA 3R76A 1Z75A 5EP3A 2X1LA 4RLHA 5FH9A 1V11B 1VIVA 1U0OC 5EIEA 2DFVA 1H6BA 4BMPB 1TTPB 4NESA 1W94A 4GH5A 4WCDA 1GSOA 1ESEA 5FNVF 2BEUB 5AJYA 1G8YA 1F9AA 2EIXA 2VJDA 2J3JA 4ED9A 1DAKA 2A67A 5LQDA 1W46A 2Y9MB 4DEYA 4CGYA 1L5HB 3EIQA 1Q0UA 3E7XA 4EMUA 1UBOS 3UUGA 5A3QA 3WIBA 1A5SB 4FQ7A 3ZZTA 2VR1A 1E6UA 2UZ3A 4FN5A 5EIOA 3MTIA 1UXHA 2QGFA 3AOEA 1HFEL 3JQ7B 4OO3A 1E3WA 2C7BA 3HCRA 2J87A 4LYEA 1DU4A 4HLQB 3RTEA 2GPTA 3E27A 1V1RB 2JAOA 2M32A 4PYJA 4UATA 1CRWG 1HLFA 1GCUA 3ZV4A 1D5WA 4XM1A 1FYVA 4B3HA 3A1TA 4I19A 5CA0F 2O3UA 4O2AF 4UMFA 4LY0A 2DSNA 5JCXA 3CVUA 3ICEA 4LI3X 2XBLA 3LYAA 5AXAA 1OXTA 4X6YA 2JG3A 2JEZA 4ALLA 5EA2A 5GV7A 4MS1A 3KYDA 4Q1DA 3PD0A 4PZ0A 2IEDA 4ZWNA 1CE8A 3F71A 4HXGA 4MVJI 1LLQA 3PPIA 3G1TA 2BKAA 4JLKA 3WFIA 4BEBA 3AFMA 5K0EA 2RH9B 4TVSA 4J8PA 2RB5A 2Q9AA 1RLJA 4RZHA 4UNPA 2PNJA 2WICA 2YMPA 3C6QA 1DG1G 2H5IA 1NYLA 4U6SA 2OKCA 3DDOA 2ZQ5A 1N7HA 1CUSA 2AMLA 2IK8A 1QR6A 4CKBB 3Q12A 3BDAA 2A35A 4YJKA 5IYZF 4P86A 1QIIA 2XMRA 3PF9A 2CLSA 1LSSA 5KOHB 3L49A 4P36A 1SUEA 4MRAA 4XI9A 1JQEA 1I32A 2EBUA 5LP6A 2REQA 1LDEA 3HRKA 1NG1A 2BR4A 3T7TA 3SBDA 3DLCA 3V4SA 3U60B 4ZC8A 4OJNA 1GPAA 4N8SA 5IBQA 2Y4NA 3U7EB 4EHBA 3CNLA 3NH9A 3LA8A 1N5JA 1SCAA 4TWIA 5JC8A 3RTCA 4ZYYA 2V1UA 3DQQA 1IM2A 1IQPA 2Q2VA 3MJTA 4IG9A 4WKGA 4FVTA 3S8EA 1ONOA 3MZ0A 4ASUA 4ITUA 2ATCA 2HNAA 1HT3A 1SXJD 3M1LA 1QZUA 5BN4A 3IKVA 2W2TA 3ZXXA 1PWZA 2RHMA 2XIJA 1A5AB 3CX7A 2WK1A 3FBGA 1DC6A 1IB0A 5H8WA 4JLBA 1DINA 1Y8RB 2QL5A 3ZJVA 4AZ3B 1Q3TA 4B3SB 2CGEA 4GWKA 4XUDA 1EM8A 2QVGA 1YB5A 5CFLA 1I0LA 3TW0A 4HAOA 3T52A 5ES3A 3AKYA 1MAAA 3TXXA 2JJ8A 3DHEA 1TFRA 1NMYA 1ODIA 2IOYA 2R4TA 5EP4A 1YDGA 2P40A 1Y0BA 1Z38A 1Z5PA 2YQ4A 4I4IA 1V8BA 1HKHA 1R1DA 1W96A 3KB2A 1GNRA 4D9CA 2JHGA 4FU0A 3RU2A 1EP9A 2B92A 1LPNA 4H9GA 4OJYA 3CRVA 1YB4A 4L8GA 5EHXA 2MU1A 4OHFA 1VJ5A 5DRYA 3OQPA 4JYBA 1QHFA 1IIRA 3KOZA 2A9RA 2HM7A 2E55A 2V4MA 1E1NA 3MTAA 4KHPB 2BELA 2QX7A 1G8GA 3LLMA 3COPA 3EQ8A 2NO6A 1CHDA 1NM5A 1RJFA 1XFAA 5DULA 4ACAA 4AS3A 4JJ6A 5KPDA 2XADA 1TZCA 3GFSA 4MWBA 4ARIA 2H4YA 1UXGA 1YUBA 3GVCA 4MLPA 1D2MA 1ODTC 3HKDA 5K3FA 5SY4A 1EFRA 4X7PA 4A1FA 4JFRA 4M1ZA 2FN4A 2Z04A 3WJ1A 5JVDF 4BNGA 4MROA 5AR1A 1MB9A 1SUDA 3KV1A 3Q88A 3T8YA 3PHBE 2HLPA 5K0FA 3RIMA 3ZI7A 4C3VA 4IUCS 1JH9A 1TJ4A 1TUBA 4TM7A 3WJ2A 4OD0A 1RPJA 3GJQA 2ZIXA 2QIPA 3PQ8A 2PT5A 4DTIA 2VHWA 1ZRHA 3HUDA 4ZT6A 4KX5A 2I67A 1MX1A 4L4XA 3B60A 2Z6QA 4YJDA 1XZNA 2HJVA 2QPLA 2JFPA 2WD7A 3MM4A 1U8TA 4MP3A 1I6KA 1HQDA 3QOFA 1FNCA 5REQB 1AO0A 1GG9A 5IEBA 1GGHA 1Q0LA 2X6TA 3WG9A 4NU8X 1E2PA 9LDTA 1C4KA 3EVNA 3KB8A 3EFOA 3RARA 2FX3A 4AYXA 6CHYA 4R69A 2IXEA 4JZKA 4TUYB 2F8LA 3DMHA 2M1ZA 4GAEA 1EZ4A 3LS2A 1R5JA 2O2JA 2WTMA 3B3JA 1F20A 4NNJA 5E1MA 4B4WA 1QK3A 4BQQA 1RCTE 1WD5A 4UTRA 4KQHA 2C4VA 3EDQA 1NPDA 1YZFA 2VJMB 5T6MA 1YR1A 2VDVE 3AEZA 3QVWA 3VVBA 1VL0A 4BKMA 3L1JA 3IEIA 3UN1A 1EFAA 3ANNA 2IUUA 5LYJA 3SFZA 4CDMA 4EHAA 4ESVA 4K46A 5CVTA 4DF3A 3TZKA 4ENPA 3EXHB 4B82A 3LPDA 3EODA 4IXTA 2VP9A 1H8HA 1VE3A 2QL7A 2ZYWX 2H7VA 1G9TA 3H11B 4NPCA 3DHWC 4KWHA 3UTDA 4YRJA 1OGIA 4DMCA 2GTHA 5AKKA 2O6HA 1JIJA 5G1PA 3VUFA 2AC4A 2VWQA 4BBZA 3WIEA 3D3NA 4DJ5X 1Q7BA 2DQ4A 1ZWKA 2VRNA 2WIFA 3L0SA 4ZIRA 4LSGA 1XU4A 1EB8A 2Q3FA 1HZJA 1W76A 3FUWA 2WT9A 4JL8A 4RMGA 4BLQA 5IG2A 3QA3E 4XJXA 4AURA 1EIWA 4P4LA 1I4TD 1G291 1OYVA 2G04A 1XRNA 1QZTA 5FA5A 1EX9A 2X3YA 2KYRA 4I9UA 1Q1BA 3HJFA 4GD3Q 3WGVA 2RGAA 3GPDG 3PGA1 4QT4A 2GM5A 2HWWA 3Q5GA 1ZNWA 3W7AA 4II2A 4WK6A 1VL8A 4OLAA 1Q6ZA 4QOFA 5AM1A 5TJHA 3WV5A 1S4MA 4FNAA 3N07A 5IXYA 1JKJB 1AA9A 3ZWCA 3AF2A 4TV9A 2DY1A 1QU3A 3AEKB 3UK6A 1SHZA 1RS0A 3K3PA 4GS5A 3W6PA 1XK6A 5CBPA 9GPBA 5JANA 4Z2YA 4YJFA 1F4LA 1FRQA 1RTKA 1SU4A 1RP1A 2R8ZA 3CWCA 3WYAA 1L5GB 2R7NA 1T9GR 3U61B 4Q9DA 1KZ9A 1IZ8A 1T3ZA 2ORIA 1EE1A 1PFGA 3I9KA 5DNEA 3N6XA 5FUXA 4ZCIA 4TQ9A 1OE0A 3G0GA 5E7MA 5KYTA 1WUJS 4ZT2A 3GEBA 4TMVA 1GG5A 2I4NA 4CM9D 4WBNB 5FV7A 1KARA 1TTQB 2D13A 2Y1OA 2HMSA 3FHJA 3HUTA 4WCVA 3S7ZA 1DFGA 1KJZA 3C0KA 4DAOA 5JS7A 1DC5A 5LQMA 5JS1A 1R9MA 4CM8B 2BEWB 1LRKA 2RONA 4PAOA 3RVLA 4ZZ0A 3L8GA 5IJ9B 2ZWOA 1KEUA 3F46A 3IQXA 3QKTA 4X8OA 1TA9A 4LJ4A 1VE1A 4BVGA 3KOXA 3ZK8A 3IO3A 3G8AA 4E4YA 2X5NA 4XRRA 5A2QA 4G1UC 3AHIA 3ZE8A 3OFNA 3ESDA 3L79A 1AV7A 3AY3A 4D9BA 3FOFC 1YJCA 2DQKA 5TC4A 5I9TA 2FSIA 1KSFX 5JU6A 4R1TA 4MV7A 2ZE5A 4REMA 3BF7A 4NJEA 2HDOA 1A27A 1P9WA 1BMTA 1HE4A 2Y1DA 1PBTA 3NQ41 4E51A 3T3HA 1N3LA 1NUHA 2PGDA 3RQIA 1QO9A 3FI9A 4CKYA 1AV6A 2XVYA 1UMCB 3PSAA 4HGZA 4RO0A 1XRSB 3RNLA 1SPXA 3RTGA 4OHXA 2QW8A 5E6RB 1STOA 2G7ZA 4L5AA 3S2SA 4FHGA 5EINA 3WYBA 4E46A 5B6JA 3FMGA 1JMYA 4F71A 2QE7D 1DI0A 4PHHA 4HN9A 4EKIA 1DJLA 1LI7A 2L18A 1ZZGA 2FZKA 1HL7A 2YWDA 3PGLA 4CXMA 4LX8A 1DDIA 3DPIA 4GZ3A 1EDDA 3E9YA 3FMFA 4JD5A 1M8PA 4Y2VA 1JEYA 5B57C 4YREA 2IYUA 2XNDD 3IBFA 2DOKA 2PZKA 3D0QA 3FHOA 2PAFA 4FKBA 4XWYA 2L17A 5HS6A 1NVTA 3E2PA 4NX2A 5LM3A 3UOAB 1POXA 2QTNA 5FOXA 1ZIXA 1LBTA 1ENZA 1YOVB 2IEBA 5E2BA 4Z4EA 2R87A 2YN4A 2DFDA 3MJEA 1OT5A 1ZOLA 2R6DA 3TOCA 4CMHA 3EPJA 4ZAXA 5KAMA 3G6KA 4RXMA 2VJYA 4LVOA 4GKVA 2GYWA 2X13A 2LCQA 4CTKA 1C9KA 5HCIA 5JAQA 2QROA 3R5XA 2UAGA 1T8RA 2EHDA 5A7GA 1W73A 2VYQA 2GTPA 1OPRA 4IEEA 1GAEO 3OT4A 3MSXA 5AUNB 4JN6B 2LDXA 4M0PA 1K8RA 3GUVA 3S0JA 1U3VA 3Q7TA 4PWYA 4JLSA 4LZPA 1XQ1A 5AJVB 3KZ1E 1TRKA 5HYVA 1KOFA 5K0ZA 3IAHA 4CR7A 3JAWB 1XSEA 5IBRA 1GU0A 1IJBA 4R8VA 3T99A 3FYSA 2WWXA 3OO1A 2HXGA 4WCFB 1FYXA 2BDEA 5A6SA 5TIIA 3AEQA 3UXMA 3WGHA 4YJ2A 5F3DA 1FTSA 1CBUA 1B3BA 3LJKA 3M4ZA 4LDPA 3CO0S 4KTTE 1XMJA 4C08A 2R00C 5DIZA 5M3BA 1FDSA 1FNDA 3AUUA 4QVGA 1G7SA 2GA8A 2ZUUA 3HJCA 1ID1A 1PG5A 1N7GA 3EEFA 4OSEA 5AK0A 1PT5A 1CJTC 1W48A 3G2IA 1U7UA 2CNWD 2XUPA 5CLLA 3AB7A 1B16A 1CY7A 4G4GA 4TXHA 1G4UR 4A0RA 2JC3A 4LS3A 4UQPA 2ZJ4A 1Y5RA 5E7JA 2NO7A 4JI5B 3DE3X 2CKDA 2PLWA 3GP5A 2HV8A 4HNQA 1KEVA 5TX7A 1K0UA 2J5RA 2ZJFA 4F45A 4QUGA 1JJIA 4OMCA 4OHMA 3L7LA 3U0BA 1JQAA 1AK9A 4URWR 1YCGA 3IJRA 2C7PA 3NUGA 1YIAA 3UMJA 2V6JA 2V7QA 5CM2Z 4JEUA 1ZM7A 3E5MA 4CN8A 1JEQB 1KKMA 1UDRA 1AVTA 1EBUA 4NH0A 4ZOCA 5CCBA 3NO4A 1XPOA 3KB6A 2HQOA 2PKYX 4Z9FA 4DBVO 1R50A 4Y67A 3DL2A 3U9SA 3CNHA 1PL0A 3AHFA 4D9EA 4JP8A 3MGBA 4NPAA 4Y2GA 3FTCA 4DJFC 1QF9A 2H0RA 1E1CB 2HF8A 1NW6A 4HUJA 5DXFA 2H1CA 5C1IA 2DH6A 1W2HA 3L8CA 1T1RA 3BD8A 4P4TA 3S5UA 3UHPA 1LU9A 1OC4A 1CVLA 4B7ZA 1ONSA 2V7GA 1T5SA 5FFNA 4B6QA 4IDNA 3SQDA 1OB2A 1N2ZA 1NTOA 2R68A 3WGOA 4BZWA 1T9GS 2XCOA 1GZDA 5LYJF 1KNXA 4Z3KA 4X54A 2DKNA 3EF3A 4TLEA 1KFKB 5EE5B 4BP8A 2NYAA 2HA4A 2UZ1B 5CEEA 4FKZA 4BFWA 1E62A 1EWYA 1A1SA 2IY7A 4YP6A 5DHFA 3X1DA 2VNSA 3BL5A 3TR5A 3GG9A 4L5JA 1H0HA 2ZRNA 3BHMA 2VHJA 2D0PB 5FTKA 4NJOA 1E3LA 5EJIA 1QR2A 2CV0A 1SHTX 4OL0A 4ZI2A 4FMBB 1E9BA 4Y2JA 5L40A 3FLAA 3CLSD 4KOEC 1P7CA 3IB6A 3RF6A 4LJLA 1WW8A 2C1XA 3IMFA 4KPGA 4M1SA 4P54A 1V9LA 3R7LA 2JFZA 2PV0A 1KPIA 3ROPA 3ROZA 2IRWA 3DOUA 3U4IA 3BD7A 4ZAVA 4M1TA 1AGYA 3KC2A 1LLFA 3BH7A 2LUOA 1NYTA 4Z99A 1NUUA 1L7PA 2VRBA 4RQBA 3QMPA 2HHJA 2AHOA 2OO5A 1JHUA 5C5DA 5K3EA 3EZ6A 4TV9F 3AKZA 1CY8A 4WSOA 4WZBA 1QK5A 4R1LA 3WQSB 2C9BA 4BX9A 5E6SA 3J7TA 3LC0A 3O0TA 3FD8A 1ZO8A 1Y7TA 4JQSA 1H2HA 5BRNA 1E6MA 3S3TA 4G26A 5DHSA 3I9V6 2HHCA 2LVBA 4JS0A 4B9AA 1I7DA 1WXHA 2VNAA 2VF8A 3BEDA 1KI7A 4QDOA 5ER6A 4MR8A 3RS8A 2AXEA 2CB0A 3QNWA 4IIBA 3WK6A 3EVGA 5BN3B 4QYIA 1YOBA 2CDBA 1GYPA 1KHHA 1KR5A 1IXRC 3C6YA 4L73A 5DGIA 3ELWA 4Y2RA 4RL6A 4J6FA 5TMBA 2W6MA 2AF3C 1NI5A 1U5AA 4MB0A 4DJJA 2LW7A 1C7ZA 3ITDA 5MDHA 1K4MA 3CU5A 3HPQA 1DO0A 2OFWA 1BOFA 4U2FA 4EDFA 2CLIB 1Z8FA 3LTEA 4NZNA 4EJ2A 5DO9A 4ZDIA 4A5SA 4MRNA 3ZX5A 2Q8NA 3GGOA 4Z86A 1SXJE 4Z9BA 4J3NA 5EVJA 4BKUA 3RUDA 3AV3A 5EJGA 4BFVA 2PZEA 3FUTA 4BE9A 2O8NA 4JEHA 4JQCA 4AY2A 3A6LA 3DE5X 1S3FA 3EISA 3ENQA 1UOQA 4B3JA 1N9ZA 2J3LA 2QVBA 1NRXA 2AFHA 1UDBA 1PTJC 2Q2OA 1ZMRA 1A76A 3M5PA 1QC5B 3P0RA 1NU8A 4GU5A 4RVHA 3O8OB 4N76A 4RK7A 4DCPA 5MGBA 3INTA 5KKNB 1Z08A 3H3FA 3LCMA 4BNWA 1WULS 3GMTA 3OQBA 2AK3A 4QEDA 4R41A 2ZPAA 4LZLA 2FMIA 2VCYA 3AO0B 4LJ6A 3NKFA 2WMNB 5EY5B 3QHAA 3H1GA 2WRZA 4B5LA 2YKGA 1TI7A 4KQ9A 3D3WA 4PYIA 2F3PA 3DBLA 1JDBB 1WA5A 2ZBPA 4HF7A 3VPFA 4EM6A 4FGKA 3L4BC 1VRCA 1YDWA 4TZTA 3VQTA 4RANA 5E6UA 3ZDBA 3B9BA 2GVNA 2BGGA 3A04A 2VPIA 4OLJA 3M8KA 4ES6A 1SCNE 5C1PA 3KPJA 4JWKA 1PWXA 2BI8A 4NOJA 3AZPA 3DEAA 4WNAB 4YAFA 1V47A 1Z8HA 3TSOA 1E5QA 4U7HA 2Z5LA 4PAMA 2CK3D 3HQ4O 4ZU1X 2IP2A 1PFQA 2QRJA 3STTA 4MKFA 1ISMA 3IT3A 1GQFA 2DHRA 3D1VA 3ENKA 4IG4A 4ZO6A 2IV2X 5IF3A 1MKYA 4I55B 1R0SA 1T2UA 4PX3A 7ADHA 1YQDA 2QTTA 4BMSA 1T35A 5TRTA 3BORA 2O7RA 4RHUA 5FKJA 3A58B 1BS2A 1QO7A 2ECFA 1YMUA 1I3MA 3L7AA 3LUGA 4URZR 3IB3A 5H82A 3ZNNA 4J4HA 4U6NA 4FGSA 2QRZA 3WRYC 5LLDA 2H4WA 1WB6A 4QX6A 4HLDA 3CX6A 3Q7RA 4ID3A 1KMCA 2GF0A 1KZ6A 1RRVA 4OHYA 3OE5A 1KE2A 4TVBA 1XG5A 2QD1A 3WOVA 1D3AA 1SU8A 2DTDA 2I0FA 2RC6A 3GEPA 4YJ2F 1JRLA 1C9JA 1QS0B 3ME5A 5CCDA 3T3PB 2D06A 4JSTA 4B48A 3OCYA 3MGCA 1VA4A 4ZVLA 4BQSA 2DF8A 3GT7A 3EEOA 2PJZA 4A91A 1SHJA 5LQKA 1DRKA 2ZYUX 1DJQA 1FFEA 2O2XA 3KVNA 2LTAA 3NHBA 3K0HA 5JMPA 1Y3IA 1T3TA 2WYUA 3O1JC 2CLFB 4BZZA 3KTAB 2YICA 2PXXA 4KNWA 1NQUA 5E8JA 4C6SA 3ZV3A 2XDYA 5DHTA 1D0VA 1QQ6A 2D2FA 3RS2A 3T1VA 1TEVA 3UA3A 4I2VA 3U5ZB 3T3GA 2M1XA 2PL9A 1SEPA 5KB3A 1A7KA 3SWWA 2QY6A 2ATXA 4DXAA 1HM5A 1Y6ZA 2ANBA 2KW5A 5CDGA 3ISVA 2KX7A 1VGVA 4FWIB 4ZGGA 3A9WA 4GMHA 3BTUA 3HYRA 4TV8B 4KU4A 1CRLA 1E8MA 1C1DA 4IJQA 4NMMA 2Q9CA 3UATA 4BV3A 5LA6A 1E3IA 3KAPA 3IAFA 5LL6P 1RKBA 4HDNA 3R9XB 1RJDA 1NZFA 2XA9A 3VH4A 4KRFA 1M5TA 3LRTA 3SZ3A 1I7LA 4MW2A 1K88A 2J45A 4YDRA 4TKZA 3GGJA 2B78A 1JSCA 3L7BA 2DUUA 4PM4A 4QXPA 3ZZMA 2QPAA 4WMLA 3SIWA 1KMMA 3CISA 1P1KA 4U2KA 4X20A 1J9EA 4IR7A 2Z1MA 4ZCSA 3GU3A 4EG7A 2BFBB 3TAUA 4J91A 1C8LA 3LHSA 3NANA 4QGHA 3R5TA 1L5OA 4R01A 2QD4A 1EFUA 1OFGA 1SRRA 1EFKA 1VJCA 4R6WA 5D6NA 5SICE 3UENA 5GJVC 4K9MA 1P19A 4FD3A 4MINA 4EJSC 4G0ZA 1O95D 3I9NA 1EFVB 1RM4A 1G7RA 3H99A 4JVOA 4XLZA 3HGMA 3O84A 4PQYA 4JCOA 2P11A 4H7JA 3ESYA 5FWAA 2BV3A 3QLEA 3RU7A 4MUAA 3AUTA 1Y4SA 4L4ZA 4LSMA 2A1IA 5AVSA 3KLNA 2WPDA 3JQBA 5A3RA 2WBLC 3D0KA 3A1WA 4GYJA 2FXVA 3H2ZA 1MVNA 2HYDA 1DV2A 3AEUB 1GN9A 1ZJ4A 3I8XA 3TFQA 1UFKA 4ZZ1A 3CIFA 2X23A 3FMOB 3AM4A 1F2VA 3KHKA 4BVKA 4WJZA 4O1MA 3WO0A 1FQWA 1UWLA 3L0ZA 4E5KA 1DLJA 4A8JB 4EGQA 3EVEA 4L8WB 3HHEA 2W2LA 4R2JA 3W5JA 3OZIA 2M6LA 4YMVA 1XHLA 4JLNA 5IZCA 2FVYA 1UJ2A 1VXRA 3GMDA 4MS3B 5JSZB 1XC7A 2CLDX 2GS9A 2ID8A 2E85A 2W48A 3G2QA 4LZOA 2WFLB 4PLZA 1UBRS 2CHFA 4YRFA 3STHA 3U4GA 3V8RA 3IEXA 4F5DA 2QW1A 4MV4A 4YUXA 5K0GA 5CT9A 1VQ1A 3AT1A 5CJ2A 3K7EA 2H8GA 2OXTA 4W5RA 5ELLA 4UM9B 4PG8A 4D8YA 4TRNA 4BVFA 5JEDA 3KQHA 3WGYA 2EX0A 1DAFA 3VV2A 3FPAA 5KQPA 1SVSA 3CC8A 4YK7A 1UR5A 3DDCA 2H00A 1ZEMA 3B6KA 1DUSA 1SJ9A 5FBZA 1NP3A 3C24A 2GCPA 2V7UA 4PLGA 4Y6SA 1DKMA 4MGZR 1W4CA 2OZLB 4XQ9A 4YUVA 4CM3A 6REQB 3SHVA 2XUHA 1GPYA 3LX8A 4QATA 2ASEA 4WA8A 1GPBA 4YR9A 5BXYA 1I9CA 3LGAA 5CB8A 2G4CA 4YRTA 2PUBA 1XJQA 3EVTA 1L5MA 2I4OA 3M6VA 4ARUA 3CSSA 4Z1MD 4URXR 4PW0A 3RFCA 4BNUA 2YWBA 3T9EA 4D99A 2XXBA 3KZXA 2XB6A 4FM9A 3EGDB 4UM5A 4Q7LA 2RBKA 5FYDA 1MDBA 1GPDG 1DC4A 1AKQA 2OGTA 2W2QA 4H1HA 4WT7A 3QMMA 2CLEB 1OXVA 1LF5A 4B3CA 1NATA 4YYZA 5KNCD 2OXRA 4CE6A 2J3KA 4O0LA 3VDQA 3OMXA 2XCIA 1IQRA 2SNIE 1IY9A 1D9ZA 4FONA 1NLMA 2CL7X 4YJHA 4HGPA 1MAHA 3MWEB 5KOJB 5TQ0A 5C53B 1T13A 2PS9A 1R0LA 1FA9A 1SC6A 1RLUA 2HC9A 1TGVA 4YIHA 3DKVA 1YWGO 5EUCA 5TDHA 4UBNA 2AE2A 3COYA 4AG3A 4KAFA 4D3SA 1YE5A 2GOYA 1IHUA 1EVKA 6Q21A 1MQ8B 1QIKA 1VCNA 1RZRD 1I1NA 1AGRA 5H3LA 2AFIB 3ZUGA 2XB8A 4AO8A 5K6RA 3OMWA 2GF2A 2C5FA 5FNZA 3GA7A 4K86A 5BNIA 2DYKA 3O8LA 4DMGA 5L3SA 4QJBA 1NVVQ 4L2IB 1ZESA 5JPIA 2VOEA 1WL8A 1N8NA 2CHEA 1G21B 4ZHQF 1A9PA 5LMUB 1N78A 4AKGA 2R2GA 1ECGA 3QFHA 3VSAA 1QHSA 2JI8A 1L3IA 2RDMA 4FYXA 4TS1A 4MQ6A 3REQB 2ZJOA 2FP3A 2VPPA 3A06A 3MERA 4MVXA 3DTNA 1YIDA 1WSDA 4ZAYA 3UCEA 3RYIA 3X1XA 1DFHA 3CT6A 2GXSA 2FFQA 3A25A 4C14A 4CTJA 2GPJA 1W1WA 4ONEA 1UM8A 1LSOA 1SG6A 2J07A 1FL9A 4FNGA 5IJAA 4OFXA 4YXWA 3WAKA 2DQZA 3D3JA 3JQ8A 5DH9A 5JSKA 5CTJA 4RF5A 3SAJA 1GGKA 3DEHA 3H6HA 4D44A 2ZYHA 3DLTA 2ZSUA 3ZZ1A 1M6VA 2VNKA 3NH6A 1NHWA 4JXKA 2MMCA 5ARBA 2QXYA 3QE4A 5HTKA 2LKDA 2A59A 1QZZA 1RLTA 1JDJA 3BJIC 4REQA 1D4FA 2AQKA 3I1YA 4YV2A 3TWOA 3ZVKA 5G41A 3MWFA 4D43A 2XKBA 3BB4A 3CKKA 5CHEA 1FSSA 1VPDA 5HQ3B 1LBSA 3IODA 4LRQA 1CPYA 1G8HA 2PKQO 1YF3A 1KAQA 5T67A 1B6SA 4UHJA 1SC4A 1UBGA 2NO4A 4TT3D 1GZ5A 4M55A 2Z0MA 4QQNA 4N40A 3CUTA 3IAM1 2WP8J 3CG0A 5KSZA 4NOKA 5JJBA 5AFSA 1P5HA 4DDWA 1N5KA 3N0RA 2DPLA 1ACLA 3ZLJA 3V1MA 3M4NA 1I80A 2HRZA 2XUOA 3LE8A 3LLCA 4X94A 1IC6A 2ZLBA 3P0HA 1ABEA 4KWIA 3ILHA 2VTEA 4ZAZA 4D8XA 1F8GA 2XRMA 2ZI9A 3D8HA 3K9WA 2OORA 2JKYA 4NIMA 1LSJA 2Q4BA 4MARA 1R3UA 3VH3A 3ZGOA 1R0RE 2VTDA 5LA6F 2OTCA 2P62A 5JS6A 4NV3A 4MPDA 3DT8A 4HDKB 3H5LA 4HNGA 4PC2A 5JBQA 1EK5A 3CUUA 1KRWA 1E58A 1QYCA 3BMNA 2V4UA 3SLRA 2JIZD 2COUA 3GFTA 3QU7A 6LDHA 1U0BB 1HDXA 4D9FA 3OO0A 3FW1A 2FGJA 3SJCA 3F6YA 1DCFA 1KI6B 2O2SA 2J3MA 1WJGA 2YXPX 4NPHA 4C4TA 5LP1A 1Q7GA 5AXCA 3LT0A 4ENQA 4ZYZA 5K51A 1V96A 2QTBA 2D5AA 3H2YA 3DDUA 1IPEA 4WK4B 3N53A 4EUEA 3W2TA 1ESDA 3CCCA 1RAEA 4RZ3A 1F38A 4TMFA 4ENVA 4QYTA 4EG4A 2OXIA 5HKLA 2ALJA 3EG5A 5KYWB 5J5VA 3DDSA 1XWFA 1AKRA 3L8YA 2YASA 1GARA 3VKWA 3D6JA 4XWAA 3GXOA 4LDZA 4OCZA 2DQYA 4IIHA 4KXYA 1FMTA 2QU8A 4ZVNA 2O19A 5A4IS 1WZUA 4XD2A 3OTHA 2P35A 3BCUA 2YUIA 1LV8A 1U8YA 4H0FA 3DONA 1QF7A 1VJ1A 1P3DA 1J7JA 4ZN6A 4K6OA 1S3GA 3BM5A 1QIGA 1V35A 4MVCA 3SIRA 5JDIC 2VSYA 4E5PA 4K9DA 3I9JA 1KYWA 1JDUA 3IUSA 4UM9D 2AKEA 3PB3A 5EN4A 3BIWA 4X7RA 2GILA 1GKLA 3UXEA 4QLAA 3ASYA 4EMBA 4F7DA 1XMVA 2EBWA 4L8LA 1UP6A 5KOIA 2YHUA 1L7OA 2X2OA 4GPTA 4Q15A 1OUMA 4GWLA 2GCEA 3Q3JB 1JG1A 1YR2A 3OBIA 3W1WA 2A4MA 2DE0X 1KMNA 3KZNA 4KDRA 1W5TA 2F1KA 4L5IA 3T9CA 3WC4A 3SVLA 5T7BA 1N0UA 2UYQA 1M2VB 1PNQA 3LVFO 5GIPE 2EVWX 2H2GA 3OPXA 4TWBA 2ISQA 5I45A 3PNYA 4YMHA 5AVWA 3IDZA 3I0NA 4WPGA 1B6RA 3TMYA 1O6GA 2Y6VA 5IEJA 3BSWA 1IEQA 4PLHA 2NXNA 1X7ZB 2QX8A 5BVHA 1LPOA 3TQSA 1ENOA 4MVJP 3H65A 4BZPA 4DXHA 4GZMA 1GZUA 2FP4B 1CETA 1K89A 1Q3KA 4CLHA 4LRTB 3NAZA 2RH8A 3VKHA 2BJVA 2PRYA 4ND1A 1XZHA 1CUJA 1OLOA 1FLNA 2BRUC 1M2NA 3AW9A 3RS0A 1SG9A 2JGDA 3WBKA 1H1DA 3KFVA 4PFKA 3UT5A 5AW2A 4NK5A 4UD2A 4AYWA 2C4HA 2EAUA 3H5IA 3K4HA 1LJLA 3MB8A 4HWPA 3ZD7A 3T7CA 3SG0A 5CDHA 1HQCA 2CJYA 3NTVA 2X1VA 4EHNA 2QI9C 4E5SA 1NNEA 4MOWA 2DBZA 5HOQA 3KHTA 2MJLA 4DV7B 1JJFA 1H6CA 4BPBA 1XZAA 2GNPA 3FCOA 2AN9A 1M66A 1K9SA 4G24A 5ICGA 2VCHA 1LEHA 2AN3A 4M1MA 2EFCB 3OZ7A 1FUEA 1S2GA 3I5XA 1OYOA 1FVXA 4YLYA 2FNAA 4QHSA 3N2GB 5T8KC 3CVOA 2M6RA 4FNOA 3KVRA 2YZNA 4GMFA 2O4CA 4EGSA 4KR3A 3E70C 1H94A 4BTLA 2VWHA 2VYFA 1Y1TA 2P2YA 5FLKA 3GNTA 1GTG1 1H4VB 1LCIA 2AN5A 3BXEA 3LC7O 3PQFA 2F48A 1FRFS 1U9JA 3Q8WA 4HWOA 4RZXA 5TXGA 3DMYA 4ZAWA 2DPYA 1ZVMA 1QBGA 1FX1A 5CA0B 4O2AB 3SJAA 1Y37A 4FCWA 3DKRA 1KQOA 1KU0A 1N6LA 4PRLA 3TQRA 4QT0A 5B7GA 3N2KA 3PI6A 4MI1A 2DR0A 5BOSB 3FWZA 2H4ZA 2PUEA 1BU5A 2E49A 3W4JA 4OSPA 2Y1GA 3GW8A 5G4KB 5FUMA 4DCOA 1Z4NA 2IVZA 1LUAA 3H0EA 3HL4A 4RKYA 3OIVA 3QUCA 4Q9KA 5ALPA 3VSCA 3WO1A 1SCBA 4CL8A 3QU2A 4YHBA 3TZLA 3G0OA 1MPXA 2F1OA 2RH5A 4ZI7A 1P4GA 1W581 2NADA 4RV5A 1U1DA 1AS2A 1XHEA 5JQGA 4TKMA 3AR9A 2J9FA 1OX4B 1GPKA 4G81A 3VPXA 2Y1FA 1XZLA 1R18A 2JJ1D 4M8LA 1HDGO 1CF9A 2RGWA 1UADA 3OQHA 4X8MA 4RS3A 2EFDB 4Q19A 2JFGA 4MW9A 5KDLA 3A2LA 1ULBA 1EXVA 2JASA 3NGLA 4C87A 1E2MA 1S2OA 2LE0A 5EMNA 5ITSA 1DGQA 1GQYA 3THYA 1Q0SA 1UZLA 2C5AA 1WB5A 3V4OA 2ZGVA 1SB8A 4TLAA 2QTCA 1J00A 2YV3A 2I54A 2OC9A 3TCNA 3K0BA 5BRJA 2SHKA 3CEJA 1F2DA 1ODSA 1LZKA 4PO8A 5JWHA 1ZSYA 1ZC4A 3VYUB 2JBAB 1T5IA 3AETA 1EGAA 3NYQA 4QL3A 1QAQA 4R1MA 5EUMA 3WL3A 5FV4A 1J7KA 3LKZA 4AG5A 7MDHA 4AKSA 1MIOB 1GYRA 1K27A 2EP7A 3I04A 1YBAA 5DHQA 4YRAA 1U5BA 2I80A 3OWOA 1BS1A 4HX5A 3AVXA 1E79A 3QFTA 2HTEA 5CA1A 1TA4A 5I7UA 4F8JA 1YZNA 5EEHA 2IODA 5COAA 5GTDA 1OIWA 1C3VA 1ZMBA 2XLBA 4EG0A 3FNQA 1CZOA 1NZDA 2VJNA 2VWPA 5KJ6A 3X44A 4NNPA 3WB1A 3HDYA 1AM4D 1FNNA 2A78A 1I24A 1WTAA 2FWRA 2I8CA 2Y1LA 3L40A 2IH2A 3MJSA 1KQGA 1X39A 2QUHA 4QTUB 1G6OA 1QJ4A 1XTSA 3HKBB 2JCYA 1TU3A 3KYIB 3UJHA 1ZLXA 3L01A 4IXMA 2GZMA 3OICA 4PXAA 3T7EA 2GN1A 2ZJBA 4GHWA 2R5NA 5KTSA 4JXZA 4KKVA 4HHEA 4TLDA 4OGGA 4TRMA 4RKEA 1YDEA 4HXEB 4ML3A 4QLOA 3U7QA 4CLXA 1YBVA 4QHYA 2PN1A 4QDJA 2JFXA 4DE5A 3VX4A 1S9DA 3LPAA 1QQTA 5JCOC 3FWNA 2OLKA 2PLFA 3CZ5A 3H8WA 3OZFA 1M3SA 1GA4A 2A3RA 4DV3B 4DBLE 4IXWA 1ZK0A 5KWJA 3ICWA 1KETA 2WG1A 2E4XA 2GRAA 1CW2B 2VPWA 2XSZD 3CNOA 4ARAA 4KQ6A 3QI7A 3FLBA 1UXOA 4GI5A 3GFVA 3EWAA 2H9YA 2QRGA 1U0FA 4FYHA 1I2AA 4F5YA 2FF5A 3BPSA 1YTLA 2YL2A 3JWJA 2NQTA 4JB0A 3EZ2A 5D3KA 1NC1A 4DGQA 5I48A 2ZAIA 4JASB 3VVCA 1UAAA 3QG5A 1R15A 3JZIA 1AUPA 3EA0A 5IJXA 2A1UB 3OIUA 1X14A 3ZBUA 3QA9A 1IUKA 1KY2A 2ZBGA 4MICA 1J1UA 1ADJA 1QKJA 4URUR 3QY9A 1XKLA 4R2MA 3S1AA 3W9SA 4RK1A 1Z88A 5I4BA 2PLAA 2X0NA 5B64A 2ZU6A 4RDXA 4OOFA 1E6CA 2OD2A 2ZJ6A 3KSBC 3BJRA 2PUFA 5AMXA 1U4OA 2O1SA 5BN1A 1KQFA 4RFVA 2AK2A 3L6OO 1CUCA 3GLVA 5DEOA 5MGNA 4D25A 1JDPA 3ETLA 4TN1A 1KMHB 1DARA 3KJHA 3IVGA 5GZ1A 4CV3A 3A1EA 2YCLA 1UJ4A 3QTLA 2FRVA 1NQTA 3Q6NA 5CFZA 1YGYA 1ZVKA 5JD5A 3KSAC 2R6AA 1E9FA 2EP5A 3RGWS 5MN6A 1JJAA 1AQLA 3T4PA 3PZBA 1N2GA 2AOTB 3JASA 1NJ2A 3WQHA 1VBNA 1ISSA 2FPGA 3DCJA 5BSFA 1H9CA 1GLVA 1C9DB 1R0CA 2B35A 2GJSA 1A9TA 4JDPA 1BA3A 2PSEA 5JFGA 1GQSA 4M6WB 1Z0AA 1WLYA 1F0NA 2ENUA 3PUHA 1WHSB 1SA0B 1G4HA 1K2WA 1XTPA 2YHAA 2YW2A 4HPWA 3CX8A 1JSLA 1X80A 4UVDA 4V38A 4ZQCB 3WMXA 1AQJA 1OXBB 2O59A 3U3OA 3FOZA 2EX1A 3CKMA 1TKCA 4ZT7A 1DWUA 4PSCA 5DLPA 1KMIY 5BV2P 2PWAA 3WLHA 5MFPA 2QLMA 5KEIA 4NXMB 3BRSA 3MQ2A 5H81A 2IQ5A 5A4FS 2ZJ5A 4GXTA 1GGFA 2P77A 3B20A 3PWTA 4XOIA 4I66A 1JHZA 2I7CA 3W5CA 2EFYA 2IOFA 1IL0A 3PX3A 2VVTA 4DBZA 3G6WA 5JNLA 2D5CA 1LGYA 3VV3A 2XXAA 4MHTA 1EM6A 5DEIA 3O8QA 2C7QA 4KMRA 2C2MA 2Q3BA 2QYOA 1ORTA 1B23P 1Q1EA 2B9EA 2G06A 3MTJA 4C7VA 4WNYA 1H8ED 4MS4A 2RHJA 1DTEA 3IURA 3L82B 5E9QA 2PGIA 5KSYA 2X5XA 3RT9A 4KQ1A 2WA1A 2AJDA 4A9AA 2VJCA 1OGYA 4QARA 5IC5A 5K2MA 1WCIA 1X8KA 2XB2A 1V5WA 4WTOA 4GFDA 4UBJA 4QYXA 3I9OA 2CMDA 1I3NA 4WOCA 4G0QA 3ESQA 3CPHA 1XF1A 2HRCA 4BVHA 4ZK2A 3TLXA 1QG0A 1TCVA 1E5XA 1UZNA 2QAGC 3E8XA 4OX9Y 4I1UA 1V1MA 2GRJA 3EF0A 3OEHD 4IHAA 4IWNA 5L51A 1FIUA 1M76A 1W85A 2QJRA 1J0EA 4TLLB 1E3WB 1XL1A 4HNRA 1O77A 2NVBA 5DBHX 1FVHA 5DHRA 5TARA 1X9HA 3DL0A 3FHLA 4V39A 3IP3A 4QEZA 3PV0A 3VSDA 3OIWA 2AW3A 4Q00A 1FQKA 1PQUA 3SZOA 1UAYA 4MS1B 4NBSA 1XKQA 3KYDB 1EK0A 2I1LA 1SD2A 5EUQB 4FI3F 5EKTA 1EWVA 1JMVA 3QEMA 4MYDA 2E48A 5EJAA 4JGIA 4XM0A 4AKIA 1IVNA 5JYDA 5BW6B 5JQGF 1BVRA 3S28A 5IK2D 3RUFA 3COWA 4YCLA 3F3KA 4AN0A 5JJ5A 2HLHA 4IJKA 4IZOA 3D5QA 1LK7A 4AIRA 4XEUA 13PKA 5CLJA 4I1PA 1O03A 1H0RA 3UWKA 4FYWA 3GEEA 4XGKA 3O21A 1NXQA 2VSXA 3ZJYA 3LP5A 5HX7A 1XNRB 3IRUA 4OFBA 5TJ9A 2XB4A 5TSDA 4QC2A 1HRKA 3NIGB 1Y4UA 5LP6B 2REQB 1I7SB 1SELA 2NZJA 5AVOA 1DDOA 3NBMA 4TZ0A 2GD0A 1AQNA 3ETHA 3JQDA 5I7WA 3ZIUA 1TE2A 3ZDCA 4Z7JA 3CB4A 2NTJA 5FPKA 1QP8A 1KHTA 4MMZB 4OU5A 2XOKD 2VDNB 3GBVA 5K8LA 4C7XA 1BNCA 2E7ZA 3KSDO 4WZ6A 3AI7A 3G13A 1ZR2A 3CZQA 5IABA 1UFOA 1GUYA 2RCNA 2C1ZA 5BN4B 1L7BA 5BUZA 5K6AC 4HQLA 1QP7A 1XRQA 5ESRA 1Y6RA 3OAAA 4KO3S 5J4LA 2YWFA 5LQNA 4OBBA 5FXMA 2W7TA 1NXWA 2V9CA 1BVUA 1KPGA 1Z2EA 3BTSA 1QHIA 2FOIA 2NSLA 4UQOA 4GBED 4Y2HA 3RWBA 5JCZA 2ORWA 3IKMB 1EM8B 3QH4A 3FCCA 2XTZA 4JUAA 4ERNA 3OJXA 3H9BA 3NYWA 5KYYA 3AFOA 4ZOEA 1DIHA 2FZCA 2K5UA 3TNFA 4E32A 4EP1A 3TIFA 1T6XA 5LUAA 1CXZA 4PZ9A 4RZ2A 3UMGA 2OK8A 4KAJA 2IE8A 3BQNB 5I9BA 1NHGA 3KQWA 3KFLA 4DM3A 3DHNA 3P2EA 5FI1B 3UUWA 3F6RA 1U94A 1W0KD 2B2CA 3UMFA 1D1PA 3WNDA 5CDSA 1UBHS 5GZ3A 4OK6A 1QDEA 5DV9A 4ZAFA 4RTOA 3TVDA 7REQA 4XH9B 3OTWA 4G0YA 5NLLA 2GAAA 4N7RA 5HUJA 2FW6A 2IF2A 2VK1A 4MR7A 1QB7A 4GZ5A 2BY4A 1R5OA 1XXHA 2ACWA 2WJWA 3UT6A 4OJKA 1U0LA 4JOCA 3JW8A 5IPFA 1Z4QA 1C3JA 1KS9A 3NGMA 4R2LA 3BE6A 4CBVA 1PNOA 1D2RA 2CEAA 5K3FB 3RYHB 1HTBA 3HKDB 4DC9A 2XQVA 2ZJZA 1SXJC 4D3FA 2NO0A 1BW9A 2BUCA 1SOVA 1Y9EA 4LF8B 2FLKA 1RQNA 2H85A 2JFWA 1YR7A 3ASVA 4JKYA 1NW9B 4PQGA 3NC4A 5HUHA 3ER8A 1TUBB 4NULA 1GP2A 1V95A 2ZIXB 3T1QA 1E1DA 2ODWA 2XA1A 4UHBA 4OX9B 3K09A 1SBNE 3PNLA 4B71A 2R11A 2V5VA 3PR2B 1PJBA 4H1VA 2WD7B 3DAHA 2NTYC 2YC2C 3DS8A 3HH8A 3SBXA 1P9OA 3M5WA 3QY0A 1SXPA 3DF7A 1USKA 1AMOA 4M7OA 4BBAA 2PPLA 2ZRQA 2YWRA 2B5VA 2HLDA 4PNZA 5HKBA 3UHAA 5IXSA 3ND6A 3H5NA 2C3MA 3LWBA 1EDZA 1U0TA 1EI9A 3EFOB 3N1UA 4HDMA 4HTFA 4QJ5A 3GJSA 4QFMA 3LMKA 3SJ7A 3NB0A 3DWEX 3DAGA 2WIKA 3FJ1A 2PGXA 1ODLA 3WTCA 1EEXB 3ID6C 3CFYA 3CPEA 1LDMA 1ACMA 1EB9A 1F4PA 2E4AA 2PA0A 3BCSA 1UP4A 1WOYA 1WW2A 2X8LA 3KP1A 3L1IA 4N65A 1JIQA 1LWNA 3RSQA 3PGMA 4C0SA 3GVPA 3NHFA 4ZEXA 3KSZO 3T7DA 3ZE7A 1PDVA 4PX2A 4LFBB 1FRZA 3ZGZA 3WHLA 1K0FA 2XGOA 4RD1A 3GLGB 1AY0A 3WV4A 4PBRA 2C29D 1PJTA 1P4AA 4XRGA 2GTIA 1U2DC 2X40A 2PZJA 3OCVA 5D00A 3UICA 3AF6A 1P2SA 2JPDA 2IZZA 3BOSA 4GEGA 4WH0A 1SXGA 3WKDA 4ZHQA 1DX4A 2RI6A 3TZHA 5H59A 1PHRA 3P7MA 3NWJA 2HIGA 1D6JA 1U8CB 2AR0A 2WOOA 3L0IB 3S8YA 3UPDA 4IOKA 5T41A 4ZIRB 4BMYA 2IW3A 1J9ZA 3O9ZA 1F5NA 2Q5FA 3N0TA 3HZHA 1PNTA 1ZM3A 3KKZA 2OB2A 1DC8A 5BSKA 1OH6A 1XJ0A 1QFXA 2PIDA 1X6VA 4K5QA 1DOAA 1ETHA 2PJRA 1DJNA 1BWSA 2OMEA 3HMKA 5FL7A 2FFJA 1VBKA 4GXQA 2I3DA 3AR6A 4KG7A 1KH3A 4OF4A 1T1EA 2BAGA 3BN3A 4Q1BA 1QU2A 4KR6A 2AHRA 1L7AA 3R7NA 1A98A 1QMGA 3DUFA 4NCJA 3SZLA 3OECA 3NXSA 4BP9A 1JLKA 2P9GA 4PYLA 3V48A 2JHFA 3NFYA 4FFRA 1T2VA 1AN9A 2OB1A 2ZYRA 3Q2OA 3GT0A 5AQEA 3F7MA 4TV9B 3KE9A 5JNRA 3S1SA 2K7FA 1WMDA 5JXIA 1P91A 3EMBA 4NSNA 5CBPB 5JBNA 1KVUA 1RACA 2NXEA 4RVFA 4KLAA 4F5ZA 5IKEA 1EUYA 2IIPA 4QD3A 1RAAA 2ZYAA 1IN6A 2WUWE 2WSSA 3TRIA 5IDXA 1IHYA 1VPEA 2VXOA 3EVDA 2WWVD 4FB4A 3C3MA 1YQEA 4BMVA 1XZPA 2JKZA 2VZEA 5IJZA 2H92A 2E5FA 4QPDA 5CVCA 2JD1A 1F06A 4Y0AA 2XZPA 4BB0A 4I6EA 3O94A 5HA5A 1O57A 2G67A 4AM8A 1GCOA 4JP2A 5FBKA 1W30A 1N6OA 3DHYA 3WGUA 1CY6A 2JA2A 4MO9A 2VK2A 5A3SA 3L3BA 4IHJA 1RE0A 1T1JA 1V41E 4Y0VA 2FEXA 2IYLD 4EAAA 4FN4A 4IOJA 3L7JA 1CUYA 4JODA 1TAUA 1RYMA 3PX7A 3TE6A 5FPHA 1P2DA 121PA 2G25A 1J22A 3FROA 5ALJA 4E2YA 3UJCA 3V1KA 4EUHA 1TZMA 1Q1GA 5JD6A 4JLPA 3JD4A 4LNAA 3NONA 4NFYA 1CUIA 5DTJA 5U1PA 4WY5A 4B8WA 4NJEB 2ZRFA 2J9ZB 3VC7A 4TKUA 4GUDA 2NUPA 4WEOA 2BFEA 3QPVA 4O2BA 4FZ3A 1C1XA 1YA4A 3NT4A 1UKEA 3NVAA 4ASUD 3WFJA 4EUNA 4DQDA 5DLDA 4NMLA 3AHDA 1Z17A 1T2NA 2VTKA 3ETDA 4MUFA 5EFOA 5BPHA 1I6WA 2JCXA 1ONBA 3LKDA 1YR6A 5J4VA 2PO7A 4P5EA 5FBVB 1O97D 4JB2A 3KDSE 3WYDA 4G85A 1AKNA 4HPXB 4GDMA 3IHWA 1KEEA 3TLCA 4DANA 4FJ0A 3WNCA 5HHTA 1XKTA 3QQ5A 3H1BA 2WWRA 3F97A 2GHRA 1M8KA 2PSDA 1E9RA 2PGJA 2FQWA 3EOAI 4MITA 4MEJA 4MV6A 4NYMR 2HA7A 2V7XA 3LNCA 2CXSA 1RBYA 4J94A 4LKOA 1JEYB 1P2GA 1YR8A 5EE0A 5JIBA 2BMVA 3L6EA 4L08A 4RU1A 1IPHA 3EZLA 3EVCA 3LY5A 1OJLA 3K9CA 3NKLA 2HMUA 3A9TA 3OLVA 3HR4A 3FVTA 2V1XA 4TTAA 1VMEA 3PC8C 3IEKA 2DBQA 2D62A 4PPGA 4HQRA 1TCBA 1Y48E 2UVDA 3CZRA 3NAQA 4MVJA 4U7GA 1KDTA 1L5WA 3R24A 4XWOA 2B3DA 1Q7RA 1W75A 3HK2A 1TW2A 4RETA 1RXWA 1FMFA 1TM5E 3OZVA 4KYTA 4RV4A 1P2VA 2P0YA 3MGKA 4YO8A 1JXOA 1DT3A 1K68A 1KFCB 2ZYGA 3LXXA 2WU0A 2JLUA 4BNJA 5D3ZA 5G40A 4EZIA 1D7AA 2WSIA 1NRIA 3ICPA 3KD2A 2FWMX 4C0HA 1GOTA 1KU6A 3L7IA 3GOQA 4MP8A 1Z26A 2HBYA 2ECOA 3O38A 4HGNA 4HQKA 4H3KB 4MMXB 1XDZA 3L4KA 1GJRA 2FYTA 3GJ6A 4EO9A 5A6SB 2YOFA 3AEQB 3G68A 4NV0A 4CQMD 4YJ2B 3GLHA 3HU5A 2G1KA 1Q3HA 4CDGA 1TJYA 2QRMA 4NBLA 4XX0A 3MSCA 1S7GA 4LHXA 1UQRA 4KH1A 1YB1A 2WJHA 4N3CA 1VGQA 3FAZA 2WWFA 4US1R 3AI3A 3N6RA 1OPXA 1O9BA 3VR5H 4HVCA 3NNDA 4KLCA 2O0MA 3F90A 4QUKA 5AW5A 3RAJA 5A1TA 2Q0QA 2XI4A 1AGXA 3KNZA 4AZSA 3PA6A 3K1AA 2XBMA 4BUCA 4I99A 1ACJA 3IJEB 3O74A 2PZAA 4JL5A 4OM8A 1WMAA 1OU4A 3D6HA 2NSDA 4CTNA 3T1NA 1YTUA 5ELMA 1QMPA 5JYEA 3GCWA 2QV7A 4DPKA 3F3YA 2XW6A 5J1TB 3WAGA 2B30A 1B2LA 2JJYA 3BAFA 4F4UA 5JTUA 1TAQA 5HNKA 3Q3HA 1TVKA 1CEEA 2FPMA 3HSSA 1UMKA 2WTUA 4C43A 5HZKA 4ZYUA 1Z83A 3FBTA 1EBFA 1FTYA 1XF9A 4RSHA 3P8ZA 1KL7A 4IO1A 2W2NA 4HYTA 5BWCA 2BISA 3VU9A 5A62A 3EDCA 3MGGA 1IE3A 1KC3A 2QD3A 2C57A 3AJ9A 5AVJA 5HGJA 4LNHA 4LF6B 2HW8A 2Z2JA 3KPWA 4HAWA 4XQEA 1GL3A 4CL3A 1MQ9A 1ZCBA 3AF0A 3UMSA 3X1MA 5L4LA 3QELA 1YHYA 4V0ME 5I9NA 5ED4A 2IHBA 2PQ2A 3TX2A 4YAEA 2CLOB 1ESMA 2YWCA 3Q4GA 2CNBA 4CT5A 2F1HA 4MQBA 4L6CA 1WVGA 1XTTA 2ZWAA 3R5FA 4BWVA 4GOKA 1WUTA 5J47A 1ULUA 1KH1A 1LVGA 1LXCA 3RC1A 1N3BA 3NRCA 4IIUA 4QJIA 4M0UA 4KVAA 2PX0A 1PT8A 1BS9A 5E2IA 2ID9A 5K7SA 4TMZA 3O7WA 5I7RA 3J80A 1AX9A 3W8EA 1EWQA 4CQNA 1SC9A 4FHFA 1TQHA 3D7RA 3NOQA 2V6BA 4ZRDA 1E8DA 1WE2A 1H6AA 2KS6A 4RZIA 4GPBA 3QFFA 2HA5A 3M89A 1SC1A 3A14A 3DFZA 4L15A 3LNTA 1TYDE 3K4QA 4EFMA 3V7YA 4DKXA 4XB6B 3TIGA 4LRUA 5TVGA 4RTSA 3PHIA 1H0SA 4WZAA 1XZIA 4Z8YA 3R7FA 4DIFA 1CB0A 5HCNA 4Z4HA 1VIDA 4C4XA 5EG5A 1XDBA 4IYJA 4YYEA 3AU8A 1XMQB 4BU0A 3BE4A 3FCUB 1PR1A 1NI3A 3VR4H 3HFSA 4G4IA 5EIAA 5EZQA 1BIFA 4CWAA 2WVHA 5IJ0A 1ILEA 1IULA 2JIPA 4JJGA 4WZBB 5J4HA 1F0PA 3S99A 3O4IA 5JLAA 3QXXA 1ZJZA 4ETIA 1AH2A 4KAXA 3PVSA 2O8CA 4XR4A 3GUHA 4KOAA 1N8KA 1ARZA 1YC2A 4L02A 5E0KB 2QP9X 4YPVA 5HPYB 2O4UX 4OSOA 4F3NA 2XMSA 2ZWIA 4O63O 3AVTA 3WWYA 3L1HA 4A10A 2C00A 1Q17A 4L7QA 4KODA 4KI7A 1BXZA 2FJUA 4MR8B 4D0SA 3EQ2A 4QYIB 4LCEA 4KGXA 4OFZA 2R7LA 2VT3A 2BFDA 1C1HA 4E15A 4EATA 3BVPA 3MIIA 4JU8A 5BWNA 3ZJUA 1L1RA 3M82A 2C1EA 2J41A 4LHWA 4ZV7A 3QUBA 4RS4A 1YR9A 2M2IA 4MKZA 4C5BA 4F38A 5CGZA 1MHPA 2BC9A 3LSTA 3I4LA 3M9XA 3WWDA 4BN0A 5IKMA 1PS0A 1XL0A 3CLSC 4QNMA 1P33A 5LKRA 2Q45A 1YBHA 4MYSA 2BGRA 1OF1A 1CUBA 1OZHA 3RM3A 5EZYF 1OTXA 4JR0A 1J2YA 4TYQA 4HAUA 5EGSA 2UVQA 4L4YA 2G1AA 2RHWA 2GAFA 3HN7A 5LQUA 1P9LA 1THMA 4TS3A 4DSAA 4F4CA 1T5LA 2VWGA 2HQRA 1VCMA 2YDYA 3DFKA 3NCHA 3TXYA 4Z9XA 1E1QA 3DV9A 4B83A 3AVWA 4BRUA 5E1DA 4OMFG 3E84A 3LUHA 4GPZA 4H3HB 1UINA 2GSWA 2XF2A 3D8RA 2OBLA 2RFLA 4IVRA 1G64A 2FA9A 5AO9A 4MYRA 3GUYA 1NBWB 1OXXK 3MJ4A 3RBXA 3D3WB 4Q1EA 5TT1A 4W9NA 3DBLB 4CR6A 1V4NA 1FW6A 1X87A 3TEFA 4S1PA 1DKQA 4R9VA 8MHTA 4XE5A 5E6UB 4UZEA 2CV1A 1J2UA 1CX9B 3E1SA 1FPQA 2XWBF 3OWHA 3FPSA 4L16A 1TIKA 3HA3A 3HCNA 4UXHA 2VF2A 3HCPA 4AXBA 3WGIA 1RXVA 3DXFA 3NEPX 5CB4A 2I33A 4DMMA 2EQ5A 1A9XA 2H2AA 2OM6A 4M0EA 3KWMA 1RHMA 2FJ0A 3B53X 1TUIA 1HZZC 1TMYA 2C31A 2DG2A 3NHAA 4J1QA 1FDIA 4KO8A 1B73A 4CTOA 3IQFA 3OOWA 4OUKX 4W99A 3ZVLA 4BO9A 2EW1A 5BQFA 3EWIA 2D2IA 5DM1A 1PR6A 4Y2QA 4CM4A 2VDOB 1XAGA 5DF1A 4INAA 5C9ZA 2Z2XA 5I5EA 4M9XA 4NOLA 1VYHA 4GVPA 3L43A 3X1KA 3QNMA 3P9KA 1AJEA 3BXPA 3E61A 4GE0A 3NDBB 3V7NA 5LFAA 2OA0A 1DJOA 2YXLA 3I6ZA 3E35A 5H4HA 4DIMA 3FXAA 1ECPA 3L7KA 2ETXA 4D96A 4YRNA 1CFZA 2A7QA 2CL0X 1DTWB 2RI1A 1H2BA 1DBVO 4YHHB 2HYIC 3KD3A 1CZHA 1C7EA 4N12A 3T7KA 2PUHA 3Q3IA 1FZQA 2Z08A 3F98A 5ICSA 3SYRA 2QMOA 3A1DA 3PWZA 2QUJA 2FRDC 4YP5A 2UU9B 4AMZA 4LGMA 3BIFA 2PS3A 4FFBA 5DVZA 3H5WA 5ITZA 1VECA 3TM4A 4KZPA 1DL5A 4HRVA 4FLEA 1AU9A 3R5HA 3DXYA 3MTEA 4DA9A 3GL9A 5FADA 3WLSA 3UH0A 3D7NA 2V7QD 3AYZB 1RSZA 3I12A 3RREA 2XX3A 4Z4IA 5JSUA 1CR1A 3N0VA 3KUUA 2Q1WA 3CCFA 3H86A 3M6MD 1N36B 2WNIA 2NNLD 1W4BA 3U7RA 4F4JA 1GQ2A 1P7PA 2ZRGA 3HO6A 3OE7A 3GRUA 4WCFC 5TEWA 5LVAA 2CF6A 1FP1D 2A0UA 1GVNB 1V4VA 1O6FA 3A6DA 2B4RO 5M2QA 1C1DB 1KERA 4R0VA 3ETGA 5LA6B 3VOSA 4MRVA 4OAPA 4M0FA 1TIPA 4HDNB 1E3MA 2OXCA 3WMRA 5IF9A 2PSJA 3L04A 1JG3A 5DB4A 3MT9A 3K5PA 1SCQA 4YMGA 3S2UA 4WKCA 3LRPA 1A71A 2N1MA 2YJNA 4K6MA 4X6XA 1UZUA 4X20B 1JSZA 2YJ3A 3ISJA 3R6TA 4L4SA 1KDZA 2XJ9A 2MWMA 1ZSNA 1MU0A 1JQLB 3H4TA 4KAAA 3V1NA 2AJBA 2ZXFA 1ZS9A 4DV0B 1BXRA 4ZEVA 4PC7A 2YNMD 2CZQA 2D3TA 4GX1A 3G02A 3ADDA 3BA1A 2QL9A 3T12A 5JADA 3TUIC 5BSVA 4FYMA 1XJ5A 3ETCA 1Z2NX 1QH0A 2D5IA 1VOTA 4RCZA 1J24A 1DXQA 4M1KA 3Q10A 2JH8A 5KWVA 3KXDA 2BFNA 1KC1A 4PF1A 1K5PA 1PJRA 1RPAA 1GNSA 1XQYA 3BWXA 1KI1A 5DGHA 4P3PA 5ALZA 3W2FA 1VXOA 3HLYA 2DJIA 2W90A 2XMZA 2QRHA 3C98A 5HE8A 2WE7A 3LY9A 4AQ7A 1W5BA 5ALFA 5MHTA 1UT8A 1JAXA 2H9AA 3BL8A 4LGCA 1NN0A 3ZIDA 3TPZA 3W1VA 5KJFA 3GJ5A 1E0SA 1WMFA 1JDTA 4PLTA 4UUAA 2NLOA 3UKOA 3VPAA 2ZTSA 4JI4B 1BVYF 4W63A 4XKJA 4OQYA 5CLHA 3PVZA 4DUGA 1CQWA 1ONNA 4BN4A 3C1OA 4LRYA 3PQCA 2XKKA 4MI6A 3W05A 4QOEA 3EZ7A 3KZMA 4P4NA 1GDDA 4R4JA 1VKRA 2ISCA 4PQRA 1PKEA 4EYEA 4NABA 4URYR 2OD9A 3CRW1 3R6GA 4YRCA 1AZWA 2RJOA 4JB3A 5AHKA 1JF8A 2ZRIA 1MIHA 2QD5A 4RJJA 1JKFA 4PAWA 2AX3A 4AN4A 4C0AC 4EFLA 3OD5A 5A2GA 1FFCA 4EB3A 1JR4A 4MCJA 4CCAA 5GVSA 2NVUA 2AMJA 2JRCA 3CF0A 2W6JA 3DR3A 1HT2E 2VZLA 4UMVA 3W5BA 1EGVB 1Z4LA 1NSTA 2HNBA 4IDGA 4UXIA 1U0HC 1O95C 2HU2A 4RNDB 5AW0A 2XGJA 1W87A 1Z3IX 2XRYA 1CIVA 1XZFA 4HB4A 4RFSA 4TTIA 4Q7MB 2EBHX 3EIWA 4YMLA 5JI3E 3KHUA 2YHIA 1Y9AA 2ZZMA 1T3LA 5B5SA 1R64A 2XNJA 2I6QA 2GFQA 4MPTA 5D87A 3LH5A 3HGQA 4OGFA 5AVYA 2IE0A 1OAOA 2J30A 5ALUA 5HQJA 2WT4A 4S2UA 2XTMA 3CEAA 1HX7A 4B45A 1XZ8A 2BGUA 2L69A 2R4QA 3P9NA 3VJRA 2ZITA 2O2HA 1EHYA 1Z4JA 1V6SA 1ANKA 2HJSA 1PJCA 1Z4KA 3BIXA 2P8JA 3RRYA 1XTZA 3W3AH 1RXCA 3H84A 3L6CA 4DBLC 2RGCA 1X3LA 2IP1A 4E30A 2CHVA 5HZMA 2AJCA 3FR8A 4HSEA 2IW1A 3OPNA 2AFVA 3IULA 3T7SA 2GPWA 4E2ZA 3UMMA 4O33A 4LF4B 4XXHA 3ST7A 4KQWA 4YJHB 4ER6A 2HHAA 3F67A 3F6CA 1J8MF 3DUWA 5CYFA 4NI5A 1T8TA 2MYNA 5TQ0B 4AJLA 4DRYA 4M89A 3ZJ4A 1E1RA 1J25A 1H2YA 3MRTA 4LWQA 4M60A 2WIBA 2B1IA 4LA4A 1YS7A 3WL6A 2OPHA 3ZVRA 5G2OA 4MDFA 1R8QA 5JLJA 4B75A 3C74A 1B0UA 3DZDA 3KKLA 1GEGA 3DXZA 3GRVA 3O8CA 4NENA 2IFTA 4PRKA 4DT1A 3ZNPA 1GKKA 5L3SB 1M2OA 4UHFA 5KNBA 5GM1A 5L4SA 4DDUA 4IILA 3ZWYA 1FX0B 1RYNA 2CXHA 4FYKA 4AX8A 1RI5A 4WY8A 4QPPA 1JLSA 4S1WA 1A8SA 3N2EA 4MKGA 4AB1A 2E87A 2PKCA 2B8EA 1OD6A 2JBWA 4DUPA 2PMCA 5CB4F 1TM3E 5KNDA 1GKIA 1S96A 1U81A 2ADFA 1U3DA 3D4LA 3U1VA 3USCS 3VYSB 3WWCA 4DQLA 5CT5A 1R6VA 1ZOSA 3OZTA 4ZMRA 1YL7A 2YMQA 1B8OA 1IAQA 3RYIB 4ZKDA 1E1KA 4E6PA 5ES4B 2C2HA 4MJXA 2YZKA 5LQJA 1B3RA 1JPVA 3C7TA 2CLKB 3RU9A 4A03A 4QICA 1DIAA 1I0IA 3AR3A 1PNVA 1V7QA 3KQUA 3F9RA 3JQ8B 1HBJA 4P8RA 3IL2A 1PYGA 1Q0PA 2AOXA 5CK4A 4N0EA 3SM9A 1M6VB 3FB4A 1G8AA 1OX5A 2B3TA 1SIBE 1OWPA 4XZ3A 4V03A 5GGYA 3R8XA 1OYYA 3LT5A 4JJZA 1VJRA 1SURA 2J7KA 2ZAOA 3EDMA 2PEYA 1BYUA 4REQB 1EUZA 3MJFA 3T9FA 4FBMA 1XEXA 3HO8A 2XLCA 4Q1FA 1NRWA 3OOYA 3C3YA 3RBVA 1X1CA 2WTNA 1GV1A 1WXFA 4RPKA 4G9GA 2SECE 1PWEA 3ITNA 1Q0ZA 4YT8A 1J99A 3GLGE 3MF4A 3E9MA 4CLOA 5ESWA 2IPOA 3EG9A 4M1EA 4ODIA 1ENPA 7YASA 1Z5OA 3PEWA 3HJTA 3M81A 3M7IA 4NNOA 5F5LA 4A6XA 2C2WA 2NSHA 1DBPA 5KYKA 1PVVA 1LNQA 3DD5A 3FPKA 4NBRA 1GITA 5LJIA 2X19A 4DUYB 3EFBA 2OPBA 5MF6A 2NU8A 1NUQA 4Q4CA 5LQRA 3T4UA 1AKYA 3BMCA 4BNZA 3DZCA 1BWQA 3QPDA 3C7AA 3GZ4A 4JX8A 1XD9A 4S35A 4C20A 3QLVA 4C30A 2AA3A 2VEDA 1DJMA 3E15A 4Y0NA 3S40A 1N2CE 4MTLA 5IDYA 4FR0A 2C82A 3DH0A 2PD3A 4OI4A 3BH0A 4W1SA 5I8PA 3OT5A 1DAGA 2D7JA 1DWQA 3OPYA 2WVAA 2YRWA 2KJQA 3NBAA 1S8AA 2ATEA 4OI2A 3CW2A 4R9RA 2BBOA 2I5PO 3D7KA 3ZGXA 3UK2A 4EG1A 3A6GA 1DSSG 2JIQA 9ATCA 1OFUA 2HJHA 3IKLA 3SSAA 1IY8A 1FFGA 3O6VA 3PICA 1UANA 1FTNA 2HDWA 3PG5A 3PUXA 2CLCX 2P9YA 1P0CA 1RRKA 4OHBA 1II8A 3C15C 3IDFA 3CZCA 3A6KA 1QVVA 3B1JA 2OBFA 1D2NA 5JDCC 1TX4B 2IHTA 4ZP1A 2H1SA 1QIEA 3K32A 3RODA 4U02A 5HF5A 5CCEA 1Q15A 1Y34E 3MIZA 3V6LA 4UFOA 5JISA 4IRMA 1HDYA 4BB5A 4N0QA 2YIDA 1F0YA 3L0CA 3U62A 2ROQA 2WAAA 3MQFA 3VNRA 3B12A 3KU4A 1F48A 4PGHA 1QDLB 1NXVA 1J0BA 2V55B 1IXKA 1N75A 2VQDA 4RVOA 2WJZB 1KORA 3NBYC 4H18A 4TL7A 1JWBB 1ISGA 3A37A 3CLHA 3EIOA 2K7ZA 3ASUA 3G7SA 4OQZA 4P35A 1VSTA 1MO6A 2GERA 1NJ6A 4CI9A 5T4FA 3HXQA 1FRVA 3CMMA 1U1IA 3C3DA 1AHNA 4KLRA 6AT1A 3JQGA 5I8WA 1U11A 1E2FA 1E6EA 4CCWA 4BRWA 3QMWA 1Y5NA 2Q0HA 4JVLA 1EINA 1Y33E 2ODTX 1U8EA 4FMDB 3U16A 3G79A 2JLBA 4MGYR 3EFHA 3PF8A 4POAA 3NS7A 3HWX1 5LBUA 5IW8A 2INGX 1VRVA 3NHRA 2WM2A 3KPUA 1I01A 4N6GA 1KYVA 5FEMA 2HSDA 2FMHA 5TQVA 4CG3A 4F21A 3UJNA 5KUTA 4RNCA 5C52B 2WHXA 1GRRA 1IMJA 3O95A 4I6JA 1X9GA 3SGLA 3CZPA 1RWVA 1T5BA 3V8BA 3FPJA 2QVXX 4EEXA 3NEJA 1XDGA 3M6XA 1L7XA 2WWHA 1A7JA 1NW4A 4AJEA 1A4RA 1L4NA 3LOQA 5AUPB 3ZQJA 5JXJA 4CPDA 2FR8C 2HT6A 2O5VA 5BVHB 5JMTA 2PZ8A 3KQKA 3M83A 4J0HA 2J32A 1K8ZB 1W0JA 2AX4A 5IC6A 2H57A 4HVAA 3GLKA 4A8JC 1SOMA 1J8YF 1T3HA 1GPNA 1N5OX 2W6OA 2JGNA 2GBIA 3CF4G 4U5QA 4TQGA 4ZALA 1T1IA 2EG5A 4YNBA 5H5JA 3VOTA 3SC4A 4XTCS 2JGDB 1R9NA 2X6QA 4HH4A 2ZVJA 3UT5B 2YXNA 3RHSA 2E4ZA 1Q0HA 2PYZA 1QONA 4UOEA 4OKNA 3QX3A 2BZ0A 3D4PA 4X1IA 2WSBA 5ECGC 3VVLA 2PX4A 3KG2A 3FPGA 3N5KA 2Q1UA 2C2KA 3RJMA 1QBKC 4KE6A 2O5CA 4K7JA 4MVJH 1JXMA 2DRIA 2IELA 3S2YA 4P81A 1F9EA 2IVFA 2GH1A 2TMDA 3IE0A 3QF7A 4ITVA 4ZOLB 4EO7A 2ZI3A 3ES9A 2Q62A 5CIQA 3G82C 2BP7B 4C6TA 2AG1A 2IITA 2DR3A 2H3EA 3VHXA 3ZDQA 3DR5A 1AUXA 3NAMA 1MOQA 2HI0A 3MT8A 2Q50A 3O9MA 4EITA 3DBHA 1ULAA 2GK4A 4D8TA 3TTTA 4DR6B 1W19A 4M46A 3PJDA 5E1OA 4B7UA 2DPMA 3L4EA 4XUCA 4YAOA 4P0QB 3SXPA 1EGMB 3HC7A 1P2UA 3IEUA 2H17A 1ZJ6A 1V8DA 2OBBA 4IRXA 5HBRA 2G0NA 2PM8A 3WNQA 1KY5A 2IYRA 1BO6A 3KV3O 4P31A 2R6CA 4GKAA 1USIA 3DXXA 1CFJA 1GZ4A 3GWGA 3P9RA 3FZNA 4G1EB 4Q3OA 3ZK9A 3B36A 5FA6A 3VNUA 4PCUA 2I99A 1UBSB 4Y6OA 4M54A 1G8FA 3HBMA 3EOBI 3N2KB 3EW9A 2JAXA 1CUGA 4FFSA 5BWOA 1T8WA 2JA1A 3HDGA 5HF6A 4GKBA 3TSAA 1FXSA 2JHCA 1VL2A 1L7MA 2OKGA 3FWYA 2R7AA 3IOMA 4LPSA 5H80A 4RIFA 4BJHB 4MW7A 5HILA 4C4RA 2PY6A 2FW0A 4ZI7B 2WWIA 2ZBFA 4EECA 4ZFNA 5JQGB 3PXGA 3PIRA 2J9FB 1SKBA 4MLCA 3ZWAA 4HYEA 1CJKC 3QE3A 4BC0A 1RP7A 4PN7A 3RFUA 1HSZA 4CNQA 3OZDA 1FC0A 1U02A 4RMHA 2KLHA 1W88A 4NE2A 4RVGA 4A3SA 3L6UA 2OO3A 1WPRA 4JBHA 1QANA 4YRKA 2XCUA 1GPLA 3JS5A 1JDNA 1UPAA 1HETA 3IAEA 5F7JA 1NU6A 3RK0A 2C8JA 5F2OA 2NV2B 2QZ4A 4X7BA 1F12A 1I33A 3THYB 1D1SA 3R8CA 1KH2A 2UZ4A 1ZR4A 4C04A 3O4JA 2JGMA 1PR0A 2HF9A 5AUQA 2XY4A 2XTNA 5E3JA 1DP4A 2EKBA 2C61A 1PQYA 5AK4A 3FMVA 2AOWA 2I8AA 2NPOA 3VJMA 3WFZA 2GZSA 2VUSA 1SVMA 2P6NA 3AETB 2CCJA 4OVKA 3QE9Y 3GRRA 3LKVA 3BF8A 1L6IA 2I65A 1ADGA 2Q4OA 3LZ6A 1RDFA 1E3QA 1U5BB 5SZHB 3WXBA 3DZHA 3K8OE 4GW3A 4WVFA 5CA1B 3NIDB 3KQSA 1YFZA 3K9FC 5ERXA 3G2OA 2X7HA 3IXLA 2Q4RA 4W7HA 2DECA 2BSXA 3GR6A 4Z4CA 3II6X 2COEA 2KB0A 4KPFC 2UKDA 5AP9A 3HUFA 2FW8A 3CRZA 4HY3A 4ZDKA 2XUQA 3LQFA 1I4OA 1W9MA 4RSMA 4F1KA 2CUKA 3GZJA 2GN2A 3FFXA 4B2LA 1SUSA 3GD7A 4Q7JB 4E1VA 3A31A 1RRCA 3B38A 2D5BA 3TCKA 3AUXA 3IUJA 4V0SA 4FFLA 3T06B 1J42A 2J6HA 4E5DA 3PFWO 2NP6A 3AFGA 3OM8A 1YB2A 4MRRA 3UBMA 3RR2A 2WU1A 5JR3A 5JS8A 4M21A 4BQPA 3U7QB 3JZMA 3Q7QA 4Y30A 1EHIA 1ESZA 2HU7A 5SZJA 4F46A 1KYTA 4DLVA 5KTNA 4DLUA 2NV0A 1DC3A 3D2BA 4MXDA 2PEZA 2A5GA 1BMDA 3DL7A 4JBGA 5JSYA 3W4IA 3PUVA 4D0GA 2SKDA 3KWFA 2GLUA 4FWTA 4CMIA 1YI8A 2NG1A 1OLXA 2XNSA 2ZSIA 3MLBA 3ADPA 4J7CA 4JBNA 4A5OA 4AF6A 2ZS9A 3DEFA 3M0EA 3OC0A 1ZU5A 4B8ZA 5INTA 5IXJA 4BFUA 4BX2A 3LDFA 5E95A 3WLMA 3WWEA 3ORFA 1U7PA 3VOAA 3H2IA 4JBXA 2ZDQA 5EIFA 3TJRA 1CVRA 1Q11A 4YI5A 2WPNA 3GRKA 4BNDA 621PA 1HNXB 1MABA 3HXLA 1K7EB 2WABA 3L2OB 4RGYA 1EFLA 5AKZA 4X8LA 2FLVA 2HGSA 3E2IA 3PDIA 4MHSA 4WHMA 2P5YA 3DLAA 5EERA 3S1AB 3VC2A 3TIIA 3TECE 1VMAA 1K92A 3IMKA 4GBGA 5COBA 1U0SY 3FVWA 3O8NA 3N8GA 5TNXA 1QOQB 3T7JA 5JFTA 1EXMA 1N7JA 1DBSA 5AHWA 3QX7A 3VR5D 4BJ5A 3ONNA 3BH6A 1U7OA 3JQ9C 4QQFA 2BKVA 3TLEA 2G1PA 2WYHA 5CEJA 1TT7A 3AUYA 1PKXA 1KIAA 3E9EA 4MQ5A 2FZ4A 4RIEA 1NBHA 4GG1A 2IUTA 4RIIA 1PRYA 1O87A 2Q7DA 3JASB 5IM4A 3SHFA 1I2MA 2VLBA 2YFQA 1NNSA 1T9CA 2HLNA 3E7DA 1NN5A 2XNKA 4EYSA 2DERA 4GM0A 1MGOA 1P7WA 3RKUA 5EL0A 5FAKA 1EQ2A 3L1UA 4PLVA 4X92A 3DMTC 4R71A 2GQ0A 1QGZA 2C5BA 1X80B 3AWDA 3F5DA 1F7UA 2YVUA 2ZT5A 3TDMA 4ZXPA 2D1QA 1M74A 5D7BA 3PQDA 4POOA 5CX4A 1B1CA 3DCYA 2O1XA 4DB2A 5AVZA 3TI9A 2HQBA 3NC1C 3ZQUA 5A6VA 4LFAB 4D4JA 4Z4FA 2GEFA 3CUVA 3L0DA 2N1BA 4TGLA 1ZH0A 4PBSA 2XXAB 5I9SA 4JJ7A 1A96A 1ZEJA 3L06A 4BNXA 3KRTA 1SOAA 1X1TA 2EZ4A 1EBBA 3PCXA 2I2XB 2G28A 1DQYA 3BERA 1MCZA 1YZUA 4MS4B 3BHJA 1VKHA 3GPCA 3P5BA 2QUAA 3IVAA 4W1PA 3PFIA 5DCYA 1PNRA 3K9QO 5HZGA 2B8JA 2PQMA 4INPA 2V8BA 1P39A 1WCIB 5ALDA 3G2JA 4MR9A 3WYCA 4DDHA 1FUUA 3BXGA 3ZWPA 1N1DA 1VG0B 4KN6A 2X42A 4ZTUB 5L6LB 4AUMA 1ULTA 4N54A 4DR3B 5BOVA 3EZGA 2CE2X 2VJAA 1MAUA 1H1LA 1V1MB 2A9KA 2F3SA 2XE6A 4AT1A 3VMFA 4ECEA 1DE0A 2ZSE