1Y7LA

O-acetylserine sulfhydrylase complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-acetylserine sulfhydrylase
publication title The active site of O-acetylserine sulfhydrylase is the anchor point for bienzyme complex formation with serine acetyltransferase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 113
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7lA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7lA02
2PQMA 5CVCA 5IXJA 1KFBB 2CLHB 3CEPB 4JBNA 2Q3DA 4D99A 1CW2B 4L27A 5I7OA 4LMBA 2ISQA 4HPXB 4IL5A 2TYSB 1C9DB 2ECOA 3IQHX 4D8WA 5D85A 4HN4B 1K7EB 3VBEA 1TDJA 4D9KA 2ZR8A 5D84A 3VC3A 1O58A 1WTCA 1BEUB 2RKBA 2J9YB 3PR2B 2V03A 5B3AA 4D92A 1A5AB 1F2DA 3HMKA 3TBHA 4D9IA 2TRSB 2O2EA 1TTQB 4LI3X 1K8YB 2DH5A 1J0EA 4KKXB 3AEXA 2BHTA 2CLEB 4D9EA 4AECA 5JJCA 1WDWB 2ZSJA 2WSYB 1TTPB 3VSDA 1Z7YA 4D8TA 5KINB 5E0KB 1PWHA 1UBSB 5EY5B 3SS7X 5I6DA 1V7CA 1K3UB 1UIMA 5D86A 3L6BA 5DBHX 3VSAA 1TJPB 2O2JA 2TSYB 5B1IA 5I7AA 4D9FA 4L3VA 4L0DA 3SPXA 5KZMB 4HPJB 3X44A 3FGPA 4HT3B 3PC4A 2Q3CA 4PCUA 2Q3BA 3IAUA 1CX9B 5T6MA 2BHSA 3DWIA 5D87A 3L6RA 5J5VA 2GN1A 1QOQB 4LMAA 1PWEA 1V71A 2C2BA 1KFEB 1E5XA 4QYSA 1J0AA 2CLOB 4D96A 5IWCA 4D9CA 3X43A 3BM5A 4F4FA 4ZU1X 1Z7WA 1A5BB 4D8UA 5I7WA 2J9ZB 1OASA 1TZ2A 1FUYB 5I7RA 1C29B 2C2GA 5CGQB 1M54A 1VE5A 3SS9X 5DBEX 1A5SB 2J9XB 4D9MA 4D9NA 3R0XA 1J0BA 5HBGA 1WKVA 3FCAA 4JBLA 1C8VB 4HO1X 1K7FB 1JBQA 1UINA 2CLKB 1FCJA 5DW0A 4D9BA 5B55A 5BW6B 5I7HA 1K7XB 4I1YA 1TYZA 4NEGA 1J0CA 5B53A 1WBJB 5DW3A 1A50B 2JC3A 4NU8X 3RR2A 4OREX 3PC2A 1VE1A 1RQXA 2ZPUA 4ZQCB 3AEYA 1KFCB 1K8XB 1P5JA 1X1QA 4ZU6X 3ZEIA 1TZJA 1D6SA 2CLFB 5DVZA 1BKSB 4XUGB 3VSCA 4AIRA 2RHGB 1KL7A 2GN0A 5IW8A 3IQIX 2ECQA 3PC3A 4WX2B 4COOA 1TZKA 2CLIB 1VB3A 4OFXA 3IQGX 2GN2A 1Y7LA 5JISA 3L6CA 3T4PA 3V7NA 1KFKB 1QOPB 4Y6GB 1K8ZB 2D1FA 2CLMB 2RH9B 3DKIA 2CLLB 3R0ZA 4H27A 5J43A 5B1HA 1TZMA 1V8ZA 5C3UA 4D9GA 3DWGA 4L28A 2DH6A 1KFJB 1J0DA 5B36A 2EGUA 2EFYA 4D97A
chains in the Genus database with same CATH superfamily
1BGXT 2FPKA 4J0DA 1L0BA 2VO1A 1OTHA 4IBOA 4L8YA 5A05A 2WWVD 1CERA 3MJFA 4AP5A 2L69A 5IJ9A 1WXIA 2E3JA 1ISJA 4LV6A 1EVJA 5H7XA 1DC4A 2W93A 5DLEA 1Q50A 3CW8X 5BRNA 4FFPA 1K2WA 2L0XA 5CW1A 2FPIA 1CTQA 2CMKA 3THRA 2PUGA 4ETIA 4GU5A 1RJWA 3EYAA 4DNQA 1T8TA 1J8YF 3GOHA 1L5HA 2PMBA 1TM7E 2F67A 3CKKA 2PJZA 2V03A 3BN3A 3M4NA 5JLAA 2C2KA 2WUEA 4B3CA 3ZS9A 2OECA 1RQGA 2J30A 2ZI7A 1I6WA 1FBTA 5JH7A 4AD8A 2JBWA 4GOLD 4DC0A 1FNBA 3UAYA 3HKDA 3VSBA 3NDJA 3VR2D 3QPWA 4DZRA 4JNCA 2WYUA 4IIEA 3CNEA 2JAWA 2O0LA 4R01A 3EMDA 5IXSA 3KU4A 1IVSA 2R84A 1WWKA 2WJ4A 3T9AA 2P90A 2UUCB 1DXHA 3WRWA 4M53A 3T3HA 2P2NA 5INTA 2FW8A 1VIVA 2J3KA 3A4IA 3PDHA 521PA 2PX8A 2WTUA 3BA6A 3BWCA 3FWNA 4RY2A 4E5UA 4YMIA 2TMGA 3A4VA 4Y6PA 4YHBA 4BNDA 4PHCA 4CMEA 4F60A 3FDJA 4HNSA 4CV3A 3CNOA 5AKGA 3BULA 5AW6A 3UJ8A 1BD4A 4ND8B 4D74A 1JZQA 2CNDA 1Z3IX 3S29A 2IH5A 1PUIA 1NZFA 1EX6A 3FZNA 3O26A 1PZHA 2GD1O 1X80A 2X2EA 5T41A 1NYQA 1XL0A 3H7IA 4M22A 5B58C 4G1VA 3NGLA 5LMCA 4KCGA 1HETA 1QCYA 1QH1B 2XNCA 4UAGA 1PZXA 1OLUB 1UXJA 4TVSA 2MSKA 1JN0A 1GZSA 3GQVA 2B8WA 3WISA 5C52B 3ECSA 4X1YA 1RAGA 5I9LA 3SQWA 2O2YA 2GBGA 4YP6A 4ITUA 4RZIA 3VPAA 1DAIA 1VKNA 3D6VA 3T3MB 1K66A 1W9HA 1RC0A 2WA2A 1XNRB 1KKMA 1NKTA 4XWWA 1Q22A 2AXPA 3DC7A 5DN6A 2BEUB 3H42B 5FV7A 3UJ9A 4Y2HA 4YUAA 4Z9YA 3D8UA 3DOOA 3TQRA 2CBZA 3QGMA 3GF4A 2GBFA 2Y1DA 3N3AC 3TRJA 4HEQA 1JXMA 1BSVA 4OREX 5AJHA 2WF8A 1JR3A 4KMMA 2HJVA 4E15A 4IIJA 4L4YA 5FLEX 1KOLA 1YQ9A 1XD8A 4TQAA 3OCWA 4B6GA 4YQZA 3SKVA 1U7XA 2WJWA 4R0VA 1VPWA 4G1UC 4Q19A 2V6IA 4CCYA 3R5FA 1QHHB 1Y5MA 4NAHA 4J16A 3I72A 2C42A 1RLMA 1XSEA 1T6YA 1RD4A 1ZEMA 2VL7A 4PLWA 4D3XA 1QVVA 3NC1C 3GA5A 4YV7A 2ZUCA 1S01A 4GMGA 4R6WA 4AWBA 3KQVA 1IRIA 1LBSA 2YNMC 1ZNXA 3NTVA 4L28A 3UMCA 1DLIA 2CUNA 4LUCA 1VSBA 3TM5A 4MOWA 2RJNA 4YO7A 4B2IA 2PX6A 4I4TF 3LG2A 3TCKA 1XJCA 3ULKA 5KEIA 3GL9A 5TDHA 3IKLA 1XMPA 3QVTA 4XKJA 2J85A 4JI2B 1ZQ1A 1RAAA 1K6IA 3MG9A 2EATA 2QZJA 1ZDMA 1XKXA 1FW8A 1LCIA 1OR8A 1O6CA 4BCDA 1X86B 1K7EB 3NX4A 3P0HA 1PYGA 2FOXA 4DLYA 4IOLA 4NQZA 3ONNA 3AMVA 3CRW1 5CFLA 1N9GB 4LGMA 4XWAA 2VQFB 1SXPA 1OH5A 2YJTD 4BMVA 3H16A 1P31A 3WI7A 5GJBA 4K0KB 1M8PA 2Z6QA 4BKMA 2Y6VA 1M2KA 5E4JA 4LK3A 1LBIA 5D51S 1FRQA 1M3SA 1QCCA 3HDTA 2PUEA 1HWYA 4FJ1A 5LN1A 2R8PA 1YF3A 3SP1A 3FROA 4F72A 1SD1A 3KT6A 4WCDA 5CB0A 3AW8A 2VAVA 3LI2A 1CRQA 4LMRA 4KQJA 1PWHA 2C58A 3PX2A 4CR8A 5EY5B 2P4HX 4I0WB 1SVUA 1BXRB 3GW8A 2I7CA 3NBZC 1EB8A 3QELA 5F1KA 4G0OA 5H81A 5HK8A 4JI8B 4P54A 2NZWA 1EVYA 4PCVA 3EIXA 3KOXA 2JGIA 1GTZA 1TXGA 2EC5A 4IILA 4U2EA 4Q34A 1A4IA 3RVKA 2Z2YA 1WPGA 2AI2A 2OQVA 4FGLA 4CIYA 4E4TA 5AH0A 3UPUA 1MG0A 4MWSA 1RXCA 3E7DA 2QLLA 5SZIA 3SE7A 3IL2A 1GPDG 2BAGA 3KL2A 3P9XA 1C3OB 1R8SA 1ICIA 2VHVA 4R9UC 4CLHA 4K7JA 1Z56C 2UYGA 3D31A 3NRJA 4IKEA 5DNEA 5AKKA 3WSWA 5IHPA 3MMXA 3C3JA 2HMSA 5BY2A 2QD4A 2FR0A 2HYDA 3E2PA 4O63O 5K3BA 3EX7C 1H0SA 3SYMA 4ZDWA 4C6RA 4ZEXA 1BXGA 3PTLA 2AI1A 4Q5IA 2CHVA 3OQJA 5FPHA 4PGHA 1Y80A 1FXUA 2QPTA 4C4AA 1JAXA 1I3KA 1WX1A 2R8BA 4EHNA 3TLXA 4R7ZA 1M54A 2XVAA 3CBGA 2IHVA 3C1UA 2HYIC 3CVJA 1A5SB 1C30B 3PHGA 2C4HA 3PPIA 5L6LB 4IUDS 1G0OA 4LN1A 3E27A 4TS4A 3WHPA 2NXEA 1X7WB 4JUFA 4EGJA 5HBRA 3HCOA 4ABYA 5ESRA 5FA8A 2BZ1A 5JRDS 5FPPA 2XZLA 4V2IA 4GLJA 1G64A 1BDHA 4QYIB 1U1DA 4I5GA 4MI1A 4HLUC 2EBHX 3QBVA 4MVJF 4ZO9A 5HTKA 4QTZA 2J3HA 3UANA 1L2TA 5BSGA 2CEAA 2QUBA 3W79A 3HYRA 2X3FA 1WW8A 2ZBQA 4C0BA 1TVEA 4YAGA 3PVCA 2DHRA 3OOSA 5JMOA 3UMYA 2XGSA 3NVAA 2ATEA 1AIPA 1IN8A 1I9GA 3KR9A 3O3OB 2V0NA 2J6CA 4J76A 5KYUA 2BGWA 2A1UA 3IQGX 5TGDA 4DKXA 4R31A 3GMDA 1H1DA 2RIRA 1G9SA 1XT6A 1WUHS 3GGCA 4LQDA 3S6JA 4D6XA 1EVEA 1EJ0A 4CCSA 3B6MA 1E2BA 2CNWA 4BEBA 3DWGA 1A2KC 4HLNA 1W49A 1JQKA 1QG2A 1LFAA 1EDBA 3IULA 1E9BA 1OWMA 2VYQA 4TSFD 4NYIQ 1YJBA 1Z7BA 3RD5A 5BQXA 2JFPA 1M10A 2O2HA 5CVCA 1PLLA 1PSDA 3B82A 4Q4CA 3SSOA 5DFAA 1WB9A 1OLXA 3DFKA 5AICA 1RWXA 4I50A 5I7OA 1JQDA 3FKQA 5EEGA 4ZKEA 3ADBA 5JAIA 3KVNA 3TE7A 2EU8A 4TWIA 1UL1X 3KTAA 4DCUA 3RADC 2PKWA 3WJ7A 1XZPA 2V9PA 4TT8A 4M83A 3D5QA 3GHYA 3K0AA 3L92A 4EKDA 1NXOA 1XTPA 3P9QA 3WB2A 4JOSA 1OCEA 3DP9A 1NWCA 4ZT3A 3OE7A 2GEVA 5FCDA 3I3OA 2JRLA 4G36A 4RJLA 4P3PA 3ZU5A 1CY4A 3OO0A 3LQRA 3CLRC 1EHIA 1EHYA 2ID4A 3HEBA 4JFRA 4JVOA 1QNLA 4WKBA 4WLEA 3WLNA 5IJ9B 4D6YA 2ISCA 2QYTA 2V6BA 4R1MA 4A2QA 2I6UA 2IEAA 2Y1LA 4B33A 1HURA 1Y37A 2QX6A 1MVOA 2FRDC 3L8FA 5D1HA 2FPIB 3DEYX 3ANXA 3ZQ6A 3I4CA 2XRFA 2PEYA 1OAOC 1H93A 2PKYX 2BEJA 4RLHA 3LKBA 2C9DA 1I7SB 5I7AA 3WLHA 2HPVA 3JSAA 2HMUA 3O8QB 2HL6A 1YTLA 1HE2A 4G1FA 2VBFA 1OKKD 1UKAA 1RWMA 1AU9A 2FE4A 3EDOA 3GRFA 2NPIA 3D6JA 1G18A 2C3UA 2Q3CA 3BILA 3PUXA 4JMLA 3T6KA 1YMVA 5KKAA 4KR7A 2X76A 5CT9A 1BH6A 1JPVA 1AKTA 5ICFA 1FJ2A 5HA5A 1ZK3A 1E6EA 4LMAA 1YKSA 4DG5A 1O94C 1F51E 3V42A 2OXCA 4P9NA 1YA6A 3CCFA 2OT3B 2XNSA 5CB8A 2QE7D 2H5LA 1Z34A 3PXUA 2JLZA 3T5TA 1OXBB 2GESA 2JGAA 1FRFS 4NCXA 1B4DA 3O9VA 5E7IA 4Y2GA 5EIOA 2AZ4A 3U3MA 1TYAE 2M1XA 2NSDA 4PZUA 5IP5A 2ZE6A 3PTZA 1A5BB 3WQRA 4TYMA 4W8GA 1FFAA 2GVZC 2JEZA 4CM3A 2PMDA 3O31A 1AG9A 2JVIA 4P7BA 1NQVA 1MW8X 4U8HA 3BMOB 1JTVA 1R16A 3VTKA 1NBEA 8GPBA 3O1IC 3I53A 4Q00A 5CXQA 3E4CA 2Y76A 3DD5A 4RFLA 4JODA 1NI4B 3H4MA 4N49A 4ZQHA 2EFDB 4X1OA 5BMVF 1FQOA 1JSCA 1SRRA 2FLKA 2XQJA 2Z8YA 3M6WA 4KDRA 4PQFA 5DT2A 4EL5A 3TL3A 1FU4A 3N28A 1S3IA 3HP7A 4KWHA 2QL9A 4ALLA 1Q0HA 3AR6A 4WOBA 2RONA 1AXGA 3TLBA 3B6IA 3GWGA 1ZXBA 4I5FA 5M04A 1AQJA 1L4GA 3RWBA 3TUZC 4X1YB 5KNBH 1XMXA 3IP6A 2OG1A 1EG7A 3MUEA 4L0QA 2XMZA 2OYRA 1Y8ZA 3SZLA 1KMHA 3HDQA 2XKKA 3DZ8A 1GAEO 2Q3JA 1VDZA 3S1LA 3U3OA 3NWPA 1CUGA 4XD2A 1JSXA 4DIDA 4PR3A 4R0NA 1R4MA 5AK6A 3RJZA 3N9IA 3AZOA 1ZD2P 4BJ5A 5ARBA 2BVNA 3PNOA 3QF7A 4GQIA 1WZNA 3BRWA 1ZW6A 4JR2A 2CE7A 4YT8A 1P91A 4FI3C 2ANCA 4IZHA 1OYVA 3GJQA 3FSJX 2GI4A 1SK9A 1FTGA 4FDMA 5LXTF 4EGCB 4MPPA 3EXEA 4NJEB 1TM5E 1DKRA 4FGZA 1TA0A 3O92A 3PENA 1DCFA 5DBGA 3FVQA 3R7DA 1NMXA 3UQZA 1ZX1A 3NYRA 4D2IA 2VP9A 1X94A 1Q19A 5CYFA 5CFRA 2UU9B 4YGYA 4BWVA 5HCUA 3ME5A 3LC2O 3Q4GA 2XBLA 1RDFA 4FFSA 4K05A 1HF3A 4LDJA 3BGIA 1EGVB 2EARA 1AQNA 2IQIA 1MGOA 2YXBA 3P9RA 1TK3A 3PGJA 4AM8A 4AY3A 5AM2A 3KJXA 3UG6A 4C5CA 3QE9Y 1P77A 1LV7A 2I4RA 4QGFA 3DAGA 3UZUA 3KT3A 3VKVA 4YDQA 3WTCA 5CMLA 5ES3A 4ZCLA 3MF4A 4KH1A 3L4BA 4BFSA 5KREA 3F6CA 1E18A 3IUMA 4ZAFA 1D1QA 3EPHA 4MW6A 5FI1B 3DQPA 4ZREA 4ZEVA 3LECA 2O8FA 2DR3A 2CK3D 4C20A 1WZ2A 4J4BA 1QANA 1QYRA 5AQEA 2A35A 4I8XA 4WAUA 3RC9A 3KPVA 3D3QA 3N8DA 1IZ8A 4YAIA 4DL9A 3I5YA 1NBAA 3CISA 4HUJA 4ZVQA 2VCEA 3ML1A 1NTOA 1SXJB 3MD9A 1NONA 2DKFA 1QK3A 3HBNA 4JKYA 1ECFA 3EVGA 5ARCA 3QXJA 3EVDA 2W43A 1WQ1R 3SYRA 2ZWMA 4XYGA 3SAJA 1JIIA 4BXOA 4TWAA 2N0SA 5HJ7A 2VQSA 4K86A 2W37A 1CDOA 1XFDA 5CB6A 2E37A 5H9WA 4OQXA 1O87A 1G5QA 1ORIA 1V8OA 3HLTA 2GILA 4GR9A 5CCDA 1FC0A 3KUDA 5J5VA 1W581 2ZTUA 4Y2VA 1QRTA 1ZSNA 3EDCA 4OJQA 2ZB7A 4R5MA 3RUDA 4BNUA 4F56A 3QELB 4Y9SA 2CSUA 1UOPA 1NRXA 3QFRA 1KJYA 2HWXA 1CJKC 2FEKA 2OCPA 3CR3C 4NL4H 4O4LB 2EQAA 5AUNB 4YFYA 2VYCA 1GKIA 1JE0A 4E94A 3O8BA 5JTTA 5CFZA 5F52A 5CBPA 2VBCA 4CHTA 3LWZA 3C8UA 5ECGC 4WI1A 1MAWA 2W2KA 4PC3A 4DREA 2C7PA 1KHHA 4TUYA 3F98A 1AH2A 1HKHA 4Z4QA 2I2XB 4WUTA 1XLUA 4DSTA 4ZQEA 1W5TA 5CK4A 1EQUA 3KZKA 4P81A 5E8RA 2C4NA 2A0FA 4QUGA 2J09A 2J7PA 4L85A 1PUXA 3COSA 3IHLA 2B2XA 1ZD9A 4RESA 4MJ3A 4C0AC 1E6WA 1P4SA 3U62A 1BHQ1 3TW4A 1U94A 1XXHE 3DLHA 1TUEA 4DC1A 3IFSA 4CMKA 1WBBA 5B3LA 4OFXA 4ZA2A 2BLLA 1GFZA 4G81A 5BN1A 2F1KA 5F98A 4YXWA 4FGKA 3JVDA 4TMYA 3PEFA 4BMSA 1MABA 2XDQA 3CXUA 3L5OA 1KPIA 1UBTS 1QV9A 1ZY2A 4ENQA 1ZI8A 3GLRA 3IUYA 3AM4A 2G9NA 1QE3A 2QJOA 2YDYA 3AONB 1E64A 1FP2A 5LBTA 3T3IA 4NDNE 4IF6A 3SMVA 5E2AA 1KFBB 5I7FA 1QIIA 1O4WA 1MN6A 1XKTA 4ND1A 4UCXA 2CDBA 1P17A 3ZW7A 4Y6SA 1FF9A 1QKIA 3OEED 4HNAA 4PAGA 5EWLA 4ZKDA 1T1IA 2HADA 3HYSA 2DTXA 3L46A 4ZAZA 3NPMA 2VPXA 2O9JA 4WVFA 4WL0A 1V9SA 2N75A 1YRYE 2WWHA 1EXWA 3BG5A 2R7MA 4GM1A 1PGNA 5K8TA 3DVQX 1U2GC 2WAXA 1KZ9A 4Q7KA 1V48A 3OQVA 3L7MA 1NXXA 1OWPA 4KXMA 5BYJA 4JLWA 5E1OA 2Z08A 1TTQB 4M1WA 1FNCA 1KAEA 3KDAA 4IFEA 4LOLA 1DIGA 4I50B 3EA4A 5ITVA 4JYBA 4XGQA 3DOHA 3Q3VA 4G23A 3BF7A 5LA6A 4P0QB 1RPAA 3VAZA 2GCNA 3F3KA 4IJ6A 4QT4A 2XAUA 5JVDF 3K0AB 4WEOA 3VDNB 3WLRA 2LNDA 3K30A 1LRLA 3DMYA 3OP4A 2HI0A 2JI9A 2FEOA 3KZOA 4IF4A 2V98A 2SKEA 3ABIA 4ILEA 2HXSA 3CW9A 1CHNA 4L0DA 5HSGA 5JROA 1G59A 2WP0A 3ST7A 4XEHA 5IWAB 5CCBA 3MAJA 3MUNA 1TFRA 2YHUA 5HMLA 5DHUA 5AXBA 1MOSA 1WQ3A 2PVSA 1H2ZA 3L6RA 3SQOA 1E8DA 3RAJA 1M1YE 4WHMA 1U0RA 3F71A 1ZN2A 3DEHA 2HLHA 3EZLA 4PQRA 1KE1A 3NHKA 2GYUA 1BX3A 2D1QA 2XUJA 2OO5C 4L07A 1IIBA 1UFVA 5IBQA 1Q1BA 4N9QA 3ZR4B 3MOIA 4FOPA 4KZKA 3V55A 3A6JA 3RVRA 2PT5A 5GM2A 1BMFA 1LTKA 1IXYA 1Y6RA 4ZU1X 4R2LA 2WINI 3SK0A 1J42A 2XNDA 2ATIA 3W2EA 1VIYA 2OC9A 3UBMA 4CNBA 3QY0A 1LUAA 1KTVA 3WA6A 1CF2O 4KL8S 4KIWA 5CLLA 5JS2A 4UMVA 1V5FA 3EODA 4HBZA 1OWNA 5JPIA 1JDSA 1U3WA 1Y9ZA 1Z4LA 2GZ3A 1V26A 3GA0A 3GR6A 3K70B 2J0EA 4WZBB 5ICSA 4ARZA 1ZLYA 3COPA 1Q77A 4J4TA 3RYHA 3VZBA 1UWVA 5E9AA 2AOWA 1MVNA 5FPSA 2VHQA 3SZMA 3JAKA 3BMQA 3IIIA 4MYDA 3L7CA 1GPLA 3OQ1A 3T8YA 4JLOA 4UVIA 3ANMA 1I94B 3ZLTA 5K3EA 1USIA 3ZNOA 1OV4A 5ED0A 3GDOA 1V8DA 4PAMA 1SQ5A 2CE2X 2WR8A 2NO9A 3R9IA 3TZEA 2IF0A 3D9QX 3NBXX 1PL6A 2FGKA 4IHJA 3T5BA 4X44A 2BDEA 1F2UB 3NJRA 4Y98A 3GJ0A 5CVJA 5J63A 3WYCA 4BNJA 1ESMA 2RHGB 3IKVA 4ZIRA 5DEOA 1SBHA 5F76A 3KOYA 4QRHA 2B4QA 5J1SB 3PNMA 2E49A 5HF5A 5B57C 5AW8A 4H2DA 1A9PA 5A5GA 2DB3A 2HAEA 2XUFA 3P8ZA 3UHAA 1DELA 3U40A 4YV1A 3QKSA 2R1TA 3FAZA 3QYAA 2PKRA 1ZEJA 3NHMA 4YIHA 2VAMA 4U2BA 1ZMOA 3PDWA 1R5NA 1XRQA 3K9CA 2CV2A 2OYSA 3PRHA 4NVRA 2Q7DA 2EGUA 3DL2A 4FSHA 3KLMX 3CJRA 1P3DA 3IBGA 1OXKB 3N2KB 4O33A 5C8XA 1E60A 3Q8KA 5A6VA 1PRYA 5IK2A 3S2YA 4D3FA 5HIAA 5JYEA 3THXA 1R4MB 3QU2A 3R3JA 4GEKA 3IB3A 4E51A 4EHAA 3BGOS 1A9XA 1R18A 4KLCA 2Z9BA 1J21A 1U2ZA 2P35A 4UHHA 4KNYA 3E3OA 2WM8A 3HQ4O 1KZ6A 2WSBA 1QKJA 1JJFA 5DHTA 3FLMA 3ISTA 4WKOA 1RI3A 1JU4A 2J32A 3S68A 1WEHA 2ZQ5A 3TOSA 1H2WA 1ZIPA 1G6KA 2V55B 1B26A 3HBFA 4F4HA 4O3MA 3W4KA 1T5LA 4PYIA 4ATNA 2B4AA 4MQ6A 1NT2A 2H1CA 3W06A 4HXEB 5FNZA 4HZUB 4OX9Y 1LBEA 5DMHA 2SBTA 3TNJA 1GDDA 1E1RD 1ORHA 2HSGA 4AY4A 1TIBA 3BIFA 4KYIB 1BHJA 3T7IA 4H1TA 3C6QA 1XVAA 221PA 3CYFA 4S1VA 4YECA 4D3DA 1S89A 2RG7A 1C3EA 5FBWB 1S7GA 1VOTA 2MSCB 3AFOA 4EPRA 4Q4JA 4CMJA 1MJNA 3CJQA 1CKEA 2PZKA 2B5OA 2PXAA 4X60A 1MUUA 1PS9A 4NP6A 4JROA 4P4UA 4Z4EA 5K8UA 1RWBA 1YR7A 5IDWA 5FO0A 4OHMA 2O8FB 5TVKA 2FQXA 4DT1B 3AVTA 2VPWA 3DLAA 1PG0A 1Z0DA 3RTGA 3W9UA 2G67A 2Q9BA 1XRJA 3OZXA 5JS6A 2EKZA 4QDZA 3IOEA 2IBMA 3QX3A 3DSRA 5JFGA 1YJCA 3DKPA 5DNCA 3T3DA 4OHPA 1GZ6A 4PLTA 3KEFA 2E48A 1XPRA 1XHFA 1YQWA 4J2OA 4BWGA 4C0LA 3KJNA 4EMBA 1UKZA 2XA2A 3CNQS 4O1MA 2JFWA 3A14A 4Q15A 4S0ZA 1C7RA 5HMMA 2VKTA 4WGFA 3D7NA 2O1XA 2VIIA 2NO1A 3AOEC 5CFMA 2P62A 1JU9A 5C1BA 2IY8A 1Q0QA 1TM1E 1Z0AA 2JJQA 2EAUA 3CZQA 1IY2A 4NU0A 1F60A 1H05A 1Q7TA 2BWJA 3B8EA 3G2QA 3MB8A 3O4FA 4UOEA 3A2KA 1J0BA 4RY0A 3AVQA 1VJ0A 5JH7F 3M34A 3G2HA 3SXJA 4ZDJA 1JZSA 3ITNA 4JL6A 4JLBA 3W34A 2P0AA 3QYJA 1PZEA 4FYWA 4W9MC 3HXQA 5IDQA 3LHDA 3E61A 3NHLA 2NTNA 1FA9A 4XX0A 3ETDA 1TFUA 4QJ3A 4NATA 2E4ZA 1RKQA 1SPBS 3WL7A 4ZCSA 4L4SA 4TWZA 5AESA 4D42A 2ZITA 1M1NA 1KHTA 3E9DA 1ECPA 4AIRA 5ADUS 1TMOA 1VL2A 4KNVA 4QU8A 2AV6A 3HXKA 5FNVA 1T36A 1DX9A 1T1RA 1J8MF 1RJFA 2F9FA 1E66A 2GR9A 2YRFA 1NVAA 1VKJA 3F6EX 4CIXA 1OXVA 1T5OA 4GKBA 3UCEA 1YDMA 1RYHA 2HIHA 3GJ5A 1SXIA 3ROZA 3E82A 5K1ZA 4J1NA 2BFOA 1BTOA 3V6LA 4ZV4A 1NP3A 4A6DA 2FWRA 1ZU5A 2B78A 4IVNA 3DKIA 4MUKA 2FR1A 3B5EA 4KSBA 5CX1B 4YJKA 3HYCA 1NQXA 3JTMA 3KAJA 1FBNA 2Y0PA 1QM5A 2VJOA 2X0RA 3ONWA 3DH0A 1DRUA 3GPDG 4JYMA 1D3AA 1EDZA 4BN4A 3ID6C 4E1BA 2XV1A 5TR9A 5IT4A 3WFIA 1NFFA 4J07A 3FWZA 4MTCA 4YCJA 3JD0A 1V6CA 4Q9HA 1MABB 1NAHA 2PUVA 5LBUA 2R4UA 4PGFA 5EXDA 3L41A 4BEVA 1NKVA 3ELUA 4F8EA 2OFFA 5BYAA 4ZYXA 4JQOA 1Y8AA 4MQUA 4EYOA 3CH6A 4G97A 5BWOA 3ZU2A 3ZC3A 2KMLA 4BRWA 4MLCA 3FOFC 4AI6A 1UKVY 2VH5R 1L7OA 4IIJF 4DV2B 4UUQA 3CEMA 3GNSA 4F8JA 5KNCD 1FXSA 1PQPA 2D8AA 3SXUB 3G49A 3GFGA 1WU8A 4HGQA 4HQRA 4QOIA 4RHEA 4X91A 2H2FA 4Q9JA 2VSQA 5DTMA 2HMTA 3RROA 1WSDA 4BGDA 3NDIA 2BHLA 3LT4A 3H5LA 1X39A 3H5WA 1R8YA 4I6JA 4DMHA 4MIOA 3ITEA 2LPMA 4P92A 3MMSA 4HDNB 3MAAC 1E5VA 1K4YA 3EIQA 1FDRA 2QY9A 2I4OA 4OB6A 4P82A 3UWOA 6GPBA 3AF5A 3SYKA 4LF4B 1FOEB 3PGMA 3P4UA 4K88A 1AC5A 3PCRB 4LNAA 4WASA 2H0RA 3VUEA 4LZAA 1VIAA 3LHIA 4NESA 2QN3A 1LC0A 4F3KA 2GEFA 3TLGB 4J49A 1P2FA 1U3CA 4PCLA 4UCQA 4I6EA 1Y42X 1V71A 4O2LA 1DTEA 1EKXA 2JH9A 4H4EA 2GZMA 3T34A 1F5NA 1NVTA 2KM1A 4MZXA 1DJMA 3NAQA 1J97A 1QFJA 3S99A 1WMFA 3NHWA 3RS5A 2DHCA 3ZWAA 2BT4A 1NA5A 2RAVA 3KR0A 3HCFA 2P75A 3RNLA 4QU9A 1X3SA 4OI0A 4BLTA 2DR0A 3Q6NA 4QEKA 1SJ9A 3PRJA 4JOQA 1Z4PX 4DRXB 4YHHB 1S7CA 3ADDA 4E6EA 2PJRA 1DIOB 1Y1KE 2JHCA 4B6PA 1QDEA 5I8PA 1IATA 1YZYA 1KQOA 3A4NA 4GEGA 1JH8A 1I4OA 1KIFA 1L8LA 1BVYF 3E22A 3AVYA 5KJ6A 1YZ3A 3SDSA 5HFAA 4R2IA 4D0LB 5B2EA 3GEBA 2Q4RA 3OU7A 4EJMA 2DQ4A 2XCQA 4FJ0A 3W9BA 3AWDA 2WTBA 4JK3A 1H8ED 2H51A 3HXTA 3VU9A 2ZSHA 4FFRA 1ORWA 3AERB 4BAUA 1RI1A 3O94A 3JAMA 3AJ8A 4R9RA 1CR0A 3SX2A 3ENZA 1Z0ZA 1G7RA 2RHJA 1VSTA 3TQTA 1RLUA 1ZD5A 2XD9A 4LOKA 1NW4A 2XPCA 2D1RA 2P69A 4WCFA 2QQ5A 3SKXA 1JA9A 1MV8A 1PHPA 1UMBB 2Y1KA 3ETNA 3KPWA 1CC1S 4N7RA 4Q3CA 4RFSA 1AD2A 1J8FA 1EGHA 1Z12A 2FMUA 3RSFA 1DT3A 1Z5OA 2YHSA 4PLFA 2BR5A 4A82A 5CG1A 1QS0A 4D57A 3UBTA 4DQXA 5A1TA 3TKAA 5BWLA 1M2HA 1HR0B 3ER8A 4IHJB 5DNVA 1RJDA 3ONVA 1NOJA 4G0WA 1UBOS 1Y6QA 2AIRA 1N92A 3CSDA 3Q6MA 1IDOA 2FFBA 2F8MA 4LBYA 3SU8A 3KQQA 4E03A 1IHOA 1Z16A 3QPVA 4G5FA 4IVPA 2BDTA 5IG2A 1COZA 1OT5A 1TLLA 4WXMA 2JLYA 1LC3A 3G9QA 1KBZA 2XAAA 1A8IA 5C8YA 1HTBA 1MC1A 4QSHA 2QMUA 3OAAD 3PC6A 5TQVA 5EJ8A 1VA5A 3RYFA 3KHSA 2JVJA 1FVFA 1E3WA 2Z8XA 2JGDA 1MF7A 1N2CE 2IXTA 3LUDA 2HK9A 3ABZA 3MJDA 1J22A 4FR0A 3FUWA 3CLKA 4PRKA 4YGXB 4EB6B 3VYTB 2WABA 1XZCA 3MHPA 3OH8A 1P5FA 4RL4A 4TV8A 5GVSA 2Q21A 4H1HA 1FFCA 1W25A 2TS1A 3Q3GE 2B4KA 2YWEA 4XRGA 1G8SA 2XKBA 2P3OA 1YAJA 4X66B 3GZNA 3SQMA 1BMQA 2JJYA 5ULLA 3GJXC 3AKDA 1Z47A 2XCOA 3AY7A 1TJNA 2G5TA 1IVYA 4DADA 1NN0A 2CLEB 4B7CA 5K3CA 5JJCA 1V6AA 4K03A 1L5VA 3RDPA 1ML3A 1OBHA 4HUQA 1VGQA 3VO2A 4DCVA 2ZXEA 4DMGA 8OHMA 2JHGA 1L7BA 2ONZA 5KVAA 2XI4A 4LX8A 4BY9E 2PRKA 1D1SA 3QWBA 4YRFA 1IFXA 1VMDA 2Y27A 1F3LA 3HJHA 1YRQA 3RKRA 4K9DA 5LQAA 3LQ1A 4MUIA 4O4IA 4RLSA 1E7YA 3UC9A 4KWCA 1ZMRA 3K94A 5IUKC 3VAAA 1GUZA 4Z8YA 2RE8A 5E6SA 3RWMB 2PSFA 2GXQA 3KZCA 4JH0A 1J8VA 1K2VN 2QK4A 1QKKA 1S6YA 4JU8A 1YSCA 1T4CA 2EW8A 2RJOA 3HCNA 3NDPA 4QXRA 1OSNA 3FHJA 3CR8A 4A5OA 4CIVA 2PUFA 5BSVA 3WGHA 4G26A 1MC8A 4NOJA 4HRXA 1I1NA 3Q8LA 2C8JA 4IMIB 3MCAA 3TD6A 5GZ1A 3MTBA 5H4GA 3CUYA 2VKQA 3OI7A 3OFNA 5JJ5A 5CNMA 3WRXC 3GVPA 2OCYC 2BYTA 4XDZA 1UPUA 2A67A 4W63A 2ZYWX 2BI4A 1T3LA 2ZB4A 3DTYA 4H08A 4QD3A 2ZUSA 3WGJA 5K09A 4I5DA 3G7SA 3QUTA 3L8HA 3LA8A 3N8GA 4JASB 3SEQA 1UINA 3WHLA 2PX5A 4RDHA 1MAUA 1JT9A 3WG9A 2AUTA 4DE5A 4ZJUA 2GVDC 1N9ZA 1Y6GA 4C0WA 3HP4A 3ZIAD 5C4IA 3LC1O 1GUDA 4FDTA 4PVCA 4C1BA 1Q0TA 4WZAE 3FH0A 3EEIA 4V1CI 4WJKB 1LDNA 1ZGCA 1HDRA 1SEPA 4DV1B 1SG0A 3PQEA 1GSOA 2IIQA 3LZDA 5G2OA 3ZV4A 3RT1A 3K0CA 1VKOA 3HVRA 2ECQA 1CVIA 4R9SA 3WICA 1ULSA 4NNOA 5H68A 2WYOA 3OEWA 2R1ZA 4HAXA 1BCSA 3FYSA 4LZWA 4CODB 3OZGA 3O1JC 2PBZA 2DWUA 5EJ5A 3IUPA 1KMNA 4LJRA 2C2WA 3BGSA 4S1TA 1HYQA 4M9RA 3L7BA 4OFWA 2FMXA 5DBOA 4NAVA 1W9MA 1N8KA 2AE2A 2QZSA 3GDWA 3ROEA 4PYMA 1ZR4A 1J7JA 2I3ZA 3DXXA 4HQFA 2PN1A 1XQ1A 2ERXA 1I2DA 4OSPA 4CCWA 4JC8A 5FAKA 2NUPA 2OXIA 2PNJA 4U2GA 4WT7A 4CMHA 4G0UA 1RZUA 4PGMA 4IR7A 1P9LA 3DDCA 1G20E 4LHVA 1PFQA 4XWGA 4B31A 1X1TA 4OK6A 5FOXA 3SHVA 5I4IA 5DTEA 2F3PA 1KK2A 1XXHA 2VS1A 1UJ4A 2O7SA 2Q1TA 4LTMA 3PFWO 4WRRA 4I3HA 4QECA 4M2LA 1SWWA 1UM9A 1WMAA 2JB9A 1WF3A 3W3AH 3L4KA 4RAOA 4Z4CA 2JAQA 4LW8A 4N6GA 5HK9A 3CNNA 4JT2A 2A1TR 2YC2C 3IUSA 1N0UA 5SICE 1R4ZA 3N59A 5CEFA 4ZI3A 1CQIB 1MO3A 3TUIC 5IMSA 5B3AA 1P9WA 2FVYA 4JIMA 3H5VA 1YA4A 3D02A 5CAEB 3WVNA 1HL3A 4OA5A 5H3CA 5TPWA 3WL5A 1M5RA 1F1BA 2NV0A 1LZKA 3PQ2A 4I55A 4IRMA 5EINA 5EVCA 1II8A 3LW8A 3S2ZA 4W5OA 4W99A 1DADA 2GD2A 2PMWB 3NHBA 1HDCA 3DR5A 4LXGA 5JDCC 4ENUA 3VSDA 5BW4A 3IT1A 1BQEA 1HDGO 2O06A 3CCCA 5K6RA 5LOVB 2V4MA 2PD3A 3WLFA 1EXVA 2FH5B 2XE7A 3BIXA 4LOHA 1JMKC 1CUFA 1YB5A 1YMQA 3AIOA 3LUCA 4FFDA 1OB2A 2PA3A 3HR4A 1F8YA 4GYWA 5EMKA 1FLAA 3SPXA 5KQSA 3I9V6 1H2AS 4OBWA 4REOA 4RPLA 1IMJA 1XYVA 4HN9A 3LKVA 3KZXA 2VR1A 2JKZA 3OPXA 4HNTA 2YXLA 2CMGA 4IIBA 1C1DA 1NP6A 2XODA 4NZZA 4NCAA 2PQ6A 2W2QA 3F4KA 4O4JB 1LSOA 3N6VA 3WK4A 4PEVA 1KYYA 3O90A 5EZYB 4UBMA 1SA0A 2NU8A 4DNOA 4ERNA 4JT9A 1YDEA 3E9CA 4X62B 4QELA 3TSYA 3T7TA 3EN0A 1XE3A 5IKPA 4QRDA 4MKHA 5EESA 1K7YA 2BE7A 1Z7WA 1JHAA 5FD8A 5A7GA 1PL8A 2QTNA 3QW4B 4KXQA 3F9CA 4YMGA 4N41A 4M86A 1Q1AA 1FLDA 1E2HA 2VAWA 4RK5A 2BGTA 2I6SA 3KSZO 3TG8A 1QXSA 2CVOA 5JZVA 1XB2A 3HHPA 4MQEB 2AF3C 4WWHA 1JBQA 4H7FA 3FTQA 5A5VA 3EYWA 3MA0A 1Y5NA 2IL1A 4B35A 4M8LA 1H5NA 1XD2B 3QVOA 1SBZA 3DZFA 2VRCD 2XD4A 1EHCA 2I71A 4QOGA 4YUWA 2RJ3A 4F3YA 2OZEA 1Y3DE 4HH0A 1M2NA 5A3VA 3T54A 2QM0A 3FMVA 1L5NA 5JPDA 3IT2A 1UAAA 1S9HA 6REQB 1ABBA 3L8YA 3AO0B 5A6SB 4KUGA 5BORA 5KB3A 3K1JA 1G16A 1H9BA 2PKEA 1T4MA 3PDUA 5BSHA 2G4VA 2GJ4A 2II6A 2X4GA 4P7GA 1NVWQ 2EDAA 2I6QA 4V3BA 1TRKA 3DZGA 1IG0A 1PF7E 3GT4A 2FI1A 2AN4A 4DDTA 1W96A 2YKGA 3WX0A 4JI4B 1JALA 1PJ4A 1Q84A 2IT1A 4Y6GB 1J2EA 1DWUA 5AUOB 2DBQA 3V8RA 1D7OA 2ZROA 2OM6A 4FR2A 4D9GA 4NFYA 1U3VA 3KELA 3GRKA 4OKIA 1NOKA 2CHFA 4X7PA 2R6AA 1KMQA 3Q1LA 2WLTA 4E1AA 4MV0A 3MWEA 3OKCA 3VPFA 2J9FB 1EYZA 3VNSA 1NJ2A 2EEZA 1CNMA 5EPEA 2B69A 4DA4A 3TJMA 2ZR7A 1T8RA 2OZKA 1QONA 1GUBA 2AUMA 1CP2A 3E7PA 4TUYF 4WXEA 4C78A 4DMKA 5C80A 3ADCA 1KEPA 3F90A 1KP3A 2P9BA 1IOZA 3ZX5A 5B6IA 1DKPA 3TTTA 4F6LA 1ZUIA 4YJ2B 1S3GA 1JHYA 4EARA 2WF6A 2VQ3A 3ILYA 3NIGB 5EYPA 1YS6A 4B6SA 1VLLA 4CJXA 3UT0A 2ZVDA 3FPLA 3OA2A 2Z5FA 3R3XA 1G42A 2OBNA 4AZVA 5KWIA 3QQPA 3T3PB 4AJOA 5KNCH 2X5NA 4L5IA 4XVQA 1SMKA 1X1BA 3FHLA 2JL1A 3PEWA 3E48A 2CXUA 2PV7A 2YS7A 2YZKA 2DULA 3NHAA 1G8JA 1V5IA 2ARKA 3DZHA 4ZCPA 5HIJA 1XEXB 2CJYA 1E3DA 1EK6A 1MJ5A 1CB0A 3P9ZA 4TV8B 3R7FA 5L53A 1R64A 4PQEA 4L3VA 1AZTA 2FY8A 3PJEA 5IVIA 1SWVA 1WABA 4MHSA 1RQRA 1CPYA 5DK6A 3S55A 4DC9A 2DECA 2PGOA 4IJVA 1GTSA 3P9SA 4E30A 1NNLA 1T2DA 4BPBA 3R77A 2ZLBA 4JZYA 2I65A 3J80A 3UPDA 4CFYA 1VJCA 2PS3A 3CM0A 4MLPA 2RAUA 1K4KA 4OMDA 1VJGA 5DWQA 1ZWKA 1G1AA 2PGAA 1G55A 3P9YA 2HEGA 4CM8A 3OA0A 1LBTA 3WNZA 4MS4A 3H9CA 2WUFA 4ZXFA 1P9RA 5AKLA 4GDFA 4WERA 2R1VB 3MINB 4QXPA 2YBDA 3OE4A 1RBQA 1QYXA 1XTRA 1HQYE 1W19A 2I1WA 2KPOA 3C14C 3CU5A 2O1EA 1ZH8A 1D5CA 4ZEMA 2ESRA 1ZIOA 5JSKA 5C3MA 3FNGA 1UPAA 5E6SB 5JNVA 2MYTA 1QDLB 3RFVA 3JASA 4XIGS 5C7YA 2V1XA 2HTEA 2Y2VA 1ZOPA 3HVHA 2Z4RA 4Q93A 4FDUA 1T4CB 4Q4AB 4IYRA 3JATB 3OFJA 5LA6F 2CXNA 4N47A 4KXFB 1GCOA 1HBJA 1RWPA 2AX4A 4HK4A 3WGTA 1ZQ9A 2R87A 4G5XA 1GFIA 3PC8C 3WWDA 3AXTA 1DCKA 3JD2A 1JNYA 3STXA 1NDUA 1UKEA 3FVWA 1EINA 3HFJA 2H1FA 1MX5A 2O2GA 4FHEA 3H1FA 3ZH2A 4L5CA 3G8DA 3WMRA 2GN0A 3FDFA 1KTIA 4S2EA 4I46A 1GNVA 3JYHA 5HKKD 3RRBA 2ETVA 4GPIB 3UT5B 3JAWB 3PQ3A 4UPVA 3C0KA 2GN2A 3R5TA 4L8WB 2EWVA 3NWJA 2WJJA 4Y2PA 3X2SA 1TL7C 3B9QA 4LOIA 2YYSA 1E9CA 3KAQA 3DFZA 3OPVA 5HCIA 3I83A 7ABPA 3IDOA 2PE5A 2FP4B 3MT7A 4LYHA 3VTZA 3WOVA 1E5TA 5E2BA 3TQSA 3E9MA 1LLQA 4XD7D 1I4DD 1JBKA 4BZQA 2GPTA 3BWEA 4ZCTA 1BCSB 3NM4A 5SZHB 5TY0A 3GAZA 2GBIA 2OGUA 3RKUA 4D99A 4Z7JA 1DE0A 1HFJA 1XTKA 2KW5A 3ISVA 4POAA 1OXXK 1X9IA 2NTEA 3TAUA 1TYDE 3D8TA 4KG7A 3CVXA 2IPMA 2J3DA 1X70A 2WK1A 2PWBA 4U9UA 2GPYA 3RREA 4Y0NA 1IN6A 4JLVA 4X85A 2ONJA 4FU0A 4LZPA 2AJCA 2A9KA 4X8MA 1HOXA 5JRZA 1IB0A 4KMRA 3ETJA 3CNLA 4J9UE 4TQUS 3ZWNA 1CZKA 1EA7A 2TRSB 1GR1A 5HZMA 3KPUA 3AUXA 2ZOSA 4IHJF 1DOAA 4HGOA 3SD7A 4B34A 5P21A 4C76A 1QZZA 3A7DA 1UZNA 5AK0A 1Z6PA 3SYTA 3TGWA 3N05A 1UM9B 2QF7A 4GL2A 3AF1A 3U5TA 3VR2A 3ZX4A 2GZSA 5FTKA 1AVTA 1CUCA 1K3UB 3M4JA 3WYEA 3G79A 1T6NA 5HWSA 1ESNA 4QQRA 4EG0A 4RADA 2W8ZA 5LR6A 2FK7A 2X4LA 3OTHA 2QE6A 2WOOA 2QW0X 5IH3A 4FBLA 2GAFA 1UEIA 1XA0A 2DU8A 3PC4A 3FVVA 4AJNA 3KHUA 4I55B 4J4HA 4PSDA 1AK2A 4QFMA 3WRVA 4ZT4A 3LVBA 4C6HA 2GN1A 3BREA 4FE7A 3IEIA 3JWIA 3M9LA 5FHQA 3QPUA 3CG4A 3M89A 4GZLA 2OFOA 1U3UA 2XF8A 3MD0A 3V4PB 4DCOA 2R6HA 3DOCA 4OH1A 2HIAA 1QUEA 2NQ2C 3V6MA 1PR5A 4TXNA 3C48A 3DPIA 2P1RA 5T5QA 3DMDA 1KYXA 2RHLA 2WAYA 3CWCA 1ITZA 1VJRA 3KPJA 1XMJA 3R6WA 2BL4A 3C5VA 5EOVA 4GZ3A 1Q95A 3RPEA 4OGWA 4ZICA 1GCIA 1W7AA 3E7XA 3HADA 3WYBA 1XTQA 3ZCPA 1ZA1A 1TCCA 1DBPA 2C2ZA 4KDFA 1YB2A 3C1OA 3HUUA 5DYGA 1NY6A 1P7PA 3VZQA 4D9MA 4EFNA 3Q2IA 2YC4C 3FCAA 4CMCA 3KKZA 1T25A 1YC2A 1SA0B 2WT9A 1C8BA 2NU8B 1S3SA 4GGMX 4MCIA 3L8EA 4JOCA 4A2CA 2F43B 5A1JA 4NEGA 1GT6A 2VK4A 4Q9AA 1DJNA 2AC2A 5EIBC 4GI3A 4BO7A 1CIJA 5HUQA 1K5DA 4UTXA 3NU1A 1GL7A 4CM6A 1VE1A 2ZI6A 2JJ2D 3HG7A 5HF6A 1RWQA 3QV1A 4GVXA 2JLUA 3VMMA 1PQUA 4G67A 1E6MA 4UTRA 1UKCA 3I2HA 4GVLA 2ZRMA 4DDVA 1Z6ZA 5CURA 3S5JA 2OHVA 3Q7SA 4AO6A 1TZKA 4AZ3B 5CA0F 4JKOA 1U3TA 2X5XA 4TS3A 1BWRA 3G23A 3UO8B 1XDGA 4URYR 4B81A 1EXDA 3RIGA 3A3NA 5KYVA 1T24A 2H54A 1PKXA 1VGRA 1H5UA 1UMDA 3A0UA 3Q41A 4AF7A 1P80A 3BERA 1GKUB 3NO4A 4C4YA 2WZQA 2XWJI 1T8WA 1PT6A 4DA8A 2EBUA 1Z88A 3PPYA 5G1OA 1HT0A 4RENA 5HS6A 1LDMA 3BWVA 1YH3A 2BSXA 1SCUA 1Z08A 2DBVO 2GKGA 3BQNB 3C7TA 3CUSA 1Y81A 4TTRA 1NIPA 3C3CA 1N6OA 3T1NA 2BTQA 4DEVA 2HQRA 4JXXA 1UCFA 3STVA 3U3XA 2R6JA 2WJ6A 3S8EA 3HA5A 2BF7A 2HZBA 2I2BA 4PZLA 1KYQA 5ILGA 2ZJYA 3ESZA 3WO1A 4ARBA 4CG0A 3W5HA 4GE3A 2W6QA 3PXDA 4JSTA 4D9IA 4DJ5X 1NPYA 2JGMA 2Q2VA 1P1IA 3DMTC 3IA7A 3R5SA 1Z5ZA 2E4WA 3GEDA 4LDRA 4YALA 5FPYA 3WC4A 2QRVA 4MRRA 3Q12A 2XW6A 3NETA 1GYQA 1XKLA 2XBUA 3G1UA 1ZUHA 1NC1A 2VJAA 1MOPA 1YBHA 1EXMA 1YO6A 4NBNA 5IDYA 4ARCA 5FNVF 1QGYA 3ZQ4A 2VHEA 1IQUA 3NBFA 1IJBA 3CFYA 3EOAI 5TVGA 4S35A 2PIDA 3GELA 4WZAA 3ZDEA 5EYPB 2Q3LA 1SBCA 2LIPA 3JQGA 3PNVA 3PITA 4D4HA 3AINA 4DCSA 1HT2E 2E6KA 3BWYA 3GEIA 2EJCA 2C20A 2IZ1A 3EXIA 3DWEX 4ZI2A 1AGNA 1HFKA 2LGJA 3K2QA 5ERYA 3ZJUA 4GP7A 1UFRA 2Z95A 4FFBB 2OORC 3HWWA 4BKUA 3A04A 5L4SA 3R8FA 1TEVA 2AZDA 3F97A 1NUUA 1RZVA 3IOCA 4N7BA 3L01A 1U2RA 4A2WA 3IOYA 2F4NA 2H52A 2V4ZA 4R8RA 4UQPA 1LLDA 4B6JA 4OXNA 5ITZB 1NY5A 2YVKA 4PBSA 4OKSA 2QUHA 2D4HA 4EKIA 3MT0A 2C1XA 1XEWY 1P3Y1 5YASA 3JQBC 2XZTA 2ZE5A 1GNLA 3M1IA 3RJMA 1R6BX 4Z54A 2RMKA 2ICAA 3B6ZA 1DB3A 4TKUA 5ADWA 4A5SA 3OLZA 1OPRA 1I14A 5IKMA 5FUYA 3RNOA 5EIBD 5JU6A 4RMJA 3M3HA 4MRNA 5I48A 2XRZA 4DZTA 3O1HB 4EOGA 4RJTA 1B1AA 1Y63A 4GLOA 2YFYA 1EUDA 1H6DA 1GLNA 1DQYA 3TZHA 2FPWA 2N46A 1YUNA 2NIPA 4GZMA 1NVXQ 4KIUA 2D8MA 2O2XA 3QH4A 2W8BB 4YUVA 1Y8QA 3R76A 4HQKA 1H8HD 2PBLA 4Z4IA 4R6XA 3CVWA 3CXRA 1JG6A 3U6KA 4BNWA 4ZALA 3VH3A 2ZM5A 1ZVKA 3LZ6A 4NYIR 4JXKA 3WE7A 4BVKA 1XALA 1W2WB 3CR7A 4CETA 2WAAA 2CZGA 3AILA 3JQ7B 1CY0A 1V8BA 4F85A 3AHFA 4H59A 2YNMA 4DIEA 2RK4A 1UDXA 2QY6A 1TC2A 2C3OA 3A37A 5K0BA 1PT7A 1J0DA 2CL6X 3H6KA 1DC8A 3CE6A 1KH1A 4NBLA 2HBQA 1MENA 3DMFA 1DQNA 1HYHA 1DX6A 4TSFA 4PBTA 4YLEA 4AJ4A 2RD2A 3QEBZ 3FYDA 3PFFA 5LC1A 1VHQA 1XEAA 2C7BA 4HATA 4KQXA 3BPSA 4KGDA 4RYLA 4G0MA 1SG6A 2CFOA 3EVBA 1JEQB 3U16A 4RZ2A 4CLEA 1BS2A 3KJIA 4K8OA 4NMMA 3SM9A 3BIWA 3L0ZA 4HYTA 1JBEA 5SY6A 4D5GA 5BSMA 4UREA 2JHAA 4KGXA 4XARA 1M2JA 4EZEA 1AKEA 1G0NA 2D5BA 1GCGA 1XCLA 4NJMA 4YRIA 1XMIA 3L05A 2P4SA 1YJAA 5CB4B 3TBKA 2H7XA 2Q50A 5C53B 2DLDA 3A1SA 3UAWA 3HL4A 3BGDA 3IUBA 1JFTA 2Q2QA 3UIEA 2D59A 2X4IA 4C0JA 3KETA 3I73A 2ZAOA 1G20A 1IY1A 3TWOA 3DA8A 3V80A 5AVTA 4LYJA 1E3SA 2P6NA 3NJ8A 4TLLB 1NJ8A 1RXIA 5DNYB 3GWZA 3S1SA 2WIFA 4S2UA 1XQ9A 1NF3A 3IQXA 5ALLA 4AJ9A 2RHOA 1JEYB 3UHOA 1IY8A 2GK7A 4WY5A 2P2ZA 1R0ZA 2E6UX 3W8EA 4TKVA 1M74A 1ISPA 4D8VA 1JL3A 4OHRA 3M5PA 1NASA 4J7AA 2FQWA 1OKKA 2ZR9A 2R7KA 3EJWA 3NAZA 1X0XA 3GYBA 1SUWA 2BEWA 3CY6A 4LXTA 3OPQA 1X74A 2ZCUA 3HO8A 3DFIA 3AY3A 2PWYA 4MIKA 4R1QA 1JIQA 1P19A 5F3RA 3TL2A 4TM7A 1FNDA 3WLKX 2QX8A 3GLIE 1CJUC 3DLCA 1Z8HA 5TS3A 3WAKA 2EX1A 3KAKA 2FETA 3MT9A 4N1AA 2MSWA 2VT2A 1Y5LA 4RWEA 4JLKA 5C8YF 3I3SR 2QE7A 1Q0RA 4WN9A 3MS4A 4L16A 5IBPA 3TTXA 1JJBA 5A02A 2WQZA 2CL7X 5PGMA 4AJ1A 1XDUA 4IUCS 1E69A 2DY1A 1D2EA 4PXSA 4HQNA 1K9SA 2I6FA 1HLGA 1P73A 1XLTC 4IDGA 4WD3A 2GSDA 5IBCA 3D3KA 3PX7A 1P60A 1EVQA 1EGAA 3PYLA 1X7HA 2P2YA 3NB0A 1IN1A 5EQJB 2POCA 4E2ZA 2ZS8A 1V9LA 1N8NA 1SZPA 4FEGA 1DCTA 2P9HA 5AT1A 2F1IA 2GAIA 3KZVA 4CV2A 3OCYA 3P9KA 2GHQA 3UFBA 3VX4A 2V6GA 1LNSA 5BN3A 2M32A 4WLFA 2R5NA 2BH9A 4Q1EA 3WOHA 2XB6A 3RJTA 3ZPXA 2QM7A 2Q9UA 2Z04A 5E6RB 3TVDA 3GUUA 4CLOB 4F6RA 2ZAGA 3DHVA 3OD1A 2PKQP 3TEJA 3ZOKA 1MQ9A 5UKDA 3ZEIA 3A1UA 5EE3A 1IVNA 4TZKA 4CIAA 3AUKA 1I6KA 3GN2A 4LDPA 3EMVA 1E9FA 2PKXA 2Q99A 3CRRA 3VSCA 3J81A 1QP7A 1KVTA 2EDCA 1JHPA 3I6BA 2QKYA 4O4IF 2LV8A 2X40A 1COWD 3RGGA 1F48A 4M9CA 4WCVA 1PJ3A 5KAPA 1FSFA 2ORED 3H2YA 4AJIA 1L7QA 4RTKA 1U2EA 3QVJA 4B80A 2UZ1A 3X1YA 2R8RA 3PA8A 3G8BA 5BUZA 1FMJA 2ZP1A 4PX3A 4Y1GA 3X3HA 3AVWA 1PQYA 2VJPA 3AJRA 5KPDA 1XFAA 2B2NA 4BNGA 1PLKA 4GPEA 2QMQA 2WFLB 2BM9A 721PA 4ZVOA 1XQWA 1AMNA 3HZHA 5K45A 3OZCA 5KC9A 2P5TB 4X9XA 1QO0A 4LHEA 5IF3A 2C84A 1NNSA 5KVVA 3CNHA 4FMBB 4C3OB 2A5YB 2JEYA 2TYSB 3LFUA 3IPXA 2ZWAA 4I1RA 4P3YA 4MARA 5HE8A 4EUEA 3VMFA 4D8WA 3EGXA 4B3BA 4AKEA 1G8KA 4DR6B 3OX3A 4IQ4A 3MCVA 3U1VA 2PSSA 3EUAA 1UMDB 2DUNA 4LHYA 5J3JA 1OJLA 3PE6A 3AH8A 1XDDA 3R6TA 3LCRA 4LFBB 3T5PA 3F7MA 1H1TA 3JQRA 4MDHA 1YNSA 2P7IA 2PA0A 4MW1A 3CTMA 3DZKA 1VI6A 2F62A 2EZUA 1AHIA 3LGSA 2WG1A 5FAXA 2CFIA 3ZNNA 5CT5A 3RSZA 2FRDA 1HDOA 5E6UB 3WS7A 2QSYA 3UK1A 2DKOA 2CK3A 2NTYC 2H2IA 4Y9UA 4W82A 2PLWA 4BMYA 4IZIA 1FVHA 1G5RA 1OAOA 2WTEA 4KPUA 1BWQA 1ZBQA 4YJHB 1XVUA 1V5GA 2Q8NA 4EENA 2QJTA 3THOA 3MPOA 3F8SA 5EG5A 1KETA 3BBPA 3ZCUA 4BNHA 2QVXX 4Z4HA 3QWFA 3X1JA 1AB6A 3BFPA 3TXXA 3ANTA 3LCUA 2C2HA 1OHHD 2JGLA 1EVZA 2H16A 4N82A 2Z43A 4WFQA 2C4MA 4B4DA 1TC1A 4Q1FA 5D6OA 2NT4A 2ZSBA 3G0IA 4LQ4A 4BFVA 4P0PB 3U9SA 1T4GA 5BUQA 4RMHA 5BNWA 5F2EA 3RF7A 3ASUA 4NV0A 5ALHA 4JVSB 3B53X 4RF3A 4EI2A 2EZTA 3IV9A 4IHAA 5EZQA 3UWMA 3AVVA 4QM6A 1TQ8A 3UV6A 2YV1A 3E9RA 1NP7A 4EAQA 5FYDA 4MW5A 4DSZA 2Q4EA 3JQGB 1E1MA 5BR1A 3GLGE 4NULA 3GPBA 1W44A 1N6NA 3BT7A 1GQFA 3V1KA 3P20A 4QHSA 2WWWA 3NASA 2VK1A 4TL7A 4BLUA 4TYYA 3K09C 3V00A 4YUXA 4RZSA 1PNOA 2W2TA 1OOEA 3AUAA 4RLQA 5FUQA 2NOAA 4I55F 5EUQB 1QRDA 2BGRA 3DO8A 3GVCA 1Y1TA 5TS2A 3VVCA 2CN1A 2XTNA 3U19A 4PZ0A 4H3SA 4Q1DA 1Z25A 3PKJA 3IE1A 4I66A 2XYHA 3WA7A 3AEYA 3TI7A 1K3TA 1X1QA 1IXZA 3FPJA 2IY9A 5I9IA 1UDRA 3T5MA 3M5CA 2QVCA 2Y0CA 1R15A 1CDZA 2COEA 1EX7A 2XYQA 1RYBA 1JIUA 2PAAA 2ROQA 2B82A 3I45A 2GK4A 3DAFA 2Q3HA 1N3BA 3KTFA 4NI5A 4LNUB 4RDXA 3RYIB 3F46A 2I4IA 3HZZA 3RARA 1KO7A 1Z13A 2X22A 1SCQA 3CN9A 5BNZA 4FM9A 4INJA 5F5LA 5C31A 4MI9A 2TMYA 2BE9A 1D2HA 1FX0B 3MCWA 1DEHA 3AETA 3TPFA 3BQMB 3JZFA 2Z30A 4LMPA 3W5JA 1PV1A 4L7QA 4BTVA 4EX6A 4C9BA 2IU0A 1Y8QB 4G1CA 3B1ZA 4RE5A 4ZT5A 3CGGA 1WMBA 3INRA 1T2FA 3EZ2A 1OYWA 4G9GA 2F00A 4C0QC 4AU1A 4GOXA 4UJ5A 2B92A 1HMYA 2RC6A 4KVZA 4Y0AA 4IL5A 5AI5A 3OEEA 5IUJC 1DIBA 3OIYA 4M0CA 4FNMA 4E7PA 1N5RA 4PFJA 1CT9A 2ZYSA 3K9GA 5HG0A 5I9BA 4UU1A 2ZUUA 1F9EA 3NTUA 3B3FA 4OHZA 2QJFA 1JEEA 2M6LA 3WAGA 1D2AA 4NENB 2EP5A 3OEHD 1A82A 1U8TA 4ZC1A 1HPLA 3WRYA 2HJWA 4Q16A 5MGNA 2J3EA 3HRIA 3I92A 3NGXA 3DE2X 3IP5A 4DHWA 4I9HA 2BSQA 4BBJA 5FLKA 4NZMA 1WSAA 2J07A 4ZO8A 5FWYA 2IF2A 3GZTB 4MSUA 3W9SA 4C2UA 1EA5A 3D64A 4EVQA 3L06A 4KXVA 4BV9A 5LZ9A 3W3ZB 1JHQA 4BX9A 2HPAA 3H2ZA 1VLHA 1CY7A 2HA7A 1ZLXA 2VK8A 2X9NA 3FF4A 2VZ9A 3LY5A 4JLPA 1M66A 4RL6A 4YJFA 1HDXA 2RGNC 5CLIA 2VTBB 1KMIY 3AFIA 2WRZA 1L1FA 2HA3A 2IQ5A 4HVTA 2J1LA 4KX3A 3W7VA 2B3DA 1JHZA 1VCMA 4MVJG 2WWRA 3GRUA 4EQ6A 5D3MA 1P2BA 3HCAA 1Y3IA 3WHKA 2E87A 3FKSD 2FSUA 5FFFA 4HNHA 1R6DA 1QR2A 2XADA 4KQ2A 1YC5A 1U28C 3L5KA 4OXYA 4TL6A 2GLTA 4ZOLA 2C4UA 1E9EA 3B5IA 1DXOA 3MSXA 3JR7A 4QYSA 3W6NA 2BW0A 1EI9A 4E5MA 3PSHA 4E5SA 5CFNA 2HMWA 3IP1A 3OOEA 2H48A 1GKKA 2R9VA 3LLVA 3WQHA 1DTWA 2I2FA 4YRBA 5JQGB 4N0EA 3QIVA 3AEQA 4AK9A 4JYCA 3OT4A 1N0IA 2ZDQA 4UM9B 2J0VA 1I4WA 4GO1A 1B8PA 2YHAA 5HBGA 4JV5B 3IYLW 3KJHA 2G88A 4DJDC 2R6GA 3EG9B 1YRHA 3HDVA 4RK6A 3RKSA 3L79A 2UVPA 4CT4B 3N8HA 3D7RA 1FDOA 1NT4A 1PZGA 1V1MA 2F3SA 3HMQA 4O2BB 4HDOB 3DHYA 2NP7A 4CM4A 3KOUA 4KTVE 4DMFA 3WLLA 4I19A 3ND8A 4BP3A 4G8BA 3JZIA 3C15C 3T1VA 3V7YA 2OWEA 3VR6H 1VPTA 5DZSA 3RT7A 2H06A 3SWWA 1MEOA 1F17A 1MD9A 1QNFA 2MYUA 2AXQA 4JN6B 4YT4A 1QC5A 3GT3A 3DLTA 4MR7A 4EZIA 4EF6A 5ISMA 5K0GA 3K05A 4NC9A 4C6SA 1CE8A 4DJFC 5BN3B 2ERCA 2I62A 4M99A 4OX9B 2ORYA 1U31A 4L7VA 1OTXA 3HPQA 3GFFA 4DV3B 5BQ5A 1G3IA 4G6ZA 4F6RB 5AW1A 2H00A 3ONDA 4LHWA 1RI2A 3Q1KA 3UF0A 3EPKA 1PR3A 1C41A 4FXOA 1KFJB 4G9BA 3VYWA 2IP4A 1RABA 2FLVA 3UOGA 4N8SA 1UBMS 1H2HA 4BATA 5JAUA 1N32B 1TIKA 4MKGA 3F6YA 1IBRA 3FVTA 4XJTA 2WIAA 1SO8A 4RCZA 3VPCA 1XJWA 1S4QA 3TN7A 2QYHA 3KQOA 3PCXA 5BN4A 1AO0A 2Z1NA 5AM3A 4FD2A 1QBGA 4BC1A 4GR4A 5BV1A 4Q4HA 2ZSIA 4XWOA 3IQHX 4EF5A 3D6MA 1ZJ6A 1DINA 4D9KA 4X20A 4K3UA 2XCSB 1U2GA 2M6RA 4PSUA 1N7JA 1NJFA 1EE2A 3UTCA 4F5DA 1K98A 3FZYA 1LQUA 3HXLA 1X9GA 4NSNA 3L8GA 3UQYS 1IEQA 1PTJC 4TROA 3CZRA 4FNAA 2ZBPA 4OHVA 2V97A 4AKSA 2IYEA 4EI9A 4M9SA 2CUZA 3GGSA 1KEVA 4IGIA 5A62A 1E1RA 1SN7A 5CVDA 3V1MA 1TVCA 1EUQA 1VYVA 1ZI9A 2NZUG 4LZLA 1ESEA 3IEPA 1ES9A 3F4LA 2NVUA 4P34A 2OV8A 4FHGA 4QDTA 3TRKA 4BNMA 2BFDA 4QREA 2VOJA 3E70C 1CULC 3EFEA 5K8IA 4C7JA 4QJ5A 1MB9A 3X44A 1WCIA 1UDCA 4FFWA 4QTTB 3V1YA 2CUKA 4F38A 5T6MA 4IQFA 2I1VB 2VUSA 4MRVA 3QUCA 5DGXA 3QRWA 4ZRMA 3VHXB 1KC3A 1N6RA 3IB6A 1EP3B 4LY9A 2H7VA 2QR2A 4GXTA 2P27A 1B00A 1NR7A 4PF1A 4BLSA 3MTGA 4U2KA 4LDZA 3WMGA 2OO5A 4TKLA 3VR4H 2PPLA 4GFDA 5HIMA 1C3JA 2E82A 4BUZA 2QP3A 1I6LA 3A2NA 3AYXB 5IWCA 4EG1A 4WK4B 4YP9A 5C1IA 5NLLA 5I3CA 1K8RA 4H4CA 1SR8A 4KIJA 4RW0A 1PR6A 3AM1A 1X8XA 2RHDA 1T43A 1H0RA 2MIIA 4GLLA 3MRVA 2WJ3A 1GZ5A 2PJUA 4M1QA 1AMUA 5CA1B 3RTBA 3D0RA 1Q0UA 4FD3A 1RRFA 3GEGA 3H2GA 1MKYA 1I0LA 3COJA 1HNZB 1SKYE 1ATIA 4I1OA 1FXWF 2D5CA 1AQIA 1U1GA 2QT1A 4UU8A 1JTFA 3W90A 1YQUA 4CI0B 1OBCA 3PC7A 3E23A 2QW8A 5KMGA 4FOSA 2ENUA 4NMWA 5EIHA 3LTEA 5LZ8A 1NMYA 3PC2A 3JWJA 4DMCA 3NTLA 4ZJYA 1G5HA 1FNSA 2JK0A 3BH6A 1XRMA 2AXNA 3MLEA 3ORQA 4LSZA 3VU3A 3HU3A 1BU8A 2C98A 4QDOA 1SB8A 3H2HA 2IOHA 5B4TA 1REQB 4OSOA 4PAQA 4DLKA 4F04A 1X14A 4RH3A 2R0QC 3AESA 4DM3A 3U7HB 1BDJA 2AG1A 3L0YA 2BHRA 3LDFA 4A0SA 1XC7A 4A9AA 4GRDA 4YRLA 2R60A 4RVFA 1A88A 1YZTA 4UATA 5A4JA 2XCTB 2YWHA 4GPBA 3RUPA 3UN1A 1KKUA 1AXRA 1NWHA 1WP9A 3ABOB 5HQ3A 2ZYUX 3OOJA 4R8SA 1ZM9A 3ZY5A 3TECE 4PZDA 1NVUQ 3ZJ4A 3ZHRA 2JCSA 4M9ZA 3RIYA 2Q3DA 3GJ8A 2BZ0A 3FMOB 5DIFA 3WNBA 3WYNA 1V2HE 1C1XA 3FTDA 2EGHA 2ILVA 3CSUA 3FI9A 4FGJA 1DOHA 2J3LA 3R20A 4HGPA 4OD0A 1ZMTA 2C00A 1JXQA 1KI1A 2BEKA 2QXYA 1XMSA 4LVCA 3N6XA 3TNDA 4B7UA 1SC3A 5A4KA 1PWXA 1N5LA 4OHBA 5AO9A 4LA4A 3BAZA 3QPBA 1GAXA 1FSPA 1J39A 4B82A 2JG3A 1D03A 1EBBA 1GXSB 2FN7A 3Q11A 2FDCA 2VWGA 3H18A 2EV9A 3NUGA 1NDHA 2D3WA 3HBMA 3IR6A 4RZHA 3TD2A 1DWOA 1I1HA 3DKKA 1E1DA 4X63A 5DGHA 5KNCA 2YFHA 1IOVA 3O7WA 4R8KA 1KI2A 1UJMA 3M4XA 3Q8WA 4EB8A 1VPVA 1C9JA 1QHFA 2VP3A 3SQDA 4BL5A 5EP3A 1EWYA 1SQFA 2FR8C 2CB0A 3LUPA 2A86A 4NMLA 1KXZA 5ECYA 4LS3A 1VJTA 4PNPA 4XFDA 4ZYUA 5BR7A 2UUBB 4RXUA 3ZZUA 2OAGA 3ABRB 4HRYA 1ESDA 3WL6A 1Z6GA 1CFZA 1AUPA 1QX4A 3SYLA 3OTGA 3W5SA 2E0IA 3HBJA 1XTZA 4JITA 5GGXA 3DF9A 5CCXA 1VA4A 4EZBA 1PSWA 2P2CA 2Q0HA 5EFOA 4KQGA 2QD3A 3GGDA 2OB1A 4KBYA 5IU6A 1ZC4A 1L7EA 5BRJA 4ZCRA 4QIHA 5LZ2A 3RSHA 5DBIA 1ETUA 3EPRA 3SVTA 3MMZA 1E1QD 4QFBA 4LDAA 3SZOA 3P5BA 1U2SA 2WI8A 4F4FA 4RKQA 1JFRA 3CUWA 4YJFB 4R84A 3OPYI 2FPPA 5EWJA 3WV5A 2HF9A 2ZE8A 4BOYA 4GX1A 3OM9A 4Z0HO 3AIIA 5CLJA 1KEZA 1ILWA 4MWOA 1QTQA 4D1YA 3AOEA 4X1IA 5F35A 5JOQA 3WNCA 3RK1A 1HYEA 1FS4A 1PVDA 4J16C 2VSYA 1XP8A 3VX3A 3FNBA 4CUZA 1RKVA 4CU5A 4W1RA 3EUFA 4LISA 1HA3A 1GCUA 4UBIA 1GOTA 3SC3A 3AG5A 5C46F 2DERA 3WK9A 3FTCA 4X61A 5CDYA 1IUNA 2MINA 1MFZA 4IJKA 3PXBA 1E3LA 1DKNA 3HGTA 3O2QB 3O8OB 3HCPA 4M8IA 3RBXA 1IM8A 4DNXA 5A04A 2NQTA 1TT5A 2C8VA 4BX3A 1NZJA 4GX0A 5K0SA 5C4GB 2ORVA 1IPEA 1H8EA 2ZDGA 1L8XA 2Q27A 3UXYA 3CRNA 4D41A 5GINE 2VP4A 2B6NA 1AQUA 3HY4A 2FRVA 4WK2B 3EDMA 3DO5A 4II3A 1O0BA 1GPMA 4AUNA 2RCYA 4LFAB 4FN5A 3SOPA 3KVOA 3QFSA 2OLKA 4UNNA 5TJ9A 2IBSA 5KVQA 2YH2A 4EI8A 1D04A 4LWOA 5TXGA 1O96A 1SXJC 1MRNA 5A3SA 1KA9H 3IKTA 1GGKA 2DPLA 4Q7JB 1IM2A 4A8HA 2X5KO 5KHAA 2G9UA 2BH2A 2OPHA 1JLHA 3UWPA 2UZ0A 4M0EA 2EZ8A 5E9WA 3SC2B 1ULUA 3OO1A 2GNAA 2NZXA 4BX0A 1NVMB 4P80A 4YASA 1A1VA 2H57A 1MAHA 4XLLA 3PYXA 1VYUA 2ZIGA 5A9TA 3H13A 4OU5A 3OMWA 1VBFA 3C39A 4EY3A 4F06A 5KU1A 1ZUWA 5K3OA 4QXMA 4O2AB 3NDBB 3NH6A 2JI7A 5EJ7A 3EEYA 5G0WA 2ZK7A 2XNJA 3LSYA 3K0FB 2P2DA 3B1FA 3RS4A 1SB9A 1N2ZA 4OQEA 3ZYCA 5JNSA 4RWZA 4C7OA 1EVKA 2QL6A 1LI5A 4BAZA 4P4SA 3OJFA 3KDPA 1N33B 5DM4A 5KYKA 2YN2A 1CY8A 2JLQA 2WFAA 4ZVKA 4FKMA 3QENA 1MW9X 2H1VA 4B3RB 1KO4A 1SQSA 2Y05A 4XSHA 5SZJA 2FNAA 1CJTC 3V8MA 1CYEA 5ALPA 1VI2A 5BNFA 1U7PA 1NG9A 1MB3A 4R81A 1ABEA 1XHEA 3KNZA 1Z4NA 5LLSA 4IUBS 3MK31 4AQ7A 3CN7A 3CINA 1KZ1A 3ELBA 4TLEA 4R5HA 3BL8A 3ZZNA 2BCEA 4HVCA 2DPHA 4UDNA 2R62A 1ZG3A 1GGJA 1U02A 2ZSJA 2ZS9A 2UXDB 1CZLA 3QE4A 1E7QA 1S5PA 3ON5A 4B3XA 2X2FA 3QFTA 4LAFA 3C6BA 4X20B 4DR4B 2PZFA 2XUDA 3U26A 3VBCA 2Q2OA 4ZANA 5B1DA 4PG6A 1UJNA 4PGAA 4EX7A 2RGXA 4XTRA 4Z9FA 1G5PA 1U0EA 4GL4A 4MGEA 5DP1A 1CCWA 4KDCA 3MRXA 2QN6A 1W4RA 4OUDB 4RQUA 3MJVA 3RU9A 3WWCA 1WUKS 4UVDA 3S27A 1Y0BA 1LS1A 1QO7A 2FSIA 3ASVA 1QJ4A 4OF4A 4J0JA 4ASUD 1F0YA 2JJ1D 2XGOA 1UAGA 2CLDX 4NOKA 4ZP1A 1KEEA 1IDN1 1PWEA 2QSUA 4E5NA 4BCBA 4DMLA 5JSYA 2ZBVA 5KCZA 3Q3JB 2FHSA 2CLOB 4EB3A 3AUFA 5TC4A 2BFDB 2Q28A 4AN0A 1IK4A 3KQPA 3KLPX 1P5ZB 2QUIA 3Q3CA 3QVWA 1YCFA 3R7NA 3EW7A 3I6ZA 3W2HA 4C2AA 5LU9A 1VIDA 2FKNA 2OV2A 3SFVA 4PIPA 4NXMB 1JTEA 3C5WP 2YYYA 4MJLA 1JDTA 4N03A 5AKIA 2J08A 4QTUB 4W8OA 3OCXA 4FCCA 4ZGGA 2HW8A 3EW9A 3GP3A 5CX4A 1UQRA 2CNOA 5DBEX 3FOBA 5EE5B 3GDGA 4P1ZA 4KREA 3HB7A 1K06A 4LYGA 4Q4LA 4E09A 4YMLA 1QFMA 2L42A 5CIQA 1DDOA 1P74A 1J23A 1T3SA 4XYEA 4Q0MA 3ZWDA 4QKQA 3DTNA 1ZMBA 1IHUA 4AY5A 1TX4B 5BWBA 3K16A 2QV0A 2Y71A 3IJEB 2AMVA 4Q6WA 5ITWA 4IXWA 4D4IA 4DDWA 4ARUA 4YP1A 3VKFA 1WCYA 3BCSA 5JAOA 3GLGA 3BRQA 1KR5A 1LSJA 3H05A 4FFNA 1KL7A 1IZZA 4IIXA 3MJEA 1SXJD 4I1SA 3EZNA 3UK2A 3SZGA 3VC7A 4COOA 1MP0A 4YAEA 2FWMX 1UDAA 1B6TA 3HVKA 2ZIVB 3A6LA 4YONB 3VDQA 1SIWA 4H7HA 3BXOA 4BKRA 9GPBA 4N65A 2D5LA 4H27A 3PNQA 3G0HA 3WWYA 1NXWA 2NADA 4XIJA 3G9TA 4TS9A 2H29A 4DLPA 3KD2A 4L3WA 1BG6A 3EF1A 1JYEA 3I2IA 5L3SA 1E20A 1DIAA 3GG2A 2FFJA 4GD3Q 4QU0A 3K4PA 4OQYA 4G1BA 5L51A 4WSOA 1ZM7A 4WFKA 2CGEA 1TOAA 3LT0A 2QRJA 2HH9A 3S2IA 4Q18A 3OQMA 3MM4A 2C9ZA 4LV5B 2EKQA 2LBPA 5BOSA 3RRYA 4HWGA 1DSSG 5ENVA 5GZ3A 3LDAA 3EGVA 1X6VA 3GFPA 2ZQZA 4QT0A 1NBIA 3P4YA 4IJWA 5D84A 4YJDA 1B41A 2SICE 4OYRA 4ZAYA 2PEZA 4DCJA 3AF6A 1WZIA 1NF8A 3LY7A 1E7SA 1TD9A 3K0BA 4OU4A 5KOHB 3JPYA 3RSCA 3K70C 2QG6A 3KOOA 5CLFA 5JS7A 3JS5A 1JSRA 2I78A 1ZH6A 5KWSA 3FZQA 2D1TA 4U7WA 3A9VA 1DC5A 2EFJA 2O2DA 4CKEA 5I45A 1DL5A 2EZ4A 3QIAA 5KTRA 1L4KA 3FRHA 4RSHA 4FSDA 5BYBA 1M76A 2P9YA 3UM9A 2O5CA 1JDBB 1OGYA 1X15A 2MR5A 5K0EA 3DEIA 4DLUA 1QHEA 3U3DA 2CD9A 3UICA 1JPJA 1UEXC 5TMDA 5L3QB 1KQ3A 3RODA 1H4QA 3FR8A 3C6MA 3HA7A 4UHCA 2FAXA 1V2GA 1RC8A 2LRHA 5B30A 5HZHA 1WP4A 1X1SA 2CHQA 1GVNB 3GLFE 2HT6A 4GRIA 3OUTA 2BFEB 2DTDA 4FSXA 1MC5A 3DB2A 3GCDA 5CIYA 5HKLA 1JKJB 2IYAA 3MJSA 3DGFC 1GUFA 4BVAA 3P0EA 5JE8A 4EL0A 4BB0A 3SXPA 1TAQA 4ALNA 3LJKA 1IOWA 2WF5A 4P98A 3WRXA 4Q9DA 5ICCA 3COZA 1ABFA 1I7LA 2OXFA 2UZ4A 2XJ4A 3FFXA 4K46A 1Q14A 2PVCA 3OKPA 3UB2A 2H59A 2VZLA 3HXOA 1HTTA 1F8GA 4JBLA 4ESOA 2R1UA 5C7IO 4WNAB 3PWTA 4BRZA 3KQMA 4GPZA 4K6OA 2YASA 4UDYX 2FPPB 4GW3A 2JIPA 2ODNA 1KBQA 2P5YA 2VP0A 4R7TA 1BCRB 3TR5A 1I80A 1K27A 4X1IB 4YPFA 4UVHA 2WKSA 4NEQA 2A3RA 4MUYA 2AMLA 4OXQA 4BQFA 2VRCA 1JDVA 2FGJA 1AZWA 5AVYA 3R9XB 2PR2A 1IEXA 4B17A 1QPGA 3PEVA 3PFCA 2EHDA 2V5VA 4K9RA 4UTPA 3LQKA 2OCAA 3N8IA 3HUEA 3F5SA 3G0BA 1XRSB 1SOWA 3D6AA 4IDHA 4JI3B 4D7AA 1OMOA 2Q5CA 3L4SO 3C3DA 7MDHA 2AJBA 3OY2A 2HJSA 2VTEA 2IJGX 5HDQA 3O5AA 3MELA 3F74A 2REBA 3R3UA 4J0IA 4MQBA 4RVDA 3OHMA 2I4MA 3ZCQA 1H3EA 3IEVA 1W52X 1KORA 1UMKA 3BSSA 3K0KA 3UV3A 3FHCB 1PP4A 4PPYA 5KU7A 3OC0A 4MWDA 4TOIA 1R8XA 1Z6XA 4Y0VA 4LYFA 4J0QA 2D2IA 4QODA 2P1ZA 1E2JA 4FC6A 3WQBA 3AUJB 4FOOA 2H2GA 4G8DA 1QYIA 5FTMA 2XGJA 4KAAA 2FWAA 3ERCA 2ZJFA 4QULA 3ZE9A 1DXQA 1Z6YA 2V4UA 3K92A 2V6MA 4RU1A 5DYIA 4LXXA 4UPEA 3K6SA 1WHTA 2AZXA 3LT2A 2IH2A 1U4SA 1T5DX 2DUUA 3ZD7A 4W5QA 5BQPA 3K70D 2ZJ1A 4U7TB 4JP1A 3DJYA 4FT2A 4IP0A 1FFSA 1FFHA 2AF4C 2CF6A 2REQB 5KYWB 4FWTA 5M5BA 1QQBA 5EXPA 1K5HA 2V7VA 3DHNA 2V7EA 3U4MA 2OM2A 2XDYA 2H85A 4P8RA 1DWPA 3MERA 4MJXA 4RJIA 2D0PB 2FPOA 4MQ5A 4WLNA 5TV2A 1NMZA 3ER9A 3UOAB 4AECA 3I32A 3UJPA 4P08A 4ZYZA 3P4XA 4C7OB 2PKCA 5E0KB 5CBKA 4WJZA 1ZGGA 2BV3A 4RVCA 1URPA 1XG5A 2X42A 1Z5PA 4U4AA 3RHZA 5KWVA 2DQSA 3EQ8A 3VSAA 2IHBA 2IX9A 1P0CA 4FI3F 1AUQA 2YIVX 4NAUA 5AKEA 1IJKA 1HO3A 2HDOA 1NXSA 3MMNA 1HDZA 3LYUA 4LJYA 4RV5A 3T4EA 1QB8A 2FSGA 4TPKA 1G21E 1P2SA 3V2UA 2O6HA 1CX9B 3UXEA 1BW9B 2YV4A 4I6GA 4AS3A 5REQA 3A4LA 1K08A 4ZDKA 4H7EA 2NGRA 3EAGA 3I8OA 1QP0A 2KLBA 3QOYA 4IW3B 3HPRA 1ISFA 3LXUX 1U1EA 1Q7CA 2PR7A 3DAPA 1U0NA 1HXHA 3SDBA 4EG6A 1Y1QA 1N7IA 1WNTA 2GK6A 2JAUA 2O52A 3AKZA 4ZZIA 1YRLA 4RFVA 2Q5IA 3PPXA 4TXLA 4GOND 1T0PA 2OZLB 1CUJA 4M1OA 4KO1S 1YJQA 5H5JA 3EGDA 3QMWA 4GPAA 2WSSA 1XAGA 3E9QA 3S2EA 1NJ5A 4MYCA 3A3KA 1FJXA 4DIKA 1XZKA 3K6KA 4D02A 2X3UA 3IMEA 1M9NA 2FUG1 5ITSA 1U0BB 1P6QA 2WHEA 3NEYA 3PCTA 1MPXA 2WHPB 4MVJP 3WIUA 3ENVA 4P31A 1C8VB 1HOTA 1E9AA 3JCZA 3HFRA 4TLCA 5DE3A 2D74A 1E63A 2ZUTA 1QCZA 2OV3A 3VJKA 4EAAA 4DZZA 1LPSA 4IKOA 4OHYA 1SEVA 4LRYA 2R7NA 3MAGA 3GARA 3UCFA 4DN6A 4ND7A 4EYKA 2RH4A 4ZYYA 2JD2A 3G5UA 4MS1A 2YCLA 1RTTA 1W0CA 3PL1A 2GYWA 2I4LA 3Q3IA 4TMXA 1N75A 5I8WA 1KJ9A 4I5IA 4ZMRA 3EZ6A 4QQKA 3EGIA 3L7OA 1SCAA 4YAOA 4LRQA 5I9TA 4EMTA 5KBYA 4UVGA 2FU5C 1U2TA 3V46A 5CH5A 1VXOA 4Y2TA 2KBEA 5HKKA 2Q0SA 1KY3A 2KYRA 1N3LA 4HBGA 1DRJA 2QNIA 4NE7A 4ZOLF 2Q4TA 1DUIA 3F1LA 3WBBA 5K8JB 1XEWX 1Q11A 3G5MA 1YIDA 4YA6A 2IDKA 3WYDA 5BSTA 3DVRX 3NIWA 2NPOA 4LNHA 2ZT5A 4EG3A 4RPJA 5JD4A 4YYZA 5KTMA 2NMVA 2QUKA 2O14A 3DWFA 2IRWA 3T3EA 2FX2A 3W4JA 3ELDA 5B7PA 1JG4A 4COKA 1RAHA 4U0KA 3ROQA 3HSKA 3NIBA 3HVIA 4LJ6A 4JQCA 5COAA 4D3YA 2R751 3AJDA 3M6IA 4L0MA 2AMYA 2X0IA 1M34B 1E9SA 4TLBA 4YCDA 5COBA 2NZ8A 1RWNA 1RVDA 1ORDA 3ETLA 1YWGO 4RKRA 3WJ2A 3TO5A 4EHKA 2DZDA 1AS0A 2AR7A 4NCHA 1LRKA 1PJTA 1XZMA 4BZWA 5HP4A 3V4FA 5JSUA 2C59A 4ZO7A 4DS3A 1NRIA 4HWKA 5CJPA 1Q57A 4BX2A 2IUUA 3EEFA 2FE1A 3UJBA 3QPCA 4MRPA 3QTTA 3HYNA 1ZUD1 2R44A 3BOSA 2V7UA 1ODLA 2IV2X 5BOSB 1LPNA 2QDKA 3IO3A 4LKOA 1WF6A 3LIIA 3ZKAA 4QQFA 2QRQA 3PG5A 3OU6A 4GYKA 4BUJA 4TQ9A 2VXOA 1D6JA