3DT9A

Crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by soman
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQSEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Brain Platelet-activating factor acetylhydrolase IB subunit
publication title Crystal structures of brain group-VIII phospholipase A2 in nonaged complexes with the organophosphorus nerve agents soman and sarin.
pubmed doi rcsb
source organism Bos taurus
total genus 73
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 3dt9A00
1K7CA 1WABA 5HOEA 3U37A 1ESEA 2O14A 4XVHA 1U8UA 4Q7QA 3KVNA 4K7JA 4I8IA 4JKOA 1FXWA 4OAOA 1FXWF 4K3UA 1IVNA 1DEOA 4PPYA 4RW0A 2Q0SA 3RJTA 4JGGA 3P94A 3PT5A 5JD3A 4IYJA 1ZMBA 4NRDA 4JJ4A 1BWRA 2VPTA 4JHLA 3MILA 1PP4A 3DC7A 4TX1A 4M8KA 1VYHA 3DCIA 4S1PA 4HF7A 3BZWA 4LHSA 3SLRA 1ES9A 5BN1A 3DT6A 1V2GA 2APJA 4K9SA 1ESDA 2Q0QA 1BWQA 3SKVA 4Q9AA 2HSJA 5A4AA 2WABA 1J00A 1Z8HA 2WAOA 1BWPA 3HP4A 1DEXA 4HYQA 5B5SA 2W9XA 4DEVA 4OAPA 1JRLA 3C1UA 4RSHA 4JJ6A 3DT9A 4K40A 2WAAA 1VJGA 3DT8A 3W7VA 4H08A 1YZFA 5CD9A 1ESCA
chains in the Genus database with same CATH superfamily
1FFAA 1I9CA 1RWMA 2XUZA 1MUUA 1PSZA 2CK3A 3MVEA 2ZU0C 1BGWA 1JJAA 4FINA 1X38A 2J3KA 3I5YA 3ST7A 2ZTVA 3GUZA 4IBOA 3BFJA 1OX4A 1X80A 2Q4OA 2WIAA 3CNLA 1IN4A 3MTBA 5CURA 1U28A 2PUAA 4MQEB 3KOMA 3Q8WA 2QRVB 3QWHA 4LRYA 5BVGB 4OX9B 5LA6F 5BR8B 2W2XA 1X1SA 2M98A 4AO7A 4IRXA 2R85A 4FR0A 4C5BA 2DE0X 1ZOIA 5FR1A 2XBUA 5GJCA 3IPXA 3OPYI 1SHLA 4NR0A 3W5IA 1Z3IX 2ZPTX 4OQXA 2C7PA 2PX4A 5DEOA 3ESYA 3RG8A 3LQFA 4I2VA 2RJOA 5EQFA 1S1MA 3CSSA 3R0XA 4KRGA 5IHXA 1NE2A 2WYIA 3CPSA 5F9FA 3T7DA 1F20A 1MJGM 1N2ZA 3ZK9A 3HTXA 2I2BA 2VO1A 3BBPA 1XPJA 4MR7B 5BSGA 5HKBA 5IJ9B 2ZYTX 4ZCLA 1JQ5A 1FL9A 3E8XA 1Z28A 1O94A 3HVJA 1KH2A 1JIQA 5EQJB 1I80A 2A57A 2OCKA 1EVYA 4QIHA 2OM6A 1YIAA 3EXHB 3TGWA 1EK0A 2XUIA 3WADA 4GKJB 2V74B 4LVUA 3DKPA 3HYCA 5AJVB 1UBKS 1YU9A 3E9RA 2JVKA 3KPYA 2IE0A 3HS3A 4FSXA 4NOJA 4TMZA 3ZHVA 1IY9A 1JDTA 4P7KA 2YZNA 2HWUA 1SK9A 4QTUB 4LC0A 4RXUA 1YBAA 4QDZA 3BWDD 5ALMA 5DX0A 1UDXA 3FDZB 3INTA 1KQPA 2RAPA 5B1IA 1OZ0A 1WXXA 2Y6VA 2FPXA 1UMDB 1FYWA 5CLIA 3DP9A 2G8LA 1JDVA 1X70A 5KYWB 1P61B 1C80A 1R3DA 421PA 3SX2A 1A9RA 1E8DA 5EHQA 3IAAA 3VZSA 3IEVA 1ZOOA 3Q72A 2OT3B 3KYDA 3HXPA 5AVWA 5D7BA 1EG7A 2J09A 3W2TA 3PNOA 4OB6A 3EIQA 3FF1A 1PKEA 1TMKA 2Z1NA 3R3HA 2DVMA 4MX8A 3ZCSA 1TQDA 4XCXA 2AE1A 4W63A 1NJ2A 1T8YA 4LMRA 5CRIA 1N5IA 2YZGA 1BH6A 1NW8A 2WLSA 4WV3A 4C3ZA 1C50A 2P6PA 2V4ZA 3UPDA 2Q49A 1XMVA 2MDTA 1PD0A 2X22A 2YVUA 5A9RA 1LS6A 3FTDA 3NTQA 3VO9A 3FNQA 4KPGA 4R7GA 5C7LO 3W05A 4FX2A 1ZD8A 4YRIA 3SYKA 1NI4A 4OBWA 1P80A 1IJBA 3E1KA 4DSZA 4A4DA 4DLYA 2X13A 1R88A 3S1SA 1P5FA 3NBXX 4K26A 1RHKA 3EFOA 4HV4A 1OJ7A 2WSSA 2ZYIA 4UDXX 1K7SN 1V8BA 2AG6A 1FRFS 1A2OA 1SQSA 1TF2A 1F8XA 2V7EA 2WWRA 2ZYRA 3KWFA 4HLCA 1SUWA 2RMKA 4MCHA 3UG6A 5JV5A 4MUGA 1KYVA 1JI3A 1SUFA 3NAQA 2OWDA 4Z0TA 1B26A 4G23A 4M7WA 4CDNA 1M0EA 3NKLA 5ENZA 5LXTF 1SG6A 1U1EA 3EA0A 3GROA 3AVUA 2P2NA 4UZFA 4MPRA 4OQPA 1NI5A 2P30A 1OKKD 1Q44A 3VKWA 1TLTA 2O14A 3U6BA 2RGGA 3V8NA 2FV8A 2XE8A 1PK8A 3CT4A 3ESBA 4JBYA 4UNSA 1OZAA 1YZUA 2AQHA 3FNBA 3HO1A 4HWSA 3H5RA 3IO3A 3BMOB 5FWAA 5HZGA 1R8YA 4W1QA 5H82A 5DK6A 4ETIA 2MR5A 4LYJA 4XLLA 1J1UA 1IZZA 4ZJZA 1K4MA 2CDAA 5C51B 4GBED 4WESB 1DFHA 5DN6D 3KQYA 4G0XA 2QZ4A 3AF6A 1C81A 4URUR 1YFZA 5FF9A 2ZTUA 3VXKA 3NKVA 4XPZA 3K9GA 2ZI7A 3RC2A 1DIRA 4GGMX 4LHWA 2G6BA 4WK0B 3U1TA 3TBKA 1XK6A 2XLCA 1S3FA 1TMGE 2VF2A 3H17A 4MP8A 3CE6A 2DR2A 1N5RA 3AFNA 3EZ6A 2AN4A 3PT5A 4RXMA 5CYPA 4RE6A 3RE1A 1WZ2A 3E6AA 1JJ7A 3ZIDA 2ZU6A 1DQSA 3G0HA 2Q5OA 1M1NA 4IKPA 4RGVA 1FRVA 2NSHA 1MX5A 3JVDA 1SIUA 1V43A 3F0TA 3FCYA 2P3QA 3GFGA 3OY2A 5DLPA 5C8DA 2VQFB 2VTKA 3L4KA 2PUVA 4LJSA 3R7WB 1NFRA 2F1OA 3AHCA 1QQBA 3K96A 4HQLA 4PW0A 3VSCA 4KNWA 1ZI9A 3E8MA 1F0NA 3ELDA 2VPYA 3SE0A 3GRPA 3OIDA 4EO7A 2NU7B 3ZK8A 1P0MA 1PT9A 1QIGA 3I9MA 4GQIA 4BFWA 5I7SA 1EE1A 3OG9A 4CM6A 2YS6A 4EMBA 4HZIA 3MERA 4TLBA 3TTSA 2Y1OA 3WKAA 4D57A 1ECPA 4BS9A 1BKYA 1MN6A 4HGZA 3B3QA 3P52A 3ZWMA 3TUIC 2ACEA 1CY2A 5I9SA 3TQRA 1XQVA 1C9EA 4RZIA 4E0BA 3PXGA 1W36C 5CDHA 3WNQA 1ADGA 2QSZA 1X0VA 2Z4RA 2BFBB 3Q7QA 2PR2A 3SEZA 3E4CA 3WG9A 5A1JA 4H0CA 2YINC 1VJ5A 3EBPA 4PX2A 1OVMA 5CCEA 1V0JA 3N2EA 1OI2A 1XXHA 4PYIA 3AVOA 4C07A 3PEWA 2M9MA 3GEDA 3PR1A 4PC3A 1E0JA 4BKOA 4TLEA 4BFUA 4D99A 1THZA 5H4HA 1CYEA 1ZD1A 6NULA 2EFHB 1LPOA 1A9OA 1TZCA 1L8XA 1P72A 4NVRA 2LKCA 4M0EA 5IBQA 3QVTA 1OROA 1I1NA 1KEVA 4HS9A 4KN6A 4GYJA 3CVYA 2DCUA 1UJCA 4IDQA 3V2HA 1JIXA 2MSDB 2NG1A 3GNSA 4LWQA 1YRBA 4OHXA 3Q10A 4KN5A 1JG2A 2O6HA 1DKNA 2YX1A 3D8SA 4RF4A 3EVCA 3W1WA 2JLZA 3LUCA 2QPLA 2GTHA 4TV8B 1ZEJA 3U1BA 2C2ZA 1GSAA 2ERXA 2RSLA 2XUAA 4YGXB 3GLFE 1XZEA 2PUTA 4ZKEA 4MWTA 4A8TA 1QGUB 2GILA 1SA0B 1ZHFA 3K3PA 3NZEA 3DDCA 4NKRA 4TS1A 4DMLA 2R4UA 2WHPA 3T7SA 1ZKDA 2CKMA 1N8NA 4NS4A 2P68A 3L0IB 4XKJA 4H16A 1AKVA 1UFKA 3H6KA 4R9VA 2WF8A 1I10A 3ZXYA 1FVXA 1R6UA 4LC1A 3ZW9A 4CODB 4P80A 4XFKA 1FRQA 3MWDA 5K0CA 2GEBA 4EYKA 1DO0A 1MC1A 3WV4A 4KGXA 2YJ5A 3DDZX 3KVRA 3L0CA 3QWFA 2P5YA 4BP8A 5B55A 2QK4A 2PJDA 2QV0A 3RF6A 5JXGA 2X1VA 3TLKA 2ZSKA 3BMNB 4JEIA 4BDTA 4JZYA 2AJ8A 1MF7A 3LV8A 4G1FA 2VHWA 2C3MA 3AVPA 3HU5A 4K81B 4L6AA 4ZODA 3JZFA 4CKXA 3EEYA 3TMYA 3DV9A 4LBYA 2R6DA 1PK7A 5BSHA 5JYCA 1K8XB 1ODCA 2TMKA 1SVIA 1G7SA 1SOMA 1Y1PA 1TRHA 4KVAA 3J7TA 2R65A 3WIDA 4MWBA 4DMRA 5LQRA 2D5LA 2Q0SA 4NJEA 5L95A 1K8ZB 3D1VA 3SFVA 3S81A 2ZXUA 3EODA 3FGNA 3N3AC 2HF9A 1SFRA 3BDAA 4BV2A 1ZGCA 2WPNA 2DLNA 5EAIA 3ZQUA 1E5VA 4B0OA 2YWFA 1EFDN 1Q3KA 2CNNA 2WWFA 3WRVA 3P2MA 4KFCA 2BELA 4KB5A 4RNDB 3O31A 4YMUA 2B21A 1UJ4A 2XMGA 3KKZA 2B8WA 2WSLA 4B5KA 3HJGA 2GJ9A 3PZRA 4YMHA 2NYRA 4WI1A 3JQCA 4HDNB 6REQB 2C7RA 5EIFA 4KQ9A 1SUBA 5FBKA 5JAHA 4MVJA 3HRKA 3PTAA 3OD1A 4YJ2A 5ER6A 2F64A 1U5CA 3QX7A 1NHWA 1Z35A 1YFKA 1LNZA 1O5IA 3B7WA 4I3GA 5L53A 2J67A 1II8A 3AM5A 1F17A 3GFFA 3AKDA 4B85A 5LQDA 4KR3A 5M34A 4Y2RA 5KNCA 1KWKA 5K8VA 3E70C 4BBZA 3THXA 1CUYA 3VNBA 4GMGA 2NZ2A 5JDCC 2AOWA 4RTSA 4QGGA 3R5FA 3R75A 4I9FA 3CF6R 3AINA 3FA2A 2ZR9A 4RHFA 1DS6A 4U4AA 4JCOA 1T5TA 4WLEA 1V95A 2XDYA 1OI3A 4DC0A 3RUFA 4D46A 4OI0A 1D6NA 2BM1A 2BM0A 3LGAA 1XMSA 4YMWA 2D5IA 2PG3A 5AW2A 4AY6A 2OSVA 1X80B 4B7ZA 3QY9A 4FKZA 4DPLA 4N8DA 3QVJA 3N0RA 4OOEA 4RQTA 3NHYA 3OQOA 2IHJA 5AI8A 1LW7A 1QYRA 2XTNA 2QD2A 3D6HA 4PTZA 3QYFA 4ZKDA 4JSTA 1E8NA 2MWMA 3ROZA 4WXRA 1S9HA 2ODPA 1OLXA 4HZUA 4MRMB 3IT1A 1Y37A 3LCJA 1XZIA 1JEJA 1QKJA 1V16B 3C39A 4V0NA 4EPWA 1Q74A 1Z2PX 2PWYA 2GRJA 3RJ9A 5F7JA 2H1CA 1IEXA 1XZ8A 3DYIA 1NAHA 4B1FA 2VXCA 3PFIA 2FQQA 1GG9A 1PL0A 2IQ5A 2XB4A 4ZDWA 5IC4A 1PR4A 3QU2A 5F4ZA 1AGPA 2QVYX 3B5IA 4ASUA 2RHBA 1X87A 4U39A 4D4GA 2HXYA 4R8KA 2JVIA 2VHVA 1FIUA 4HAYA 4PFJA 3UMBA 4MVXA 3PNSA 3EVAA 1RJEA 3Q87B 5TY0A 4DRXB 4MIYA 1LQUA 1P19A 5KMGA 2BHLA 2IEGA 5FI1B 2KYRA 1TEZA 3C97A 2PUHA 2LW7A 1R0RE 4DCMA 4WY5A 5KEIA 2IBTA 4GM0A 2IBSA 2HCTA 4BVBA 3L0SA 3ZV7A 2XCIA 2LGJA 2ZT6A 3GPCA 5A9TA 2XVAA 3TKYA 4DHEA 2NM0A 4P34A 3CLVA 1J8VA 4IIHA 4XEHA 5J9FA 1CPYA 2LKDA 2WF7A 2WY2D 3ROEA 4V3BA 3SXJA 4UREA 3QTBA 4GD3Q 3JQ9C 4L7QA 3LC7O 4RCZA 1PZMA 4L22A 1DEOA 1DTSA 4G89A 1QE5A 5CTJA 2DEUA 3WJ1A 1S3GA 3QLJA 4DA8A 3NHLA 4JY7A 4FR2A 5DASA 3MXOA 2O3UA 5LYJF 3NB0A 4ZQGA 1JG7A 3KYDB 1RHMA 1NUQA 3V4VB 5KVAA 1IG3A 3IQXA 1JHYA 1QZZA 2DQKA 3C7KA 4G01B 1NSFA 3UV7A 3A1DA 3GRYA 5FWXB 2ZREA 3BWBA 3C5VA 2OBBA 1Y5LA 1GZUA 1L5HB 1QP8A 5D6OA 1SN7A 1WZCA 2QY6A 2WZCA 3P5SA 4F72A 4LHYA 3GGGA 2ZCJA 1ZXBA 2OFPA 3BGIA 1SVOA 2QAJA 3U7IA 4IXWA 3NHFA 1VHTA 5JQGA 4R1TA 4E7PA 1TZJA 2ZWAA 3TQOA 2FN4A 4LJ5A 1E7WA 3TDMA 3E2PA 4HQKA 1NI4B 3WFJA 2IUYA 3R7AA 2W4MA 1CJKC 4EA8A 2AW5A 1T2EA 2JBAA 2LZ0A 1AS0A 2GRUA 2VCEA 3HRIA 1DTWB 3LKDA 4OMFG 1YRQA 2REXB 4UUPA 1G0NA 3HPQA 3CUEF 3RC3A 1CR2A 1IMOA 1P7CA 1N5DA 4IDDA 3UJ8A 1K5HA 3N87A 4F8EA 4Z7JA 4NU5A 1OZFA 2R48A 5KU7A 5ISMA 4TQUS 3SMQA 1JU9A 5D8DA 2W2KB 3SC6A 4IVPA 3K92A 4JLWA 2VZEA 1SQ6A 2I55A 4Q7LA 2EG5A 3B3AA 3C0KA 3M4NA 4RKWA 3WRXC 4U2FA 2E6KA 4K6OA 3SDZA 2Q45A 1SD2A 3A27A 4P3KA 3RWBA 3UHPA 1S2LA 4DKXA 1U5BA 3O83A 3LCCA 1VMEA 4TXLA 4A8PA 2ZUFA 1CF9A 2P11A 5FUXA 3VH2A 2OFWA 3SPXA 3L1IA 3Q3CA 1Y4DE 4KYVA 4R51A 4HATA 3PD1A 2GLXA 5KDOA 5J2TF 4MV8A 5C2JB 2ZYWX 4JP3A 1WTCA 1H9BA 1V3UA 1YTLA 3ICVA 4JR2A 2VP2A 2BYTA 4HZGA 3EFEA 1PR6A 2ACVA 3FVQA 2E48A 1MP0A 3C85A 1VLJA 3OZ7A 5PNTA 1I2BA 4PICA 1YH3A 4LGMA 1NW7A 2QF7A 3RANA 2IY9A 4PGMA 10MHA 1KS2A 1R7RA 4RJTA 5JXHA 2WYOA 3CTPA 3REFA 1PT8A 3ZDZB 4NXNB 3ED5A 1E20A 4KTTE 1ZJ6A 4R41A 5JXWA 4EHNA 3W77A 2FDCA 3NOXA 4P3XA 1UXOA 2Q1TA 5E6RA 2F43A 2NU9A 4EKYA 2B2NA 4IH1A 4QSHA 3OEEA 5E9WA 2GPTA 4JI8B 3F9CA 2Y9PB 5AI5A 5TLSA 4ZQBA 4EFKA 5A6SB 3ZIUA 1ESCA 5LYYA 4MSUA 1R6BX 1QFYA 1QO7A 4OH7A 4A6PA 3RRNA 3IT3A 5F7XA 3IELA 1AKTA 5B58T 4QA9A 2R1TA 3UUFA 1RJDA 3LG2A 4D4IA 1VP9A 5IAEA 4GT1A 3LLCA 3KT3A 4EUHA 2JLQA 3GEMA 3W5CA 2XX3A 3X1DA 4H2DA 1NPTO 3QMVA 3DZHA 3SS8A 4AU1A 3HJFA 1KVUA 2ADMA 4PNHA 3FTNA 4EYGA 2P9TA 2NIPA 2I3GA 3COPA 4RL4A 2WM2A 2Z5FA 4OXXA 1WDLA 2Z6QA 1O5TA 1VMAA 4XAQA 1F1BA 3A6JA 4YK7A 1G5TA 1JQKA 5A6VA 3C41J 3VUFA 3CR8A 2EDAA 3THYA 1JJFA 4LYHA 1FRNA 5IT4A 1SKYE 3I1IA 1IOLA 3RTGA 3KB6A 3UH0A 1IPHA 5FHRA 3TAUA 3B1FA 1GQYA 3HKBA 1E9FA 2PZFA 1A72A 3BJRA 1Q92A 1Z25A 3KHTA 5C1PA 1XCLA 5K3FB 3CU5A 5K51A 4MUHA 2GM9A 4OQQA 3SZMA 4HR7A 4BNJA 4LRQA 1P6QA 4ND8B 3LOQA 1N4AA 1IY1A 1AVTA 3AHIA 4FIDA 3N74A 1NDQA 4B6QA 4F46A 1Y8AA 3IT2A 1H66A 5IF3A 3A9WA 1J9GA 1SQFA 2IYFA 3KJHA 2ZSDA 1A9QA 2ARKA 2YHAA 3A10A 3INYA 4JELA 4NARA 2J9ZB 4C4ZA 2X77A 2EF0A 3NATA 4PQFA 2VP4A 3OTWA 3OIUA 3PEVA 3VPHA 5BN3A 2XB9A 3JSXA 3KKKA 1ZCBA 1QZUA 1R10A 1ZH0A 4OFXA 4US0R 2PXAA 3P9XA 4GL4A 4UZSA 2WHPB 3EGDA 4LYGA 3IJEB 4ZT4A 2YHBA 4J0QA 1F12A 5L4NA 2WM8A 1IQPA 3A0UA 3ZDYB 1TVCA 4XUGB 5C80A 5LD2B 1EUQA 2CUNA 4Q7EA 3QLTA 3R9WA 3MWDB 2GVNA 1U2DC 2LDBA 4RGQA 1GPDG 1NJ5A 4FGJA 4HGRA 3U5TA 3UQYS 2G04A 2JIBA 2E5FA 3PI6A 1Q57A 1JBEA 3II6X 5E6UA 1MT0A 4IJUA 4F3YA 5A5GA 2BKXA 1W88A 2W6JA 4B8ZA 5JD4A 2PMEA 4EMSA 4CIYA 4MVJM 4EDFA 2A5FA 3UV3A 2BLLA 1CZUA 4I1SA 5BW4A 3F96A 4LAFA 2H29A 2QTZA 1HMPA 2JFXA 1VJDA 1ZR4A 2HKIA 5HJ5A 2ROQA 1KP9A 1JQDA 1SB8A 4KR2A 4NJEB 4O29A 4JB8A 2Q9UA 3PNQA 5EWJA 1R6VA 5BYKA 1AA6A 1WCV1 2DWUA 2LNDA 5AJXA 4Q5IA 1BC5A 4B6EA 1G8PA 4REOA 3N6VA 3GXBA 1UDWA 4WXHA 2PUDA 1XTJA 5SY4A 3QVOA 3RT9A 2UXBB 3A6EA 1AUOA 2OHGA 1WRBA 3FCSB 2I6UA 5I01A 4MKRA 2UYYA 5AESA 3FCXA 2VA9A 5EZSA 4YRTA 3C8MA 2XYGA 4Y6OA 1AKNA 1WW3A 1AMNA 1NP3A 3FVVA 1INLA 2QDXA 1Z4KA 2RGUA 1U8UA 2XQGA 1LX6A 1ENPA 4Q4AB 1JPNA 3VPDA 2CFCA 1I1OA 3TTUA 3U0BA 5AT1A 1D4ZA 1Z34A 4LOHA 3H4TA 1P7WA 4YYEA 2ZJ7A 1VPTA 3NM4A 5BSEA 4OHYA 2HIHA 4RV5A 3TLAA 2GBIA 2VPPA 1BTOA 4DLBA 2DBVO 3ZEAA 4URWR 1CV2A 4DLSA 4MKIA 4PZCA 2EXXA 4I9HA 4FYWA 2YYAA 3ILSA 4QEDA 3V80A 2BTQA 1YS2X 5B7PA 1TAUA 1JKFA 5SICE 3HFSA 5GV7A 3OQ1A 4WD3A 4BWYA 4UOZA 4EFLA 2RKBA 5LKRA 1HT3A 1CP3A 1PT5A 4QFDA 4C05A 3DEIA 4X5OA 3RHFA 4ARBA 5H16A 2JD2A 1E58A 2W4QA 4BBJA 1O03A 1YBVA 2HF8A 5FR2A 4QFBA 5K45A 2WJJA 4HPJB 1H2EA 3M6MD 2AJTA 4ZFNA 3DBVO 3ETJA 2ABWA 2JAQA 3A04A 2XQKA 1CJVC 3QMMA 5BR7A 5G53C 4LUCA 1G41A 2E0IA 5FBRB 1NUHA 4RVHA 4YB8A 1M5UA 3PC8A 2PIAA 2FRDA 4ZC1A 1B14A 4FVTA 2NVUB 4KDFA 4BU0A 1E2JA 1CS0B 4MRSA 3DYBA 2ADFA 4MQ5A 4N8SA 3F74A 2GN6A 3T9CA 2WF6A 2J6IA 1F2UA 2IOQA 3BRCA 5E2AA 4JASB 3ZGYA 4GI3A 2GZ1A 1E99A 4HEA6 4ME6A 1CR4A 2CK3D 3PUHA 3SGLA 3UICA 3ZOKA 4C01A 3GU3A 3UENA 2AEJA 5HFJA 3W9BA 2BGTA 3TF5A 5ABPA 3BSFA 4FFPA 4DQDA 4Z7NB 5K99A 1UR5A 1WUYA 4XSGA 4YH1A 5KMGB 3JVVA 1E7SA 2YJGA 1JG4A 3M8KA 4RPLA 3FTPA 5C81A 2G40A 4AM8A 5DYGA 1ZEMA 3CEAA 4L72A 5GZ3A 4ZYYA 4JQSA 3A3YA 5F9MA 3HR7A 3KSMA 1KO1A 2EKQA 3VDQA 2GJKA 1BWQA 3UQZA 1CY7A 2OORC 4X91A 1FFXA 5BWBA 5MDHA 2C42A 1SBHA 1SWVA 4BJ6A 2BEVA 2Y4OA 5KC8A 3LUBA 2XYHA 1MRSA 1NUAA 1OFUA 1T8PA 4YO8A 4YRQA 1T5IA 5H70A 3UHFA 5BN5B 1TVKB 5BMVA 3KLBA 5DXAA 4GBGA 1ZINA 1YDHA 2ZRDA 3H83A 1EI9A 2NNLD 3WB2A 5KYUB 2FETA 3W90A 3P9CA 4MW0A 1PT7A 2ZT8A 1GTJ1 5CFMA 2DUJA 4MGEA 1J0DA 2AI3A 1UAGA 3I2GA 3K30A 3PFBA 1U80A 5D84A 2X4IA 4C6RA 1O94D 4EVIA 1RRFA 5EJ5A 4XVCA 3AFGA 3RPEA 1NG1A 3P96A 1DIGA 1KJYA 1BDBA 1M6VB 1XTTA 1DV1A 2FVXA 1E1CA 1GG5A 1S02A 3I2FA 1GV1A 4K86A 4JVLA 3HWSA 2H7XA 2ZBDA 3HBAA 4DUGD 3M6LA 2BFEB 3PJFA 1EK6A 2BJWA 1KKLA 2P4SA 4MDHA 3KSZO 4TZKA 4Y18A 5IVIA 4CT0A 1K6JA 1TOAA 5JQGB 1M2VA 3FMPB 4IMJB 5LLSA 3TQQA 3ZZ0A 4EWLA 2H06A 4MVCA 1WQ1R 2I2DA 3GC6A 2Q4TA 4JYZA 1O0BA 4B82A 4P7FA 2FUKA 2A9KA 3PVZA 4RQUA 2JIOA 5JR3A 5FUQA 4EJSA 5AVUA 3RJMA 3GZ4A 5IMSA 1P4GA 1ZIPA 2ERYA 3RKSA 2BMDA 4RK5A 1G59A 3KEOA 2J31A 2CDRA 4JV5B 5C34B 3RFXA 1XD2A 3RS4A 2IDZA 2C4WA 4A15A 1BROA 3MF4A 2ZZMA 1EWQA 2CFSA 1HKHA 3BAFA 4CL8A 1C0LA 3AG5A 1RBMA 4ZOEA 3LXXA 1ZVJA 3PWTA 1G19A 2ONZA 1FP2A 2V3WA 3CC8A 3INGA 3O84A 3RJTA 1RTTA 1PEAA 3HUTA 4EVRA 2HQOA 1YU6A 1SJ9A 3G5UA 3OMWA 3QBEA 1MB2A 3LPAA 1OFGA 3TB6A 3HUUA 1L7OA 1QDLB 4F3KA 1HM5A 1KHHA 3E3AA 3OFNA 4N9WA 5KTPA 1KMIY 1J0EA 3IALA 3E1GA 4WJKB 4BMPB 3X0DA 1M8JA 2CXHA 5IS2A 4G0PA 3HUDA 3EXIB 1DBVO 1QE0A 2FHSA 1OD6A 3DAHA 2UUAB 3GQVA 1KDOA 5DYNA 5FLKA 4MRNA 2OEPA 1WPQA 2FWIA 4AMYA 4DA9A 1RBYA 1VL6A 1BDHA 1E3DA 3WBFA 1E9SA 2GBLA 2PUJA 3Q2IA 4M1QA 3BD8A 1P4JA 2X76A 2CHFA 5I3ZA 2X4DA 1H0KA 1NBMA 1W47A 4PFKA 2XNDA 1NY5A 1GTMA 4LNUB 4Q39A 1TTHA 1JDPA 3QX9A 5A7GA 3AONB 4ZVUA 1TKBA 5E6RB 2BW0A 2F43B 2B7LA 2H31A 1WETA 3DE6X 3HVIA 3ZHOA 3CX7A 3HP7A 3MSCA 4BKPA 3DWIA 2J87A 3F1KA 4B6PA 1VRWA 1KL7A 2C59A 1USIA 2NW6A 4MYRA 1NKSA 4U7WA 4RHXA 3UAWA 3HSKA 1SKQA 3V4PB 4BCDA 2GH1A 4R40A 1HYQA 1ZM3A 1YK1A 3SKYA 2PXXA 3Q9SA 3TR5A 2YJ6A 1B15A 1RLMA 1TIBA 3VOTA 1DXYA 1VLVA 2N46A 1ZLYA 3LYLA 4WRRA 2MSCB 2G9NA 4BGIA 4J0KA 3NASA 3OT4A 3MTEA 3SQNA 2IPNA 2PBZA 3TFQA 2BC9A 3L0BA 4JLMA 5KQSA 1IAVA 2P4HX 2W6IA 3EDQA 2ZRIA 2RC5A 4EEZA 1GNRA 3H9CA 2QM7A 2Y2UA 1PZHA 5GGYA 4M9RA 4HYQA 4ZOLA 1BMDA 3EMDA 3P7MA 4YV7A 1LU9A 3W2FA 2XE4A 3COWA 3CZCA 4Y2TA 4DSNA 3THYB 2VWPA 3ZGNA 2M1XA 2Q50A 1QRAA 3IVCA 3Q1LA 3O1JC 2FUEA 4B71A 3E3LA 5ELXA 2XZLA 5SYMA 2GAIA 5J4LA 5EXEA 2WZDA 4ZV4A 5H59A 5E7MA 4KWEA 1CZOA 3RV4A 5CH8A 2IZ1A 4WZBA 1CUVA 4H6VA 2EGUA 1L7NA 1PDWA 2OGSA 2WVJA 5DISB 4W4TA 1QG0A 3U4IA 2KLHA 2QNRA 4FOTA 1UK8A 1RQRA 1T4CB 2XOKA 3KDAA 3VTFA 3GPIA 3D7SA 3M3HA 3HU2A 2GDJA 4J29A 1EFTA 1WOYA 1XTVA 2HQBA 1P9LA 5D87A 5NULA 3A05A 2CDBA 2JEYA 2PSFA 3BIWA 4MICA 1ZCAA 4AMVA 1ABFA 2PD6A 5BN3B 1ULAA 2GLUA 1NZDA 1C1YA 4X95A 3CLUC 5EP3A 2FEAA 4M86A 4BNLA 2UVPB 3Q9UA 1C3OA 3ZJ5A 1P4RA 5B4UA 621PA 5K0ZA 1DTEA 4Y2VA 2FMKA 3AEXA 1GPUA 3L2OB 3T1QA 5KQMA 4CJXA 3V4FA 3AIIA 4AF7A 3MM4A 4MJXA 3H11B 1PQ4A 2QN6A 1W34A 2PLWA 2XGSA 1YKGA 1R0CA 2IE8A 3F98A 2XY4A 2OE2A 4FDUA 4GPBA 1YS1X 1EVIA 5IN5A 4D0NA 1LBSA 4LOAA 4FFMA 5E6UB 1KOGA 1C3JA 1GKKA 1H3FA 1RE0A 2HD4A 1T0BA 4LZZA 5EMNA 2X6RA 3LQ4A 3UJDA 4G84A 1P0QA 4NDZA 2IUTA 3PE3A 2GEJA 4EYQA 3HU1A 3OFKA 4AN4A 1KO4A 3NNNA 3OQIA 3BJEA 4I08A 4I1UA 1CRWG 3IRUA 2ZLBA 1TCUA 3OLVA 2CXNA 4Z5XA 5K0GA 1ZMBA 1NL3A 4FEGA 4CRWB 1J7KA 4H6WA 2Y71A 1NF9A 2O2HA 4MS3B 4JLOA 4AVYA 4CQJA 3PQCA 3QVUA 4QJIA 2QU8A 3GBVA 4JLNA 2OB2A 4Q37A 3D5EA 3H8SA 4P81A 4RFLA 2NYUA 2XWBF 4YREA 5M04A 5G0SA 4G24A 1F8GA 4IDHA 3UHOA 1P9NA 3NHBA 1E3QA 2IZZA 1DNPA 2FN7A 3G9ZA 3QUTA 5C53B 3MYYA 1XMPA 3JQ6A 4Q3KA 4ROTA 5A4KA 3WGQA 4RFVA 2AS0A 4C2AA 2XT9A 4CQLB 1QOPB 1LK0A 2RKWA 3GMTA 4LHSA 1LDYA 5TGDA 2A5LA 2FPIA 1WXQA 1B73A 1UJBA 2NACA 3JWEA 4E2WA 4JUIA 4X7BA 4OMUA 3ERCA 4C3UA 3G0CA 4YIHA 2VSQA 5KWSA 4RC9A 4OOFA 2C8VA 4TKUA 1FSSA 2NU6B 1TCCA 3ORFA 4TL9A 2CMFA 2VYCA 4ZAZA 1K66A 1LRJA 1R1DA 2P0YA 1BQ3A 3WWOA 2Z9BA 1ZCZA 2ZYVX 1TLLA 3OC0A 2P9FA 1A7KA 1TYBE 1NR7A 1J4AA 2NAFA 3DYVA 1PV1A 2FFAA 1PGQA 4G25A 1U3WA 4RELA 2V3CC 3NFRA 3TSZA 1P2FA 2I87A 4YCMA 4HB2A 4HGNA 2DLDA 3GFRA 3R3SA 4EECA 5KOIA 4MUJA 4BO4A 3CZRA 4E14A 4LCEA 1DT3A 5ITWA 3THOA 1U0GA 1ONSA 4G5YA 1DOAA 1D09A 1TCAA 4UBJA 3U4QB 2HCRA 2PSDA 3WZMA 5LOVA 1R4MB 3T3DA 1E2UA 3LA8A 2PYZA 3DV0B 2EX0A 3NEPX 1PJBA 2IT1A 4K40A 4MS4A 3FGOA 4Q3LA 5BT9A 3WS7A 4DAOA 2V8BA 2JZOA 4OJTA 3PDJA 2VBGA 3A1NA 1GPJA 5DDIP 1FX0B 4L1KA 2OO5A 4D41A 2ZYSA 1Z6AA 1VBMA 4G4SO 1W4BA 1WEKA 4WFKA 4O4JF 1YZFA 5EHNA 5KNCD 4ODIA 5AKLA 3CVUA 3VTKA 3ZDCA 3W6UA 4KE7A 1L1FA 3MJCA 4L4XA 1I6KA 1PJLA 1ONOA 4P9NA 3KXLA 3T3HA 1TM7E 5DM1A 1WA5A 4F12A 3KXKA 4LHXA 4UM9B 1Z6QA 3FHOA 2QW1A 3AIKA 3OSZA 3FCUB 4FWTA 1KSHA 3GLGA 2NO0A 5H81A 3GNLA 3C45A 3RODA 3ZW8A 5AM4A 1UKBA 3P2YA 4LWZA 4XDGA 2XXAA 3ELYA 2XCRB 2HWXA 4GNRA 3PFCA 4OLFA 3JSAA 3FFBA 4LZAA 3W8FA 1J8QA 1BAPA 1L5GB 5FFNA 5IJAA 1DC4A 2DJ5A 2WK1A 3UAOA 1FLDA 5BW5A 2DQ4A 1T3LA 4QRDA 1W4LA 4CHTA 1IFXA 1OT3A 2YV1A 1D1SA 5BSVA 3ENWA 2NVOA 4PO8A 4YRAA 2CVQA 3HWRA 2CCKA 2IDJA 3E0QA 2FG5A 4K6GA 3V7YA 3V8VA 2NP7A 1YB5A 5FUWA 3KAKA 1R3UA 1Q1BA 1COWA 3P9KA 4L07A 2BEVB 1NVKA 3K6KA 3VO8A 3WK5A 5KJ1A 5KYXB 5EHZA 5C1IA 3DOEA 2C7VA 5BMVB 3G9UA 1GY8A 1H6DA 5ICFA 3WJAA 2I2AA 2WJWA 3HXKA 2I1VB 4UUBA 4UXJA 1RR6A 3PKJA 2I9PA 1HFJA 1RMYA 4O4IA 1Q6ZA 2QPOA 3L49A 3I4FA 4FP9A 3IXMA 2E4XA 5AW6A 2FR1A 4MA5A 4ASUD 1GILA 1OFHA 1TYCA 2E4YA 2PLRA 4UNNA 3FDFA 3L6BA 4IO0A 2P35A 3CCBA 2OHXA 3OQBA 1KZHA 3VC7A 3VHXB 4D9FA 3JZMA 4E4YA 1QU3A 3P19A 4Q9KA 3INRA 1E1CB 5LBIA 2VJDA 1QQ6A 2V7GA 4ZRDA 1P2TA 1OGYA 2H4WA 1HPLA 4AYTA 1A5AB 4LKOA 5EOVA 3P2EA 2HY7A 4FOOA 1B6SA 4HF7A 1LSJA 3MLEA 3W3ZB 4BLVA 3TTYA 5B2ZA 2Q28A 1USWA 2QD5A 4EJSB 3T7KA 2O2DA 4BQSA 5HIMA 2OBXA 4ZCPA 2EVWX 1CVLA 2FMIA 3BRWD 4O63O 4ECEA 1G20A 3SJBA 3QBTA 4YMTA 3ZV3A 4F9EA 5HZKA 2CE7A 3LBNA 1FYXA 1U0SY 3MOGA 4MYTA 3F46A 3E2MA 4MYDA 2D3TA 3GJYA 1GDTA 1GT6A 1QVVA 3W5HA 4ENPA 2J7PA 5G0VA 5EFZA 1L0BA 3CUKA 3AXSA 3G8BA 4NCXA 3DWFA 1M1YE 3C6ZA 4EFNA 1FLNA 3U9TA 3OE1A 3BXFA 4CG1A 2CNKA 2OLKA 1I5RA 2Y0DA 1KC1A 3I2YX 3WGYA 3ZDFA 4YJ3A 1GLNA 5FJJA 3G8YA 4AP5A 3HEAA 5K0NA 1RSZA 3V8BA 4EA7A 2GN4A 2WAAA 2SKEA 3KQNA 2YWDA 5AP9A 2BMWA 1DKUA 3WDKA 5LFAA 1TC2A 3ZVKA 4GMKA 3DVAB 2N75A 2XZPA 1T9CA 3FUCA 3I32A 5HQJA 5KSWB 3OQNA 4GZ6A 1V47A 4CMBA 3ORSA 2PAFA 3AM3A 4DUYB 1U3VA 3TX2A 4A03A 1KF0A 5JADA 2CNBA 1YE3A 3GP8A 1BH2A 5L3QA 1G8YA 3AR4A 1Y3CE 2BFWA 2XGMA 3JYPA 1DEKA 2J33A 1ZK2A 4OJQA 1CY4A 4A6DA 4E5YA 5JUWA 4BV9A 1D2GA 1Z6XA 1AZSC 1G17A 1NXSA 1SZDA 2R7MA 2RDMA 1ABEA 3KDSE 3WICA 2NUPA 4C0SA 4Q7QA 2UYCA 1CF2O 4RY9A 1XZJA 5ESRA 1D6SA 4V0QA 1E3EA 1NJ8A 5HXAA 1NLYA 1MIHA 2VEDA 3D31A 3Q6NA 1DHTA 2QS9A 1DO8A 5JAIA 2QUJA 1Z4NA 3K9LA 3HYRA 3ZZNA 3MSXA 4Q21A 3CB2A 3GWGA 1QJCA 4GPEA 3PNPA 2PLAA 1UJMA 3FMIA 3QTTA 2OTCA 2I54A 3QMPA 4KO8A 5EN4A 4ZVNA 5DHRA 5KOYA 2BF4A 3MRXA 4HDMA 5JC1A 3ZJVA 4REQA 4QOJA 2H57A 2P8SA 3GLSA 3H2IA 3GFQA 3RU3A 4BJHB 1FA9A 1K8RA 2GAFA 1PHPA 1XN1A 1YZ3A 2GTIA 2NXCA 2WG1A 2XA2A 3EIUA 1AKRA 4Z8YA 2B3TA 4HAZA 4DLPA 3QIAA 3R24A 4KXLA 3BEDA 5LZ5A 3IVGA 1FP4A 3AKEA 3FCEA 3LGSA 2ZETA 4KW7A 4JWKA 2JGJA 4QRHA 4RVNA 1P75A 2R2GA 4QPCA 2FW0A 3Q5GA 3D8NA 3STXA 1HORA 3WHKA 5K4HA 2QDKA 5F2EA 4JXZA 4F91B 4OTZA 5EUMA 5KNCH 5JJ5A 2IHUA 1TTTA 3Q3GE 3RYTC 3HKCB 1DKPA 1B2LA 1EFLA 1FNNA 1KY2A 2WHRA 3B48A 3OPVA 2H4FA 4KXYA 4WZBB 4S05A 2PWPA 1EM8B 1N2CA 1OASA 2D74A 1WUTA 3IUSA 3S29A 4MZXA 1KO7A 4TXNA 1IEWA 3CX6A 3RSLA 3RTCA 2Q3EA 3GT3A 4EABA 1O77A 2EKZA 1NN5A 4M0PA 3M4YA 1Y4ZA 1CE8A 2GCPA 3AF3A 4OYLA 3RUIA 2P7IA 4GP7A 2I2XB 3TL2A 1TM3E 2BSAA 3OBIA 4MYCA 4B17A 4A7PA 4EL5A 4IVQA 1AG9A 4LISA 1QTNA 3KR9A 1J0CA 5GZ1A 3BF7A 1M10A 3GIWA 5FBZA 4FHZA 1HL7A 1D7OA 1NUTA 1HK7A 3LS2A 2G72A 3OKCA 4X63A 4XPIA 5ALJA 1OT5A 4I4IA 4I46A 3GX1A 4B3TB 3PQ3A 1IBRA 1YQGA 2PYDA 2ANCA 4Y8VA 3ETNA 1QYIA 1E79A 2V7BA 1NN0A 1PZFA 2GD2A 3I01A 1Y3AA 4RK1A 5CPBA 2O2GA 4AZWA 3NJRA 4TTIA 3QPWA 1GRQA 1O4VA 5TQ2A 2A0KA 4QLOA 1W6UA 2DB3A 1U0OC 4IDFA 3QEAZ 1W25A 4Q6WA 1GUFA 1CB0A 4RSHA 4J1QA 4TROA 1IH8A 4QDKA 5ECWA 2EFDB 1CVRA 1PVVA 3CH4B 3AETA 1YI8A 3QLVC 3UJBA 5I4IA 4Z53A 4U7PB 1TU4A 4ZYVA 1TM1E 5F3WB 5IG2A 4F4JA 3C6XA 1FU4A 2ISSD 2GMWA 1G0OA 4GUDA 3ZCVA 5CD9A 1DU4A 5KYUA 2CBXA 3EG5A 4G1UC 4WK4B 5ALOA 3S1AA 3ZS8A 3KE9A 4LI0A 2P9HA 1Q0LA 1OZGA 2XCLA 1BEEA 4RSGA 1T0JB 4DWVA 4LECA 3A9SA 3WQRA 4C7XA 2H8KA 2O1XA 2B94A 1QLHA 3H5TA 2ZJ0A 2O2YA 5IYZF 4YUZA 1LS1A 2X8BA 3AY6A 2HSEA 3NWJA 2PJRA 1N4DA 2Q2OA 4BNFA 1KI2A 1N2SA 2CN1A 5EP1A 1S6YA 2FX5A 4XD7A 2O5CA 4G63A 3NBMA 4NSNA 3VAYA 1NY6A 2E7ZA 5C7IO 4TS4A 4L50A 2VTEA 1J23A 4LRTB 1UC4B 2BFMA 4KFSA 4ALMA 5HDBB 3GXOA 1MIOA 2G3YA 3I37X 3FVTA 4I55A 1T25A 1RJ9A 2W6JD 4I99A 1UOEA 1IZ0A 4BLUA 3N70A 4DSOA 4P53A 3K8QA 1W5EA 1MAAA 5IEBA 1XMQB 1X39A 4Z9FA 5JBNA 5JS1A 1YHYA 1ISRA 4TKUB 4RK4A 3G0DA 3Q0TA 3DTYA 4NV3A 4YS6A 3KR2A 4J0IA 3TGPA 5EJGA 5IBPA 4EI9A 5KYGA 1A8PA 2AFIB 4Y7CA 2HRDA 5HKKA 2JG3A 2A35A 2G4CA 3WKEA 4CM5A 2YV5A 3WFZA 4D98A 2R68A 1ZOPA 3K0CA 4Q1DA 4R2LA 4HMQA 4YONB 4WUTA 5CA1B 3VSEA 1YC2A 1ZK1A 2MYPA 2QI9F 5J5VA 3UTDA 4ACBA 1M6NA 4Q16A 1JI0A 2XAUA 1HBJA 1UWKA 2JK0A 3F7TA 2PNFA 1H93A 1RBQA 2DWCA 2YNMA 4IJMA 4TMFA 4AFNA 1RXCA 5HNKA 3UW1A 4KOAA 5JY6A 5LOVB 3UWKA 3PK0A 1FSGA 3C15C 2OILA 2NV2B 4C2UA 2HLPA 3U40A 1QG4A 1ZR2A 4WLUA 1CRQA 2BCEA 2C2MA 2W71A 3EXAA 3QMWA 3PQ6A 1H23A 1U81A 2ZVQX 4RY8A 3ZDXB 1CYDA 4WK2B 1E6UA 1WCIB 3G59A 1FJXA 5E8RA 3RS0A 2YL2A 1J24A 2SNIE 1YVRA 5FBVB 1M83A 1M54A 1FU8A 1QGZA 2OPHA 4BGEA 5MGBA 5CH5A 3NTRA 1D4AA 2OHFA 5FEMA 4KNYA 1E0DA 4RADA 4FLMA 4NENA 4P4TA 3K5HA 3UAGA 1YONA 3JALA 1VKNA 2FSHA 5AK3A 1E2MA 1U1FA 3F73A 4FJ1A 5AFSA 3GUUA 1X1CA 1ECLA 1K0UA 4LRSB 5DBOA 2QRZA 4JJEA 4EUSA 3WSWA 1XDBA 2Q21A 3GT7A 3QP9A 4LJKA 4RJKA 3SS7X 2V7VA 2AG0A 1TFUA 1D2EA 1DSSG 1ZVMA 3JZIA 2BR3A 2CLHB 1T6YA 4Y9SA 1JEDA 1RM5A 2WDPA 4B75A 2W0SA 1Z0JA 4MA0A 5A3SA 3RQSA 1UQRA 3ZXIA 5T4EA 3G6KA 2P1RA 1G3IA 2D2FA 5JSKA 1E0AA 2PGLA 1N2HA 3JQAA 5CCDA 2DHCA 3ZS9A 4B34A 2QVLA 1G4UR 5DHQA 1GYQA 1QB8A 1XP5A 4AJ4A 2ZWOA 2O5RA 1C3EA 1VKJA 3OCJA 4XCVA 4NTZA 2XYQA 2R5WA 1E2IA 4NV1A 5IABA 3D7LA 4HWRA 2VDJA 1M2NA 3KKQA 2C4TA 4I1VA 1U0FA 5IAOA 3IUPA 5T4BA 2PGDA 4O4IB 1F7UA 2PA0A 3PI7A 4FU0A 1X6VA 5KTTA 4UM9D 4MDFA 4RVOA 4XD2A 2L42A 2QQFA 1QIDA 3AK4A 4E2XA 1MEJA 5DGIA 5A3RA 5J63A 1CG6A 3EUFA 4GDMA 4TYWA 2JBWA 1LV8A 3W34A 3LFHA 2J9FA 4C20A 2FMFA 2EJUA 2ZUVA 4H1HA 4JKOA 4GOLD 1QO9A 3JAKA 4ZCMA 1BJRE 1DG3A 2PX6A 2C3YA 2QVCA 4DARA 4PSUA 4QJ5A 1A9ZA 1B8NA 5HBGA 4O3FA 3HVRA 4MHTA 4JC4A 4GXNA 1Y1KE 3QV2A 1FVHA 5ALZA 3E0XA 3LQ1A 4I81A 5BUQA 5CH3A 1KJWA 1TZBA 2NNWB 4Q01A 4L95C 3LXMA 3OZFA 4K9NA 2JDID 3C3AA 1VHWA 1ZESA 3I52A 2CLEB 4KSCA 4EIWA 4MTLA 3UFXA 1PYOA 5BO5A 3I6IA 4N3BA 3RHTA 2HJRA 3R0JA 5CX4A 4YR7A 1VKZA 4RZ2A 3N8GA 1QKIA 2VDRB 2JATA 3S7ZA 4WT7A 1W9HA 2UZIR 5LPNA 4C2BA 1GYPA 2HRCA 2VL7A 4HS4A 3W6PA 1RVDA 1G7CA 3AR5A 4IS2A 4J43A 1B7GO 5JSFA 4HADA 4QSMA 3DG9A 4WHMA 1E89A 1XRSB 2BMJA 3GBSA 3IKJA 3QPCA 3AJRA 2Q6LA 3C4JA 4WN9A 1AQLA 3O8CA 1DWOA 3ZWWA 3LF1A 3O2NA 1DAGA 1VDZA 5NLLA 2GCGA 3G2IA 4JKYA 2R3SA 1NVGA 4WBSA 1KYQA 4AKHA 1WSWA 1KI6A 1U65A 4EG8A 5SZIA 1KZGB 4B09A 2J0VA 3KQMA 4DCPA 1UBSB 3JTEA 3TLGB 2ET6A 2Y1LA 3LUGA 2EW2A 1M7BA 1T13A 1G6OA 2POQX 2XA1A 3VYWA 3K6SA 3TYXA 1GUYA 3L5KA 3WNDA 1ULZA 2JB9A 5D7NA 3MWLA 4H1TA 3SYRA 1YAJA 1ES9A 1K06A 1OSNA 2ZAOA 5CGQB 1AQJA 4DEXA 4RPHA 4ADSG 3DAYA 3NRBA 2RK3A 4FMBB 3SNKA 2QZJA 1D04A 4QUEA 3TGLA 3QHPA 2W4IA 1ZIXA 2NUPB 3WK4A 4NFHA 5CAEA 2B82A 1TVMA 1ZONA 2IH4A 3WE7A 2FGKA 2RI0A 1LI4A 2ZTSA 3EGXA 1GSHA 5AKKA 3G2HA 5J23A 1IRXA 3OBBA 3TEMA 2CHUA 1X1AA 3CNHA 4K1LA 4V2IA 5E1OA 1PGJA 4R2KA 2WM9B 2J3HA 2VBIA 1Y5MA 1OWLA 2O8FB 1X1DA 3ZXUB 3EIHA 1LV7A 3GVIA 1E5XA 2CJYA 4XWYA 1JAZA 3FNHA 5FUBA 1GA6A 5LB2A 2NTVA 4HDMB 1TECE 4WN3A 5LIRA 1DAEA 2BZ1A 3A0RB 3PNVA 4U2KA 1A5TA 4NYMQ 3DCNA 4K9RA 4ZVLA 3WISA 2QT9A 4DTCA 2R6R1 4LQ4A 5IVKA 2AG5A 3E8SA 1POXA 1NBMD 2VCHA 1ZY2A 2HJ9A 1P7VA 2Q9AA 2VN8A 1Z37A 3F6RA 3BL5A 4QFMA 4YLGA 1O1YA 4QG7A 3RYFB 2E37A 3URMA 3USES 1QMPA 2EFGA 3S2UA 4AW9A 4AX4A 4ZYXA 4GO1A 1WABA 3GG2A 5HIJA 3LW7A 2HOQA 2VJQA 2XD9A 3X44A 5CEEA 2QNBA 4XVHA 3I01M 5FADA 1RYNA 4P98A 3VTZA 4S12A 4ZVPA 5EKTA 5JJKA 4A0RA 3QUQA 5BR4A 5LWHA 2C2HA 1N2CB 2KX7A 1XKXA 4PXYA 4RD4A 2YXBA 3BIFA 4QELA 4CIXA 1XPUA 5KVQA 5THXA 2O7NA 4FT4A 2UZ1A 2EWWA 1TYAE 4CETA 4RVCA 4BTEA 1TPYA 2PFKA 4E30A 3TG8A 4Z1OA 1CE8B 4INJA 4B7AA 3DONA 2HF2A 1ZWKA 4D79A 2DGDA 2P7HA 1CSEE 1VA4A 4RANA 1W0JD 4QE3A 3S2IA 2HZBA 2XKAA 4R68A 3GLTA 4YRPA 5TPWA 2RGEA 1YT5A 2AYXA 2VYNA 2P2SA 4XPIB 4XWKA 2C5GA 1JFTA 2POCA 1G21E 5HQTA 2O8DB 4YRCA 4XIFA 4HDQB 3MLBA 4TQAA 4CLRA 1JR6A 3KSDO 4KXFB 3OVMA 5G41A 5LU9A 2ZRAA 1P5ZB 3NHRA 4IUBS 4Q9IA 3ZCXA 5K4AA 1L7QA 5TQ2B 5LP6F 4RTKA 3PXUA 1N5OX 4I6JA 2ANBA 4RFSB 3RO7A 3RS9A 3W4KA 1XVLA 2PBFA 4BV3A 1P5RA 4E46A 1CQJA 5KDLA 3S2YA 2E4UA 3O8LA 1HLFA 1WM1A 4BTLA 1E1RA 1E4YA 1SUDA 1KFCB 2XEDA 2A5DA 1NPYA 2PGXA 3DC7A 2C07A 1YJQA 1MRZA 3AW9A 2JGEA 5AW4A 3R0VA 1IN7A 3DKVA 4JR1A 2MSKA 3ZZ1A 5JWOA 4AS1A 2NO1A 1PJAA 1VCOA 3OEYA 3RDPA 3C5WP 4FNMA 4HQNA 4DPMA 1WMBA 2X8AA 2ZUUA 3N8IA 4GAEA 4JXKA 5FPYA 3EZFA 4GZMA 3S1AB 4PF1A 3SY8A 4AT1A 4XGIA 1P1KA 3HMQA 3D8BA 2NYVA 3SC2A 4C29A 2YY5A 4OKNA 1A8HA 2W2OA 3S0JA 5TX7A 3ZE0B 3F6YA 4O8ZA 3S70A 2BUAA 3P1JA 2I71A 1QHGA 2Q41A 2ZSAA 4TYPA 3PDUA 4UBKA 3VX3A 3EUAA 2PU7A 3GFVA 3F9IA 4I9UA 4MV4A 4NU8X 4HMPA 1XVUA 2C84A 2E87A 4BB9A 1R5JA 1Z17A 1V7CA 4K05A 1CJUC 1MIOB 1YZYA 3FSRA 4ENRA 2BL4A 5LB4A 1KBOA 4NATA 4J90A 3UJCA 4FMDF 1EHCA 3ADDA 4JLJA 5ALRA 3AXTA 4XIIA 3UH1A 4OAPA 2WKSA 1ORIA 1JHZA 1U98A 3W0LB 4CT5A 3GJ7A 1N3YA 1YUMA 3FPGA 4MV0A 4OGFA 4PLGA 4UATA 1T1RA 2KBEA 3ZR4B 4KIUA 1EVZA 3CF0A 4AQYB 4BBAA 4UTVA 3DT8A 4HNQA 4UZEA 3S2GA 3C43A 3UWMA 3L7AA 4URXR 3TNLA 2NGRA 1KZ6A 3N8NA 3L4JA 1OGIA 2P5TB 4B32A 1NNI1 3GVHA 4L3WA 1X8KA 4GEKA 3O0TA 1Q50A 1NBEA 1U7DA 3DWEX 2FN9A 1VRCA 3H3XA 3IQGX 2D5AA 4IZIA 5ESWA 5JBQA 1IJFA 5KPJA 3OZIA 2KE5A 1NFQA 2RIRA 1JIJA 2ON6A 3G8DA 1E69A 1L6RA 4OK3A 1T1GA 4PPQA 3ZLVA 1WD5A 3DMGA 2EARA 1RQNA 1XCJA 2FY8A 3COVA 4OYYA 3WY9A 4FYVA 5FV4A 1H2BA 2ZBVA 3LHIA 3NM5A 2NT4A 3LYUA 1J2TA 4HH4A 4LRUA 2FPPB 4ML3A 5JNWA 3H97A 2XJ9A 1NVXQ 4CN9A 2Q3JA 3DMDA 1S2GA 4I0WB 4TT8A 4QYTA 4WNAB 1JIIA 5I5EA 1P60A 3P5BA 3PXCX 4BAZA 3THWB 4XYBA 1SU8A 1GZHB 2CXQA 4HFJA 3A6HA 3LU1A 5E8JA 2VXYA 2A5YB 2IU4A 3O2JA 4Q4HA 2R8ZA 1UK7A 4TV9A 1JBQA 3Q11A 1NFFA 1QCDA 1G6HA 2DYKA 4MJ7A 5DI9A 3UAVA 5M5BA 1F8UA 4AYXA 2ZTMA 3N8HA 1DRWA 4UEOA 4W7HA 4UU7A 1C7IA 5F98A 5AK5A 2H2DA 3DPUA 3EH1A 3OX4A 1Z29A 1HA3A 4NEHB 2QRJA 3CX8A 5BOSA 1OAOC 3O8RA 4BEJA 1NU8A 3DZ8A 4IQ4A 2QQ0A 1BEZA 4XX1A 2P62A 3ZDQA 1EPUA 1BYUA 1O87A 1WHTA 1XZPA 4LOLA 3A26A 5AW3A 4YAUA 4P3NA 1CERA 2QJRA 1Z6TA 3LBYA 3PC7A 2VA8A 2X9GA 1EK1A 1XVVA 1AT1A 5IU6A 2V65A 2JHFA 2V4MA 2KB0A 3OZTA 3E81A 1R0ZA 1XGKA 1WP4A 1QU2A 3IH5A 3ILYA 3OTHA 4LKRA 1UBNA 3UBTA 4RD0A 5K6AC 3FOCA 3LI2A 4IF6A 5DP1A 1LX7A 4JEUA 4WZZA 5JPCA 1VIDA 1QWOA 2QX7A 1IAQA 3BAZA 4JGBA 2VXBA 2G28A 4REMA 3NO4A 1LWNA 5EIOA 4BUJA 4DPKA 3L8ZA 3U3KA 4EKIA 2TECE 3DO5A 1RC0A 2NVWA 4W6QA 3R6GA 5CB0A 3JRXA 3Q7PA 3KVYA 4MQMA 5EMKA 1YZGA 2PZAA 4DNPA 1IBKB 2OKGA 3OURA 4JT8A 1OQAA 2MJLA 3T12A 2LV8A 5DCWA 4CUKA 1FC0A 1YR6A 2PQ0A 4JDPA 4UKDA 4UPEA 1N34B 2CVHA 2R8PA 2RI6A 5B37A 4AJIA 4D0RA 1Q0TA 1AHNA 3FIUA 3OFJA 2Y1KA 4QWWA 4RENA 2I78A 1PQYA 4WOPA 4AECA 5CIYA 5B12A 3OQHA 3B6MA 4AY3A 3LUAA 4KVGA 4NCIA 4U7FA 5CFPA 4INPA 2V9CA 3JAKB 5AM2A 1PG0A 1L7RA 7ADHA 2KMLA 5C52B 2VLIA 1FDRA 1BVYF 3DH0A 1KU0A 4KXUA 2BGRA 3DMRA 5EHGA 1G7TA 2YWCA 4ZVOA 2OL4A 3A3OA 1G63A 1JE1A 2YW9A 2CW5A 1TX4B 1G9TA 2FG6C 2B99A 4G4SP 4J7XA 5JE8A 1IOVA 3ZLJA 1ZJ4A 1EX1A 2YOFA 3SBXA 4CDGA 1SGWA 2JH9A 4C0LA 2DTEA 2B8TA 2MMGA 4TPKA 3VJRA 2J08A 3B1ZA 5DXJA 3JD1A 5WRFA 3EY4A 4PG8A 4ARIA 1E4EA 1T9DA 3VPSA 5KVVA 4YJGA 3RRZA 2WTMA 1L2TA 1Y89A 1HEUA 3B5EA 4G56A 1ZISA 2PSSA 4CTJA 5JH7A 3L0OA 4NH4A 5H7XA 4F21A 3Q7TA 3AVQA 4I3FA 4ZI7F 4N54A 1QFMA 5B4TA 3LRXA 2OZKA 3I5UA 4H7EA 4IIVA 4DCUA 4EZEA 3KJQA 4WN9B 5E2IA 4D3SA 2XXBA 2WVAA 1UM9A 4IW3B 4OG2A 1V41E 4PSAA 1RHJA 1YZTA 3HJNA 3PQEA 2AR9A 2O3SA 3E9EA 4O2BA 1BW9B 4Q1EA 3FCAA 4F11A 1L7DA 3IJRA 4M7RA 1Y1TA 2IYAA 4BQPA 4PNEA 2E5LB 4GVXA 1J9EA 3K6SB 4D9EA 4KMMA 1BS9A 2WFLB 4HX5A 5FCDA 3E9QA 3PG5A 1U2GC 1W5SA 5F7OA 2RGDA 2PRJA 4G67A 1JU4A 1MO3A 1K7EB 2HA2A 3EDCA 5J2UA 1TT5A 3N5CA 4LZLA 4B44A 1J8FA 4WCDA 4IGIA 1VCHA 4R31A 4DFDA 2GO1A 1OW3B 2HLNA 3RLIA 1IOZA 3SG0A 1XPRA 3E27A 1W46A 2SKCA 3EIEA 3LRPA 1TO6A 4NJMA 4TKLA 3JQRA 1XJQA 4D02A 4DSUA 4LZWA 3QBVA 4KGZA 1ZVVA 4KREA 2GJ4A 4PV7A 1HTTA 2PZKA 4A0GA 4R4JA 2D1FA 3DA8A 4KQEA 5HMLA 2NZWA 3M6VA 1YQWA 4PBSA 4EQ6A 1E5TA 2AWOA 2GYWA 2MCFA 3T4PA 2P40A 2E82A 4HBZA 1QBKC 3GPBA 1T0UA 2R7KA 1N2JA 3JVUA 2RHRA 2WPDD 4RDCA 4ZWNA 2P3SA 2QHXA 1KDYA 5HF9A 3ZE7A 4DM4A 1RE1A 2F9FA 3KEGA 1BOOA 1KYZA 1RM4A 5F77A 4FFWA 1XROA 2JGDA 3HCAA 1Z26A 5FFFA 1ZA2A 3OSUA 1NM5C 1ZH8A 3WLPA 2DR0A 1TJ3A 1GPKA 4XVUA 4B7CA 3T61A 1T3ZA 1GUBA 1CTQA 1RI3A 1N2OA 1YQTA 5GTDA 5IANA 1W4ZA 2YXEA 2A1TS 3VNUA 2C9DA 3WMEA 4PAWA 1KR2A 1QYCA 3A6ZA 4O4LF 4PX5A 2BKUA 3KG2A 3T7EA 3FYUA 3MMNA 1Z18A 4ZARA 3KEMA 5IM4A 1EGAA 4INOA 3ZNPA 1KSGA 1VYTA 4I50F 2OV8A 4BO6A 3BIXA 2OCGA 1MO5A 2H00A 1JSLA 3BWVA 1XJ5A 2ZRJA 1G5HA 5L6MB 1AHHA 4C3VA 1U2TA 2EWMA 3F8WA 1GGVA 1YCHA 3KLNA 3M5WA 4RVFA 5CDFE 3K1AB 4F4DA 3HP1A 3KJFA 1JT2A 2V0CA 4KR0A 2GFQA 3N2GA 4J1TC 3VPXA 4R0VA 2WUFA 2HO5A 4X8MA 3VH1A 2ZIEA 4HXYA 1RKXA 2FQYA 4GH5A 3HB0A 3ND6A 3MT8A 1ODLA 1I0LA 2JCYA 3BIJA 1JT9A 3EA5A 1R6XA 1W9MA 3QXSA 5B5SA 2Q07A 3RS8A 3C8DA 2O8VA 1PQPA 5DTMA 1MGPA 1VYUA 3P26A 1KEKA 2PANA 1YC5A 2B1IA 4KZKA 3TLZA 4R9NA 1CC1S 1ZD3A 5BNIA 3F5MA 2A0YA 2DFKB 4GQAA 1PFYA 1IPFA 4XWAA 1A5BB 2I6SA 1Z13A 3DE0X 1RQGA 1YQDA 3DMYA 2PZLA 1FW8A 3I45A 5K2MA 1Q0PA 2Y1XA 3OZCA 5EERA 3T7AA 4Z3DA 4N65A 3BTOA 3W1VA 4HNAA 1M1ZA 2I4RA 3STTA 1M2OA 2ODTX 4IS3A 1S2DA 1JFLA 1PFVA 1SIWA 4LZNA 2FCRA 2X2EA 3U1VA 4GPD1 3SIRA 4LQLA 4WL0A 1L4HA 3R7NA 4EGAA 4BNDA 5BWNA 3VU1A 2FR0A 3ETHA 4F8YA 2BGIA 2H59A 3KOYA 4OXKA 2YFKA 3NAMA 4WXPA 1GQFA 1ESEA 1H8EA 4NHEA 1J97A 1XAJA 2GD0A 2XKJE 4QNRA 2F1RA 3FTFA 1PQUA 4OHPA 1PNOA 2HJHA 3FHJA 3KIPA 4N5IX 3NGMA 4MR9A 4URVR 4YRMA 4MMYB 5K05A 5EE5B 3VR6D 4L8GA 1RKBA 3I1YA 4WCVA 4G9BA 1GNSA 3L1HA 4GKVA 1I3LA 2DFNA 3EXFA 3HM9A 1ADBA 3LJKA 2YHSA 3DJYA 5A3JA 4N0QA 3WMGA 1IUOA 2AZTA 1ZUNB 1M0TA 4K6HA 4RTMA 1WDTA 3R5XA 4N18A 4CZ2A 2IYEA 1KH1A 3SC2B 1MBZA 2CL0X 2Z5GA 1LVHA 4OLJA 3NJ8A 2WFZA 1H4SA 1SCIA 4A5SA 1IDN1 3C7CB 3KPJA 4KXMA 2VRWA 4RORA 3NHZA 3VHLB 4EZBA 1MXFA 4EX7A 1Y6ZA 4UVEA 4CFYA 1E2KA 1Q19A 3TEFA 4AROA 1E79D 1Z74A 3EVZA 5JMTA 1KRXA 1W1WA 5G1NA 3ZH2A 4Q3DA 2AI2A 3Q2KA 3UV6A 4CM7A 1SG0A 4ZDJA 4Q3NA 4TUYF 3SF8B 3URKA 1KOFA 2H54A 3OT1A 1J99A 1ST2A 2P6NA 3LL4A 1AKWA 4M9CA 4MR8B 3TNYA 5GJVC 1QV7A 4CE6A 1EVKA 3TMKA 1GCAA 4ZTUB 2CLOB 5E3JA 2IYUA 3HCCA 3AFIA 1SQGA 4CKCA 3E7DA 1BCRA 1NQTA 4OK6A 1M74A 5HCUA 1ZRMA 3G7SA 5HJ2A 4UBMA 3PUYA 4Z8XA 5HRAA 4ZVVA 2P75A 2GA8A 4DB2A 2J3LA 1UM8A 4IDBA 1TJNA 2OCXA 4DV6B 4ZV9A 3AL2A 3L7YA 4OCZA 2IHTA 1Z47A 1K8YB 1ZRSA 2I5PO 1EK5A 3SYMA 1FU7A 1M2EA 4B3XA 3SZ3A 2J07A 2OHHA 4HTAA 4NYIR 4QUAA 3EC1A 4PZLA 3H05A 2BHSA 3CVOA 2OHVA 1MDBA 2IYLD 3TM5A 3IEUA 1QFZA 3BWMA 3V7NA 1J6UA 3JD0A 3MGKA 1P18A 4XD7D 5FYDA 5IH3A 3OOEA 5FUYA 2R79A 3AESB 2IWRA 3HEMA 1ZMTA 1GQSA 1VGQA 2D1YA 4EF4A 4BAGA 1AJEA 5JAZA 1SXJE 4M1YA 1X15A 3MQFA 4IAOA 4UVHA 3X2FA 5IPFA 4H1UA 4DJ5X 3KOZA 2G0TA 2V45A 2DY1A 3SQOA 5C8XA 1XLVA 4ALIA 4Z9YA 1PEKE 5IEJA 2FMTA 3GHHA 1I4DD 4YP6A 3CVWA 1NAIA 3IJPA 5BSRA 3AGQA 3K1YA 1RFGE 1EDZA 5CJ2A 5HKKD 2O1EA 4H59A 1DWUA 3BREA 5DH9A 3DMTC 4P82A 3BXOA 4N6GA 2DETA 4RIIA 2BMAA 4YFYA 3A31A 4II3A 4N76A 3U2QA 3DOCA 1L4LA 3C48A 3HCWA 1Y81A 2H2WA 2QLFA 3DS8A 3N7AA 4FCCA 4H7HA 1FMTA 5TMEA 1TU0A 1EFHA 2JH8A 2PX3A 3R0QA 2NAPA 2YNMD 3CN7A 4YALA 1TZMA 4JWTA 1TO1E 2C2KA 5EKSA 3D7KA 4AUKA 3BERA 2ORIA 1RWOA 2BI8A 2Q1WA 3HJUA 3PPIA 4QTYA 5BV7A 1AC5A 2I7TA 1EQAA 1J2UA 2GZHA 4JITA 4BNKA 1FMLA 4JP8A 3U19A 3BA6A 4EUNA 4UHDA 2WHYA 3MWEB 2WSBA 1ZC3A 3B2EA 3CZ5A 4ZXFA 2A14A 3VAZA 1JSZA 2BKLA 1DG1G 4JA2A 1NF2A 2IEYA 3AUTA 4ZT3A 2V3VA 3ABSB 3HABA 4BCBA 2BV3A 2AJDA 3ZDBA 3RUCA 2O2IA 4EL0A 3WYFA 1CUCA 2B5OA 3QELA 5BP7A 2XGJA 1FMFA 2PMKA 4IEFB 2JFFA 4FYJA 1KZ7B 1Z0FA 4MKHA 1IHDA 5L7YA 3OF3A 3QZUA 4M1KA 3QFTA 1M7GA 2RHTA 1MNQA 4MV6A 2FJPA 1JDJA 3OAAA 4U6QA 3H5NA 1BHQ1 1CUZA 4QYIA 3G2OA 3LVRE 5IKMA 2VNAA 1W1UA 4QODA 2XZOA 4JN6B 3DW3X 3ESXA 5JCOA 2NSDA 3QW2A 2AJLI 4CQMA 5LXTA 3D6NB 3ICPA 2JIQA 3GJ8A 3ZH9B 1BWSA 5HILA 2FDXA 3V3TA 4PAQA 3NC1C 1SPBS 1I01A 2I34A 1W5TA 1XI2A 3BHJA 3SXUA 3NWPA 3U09A 2QLMA 3FPFA 2ZJZA 3SE7A 4DHWA 1R6TA 3FOFC 5TQJA 1DJPA 2OFFA 4AJ2A 3TTTA 3OX2A 5KOJA 3MJRA 2CNWD 4FFLA 4ID3A 4TTQA 3T0GA 4DWOA 221PA 3TQFA 3N59A 3ESRA 1XMIA 4KH1A 1UPFA 1MG5A 4O6VA 2YVLA 1M2GA 4GRIA 1WV1A 1HF3A 3ELBA 4HBGA 5DGHA 3TKLA 3ADPA 1AUQA 2QX9A 1QB7A 5I9NA 1J1ZA 1WVIA 2BVNA 1E4EB 1L6IA 2Z9DA 4Q93A 3ZN2A 4AP9A 4BLOA 3KD3A 1MR3F 4YJGB 2C3OA 3X1ZA 3T8YA 3PDIA 2IOFK 4IOMA 4BRUA 2SCUA 1C4KA 2HPVA 2WIBA 4BLPA 2AFHB 5FBLB 2JHCA 5MFPA 3BXXA 3O75A 7AT1A 5KI6A 1KRHA 4M1OA 4HNHA 4Z86A 3VR6H 1VQ1A 1ATZA 3MTDA 2PTHA 1Z2DA 3OQVA 2ZRQA 1UM9B 3ZWAA 1GZDA 2CSXA 3WL8A 4RGBA 2HRRA 1NN3A 2A92A 5ILGA 2ZJ4A 4ALLA 3EVEA 3KHSA 1H65A 3AEKA 1SBTA 4TWIA 4D42A 1Y80A 1K6IA 3HFRA 4UNRA 4FIZA 4RH0A 3K0EA 1SCDA 3A1EA 4N7RA 1FFBA 3L1UA 1XVAA 3VSAA 4EP1A 1AD2A 2YCBA 2BJHA 5HM6A 5ALKA 3LYAA 3LDGA 3HCDA 4NWIA 1E2EA 3WP1B 2G5PA 4B6RA 2PKRA 4LY9A 1R5NA 5FPTA 2IV7A 2ZIWB 4P7GA 3TRJA 1ODSA 2JL1A 2WA2A 3PS9A 3OOWA 4AN1A 5CBPA 3VR4A 5A05A 4EY7A 5G1PA 4IJVA 1MENA 2TMGA 3U17A 4B6GA 4GR5A 5CHYA 2F17A 1FFEA 3KOUA 1H1TA 5FPPA 1UDCA 2QP9X 3CKYA 2R66A 2PMCA 1U7PA 1O7JA 4N3AA 3RH0A 2X7XA 3I1JA 1UKEA 3U7QA 3T1TA 1SIBE 2BONA 2BFPA 5KIAA 1FBTA 1RXYA 2C94A 1KAOA 2DWPA 3B7PA 4OSEA 1HMYA 3Q2OA 4PZDA 4Y6SA 4EQ6B 2F3RA 1EA7A 2H48A 2LE0A 3T4XA 4BC0A 5A4IS 1ISHA 2I6FA 1XOIA 2X8JA 1CEYA 1H94A 1P1IA 1XD8A 4FSHA 4DY6A 3HB7A 4HAIA 4QJBA 5ICMA 4QM7A 4W8OA 2FWMX 4D9GA 3ZD8A 2FR8C 4RD2A 1NMQA 4KH0A 1N5LA 1E5DA 2EYQA 3K20A 2JGDB 4MUXA 1QCCA 3HB4X 2PAAA 3S8MA 3VV2A 1T5HX 2HC9A 3W8EA 1HL3A 5FTWA 3LO5A 4RULA 2BDTA 1W93A 4FQ7A 1SRQA 2RK6A 2CNDA 4OAOA 4PHTA 3SDBA 3ASZA 3SMVA 1ECCA 4CV2A 4RS3A 4C7OB 2AYZA 4BN0A 2B1JA 2JGLA 1NBOA 1ODKA 1WUJS 3KOXA 4FNAA 5JVDA 5KSYA 2I03A 3FYUB 4N7MA 1TM5E 2OAEA 1X7YA 3KBBA 1V7QA 3BB3A 4MIOA 4MGKR 2BCGY 4PRYA 3O4GA 1N57A 3ODGA 3WL5A 5ITZA 1VI5A 2GKOA 2X1MA 1ENOA 2C4UA 1TRKA 1Y48E 1WCXA 3KAQA 4PIMA 4NFLA 2CKDA 1U04A 3N2YA 3G0OA 1L5KA 3G17A 3NBKA 3E5HA 2CD7A 5TPZA 2BLNA 3B12A 4WGGA 1UBEA 1R15A 4UCFA 1MV8A 3F6BX 3LIIA 1CDOA 1HO3A 3BRQA 1D2CA 1QG6A 2EJCA 1JTEA 2IZ0A 2YV3A 3N53A 4G4IA 3TK1A 4B31A 1XTZA 1OV4A 5JSZB 5CFNA 1ISMA 1Y1QA 1T6NA 3QNWA 4J4BA 4YTEA 5HTKA 2Z8ZA 4AG5A 1KEEA 1ZJWA 5JY1A 1JDNA 1PNTA 2AVNA 3KU4A 4M7PA 5AM1A 1DADA 4XM0A 4C4SA 2O5VA 3KYCB 2HK6A 5F76A 2C97A 1UEIA 3JAWB 2GASA 3QK7A 1E6MA 1PR0A 2WJPA 4HUQA 5REQA 4EMTA 1ZQ9A 3C3WA 2AC7A 3IPLA 4IDOA 4PAGA 4RBNA 1VHLA 4HDOB 2WTXA 2EQ5A 1M2OB 2EKDA 2FW7A 2OQIA 1UZUA 2BUCA 4MO2A 2NU8B 1ID1A 4X7RA 3GLQA 2ZE5A 1HE5A 3CVJA 3WB1A 5AUPB 2X8WA 1ML3A 2UUOA 4CM4A 2V9PA 3R3ZA 1ACJA 2ZSIA 3NEJA 8ATCA 4DV2B 2BGJA 2UYQA 1X7HA 3BHMA 4OXYA 4HVLA 1BVRA 1VIYA 1NXXA 5B6PA 1E9AA 1YOVA 5IDYA 2JA2A 8GPBA 1ABBA 2XWJI 4QOSA 1DQRA 4YAEA 1ZICA 3AUYA 4N0MA 3QVMA 3K4PA 4J6EA 1Y7IA 2D4AA 1RI1A 2QL6A 2AL7A 3IAS1 2XNJA 2RH4A 1FUIA 1M5TA 5IKOA 1SZCA 4N03A 3I12A 2WAXA 3T5PA 3VPCA 4RMNA 3WDLA 5H5JA 5L40A 2B1QA 2CB0A 3LCVB 3SR4A 3EPJA 5EPEA 4Q02A 4LYYA 1BQEA 4MPPA 1XQWA 1L5WA 1V1MA 1WF6A 1ORVA 2PS9A 3NAZA 3RTBA 5DE3A 2V6JA 3M6FA 1XDGA 3IQEA 3WVNA 1NMYA 1QJ4A 5IAGA 4HO1X 5IMBA 3Q5DA 3A25A 3NI2A 3OT1B 4IGFA 1G3QA 4OHCA 4M83A 4FYXA 4QPZA 2WU3A 2X0IA 5FOWA 1E1RD 2PRSA 2NTEA 1VMDA 1XEXA 5C8YF 4G8CA 4J0DA 1JG1A 3SSAA 1H2YA 1NWCA 2V7QD 3DKIA 2YRXA 3QNMA 5JAUA 5JZVA 3CRMA 1QM5A 4ZHQF 1Q22A 1FLAA 1B0UA 1RCFA 1Z62A 3GJ5A 1IATA 3R7SA 4ETMA 3KKOA 2C61A 2R6CA 2CDCA 2XMZA 2AD5A 5CXUA 3B6JA 4ZREA 2HX1A 1EEHA 1NOIA 1PFGA 3OIYA 4M2LA 3VU9A 1E3WA 1VE3A 1VL8A 3PV0A 3Q85A 2P77A 5GONB 1A27A 1FXWF 5CDTA 2F3TA 1ZNZA 1U2SA 3OU6A 4I8DA 1E2NA 4MTCA 4EELA 8ADHA 3RVNA 4LXXA 4O4HF 2QZZA 2XYRA 3UFBA 4CKWA 3ND9A 1QORA 2G9VA 3SS9X 4BQNA 1PEYA 1HEIA 4DBZA 4EI8A 1E9BA 5HW0A 4QDJA 3GEGA 4E12A 3QVLA 4F97A 1L4NA 3FZYA 2D7CA 1H0SA 4HQOA 2FKNA 1Y5NA 1TAGA 1X92A 3VI4B 1Z06A 2BZ0A 4X00A 4M8NE 1K1EA 5JS8A 1W49A 3FFTA 3H4VA 4HH3C 5ALQA 1JPJA 5L9AA 2FCAA 4CGYA 1YVUA 5T3YA 3RVLA 2X3UA 3ET5A 1RLOA 1SXHA 3AJDA 4IQGA 2QPAA 4KXQA 4BQQA 1KZ1A 2CCJA 1ZBQA 2IJGX 2ZI5A 4TXHA 2PRIA 5LYJA 3F3KA 4W6ZA 3G2NA 1CF4A 3RVPA 4XJSA 3QIVA 1I2AA 2VF5X 4P4SA 2XA9A 3WB9A 4MUNA 1AGRA 1O57A 1AOXA 1TPZA 2FB9A 2Z30A 4Y1RB 1VYVA 4Q03A 5A9SA 2J59A 2BBWA 3M4ZA 4IHJF 1QR2A 1R6AA 2CVFA 3GEBA 1ECJA 3WQQA 2X2PA 1MGOA 1PX0A 1AKMA 5ERGB 2ST1A 4FN4A 4ZVRA 3WNZA 4X1KB 4MAFA 3SQMA 5I8WA 1S89A 2RGCA 4Q48A 1HV8A 3V9AA 4Z4FA 5ICCA 1IONA 1HLDA 5LIPA 1H0HA 2CFOA 4UDNA 4CI0B 2OYRA 3QELB 2JLYA 1NI3A 5DKFA 2JLAA 3IPCA 4CYMA 2RGWA 1KR5A 1HE2A 3WJ2A 3KPUA 4JI4B 3PT9A 5FORA 2B3DA 4B33A 1IC6A 1HNXB 2JRCA 5AW1A 3E05A 4N41A 3P4XA 3D81A 2YHUA 1D8TA 2IYQA 2W98A 2YHIA 3LX6A 2OKCA 4QYIB 3ZVMA 2CNOA 3G88A 4QQNA 4NBSA 2BEWA 4N5LA 4CQMB 4FXOA 2D7DA 1E18A 4DQXA 1T3HA 2QP4A 2EP8A 1TE2A 1UK6A 1HZZC 4WZAE 1TUGA 4DLLA 3OJ0A 5BV0A 1KIMA 5IM5A 1AKYA 1QIHA 4NNPA 4B79A 4NE7A 5JARA 3S4YA 2D0DA 2HQ1A 1YJ8A 3OIWA 4AZ3B 1VCMA 4MUYA 4DCTA 2VT7A 4JKIA 5ELLA 4L6IA 4DM3A 1S4QA 1ZX1A 2GHIA 1A50B 4MVYA 5AOCA 1RZRD 3A1VA 3GGDA 4JFRA 4XZ3A 3B8HA 1ZGBA 4EJ2A 5J2TA 5DWDA 3ONDA 2QR5A 3PD0A 4EGSA 1T2NA 1S2OA 2GVDC 1Y1SA 2ZSEA 4BX8A 4QLBA 2YWBA 2VAPA 1XZFA 2CLFB 3VR0A 4YRZA 3PUZA 1NNLA 2CL6X 2WIJA 2PT5A 3KSRA 2JGIA 3NC4A 4QNNA 5DF1A 3ZGLA 4CL2A 5JROA 3KUCA 4YCCA 2GSWA 3C70A 8OHMA 4KQGA 1G4HA 2RHCA 2AZMA 2WSYB 3MMPA 4OHUA 2GHRA 3PNBA 2SCUB 4HYYA 5GOTA 5GJBA 1VKHA 1A2KC 1RMTA 4ZVSA 4HD8A 4MQ4A 3RABA 3UA4A 4V38A 2Z1MA 1HYGA 4GP6A 4TKZA 3M81A 1QIFA 3R23A 2R4TA 4MV5A 2Z58A 3DOOA 4FGSA 4Z54A 4RCYA 4XR4A 1QNLA 2IU0A 3WWCA 2V1XA 1CJTC 2WTNA 2XUKA 3E7FA 3ZGOA 5AVXA 4B4KA 4HSGA 1C14A 3FAKA 3WHPA 2QI9C 1D4OA 1XZAA 4JUCA 1E0KA 4Y6GB 1ISSA 4TWBA 1ZUIA 2JA1A 3AEKB 3H8VA 4LHVA 3NH6A 4KIJA 1AU9A 5FKJA 3RI3A 3EQ9A 1KMHB 2CUZA 1VLLA 3EGWA 4N47A 3I2HA 3B6EA 1TA0A 1XRQA 3SIXA 1U9JA 3HDGA 4K9QA 1DL5A 4L3VA 2HXSA 3CCFA 3OZVA 4YRBA 5BURA 1J20A 3B78A 3N0TA 4LDAA 4WSOA 5EIBD 3S3TA 3ZE1B 3P2OA 3CLTC 4M9UA 5IT9A 1PJ2A 4JLKA 4KQFA 1NIPA 2V6BA 4HQRA 2Q62A 3VR2A 2IUUA 5K6RA 2Z9CA 5H9VA 1E98A 3I8OA 2J6CA 2JCBA 1TJPB 2QE6A 5CT5A 4ZU3A 3WL6A 2VWHA 5C7YA 1N6RA 5HKAA 5KINB 1HSOA 2A4MA 2FWNA 2XODA 5CT8A 3O4FA 5JSQA 1QP4A 5FNVB 1TJ5A 3RHZA 5B7GA 2V6GA 1G6KA 1NSYA 2QU7A 3DV2A 3RAJA 4X7PA 5J3JA 3O4JA 3U7QB 4C6TA 1GYRA 4H4DA 5DBEX 5JCJD 1P1CA 4R9UC 5EJAA 4ZZ0A 3K9QO 4J7AA 3AEQB 4Q3AA 4XFJA 7ABPA 3LW8A 3SFTA 4F2DA 2H65A 2A33A 2ODNA 1FP6A 5GINE 3GRFA 4RKQA 3GAFA 1AV7A 2MYNA 1YJ5A 3CTMA 2HYDA 3R5TA 3AHGA 4GRDA 4DR4B 3CR7A 8ABPA 3R5SA 4Y2GA 3NS7A 1SCQA 4TVSA 5B58C 2QTLA 1ZAYA 2PRKA 1WDWB 1B76A 1Z5VA 4GKAA 4WACA 2VDPB 2O8BB 2VPIA 2QZPA 2ODQA 3JQDA 2A67A 3FYTA 4AX8A 3VNQA 1VLHA 3UHAA 3CKMA 5JVDB 4ALNA 4W5JA 2YFYA 4L8LA 1PJZA 3A8TA 1X7YB 5K6AA 4KQWA 4ZRMA 4EA6A 4Y0NA 3HV2A 5ITZB 2VBFA 4OFZA 4JI6B 4RESA 3ITEA 1OFTA 1K4YA 1HDYA 1YCDA 1GV0A 3VPBA 1KPGA 3QITA 4ID9A 4RM2A 4XB2A 4E08A 3T5TA 2CCGA 3G7NA 2ICAA 1KK2A 3O8BA 5B53A 4G85A 3H2GA 5I4KA 1I4WA 1NNUA 4B3DA 2I76A 3B51X 2P0EA 3C6MA 2Z2IA 3OY7A 3BE4A 4PC1A 1U2QA 4DR2B 3L6DA 4BASA 3NP9A 1MRNA 1EBUA 1MU0A 1KEEB 2IS6A 1HT1E 1N6OA 2BEUB 1CJCA 2TMDA 4KPYA 3ZBPA 2K6GA 2QW8A 2R97A 3PHGA 2QRKA 4RHUA 4YV2A 2CWWA 2G82A 5KSOA 3Q3HA 9MHTA 3GRUA 1GP2A 4YWJA 2C7OA 5FTNA 1XC7A 5REQB 4DV3B 1EXNA 3W78A 5G2OA 1YJCA 1Y6RA 4QGSA 2FZ4A 2ENUA 2WJYA 2P9JA 4JOQA 1GWNA 2HSWA 4PNZA 3TLEA 5A0FA 1PL6A 3KOWA 3N3BC 4QJ4A 2CY0A 4CM4B 5I47A 5IUNC 2KM1A 4J4HA 3KTDA 2QEQA 2Q3MA 4MGZR 3DO8A 5CDYA 1UDAA 3HKDA 1W59A 1YQ9A 3CCCA 1J33A 3QX8A 3I8XA 1YOVB 2OGUA 3FPLA 4V02A 5DHTA 3AQIA 1CUEA 1HFEL 3OEHA 5HEKA 4F4HA 2HADA 1J70A 1Q3HA 3NRCA 4NHOA 3G23A 4OIFA 4XGNA 1XUOA 2BMEA 1ZNYA 3L93A 3UB2A 1BXGA 1T4DA 3MJSA 2Z1DA 3OJWA 1FDIA 4X60A 4OIMA 1SWWA 2GNPA 3MJDA 3WLHA 1N6PA 4KBGA 3BX1A 1D2RA 1TCBA 4NRDA 2WILA 4RY0A 5I3CA 1NATA 4LRWA 5ALYA 2HSZA 2OUKA 2XNHA 3T4EA 4U2CA 4AUMA 1YBFA 2AUMA 1Z5PA 3C7DB 2H3EA 4TMYA 4LDZA 2XQJA 3PIDA 4CM3A 2E1RA 1YIDA 4HGQA 4JJGA 4KPUA 4WXMA 4XJVA 2OBFA 1QP0A 5BUZA 2CF5A 3RC8A 1LJLA 3EGVA 4TRJA 4JVSB 3R3VA 4OB8A 3L02A 3T1NA 3W2EA 3SFZA 1E4VA 5EJEA 2R6GA 3IDOA 1U2GA 1USGA 4H7FA 3KVVA 2Q5LA 4I1YA 5DP2A 1A4IA 4EY8A 5ALVA 3MJHA 1G55A 2PY6A 3PHBE 4EPRA 2ZM5A 2YUTA 5A3VA 1QS0A 1ZJ5A 1NVDA 4LC9A 1ST3A 1QNFA 1XYVA 4L85A 5HS6A 5BPFA 2OECA 3I34X 3ROFA 2OCPA 2G5CA 2I6TA 5F9HA 2IZ5A 3GJTA 2Q9BA 2ECOA 3EHEA 1E1YA 3H1BA 4FZRA 4J1SA 5AI6A 3HGMA 2JI8A 3RSGA 2YWRA 2CT8A 2CEAA 5KSZA 1CQWA 1NT2A 3S27A 4B4OA 1E3WB 1ML4A 1RJGA 4UTXA 2BKVA 4OSPA 1NMSA 3KDPA 1RHQA 4PE5B 3RBAA 3ZCRA 2OCYC 2P2ZA 2Q6IA 3B2NA 4YP9A