4XM1A

N,n'-diacetylchitobiose deacetylase from pyrococcus furiosus in the presence of cadmium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
VSTFEEAFNKLLKEVLEFNLENPFEDAKKVICIEPHPDDCAIGMGGTIKKLSDEGVEVIYICMTDGYMGTTDEKLSGHELALIRRREEEESAKLLGVRKIYWLNYRDTELPYSREVRKDLVKIIRKEKPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNIDIDIGLKPHSVSFIALYYTHKPNYIVDITDLMELKLKAIRAHRSQFTDDIWETWEPFLRTVTMFYGEKIGVRYGEGFRVMPGLFYHITPFADLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Multiple crystal forms of N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus
doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Metal binding protein
total genus 99
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 4xm1A00
5CGZA 3WL4A 4XM2A 3WE7A 3DFKA 3DFMA 3DFFA 5B2EA 4EWLA 1Q7TA 4XM1A 2IXDA 3DFIA 5B2FA 1UANA 3WL3A 1Q74A 4XM0A 5BMOA 4XLZA 2XADA 2X9LA
chains in the Genus database with same CATH superfamily
3I6IA 3OFKA 1SIUA 3KWLA 3NUZA 4EGQA 9LDBA 4GYYA 1QYRA 4DEXA 1ESEA 2HIMA 2R7NA 1TGVA 4TSKA 2AW5A 4K2AA 1XCLA 3ZJ4A 1U0FA 4BQNA 3CUWA 2O4UX 3BCHA 4MHOA 3F74A 3IL2A 1SBTA 1BWRA 3A6LA 3NAMA 4WA7A 4GFDA 1FQWA 2CXQA 5L7WA 4BXOB 4FGLA 1QB7A 5BQ5A 5DBFA 4HDCA 2H5EA 4YAGA 2A0UA 4EJSB 1Z8NA 2HB6A 1ND5A 3QVOA 3OJWA 4P6VF 4BQOA 3RIYA 4D97A 2CLSA 2ZR7A 3CKLA 3L7BA 3CBQA 5BR8B 2DZDA 3AFNA 5I7OA 1IZ7A 1HH4A 2NXCA 2X9VA 1RRGA 1UODA 2OLJA 4TWBA 3TEFA 4ZZ3A 3RG8A 3S1AA 1PJQA 1LZKA 2OBLA 3EQ9A 2RJOA 2IYPA 2CY0A 2A7XA 3PC4A 1SIBE 3KKLA 4GKKB 4YCNA 2IYLD 4POOA 2JFQA 3MPOA 2OCXA 4NRDA 3DZFA 1IB0A 1ZKDA 2M6SA 4FGKA 4Q93A 5DWVA 1EWKA 3WMRA 3PFWO 4GGMX 3WGYA 3WIEA 4QJBA 1LC3A 1L5VA 3QHPA 4V38A 4P22A 4FPXA 1HDRA 2PSJA 2XUHA 4HTFA 4S12A 5JSKA 4YRPA 4BB5A 3I45A 1IFXA 3U4HA 4Y1EA 4KQIA 1O9GA 4LCEA 1M2EA 2UVQA 5E9QA 2HXGA 1DB3A 1YBVA 3I8SA 1ZD3A 1PJZA 3U7RA 1QQBA 1L4HA 2H1VA 2JBWA 2JAWA 3KQQA 3FTDA 4ZO7A 3MC1A 4B6QA 2WQ6A 4UCWA 3GK3A 4CBVA 4MVJG 1JFTA 3KEOA 1LQUA 3S2SA 3M0EA 1U8YA 1VMKA 2QLNA 1UR5A 1CY7A 1N5OX 1K75A 1G6Q1 2R87A 3VYVA 3LYAA 4G09A 1Q6ZA 4Q9IA 4M0LA 3GJ4A 1T26A 3EBOA 2OV6A 3AVOA 3VOBA 2VYVD 4BGVA 1Y9ZA 2GEFA 5IULC 1Y3CE 3EXG1 4PLTA 4MDHA 3W90A 5I7RA 4M0DA 1ADJA 3A4VA 2XE6A 4WIAA 5SZKB 4RTPA 4UVEA 1DUSA 5TQ0B 4DLAA 1U5BB 2GEBA 4AC9A 1YL6A 2DLCX 4GPBA 3VPDA 2K6GA 2C07A 3K32A 5SYMA 3ZKAA 5IBPA 5JWHA 3WWYA 2E18A 2Q5OA 1SPBS 3DDHA 2MOKA 5DASA 3PQ2A 1N2BA 2PH7A 3KQUA 1QPGA 2MSLA 2QGNA 3PEEA 1VBMA 1DT3A 3GJ8A 1DC4A 2TSYB 3L49A 3OQNA 1FBNA 4BFYA 3H5RA 3WK5A 2WMYA 1O6BA 3I4CA 1X3SA 2PT9A 1NSTA 3B9BA 1MGOA 2CNDA 1G16A 3HH8A 3H99A 3I2JA 3LY9A 4LC0A 2JRLA 4MRRA 4UU1A 1Q92A 3G68A 3RHSA 4CCWA 1GTL1 4J03A 3BILA 4OXXA 3DZIA 1SCUB 1AVTA 4FFMA 3RU9A 1HZZC 5B1EA 4A15A 5EJ6A 1V8OA 2IH4A 3NOOA 2P9ZA 3P9KA 1ISSA 1GP2A 1KZHA 4DSTA 4FHDA 4FYXA 1OW3B 2HDHA 3CEJA 3MJFA 3MWYW 4EHDA 1LSSA 3INRA 1IZ0A 2QIPA 2M98A 2XDYA 4AJ2A 2XWBF 3QA3E 1E20A 1XE3A 2ONZA 3ZV4A 2JD1A 4BMCA 1FFSA 4M37A 4O4LB 1F8FA 3EZYA 2PX8A 1DIBA 1O95A 1Q57A 4D3YA 2FFAA 3NHBA 3K15A 1K8RA 1USUA 1Z6GA 2CBGA 1RM4A 1Z0ZA 4ZZ1A 3ITNA 3VJLA 1PUIA 2ZR9A 3BL8A 4IXDA 4TL9A 1JHRA 4HATA 3C1TA 4QBGB 3DVAA 3GCGA 3LYUA 1LJ8A 1M3SA 3WLRA 4BU0A 1S7GA 4CQLB 1SKYB 1L7XA 1G5HA 2B8TA 2FWNA 2ZRPA 4RFSB 5I9MA 1LI7A 3OPXA 2CNNA 3P4UA 1UJ5A 4P4NA 2BRUC 4ZPJA 4AJKA 3E2IA 1EVEA 4A36A 2NUTB 1KH2A 3TI7A 3QOYA 2D2IA 4Y2TA 4O8CA 4HFMA 1PUJA 2CNWD 1ID1A 2Q1SA 2P9GA 2M6RA 3KLBA 4I14A 2CHEA 4HXEB 4JCOA 5EHGA 2IV7A 3HDJA 3UXHA 4N8EA 4NS4A 2XUKA 1YQTA 4DYHA 4FEEA 5F9HA 3WGTA 1E79D 5DSZA 1JR4A 1FDWA 5C5EA 2H5JA 4F2HA 4HH3C 1G2PA 1KVUA 1SVLA 4IIJF 5A2QA 6ABPA 2IZZA 3LYLA 1N1GA 3OLWA 2GN8A 3M9WA 5E4JA 1GZ3A 1KZYC 4MUEA 2ZJYA 2ZSFA 3M70A 2BC9A 5BN4A 4KRGA 3L92A 4HPWA 4UCFA 4EVSA 5FWYA 2O3RA 1QRUA 1ZPDA 5ERGB 4E4TA 5E6RA 3SFZA 1B0AA 4BCDA 3C6QA 1DO2A 2E2WA 1ZC4A 3MJSA 3GPDG 5ALXA 2NACA 1QF9A 1MV8A 1B8UA 4JP3A 1L5HB 1PJRA 3DXZA 1UT6A 4RS4A 4X94A 5IMSA 3KZOA 3OEHA 1FFYA 3VNRA 2JCXA 4NONA 2REBA 5KUTA 3KXPA 3R2JA 4FC7A 1Q7CA 2AK2A 1BE6A 1MX1A 1NM5C 3FVQA 2QPAA 2YFQA 3NKLA 2QNBA 2VO1A 3U4IA 4C1NA 1GN8A 2P75A 4FJ1A 3WNCA 4CL2A 1RFLA 3V1KA 3OJEA 2PTGA 4BKUA 3A6PC 1VYTA 4E09A 1DBPA 1D5CA 3AL3A 5L8VA 2QE7A 4KDFA 4H1TA 3MQ2A 5JPCA 3I6YA 5KNDH 2C97A 4LQDA 1IBLB 3WWOA 1VLLA 2D2XA 2JVJA 4HCJA 1E59A 2CL7X 3UJBA 1XXHA 4DLSA 1N8SA 2FZWA 2GM9A 1TRHA 5AW6A 4UXHA 1Z4LA 5FBLB 4KO1S 1NXXA 1MEEA 3ZR4B 3UHFA 2OKCA 4X61A 5A5DA 5CJ2A 1MO4A 3MJ4A 2OV8A 3TLJA 2VDNB 3C2QA 5JASA 2P4QA 1SCAA 1GLVA 1Z6PA 2FPKA 3O3OB 4HLUA 5FOWA 4FFVA 3KBBA 4IGAA 4OGLA 4F5WA 4PZLA 1M66A 1ZNYA 4KBGA 4B3IA 1YR6A 3B53X 3K70D 3S2EA 4QE3A 3WQQA 4KR2A 4EAAA 4IEFB 4F12A 1KQGA 4E11A 4RJLA 5BR1A 1YHYA 5TS3A 1KSGA 4XX0A 4CTNA 1L7NA 2IPOA 1S3IA 2WU4A 5KWJA 1F5SA 3I05A 3JALA 3MTAA 4KO3S 4LTNA 4WMLA 4HUTA 2I8LA 2I4TA 2ZUDA 3QRWA 2LDBA 3A3PA 1RQNA 3QOWA 2PX0A 4F2WA 1UEJA 4N6NA 2WJJA 3FKSD 1L5RA 3UXMA 2D0IA 1E3LA 1XN1A 3V8BA 3P52A 4FBLA 4NPCA 3HVKA 1GZ5A 4AY6A 2VJOA 3PGJA 1XR3A 5D51S 1FFGA 3HV0A 1HXHA 4HB0A 4Q1AA 1GZSA 1GR0A 5T4BA 1N6PA 1RYHA 3WFZA 4MPJA 2WTUA 4DZRA 1E9SA 3HYRA 3MJVA 3AJEA 4DLBA 1FU4A 5A7FA 3TH5A 5FX2A 1KI8A 3ELDA 3SWWA 1DADA 4GEGA 1VJRA 1S2OA 1A1VA 1Q1EA 2ACEA 4GQIA 1OZGA 1GTG1 2B69A 4DIMA 3KDSE 2J32A 3FSEA 2IXAA 4MGYR 5K2MA 2ZB3A 2WRZA 1W85A 2OHJA 2POCA 2WWXA 1VZ2A 1GPUA 1SA0A 2PGOA 3U7QB 2Y27A 3VV3A 1P0IA 4W6ZA 3WGMA 4TTSA 1GN9A 1FDSA 3OKPA 2GBCA 3BD7A 1U0OC 3FCAA 4JVLA 3FNQA 1SMKA 2FQYA 3VSCA 1GLGA 3A1EA 4V0OA 5D85A 2VC2B 4Y2QA 5E3JA 3OF5A 3NBFA 4F96A 3A3OA 3DGEC 1JJ7A 1RJEA 4LF4B 4MLPA 3Q41A 2JARA 4C87A 2Z58A 2ZIUB 3TM4A 2VQEB 5I9LA 2EEZA 4OFZA 3EBPA 5IKXA 1JHZA 4R3NA 3NHUA 2LCQA 2Q2NA 3AR2A 1MP0A 3HHPA 1O3YA 4KXMA 2PIDA 5IARA 2IS1A 4WBNF 5E38A 2FJPA 1E1QD 1PSZA 2XTZA 3LXXA 1JBQA 1VXRA 5I7HA 2FKAA 2G1AA 3P2OA 3TSCA 2IXFA 2PKCA 4D9CA 1DBSA 3ZVLA 4KQGA 1PT9A 4INJA 1BW9B 4KMRA 5IAOA 2FWRA 1MJGA 4YP5A 8ABPA 1JB1A 3K9LA 4B3CA 1YDHA 4WZZA 3TPCA 1V16A 3DD1A 3NIGB 1JAXA 2MSNA 4B7XA 2A9JA 3P8ZA 3PYLA 1V95A 3OO0A 5CR9A 2PZKA 3EIXA 5G1PA 3H5OA 2UVPB 1EZ4A 1NNEA 2WAOA 2ZIXB 3DEIA 3DOIA 3A2MA 1A7JA 3FZYA 5C32A 3SPXA 5D1HA 3G49A 5IH3A 2MCFA 4B3SB 3NPMA 2NT4A 5L4NA 1Q7RA 3OE5A 1O6FA 1HE3A 3KO8A 1T1SA 5G4KA 1A27A 2ZJ1A 3GEHA 4GD3Q 2Z30A 1CUIA 3ZGOA 3IUJA 3K9WA 3H2KA 2GSWA 2N46A 3ND9A 4M38A 4V1CA 3ZJTA 3B36A 2NZUG 4QICA 3QELB 3GPBA 1RAAA 1XMQB 1AXGA 2QN2A 2JI9A 3T7RA 4FS3A 2G82A 1CQJA 2C3YA 4D3ZA 1UZUA 2HL6A 4MNTA 2AUTA 4YJ3F 1TT5B 4HDMA 4AQYB 2IITA 1MX9A 2QYHA 4MRNA 2FOLA 2NX2A 3CWQA 4GU5A 4KPUB 3R7DA 3T4UA 1ZLYA 2PS0A 3IDZA 5DX1A 5AHKA 3RIEA 3V5NA 4E2XA 3F8WA 4LVOA 4RFVA 3HN7A 2JGKA 1EWYA 2OM2A 2WABA 3DVQX 1J0DA 3HEAA 4O25A 3VZRA 5TR9A 3AHEA 3MHTA 4CODB 4FJ2A 3FCXA 2ZYIA 4MYRA 5CCBA 3I83A 4JVNA 5DV9A 2OHHA 4JB3A 4HB3A 4J07A 1HZZA 2XLCA 5CTAA 5K8JB 3OPYA 1SGWA 4AMVA 4BLPA 1FW8A 1Z18A 1W73A 3IAUA 5A05A 2QDXA 3HCAA 4K6CA 2C82A 3ESQA 2ZT6A 1SBYA 3QM1A 3QU7A 3WDKA 1JFVA 3R41A 4PVCA 3V6LA 4D4MA 1RWQA 3PX3A 4QYXA 1MOQA 2C3PA 3RS0A 1PL7A 4V1CI 4YFVA 2NO9A 4YQZA 5LSAA 4O63O 2GN6A 5AD1A 2G80A 2BE7A 1A77A 4MICA 1FEZA 1QU2A 2P90A 1H8HD 5D3QA 3R6GA 4A8TA 1NSYA 3ANNA 1VLJA 2UKDA 2F1OA 3DPUA 4JT9A 4L5YA 4PC1A 5BW4A 3X43A 3GGSA 4UDNA 4Q01A 5EERA 3PGVA 5AXDA 3LBNA 3AVTA 3B1YA 4JSRA 4ROTA 4BFSA 4R6WA 1SUPA 4G89A 5A3JA 3DZKA 2BGGA 3Q9LA 4YO8A 1D09A 3KIPA 2DWCA 3ED1A 1QZZA 3GRKA 3JYNA 3N6RA 4HC4A 3GDFA 1ENYA 1QORA 4MB2A 4D4HA 2BRUA 1P7PA 3SVLA 3C6KA 1PJSA 3MD9A 2YCBA 5HKOA 1T8YA 4Y1FA 1AUQA 3ZQJA 1N8KA 2X6TA 2AFVA 1E2QA 2IQIA 2QRLA 1W87A 1EB8A 3OQ6A 4KQMA 2H4ZA 4OQ4A 3ZY2A 4BLSA 3EZNA 3OIUA 5CLHA 3NWEA 5PNTA 2GEDA 3WWEA 4F93B 3VC1A 3Q2KA 1I6MA 4AT1A 2Y9MB 1BU8A 4NU0A 1JFFA 1HURA 2B9VA 2Y0BA 4GI1A 4ZZ2A 4FFWA 2HQRA 5CX1A 4F8JA 5KYNA 2NZ2A 2H6EA 1YHZA 4NZ9A 4R7ZA 1WV1A 1FSGA 2ZATA 4BKOA 2O8CA 1QS0B 1EFUA 3GZJA 3ZHOA 4GM4A 1SUWA 3SLGA 3JAWB 3F6RA 1NY6A 1R3DA 2C8JA 4YDHB 1W9HA 3TUZC 4Z0HO 4BVJA 5JJBA 3ZDRA 2BHTA 1Z2OX 2IVZA 4G1CA 1RC8A 1ENZA 3T35A 4YAJA 3VNQA 5JZVA 3ZWVA 3L01A 3OSUA 2PT7A 3MAAC 4MQLA 1VHLA 1G8AA 3STTA 4IHJF 2EF1A 2I3AA 2PY6A 3TUJC 3O8OA 3V1UA 4A8PA 1NM5A 1TUBB 2RCNA 5DT2A 3L8DA 5BMVF 4E2ZA 4Q9LA 2G1JA 3QI2A 1UF9A 4JDPA 4UTVA 4PGFA 3GY0A 3PQ7A 4CM8A 2YJZA 5J4KA 4N4AA 2FMFA 2FX3A 2R1VB 1R5BA 5HJEA 4YRCA 5FA8A 5KVVA 2OQIA 4WNCA 4Y9UA 4ND8A 3ICEA 1XNJA 1ZXLA 4WFIA 4F4HA 4Z4IA 4DJEC 1U8ZA 1JIUA 1X2BA 2W6CX 1Z6XA 2WTBA 3IBFA 3B52X 1NVGA 3WQHA 3M33A 4I8IA 5IHXA 1Q44A 3BGSA 4IJ5A 5LIPA 3G0HA 2XMGA 3P96A 3ODPA 5BYJA 1BE0A 3ILYA 4L8VA 4F2GA 3CSDA 3KR0A 3TQRA 2O8DA 2WLSA 4YRRA 2AV6A 2LPMA 2B94A 1G291 2Z09A 2XX3A 3HPQA 3QKIA 3U4MA 4JL8A 1OH6A 4NDNE 1F0KA 2C5FA 1ZESA 5HYVA 2BGRA 4UUPA 2W42A 2H5LA 2CXHA 3S2FA 1E94E 1NJ5A 4ER0A 4H7DA 4HYYA 1NQAO 3LT1A 4OBEA 2PIAA 4LRUA 4BMSA 4C7KA 4CM9A 4BB0A 1QPBA 1WF6A 1WOMA 2VSXA 2FH5B 3JQ8B 3ONNA 2PGDA 4MVYA 2JJMA 3G8BA 4LG1A 2C95A 2X0KA 1BMFD 1U02A 5AK6A 1UM8A 1GPLA 5CG2A 4J1NA 1GWNA 1ZINA 4OUKX 3IELA 3NBZC 3AI3A 4XVCA 5CB4A 3D4NA 5CXUA 1XV5A 2ON6A 3M6XA 1QQ6A 1VC2A 4NAUA 3QY0A 4GO1A 2QAGC 5JZSA 5A6VA 2I7DA 3OT4A 1UFKA 2WSBA 4G5QA 4XYMA 1YCFA 5KNCA 2ES4A 2QM3A 1JG7A 4XTRA 3OCCA 3CNHA 4AYXA 1IPHA 5E1BA 4Q66C 3G8CA 4ZYXA 5ADWA 2HWKA 3THYA 1DJMA 2X0EA 3SC6A 1JE1A 1MTZA 1SCIA 5BSUA 4EKEA 3DFKA 1FJHA 1L7RA 2ZETA 1TM2A 4JJZA 5C35A 3BJMA 5DHFA 2EGUA 4B4WA 4QODA 4HN4B 3W5AA 2PWAA 1KEPA 1YDFA 2I29A 4PV7A 2WF6A 1R6TA 2C4KA 1X1QA 2E21A 5LQRA 3H6GA 1PZEA 1ZM3A 1T2DA 4IW3B 1A9PA 4B5KA 3A0RB 5G3ZA 5IBQA 2BUCA 4UMFA 4LY0A 5K3AA 3TQCA 1C7EA 1MVLA 2IGTA 1W5FA 1F2DA 3F4LA 1FLDA 1XEXB 2YMPA 1AXRA 4EJ0A 3NWOA 4XVRA 1ILWA 1Q0TA 3ZQKA 4Z8XA 3IIEA 3M4JA 3TAHA 3QUQA 4EEXA 4BHTA 5GJWC 2FB9A 5BSKA 3DOUA 4CIVA 4G0NA 1E2DA 3PR2B 4L8GA 3UJAA 2D1QA 4IIYA 3AOGA 4ZT5A 2E5FA 1ORRA 2Z95A 5MN4A 2V0GA 1AHPA 3DLHA 2FFHA 3JATB 3LUHA 4RLQA 1YGPA 1KAGA 4BO8A 3BN3A 3E3LA 4J76A 4N5DA 4POAA 4ZCQA 2H3EA 1Q12A 4E5UA 2ZIEA 4WECA 2PXAA 5G0TA 4HBZA 1OFUA 3DL7A 4AJHA 3D3EA 8LDHA 3ZJVA 2I34A 5CM9C 2W6ZA 4DNOA 4CEHA 4KGDA 2E82A 5J3JA 1BDMA 1PJ8A 4LSZA 1BFDA 4UVDA 5AJZA 3VR0A 3VVCA 4DHWA 4HNAB 1D4ZA 3BMOB 2HBRA 3HFGA 4U0KA 4YASA 3SFVA 1FP7A 3ZK7A 4EHFA 1YR3A 3WV4A 4GVLA 4BO9A 1O57A 5HR5A 4C0WA 3CVOA 3BRQA 3D0KA 3GHYA 2CNLA 2IYXA 2O50A 4Q05A 4Q3OA 4QOFA 4ZQGA 2WF9A 4MW6A 2A1UB 3B9PA 2XJ4A 3R7WA 4LMBA 5LD2B 3KTOA 5FTKA 3TAUA 3JS5A 3PSAA 1CVRA 3OTQA 3UKOA 2EC5A 1GRRA 3W2EA 4BMOB 3TG8A 5HIMA 2QOEA 2IEZA 5B2FA 3O9ZA 1G5PA 5JH7F 1Z36A 3OTOB 1OF1A 4FLFA 3NWJA 4HH1A 3PNMA 2DT5A 2VYVA 2I0FA 3GVIA 5KOYA 121PA 4HT3B 1WPQA 4QAJA 1RHRA 3ZDEA 3MJRA 4FOSA 1BXRB 5KCMA 4Y9RA 1U3GA 4ZVPA 4R16A 2SKEA 1I2ZA 4KK3A 4DQUA 4DLKA 3VO1A 3H1FA 1JVBA 2IXBA 2O3TA 3FOAA 2BI8A 3LP5A 4REMA 2QMZA 1NWCA 3W5HA 3KBOA 3PDIA 4E12A 1YU6A 5ILGA 3IBYA 3R9KA 1V4VA 2VCYA 5K6TA 4JYAB 2CMHA 3ZIUA 4PGAA 1PQUA 4DLUA 3M3HA 4X65B 2EZ9A 3NHJA 4NJMA 5HRCA 4O4JB 1TGYA 3T52A 4C0AC 4KYUA 4DV7B 2CJWA 3ROQA 4TV8B 2AI1A 4G3XA 2TRSB 4D02A 4Y6OA 2NZXA 4MV5A 1J2TA 3ID6C 5F52A 4GGPA 4AO8A 3EIEA 1KWKA 4ZDIA 1IHDA 3DT6A 4P31A 4YCBA 1K4MA 4CXMA 2V3CC 2O1WA 4R31A 1G8GA 3ZWBA 4ZEOA 3UJ8A 1I7LA 4Q3CA 1YU9A 2PBLA 2NU8B 3MQ4A 3V8NA 1YI1A 2W0SA 3EGXB 4G85A 1ZCBA 4BLVA 1ZBDA 4RKFA 4IX9A 2MHCA 4IZOA 4LECA 5LZ4A 2L17A 4RDHA 3VNVA 2A9QA 3G82C 5ECWA 2WG0A 1QVVA 3BZWA 3B7PA 3DEYX 3G7NA 3W8NA 2GSDA 4ZI7A 2GTHA 5ANRB 3I61A 1L7OA 4HR7A 1QPZA 3ERCA 5CFMA 4FN4A 2EYUA 3N76A 4NAVA 3N2IA 1JXAA 5KJ6A 2OBMA 4XIYA 5AW3A 4MXDA 2C31A 4OK3A 4ZI5A 3PYMA 1VHWA 2ORIA 3KWMA 4N12A 3T5PA 1G21A 1TQDA 1Z83A 4AS3A 1BAPA 1HE5A 5CLLA 1JQAA 1P5ZB 3OTGA 3L0BA 2H00A 5AK0A 3KL2A 1KRXA 4XR9A 1JLLA 4F3YA 1U0JA 2CNWA 4RZQA 1JFRA 1X1CA 3M3DA 4ZCIA 1CDDA 2GF0A 3CB4A 1Z0JA 3CKYA 1AGRA 1EVQA 3JYLA 5JD5A 1E79A 4PC6A 3H8WA 4RY0A 1OLOA 1CULC 3ANXA 5CT9A 5F2OA 3UH0A 1BGXT 2DWQA 1SEPA 4HEQA 1FSPA 4X71A 1KJJA 4AP5A 2DFVA 1AE1A 3NFRA 3OM1A 4D9KA 4X6XA 4E5SA 3NJRA 1Y8QA 2CFIA 5MGBA 1X77A 1DG3A 1Z6ZA 2V7UA 4X9XA 4AZWA 4H7KA 5BSGA 1K6JA 2I67A 5REQA 1ZN7A 2IYZA 4DSZA 2ZI5A 1TTTA 1V3UA 3GCDA 4JITA 5I51A 1QIEA 3OY2A 2APJA 1CE8A 1U3VA 5JWRA 1HDCA 2L42A 2I9PA 5CPBA 4OHPA 2NZ8A 2JIMA 4HY3A 1JLSA 2XCSB 3F2IA 1H1LA 5K4GA 1Y6ZA 2XCTB 4EB6A 1Y4ZA 1XQXA 1IUKA 1XTRA 2D3WA 2HBYA 2H59A 2V45A 4GKAA 3LJKA 4QFMA 4RY9A 4Y0NA 5C7YA 4AW9A 4I4CA 3OPQA 2D1TA 2Q5EA 3ZXYA 3A6FA 9ABPA 4LKRA 2VAPA 2MWMA 3C39A 3BMCB 4BV8A 1RYBA 3JQAB 4ITVA 3UJHA 4AMGA 4P34A 2O59A 2WWTA 5C8YB 2VHYA 4R51A 3T7AA 3F96A 4KXYA 4NARA 3C3MA 5DHSA 4BX3A 1N8TA 2FW9A 1T1JA 2X15A 4MINA 1H1TA 4MMYB 4BGEA 3U61B 3K96A 2NVWA 1X1BA 3N8HA 3DZJA 4PSKA 5G1OA 1KFKB 3A1UA 4H4EA 3TLZA 4JJFA 1IONA 1WSAA 2OD9A 3A6HA 3PEUA 4HQFA 4N8SA 4URFA 1XTQA 3E53A 3PD0A 5LC1A 1W88B 4IDHA 3KKQA 1ZN8A 2Q5LA 3AEUB 4GKJB 3GC6A 1FOEB 2Y6VA 3U4AA 5KDDA 3G79A 3U48A 2PJUA 1C29B 3BCRA 2GCIA 1BDIA 4Y6SA 5A7HA 3LC1O 5HJ5A 1OYWA 2J9RA 2AKEA 1VKJA 4KXXA 4GMKA 1ZUNA 2ZAGA 3BK2A 4R5MA 1DC5A 2EW2A 4RLSA 1V6SA 3ADCA 3TRDA 1M1YE 1LQ2A 5HE8A 3VZQA 1R8YA 4LJ4A 1NOJA 2F3QA 3OETA 4B6PA 2CHGA 1QHNA 5CGZA 4BZPA 3QNMA 5SY9A 2MIIA 3AUXA 3VC2A 3MWKA 3OT1A 5EHQA 4E7OA 1H5UA 1TMOA 2B7CA 2AJLI 2JLSA 2O2DA 4JA2A 1Q5PA 1X42A 2OMKA 2WFMA 4LISA 4PYNA 1P0FA 2QAGA 1L6IA 1CNMA 3M82A 1E58A 1WVGA 2H5IA 1BFUA 3ELWA 3FKSA 5C3MA 1GG8A 1KEEB 4MYDA 3CSSA 5T3YA 3P2IA 3IAS1 4TKUB 1WM1A 4BTEA 5LZ2A 1W49A 1A9QA 2C9CA 3OA0A 4D8YA 5KQRA 4BJ5A 3WLLA 4K8OA 1LBEA 4FZ3A 4YALA 1AJEA 1TD9A 2E89A 1VQ1A 4RZXA 3EMDA 4EB8A 4ZYWA 5LXTA 1VG8A 5L7YA 5DT9A 3UICA 3HDVA 4N76A 2PQ0A 5KKNB 1X9HA 3R3XA 2O5CA 3GJXC 5F5NA 2BEVA 4DMUB 2DR2A 1LLQA 1JHXA 1YZLA 3H16A 3VR4H 1D1PA 2H17A 2OENG 3IDQA 1IQUA 1V3TA 1D0SA 4QFCA 3KAKA 3KOUA 5EPUA 1B4DA 5I5EA 1RI1A 3I9LA 1FLVA 2CEAA 3KP1A 3MRTA 4UVHA 1J23A 3ZHQA 2JRCA 1SVUA 3LHFA 4RF3A 3MT9A 4I1RA 1ZI8A 3CRVA 5CVJA 2GRUA 2I2CA 1U7DA 4TTPA 4KDEA 3CLTD 4C5AA 2Y0EA 2OXIA 2BDEA 3GGCA 2ADOA 3UMGA 4MV0A 1DX4A 5ES3A 5F2EA 2H4HA 4J0HA 2VSNA 4EO7A 4Q15A 2HA5A 4F85A 1E1QA 3LVQE 1MVNA 4DLTA 4C30A 3NAGA 5KYXB 3WBFA 2QRMA 2EX1A 3ETGA 4LDNA 2AQHA 4G0QA 4A2PA 2IYFA 4YRQA 1GGFA 3DD5A 3ZV6A 3UB4A 5LNK1 4KNYA 1T5SA 2RC5A 2FUNB 3QVUA 4L9SA 3BG5A 4PSAA 1ORHA 1W36B 4Q7EA 3W77A 3L0OA 1GKUB 4NENA 2RGWA 4OU4A 4B7ZA 2JVIA 5IYZA 1RBQA 3P9SA 4Q4HA 4O2BF 4QFDA 5SZHB 3NFYA 2FPUA 4R83A 4OHYA 1EUQA 1ZG3A 4MKRA 3OM8A 3LHKA 2KE5A 2CCJA 2DMRA 2GPYA 3NGLA 1FNDA 3MAGA 1BMDA 3L43A 2VL7A 4TMXA 5IVPA 2GXSA 3BFJA 4F60A 1A82A 4HGQA 1NVVR 2OCBA 4LZPA 2JGNA 3EOZA 3PGLA 5FIUA 2C0QA 2CB9A 3BXEA 4IIJB 2AMLA 3JWEA 4JAVC 4MW4A 3T9FA 2PPVA 4ZOLF 3U9SA 3RQSA 4DA6A 1ILEA 2W6JD 4AUNA 2EKDA 2GK4A 1ZK4A 2H0RA 2V1UA 1C0EA 3O4HA 4OXIA 5EIBC 3BA1A 3N70A 3KUXA 1TZMA 3SQNA 3HTXA 3USZA 3DW3X 1DXQA 3G13A 2VJNA 5AM0A 1Z0UA 3E9NA 5FBWB 4EK9A 3ZVKA 2IH2A 3WK6A 1HDEA 2QTVB 1Z28A 2IYVA 1KI7A 4UNPA 4GRAA 4ILKA 3WGKA 2YXNA 3B6ZA 4KNVA 1JTFA 4KOEC 3CGWA 1TFUA 1PK9A 5LDDC 4FOTA 2II6A 4X6YA 2Q5CA 3U3KA 3RAFC 1M67A 3KD2A 4PS0A 3VDXA 3OQJA 1JFSA 3G0OA 4EFDA 4GR9A 1Z4KA 1T0JB 1VIVA 2YWEA 4UBJA 4CJXA 4XYLA 1L7VC 2X8AA 4GLJA 4KXFB 4FDUA 2AR9A 3BQNB 3YASA 3E5RA 4EZBA 2A58A 5KDOA 4FHGA 1Y5NA 2XGSA 3AXTA 2KB0A 4N1AA 4FMCB 1YIAA 3P0RA 3BB4A 4RENA 2RH5A 3SK0A 2C1XA 4ZIRA 4YV0A 2P65A 1XC7A 2VUHB 1I2DA 1N5KA 2Z3ZA 2CF5A 3Q98A 4FCWA 2YIDA 2QVGA 4M9ZA 2CLDX 1H8HA 1O6GA 2BE9A 2RHBA 5TJHA 3RWMB 1T0UA 2A9PA 5LQKA 5AKIA 3TFWA 5J2UF 1LSJA 4DNQA 3OOEA 3PL1A 2O0MA 2A2ZA 3HGMA 3G2HA 1W5EA 3EWAA 4A6XA 3EVDA 1FY2A 2YVQA 3PNPA 3R5TA 2PBRA 3QUBA 3O8LA 4IUYA 4ZVUA 1MW9X 4X7BA 1QQ7A 1XZMA 1M74A 2QK4A 4YYEA 3G23A 4EA8A 1OB2A 1KO8A 1U9ZA 4YMTA 3SXPA 3QXJA 1RHJA 2IZ1A 3EAFA 1WUTA 3X0DA 1QUEA 3F5DA 1KDPA 4KO4S 5E0KB 2CVOA 4OA8A 1NQ5A 1E2UA 3TLGA 5EZQA 4PLWA 4KN8A 4ZI3A 4FWTA 3A7EA 3LPDA 2XZLA 1VOTA 2EP7A 3CO0S 1P45A 3QFRA 3RABA 3WYBA 2R8RA 3M2TA 2JI6A 3PNQA 3I04M 4RSGA 4NK5A 2WTMA 2WIAA 3LF2A 4HNTA 4F72A 4E5YA 4G5FA 1K98A 4X7PA 3AERA 3LECA 4KZPA 3UAVA 2FWIA 4F4UA 1DLIA 3JQCA 3AJAA 3C24A 1QIKA 2Q5QA 2LTAA 2VXCA 3B1ZA 4JGBA 4URHA 1XDGA 3P1JA 3A1WA 3LKZA 3M49A 3TZEA 5BSMA 4PU0A 1C80A 2P27A 1SCNE 1SC1A 2QRPA 2YJ5A 2ZRKA 3FWHA 5TNXA 1R0KA 1ZGGA 1A72A 1YB1A 3NTQA 3CEPB 3RV3A 4RHTA 1DLJA 1V41E 1HLFA 1YI0A 3AGQA 2OXTA 4YIHA 2E5WA 4N9QA 4KMSA 5HQTA 5ALDA 4FFBB 3LV8A 1SWWA 1LEHA 1UXOA 3IBGA 4AURA 5EIFA 3A37A 2D1SA 5FT9A 1Z6AA 3BAFA 5JAMA 1GAJA 2Q3CA 1NUQA 2F59A 1IBCA 1RXWA 1KJIA 4GKBA 2VH2A 1VJGA 3ZOKA 2Z8YM 3ZGLA 1KI3A 3HCRA 3LFHA 3UMRA 3UJ3X 1D3AA 3O9VA 4MARA 3CN7A 2HF7A 4NYMR 5T41A 3W3AD 4AX4A 3MB8A 4RPCA 1H2BA 1E6EA 4M9QA 2UXBB 1PS0A 4ERNA 5ELLA 4JJ7A 4KSCA 4CU5A 2O0HA 1QAOA 1OX6A 5K7SA 2R85A 3BWMA 3BSWA 1QG4A 3DUFA 3DV0A 5CG1A 5IXSA 5J23A 4NBLA 3OU7A 2FGJA 2CDBA 4OKNA 3GGPA 3QVMA 1W1IA 3AEZA 3IQGX 3Q4GA 2VYFA 3HUUA 1QC5A 2IE0A 4MI6A 3WNZA 5DHQA 3GVPA 3SEZA 1ST3A 1H22A 1S02A 2RG1A 2X77A 3LH5A 3AB8A 4GE0A 4MLZA 1X74A 2X0RA 3H13A 5T4EA 3RADC 2GBPA 1T5BA 4F6RB 3WC4A 4L4SA 3ROFA 3GJSA 5GY7A 4ENSA 1ZNQO 3I01M 2WFZA 2UZAA 3GOHA 2ZBPA 1L4EA 2HC9A 1C3LA 1ORTA 2IX9A 3DAHA 4WK2B 1BMFA 1SKAA 2DUUA 4MGEA 3IDAA 2RIRA 4PLZA 1K08A 1IZZA 3TIFA 2PSHA 3V42A 3FPEA 1QR6A 1QIMA 4GR4A 4LIPD 1NUPA 4RPLA 4YCJA 2R6DA 2XVAA 3Q6NA 5I7SA 4B47A 2YL2A 2ZR8A 4FEAA 1KERA 1XQVA 3BFXA 4C7OA 3ZXIA 1JDZA 2IHNA 1QHXA 4HNQA 4EB3A 2VWPA 1PV1A 3IQXA 2B8NA 1ORWA 5HZGA 3LSYA 3GT0A 2W6QA 3VM6A 5KEIA 3ZEIA 2PH3A 1AHHA 2JD2A 4KU4A 2IIPA 4AB1A 1J25A 4XR4A 2JIBA 1OLSA 1Y7HA 4M0EA 2ORVA 5EJFA 1SHLA 3GGJA 1TO1E 3R9XB 2X8BA 4TMFA 4YJ3B 1DBQA 3PGXA 4PLHA 2R84A 4MVJE 1FFAA 5TT1A 5IJ9B 3V1YA 3QSYA 4M1SA 3W0LB 4Z53A 3FDZA 1C1DA 1RWVA 2ZBRA 2EGHA 1DTSA 3FMIA 5JG7A 3OCYA 3JVVA 4TXJA 1KF0A 1Z6TA 3F7OA 3VVLA 3MILA 3CJTA 5CURA 3STVA 2VJCA 3GFFA 2V3VA 5F7JA 1MB2A 3BB3A 1T6BY 2QDKA 2IBTA 4KQHA 3OE4A 2W4QA 3L8FA 1MD9A 4AJ4A 3EFHA 5AICA 3FPJA 3CW8X 3M6IA 1PFKA 4C0BA 2O2YA 1D9ZA 2X8JA 4Q3BA 1F9AA 1GPBA 2FUG1 1PSWA 5DULA 3IVXA 3OPMA 3KJNA 1Z2PX 2G04A 4WK4B 5FWXB 1SQSA 2UYOA 2B98A 3E9EA 3K20A 1WE2A 4LYHA 1M1UA 3UCEA 5CCXA 4JC5A 2AOXA 2LR0A 4IWNA 2PRIA 4MYSA 3LPLA 4Q1BA 4R9RA 4NCAA 1H69A 1R12A 4GKVA 1UBHS 1KZ9A 2O8VA 3CBGA 3NHWA 1FTSA 4BX8A 2HK9A 3LVBA 2HEGA 1M8KA 3RU2A 1Q1QA 4Y2RA 4J4HA 5AIBA 2WYOA 3TQQA 4EY4A 5CK5A 2W2KA 2C8KA 2WMNB 1PG0A 4YC7A 2AKAB 4B74A 1RAGA 2BTQB 4FFNA 2JZCA 3BE4A 5EJ8A 2RDMA 4CEIA 4CCAA 3TJZA 4IFTA 2V1XA 4TL8A 5DEOA 3LQFA 2VJMA 1QRAA 1A98A 3V4VB 2FFBA 3K8ZA 4PEVA 3R8CA 1GDHA 3BDAA 3ES9A 5CM2Z 1C81A 4QBKA 5KYTA 1OFHA 3Q11A 2A33A 4BFLA 2O2HA 5HBRA 3LQ1A 1F12A 4L9WA 5D84A 3HS3A 5KSYA 1GQ2A 3QVGA 4FLMA 4Z7NB 3COZA 2IUEA 2PD4A 3MPUA 4JL6A 4DCGA 4NOMA 2ZJ8A 5I9BA 2Q3EA 3OH8A 1XB2A 3W6UA 1NFRA 2CFSA 1WF3A 3QX3A 4DZTA 1WBBA 4DV6B 1CY4A 2BAGA 4JEHA 1N6OA 2JANA 2BMJA 3ECAA 4E2FA 4EX6A 4QVIA 3AGPA 1IMOA 2VXYA 1P4GA 3VTAA 1NFFA 4H35A 5ALMA 1RMYA 5BYAA 2ZOSA 2XSZD 5E6UB 2O8FA 2KLHA 2VQDA 5PGMA 2NV0A 2VNHA 2XNHA 4M0UA 3ABIA 1V1MA 1X7XA 3AU9A 4JIMA 4Q3NA 1NULA 3VZDA 5IWCA 4NZMA 4RCZA 1LRKA 2RC6A 4KO2S 3H3XA 4D9IA 2WD7A 4BMDA 3KLMX 1TAHA 4IHJB 2YVKA 2ZWMA 1PZHA 2IZ5A 3WLTA 3EXFA 5DYIA 1XZQA 4MR7B 3TRHA 3C7CB 1Q14A 2C0CA 3FUVA 1WNTA 3OOWA 3R23A 1F4PA 3LQQA 3URMA 2PDAA 4ADSG 3WMXA 1WZEA 4YJHB 1Z17A 3DFZA 3ITEA 1RWWA 5DP1A 2VZEA 4TKZA 1XKQA 5BN3B 5C4IA 2RK4A 5TQVA 3VPGA 5JPDA 1TJNA 2DAPA 1E2NA 2B3TA 4PPFA 3B5IA 4FE4A 5BSTA 4KIFA 3RV4A 4TM7A 3S2IA 1ZW1A 3V97A 1EJ2A 1XRMA 4CU2A 4DXDA 2BJWA 3ILHA 8AT1A 4LNUA 5CVCA 2RK3A 3KQMA 5KYUA 4E31A 2HF8A 2JCSA 5FHQA 3ZYZA 4BP3A 1A5ZA 1U04A 1KO1A 1Z56C 2OAGA 1FP6A 1F2UA 4IPTA 2UZ0A 5AH0A 5TMBA 1KAQA 3BOSA 3KEQA 2XW6A 1ZMRA 4Y2PA 1CDOA 1P6UA 1TE2A 2VBCA 1NQOA 3MN1A 3VR2D 1T6NA 3LW7A 1DVRA 2EBFX 2VWGA 1I2BA 1Y5MA 3CA8A 1TW2A 4JLAA 1U7ZA 3INYA 1UANA 1PT8A 2G5GX 2DCUA 3B85A 3FWYA 4AZSA 2FK7A 4BDTA 1FDVA 1Y89A 1Q2XA 1SK8A 5AK5A 1TM3E 4EATA 2LBPA 5KTSA 1OROA 1W75A 3ET5A 4HAZA 4B2PA 4JKOA 2P5YA 1NPYA 1EH5A 3UWKA 3AQIA 2O2GA 4IUBS 4Y2SA 3VU9B 1KPHA 1RHMA 2ZTSA 5DI9A 3R6LA 4L15A 5LMCA 1TADA 2CVFA 2Q0QA 1K86A 1P77A 2XOKD 5D7NA 1SXIA 2VLBA 2XUQA 1N7GA 1EXNA 4ID3A 1GPYA 5KYKA 1J49A 3UVEA 1GQQA 1T9CA 2PJZA 1GL7A 1KGSA 1ZO8A 2DWUA 2QQFA 3D8HA 2DH5A 3E3NA 3QE4A 1HEIA 1NJGA 4HH0A 4MUBA 4Q1DA 3D8SA 3SS9X 3EC1A 1SKBA 4E4YA 1G3UA 2AR7A 3PLRA 2P6MA 2GETA 1XNHA 4HO1X 5HHTA 1TF5A 2ZYDA 2MSEB 1XA4A 2GAAA 1L5GB 3ONWA 2IYRA 3PBKA 4BVKA 4OQDA 1I3CA 1C9KA 3DWFA 4BNTA 3F3KA 1JTVA 4CE6A 4AUKA 4MX8A 3QXSA 1PVOA 4C4OA 3JQPA 1MAWA 1PFWA 2DE0X 2AD5A 3B3FA 3ENWA 2FRDC 4MWSA 2VJLA 3V1NA 1IBKB 1GSIA 1O2DA 2HREA 2CV0A 5LU9A 4ZKEA 2UXDB 1EUDB 4H6XA 1QFYA 3E05A 2Q4OA 1RAEA 3AVQA 2FAXA 1DXOA 1CQIA 2AUNA 1EVYA 3QE3A 1JF8A 1YRYE 2XDAA 1A7KA 3DBIA 4HYQA 1N0VC 4IDNA 4WQMA 4YGXB 2CMFA 3GZNA 1HTTA 1DMRA 4U5XA 3VDNB 3D59A 3CUUA 4GBMA 3OHSX 5IKOA 1UQRA 2B9EA 3LBHA 3UM9A 2Q2VA 2PG3A 2RARA 3HCOA 3PKIA 5AKZA 3HMQA 3LQ2A 1DO0A 1X7YA 4DLPA 2FN3A 5K3EA 1CF4A 3AR7A 5DM1A 3U4QB 3HZHA 1M6NA 1NZDA 2ZAOA 1M2VA 3NT5A 2Q4RA 2CMGA 1QX3A 2Y1GA 4JLWA 4P5EA 3UK1A 1V8PA 4L95C 3H9GA 1EXMA 4J43A 4N0MA 5ARDA 3GFTA 2C5EA 1SOWA 3C3EA 2I6TA 4OV6B 4ENPA 3U80A 3OECA 4HYEA 4EMUA 1XJCA 4JQCA 5FRDA 2EU8A 4Y6PA 4U7TB 1Q2UA 1TOAA 3MLBA 1Y6JA 2XB6A 2YTZA 3ILVA 3OKFA 1FYEA 2EEPA 2YC2C 3N8GA 2B35A 4HEHA 4O4HA 4TMTA 1MQ9A 4TSFD 2FZGA 3QYPA 2X14A 1IAVA 2GRAA 3ZGZA 2AFHA 5AKKA 3ZWOA 1NN1A 1K8QA 2J4FA 4ECEA 5A62A 3GVHA 4GOJA 1CZLA 3KV1A 4HN2A 1N6LA 5EUBA 1ZVMA 2R68A 2O7SA 4CN8A 2HHAA 4HZIA 1UXKA 2H2HA 2R47A 2WJPA 5EJMA 1A69A 4OYHA 5GADl 2Z98A 1H2WA 4QWWA 2PQ6A 3LIPA 4X0EA 2X0JA 1ZGBA 2JNWA 3HGQA 4QTZA 3A9CA 1KORA 3MIZA 3W8RA 3ZN2A 5JNVA 5H02A 1UC5B 2NYAA 3IQWA 3HKDA 3GELA 2IIBA 3ADPA 1F0YA 1QOPB 1OZ0A 4I46A 3T5BA 3JPYA 5KZMB 2V97A 2VDMB 2AQKA 3NV9A 2B2NA 3R44A 3NC1C 1UZNA 2YXBA 3A4NA 1Z0DA 1X1EA 4PYMA 1AKWA 1I3MA 1JQKA 2ZSUA 3WMEA 1CKEA 3DWEX 1Z5GA 5B6PA 4JR1A 1MABA 3K6KA 1U8UA 1QYVA 1KDVA 3TRJA 4S24A 2D54A 4K40A 3RFUA 4LOKA 3DO6A 5JS2A 4TYMA 4B6GA 4ZYYA 1J56A 3C0KA 3IIJA 5CB0A 3HDYA 2PL3A 1I0LA 1HE4A 4IEEA 5BW5A 2QX7A 1DXHA 2FRVA 4B3DA 2VI5A 2JGLA 3GLQA 4MJ3A 5LMUB 2CFRA 1IY8A 1ZWKA 4MVJH 3BIJA 2ZI7A 4Q9NA 3W9UA 2W48A 5FTMA 4DMHA 2QI9F 1VHTA 4PZ9A 1QO9A 4U6QA 4LHYA 3SP1A 1US8B 3N3AC 1ECJA 4UHDA 1ZN2A 2QP4A 1Y3FE 2RHTA 1PN3A 5DO9A 3ETHA 4PZEA 5T7BA 1UAGA 2O3JA 3GOQA 1GNPA 3IAM6 3OP4A 4D0RA 1JS1X 1XAHA 1ZMBA 2P40A 3UMFA 4FW8A 1ISRA 2XQKA 3OJXA 2Z04A 4DKJA 1PGPA 1QMPA 1ZD2P 3K2BA 3MA0A 3NTVA 1LVUA 5TE9A 1EP2B 1DTWB 3IMEA 1CIJA 4A6DA 3A9RA 3EDRA 4UTPA 3DXYA 3NETA 4UM5A 2PYZA 2VVTA 5EJ9A 4RE6A 4ALLA 5KO2A 4LRTB 1LVGA 2RI6A 1ZFNA 4HK4A 4JWTA 1I3NA 4M3NA 1KE2A 3SIRA 1H93A 3FNGA 1OILA 4WH0A 4CM6A 3EUWA 3RI3A 1KQFA 3DHWC 4CFSA 1H42A 3WKEA 3GEIA 3W2FA 2QYSA 4EUEA 4LNHA 1BA3A 2CVHA 3DE4X 3MWEB 3PZRA 1LU9A 1ZJYA 4KXQA 2GF2A 2CZGA 1TM4E 1BYUA 2Q5JA 3PC8C 4ZEMA 3NNDA 1HY3A 2I7CA 2WM9B 1HSOA 3IP6A 3LDGA 5U4XA 5TVKA 2J6CA 3NAQA 3ILXA 3AF5A 3GGGA 3SJ7A 1ZNZA 2PUWA 1YONA 4YA6A 3BWYA 1PR9A 1GQFA 1T4MA 1YQ9A 3RS9A 1A71A 2ODBA 4FR2A 4JB0A 4E70A 3F5SA 1C3JA 1X0VA 3E23A 3HCWA 1COWD 3GRZA 3O92A 4DWVA 4Z51A 2CWWA 2K87A 2MR6A 2W6JA 4JP8A 4U7DA 4EKIA 1GQYA 3FWKA 2YUTA 3LT5A 3O8QA 5AI9A 5DK4A 1WTAA 4RC9A 5FXMA 2BFPA 2FSPA 3RG2A 3ORQA 3CH4B 1AY0A 3SCZA 1GADO 3A10A 3DBRB 4HXFB 1PIWA 2QUIA 4M1MA 1GCOA 1V11B 3AY6A 5ALGA 3HNPA 1OAAA 1YUMA 1KAMA 5EKTA 3CCFA 3T12A 2EHJA 1ECCA 1V35A 2E3JA 3D31A 4FSHA 4HUJA 2BSAA 4REQB 2PYIA 1OFTA 1VPEA 1N1DA 3LWBA 4CFYA 3F6SA 4Q4DA 4LF5B 4IDAA 2XJ9A 4HRXA 2DBYA 2HYDA 4LVCA 2IUUA 3STYA 1DRVA 1OVMA 3B60A 5DYGA 4BV3A 4IILA 4XUEA 3IIMA 3WLEA 1OSNA 3EEIA 1ECPA 1L4BA 1VCHA 2I2BA 2I71A 5BN5B 3B3AA 4TRMA 4RF2A 3CX8A 4PNEA 4GOOD 1NW9B 4JFRA 2BFAA 3NX4A 5COQA 4OJKA 2VH1A 3S7ZA 3QF7A 1XLTC 3T7KA 2AFIB 5BPHA 2HMWA 3N2GB 5GWXA 4R71A 1A9RA 4Y0AA 1U3TA 1NMXA 5JJLA 4F9GA 2I3GA 1RRKA 1RXYA 4YI3A 5J40A 4YECA 1D0IA 3JQEA 2RKBA 3RU7A 4DARA 3T15A 3P27A 3IDSA 2IYQA 1U8FO 3EIOA 4PX9A 5HCIA 1M54A 4YRMA 4QYWA 1JQDA 4ZJYA 4QUDA 3TNDA 1Y1KE 4R8KA 3DTNA 5GQSA 1SM4A 1NSFA 2PX4A 2ERCA 4LBVA 4NEHB 2CBZA 4YJFB 1KI9A 1TO2E 4N9WA 4L57A 2C92A 2ONYA 2B1RA 1LDNA 2P6OA 1JKMA 2Q2OA 3O7MA 3GW8A 4PAWA 5EI5A 3I58A 3ZU4A 4A7PA 2GZSA 2Z57A 2GZDA 3Q8MA 2C2WA 1EP3B 3RGGA 2VRWA 4HP8A 4C7XA 1Y81A 1GRCA 4OFXA 1AGXA 2HF9A 4J1QA 4N40A 5G0SA 1V7QA 5DTJA 5G0VA 3SU8A 3U9TA 3URKA 5L40A 1N36B 4CLRA 1W19A 3E81A 7GPBA 3WBJA 2DKOA 2FFQA 2X7XA 1J09A 1DIHA 2PGLA 3RYIA 4HG2A 4PQFA 3RAEC 2UZ4A 4JOCA 5K4HA 4XWAA 2GPBA 1G6HA 1U8EA 5FNVB 3RSLA 3AB7A 3UV7A 3ZWPA 2QTCA 3VX3A 1B43A 3PRHA 4NL4H 5AJUA 2ZVQX 3N8NA 3AF6A 4RSHA 2QMHA 3L9WA 6AT1A 3CINA 5FUMA 3D2AA 3F3SA 3GR6A 3NXSA 5J1TB 3HXLA 3RUDA 2CLLB 2GA9A 3A14A 1WCYA 2SICE 3NUGA 5CBPB 4XYBA 2NTNA 1VJ5A 3FA2A 1I1NA 1M34B 1ZEJA 3R5SA 3PC3A 4QBHA 1FU8A 3V8QA 2HK8A 3KELA 2FRDA 1JPVA 3G9UA 3W7BA 5JD3A 1GFWA 1FX0B 1J0XO 1RI5A 3LC0A 2XYPA 2XGOA 5TGTA 3ZHUA 2P67A 3KETA 2R6FA 3DDCA 2C2GA 4UAJA 4UJ3A 4YR7A 1RRVA 4FVTA 2FFJA 3KTDA 2YIMA 3DEZA 1PJTA 1PQWA 3H18A 3H42B 4G8BA 2DPXA 2FCRA 5BSVA 1H3EA 2DWPA 3QPVA 1UQTA 4ISCA 3VMFA 1MQAA 1WMAA 1ZISA 2O52A 4A0FA 1Z63A 5JSFA 1GCUA 3W3AA 2KWIA 2X2PA 1R0BA 3TZHA 1EGVB 1P0PA 1QQTA 1TECE 1ZVJA 3A58B 3K7EA 3CPEA 1OBFO 1CEEA 4B43A 2R8BA 5CNJA 3HJNA 4YRKA 2Q07A 3M34A 3ABOB 1A4RA 3DCNA 3I4FA 3I8OA 3VPAA 5LQCA 5LL6P 2ZRBA 1ZC3A 221PA 2PUJA 1IPFA 1H3FA 1U63A 3DBHB 3F5MA 1VGQA 2BEWA 3EHEA 3IJEB 5KMGB 5IVIA 3LLSA 5INTA 2NAFA 4UHFA 1O0BA 3MT7A 2WICA 1YFKA 2FMKA 4K87A 2XXAA 4N7JA 3BWVA 4O5AA 5EIWA 4XOUA 2JJ1D 2RONA 3CISA 3PC7A 4GPZA 1JU4A 1MJNA 4EPXA 5FOXA 5FJIA 3DDSA 2C4MA 3FUTA 4JVMA 3WWDA 4EZIA 4H08A 1M2WA 2I6GA 2AEEA 2HZBA 2NO7A 5JMOA 3OOJA 2EGGA 2B34A 521PA 3KQVA 1PLLA 4KP7A 2GBLC 1PD0A 3L0YA 2WZDA 3L6OO 2BFNA 3OIVA 4B7CA 3NYRA 3C43A 1VXOA 1OD6A 4BRUA 2VUUA 2AXPA 1H3NA 2BKXA 3PYXA 3BFPA 4V0KA 5SYNA 3HMKA 2OGUA 3FRJA 4P83A 4QYIA 4OUDB 4DC1A 2AOTA 3HZRA 4D8VA 1DEHA 4ZOLB 3U2QA 4DRXB 4TYQA 3RKUA 1EX6A 2YHBA 1OXXK 5CHEA 2NSDA 2ZRDA 3D43A 3VHXA 1TK2A 2G17A 2V55B 2W8BA 4XDGA 3R5FA 2PMEA 1ZMXA 4DPKA 4F4FA 4X7MA 5T3UA 3CU5A 2W7TA 2ZT5A 4CHTA 4Q37A 2Y2UA 3UV3A 1L3BA 2CXTA 5K6RA 3GFVA 4NHEA 3WHLA 4BB9A 1W4RA 2D4AA 1ZUWA 3N0VA 2EJVA 4FYVA 4PBTA 3IKLA 5BWBA 4RK4A 1T3HA 3LLMA 1NX6A 2CJYA 4TWAA 5EKUA 2VP9A 4XH9B 4XI9A 3EHDA 4ZAGA 4A27A 4EBFA 4K3VA 3CW9A 5HRUA 1WD5A 2VF2A 4ZAFA 1I94B 1A9XA 2A67A 3CR7A 1EUCB 1QFJA 3UCFA 4EYEA 2C5BA 3WE7A 5HNKA 1NBWB 1ZSVA 2QXYA 1UJ2A 2QTFA 3DTVB 3GA5A 4QULA 4OKIA 3WO0A 5D3MB 4MHTA 1OASA 5AI4A 1G9XA 3HU3A 5LQSA 2FUEA 2Z43A 2ANBA 4ZXFA 2NUBA 3UAZA 4N6GA 2PKEA 2QBYA 3DDWA 1W5BA 4O2AA 1ZJZA 5EKSA 2VDOB 3PDWA 3KAPA 1PGOA 4RVSA 3FPCA 1E4YA 4LYYA 5LU8A 3WNBA 1KY2A 3H65A 3I9V6 1Q3TA 3IO3A 1YS4A 3LK7A 4IIXA 1WIWA 2CXSA 3TBFA 4BQSA 3GARA 5JAZA 3F1KA 5FUQA 1H6CA 3I2HA 3HU2A 2VA8A 1BKYA 3OEWA 4KSBA 4D9HA 1ZR2A 4X20A 3SOZA 1M5RA 2OBXA 4JXXA 5IS2A 1ABEA 2AZXA 1FVHA 4WL0A 4CM4B 1ENPA 2FSFA 4YJKA 1N2OA 4OK6A 4TMZA 1U8AA 2ZYUX 3RVNA 5ED4A 1I5EA 4C01A 3OZBA 5JNTA 3DE6X 4GX2A 3TLXA 4C0SA 1IY1A 3TXYA 4BZXA 3LRPA 4F3KA 5IDWA 1KVTA 4RA9A 3EZ2A 2OCGA 3PC8A 2JCYA 1SIOA 4KWEA 4LXIA 5HF5A 1DRWA 2H2AA 4P32A 3DA8A 3HJGA 3IDOA 3F1LA 3QYFA 1VECA 3EF3A 3IURA 3N7AA 1MJHA 4OGWA 3F4BA 1XD2B 5LYYA 2DLDA 4XPIB 2YY5A 3T7IA 1TKCA 1WL8A 3KFVA 1X1DA 1NDUA 2YNMD 3EJ6A 1NVUQ 1TCBA 3O4IA 1U9YA 1A97A 4KGZA 2F7SA 1SRQA 2WSIA 4HZGA 2YY6A 1W2WB 4U3JA 4YY3B 2HIAA 1ZXXA 1U94A 2G9VA 2IYUA 3KSDO 5IKPA 4GF5A 1UFRA 4RZIA 1HLDA 2XSZA 4OAOA 4QJ3A 4EFMA 4L7VA 1QDLB 5K1ZA 1IIRA 1EK6A 3V6MA 2JGDA 2QVZX 4KLRA 3AQ4A 5ALWA 1FL9A 1JVNA 3U62A 4I4TA 4AZTA 4Y6GB 4P0QB 1GZHB 4UMDA 4LYJA 3RSGA 2FWMX 1QIDA 5H16A 4BV9A 4LDRA 4CKCA 5B6JA 1QM5A 1NNI1 5CLJA 1SUAA 1HRDA 3JAKA 3FVTA 5BSRA 1FMLA 1V43A 2OXRA 3P9NA 2WKSA 1OU0A 1E0SA 1JMYA 3Q40A 1H85A 2J0SA 2G0TA 2Q9BA 3K5WA 2ZJ7A 1FP4B 2QZ9A 2JAXA 1AOXA 2VS1A 5LZ7A 3M83A 1SCJA 3GX1A 1AC5A 4BP1A 2GN1A 3NGXA 4MA5A 1FP2A 4K7JA 1XLTA 3D3JA 3V3KA 3P7MA 1JPNA 1YE5A 3S6JA 2A57A 3PWSA 3ITDA 4X1IA 5EIOA 3H1TA 2YBDA 3B1VA 4IEIA 1N25A 1DQNA 1JEQA 2GAIA 1PYOA 2R2GA 3HC7A 4JROA 4OBWA 5AYVA 2VTBB 4LOLA 1YRBA 4A0HA 4IDQA 5LOVA 2D2VA 3IAAA 1RXEA 4CLXA 4GX5A 3TE6A 2MYTA 1YJQA 4NYIR 5DJ5A 4BX2A 4Z3OA 2F3UA 1JWLA 5EMKA 3TZQA 5KOHA 4HX9A 1Z35A 3C3JA 4YMGA 4KRYA 2QTRA 2JLRA 4JJ8A 1R4NB 5IJZA 5FAKA 2OGZA 3NATA 4L72A 2NU9B 3VR2A 1JJFA 5FUWA 2WT4A 4IGIA 2G3YA 2HRQA 3U16A 3N6VA 5TMDA 1JSLA 4OOEA 4J0CA 5L3VA 2WWFA 1B1AA 2HJRA 5JALA 4IZHA 2WP8J 4DBVO 3R7LA 1ZOLA 3D4IA 3OWHA 1E2EA 4BJHB 3VGJA 2AN4A 2Q6IA 1XRPA 3WZMA 2V9ZA 4JJGA 1T5IA 2ASVA 4PSCA 3O5AA 1QH8B 2GPJA 3HR4A 2J7KA 1LWNA 3NBUA 4IZIA 4KGXA 2CXXA 2FW6A 5AI0A 5FI3A 3UHJA 3U3JA 1G20E 4BVAA 2XOKA 3WIDA 3THRA 3G5AA 4ME6A 1KQOA 6PFKA 8OHMA 1TVCA 1L5MA 1YQEA 3IVMA 2MYPA 3O4JA 4HGRA 4M83A 3K9CA 4KUEA 1Y1RA 2WIGA 3QX9A 5AIAA 1UMKA 5B6IA 5L6LB 1G59A 4H7IA 4IIGA 4BLQA 2ISCA 2XBMA 2GPSA 1NG9A 4LMRA 3EWNA 4WW0A 5ADVA 1SOMA 1Q11A 2Y6UA 3CRQA 1FB5A 1ZJ6A 2HIHA 4KE6A 1B74A 2JGIA 1FW6A 2OWDA 3ACDA 3DULA 4E21A 3U19A 3E35A 4UCXA 3S7TA 3W78A 4YV1A 5JQGA 3QLVC 3HKCB 2OESA 3J7AC 3TW0A 3LVRE 2GCPA 3OZIA 5EQFA 1LLCA 3Q9NA 2QD2A 3TE7A 3CLSD 2R6CA 5IP5A 3QBVA 1CJTC 1W9MA 3ZTWA 1N92A 4CIWA 2Q5FA 2YJ6A 4HJXA 4X3CA 2HBQA 4E1VA 2EJUA 3I64A 1WB9A 1Z5OA 5C81A 3T1HB 2J45A 1U0NA 1XFDA 3ZC3A 4UBKA 4EJSC 4S05A 4AJNA 3U3ZA 1V37A 4DJFC 5ALEA 3ZD9A 1YAJA 4JJIA 3SS8A 5JSHA 1YACA 1JPJA 4RYDA 5LP6B 5J5VA 4C2TA 1BWSA 4BNDB 5ITWA 1A50B 3ZE8A 1T2NA 2CL5A 2B1JA 2D6FA 4EM6A 2Z5VA 3EIWA 5ICFA 1RBMA 4J0FA 1A2QA 4ILEA 2M32A 3JR3A 1N2CA 2I66A 3ZGVA 2YOHA 2NM0A 2PMWB 3AV3A 3H84A 5TQ2B 5FWNA 3RUPA 3CZQA 1T5HX 1KK0A 4ZK6A 3KXKA 3COWA 4TSFA 1VMEA 1KMHB 1HI9A 1KY3A 3MT0A 4JKIA 4DCJA 1O77A 2OG2A 1N2CE 4AG6A 4DW8A 4IUDS 4AWAA 4G97A 5KTPA 1ULTA 2XPCA 5HKKD 2GBLA 3BFVA 5A3RA 1SXJB 4EW2A 1JIKA 2B78A 2X76A 3IP8A 3LP8A 4OMFG 1QF6A 2NZWA 1OBCA 4R2HA 3EVGA 1VHJA 1OI2A 3LT0A 4D3XA 1SU6A 4JJEA 1NKTA 1YOBA 3KR1A 3ZNQA 2P6RA 5EJ2A 4YVFA 1M2OA 4KLNA 4LPKA 1R0YA 1MOZA 3DDUA 2Q7DA 2BFWA 3T9EA 4FZRA 5AJTA 3T5DA 1M9NA 1MX3A 2IP4A 5GV7A 2IF2A 1J8VA 2B4YA 3ZK8A 4BMPB 5DNCA 1BCRA 1S1MA 1E96A 1FDTA 2WHXA 3WR5A 4DREA 4RD0A 1YE3A 4E7PA 5HX7A 5KQSA 3U4CA 3KT8A 4I81A 1Y5IA 2DEUA 4IVRA 2P41A 3WL7A 2BI4A 2B1GA 1J5PA 3MWFA 4RVUA 5E2IA 1O87A 3PSHA 3RBVA 2WHYA 3D2CA 1XZFA 3ONVA 1YWGO 2OCAA 2O2SA 2R48A 2REQB 4LJKA 5DYTA 3K4HA 1E9BA 3MTDA 1WAMA 3LX6A 4G4GA 1NXSA 1I6KA 1KWGA 1CETA 1IN4A 3M6LA 1A9ZA 1CP2A 1UAYA 2HRCA 4X1OA 5EMLA 2OK8A 2YUIA 2B36A 5H68A 2CXUA 2PFKA 4ZQBA 3GRYA 3SSAA 1L4YA 2J0UB 3NAZA 5AI8A 3TX2A 5L6MB 3MUEA 1A4UA 1JE0A 1XCOA 3K4QA 1C7QA 2I55A 3L1HA 3T7TA 2UAGA 1PYDA 2WIFA 2GASA 1YB6A 1KY4A 2XMRA 1Q7BA 3E0QA 1YDEA 2GRJA 1GPH1 3HO6A 3NKFA 4G9EA 4GXTA 1JALA 3K71B 4FCTA 5DCUA 3RW9A 1TU3A 3SZLA 3U6KA 4YQEA 3M1IA 3ZI0A 3Q1LA 5DM0A 3QYJA 1ULAA 2VEDA 3FN4A 5K3DA 3DQZA 1C3XA 5BVHA 4GBGA 5IASA 3L4KA 2JG3A 5DHAA 2Q46A 2ZWIA 3MGKA 1ZNWA 3EZ7A 2YDXA 3BRWD 3EMVA 2IXTA 1DMSA 1HLGA 2B6NA 2IYWA 2XDQA 3L6UA 3O26A 1FYDA 1K5DA 4L0QA 4BQRA 3HVIA 1YR7A 4LJ9A 2RK6A 5IKEA 3FZEA 1UCFA 3EMBA 4HGNA 4CLDA 4Z54A 1LBTA 2BH2A 2YJ4A 1DI0A 1KJ8A 2JAUA 2BFMA 3BXHA 3MF4A 3OZCA 4M7WA 4UFOA 2IOQA 1W0JD 3IA7A 1G4HA 2OHOA 2R1TB 2CXPA 3BREA 3B78A 3OJCA 4G24A 4NBUA 2A8YA 4DRYA 2ZCVA 5D5HA 3NORA 3HCFA 1WQ4A 2C5HA 1MQ8B 2O5RA 3TD6A 3E8SA 4QM6A 4KX3A 4MV8A 1Z88A 2W6OA 4KV7A 1IQRA 2YRXA 2SKCA 4M7OA 4Y9SA 4A8JB 1OIVA 3LMKA 3QH4A 4BC0A 5KWIA 1HX7A 4DNPA 3DEFA 3D6TB 4YRTA 2OILA 1MCZA 4NS1A 1G7TA 2GXQA 5HOEA 3F67A 4HNGA 4PXYA 4QPPA 2YRFA 1WZIA 2AEMA 4HBGA 5JADA 1BQ3A 1DBIA 1KC3A 3HR7A 1V1RA 4TUYB 1NBME 3SDBA 3UT5A 1KETA 2ZJ0A 2DF8A 3ICVA 1QFSA 2WJGA 3A4MA 3K0EA 4RQUA 3Q5DA 3GLGA 1JZSA 1C7ZA 1COWA 3I4LA 2YNMC 4P7GA 3WLHA 3WDLA 3WADA 5CDTA 1XVIA 2AN5A 4ZA2A 5EZYB 4D43A 3H1BA 2PXXA 1EX1A 4FOOA 2ZUVA 4Q0MA 2NU6A 1H2EA 1X1RA 3IUMA 4MWTA 1BU5A 1Z5WA 4ZVMA 5KYGA 1C1XA 3HZOA 4KN6A 2D13A 3NC4A 2WTXA 3CGGA 5AJYA 3BSFA 1T35A 5T6MA 3HFRA 1INLA 1NW3A 1J90A 1XVTA 5HTKA 1L8XA 3FI0A 3PC6A 3PE6A 2GPWA 2VHZA 3JRWA 2VUIB 4ROSA 2GKOA 4QHTA 1GAEO 3RK0A 2AK3A 5HBGA 3WRWA 3BFKA 3WLNA 4DBLE 4XSHA 4PICA 1ZIDA 4IIBA 2G1PA 3NTOA 4PLVA 1RFGE 3A6ZA 4A0GA 4CMJA 4NJEB 5C5CA 5JEEA 2A1TS 1OLXA 3VHQA 1FFHA 5IUKC 1NXWA 5EY5B 3CIFA 1P2DA 6REQA 2VEOA 3EH2A 3JASA 2WPDD 4K8RB 3IMFA 1GGEA 3LHIA 1ZHOA 2OEPA 3KEMA 1SQ5A 2W6NA 1QRRA 2YV1A 2ISSD 1OI7A 2QSZA 1J2YA 2GGSA 3O2JA 5JECA 5LQUA 4JV5B 4WZBA 2V96A 1YZVA 2RFLA 3UGQA 3BSYA 1MNAA 5HUQA 1K5HA 1Z22A 1Z2NX 2NPOA 2V54A 5M7EA 4XEHA 4A5OA 4AXBA 4XGQA 1X7ZB 3H2GA 3L18A 3AF2A 2P3SA 4HDKB 1E18A 2WE7A 3EVTA 3LTEA 4N7MA 5H9WA 4LCBA 3DEHA 3RVJA 5JC1A 2PSDA 1FP1D 3UFBA 2WUDA 4GE3A 4I1PA 2BFFA 3ZHXA 2F4NA 3IHTA 2FZ4A 3HY3A 3PF8A 4BV2A 1SKQA 2WQ7A 3B13B 1EQUA 3QF4A 2CL0X 4MVJP 1CCWA 1XLVA 2GEKA 2ZUCA 1C8VB 5DTRA 1QE5A 2PX6A 1E32A 3OZ7A 4YP9A 2AG6A 2WJIA 3DQPA 3STXA 4HS9A 3I6QA 3T9CA 3ZW7A 2I76A 4I19A 2H63A 5GGYA 3LO5A 3H1EA 2Q3DA 1EESA 1CY2A 2G6TA 3GJ6A 3IB6A 8ADHA 4C78A 3CUEF 3FE2A 4IKPA 4MRVA 4BUZA 4KPYA 4D2IA 1QGZA 2ZYTX 1F17A 3AL0C 4JIGA 2Y66A 1LSUA 1LI5A 1XUOA 4LE2A 2RGRA 3Q88A 5B1SA 4U4AA 2WDPA 4EG5A 1UM9A 3VNAA 1L3IA 6ADHA 3CRRA 3I9NA 4F1KA 1Q95A 3HYSA 1IOLA 4WN9A 2Q9UA 3ELBA 1KIAA 4PX5A 1HFJA 5AWFC 3TTXA 3CVUA 2RB4A 3NVKI 1PR1A 1FFXA 1U2SA 3JPWA 4NV3A 5FUVA 4EG0A 2A9RA 4RGVA 1Z6QA 3R0VA 2DQ4A 3CZ5A 1EFRD 5JANA 2PZMA 3GEEA 1Q0UA 2ZUBA 3QLVA 4G0PA 2G09A 3E70C 4OJNA 3VMMA 4A1FA 4KX5A 4N3BA 4ZI2A 3T5AA 1NN5A 4LHEA 5K9ZA 1ISFA 1P7VA 1PRYA 3NOQA 2C4TA 3PHGA 4PCVA 4UZFA 3I9KA 3CLHA 2J07A 4X84A 4WZAB 4UNIA 3VJRA 4G1EB 2BFEB 2FR8C 4KKXB 5KQPA 1PFUA 3GNTA 5A9RA 4DUYB 3AYXB 4BXOA 1AUPA 2E85A 3CLSC 4LHZA 2XYRA 4EJSA 5IJ9A 3Q85A 4ZVLA 5IF3A 2XMQA 4JBIA 3U17A 2VATA 1XEFA 3UTDA 1OVGA 1ZWLA 2P68A 1R5OA 3M89A 5IZCC 2WKQA 3HB1A 4BN5A 4KODA 4EF4A 3MJEA 4GMDA 2H9YA 4B79A 4K05A 4DY6A 2FR0A 4PX3A 5C7LO 4N41A 4KQ6A 4GECA 4CF4A 4C4SA 4HX5A 4AROA 4Q4JB 4WXEA 1GNVA 3CKKA 4F5DA 2EIXA 4MUHA 4OIMA 2BHRA 3ONFA 1EX9A 1VIDA 2E5LB 2B1IA 4LTMA 2PCLA 2GERA 4CR6A 1TQ6A 1U6KA 5JJKA 4EAQA 2ZCUA 1T6ZA 1U6JA 3AJ8A 2GCEA 3H9QA 2EP8A 2FEKA 3LVFO 3X1ZA 4E5DA 2JJ1A 4ZGGA 1OPRA 4I08A 1KDRA 4EECA 4PYQA 3AR5A 2PKQP 4L6CA 4B4UA 1A9YA 3SEAA 2H51A 4Z4GA 4UTNA 4ZAZA 1JP7A 2EL7A 4ZYVA 3JQFC 4NCBA 3IMGA 1JBEA 3NPAA 2IPNA 1XL1A 1F5NA 2OAQ1 3LCUA 3PKJA 1MJGM 3FYHA 3R3SA 1KOGA 2F8TA 1VE3A 2C5AA 3GIDA 2NQ8A 3L82B 5L95A 4A0RA 2RGUA 4S1WA 2YICA 3NDBB 1WQ3A 3RARA 3T5GA 3U44B 2HADA 2OYRA 1SUEA 2ZJFA 4TYWA 2WSSD 2PLNA 4DLWA 1LTKA 4NE2A 5TQ0A 3ROKA 2I4OA 3RYTC 4YJ2B 4EJ2A 4M8SA 1E2JA 1KRHA 3IT3A 5LDGA 5KJFA 2I91A 1NF8A 4B6JA 1V45E 2G25A 1NBHA 2BHNA 2PH1A 3AHHA 1NUTA 4KXUA 4LRSB 5G02A 3SIWA 3UMSA 4AXXA 5KOJB 2ZP1A 2I4IA 1CIVA 6GPBA 3ZS9A 1EFHA 5JFGA 2VN8A 3MBKA 1GAQA 3TOVA 1LNQA 1S9DA 4D3DA 4HDRB 1VE5A 3HA3A 1XNRB 3AIOA 1QLHA 1DJNA 3N8DA 3PG5A 2Q1UA 1ZM9A 1YKGA 1U65A 4IRMA 1YO6A 4L73A 2JIRA 1U7OA 1XTKA 1T9AA 1XP5A 3IPAA 4ND2A 4ZICA 3S81A 1G98A 2DJIA 3BIFA 3IVGA 2F67A 4KAAA 4Q9DA 4BX0A 4CMAA 1HE8B 1T8UA 1YNSA 1R4ZA 1H8ED 1MAUA 3EOAI 2AG1A 3EC7A 4IDGA 3T3MB 3COJA 5K0CA 2B1QA 3EDYA 2XCOA 1MIOB 2BV3A 1D2NA 2AUMA 2M2IA 2UYQA 2YXLA 3ABSB 4MQ5A 4XQ9A 1GUYA 4YMWA 1KP9A 1XQ6A 2QTLA 1P5HA 4JI7B 3D0QA 2Y71A 4D57A 5JFOA 4O4LA 4XUCA 3FFWA 1E1CB 3PLNA 3P45A 5ITZB 5ICGA 2PVSA 2Q28A 2WSMA 1PZGA 2ID4A 3A9SA 3BM5A 3E9YA 4H4CA 3SQDA 3WDSA 4JUDX 3F5FA 5ALTA 3ZD8A 2B8EA 1OXUA 1NATA 3RYHB 3ADBA 1T4CB 3QQPA 5JZMA 2C2OA 5BRJA 4RTLA 4YT4A 1N2SA 2E87A 3SM3A 4HWOA 1NWHA 1JVSA 4LYAA 2XNSA 5EE1A 2WA2A 3TSYA 4DMGA 4CM1A 9LDTA 4WFQA 4V03A 3E3MA 4FQ7A 4LOIA 3ZKWB 3UH1A 3RTBA 4X97A 4RFSA 1Z39A 4TLAA 5ALPA 1JI0A 5KTTA 1YQUA 4UU8A 3RBZA 1IM5A 5A4AA 1E9RA 2KSQA 5F33A 1CLUA 5CPFA 5I7AA 4KIUA 3V8PA 2G9RA 3STWA 1UMBB 3TX6A 2MSKA 1X1TA 4H3KB 1KY5A 3KUUA 1LBSA 4IMIB 3CNLA 3PD1A 2MINB 2QRNA 3NIWA 2HLPA 3D2LA 3TFOA 2Y1XA 5GIPE 4JELA 4ZAWA 3JZIA 4YWHA 1VG1A 3T0GA 2PN1A 4MEBA 4FYJA 2V6GA 3M8KA 1ESZA 3QG1A 3WICA 4YUYA 3RVQA 1RYYA 2FJUA 3AZPA 4UHCA 5D7BA 1JG1A 4TX1A 3GUYA 4YLGA 1ZA1A 2YNMA 3KPJA 4KRFA 2EWVA 3L1KA 4YGYA 3IALA 3QPUA 3ZU3A 1JG6A 2GCOB 4PHGA 4BLWA 2JLUA 4GPEA 3ZCXA 2R6HA 3A26A 3Q0TA 4NY1A 3TBKA 1L5HA 3VOAA 1EP1B 3STUA 5DM70 3KC2A 1NYTA 2FDXA 3EGDB 3TQHA 1DRJA 3EUFA 4MJ7A 3N07A 1SUSA 3OD5A 3TTTA 5AFSA 2XYQA 1XYYA 3A11A 3IOBA 3F9IA 1FDIA 1T43A 1F8GA 4PC2A 5CH8A 3RJMA 4JUCA 3R0JA 4IV5A 4DR6B 1SCBA 3E03A 4IJUA 3T7EA 5BY2A 2HR1A 1HA3A 4Q19A 3NZEA 3TTUA 5B12A 3IOYA 3MCTA 2GUWA 5JMWA 7ABPA 2QRKA 1OGIA 4BOYA 5KVCA 4AX8A 4MKXA 5B4UA 2HNKA 1VL5A 3O3CA 1U3CA 4FB4A 3X1MA 3PNVA 2VDLB 2HD4A 2EFJA 3UPTA 5NLLA 4RFLA 4G8CA 1RQXA 4AU1A 1GPKA 2BGTA 3TW6A 5IH7A 4YN3A 3UT0A 3BWCA 2OYCA 4B34A 2GPTA 3WHKA 3A2KA 1PV4A 2E48A 1J9GA 4EG8A 4TXHA 2QL7A 3FOBA 1ODTC 3N5KA 4J7AA 4U7JA 2CK3D 3P0EA 4JUIA 4KIWA 5DP2A 3SC4A 4OB8A 1YQXA 3E7FA 2Z8ZA 3DHEA 5HA5A 5GOTA 3KSAC 1M7GA 4IDOA 4F6CA 4D25A 4AQ7A 1SUBA 5G0WA 2FN4A 3RD5A 2W5UA 3VH4A 1ZGAA 3PQ8A 3EZLA 1U1GA 4B81A 2AGVA 1Y80A 3GJ3A 2GS9A 3SHQA 1OU4A 3TL3A 1IVNA 3BX1A 3O8CA 1Y6QA 3U3DA 3LOUA 3HJUA 4JOBA 4EPVA 2VJPA 2GLTA 4Z1OA 3D4PA 4CLHA 4RVFA 4QTTB 2BWJA 1WCIA 3UWDA 1R7RA 3LZ6A 3TLMA 3AHFA 1VKNA 5A03A 1QYDA 2G07A 4YONB 3OE7D 2YS6A 4J49A 1WMFA 3JSXA 4TLCA 3OT5A 5LFAA 1V7CA 2ADMA 1N9KA 4EEZA 2GNOA 3RWBA 3QE0A 1OWMA 5CB4F 2Z4TA 1JHOA 3HWRA 4KBFA 3WS7A 3C7AA 3VI3B 2YXEA 3SYLA 3B20A 3DOHA 1QHHB 4PW0A 1LK5A 3OEED 1E5QA 1F8XA 3O1LA 2KS6A 1FTYA 1KO5A 1UDBA 4RQAA 3AR6A 1IOVA 4WWHA 2IL1A 2I7XA 1G8FA 3DS8A 2AFRA 4M7PA 4U8GA 5JAPA 2QVBA 1GPAA 1MKYA 1YSCA 4ZZIA 4A6EA 2V4ZA 2UYYA 3IRUA 2BBTA 4EKNB 4BFTA 2FZVA 1ODLA 4L0DA 3U5TA 5FPHA 4UDOA 4CG1A 3QK7A 1W25A 1ITZA 1FX1A 2FR8A 3ABQB 2GO1A 3U7QA 1QMGA 2CE2X 2G9NA 4ZHQA 1XMVA 4YMSA 1VKRA 4LBWA 4H27A 3UO8B 5I7FA 5L45A 1SBIA 2CUKA 4FGZA 4PZ0A 3C3XA 3HJAA 4DFDA 2JF0A 3WXBA 1DX9A 4KXVA 1KJWA 1EK1A 2B4QA 4G9GA 4IR7A 2ZRIA 3DV2A 4NYIQ 1ZM7A 1ZK1A 4N3CA 3ZJ5A 1NBOA 5IZCA 1FPQA 1NJ2A 1SQGA 3L0IB 1TTHA 1Z7WA 4TQGA 4CCYA 3P0JA 2H52A 5FLKA 4UZEA 4QUEA 3UTCA 1BHSA 1G41A 1OYVA 3T0FA 4KE9A 3AY7A 4PG6A 2XI4A 5AVJA 3A04A 1VKOA 3C70A 3HCPA 2C9BA 3ZU6A 4MEAA 3ZVNA 1T25A 2O6HA 3KHKA 3FGOA 2BL4A 1EMDA 3OFJA 2QRUA 4QBFA 4MP3A 5CLIA 1NN3A 4M0KA 1VIYA 1BW9A 3WB2A 4KZKA 4ARBA 2QX9A 7YASA 3GDWA 1AKYA 2GX6A 2PKYX 3OBBA 3ISVA 2JHPA 4NI5A 4KLCA 2O7QA 4MUFA 3ER6A 4WY5A 1JMKC 5BR7A 4UBNA 4M21A 2G28A 3HPRA 1XTVA 1Z4PX 1BNCA 3NBKA 1KZ6A 4MIEA 5EOVA 1D2EA 2HRZA 1UWLA 2J5BA 1H2FA 2HA3A 2HLDD 2K5UA 2VF7A 1BKSB 1W52X 3DLTA 1WPXA 3JQFA 2YN2A 3PNLA 2N42A 3KB8A 3WX0A 4DCVA 5C8DA 2NP6A 1IN7A 3G5MA 1STOA 1HM5A 3QP9A 5D6NA 1AM4D 5HKKA 1WEHA 1TYAE 1Y7PA 2QZJA 2YMQA 2NMVA 2WVJA 5LD2C 4XJTA 2WPNA 1YASA 1DP4A 2X9LA 1HGXA 4ZK2A 4CMEC 5A06A 3RS7A 1Y3HA 2F8SA 4EG7A 2X1HA 1UQUA 1SURA 5LB2A 4E03A 4ENUA 1A8PA 1JHUA 1QH1B 3FFBA 3GT4A 3QELA 2QMUA 1ZICA 5HP4A 5MGNA 1XP8A 4Y3UA 5F7ZA 2D5LA 2GBFA 2WHRA 1E0KA 1RWXA 2FPRA 2WLTA 3FWNA 1IOWA 3I2GA 3L8CA 3QBTA 1IG0A 2BMAA 1ZGHA 2ZLBA 3GXOA 3P9ZA 5FR2A 2ZBEA 3T1OA 1TT5A 3WGOA 1S8AA 1XFAA 1KU0A 2IJGX 3BZUA 1ZRHA 2RBEA 3HBNA 5EEGA 5EINA 3NIDB 4KPUA 5AKEA 3VZCA 5E3HA 5J2UA 5IT9A 1OE0A 1TEXA 1VKZA 4OHFA 4DV0B 1E0DA 3IJ5A 5FULA 2GPNA 1CK4A 1M2KA 3K09C 5CT5A 1J39A 5EIHA 3RYCB 1U1FA 2I6UA 2WT8A 1CXZA 2NUPB 4EX7A 1BHQ1 4XWOA 4R1MA 4YREA 4URVR 1VGRA 1XRLA 1THZA 1UKCA 3GUVA 3O7WA 5AJXA 4MEJA 1YR1A 2TYSB 4I4NA 2YC4C 4BTVA 3DC7A 4PX2A 2L82A 2R6JA 1ZUHA 1VE9A 2B5OA 4H1VA 4MAFA 2QD5A 1U99A 3C3WA 3WGLA 1CZKA 4CKXA 1MUUA 1GKLA 2X3FA 3QFFA 2NSLA 4YROA 5ALVA 2QY9A 3IXMA 5ITVA 2ZANA 5DBIA 3IILA 4BQEA 4MV7A 4WT7A 3A9VA 4Q9KA 1HSZA 1BEZA 2C8LA 1W6UA 2RHHA 2ECFA 3G89A 5DCLA 1F6WA 1U6IA 4WUTA 2XMDA 1KYYA 3LL7A 1KMMA 5IFKA 3C1UA 2W83A 3BRWA 2J33A 3ZWXA 2ODEA 4IRUB 2ZWAA 1GO2A 2IFTA 2P2YA 2VHTA 2OWEA 2ONCA 3DP7A 4ZVRA 3L6CA 4YI5A 2ZTUA 5AP9A 2A14A 4P1ZA 4RX1A 3P97A 4KH0A 3V1LA 4A2QA 1RJWA 1RJ9B 1KOFA 3PE3A 4TV9B 2IV2X 1AX9A 1WCV1 1Q83A 3KU1A 2G0AA 1RIIA 1W0JA 2EBUA 4Y7DA 5KJEA 3X2SA 4ZI7F 3L7DA 4YAEA 3HUFA 4MS4B 4AS1A 1UOQA 4YPFA 3S70A 1JR3E 1N7IA 3B1WA 4FT2A 1JHPA 3JX9A 2IY9A 2CGEA 4LDQA 4IHKA 4YRDA 5JYBA 3NV7A 1CJMA 4XGIA 1N6HA 1QKKA 1DZ3A 2VJDA 4W6QA 3ZE1B 5HKAA 1D6MA 1GEEA 2X3UA 1DELA 2PGIA 1XZAA 3B5EA 5BNFA 4UQLA 5LM3A 2JAQA 4P3YA 1J07A 3RUIA 5G53C 4YDRA 5K8TA 5FPTA 3JTMA 5DLQC 1IHPA 4UUAA 1SVWA 3B12A 4LSWA 4NZZA 4OHVA 1QS0A 3E3AA 5LQJA 1GPDG 1PG2A 3JAWA 3EPPA 4NE9A 2FVXA 1XBTA 3KVYA 3V2GA 1Q15A 4PZZA 2C5GA 1I30A 1XRSB 2WM2A 1CQXA 3F47A 3JVEA 3KJFA 4G0YA 5AOCA 1VJ1A 1WABA 3HRHA 5B2EA 3KSBC 4O29A 4ND3A 5C1DA 1H1DA 3OLXA 4MRMA 3ZI7A 1M6VB 1FTWA 3OUUA 3PQFA 1WO8A 2ATVA 2B2XA 2XEDA 2HJGA 3GJTA 3WLPA 4EFNA 4RVDA 1RYMA 3H2ZA 5JY1A 3ENZA 4YHBA 3O82A 2X5OA 3FH0A 2V6BA 4P86A 5EZ6B 5BP7A 1TUBA 4GM1A 3HUTA 3CT4A 2OCIA 2ODWA 4RZSA 3E5HA 4RTOA 1H2HA 5HFNA 2I3BA 4RY8A 2VF4X 1F4VA 3B38A 3AVVA 4Z7OB 2X6RA 4G07A 2IX3A 3RASA 1NYRA 2R1VA 1R0WA 2Z1NA 1CR6A 4ZAYA 1YBFA 3ZIDA 3WGHA 4F1WA 5C1OA 1OWOA 2DH6A 4EVQA 5F7XA 1SVMA 1SULA 2QE6A 4QPCA 2OORC 5LVAA 3BH6A 2WPDA 3GDGA 3O03A 4EDHA 3GQBB 1VJDA 4WXYB 3VKWA 1VI2A 4KFUA 3EW7A 2O2JA 5JTUA 1RTKA 1AZLA 2B4RO 2Q41A 4P4GA 1JTEA 3UUGA 1E8MA 4G5GA 1L7AA 1PF7E 3O90A 2V6MA 4AKTA 1AQUA 1R9MA 1EVZA 1HFWA 3HM2A 4TQ9A 2OBFA 2VPPA 4HB2A 1K88A 1L5FA 1MXFA 3V8VA 1TTQB 1RIFA 1XDUA 1XF9A 2ZREA 5EESA 2JLWA 1NPDA 2CBXA 3LBFA 4HEJA 2D0PB 1RQGA 4FGUA 4OAPA 3IPYA 1XMSA 2WUFA 5I4BA 2RGNC 4LGVA 2FP4B 3DYBA