4XM1A

N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the presence of cadmium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
VSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Metal binding protein
total genus 99
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm1A00
3DFKA 2IXDA 4XM2A 1Q7TA 5B2EA 3WL3A 3DFIA 3DFMA 4XLZA 5CGZA 5BMOA 5B2FA 3WL4A 3DFFA 1Q74A 2X9LA 4EWLA 1UANA 3WE7A 4XM0A 4XM1A 2XADA
chains in the Genus database with same CATH superfamily
4LJ6A 1JFRA 4QLAA 1E1RA 2X8JB 3DVQX 5MGNA 1Z17A 2FZGA 4RCVA 1KAOA 3O9ZA 3I2KA 3R2JA 4KQJA 4ONEA 1MV8A 3WJ2A 3NWOA 1WUJS 1DRJA 5IT5A 3DL2A 3KTAB 5IXJA 3GH3A 3RKSA 1A2QA 2RE8A 221PA 4KTTE 1JSXA 3GVIA 2R96A 4MYSA 3IH5A 3GFSA 1U8UA 1ZGJA 4NWIA 3RRMA 3SHWA 3PYMA 3U80A 2C7PA 1T36A 2M2IA 3OZEA 2G06A 1DKPA 2PN1A 2XGGA 1GNRA 4GLJA 4QEKA 2ZROA 3GLFE 2ZYWX 4Z51A 2PYIA 4EMSA 2XCLA 3TH5A 2YWRA 3AL2A 4BU0A 2CL7X 2HHLA 2BFBA 4TV8A 4C2AA 1O95D 1U0NA 2J9FA 2ZDGA 4HGQA 3CX6A 1RI5A 1EWRA 2QORA 3QOYA 3H8JA 3K0SA 3U4AA 1KARA 2B4AA 1XCGB 2QS9A 5BVHB 1XMQB 2V6BA 4C29A 4NBNA 1R4ZA 3CXRA 1KO8A 5CEFA 4NCJA 2YQ5A 4YNBA 1LGYA 1M1ZA 3KL4A 3BTOA 3KAJA 3ETGA 3DA8A 1CEYA 3DL0A 3G1UA 4EABA 3DEJA 4XM2A 3V4FA 4YLEA 3LC7O 2UUAB 3NTXA 2G5GX 3CZ4A 3R5HA 4WVFA 3UM9A 3OWOA 3WB2A 5AI4A 5IJ0B 2I1LA 3KZCA 3WGLA 1Q1NA 5CA1B 1H6CA 4RHCA 3HJHA 3RBZA 2D13A 4NAUA 1P0FA 4B83A 5BV8A 1TIPA 4RMNA 2IF0A 4WN9A 1E4EB 4OLJA 3EWAA 1JFVA 5HCIA 2YJGA 1IJBA 2ZR8A 4MRVA 3LIIA 3ZPXA 3JWPA 1HQDA 1EZZA 2W6JD 2JGNA 3B48A 1V8PA 4OKSA 4H4DA 2ZJ6A 3FFBA 2IYQA 4GC9A 4D6XA 1RJ9B 1T3HA 2GZ1A 2QW8A 3MPUA 5FHQA 2WOOA 5DLYA 1B8OA 2IDZA 4TTIA 1O6GA 1ZIPA 1WB5A 2VYNA 4PWYA 4PYMA 2Z95A 2XOKA 3O4FA 4CV3A 3DNPA 4PSCA 3BBPA 2B8NA 1XFAA 5CT5A 2ZTMA 4GNKA 3LKVA 4FFVA 4IZ6A 1R8JA 4LSMA 5HUJA 3BRQA 3B8HA 3D8UA 3ES9A 4AKGA 4HXFB 2W98A 3LS2A 2QEQA 2JBAB 1FBNA 4HWPA 1CY7A 1I6MA 4INPA 3GH1A 4ZCLA 1CF9A 1N2JA 1C4OA 2JIMA 4N3CA 2ECQA 5KTTA 4UE2A 2MYNA 2FMIA 1Q1AA 3CY6A 4K9SA 3T35A 5HRAA 2VOEA 4Y6RA 1USGA 2MSWA 1YRBA 5DBOA 1RWMA 3WSWA 4OHOA 1MRNA 3EGEA 3OCZA 1ESCA 4PCLA 1CUHA 3PZBA 3VDQA 2FE1A 3GDHA 1H3FA 3BXOA 2XT0A 1T8PA 3JQRA 4Z1OA 5D01A 4YPVA 2PKXA 4M83A 2Y93A 4Q93A 4BGDA 4WT7A 1Y80A 2C0QA 1ODFA 2E7ZA 3M9WA 4X7BA 3K32A 1C29B 1KMNA 1UDWA 3MTQA 1WDMA 1L7EA 4GZ3A 5HQ3A 3T1TA 3UB3A 3WRWA 5IP5A 1I1HA 5JASA 5DW0A 3BMXA 3EFBA 5I4CA 4FZVA 3FD8A 2B8WA 2G3YA 4LMBA 5IXSA 1SOMA 2J3QA 3MELA 4MJXA 4ID3A 1Z18A 2PD3A 4TXLA 3NOQA 1IN6A 3MWLA 4N6NA 3TNDA 1ZZEA 1RWOA 1U8CB 4D6PA 2VDKB 4B6GA 4AO7A 1WL8A 4TLLB 3UT5A 3JRXA 1EFPB 1EAYA 3AC0A 4HWRA 4C7MA 4H27A 1JHRA 1IH8A 4PGHA 2WTMA 2OHJA 1S3IA 4MQEA 4YRSA 2C9MA 2J46A 3OM8A 5HFJA 3SHTA 5AW3A 1UC4B 1Z7GA 2GNPA 2NPIA 4G0WA 4QDZA 2CDNA 2O2XA 3KDPA 4FHFA 3PE3A 4OU4A 4ZQIA 3ZE9A 4M87A 2YDYA 2I7VA 1V4BA 5K9ZA 3I76A 1NC1A 1PR5A 3K8OE 3X2EA 5CHYA 1VSTA 1YR1A 3K09A 1I7NA 3G17A 1YL7A 2ZT5A 3AUXA 3GRAA 1QYRA 1CUWA 2XHZA 2YZNA 3JQDA 3LW8A 4MQBA 5DJ5A 2CDRA 3L1IA 2ZYRA 3E7WA 5DYTA 1Z2DA 1RRMA 3M5DA 5B7PA 1H4QA 3ZZUA 1ZD5A 4XJXA 2P30A 3DOJA 1GVNB 1GL9B 1MQSA 3IB6A 4LYDA 4X9XA 3G9QA 5FQNA 2H16A 2PFKA 3MEQA 3WFZA 1TF5A 3ITKA 4TV9F 4EHLA 4O4JA 6REQB 4LOJA 1RXCA 5A62A 2WU8A 1VKJA 1N57A 3LQKA 4Y6SA 4CEJA 1MPTA 2D62A 2H9IA 4HJXA 1H8HA 5JCOC 7ABPA 1E1RD 4RO0A 4Y1RB 1JNYA 2OG2A 4HQ6A 3EGDB 4RKEA 3ZW7A 1SBQA 4WXEA 4RD3A 2Y27A 5A06A 2NUPB 4XDZA 2FZVA 2HA3A 1MO4A 2XXJA 2XUGA 1QBKC 1VPDA 4PLGA 5I7EA 1DO2A 1HYEA 3H3JA 1TT5B 2LW7A 4WZZA 3ZUGA 4BP9A 3RTCA 3KHKA 1F06A 4F0JA 1X92A 3N86A 1H66A 3MWKA 4HH4A 3WSTA 1WPQA 2EQ5A 3BUSA 2J5KA 3HUFA 3W6PA 1KP2A 1WE2A 4Y9UA 4ZARA 3RS0A 4OHCA 2ZTHA 4FOTA 1OZGA 3PJGA 2N3ZA 1R8YA 2ZJ3A 3BULA 1Z4IA 4V0OA 5LMCA 1K66A 3LBFA 4QFDA 4TRJA 2XTAA 4ANFA 1JLSA 4MHSA 3E9EA 2FDXA 1V5FA 4LDRA 4RDHA 2H92A 1W48A 2C5FA 1O9HA 1RQLA 3GA5A 4TWBA 1X1DA 5JLJA 5JSYA 3N70A 4I3HA 2DY1A 1U2GC 2PR7A 3KPYA 3QVSA 5AJVB 2GM3A 5I9BA 2QI9F 4BQOA 5I3CA 1NPDA 10MHA 1PG5A 4UCFA 1LSOA 1Z2CA 2RGYA 2W83A 3PHHA 3WLQA 3KQNA 2BMJA 4QOJA 1PGOA 3CLKA 3SYKA 4C3UA 2C8KA 2XZTA 4IRMA 1V8DA 1L3BA 4UTZA 1RC0A 2CFOA 3ND6A 4YQFA 1X8KA 4PBRA 5CA0B 1FW6A 1YAHA 3KZVA 16PKA 2OCXA 2ZR9A 2BFAA 3TCKA 1M1NA 1KORA 1UINA 4PYLA 5AH0A 3WQRA 1ZNQO 4RPKA 4EKIA 3R0VA 3MGGA 3ONEA 3PNLA 2ZRQA 4TZKA 3WLOA 4AYWA 4BAGA 1CU1A 1G9SA 2VYND 4XWYA 5CAEA 1AKYA 2PSEA 2XNSA 2XOKD 3KU4A 4HNGA 1IN1A 2CHQA 2PBZA 1T2VA 4O8ZA 3HUEA 1FPMA 1QB8A 2HCRA 5K99A 3JR7A 3NC4A 2FJ0A 4TSKA 2GF2A 1U1EA 4C4SA 3QXGA 5EXSA 5I9IA 4P4NA 1I33A 3U3MA 2H29A 1T5OA 4KR3A 1L1QA 1A4RA 1YBMA 4L0DA 3ZK8A 3ASYA 3HCAA 3JQEA 4YI3A 1NN1A 1OYWA 2GH1A 2GAAA 1TKCA 2BEUB 1MB2A 3O6VA 2EFYA 3KKQA 4K6GA 2ZTUA 4L6IA 1C1DB 3UW1A 1MUUA 3ZX5A 2MJLA 3KNZA 4JS0A 3BD9A 1G20E 5T67A 4BZWA 3WFJA 3MAGA 1J9EA 3GMSA 2O0KA 1U2SA 1JDBC 2H18A 1JLKA 4I8DA 4JEMA 4MCIA 4XR4A 3GMTA 2I7TA 2YXEA 2FFHA 3W1WA 1TK3A 3B38A 4Z0TA 1TU4A 4TL6A 1VPVA 2BTQA 1H2EA 1T1IA 1PV4A 1JRLA 1H0KA 2W0SA 4R4JA 1XEFA 4L07A 3EZ6A 4DR5B 4FHZA 1PT9A 2IDKA 2X0NA 3H2BA 1II0A 4H31A 2KLBA 1RWXA 1ZGCA 3GARA 1U2DC 5HBGA 4QYWA 2VQDA 4BATA 4EW6A 1F1JA 4I19A 4ADSG 1NYLA 1JB9A 1KY2A 3H4IA 4EBFA 3WLTA 2IEBA 1A9TA 4KYVA 3BS4A 4HH0A 2G6TA 1GL6A 3QBJA 4EPWA 1XD8A 1CHNA 3EB9A 3MVEA 4FZJA 5ISMA 1XMSA 3HB0A 4EPVA 2VWPA 3A9VA 4FDLA 1L4MA 4PLCA 4WOJA 2FVXA 2Z43A 1LBIA 3WK4A 4QT4A 3RJ5A 1C0IA 3MLEA 4EY7A 4DMLA 2HPAA 2XKKA 1XMOB 1HKHA 5FTNA 2WSIA 1GCGA 2WUWE 5HIJA 4DC1A 2CFSA 3NBQA 1M1YB 2JFQA 4IIBA 3MB8A 2V7VA 2PH1A 3K9QO 3T3MB 5JT1A 3UFBA 4U2KA 4YXWD 2EDAA 1JWBB 2PSHA 4JJ7A 1I3KA 1LNSA 4LDZA 1PFGA 4YFVA 4L3VA 2AV6A 1TUIA 4QODA 1GV0A 3RSQA 4D74A 1UAGA 2XB6A 1EP1B 1B0UA 2IY8A 2PMKA 3PJDA 5AKXA 1T9BA 2NUAB 2NOAA 1KPHA 2FW1A 3TLEA 3VMFA 4V02A 3ZVRA 5JI3E 4C3OB 4ZQCB 5DLPA 4ALMA 1ZC4A 1GQSA 2Y99A 2ZWPA 3ND8A 2M6SA 4HY3A 3V7NA 1VRWA 4B4VA 4EDHA 3EGXA 2KWIA 3UHOA 4R8VA 4BKPA 1C2TA 2GK7A 2GJKA 4ZPJA 4TLCA 1H8HD 3ZKAA 3ZV5A 2V0GA 2F1HA 2P5TB 3OQMA 1BMFA 2J6IA 1ZN8A 3KKMA 5HRCA 3NAGA 3ODGA 4NBWA 4CMIA 2W71A 4PZ9A 4C9BA 3IILA 2HFKA 4C4TA 2VOJA 3DGFC 3KJNA 1UC9A 1E6CA 3FZYA 3MD9A 3PDCA 4J8PA 2O8BB 3DV2A 3KL2A 1D1QA 1EE2A 3AIOA 3FNBA 4MRMA 3V7FA 4A2QA 3ESQA 1DAIA 3QYFA 4TV8B 2PBLA 4KIWA 4L1KA 1G19A 1PGQA 4O0LA 2FZKA 1LC0A 1QHXA 1GLGA 2YFHA 3A4MA 3GZNA 4LCJA 3VPDA 4A82A 5E6UB 2H8KA 2EC5A 1O7JA 4AROA 1FDUA 1ZXXA 2MHCA 4R01A 3HP1A 3RAFC 2YIJA 1ORWA 4WJLA 5DGHA 2JDIA 3Q3JB 1TVEA 3QZUA 5FOXA 4Z3KA 5KTYA 4JOBA 1L4GA 3BHIA 4XXHA 1DMRA 1TJNA 2OV4A 4EF5A 4PXSA 1P44A 3EGOA 4FFLA 4FNOA 2ADMA 4HEA6 4N7RA 1WB4A 4HV4A 1N7HA 4QYIB 1WW3A 4EHJA 3J81k 2WWVD 4HUTA 4HJRA 3V34A 4D9JA 2R8YA 1DXHA 3HJFA 3WE7A 4HDQB 1TAHA 4WN9B 2B37A 2K4MA 1T34A 4BJ1A 1XRMA 1XZDA 1Z5OA 2Y71A 2YXNA 5KOJA 4HN4B 4V0KA 4OX9B 2OO5C 1C8VB 4JDPA 1UUFA 2FVYA 3MIIA 1RRPA 1V16A 4FLEA 3OPNA 4L7VA 1GYPA 3C1OA 3ZWXA 3TZEA 4AIRA 1BA3A 1KKUA 2G67A 1VLZA 3V4PB 5ALIA 2GCNA 4PO1A 1S01A 5DIZA 3IXQA 3ZV4A 4HRAA 3EBLA 5L3RA 3LHDA 1JVSA 1R16A 1R4NB 5DNWA 1GSOA 4OF4A 5BURA 4MYCA 2VFAA 1CZUA 2NZYA 1KMQA 1A5AB 2OK8A 1W85A 4QUAA 1KETA 5A4MS 5IF3A 1YIOA 3GJ6A 3UFXA 4BFLA 5KNCD 4R1QA 3QRWA 4UNPA 2JZNA 3H9BA 2HYDA 1K9VF 3BL8A 5FO0A 2NX2A 3GGSA 3QFCA 5FLKA 3H1BA 2IW1A 1C8BA 2VTEA 1RYEA 2IIPA 3AY7A 3FNRA 5I9LA 3BH6A 4KSBA 2OXCA 1WRBA 3DPSA 2I6UA 4J0GA 5HQJA 3RSHA 1FB5A 1T8UA 4V2UA 3ZQ6A 5KHOC 4TLAA 4BPBA 1BTOA 5HM6A 2ZSEA 1V95A 1LI5A 3INNA 2GM5A 4IL5A 3TIIA 4BNDA 1H8EA 3SYLA 1Q0HA 3FGOA 4MWSA 4TUYF 1D6JA 3UPDA 3CU5A 3H2ZA 1TLTA 1ZHFA 1O8CA 3IMFA 4HLDA 2NYUA 4RGBA 5HQ3B 1BEUB 5TMEA 3C1UA 4BNYA 2UUPA 4J3FA 4CXMA 1HH4A 3RABA 5FRDA 2MU1A 4TXMA 2I8LA 5AW2A 3FGNA 3UHFA 2XVXA 4LRSB 3DV9A 3H9CA 4RZ3A 4UU7A 3S2ZA 3TBKA 3WLPA 5JXGA 3OBIA 2VSNA 2RFLA 2VSXA 2P9JA 4B44A 5LNK6 1V5WA 3GXBA 1RLMA 3UT5B 4F56A 1OROA 2FFBA 4P33A 3FI9A 4DQ0A 4B8ZA 1XZQA 2CFIA 1RWKA 1NSYA 2FH5B 3QU4A 4R16A 3L6UA 1O57A 3ESCA 2HA7A 3RSCA 3EEFA 3ENNA 3LIPA 1UXOA 3CR8A 2J0UA 3AI2A 3FTNA 3FZQA 4DRXA 3VU1A 3GBSA 1ZGZA 3LTNC 4LVCA 4OA5A 2NZJA 2Z0MA 4ETNA 3ZS8A 2ZI6A 1SBIA 4IJKA 4M49A 1OBFO 3RVPA 4JYAB 1C1YA 2A58A 3HSYA 4OTZA 1ECJA 4I5IA 4BMXA 3RUCA 5G53C 4BLPA 3DBHA 2P9BA 3GJ4A 5CLLA 1E69A 5GVSA 1WOMA 4BNVA 4O4JB 2P11A 1CF4A 2O6LA 2C78A 3LXMA 2ONKA 1YHNA 3RQSA 3PGKA 2PZ8A 5BMVF 4KV9A 1KEVA 1IB0A 2RI1A 2D06A 3AETA 3EVBA 3OAAA 4EQ6A 2ACVA 5EL0A 1VGQA 4Q1CA 3A7DA 2PX3A 1A0OA 3Q7QA 1P74A 1IWBB 3A1FA 3NHZA 4FC6A 1T9KA 1DC6A 2PSDA 2OM2A 4TKZA 4B9EA 2GM4A 3LY9A 3CC8A 2WKSA 4KHPB 1BMFD 2AI1A 1IIBA 1OGJA 3HJRA 5GAJA 4F46A 5EN4A 4MGIR 1UFRA 4IVNA 3L7CA 2QRHA 5TEVA 4AN1A 3LD9A 1NW5A 3IDSA 4N5MA 4ZOQI 2O0MA 3KFVA 1YJQA 4XCXA 4YAIA 1D3AA 5C7IO 4XI9A 2W6MA 2C2ZA 3GWZA 4WL0A 1LQUA 1KA9H 1OZ0A 1ORDA 4D4GA 1UPTA 1UC5B 4BPRA 4WBNB 5AVZA 3FNFA 5LSAA 5HKKA 3D6JA 1JDPA 4ROSA 5EA2A 5M3BA 4F3NA 1NQ5A 3QKRB 4JLUA 1ZWKA 5BSMA 2J7PA 3PDJA 1QHGA 1BJTA 1GT6A 3EXIA 3N2KA 1RDFA 2JDID 5CMLA 4NXMB 2Q8PA 4U6NA 1JIVA 4YGYA 1Q15A 1A8SA 1UOOA 2P5UA 5ILQA 2NT3A 1CY4A 3ZKWA 3SR4A 4PZAA 1NVTA 3JARA 3O83A 1T8SA 421PA 1N0WA 1ZUIA 4GI5A 3Q5EA 5T5QA 2RHWA 4OCZA 2QIOA 3FTFA 2C4HA 3VHQA 1V7QA 4L51A 3OQ1A 1KAQA 1N1EA 1KBZA 2CHEA 3IGFA 2BI7A 4DM4A 5C5DA 1I4WA 1NLUA 1CNEA 1GRCA 2QTTA 2CFTA 1M1NB 3BH7A 4QDTA 1AXRA 1XD9A 1E6UA 2A94A 2Q1UA 2ZE6A 5FHRA 4DLPA 3UMYA 3NBUA 4JQYA 3G2HA 5HE9A 2WIDA 4WZAA 3F6SA 2IXAA 3U37A 1UAYA 5ICFA 4GSLA 1H65A 5INTA 3TFOA 3OVMA 1XCPA 3A9SA 4GAEA 1Y1KE 1QXSA 3CNNA 3FHJA 4FEYA 4GRIA 3ZV3A 3DOFA 3IVCA 4A2WA 4M9UA 3D7MA 4NBSA 1G8HA 2GCOA 4U7GA 4U1RA 5AR1A 3UV7A 4FW8A 4HRVA 1MIOB 2J67A 3BHMA 1ABBA 3N2LA 1TK9A 4E2WA 2PZAA 4HH3C 1S2LA 3L3BA 3ZTWA 1QTQA 3LG2A 2Q1WA 1R7RA 4HCJA 1ZOLA 3IV9A 3VPFA 1ABEA 2V4MA 2INGX 2R79A 3CNOA 1UJ6A 5B3LA 2VHQA 2IU4A 2B7BA 2IVZA 1XRNA 4QNRA 1NOIA 4QYMA 4TTQA 4QA9A 3BEOA 1R4AA 1XJ5A 3JQQA 2KI5A 4QOSA 2QM7A 3O8CA 1H8ED 4DM7A 4NATA 3IOYA 1KO4A 1XTKA 1FFSA 2W6QA 3AV3A 4HSGA 3QLUC 1NM5A 1YKGA 4UHKA 4JY7A 5HJ7A 1WHSA 4G85A 1C4KA 1T13A 3AYZB 4DA9A 4QX6A 2OZLB 2PUWA 4GFDA 2HV9A 2R5NA 4GLOA 3N0VA 4JODA 5JAQA 2C5HA 2OUIA 4S3MA 4LBZA 3EXHB 1GZHB 1UBSB 2Q4BA 1CC1S 3VOBA 1LNQA 3JQCA 4ZT3A 3JZDA 4LF4B 5CURA 3R0ZA 1M6NA 3R40A 1GL7A 3G0DA 3R5JA 4YRTA 4C6HA 1Y5MA 3UWKA 2JAHA 4LRTB 3FA2A 2RJNA 4FYVA 3LHKA 2KSQA 1AXGA 2FKNA 4LDNA 4IW3B 2ZIAA 3KQHA 4G0VA 2H8GA 4YRRA 1PHRA 1YCHA 3IR6A 1ADCA 2P9CA 5LUAA 1LDMA 2R7AA 2Y4OA 3WB1A 4DC9A 4GW3A 4YJ3A 1EFHA 2R68A 5GONF 1BMQA 3ZK9A 1E0DA 3E7FA 1NRJB 2PAFA 3EVCA 4AQYB 1G5FA 4ML3A 1SVOA 1NTOA 5DSTA 4IS3A 4M7OA 4D4HA 1F48A 1MAAA 4AW9A 5AI8A 3IRUA 3T06B 4D0NA 2AG1A 3BFXA 1T4GA 4KTVE 4DUPA 5LZ4A 2EFJA 1A5SB 2GTHA 2N42A 1DBVO 2IYOA 2YHIB 3I6YA 5G40A 1B76A 4KWIA 4ECAA 4XIYA 1UT6A 2GXQA 2X7JA 3NVKI 1BHO1 4UAUA 2QJWA 3L7KA 1IJFA 3AWDA 2IEGA 2I99A 4HVCA 2VJQA 3QKUA 4MVJM 4ZHQF 1US8B 5GZ6A 1AQNA 1WETA 5F3DA 4CEIA 3HB1A 3GEMA 3OAAD 5HXAA 2G04A 5BN5A 5LOVA 1G6OA 3PHJA 4Y6PA 1AA9A 4AL4A 2FPGB 2ISCA 2W0MA 4LYAA 4TKVA 1ES9A 1P5RA 1PZHA 4MKHA 5CVJA 5G0TA 3W1VA 3JYOA 4A3SA 3KQMA 4HDOB 2IU0A 5F9HA 5ESXA 3NOVA 1R27A 3UGQA 4ESVA 4RFVA 5ALRA 2IWHA 1U2PA 1Z0ZA 3V4VB 5KJ6A 1ESNA 1Y81A 4OQNA 4XPIB 5KJCA 2O3JA 1FJ2A 2PSFA 4LFBB 1F38A 3GZNB 4PQGA 4TXJA 1X1QA 5HHTA 1IOZA 4G5FA 1IB6A 1OC2A 2VDRB 3DLPX 2R4QA 4ERXA 2QR3A 3NM6B 4J2HA 4ZQFA 1QP7A 5JV5A 4FM9A 3UCXA 4L73A 4HAOA 3ZH2A 5HKKD 1KZ9A 4OBWA 2YXBA 2H1RA 4JP8A 3CZ9A 5K01A 2J7PD 5HCNA 3QXCA 3RD5A 3SZUA 1IATA 4REOA 1IY1A 1MT0A 5ADUS 5CDHA 3SVTA 1NLYA 1O8BA 4LXXA 4YMIA 1LK5A 4FPXA 1GG9A 1WWKA 4CL0A 5KYTA 5EWJB 1VCNA 1ZJ5A 4WCFC 5EJ9A 1WV0A 1RQPA 2H54A 1CZOA 1LH0A 4BNXA 1P6UA 1WR8A 2WRZA 4R3NA 3JD3A 3LT2A 5ALNA 1A9OA 1V37A 4XEUA 5CPBA 1V16B 4OHRA 2R5WA 4OSPA 2PCJA 4ED9A 1TI7A 3R5XA 4AN0A 1P9NA 3Q6MA 2WE8A 4QHSA 5T6BA 1TW2A 1GTG1 1JJ7A 1QFSA 2B9VA 1P2SA 1SZJG 2PBFA 4JJ6A 2A9FA 4KLZA 4KOEC 5K7SA 4UE6A 4WEQA 3QVKA 3SLKA 3SX2A 5J4HA 3IX7A 3HJUA 4JC8A 3TL6A 1QJCA 2JAPA 3LLSA 1A50B 3PXCX 2PT6A 1PFQA 3GLHB 5GM2A 3W9YA 3TOCA 5BWBA 4ZVNA 4LW8A 3TVDA 1JAYA 2MCFA 4BFXA 4KXMA 3CLRC 4Z0HO 2I2FA 5NLLA 2CB9A 2P2CA 3GIDA 1QGAA 4M21A 1AC5A 3O4IA 5EJIA 2VJMB 4IJ6A 4NZZA 3WDMA 1N6NA 2D1SA 1ZA2A 3PUVA 3WWOA 4TVKA 1ZVJA 3VFDA 2Q0HA 3SIWA 4EA8A 4JU9A 2F8TA 4TLMB 1N3LA 1UK6A 1V3QE 2PSJA 1Q50A 2QTMA 3PEVA 1FYWA 1K2VN 3K0HA 4J6FA 4AJ9A 1FMJA 2KLHA 3BX1A 2W2TA 3GLRA 2EHDA 1A9ZA 3KQKA 1OKKA 2R8OA 4ZYXA 3N6XA 5CVVA 4ZOBA 2YYSA 1IEWA 1M74A 1PV1A 2B3TA 2G4VA 2W2PA 1U8YA 4NYMR 5BN4A 1HA3A 3EIXA 4ZANA 2IUSA 1VL5A 1YFJA 1KPGA 1QDUA 5F9MA 1ETHA 1L5YA 3BRSA 1CRWG 4AG3A 3Q1KA 1CY6A 2GRAA 3VOAA 4DQLA 3IQHX 1MFZA 4UOQA 2VCEA 2QVXX 1JPVA 1JYEA 1VBMA 2ZBDA 3V8QA 1B23P 1WP9A 3IPCA 2R8BA 4PHCA 4QFCA 3TLMA 5JAPA 5IKXA 2OAP1 2I55A 4WA7A 3ADBA 2C2XA 3L6BA 3TRIA 1JBEA 3RS7A 4LY6A 3TSCA 1Z36A 3PTLA 2HA6A 4AQ7A 4UEQA 5EXXA 5AHWA 2A0KA 4DRXB 5BSWA 3CZ5A 2PGXA 3H5IA 5IW8A 4BMYA 4A6DA 2B6HA 1PFVA 1V1MA 4H3SA 4G1VA 4HZUA 1HFEL 1WV1A 2OO3A 1JLLA 3JQ7A 2ASEA 1X70A 2DSTA 4FHDA 3AHFA 2XRFA 3T5BA 4WXHA 2VDMB 2GZ3A 1SAYA 3W5IA 4ON9A 4GU5A 2AQKA 3P1JA 4WW0A 5J3JA 1CETA 4B3HA 1VHDA 1Z7BA 3K6JA 4L5JA 4PV7A 3GQBA 1K7CA 1IXZA 1FFDA 3RREA 4IDEA 3QVMA 3WDSA 2O8NA 4E12A 5E0OA 2IEIA 2P67A 1SXGA 2SHKA 3OMWA 1NOJA 3PD7A 5HM8A 2OK7A 4CV1A 1ZINA 3D8BA 1DI0A 1TM2A 3P9YA 1OFHA 1LY1A 4HWKA 2ZR7A 4DNOA 3QX9A 4FFPA 2QW1A 4PNPA 3CH7A 4YREA 4BNWA 3IBCA 1ZNYA 2HREA 4QHTA 1DFHA 4WKCA 3KTDA 2ID4A 1YA6A 4EQ6B 1IY2A 1H9AA 2ZAGA 2NNWB 3BFPA 4EGSA 1DJOA 2ZIWB 3JR3A 4B2LA 1P3DA 4FYYA 3GYBA 2J31A 3QBDA 3SNHA 3DE4X 2H0QA 4NVRA 4PM4A 2CEAA 3O1HB 2QRGA 3IQEA 5C9ZA 4TRRA 4WADA 5AVYA 2AYZA 5C4IA 4XRRA 1E2DA 1FIUA 1MG5A 3MGKA 3N0XA 4PANA 4TZTA 4KFUA 1SN7A 5CDFA 4D1YA 3L93A 3HZOA 3ORRA 3UJ3X 3WLLA 3EEBA 3SZLA 5KX5A 2D7DA 1X7XA 1S7GA 3SIPA 2CB0A 3NAMA 1F2UA 4BO8A 1D09A 1M5UA 3DONA 4MUEA 3NHPA 1N6RA 4LMRA 2J3IA 1XELA 1DXQA 1M9NA 3EXIB 3N2KB 1QFMA 3NHLA 5DHQA 4DBZA 3JRNA 4BAZA 1TYCA 3VR2A 1USVA 3K2EA 3ZKWB 3ETCA 1HKUA 2NO6A 1DAHA 1G6HA 3FLEA 3OHSX 3F8WA 1FNSA 1PKXA 2W2XA 3R4CA 1Z4NA 3L0BA 2A9PA 1GD1O 1NA5A 3B12A 4GF5A 1NRIA 4I7EA 4WLOA 5E7IA 1SXJA 2VXCA 5DGDA 4UUBA 4DSZA 2DXIA 2Z1MA 3G68A 2OPHA 3CZCA 1Q2XA 3LY8A 1WVIA 3TLJA 2BP7A 1GGMA 1FFAA 1PR9A 1XBTA 2O9JA 3NJRA 5HSGA 4KAFA 2AYYA 1PZNA 1CUVA 1GSIA 1TJYA 1UKBA 3AM3A 4OM7A 3NKVA 4WZAB 3HVJA 3DF7A 3K1ZA 1VG9B 3WJAA 3J7AC 4GKKB 3AKDA 3BXEA 2ZT7A 1G8GA 1R0CA 1S2IA 1K8RA 3FZEA 5FNVF 4D8WA 1AD2A 2ZRNA 3UK0A 3L7MA 1OWPA 3EXFA 2PUFA 2ACWA 4BNHA 2IIVA 4GR4A 2OBXA 2WNIA 3IUMA 2Q7DA 2BBOA 1NMZA 1LDNA 1SIOA 2VJYA 4A1FA 5EIEA 1LPSA 1XXHA 3OU6A 1FZQA 2ZYSA 1HFWA 3GA7A 3I12A 3QMWA 5CBPA 4XSGA 1SUEA 2F62A 3W3AH 3UPTA 1WLYA 2ZUEA 3A1VA 3DEIA 3D7SA 2QVGA 5E7QA 3C4VA 2AA3A 1PZGA 2QTHA 2JFPA 3OFKA 1Z6ZA 2GUWA 1X1TA 5DDIP 3UC5A 5AKZA 1VCHA 1ZM4A 2PCLA 1E6EA 3M4JA 1XN1A 3CF0A 1GTVA 1X1BA 1ZVVA 1U7XA 4A8PA 3GW8A 3CF4A 3IVMA 1SH7A 3D3JA 1G2IA 5KS2A 2ZUWA 1AHNA 2L18A 4WKPA 2F3PA 2A7XA 1LX6A 1OKKD 3EXEA 1AV6A 1ZUWA 1PVDA 1U0FA 3NX4A 4E07A 3GZ4A 1JQKA 1EXDA 1Z56C 1GA4A 1K88A 2EX1A 2P9TA 4J0DA 4R05A 2YQ4A 3RFFA 1ZGGA 1LBQA 1NL3A 2OGSA 5BWOA 2IH5A 5JD6A 3NONA 5DN9A 3LA6A 1USIA 4TWIA 8OHMA 4W5JA 4WECA 4X84A 5T8KC 4DLSA 1QLWA 3HMQA 4H7JA 2DKFA 4ZYVA 1N5KA 2UKDA 4MS1A 3MGAA 4GMHA 4B82A 2PXAA 2WYOA 1PLKA 4W8GA 5A1TA 5JANA 2FZCA 2V6MA 5BNWA 2CXQA 4MV7A 1Y1LA 5LKAA 3E9CA 1MW8X 5G1OA 3EIOA 3UUWA 4YAKA 2YRWA 5AXDA 3ZBTA 3MOGA 4B71A 5HZGA 2VS1A 1TT7A 4OG2A 1BDBA 1U8AA 1KTVA 2PGNA 4YJ3B 5AO9A 4HYQA 4DJJA 3DD1A 3OJOA 2BY4A 3AESA 5IK2A 2NG1A 4B0OA 3C48A 1KI6B 1OFTA 1U2ZA 1YULA 2W2NA 4QEDA 3E03A 3OQJA 4S1NA 5MDHA 2Q46A 2HEGA 4TQUS 4W9MC 1J0EA 3G2MA 4U63A 5BWCA 2ST1A 2FMXA 4LJ4A 2VA9A 1UQRA 3D3NA 2RHCA 3GAZA 3F98A 3HU1A 2MWMA 3NFRA 3MJSA 3OJWA 4GOXA 3WGQA 3IEMA 1IPFA 2PJDA 1SXQA 2VUHB 4O2BA 5BQFA 2QD4A 2BMVA 3PDIA 1BW9A 2R62A 4GUDA 4UBNA 5EZYF 1W1WA 2FTKE 4B3IA 1DCFA 1HYHA 1RBYA 2HCTA 3G2NA 1F4PA 4KDEA 4NYJR 3R3VA 4PZ0A 3UV6A 1SEPA 4PQEA 4O4LA 3AKEA 3HJTA 4MV6A 2R66A 3I0ZA 1YVUA 3MB5A 2P90A 4C07A 2FOLA 4ZQHA 3PX3A 1ZI6A 2VCYA 2WMYA 1D03A 2Q5OA 1T9HA 3O73A 5DBHX 5BN5B 3M3DA 4ZJPA 3TECE 1DT3A 1O87A 3QX8A 3M89A 2Q5JA 5DLDA 3OPYI 2II6A 5TR9A 3K72B 5ALMA 4F38A 1CSEE 2HU2A 1GY8A 2A0YA 4I9NA 1R9GA 1NE7A 1ADYA 2ZCVA 4RK4A 5AVRA 4NQRA 3ELDA 1AURA 1KBQA 5CDTA 1PX0A 2B6NA 1AA6A 3ORYA 4V1CA 3CMMA 3V3TA 2YV4A 3HCPA 4MSUA 1NUPA 3QJ5A 3CH4B 4Z86A 5IJAA 1Y3CE 1B4DA 1GCUA 2HO5A 1CIVA 4YJFA 2A9JA 2NVUB 5CK5A 2QX8A 3W9BA 1GYRA 1DTSA 1VRCA 4D9MA 1SQFA 4L8LA 5CLJA 1C3XA 4KXXA 4YB8A 5AM3A 4X8LA 1ST3A 4PPGA 4BFCA 4DYHA 3GCZA 2HU5A 3PJEA 2IXTA 1MR3F 3SICE 2RBGA 2Y0EA 3VR2D 3U4QA 3F74A 1MDBA 1HT3A 1Y5RA 4FMCF 3U4IA 3RVJA 3RK1A 3SZRA 5EWLB 2QXTA 2XMGA 4HRXA 3UQYS 1V47A 2F6RA 3MYRA 2FW0A 3UJ7A 3IUBA 1ZMBA 4OXRA 4DIFA 5A3RA 4LOKA 1SXJD 1YS4A 3SJ7A 3ILHA 1DB3A 3WOHA 5JMTA 1UJ5A 1SHLA 1CVLA 1YB5A 2EZ4A 4Q39A 4C22A 5EC8A 1M2VA 5JXIA 1HEYA 1N0VC 2B34A 1XF9A 3B3QA 1K98A 2EJUA 2GPTA 2PUJA 3L8DA 4GGOA 4RQUA 2TMDA 1ABFA 2IYTA 2QUZA 4DYDA 1TLLA 5HS4A 2IS2A 4IG4A 4KFSA 1TECE 3ZYZA 3LUFA 3KSUA 4CRWB 2O54A 4YDRA 1KK0A 3CZQA 4P4TA 4ZV4A 5K0TA 1TMGE 3ZD7A 2NU9B 3ETLA 1UWVA 4I4TA 4D46A 2GX6A 3FSJX 3WZMA 5BSEA 4IEIA 3V1LA 1V6AA 2XBMA 5EE5B 2WZCA 3RVRA 1UDRA 3MINB 4KGXA 4GDFA 4P4GA 2W2LA 4URHA 3OQPA 4E1AA 2EV9A 1JHAA 4Y9DA 4BXOA 1OX4B 2FF5A 3AM4A 1C0PA 5IEJA 2I3AA 5A4IS 2Z2ZA 3AR5A 3BD7A 4PN7A 5JNUA 3MA0A 1QOPB 4RV5A 2QUBA 1VYHA 3ZYCA 1LBTA 5K3SA 1A1SA 4ZXFA 3ICCA 2UVPB 4H6XA 3BSWA 3ELWA 2HHHB 4BMSA 4CZ2A 4W5TA 3NETA 1T29A 4PLTA 3TEJA 5DISB 4HKTA 3ZGXA 1G41A 1SHKA 4RDXA 4UXHA 4JB2A 4YI5A 2IUTA 1U5AA 3NIGB 5EP1A 1V71A 3LT5A 5UKDA 2R6JA 3KO8A 3TR6A 2AZ4A 2PRIA 4Z8XA 2WM8A 2ENUA 3ZDZB 1RSZA 1MJGM 2C2YA 2VDWA 1IBRA 3QTBA 4R7TA 5AFSA 2JZCA 3TTXA 5IM4A 1DBPA 1O0SA 2R60A 3H2IA 4DB4A 1IEVA 2A92A 1FK8A 1YFZA 3O93A 4L27A 5P21A 2XY4A 4ZICA 4S35A 3H17A 2IBTA 2HMYB 3URMA 4LVUA 5JY1A 3TXXA 2VUUA 3ZY6A 3TK1A 5JWOA 1JMVA 4HZUB 4NRDA 1QRAA 3OQ6A 3STTA 4BO0A 2ORVA 4EEXA 3H97A 1CDZA 1J0XO 4Z9FA 2CBZA 2YV5A 4CLEA 5GINE 1Y9ZA 2VTBA 5IK2D 4EY8A 5C53B 1CIJA 4I0WB 4CCAA 4MJLA 3TIXB 2PIAA 2FR0A 4NMXB 1CFJA 3GQBB 7MHTA 3QVWA 1J24A 3SG0A 2QR5A 4C43A 3FOCA 1T5IA 1ATIA 1W6RA 4KO4S 3W7AA 3EJ6A 3N6VA 5JAIA 1GVHA 2BT4A 2C5BA 1P19A 4HLCA 1V5EA 3TS1A 2O8CB 4M6WA 4JC0A 3R6GA 1NVBA 4UDYX 3S0JA 1T25A 1XZBA 3O7MA 1G59A 2QDKA 4D0RA 2A5DA 5T3YA 3RVNA 4QWWA 4BV2A 3LP8A 3EIUA 4G89A 3OZSA 4D57A 4DREA 4YJ2A 3E82A 1CQIB 1YRLA 3K71B 4Q9NA 1UZAA 2BBSA 2PS1A 2XDQA 2HV8A 3Q0EA 2AHOA 4AYTA 3R9XB 1DWPA 2V7QA 1FBTA 2ZPTX 5L3QB 1LKZA 1WSWA 2Q6TA 2VPXA 1PJCA 4ZMBA 3C45A 3S5JA 2ZCUA 1DFIA 1RT9A 1X7XB 5ED4A 4Y0AA 1BDHA 4AC9A 2FPKA 3W2EA 4BTVA 1U0JA 1T2AA 3Q9NA 5J4KA 2PRJA 2V5UA 3OTGA 4HNSA 5DGTA 2YUIA 1GNLA 1NQWA 2B4TO 2G71A 2JASA 1G291 2NU7A 3L8YA 2Y1CA 3E5HA 4XKJA 2ACEA 1JG6A 3C85A 1E0SA 3TOXA 4CKBA 4UEKA 3DBVO 3UQZA 1SELA 3MQ4A 1TD9A 1E3IA 5F7OA 1JBQA 2WZQA 5D51S 2JPDA 1CUAA 1Y7IA 4JT8A 1GZ5A 2AOTA 1PUIA 3AEKB 3ETEA 2R7MA 3WL6A 3E5RA 1YD7A 2IZOA 4QAQA 5C0OE 3DUFA 1NBEA 3M6WA 3F5MA 1KIFA 1BMDA 1M2HA 1IVSA 4PTZA 4BCCA 4LHSA 1E5QA 3IRVA 4V2IA 1U81A 2RJOA 4F9TA 3VHRA 1NUUA 1FU7A 4H59A 1JKFA 1PYGA 4YS6A 1PT6A 5BV0A 5THQA 4D4IA 1PVVA 4XQ0A 4GPBA 3P9SA 3R09A 4PAWA 4K7JA 3T5CA 3PKZA 1XDDA 3SZGA 2LIVA 1C5KA 1TRHA 5EHZA 5TF0A 4O2AF 3ELUA 4C7XA 2Q2OA 3CTMA 1EXVA 4FGLA 2IS4A 1K2WA 4JLBA 3FETA 1L7QA 2JC3A 3EXFB 1NPYA 1V43A 2B2CA 2EQAA 1ZCBA 2E87A 3IB3A 3MMZA 5BVGA 1CVRA 1SVWA 3T0GA 3OLWA 3L04A 4G65A 1XXHB 2WV7A 4PNHA 3W2GA 1C7JA 2ILTA 1XL0A 4NF2A 5A03A 5CBPB 3V1UA 2EIXA 3ZLVA 3PQ4A 1O0BA 3KIPA 1Z5ZA 3QU7A 3ZJYA 3VTKA 2RG1A 4Y0VA 1T3GA 2RB4A 4WKOA 1PRYA 4J0QA 4IOKA 4CM4A 3IUPA 5BXYA 1C7EA 4HGNA 4QD3A 1C9DB 2W2LD 1CJMA 2BDTA 1IC6A 1KC1A 4OYHA 4U8HA 1KDYA 3UOAB 1C3EA 4QM6A 1HI9A 1NW4A 2WWXA 3DEFA 1NUTA 3GAFA 3QTLA 5BW6B 2XECA 5B2ZA 2PZKA 1Y33E 4NPHA 3IIIA 1M75A 2O1WA 3IP7A 4P4SB 5KMGB 4F5EA 5EXPA 2AOVA 3WJ1A 1PG2A 1U8FO 4EGAA 1V48A 3AB3A 4N6OA 4K3UA 5EOVA 1NBMA 1B14A 1LWOA 1R5JA 3I8XA 1UP7A 2QBYA 3K70B 4KLCA 3JYLA 4MULA 4KLAA 3AR4A 2EBWA 5KWEA 3MIZA 1QH1A 5CX1A 5D6OA 1FSSA 1NE2A 4N9WA 2VZEA 1U1DA 4HDMA 3WIDA 1Q2UA 1F8XA 1WQ4A 3NTVA 4MS1B 1Q57A 1DKMA 3M6FA 4QBHA 1Z45A 4JI6B 3ZIUA 5IXYA 3JYNA 4HEQA 2J5QA 1VA5A 1DZ3A 4YJKA 2WYHA 4UKDA 1UKAA 1QS0A 1ZO8A 2Z9BA 3N8HA 3O3NB 3IFSA 4YDHB 1ZIYA 2NU6A 5TT0A 3BREA 1NF2A 2W70A 5ELXA 2WTBA 3PQEA 3RS8A 1IMOA 2NZ2A 3BB4A 4FIDA 1TD1A 4JBHA 4DADA 3DE1X 4BE4A 3U7HB 2IHYA 3R8FA 4H17A 2FW8A 2RD2A 1E9BA 3CX4A 1V2GA 2EF0A 5I6DA 2CVQA 3GEDA 4IYJA 4QREA 3V8RA 3G3EA 3QE0A 2OQRA 4YRIA 3TEFA 4EGFA 1X8JA 3BEDA 3U44A 1HFKA 1A9YA 4I1YA 2BYTA 1DCTA 4HZIA 3UHJA 2KW5A 2PH5A 1Z2OX 1XZEA 4UATA 4G5XA 1NUSA 3PNSA 4O2BB 3PBKA 2XAAA 4R1OA 1J8QA 3ULKA 8MHTA 1KFCB 4NCBA 3O8OA 4W5QA 2VLIA 4UEOA 3ZHSA 1C0LA 1XG5A 1BWRA 4PCVA 3PJRA 5EPEA 1GGEA 1ZGHA 1U02A 4BTEA 5CJ2A 1OAKA 3QFFA 2WF7A 1F0YA 4U7DA 1RPJA 4TYPA 3USCS 1BDIA 4ACAA 1CUGA 5ALJA 2DECA 2V9CA 4DL9A 5EHGA 5B4VA 1XEWX 4JJFA 5IFLA 3II6X 3JQFA 4LVOA 3P97A 4N01A 2WWGA 3EUWA 1QP4A 5EXDA 3N53A 1XHLA 1ESDA 4U9HS 4ZYLA 2D1QA 3E0XA 3U17A 4RK0A 1SQ6A 3ESBA 4QJBA 1ZSYA 3SS9X 2V7QD 2FFAA 4BGEA 3FWNA 1A69A 1ND6A 3HK2A 3Q2IA 1VKRA 4FYHA 4YJFB 4GT1A 4P35A 3ZZMA 3GRRA 4GXQA 5DHAA 3CPEA 1I3MA 3AK4A 1U6IA 3R0XA 1I13A 3HUTA 4AWAA 3MPOA 3FPKA 4MYDA 1VL2A 5CYGA 2R8EA 2QBYB 2A9OA 2DUNA 3P0JA 3C74A 3PPXA 1D6NA 1LW6E 4NNOA 4BMZA 2X58A 1DE0A 5GJWC 4DEXA 4EHNA 3U4QB 2AJDA 1FLAA 4ZAXA 4CMEC 1W75A 4PC3A 1K0UA 1KMHB 2XNKA 4HSEA 1E2BA 4DMCA 4FONA 4L4RA 2P1RA 4QPDA 4EP1A 4JEHA 4NABA 3X1MA 2AG6A 2DPLA 2P40A 4H7EA 5BYJA 4B5LA 1I0LA 1GO2A 1SCJA 2QL9A 4N03A 4ZCSA 4D6YA 1R4MA 1MD9A 3ESAA 1IBKB 5BYBA 1EUQA 2XGJA 3QPBA 721PA 4A92A 4C0JA 1JSCA 2QE6A 2OZEA 3H99A 3PQ7A 2PUCA 3SBOA 2RAUA 3UMBA 4LJKA 3ECSA 5JR3A 3IBFA 3IT2A 3P9XA 3D43A 4H16A 4ZIRA 4RH3A 1GR0A 5LIRA 2HF8A 3WMWA 4K05A 3FWHA 2Q8NA 3GUUA 4IFBA 4LRWA 1SQ5A 2P8SA 1RR6A 3LQ1A 3GGPA 4XWTA 3ZWBA 4B2IA 4ZRMA 4EHKA 3HA7A 2E6UX 3LQ4A 3OOJA 5AOBA 1TZBA 1Y9JA 3RFTA 1RQ2A 3NUGA 2XCOA 1MQAA 3D1VA 5DV9A 4D92A 4F5WA 4YY3B 1W49A 5H1YA 2O7SA 2X4DA 2NSLA 3OJFA 1G60A 2PS9A 2EYUA 4NJMB 3TQOA 4NFSA 5JFTA 4D81A 1FDWA 1DEXA 3T7JA 4B5KA 1E1LA 2I7XA 2R1VA 1LTQA 3SZOA 1KH2A 1VPEA 2Y0PA 5C7OO 5KYXB 1GTL1 1RQRA 3C8MA 1RI1A 4AAYA 4R2WA 3GRKA 5EUMA 3R9KA 2IOFA 3AHHA 3ZCTA 4FOPA 3BZBA 5TXGA 3B6JA 1V4NA 3U4HA 4D9HA 5JZ9A 3K4HA 1P2VA 1SUSA 4CF3A 4TTPA 1SCIA 3SQLA 5J23A 3U7GA 4DNQA 1HSOA 3C6KA 3ZUPA 4LPSA 2YWCA 2QMOA 1NBMD 1O95C 1YHYA 2JFFA 1NWCA 4JL5A 4QHYA 4WOBA 3RG8A 2IX3A 2Q7OE 1WXGA 1FFEA 4M36A 1T2NA 2X6TA 2Z5GA 4N5LA 3SDZA 3EVFA 4DXAA 1FEZA 6NULA 2OTCA 5F98A 2WFZA 3CGWA 1RXIA 2R00A 2WM9B 3NYQA 1ZZGA 3HWRA 1SHTX 4L3WA 4CG1A 2GEDA 3UXEA 1MABB 3U48A 4MW4A 2A0WA 1EJ6A 1E2FA 1NI4B 3G0CA 4X63A 1A5TA 1L5RA 5KYWB 2AWOA 3BN3A 1E7SA 4PR3A 3KPVA 1TA0A 3UT0A 4EJ2A 1DOHA 1RMTA 2R6GA 2C2BA 2GPNA 1IBSA 3L6CA 1VJRA 2JAWA 2PLNA 4HQ0A 1SUFA 2BHNA 1KR2A 2G72A 4IV0A 1W36D 4UUAA 2PEYA 5FUVA 4IJVA 3VZBA 2ZRAA 4LV6A 3LRTA 4A0SA 1GGKA 1ZCFA 1T0IA 1Z4KA 3L0YA 4PWZA 4B2YA 5ADVA 4NPAA 5J1SB 4Z4IA 5CXQA 2AQHA 2JLCA 2DHRA 1R3DA 2F17A 2V54A 2YWJA 4H7PA 5ESDA 1NN0A 2O1SA 1AMOA 2D1FA 1T2DA 3L7IA 3MS4A 4Z3DA 3W2TA 3BHNA 4EX7A 2P1ZA 4QBFA 3AUUA 5IVIA 5ANRB 1Z33A 5EMMA 4K6KA 4OL0A 5GJVC 2X0FA 1Q0UA 1WCIA 1WZIA 3EBOA 3GBPA 4JVLA 4AZ3B 3ZVMA 1ZBQA 2CNNA 2CLEB 3DVRX 1N2CE 1U99A 3MGCA 4ZEXA 3D0OA 2XT9A 3SFZA 3ZU6A 3ILXA 4TXNA 4R68A 4RLQA 4OQMA 1RMQA 2HK8A 3OJXA 3PKJA 5H82A 4KQGA 1KYZA 1MTZA 5ITVA 2HJWA 4F93B 1QG0A 5CLQA 4BWFB 3I9V1 4ND4A 9GPBA 1VHLA 1QGED 4AJPA 1K75A 2W5UA 1Q6ZA 4BX9A 2XDQB 3E2MA 4EI9A 1TVMA 4N8EA 4RWZA 3ST7A 1XLTC 1Z06A 3X3HA 1JG7A 2QD3A 2O3SA 1N0UA 2CLKB 1N8NA 3OJCA 1IM2A 1EH5A 2OORA 4AKEA 2VBGA 3O4HA 3LXRA 4JK3A 4AB1A 3OO0A 3WNCA 3EZNA 4RIHA 1L4BA 3ZWOA 3UJ6A 3EIHA 2QSZA 2QVYX 1E2MA 2F55A 1O54A 1XRPA 1VGVA 1YDGA 1P9WA 1TK2A 4AJLA 2YKGA 2CKMA 1E2LA 1Y3FE 2R4UA 4Q12A 2RCNA 1JUDA 2OPBA 4C4RA 1P60A 4LIPD 3E22B 4CKBB 3ZDBA 1H85A 2I6XA 2P5YA 3P9PA 1T3ZA 3N6RA 1VSVA 2I2WA 1N75A 3T1QA 4PNZA 4P0PB 2QSUA 3DUFB 1J2EA 3HI6A 3T5MA 4C5CA 2IUYA 2B5WA 2CZCA 3PGVA 4PSUA 3R7BA 1AUOA 3C6YA 2OO7A 3A9UA 3C98A 2QQ5A 3SQNA 4BQFA 4EITA 1L4HA 3L40A 4OJYA 5FH9A 4ZYWA 3PLAE 1OWLA 2Q4DA 2GZRA 4NPCA 2GPJA 3AOEC 5IN4A 2KMLA 1W0CA 1CLUA 1Q7TA 3KSBC 2VG8A 2FUEA 1X80B 4Q3CA 2OKGA 5F2NA 3H75A 1JEDA 3TRKA 1XD2A 2ZAOA 3ZW9A 3OE4A 4IWNA 3M6XA 3PHLA 5BVGB 1UDBA 2WT4A 1DELA 2IUFA 4LI0A 3S2SA 1JA0A 1PAUA 1N0HA 1UBOS 1IQRA 1QRRA 2BBWA 2LKDA 2FQXA 3LQQA 4I3GA 3GPLA 1WBBA 5GWXA 2JCSA 4RSHA 4DQVA 3W9SA 1SC4A 1H2XA 2P6PA 3W4KA 1O9GA 1RHJA 1UJMA 4GQBA 1EFDN 4KR0A 1OLSA 4Q9IA 4PRYA 3EA0A 1MEJA 2HLPA 2Q2QA 3RWBA 4WFKA 1U7HA 2XUKA 3KFLA 2HSZA 1E9AA 3TGWA 3EWSA 1LS1A 5AIBA 3CVVA 1UAAA 3BTVA 1M76A 3B7WA 3T4PA 5ARBA 2P3QA 3BC1A 2YFYA 1JT2A 3A4VA 3N2IA 2AR0A 3R6DA 4HWTA 1M5TA 2JD0A 5IU6A 4KQ1A 1NU6A 4A4DA 1FYFA 1VG8A 2GPSA 4CFSA 2NXJA 5T64A 3WGUA 1GQQA 5E8JA 3S29A 5AXBA 3C43A 1QMGA 1TM7E 1OFIA 4JBGA 4LKOA 4UUQA 4WFQA 4YJHA 3BCHA 4QC2A 4AVYA 3WHPA 2WAMA 3M70A 5CA1F 5EUCA 2GLTA 5KDOA 3JD2A 4R0MA 4RPLA 3ZD8A 3DHYA 4HDMB 3PQ2A 5AVSA 1VHJA 4LF9B 2YY7A 5ESWA 1FC0A 4PPQA 1N0IA 4AT1A 3HPQA 2R87A 1V8FA 3RSGA 3HPRA 4F4UA 5KOHA 4DW8A 2C61A 3GQVA 1QS0B 2HTEA 4NDZA 2C5AA 2PKQO 5HWSA 2AOXA 5FOSA 1DBRA 4UJ3A 4ACBA 3TFQA 4OPMA 4YMTA 3TTWA 1YXMA 4JYCA 3GB9A 4JLMA 3KXLA 4JLNA 4CQJA 4Q9HA 2ZPUA 4RTRA 1W36B 1FP2A 2QTNA 3NEAA 4M1MA 3T5DA 3I5UA 1VP3A 4QTUB 5F1PA 3NT5A 3UBTA 3P4XA 5E9WA 4H7HA 2DF8A 2WB4A 3JWHA 4AKSA 1M2OA 3ZGOA 4C6TA 2H2HA 3AY0A 4HAWA 4CL3A 5K3CA 1TDJA 2AKAB 5CW1A 3A36A 2C9BA 2J6BA 3VR6A 3RVSA 1E60A 1QJ4A 4MQ6A 2HCJB 3ZH9B 4A91A 5KSOA 4KKXB 4MTLA 1NW9B 4J7XA 3O8OB 1HEUA 1Z29A 1N2SA 3JYHA 5FUYA 4UZEA 4JQOA 2YVLA 1MO2A 3RFCA 4AZWA 4CV0A 4NFYA 4CL8A 2O48X 3D31A 5CFOA 3OPQA 2J3LA 4AY2A 1E7QA 1L7RA 1Z08A 5MFZA 4BO2A 2E49A 1AXEA 4KP7A 4D7AA 3A2MA 4ZVPA 5B1SA 1JFLA 4U7JA 3ZDAA 3HZZA 2Y1WA 4IHQA 1YRAA 9MHTA 2IHTA 3EVEA 1Q16A 2D2IA 2PX6A 2JLXA 3AEUA 4CKXA 1WEHA 3HSKA 1MF7A 3BGVA 1KRHA 1NF9A 4GRAA 2IPLA 4K9QA 5AK5A 3HY6A 1KDZA 1I4LD 1GILA 2H4HA 1VQ1A 1LF0A 2PDAA 3FMPB 4X24A 2F3RA 1ZJZA 2GDZA 4EYKA 3RYHA 3F67A 3O31A 3X44A 4BNGA 4IVQA 4PG6A 2WYIA 4PZPA 5CVDA 4WKBA 3PNKA 5ADWA 1R8SA 1EHCA 1KO7A 1T5LA 1UM9A 4XW2A 5ERXA 4OATA 3ZDFA 1JFSA 3ER8A 5JS1A 3H8VA 3W3AA 2QXYA 2FUG6 3L6RA 1GCAA 5DNVA 3N7TA 2C77A 2RH8A 4B7CA 1BD3A 3A4IA 3N39C 4XM0A 1UFQA 5U1PA 1B1CA 1S8AA 3KALA 4JCCA 2C2GA 4X1KA 2J09A 2ACKA 4MINA 4EUHA 1NQVA 4PY2A 2ZS7A 4LJ5A 4KQFA 4BQPA 4C88A 3I5YA 1UJ4A 1JEOA 1QPZA 4J4HA 2GHQA 4ETWA 1XRJA 4C0XA 2ZIGA 4IBOA 3OEEA 1E64A 4Q3OA 4TZ0A 3KQYA 3SZMA 2XXAB 3WMFA 3V80A 3EYAA 2VF7A 4ZYTA 1TKRA 3Q7SA 4H7IA 5C34B 4CKCB 4ZIRB 5EP4A 4HB3A 1YR8A 5IBRA 2XLBA 4KSCA 1GCIA 3T0FA 3TVYA 5AQEA 1RAGA 3D64A 1C8KA 2YR0A 2ZJ7A 4F4DA 4EKDA 5C5IA 4Q4AB 3A6FA 2P27A 1Y6JA 2CHVA 2GLXA 2FWMX 1HV8A 4N1AA 3K09C 2QRZA 5L3ZA 3ZLBA 2Z3WA 4CGYA 3KFXA 4JELA 4XDHA 4X66B 2QROA 2WW8A 1LU9A 4P86A 1I3LA 3RAPR 1FSZA 3WLKX 3QWAA 5B5SA 3SBEA 2YMQA 4UHHA 3T9BA 5CTAA 2W4IA 3ZBPA 4Z3OA 2ZATA 3CA8A 3DAGA 2E5WA 2IXDA 3W0LB 4YX9A 2H5IA 4BWVA 1XHEA 4OGKA 2IZ6A 2R1VB 3P2JA 3WIEA 1V4VA 5JYDA 4J49A 4L16A 3I6ZA 2H2AA 2AEMA 1PJ8A 2VAPA 2ZSAA 1V9SA 2IH2A 1VTKA 2ZT6A 4WJZA 3HDVA 2BKEA 4WZBB 4XGNA 3I01A 5EIXA 1P2DA 2IA5A 1NVGA 3ZQ4A 3D6TB 1RKUA 1NXSA 1Y8QA 2R9VA 3HYSA 5ELLA 2TRSB 1JDSA 4AY6A 1Z9BA 4NBKA 4B40A 1W1UA 3O7WA 3UAVA 4S2UA 2IPMA 3OOWA 2DT8A 4UUMA 4KBFA 1T8TA 5CA0F 3INYA 2VK8A 5AI6A 3CTPA 5JSQA 5KU1A 1F6WA 4US1R 5KNLA 4DV0B 1K5DA 1VJ1A 4IH4A 4WGFA 1OU4A 4IIJF 3K6SA 2Z6VA 4U2CA 3D2CA 2GAJA 3KJFA 2V3VA 4JHXA 2D0DA 1MAVA 2Q3CA 2PWPA 2Z08A 2H1FA 1V45E 4OMUA 4XUCA 5JDIA 4ZI7B 3CKMA 1IZ7A 1WUKS 2IYAA 3AHIA 4JXJA 4Z1MA 3UY4A 1R6BX 1XCOA 3QPAA 3IKTA 2X2FA 1AOXA 3RRJA 3TQQA 1VZ3A 3ENVA 3R0IA 1CRQA 1XDUA 3L18A 4OJNA 1IOVA 2YVUA 3ZTYA 4GQIA 3VVMA 1DWQA 4IS2A 4NBVA 3PTAA 2QLMA 3TXYA 3FM9A 4ILKA 5EIOA 3VR6D 3RE1A 3AF0A 1ZVMA 4NSNA 3R44A 2RB5A 3H2YA 3JRWA 3BGSA 1JG4A 6GPBA 2NADA 2OENG 4A26A 5ICCA 1TQ2A 4HG2A 5FBKA 2R5FA 4ZT2A 1K4MA 1NYRA 4BB6A 2XI4A 4QL3A 1ZMXA 4ND5A 3W7BA 3KG2A 1FQKA 1Q0SA 2C0PA 2HSGA 2OB1A 2R8RA 3CSSA 4AYXA 4BIIA 2HMSA 3U5TA 5IKMA 3V6MA 3IUYA 4NULA 1MOZA 2ISSD 1W19A 2VHCA 3CZRA 3MOIA 4GXNA 5KU7A 4MNTA 1RI4A 5EP3A 3W8EA 1BFUA 5AKEA 1PNQA 1XOIA 3BMCA 5FBVB 4QQRA 2MIIA 4YYEA 2HRQA 1RZVA 2WMDA 3PUJA 2JGJA 2X8BA 3COZA 1PNOA 3GFTA 3GOHA 4INZA 4JGBA 5ARDA 5H3CA 5HBRA 3U3RA 2NYAA 1UOPA 4DXHA 4M0FA 1S2NA 4C89A 1YOBA 2Q3EA 3AF6A 2QQEA 2ZUBA 4YO7A 1YZUA 3D3WA 1LRKA 2OV3A 1HOXA 3F7MA 3MTGA 4OQQA 5BV2P 1E32A 1LFDB 2JATA 2M1ZA 4R81A 3O84A 1KZ6A 5IF9A 1CR4A 5K0LA 5K3FA 4IQ0A 4CBVA 3W3AD 3PVZA 1JEAA 1OIWA 3KV1A 4FZ5A 4BRZA 2C20A 3UC9A 1C8LA 5EUQB 4UXIA 4RK5A 4BP1A 1N78A 1G6KA 3GVHA 3AMVA 1TTQB 3EXHC 5C8VA 3U4MA 3G79A 4JKOA 5BRNA 2E4AA 2RONA 5B36A 3RIYA 2HT6A 3UXHA 4P2GA 4KACA 3HM9A 3FB1A 4CLRB 4Z4QA 1OH8A 1QH8A 2QNIA 2WJYA 3JYPA 2OQ2A 2D1YA 3DULA 3OEED 5I9TA 2B4KA 1ONNA 4Q7MB 3SGLA 4LWQA 1Z74A 2COKA 1U04A 2FPIA 3DVAB 4QVGA 1Q7BA 2ZB8A 4IIGA 3N07A 2OHGA 4XYEA 5SZHB 5IT9A 1RM4A 3EDYA 2V3CC 4C1NA 5DGXA 5C35A 4BEBA 4JXXA 2J3DA 1UP4A 3PEYA 1YVRA 2R47A 4BNUA 2DFLA 3HDHA 2I4TA 3EIEA 3H86A 3OQHA 4IDDA 4RFSB 3LY5A 3SC2A 3WLFA 2JLWA 3ABIA 3FOAA 5TQ0B 1USWA 3TMKA 3Q8KA 1RU3A 1FTQA 1NBAA 2VLBA 4L5CA 2JW5A 2APJA 4UM8B 5K8CA 2YINC 3F7OA 1P4RA 2X9QA 3GMIA 4YT5A 1T9AA 4TV8F 4IDFA 5FQOA 5FD8A 1GPJA 2DWUA 3LUCA 5ILGA 3FXAA 4LXYA 3IC5A 4G1EB 2PQ2A 4MWGA 1G1MA 1AZLA 1T5BA 5DI9A 5ECDA 1C4WA 2GDJA 1M0EA 4G8CA 3CNBA 4NARA 2B61A 3TGPA 2RGDA 3EDCA 3WLJA 2OCYC 1Z8DA 2XD4A 1R12A 1W0JA 2P75A 4PZEA 5ERYA 1MCZA 2OYRA 3LXUX 1S8OA 2D2XA 3EH1A 1ML4A 1CUEA 3NYIA 4YJHB 2FSFA 5EJ8A 3IQDB 1L8QA 3QLVC 3CNHA 1BRMA 1NC3A 1Y1SA 1XNJA 1HYBA 3OD1A 1WDKA 4P3KA 5K4HA 1A27A 4BRWA 4QQKA 1UBGA 1QAOA 4FJ0A 3AUAA 5FI5A 2NQ2C 2PJZA 1FRZA 2AB0A 4ZQEA 1HX7A 1K7XB 1G21A 2W43A 3SX0A 4E6PA 1CEEA 1FSPA 1P80A 1OZFA 2ZVQX 4YFYA 3BGOS 4Y1GA 1YZYA 1NHGA 4UHEA 3Q72A 1CX9B 1Y3HA 5AJWA 1QF6A 1R18A 1S2GA 4WLFA 2P2NA 3K9GA 4IG9A 4J3NA 1NBOA 1MPXA 2ILVA 3DLAA 2F1RA 3MJCA 3SJUA 2JHGA 2QLBA 2JGLA 1N8SA 1W5BA 3A70A 1L5QA 4MCAA 2BKLA 3D7LA 4MKRA 1VIVA 3AERA 4G4GA 3HDTA 4WK4B 2VDPB 4Z1MD 4R51A 3R76A 3V4LA 3ETNA 3GRPA 3NHBA 3VM6A 3E0QA 1GPH1 1AVTA 1D2CA 2CJFA 2Q0SA 3IXLA 5GY7A 3KE8A 4IDQA 2QRJA 3IAHA 4AWBA 1KRXA 4Y2GA 3EGWA 4I66A 4UTVA 1UOEA 4IM7A 5JJ5A 1QC5B 2C3PA 5K0EA 1XVUA 1D4AA 3JD4A 4Q7LA 4R8RA 3E7XA 1NASA 3WC4A 1P0MA 2UXBB 4ZCTA 1PK7A 1E3QA 4XJVA 4KW7A 2GBPA 2PGDA 2VUTA 3FRHA 3VSCA 2E4XA 4E1VA 7MDHA 5LQRA 4QAJA 4EJ6A 2HKIA 3C3KA 4M7WA 1QIJA 1UEJA 5J43A 1TCCA 4B45A 3KSRA 3LSYA 1CRZA 1M2GA 3OZTA 4MR7A 3UAYA 3I04A 2YWEA 1ZK0A 3IOCA 1UFVA 3KEMA 3OTQA 4BO9A 3KQUA 2J7KA 2L19A 3GRUA 3PQ6A 4XB1A 3VISA 3NBXX 1ZL0A 4C01A 1DDGA 1P8AA 4PX5A 3R20A 4NU5A 3BQNB 3G8CA 1DVRA 2NQTA 4P34A 3S40A 4XAQA 3TLZA 5FTKA 4U7FA 4Q9LA 4IDPA 5IPFA 3DT9A 3DL7A 4GPAA 1Z07A 2P2DA 4HX9A 5D3QA 3VYRB 2KQUA 3MZ0A 1NBWB 3SOZA 1XF1A 2WFMA 3PC4A 3DHEA 3QFHA 4DWWA 3G82C 3QVOA 5LU9A 1ISRA 2AQ8A 2HK7A 3KEFA 4I2NA 1J39A 5ABPA 1A8IA 2QM3A 1EQ2A 4RJJA 3E53A 2V5AA 1XZCA 3QPUA 1CFZA 2YBEA 3SXUA 4F06A 4R1NA 2DQYA 2JGDA 2RJ3A 2IW3A 1JAIA 1UMDB 2VXOA 2N75A 3MG9A 1U98A 4X1KB 1WOYA 4XWGA 2P3OA 3GCWA 1JHQA 5BYAA 2BVNA 4R2KA 1SCBA 3EDRA 3QY0A 4AULA 4GVLA 2JFOA 2HHCA 2VHTA 3R7NA 3FLBA 1BWQA 3CE9A 2Y2VA 3DKIA 3OOYA 1F8YA 4TLBA 4O4JF 5HIKA 1Q7GA 1M83A 3DMDA 4HTFA 4OXQA 3K53A 3W05A 4LJYA 5AVVA 3EPJA 3WK9A 2F1OA 4HS9A 5DW3A 3HXTA 4U0JA 2NV2B 4Z6KA 1KZ7B 1SCAA 3WBFA 4S04A 4NG4A 4G5OA 4N5DA 4B34A 3KZ1E 4M1KA 3ZOZA 3VSEA 2JFUA 1U2GA 13PKA 2R25B 3COJA 4LQ4A 2BHLA 4GBJA 4A9AA 4OQXA 4BNNA 2ZJ2A 3QA9A 1KAMA 2LZ0A 2D8AA 3GC6A 2O06A 2W8BB 3VR5H 1NRXA 2QZZA 1MNAA 1OIXA 2CXTA 5B6PA 3PT5A 2YUTA 1TC2A 4GKBA 3RBXA 3UGTA 1WMSA 3I9FA 2Y6VA 3IUNA 1QV6A 2VP2A 4J07A 4J75A 3IOEA 1P18A 5DM2A 4MVJG 5HEKA 1NP6A 5JYCA 3KAPA 4WNAB 3ZI0A 4AMBA 3KWFA 2LV8A 4KVAA 5LCXA 1HGXA 2WHRA 4GPZA 3WIOA 1FFXA 3HWX1 4MUJA 1OXKB 3RLIA 2C94A 4XGIA 2QN2A 4H0CA 1QZZA 1U0RA 2AI2A 4REQA 3LT4A 4ZT6A 3R7SA 5E1OA 3RPEA 1SKMA 4IFIA 1L4YA 3AIIA 4R0VA 1DRUA 5AXAA 2C1EA 4HWGA 1W0JD 4R5HA 4A8JB 2VSQA 3SP1A 1X7YA 4FE7A 4PZDA 3TTYA 1K8QA 4BX8A 1Y8QB 3RVDA 2ADOA 3E9RA 2BIFA 1YGPA 1HRKA 3IXMA 2GERA 1KVUA 1G8KA 3G0OA 1QTNA 1QV7A 4QE3A 2CVZA 4IIUA 4R2HA 4BVBA 4FILA 3DJFA 1T9DA 2DAPA 1YH3A 4CETA 4Y2YA 3BFVA 1BKSB 1FRQA 3K5IA 3U39A 1G8AA 3AB8A 4KMOA 5LL6P 1SU8A 2H1LA 1OXVA 1IBLB 4DMHA 2RGRA 1JYFA 1OHHA 3PL1A 1EX7A 1AIPA 4LNUB 4IQFA 4RY2A 1VJTA 5TMPA 1VPWA 2WPNA 1HFJA 4PPYA 3COSA 3KJHA 3KX2A 3ZWCA 4ABTA 2PLWA 2XNDD 3PFWO 1U7DA 5CDSA 3ITEA 2BFDB 1YZLA 1N1GA 3ZE7A 1Y6ZA 3WYNA 3EVGA 5DO9A 3WX0A 3LW7A 1GSHA 4D9IA 6ABPA 3CUYA 1U2DA 1SU7A 1F6BA 2VTVA 1G5PA 2O2HA 3OPYA 1J7JA 4QVKA 2XVYA 1LSJA 2XD9A 3I37X 2WSSA 1JWAB 1NVVR 4IUCS 2BF4A 5FWNA 3O1IC 4HMQA 1RC1A 1B3BA 2BUCA 1SUDA 2VJNA 1M2NA 1U0HC 2C4WA 2DBQA 4G2NA 4RHEA 2ZKLA 4TS1A 2BM8A 4WEOA 1ACJA 1HR0B 2HWWA 3EFOA 2ODQA 1P2TA 5JVDA 3Q41A 1GADO 4FSDA 1I2DA 3YASA 5JBIA 4LNHA 5FR1A 4ALNA 2QAIA 2WAAA 1ZQ9A 1N34B 3H2HA 2BGRA 3K9BA 3DC2A 2WP0A 4XVQA 1DIBA 1H2AS 1QNLA 4ZV7A 2J07A 1P1RA 1A4XA 2R6FA 4RCYA 5IDVA 3RIGA 4DTIA 3O9MA 5T57A 3IKJA 4G67A 3QPDA 3Q85A 1ZIOA 1A2KC 3JQAA 2O3UA 4GKVA 4KNWA 1YL6A 4MKXA 4Q5IA 1BFKA 1N7IA 2R8XA 4OJMX 4L5YA 3PFGA 1Z73A 4P81A 3V2IA 1WABA 2D1TA 4RSGA 2YXLA 3OQNA 3Q3HA 3FF1A 4H77A 4ROTA 1B8NA 4IAOA 3FYDA 1OX5A 5H4GA 1SVSA 1PT8A 1MC1A 1J2RA 3ANXA 4HK4A 1VCOA 1J6UA 3VSDA 4BWYA 1Q7RA 1C4XA 2IYXA 3QKTA 4P08A 2ALJA 2UAGA 4MV1A 2YJ5A 2P9QA 4Q6BA 3TXAA 1ULTA 2HQSA 2W93A 2LD4A 1DV1A 2BGIA 2WDPA 3AL3A 3CUKA 2AYXA 3BA6A 3JATA 4LWZA 4MRPA 4R2MA 1ZJ6A 4OHKA 3G7NA 1NNUA 2DZDA 3NUZA 1CP2A 3DE6X 4K28A 2A3NA 3HXOA 2VHWA 4EECA 2BEKA 3FNIA 4G0UA 3S1LA 1KIMA 1QK3A 3AKYA 3TUJC 3F3MA 1NQOA 5EERA 3QXXA 1F5SA 4OKNA 4AUKA 3N8KA 5GIPE 2ZBPA 3QH4A 2Y1OA 3AJ8A 2F9FA 3LBHA 3RC7A 4ZTBA 4ZHQA 2G28A 1M6EX 4FGKA 3SC2B 3KR2A 3TDNA 3CLSC 3SQWA 3ONNA 4NCIA 3JQBA 2WTXA 4RLHA 5F3RA 1DQRA 4XRGA 1TCUA 4B6RA 4D3XA 3FYCA 4DBVO 1FQJA 1UXJA 4FKZA 1P31A 3WGIA 3ZDCA 2FUCA 4EFNA 5SICE 1KSGA 2VDLB 4MQFA 3PC7A 5T6MA 4F8JA 3PA6A 2X9LA 1GDTA 5DH9A 5JC1A 1VBNA 3TAUA 1PJ2A 3R0JA 2PJRA 2CMHA 4OHYA 3I5AA 4NCAA 2H08A 1YA4A 3OC0A 3HYRA 1QVAA 3DQZA 1IU9A 1N2ZA 3N8GA 4GX1A 3KXIA 3MTAA 3B36A 1EDEA 2VF8A 2ZUUA 1RHUA 4GR5A 4AF7A 1KR5A 3U7QB 2ABWA 1KJQA 4LY0A 3DTNA 3K0CA 4JBLA 5CGQB 1LEHA 3RYFA 5DYGA 4ER5A 4EARA 1HMPA 1PQYA 3QOWA 1MO5A 4QUDA 1AHHA 4GM1A 4C7VA 2WR8A 3GNQA 1ICIA 2OXRA 3TSZA 4QRDA 2A0FA 1FXWF 1U5BB 2C7QA 4DVJA 4MUXA 2R65A 5GV7A 1NATA 4Z99A 3AVXA 4H7KA 4L95C 1NPTO 4JSYA 1V9LA 3L7LA 5BUSA 1ZOSA 4QXMA 3UK7A 2FOXA 5HE8A 1P7ZA 2EWMA 1D8TA 4J94A 2PS3A 1FNMA 4QDXA 1APBA 1ESZA 4D4LA 4K2HA 3E9NA 3FCYA 4KUGA 4GYYA 1RXVA 2WWFA 4TZ6A 3ETJA 2RCYA 3K8YA 2IU6A 3QELA 1W7AA 1T2UA 5KEIA 5E3IA 1OHHD 3V8PA 1U1CA 1Q0TA 5MFPA 1MC4A 4DDMA 4AK9A 2CXHA 3D7KA 3HKCB 3CO5A 2JIRA 2QNRA 4M22A 4PGAA 2R2GA 5FOWA 5G0SA 3PSAA 1UBKS 1PU2A 2I29A 4DHWA 4DRYA 4RNDB 1TCBA 1H5NA 5K51A 2OV2A 1GOTA 1B42A 1AU9A 2FSPA 4MUKA 3RU9A 2VQSA 2P1DA 3GRVA 2OHFA 3RRBA 1CUUA 5C8YF 3ZCQA 2ORWA 3E4DA 3PNVA 1BJRE 1WO8A 3EQ7A 5DHRA 2WJVA 3TLGB 3U61B 1TE2A 1V7ZA 2FV8A 4J0FA 2A4MA 1PTJC 3P4UA 2WSSD 2D0IA 4JN6B 3M6MD 5EHNA 4N47A 2AHRA 1XWIA 2PH3A 2FRVA 3K6RA 4ITRC 2BH2A 4K0KB 1CK4A 1SHUX 4PYKA 4N6GA 2Q28A 3PCRB 5TS3A 4BQQA 2GPWA 1EFRA 4U2GA 4RS4A 2XYRA 3E61A 1RTTA 2PMBA 3BWBA 3NVMB 3D54D 3CRZA 1J2YA 3EHEA 4IRXA 1SVIA 4MVJH 4Z4GA 2XRMA 1E2UA 2EJTA 5BPFA 1U2RA 1C80A 4EG6A 4NBUA 2CMFA 4DBLC 4DNFA 1XTPA 3AHDA 3DKKA 4CDMA 4G0PA 1HE3A 3BZWA 1CE8B 1TZCA 3LX4A 4M54A 4P32A 4DCNA 5DXJA 1KJ9A 4AS3A 3T5TA 4JI8B 1EK1A 3JQAD 1AV7A 1NKSA 4BNKA 4RY0A 1QIIA 4DTCA 2NIPA 5JO9A 3VH3A 4AX8A 3KYDB 4F4CA 2RAFA 4NBLA 4BLOA 2D7JA 5E7MA 1DZIA 3LVRE 2XMSA 3ZY3A 1JVNA 3RBVA 4JJ4A 2ZRGA 1EFLA 2I4NA 3LOPA 1TCVA 1JH8A 4I1OA 1II8A 5AHRA 3KLNA 4UARA 4ZGBA 4DDKA 2IPNA 1Z5NA 2POQX 1QZTA 3TTUA 4LF6B 2G7ZA 4YAEA 5LA6A 4XUGB 3X0DA 4BFSA 4EY4A 3QV1A 1D0VA 1ORVA 1ONSA 1SR8A 1XRQA 3CR7A 4OX9Y 1CYEA 1RFLA 1QP8A 3EEYA 3E7PA 2IT1A 1DFGA 4OUKX 4BJ6A 3MK31 5CNJA 2O8DB 4QU0A 1F2TB 3MFQA 5IAEA 1ADJA 2N9UA 3NS7A 1M0WA 2QOEA 5TVKA 4TN5A 4BJ5A 2XB2A 1HL3A 1DC4A 1P0PA 1RD4A 4TVBA 2DGDA 4KE8A 1ZD4A 2GNOA 1FLVA 2IPOA 3Q3CA 2ID9A 1XV5A 2G63A 2GGSA 2WNSA 3OCVA 3LQRA 3OA2A 3VYWA 3GNTA 5I7SA 3EVNA 4FBGA 3OX2A 4GQAA 4AUEA 4ENRA 4LY3A 1B00A 4ZC1A 2FEWB 4A15A 3Q3GE 2QD5A 2DPGA 3RNOA 4WPGA 1EVIA 5DNUA 4B7UA 3F3YA 1ULSA 4PIVA 3W5UA 2CUNA 2OBMA 2P7IA 1J8VA 2BFOA 3HU5A 1K3TA 4A5OA 1HMYA 2JLUA 1SXPA 3NB0A 3EW9A 3WLAA 5DBFA 4I1SA 3VAYA 2EJVA 4ENPA 1XROA 2Z1DA 3K8QA 2ERXA 1R0WA 2IYNA 3JQ6A 3M4YA 1BG6A 1X7YB 2EBUA 2ZYVX 2JFXA 3G6KA 3I1JA 3O8DA 4J3JA 3ZE0B 2AW3A 3L1VA 3TINA 1CUJA 4Y2VA 5BSKA 2OZVA 1S8FA 1H69A 4OAPA 2J4CA 3LLVA 1SRQA 1V6CA 4D25A 1LJ8A 1PIWA 4G5QA 5K45A 1S9HA 5F5LA 3VPGA 2D3TA 5AM5A 3K2BA 1ACMA 1RWVA 3DAOA 3HM2A 2NU8A 3RJMA 1XA4A 4S0XA 3ZNOA 5JD4A 3CUTA 4D4JA 2I62A 3AHCA 5FXMA 5GGYA 3QGMA 5HJ5A 3FFAA 4R0NA 2FW9A 4ARAA 4TWAA 4H4EA 2L0XA 2H59A 2JVKA 3KSDO 5EUBA 1XNGA 4NJEA 2K2WA 3IVGA 1QZ3A 2VP9A 4EB3A 4MRAA 2NTEA 2IZZA 3LUPA 4ICIA 2Y05A 3E9QA 4N3BA 1IONA 1U3TA 2V58A 3L02A 3P0FA 2XQJA 4JC4A 2IHVA 5I9SA 3ZWPA 1XPOA 3OZGA 3QLUA 3NHKA 1QGZA 1P0IA 5CB0A 3WGGA 4ZEOA 3LWZA 4US0R 4NONA 2V0NA 4XIFA 5LKRA 3FGZA 3S2EA 2FFJA 2ZB2A 3LPAA 3S3TA 4F6LA 2RC6A 1G5QA 5ERGB 4RE6A 5BY2A 5CTJA 2A33A 4O63O 4MCJA 4YMVA 1L7VC 3GJYA 3I64A 3O9VA 4KR9A 3AR2A 2ODBA 1RP1A 4PBSA 2FHSA 1IQUA 2RHOA 4X0EA 4URYR 3VR1A 2G9QA 1BX3A 2ZYTX 1FNDA 2JLSA 4PZLA 3H0KA 2RHJA 4NCKA 4O5OA 3T5GA 1OXMA 2G76A 1HDCA 2CVHA 2IYUA 4R31A 3WL3A 4BO6A 5M34A 5IS2A 1FDTA 2GYUA 4JL8A 1ANKA 5JVDB 4ZT5A 3JD0A 4CF7A 4LBWA 2REXB 2GJ8A 1V3VA 3FG9A 3LO8A 3LVQE 4WK2B 2X1HA 5FOTA 2BLLA 1EFRD 3L7OA 3OZIA 5LQSA 1ULZA 5KNBA 3DM9B 5BWLA 1W0KA 1CJSA 2JJ8A 3IDOA 3F4BA 5K8VA 1IK6A 4N39A 3USZA 3D6HA 1IHYA 5I4KA 3K6KA 1JFTA 1A7AA 1KZYC 3N0WA 3E8MA 1YTUA 2HX1A 3GT3A 2P41A 4NU6A 1UFOA 1KI8A 5K6RA 3KBBA 3L01A 3LGSA 1V7CA 1KHTA 3E23A 2ZGVA 3TRHA 3U60B 4U9IS 3OZFA 2CLLB 3L8CA 1J0CA 3KVYA 4YJ3F 5AOAA 3EASA 3WWCA 3K70C 4B87A 1L2TA 2Z4SA 4OFXA 3S70A 1I94B 1E18A 2GN8A 1J07A 2HF2A 2IEYA 3JATB 1ISFA 4ZPXA 1D1TA 1LQTA 2V74B 3MT8A 5A9TA 1RZUA 2HA4A 1KI3A 3R5TA 1B26A 2Z4RA 5TT1A 1DG3A 1PKEA 3PSHA 3VZQA 5HX7A 3OFJA 4KRFA 2QRVB 3AF4A 5C1BA 2P4HX 3VYUB 4YV1A 2ZDHA 4ALKA 1DIRA 2G0AA 2I1WA 2ZULA 3MXOA 4WY8A 5EZYA 5HILA 2ZU6A 5HYVA 1PO7A 4EJ0A 1Z0KA 4DWOA 1E9FA 2FPMA 1E98A 3GVCA 4LMAA 3G85A 1G0NA 1HE2A 2GI4A 3PEUA 4EUFA 4ZU1X 4IHKA 2GUGA 3GLUA 3NO4A 4X41A 2ZIXA 4R1MA 4HNAB 3Q3VA 4WV3A 3BAFA 3EISA 1JG3A 3S2IA 3TQIA 1C9NA 1MIHA 2JKYA 3AUJB 3CR3C 3M5PA 4UM5A 5G02A 2H57A 2E4ZA 2B4RO 4JZKA 4R9VA 4ID9A 4MGEA 3PITA 3LNTA 3PA8A 5C8ZA 3LUHA 4MGKR 4JUCA 1SG0A 4WCFA 3KQLA 5D5QA 1D7OA 3FUUA 1PFUA 5M29A 2Z2XA 3IAM1 3SHOA 3PI6A 3U31A 3EZ2A 2J5BA 4EPRA 2BMWA 3KZKA 4PTLA 3VXKA 3EH2A 4FK8A 4O59O 1KOGA 2JHPA 3RYTC 3UUGA 3RB8A 1KPIA 4DR1B 2EGHA 1HE1C 3ZS9A 3OCXA 4B3DA 1KJIA 5KDLA 4DSOA 1A8PA 3I2JA 3B9BA 4LQCA 4NZOA 2IYFA 3FLMA 5TGDA 3B2EA 2WY2D 3ZGNA 3RYFB 4HXYA 3ND5A 4WX2B 3RK4A 1W6UA 1I2CA 2REQA 3H6HA 3P8ZA 4KUHA 4ZODA 4BEJA 4EHBA 1VJGA 3A1TA 4M7PA 5B3JC 5EMJA 1NTRA 4KQIA 2HQRA 4CTOA 4E7PA 3QEMA 1JDJA 3E15A 4P5PA 1VA4A 4TM8A 2B9EA 2BZSA 4K40A 1TJ5A 5HK9A 4PLPA 5KWSA 2PXXA 2X13A 3A11A 3QF4A 2IBSA 2C3YA 1GZSA 1U8XX 2PRKA 2J0VA 1KQOA 1OASA 1OJLA 4C5AA 3TE7A 2P0YA 4YYZA 4CPDA 1JQAA 1PGJA 2F8LA 3FVRA 4R9NA 4OHVA 4B4DA 3AVYA 3H7IA 1QB7A 4MLPA 3CXUA 1H94A 2WJPA 4D3YA 1NG1A 4MUHA 3BSYA 1VI5A 3ROGA 2FZEA 2PL5A 3GJXC 1YU9A 3WB9A 4DFDA 4MDFA 1OILA 4PC6A 3Q0TA 5TV2A 3W9UA 4JT2A 3S4YA 2COEA 5H68A 4I81A 4Q3NA 4YT4A 1XZHA 3NZEA 2YV2A 1PLLA 3GXOA 3OHMA 1WMEA 2B8JA 2XPCA 3ZU2A 1JG1A 1C7RA 3GGJA 4XQEA 1G42A 4J2TA 3ZGVA 2AFHB 3Q8WA 1OSNA 4NE2A 1LWNA 3QVXA 1TKAA 4N0MA 1CJBA 3G59A 4BQIA 2CV2A 4IRUB 5L7TA 2WMOB 2DBRA 4CV2A 4FD3A 1L7BA 3DTVA 5JH7A 1U7UA 1UT5A 3RADC 1E5VA 3MMSA 1THGA 4CCWA 4CE6A 3DFIA 4Q18A 3TMAA 5C7YA 1RPAA 2Y4NA 2HU8A 3T4XA 3NATA 3Q7TA 1Y9AA 4R84A 4DLWA 4Z9AA 4ABYA 1EP9A 1K5PA 2C92A 1UMCA 4HDAA 2C5LA 2EW1A 4I3FA 1GQOA 1N1MA 2YBDA 3JSAA 4OYRA 4MYHA 2OCLA 5FULA 2SECE 4AJHA 3ECAA 1NLFA 1P1HA 1T2CA 3PR1A 3AUSA 4RANA 1C7ZA 4CU5A 1JU3A 4E5SA 5KTPA 2O8EB 2ECFA 1A04A 3NBFA 1I1QB 3HADA 4WOPA 1KYIA 2OCKA 4YDSA 5FUWA 4FN4A 4PXYA 3R3SA 5F35A 1ZDMA 4E5KA 5KNBD 4Q34A 5LIPA 4MOWA 3EPKA 3FFTA 1FNBA 1YU6A 1EGAA 2BSAA 2BI4A 3N8NA 3Q7IA 5AVTA 1BHJA 3GIWA 3H16A 3ZOKA 3ESYA 1KJJA 2GS9A 4U5XA 2UUCB 2EG9A 1Q92A 3BJMA 4PFJA 2Q41A 3BIXA 1VLQA 4D79A 1HY3A 2UYCA 2G5PA 4MUAA 1T8WA 3B7PA 4C4ZA 3REOA 4DT1B 4E03A 4FD2A 4XCVA 4YAGA 2Y0BA 4IGFA 1II8B 1UKYA 2SKEA 4MP6A 1UPFA 1XQ1A 4Z4FA 1F8GA 2P6UA 4TX1A 2N0SA 4XOIA 1SVUA