1Y7LA

O-acetylserine sulfhydrylase complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
310
structure length
309
Chain Sequence
AIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVCRIGANMVWQAEKDGTLTKGKEIVDATSGNTGIALAYVAAARGYKITLTMPETMSLERKRLLCGLGVNLVLTEGAKGMKGAIAKAEEIVASDPSRYVMLKQFENPANPQIHRETTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPVESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTALATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERYLSTALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-acetylserine sulfhydrylase
publication title The active site of O-acetylserine sulfhydrylase is the anchor point for bienzyme complex formation with serine acetyltransferase.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 113
structure length 309
sequence length 310
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7lA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y7lA02
5KZMB 1F2DA 1VE1A 3PC2A 4ZQCB 3X44A 3VSDA 4D96A 1C9DB 2DH6A 4JBNA 1K8XB 4L27A 4F4FA 4D99A 2J9YB 4NEGA 3HMKA 5B36A 2ZPUA 1M54A 5CGQB 4OREX 1PWHA 2WSYB 2GN2A 4IL5A 3PC4A 4ZU1X 2O2EA 2EGUA 3IQHX 1Z7WA 1FUYB 1OASA 1A50B 1A5AB 2CLKB 2D1FA 3IAUA 5T6MA 4D9KA 1QOQB 2J9ZB 3ZEIA 3SS9X 1VE5A 5IWCA 3AEXA 4AIRA 4D9GA 2C2BA 2V03A 5I7HA 4XUGB 2ISQA 1KFJB 2CLEB 2RHGB 1K7FB 3SPXA 1KFCB 5B3AA 4D9IA 1UBSB 1TZMA 2CLHB 5HBGA 1O58A 3VSAA 1BKSB 1TZKA 3IQGX 2PQMA 3TBHA 5B1IA 4HT3B 4D8WA 3PC3A 4L0DA 4JBLA 1C29B 5DVZA 3T4PA 3IQIX 1CW2B 1TYZA 2C2GA 5D86A 4L28A 3VC3A 1WKVA 2ECOA 1WBJB 1UINA 5D87A 5D85A 2GN1A 1K8YB 1UIMA 4I1YA 4D9NA 4D97A 1J0CA 3RR2A 2O2JA 4HPJB 1TZJA 2TSYB 1X1QA 1J0AA 2J9XB 3R0XA 5DW0A 1A5BB 2JC3A 3CEPB 2CLLB 1P5JA 3DWGA 5B55A 2Q3CA 5J5VA 3FGPA 3PR2B 1K8ZB 1KFBB 1V71A 1WTCA 3L6BA 2ZSJA 5I7AA 4D92A 1TJPB 3DWIA 2ECQA 5I7WA 1A5SB 4COOA 1V8ZA 4KKXB 1RQXA 4D8TA 2EFYA 4NU8X 1WDWB 4AECA 2Q3BA 2ZR8A 5I6DA 5IXJA 5JISA 4PCUA 3VSCA 1KFKB 2CLFB 1J0DA 2BHTA 5C3UA 5DW3A 3X43A 1TTPB 1C8VB 1V7CA 4LI3X 4D9FA 4LMAA 5DBEX 2BHSA 2DH5A 1JBQA 1KFEB 1TDJA 2GN0A 5D84A 1Y7LA 5I7RA 5BW6B 2RH9B 3VBEA 3BM5A 1VB3A 1PWEA 3L6CA 2RKBA 1K7XB 1QOPB 5B1HA 1K7EB 5J43A 1D6SA 4WX2B 1TTQB 2Q3DA 5JJCA 4HPXB 4D9MA 3R0ZA 2CLOB 3AEYA 3L6RA 5KINB 4D9BA 1K3UB 4HN4B 4D9CA 4QYSA 1J0BA 2TRSB 2TYSB 4ZU6X 1BEUB 2CLIB 3DKIA 4LMBA 1J0EA 4HO1X 4Y6GB 1Z7YA 5EY5B 5IW8A 3SS7X 4D8UA 1E5XA 5B53A 5DBHX 1KL7A 4OFXA 4D9EA 1FCJA 5CVCA 1CX9B 5E0KB 5I7OA 4H27A 3FCAA 4L3VA 2CLMB 3V7NA 1TZ2A
chains in the Genus database with same CATH superfamily
2XNCA 5KZMB 3N2KB 3I9V6 1FEZA 3G89A 3E9CA 1ZQ1A 4BBAA 1B23P 2LBPA 3EULA 3ICCA 2H5IA 3ITKA 2KI5A 4QXAA 3C5WP 4RA9B 4RY8A 2DT8A 5EJGA 3UCEA 2ONZA 1G64A 4YN3A 2BGLA 2QTGA 5A0FA 1UADA 4WVLA 4BQRA 1BAPA 2CHGA 1KMHB 5KYYA 1HNWB 2QX9A 2PMWB 1FFGA 4OA8A 1XU7A 3A6ZA 3TEFA 3WWPA 3VPBA 1OLSB 5ELXA 3I8OA 4C0AC 1A8IA 1ONOA 5JCZA 1AMUA 3C6KA 3ENVA 2ZKLA 3HB1A 4DA0A 3F8SA 2HT6A 4B7AA 2GBCA 1PUIA 1GTMA 3E22B 4RLSA 4EYGA 1DBIA 3PICA 1GYQA 4RZXA 1B0ZA 1C81A 1E9DA 3AFOA 1MT3A 3H1FA 3ZDDA 2YOGA 3BRQA 3CRMA 3K0HA 4F2DA 2P6NA 3MMZA 3ITNA 3QU7A 4UNPA 4L76A 1AD2A 1CJKC 2HO5A 2JI7A 4HLUC 3WAKA 2BMDA 1UF9A 1RABA 3EQ6A 1PEKE 5FCDA 3VR2D 3EUAA 3EVDA 4MH0R 5K01A 4Q9LA 1LJUA 1RAFA 1GG2A 1P80A 3CXRA 2P5UA 1QV7A 3Q1KA 2FWPA 4H4EA 3W2TA 2X9QA 1K88A 5D85A 1VPEA 2ILVA 4Y8VA 3C0KA 4G26A 1UWVA 4XWAA 4MWTA 4C5CA 2LKCA 1MOSA 4AS1A 2A9OA 4GOKA 2HMWA 1B16A 5DW0A 5IVPA 1FE8A 3AONB 1H9AA 2OCAA 4L4SA 1QDLB 1SCKA 2A94A 4GZLA 3X1YA 1U0FA 3H4IA 1KFBB 1H2RS 5KX5F 5KTTA 3EZGA 1SD1A 3LHKA 3D8NA 1ZDMA 5AI8A 2ZWIA 1USGA 2WWWA 5EVCA 4YJ3B 3KTOA 4NCIA 4LNHA 3ILYA 4N82A 1CHDA 3KXPA 4D8YA 2JAWA 3T3NA 5BO5A 3HADA 3Q2IA 1NWHA 2YQ5A 4WLEA 3QVTA 3NTXA 3AF3A 4GIBA 4FZ5A 5DN6A 4FGKA 1Q44A 2JRLA 3K53A 5TV2A 3UJ9A 4C04A 3MWFA 5BWCA 1K6EA 3ELWA 3KX2A 4MARA 4Q1FA 1B3BA 3HXLA 4BV9A 5K8TA 5KB3A 3VISA 4PSKA 2JK0A 2QHXA 4OHPA 3LHFA 2AOTB 3EZLA 2ZLBA 4WCFA 4OP2A 4F1WA 4R8LA 3ZD8A 4WLFA 4PIPA 2DXIA 4TV8F 1WXWA 5EHIA 3LUGA 1VL8A 5JNSA 1KMIY 1KGSA 1UFVA 1ZH2A 2W6MA 5CM2Z 4I5DA 5ARDA 4RMNA 1DB3A 1LTKA 4TTRA 4FOOA 3GO4A 3HDQA 2ZXUA 1VIYA 2IP4A 3G79A 4WGFA 4X8LA 1JA0A 3EZXA 1EX9A 3AY7A 5JY1A 2FSFA 1EDDA 3FPKA 3W1VA 3NV9A 2IV3A 1I2AA 1J0EA 1KKUA 2RGWA 1KQPA 2YZMA 2MYUA 4TKZA 3TR6A 4DBVO 4M7WA 1M34A 1VLVA 5CIQA 2JCGA 4GM0A 4P3PA 1X3LA 4RHYA 3K0AB 1SHTX 1QTQA 4QPNA 3F1KA 3PUZA 1TW3A 4HCJA 1DXQA 4A6PA 3H0EA 4KREA 1U3DA 4H7EA 1VJGA 3L79A 4LBYA 1PZHA 4E3WA 3M4XA 3RRFA 2HRRA 4ZZ2A 1GFIA 5I9LA 2H00A 4HDKA 3H1GA 1VPLA 1D04A 1Z5WA 2AK2A 2WMYA 4B84A 5H4GA 1OLXA 2GM5A 4OFBA 1ZEJA 5JRDS 2AG5A 5JSUA 4JR0A 4TZ0A 2OT3B 4DR1B 1WU7A 2JKVA 1WCXA 4AZ3A 2IY8A 3IUPA 4DHEA 1QRSA 2XD4A 4QFCA 4RVHA 4BLRA 3MFQA 1A4IA 4QJBA 1KKMA 4BFSA 5CT4A 1Z8HA 3P0HA 3SLRA 1DKQA 3ZDRA 2JJ1D 1Z0IA 3BGSA 4NBUA 4Y6OA 3RPEA 3VMFA 3HJTA 4D9GA 5DGDA 3DOJA 1UEIA 4BP9A 1EDEA 1IN6A 2JJ2A 2CLEB 2WOJA 2PUHA 4XCXA 3TUIC 1RAAA 2IPXA 3JRWA 1V1MA 4GWGA 4P5EA 4IH4A 1HNXB 1RCTE 1DAKA 4L9WA 3QTBA 4RPGA 3QH4A 4P58A 4PZLA 1JMYA 1XNQB 4DWWA 3DD5A 1J39A 1PW7A 5BSVA 3G9QA 4W7SA 3CXUA 4JBWA 4YX9A 5DHUA 4GQIA 4YUYA 4D8WA 1E61A 3HCPA 4OIMA 3LRPA 3NATA 4NECA 4QNMA 5IMBA 5J9FA 8MHTA 4HTFB 2BL4A 3OKPA 1AHNA 2TS1A 4M9ZA 1ZOSA 2O06A 3Q8XB 3CONA 1XTZA 3VPSA 3A6PC 2QT0A 4QRHA 1YA8A 1Y8QB 1HFWA 1QVAA 2C2HA 2O2ZA 5THQA 1BW9B 3RIEA 3EAGA 5KYWA 1Q0ZA 4LTMA 4WV3A 5EMKA 3PCRB 4YEDA 5DTQA 4B33A 3JYQA 3ZWMA 2JFYA 4E88A 3TGLA 4R0VA 1BQ4A 1NU6A 4X64B 2RK3A 5DWDA 4E2XA 1W59A 3PNLA 4KIGA 1DEOA 3TOSA 3T15A 1C3OA 3SMQA 3ZGZA 2IYFA 3OA2A 5IJ0B 1PUXA 5FPPA 1KTIA 1OFIA 2OCKA 3EC7A 4PLWA 1JIVA 5F1PA 2F17A 3UHFA 3TTXA 1WDWB 1W88A 1E3MA 1E7MA 5HM8A 2XITA 4XUCA 4UDXX 1TQ6A 1VYUA 1ZG3A 3FVVA 3FTCA 4R9UC 4DJAA 2C7RA 1A96A 3HJNA 3DKRA 1NN5A 4DKXA 1JDNA 1OC4A 3NHYA 2XQKA 3IE1A 1RCFA 2FEOA 5FR1A 4ZK2A 3QF4B 4HQLA 2R65A 3F6RA 2J3QA 2JFGA 1NU8A 1PJSA 1DQPA 3M49A 1AKUA 1OZHA 2DTEA 5LP6C 2AJDA 1E2UA 4KDEA 3OZWA 2ZWMA 4DJTA 1LW7A 2H29A 4NRDA 4E31A 2PJRA 1BDBA 1E0JA 3C3EA 1VDMA 1H8HA 3GZNB 4FFRA 4JBIA 4QDKA 3VZDA 3BVPA 3PSHA 4Q9JA 3CUSA 3ZQJA 4W4TA 3ADBA 1H6BA 5GIPE 1OAOA 5LSAA 1K4YA 1DCTA 4X0EA 4HH4A 1XDUA 4TXHA 1SUAA 2VTVA 2XX3A 4NQZA 2P2SA 2CYBA 1NUPA 4XWOA 2WZDA 4L9AA 5IKXA 1E3QA 1A9QA 4YRQA 1JLHA 5M3BA 4BLVA 1BXRB 2EX0A 2ZATA 3MRTA 1IHDA 4PLYA 3E7XA 3P4YA 1EXDA 1NI4A 5B7QA 5BP7A 3ZZUA 5JCJD 3DWEX 3UFBA 4ITVA 3K4PA 4OK3A 4RQTA 3ZQ4A 1DOAA 4I2NA 4G9BA 2O8FB 2OV1A 4ZAXA 3FCAA 3T4UA 3AINA 3AT1A 4FMDF 4HP8A 4NPHA 3TL2A 4BQNA 2VUHB 5BN5B 4HDOB 3BFPA 4O29A 4A8JB 2QMZA 3O0DA 4QYTA 1BHSA 5EZSA 2NOAA 3K96A 2EL9A 1E2MA 2OV8A 3N5CA 4Q3EA 1Q95A 4QPDA 4ZCPA 3SYRA 1PWHA 1SVNA 1SWWA 1CIVA 2IDMA 4I9UA 3LLVA 2CDNA 2J6IA 4ABTA 5HE8A 4ARIA 2NAFA 3I04M 2EGUA 2ZRPA 3FH0A 5HTKA 1O87A 3IUYA 2P5YA 1CQIB 4GAEA 4RLQA 4Q7EA 3TWOA 4QYIB 4A2QA 5ICMA 5F9HA 1HY3A 1BOOA 5DT9A 1UXIA 3SR0A 1II8A 1CQWA 2XSZA 5BYBA 5CK5A 5TR9A 2A9VA 16PKA 1CUHA 1RS0A 2HD4A 4NMHA 4M2LA 4PFQA 1L8XA 2V03A 4MR8B 4ARSA 5IJZA 1UZNA 3WGIA 1R8JA 1ESEA 1VXOA 2O6LA 1MG5A 3L7KA 4P2GA 2YWCA 1XCPA 2OV4A 4QBTA 3RT7A 4F04A 3DE4X 3KE9A 1TZKA 1QO0A 1S0UA 1UP6A 1Z4KA 3KJGA 3OHPA 4V3BA 3WQQA 4FOSA 3K9BA 1U81A 4BBPA 1N77A 5C1PA 1MOZA 1T0BA 4U7JA 5J59A 1NBMD 2JARA 1JAYA 3DCYA 4CM7A 4B83A 3T4PA 4JT8A 5GAJA 4PX9A 2YTZA 5CP8A 5L9AA 4Q4CA 4O4IA 3W90A 1T4BA 4QEKA 1ZCFA 1GNQA 5D87A 3TLJA 5KHOC 4CMJA 3JXEA 2XCQA 3OFKA 3MZ0A 3H9GA 3B2NA 4UAJA 2O2JA 4DNPA 3AHGA 4IMRA 3OOWA 1FFBA 3COPA 1UT5A 4LNUB 5FL7A 3IJEB 3TE6A 5JBNA 2V6FA 2BV3A 1NQXA 1D6JA 1K98A 4LJ9A 3KEFA 5D7NA 3ST7A 2FW7A 3L8EA 3L2OB 2Q9CA 3I64A 4QREA 4CLRB 5DGHA 3TDKA 2ZITA 4LZZA 1C7EA 4V1CB 5AVZA 1E1LA 2J5KA 3AFMA 4HG2A 4DARA 4ZJYA 2TMKA 1G5PA 2BGMA 3HFSA 3L6EA 2HK9A 4G1BA 4U8GA 1KRWA 1QHGA 4MWBA 3IALA 5TGTA 1FPQA 3WGZA 1SULA 1T29A 4J7XA 4GZ3A 2YYZA 1JDUA 1U3CA 3HCNA 1EQ2A 4KVAA 1XNGA 4JROA 3F8TA 5FULA 2QD4A 3LA6A 1WHTB 2I1LA 4QQRA 3RAEC 2ZYWX 3D6NB 1W0JD 3P0RA 3ZD6A 2H9AA 1ZJ5A 3FHOA 4G0OA 2XCSB 2AEEA 3QG1A 1NAIA 3HB7A 4ZO4A 3PX3A 4WX2B 1Z29A 2IF2A 2TECE 2AZXA 1XVLA 2WSSD 4DBZA 1VDZA 4L5AA 2DCMA 4WLUA 4CT4B 1ATIA 5JC1A 3EPKA 4EYKA 3HCCA 3IQEA 3H11B 3H9CA 3LGSA 4X94A 5C1DA 1OTHA 4A5SA 5LD2B 4IMJB 2BGJA 5COAA 3SF8A 2H8GA 1JR6A 2E5FA 2QYSA 1IOWA 2HI0A 2IS6A 5JZMA 3KLNA 3Q7QA 3UJCA 1M8FA 2BCGY 2XODA 3PZBA 2A7XA 2ZVPX 1QYXA 3GRPA 4KPUB 4KQEA 2H0QA 3CLUD 2ZUCA 1LA2A 3FNBA 3G5LA 3N8NA 3QHQA 4HGOA 4I8DA 3TZEA 2PIDA 5FOUA 3UMCA 3CVXA 3ETJA 1V16A 5GGYA 3FWZA 4DY4A 5TF4A 4HI0E 1T8SA 2J4FA 3FGZA 2JAXA 1P1IA 1H6CA 3KPVA 3K5IA 1C41A 2P3OA 5T41A 1XZEA 3ZOZA 4PBTA 5L3VA 2C8KA 4UBIA 4BN5A 2G28A 4B6RA 2HW8A 2P6OA 2J6CA 4ZVVA 1EBFA 1SN7A 2WD7B 1YHNA 3OKAA 3W0LB 2HSEA 4YRRA 3ANTA 3E3NA 2G9NA 5TJHA 3ICWA 1YDFA 3JQGA 3A2NA 4X60A 1JYSA 3I9NA 4JB8A 1JDJA 4TSFA 3HYCA 2O5RA 4NZYA 3AL2A 2Z3VA 2ZSAA 1HYBA 1SXJC 2Q4TA 4JKYA 4DYVA 5DLYA 4TMYA 4DR2B 2MTBA 2PVSA 2N75A 4M0UA 5FQOA 3RYIB 2W42A 3LGXA 4A15A 2RARA 3QRWA 4RA6B 1AC5A 1TF7A 1BD4A 3VSAA 4HQ6A 4G4JA 3R6WA 3V2GA 1UKZA 2I2AA 3I6YA 1LI4A 1SD5A 1SU4A 3JD1A 4MRVA 1ONNA 2H6EA 1GAEO 1WVIA 4P4NA 5BSRA 1UBFA 3FMGA 3QUTA 4M8IA 3JQAB 5FKJA 4UEOA 3ZGYA 4WNCA 4DIBA 4L28A 4W5QA 2GPAA 4HFRA 3OLYA 4JYZA 2G0AA 1XELA 1NRJB 1P2FA 2YFQA 4DA7A 4B3RB 3EVGA 3BQNB 4JY7A 1AVTA 2DE0X 3PFKA 3K1TA 3GW8A 5LYJA 3OKFA 1SZPA 3BJMA 4LXIA 2JGJA 5CLIA 3U3KA 5BWLA 3KSMA 2X41A 5CIWA 4EYOA 4QLBA 3KOXA 5JCXA 2HCRA 2XNHA 1BXGA 5C7YA 5JFOA 3N2KA 3G0HA 1NMYA 1KI1A 1Z73A 2YX1A 2A5DA 1HEUA 5JRJA 2I4OA 1MN6A 4LWOA 4RA9A 1E9BA 5JQWA 2ZAYA 3DC7A 3FMIA 4MA0A 2HXSA 3EY4A 4WZAE 3PB3A 2CLFB 4DR3B 3UCXA 2GPWA 3MWDA 1VHJA 3A4VA 1JTEA 3KK0A 1OLSA 4YTEA 3JU3A 1HL3A 1Y6RA 8OHMA 4S05A 2FZ4A 1U0LA 2IDKA 2B20A 2G7MC 2NU9A 5JHHB 1ZCJA 5E3JA 5NULA 4EA7A 1C2TA 2ADMA 1KEWA 1O89A 4TLBA 5JLAA 3KL2A 2D7DA 5JADA 2E9SA 1CYEA 3DL4A 1W4ZA 1QKIA 2JFZA 1DJPA 2ZE8A 4QTZA 1VG0B 4YLEA 2XVAA 1Z83A 4L50A 4RMGA 2OHVA 2E3JA 1CIPA 1JUDA 3IFSA 1DRJA 1NMQA 4XX0A 4C3VA 1NLYA 4O1IA 1Z39A 2VXOA 4JEMA 5DLPA 1IY1A 1FMLA 1C30A 1U8EA 4PSCA 3NBYC 1OYYA 1R6DA 4OKNA 3BD7A 3GEEA 3OE5A 4OHWA 4XPIB 5DHRA 4BQEA 1EYZA 5J4YA 1R0SA 1GCGA 1ZWLA 2X23A 4C22A 2VVTA 1JHZA 3VX4A 4W1QA 3X0DA 2WP8J 5AHRA 2JI9A 1MDBA 1A9YA 1K75A 1ZONA 5FTWA 3HJRA 3L1IA 4F3RA 1IAQA 2H1CA 2NO6A 2X5KO 4WD3A 3VR6D 2ZJ7A 3L0CA 4I50A 1TE2A 3KCQA 2XZTA 2GPBA 1A5ZA 4FVTA 4E6EA 2JD2A 3O7MA 1F0PA 4YCMA 5KIAA 2I1VB 4G0VA 4HWRA 1H1LB 2ES4A 1CZHA 3B3FA 1N2HA 2JIQA 2ZBVA 3BN3A 3RJZA 3WJ2A 4COKA 4AUKA 1VYTA 1XZNA 4NE2A 1USUA 2BMWA 1RYHA 3LGAA 1S7GA 3TJMA 2J9ZB 1DPGA 1H0HA 3RNLA 1V7PC 1XZHA 2BKLA 1IZ8A 2NNLD 3UAOA 9MHTA 4YMGA 2WWTA 1Y5NA 1R4AA 1JLLB 1RD4A 2ARKA 1L4NA 1MA3A 4CUKA 4WCVA 5JTUA 3U60B 4QWMA 5CAEB 2QROA 3F5MA 3A9UA 2AOTA 3Q8KA 3G2HA 4XRRA 1TYCA 1TEVA 4OGFA 1PFWA 2OGWA 2QTBA 1QO9A 3QX7A 1ODTC 4R1QA 3T7JA 3U16A 3TKYA 4GKJB 4E70A 3U19A 5CLGA 3KUDA 3GOHA 3ZV7A 4EHIA 1JHAA 1MB2A 3P4UA 1YOVB 5DVZA 2HV9A 2WK1A 1P19A 1U2SA 2XA2A 3PUKA 3T7DA 4ACBA 4HY3A 1FTNA 2V0GA 4L6AA 4TV9F 5IDWA 1ZR4A 1V5IA 4M1SA 1GGJA 1TCCA 1PS0A 2ECPA 2J59A 4BNWA 2ZR7A 2R8BA 4LAFA 2YNMA 4IBOA 1XJCA 3FXAA 4NMMA 3T9BA 1QORA 4ZKDA 1Z45A 3T5DA 3B6KA 1Q7CA 2CZQA 3K0AA 3LRXA 3LU1A 3QEJA 3EW9A 2E0IA 4ZCQA 3RJTA 2PUFA 3DWGA 3QY0A 2JGEA 4JHXA 3A4IA 5LP6F 4EGAA 1GAJA 2CSXA 1ECCA 2BFCA 3AH8A 4LXQA 4PGGA 4CR6A 4JVMA 2X4LA 5AUQA 3HCOA 4WE3A 1E2BA 4DMHA 1D7AA 1HYGA 4IIHA 3X2EA 1N1GA 9GPBA 2I3ZA 4F6LA 1AKWA 1DQSA 2PZKA 3F5FA 1A5TA 3EPLA 2MIIA 2YV3A 1PEAA 1U1GA 3AVQA 4R8RA 4LGYA 3COZA 4ZICA 1J49A 3BTOA 2VBCA 4FJ0A 2IQ5A 1NXWA 2OSVA 4UDNA 3UZUA 4ARAA 5LDDC 2ENUA 1ZI8A 4J7UA 2BSAA 4NL4H 5IZCC 4BVBA 2O2IA 2PSSA 1QR6A 4KAJA 1ECLA 1GLGA 3Q6MA 3KLPX 1WMSA 3WK7A 1HXHA 3MTGA 2O23A 4WZ6A 3H3FA 3RHTA 4IF4A 3SD7A 2EWMA 1U7XA 4ZGWA 1JEDA 3UWOA 1T9CA 3PA8A 2JCBA 1JPVA 1N8KA 3D3JA 4MR9B 3AI2A 3KAPA 3SAJA 1W30A 3NG1A 3V5NA 1YRWA 3HQ4O 3CEJA 2WJZB 4HTFA 3FW1A 1LNZA 1CY1A 3L7YA 4FYMA 1EE9A 3GLVA 5IDVA 1JL3A 4AKEA 1XALA 3M0EA 1VI6A 1Y8QA 4U7HA 2BP7A 1BW9A 4W5JA 1F8UA 3QVOA 1JEYB 2QIOA 4DMMA 4JYBA 1DEAA 3OOJA 1QF6A 3KBBA 3FCCA 4LY6A 2J7PD 4CIDA 4MKRA 3KR2A 5KBYA 1ENYA 2VSXA 5J47A 1RM4A 3KJQA 1WUKS 1YI8A 3BFKA 4GMKA 4A5OA 1EK1A 4F45A 4F4FA 2B7CA 5IJ0A 1TQ4A 3L3BA 4OREX 2QI9F 3H5IA 5CNJA 2QRKA 2NSHA 1Q91A 4Q00A 2G1AA 2O2EA 2QRVB 1PO7A 3Q4GA 4H0CA 5AIAA 1X1EA 1XMVA 2AG6A 2E1PA 4KWIA 3UHPA 1L7DA 4ESEA 5KQSA 3GLIB 2G17A 2IOQA 2I78A 4C3OB 1L5WA 3FCUB 3PR3A 3TLKA 4R0MA 3QF4A 3ZVKA 3K0CC 1PR5A 3AXTA 2HMTA 5EIWA 4AF7A 1VOTA 3MCUA 2O7RA 3NIBA 4Q4HB 1XNJA 4UTVA 1X80B 2WIKA 3ZH9B 5EINA 1M7BA 4R51A 5C53B 2BMVA 4C0XA 4C7VA 1W5BA 3R8CA 3VU0A 3GZNA 3N8HA 3CE9A 3O8NA 1D03A 1AH2A 3DE2X 3LOPA 1PJ3A 3QLEA 1MVLA 4NYJR 2FW8A 3HSKA 2GHQA 1GN8A 2WJAA 1DAFA 3I1JA 4WOJA 3ZI4A 5H9WA 3I37X 2WVJA 4DMUB 4GOOD 3SS8A 5KNDD 4M7PA 2XCTB 1YBAA 4NMLA 4PXYA 2D1TA 1RTTA 1CUDA 4W5HA 4EUEA 1AZLA 3EZ2A 2BI8A 2JGAA 2C4HA 4V2IA 1KR5A 2JCXA 2NSJA 1BJTA 1FLVA 2BAGA 3CWZA 4Q21A 4RWEA 1BXRA 4AT1A 1YF3A 1FNBA 4S12A 3WGLA 4Q7QA 2W6JD 5FPTA 3A37A 3E9EA 2H18A 4IXTA 5HS6A 3VC2A 1G8AA 2WG0A 1FUIA 3TLCA 3K70C 3PG5A 3QMWA 4LHSA 1M2OB 2YV1A 4DOMA 4IJMA 4UBKA 5BN5A 3QTLA 5HIAA 1ACLA 2DWCA 2P9FA 4A8JA 2UYHA 4OJNA 4JI3B 1A2QA 3TTVA 2QTAA 5EEHA 3WIVA 1CZUA 2RAPA 2ZJ3A 3KR1A 4DBLC 2QTLA 2OORC 4OP3A 4O4JA 4ZC8A 1RXYA 4CBVA 3JX9A 4OCZA 1Q1GA 1TD1A 4M36A 3DEFA 4KQJA 4W5WA 1J0DA 2PD4A 2QQ0A 4QGGA 2VH1A 4N7MA 4V0NA 3W4KA 5J4LA 4DV7B 1CQIA 1V7CA 4LI3X 4ZQHA 3IRVA 5IT9A 3BORA 4BZPA 3AVTA 2IZ5A 1FLNA 4QYIA 3QPCA 4HMQA 3VR0A 3DZFA 4TXJA 1MH9A 1D7OA 4URUR 3OM0A 1L4YA 3NANA 3SQNA 2C5EA 2VAVA 5EJ6A 2PKWA 3RYCA 5SV2A 2YWXA 2RH9B 3IT3A 4HRXA 4M9UA 3IQDB 4C2BA 4TWAA 4MR8A 3MTEA 4R9RA 4K2AA 1C3LA 5B1SA 1GTL1 2RKOA 4DIKA 2D54A 2Z2YA 3SR3A 2QVZX 1C9KA 3D43A 3GQBB 5K3SA 3QWFA 1JILA 4P82A 2GJSA 2EYQA 2QLNA 4K1XA 4P92A 1L7QA 2WJGA 4XM0A 5INTA 2HIAA 1SVSA 1JDTA 5FPQA 3O5AA 4G07A 2JFWA 1B3RA 1ECPA 1BSVA 2PLWA 1ZNYA 3P9RA 4CPDA 4DG8A 2P4HX 4ZYYA 5ECDA 2GYVA 4HEJA 1ZVMA 1RQNA 1AURA 1VKJA 4PXAA 2A67A 1FFEA 1BU8A 1YOBA 2FNAA 4X7PA 1P4SA 3E5HA 5AI9A 4KPGA 2B69A 1E6KA 4FQ7A 4QD3A 5AO9A 3OUZA 1SBQA 2OC9A 2R48A 2ZUBA 3V2IA 2WDPA 4BLSA 4MGIR 2OGZA 2PL5A 2VSOA 3N0VA 4GLFA 3S5JA 3H2JA 1CY0A 2AEJA 2VDWA 2FN7A 1FSFA 2DFTA 2G88A 4CF4A 4EYEA 3ORSA 4LE0A 1XTVA 4TT8A 3LBFA 2W58A 3RQIA 3RVNA 1JWBB 2W2PA 4NX2A 2PCJA 4CLRA 3H83A 5HRCA 1PF7E 2WPDA 2FPOA 3F9RA 4OHOA 4ZQGA 2J5XA 5K3CA 4CQNA 3PHHA 3CT4A 3S44A 3IE0A 4HDMA 1OV4A 3AC0A 1UJ6A 4EITA 4PV7A 5LA6B 5GONF 4CV0A 3EIEA 2VBGA 4RH1A 1KI9A 3DQPA 3DZCA 1QE3A 3BGVA 4MKZA 1O95C 2IUYA 2HYDA 1TK2A 2XEDA 4QQFA 5GJBA 4RVCA 1TJ3A 1T6YA 2BGRA 1GKLA 4MIYA 4QYXA 4KMRA 3TRDA 4XWWA 4QZVA 2VBIA 1HMYA 1LI7A 2WTBA 3NTRA 3SOZA 4YCCA 2DMRA 4E30A 2J0UB 2AX3A 1QZ3A 3DL2A 4CV1A 5JROA 1A95A 3MW8A 3C7AA 1LK5A 1RLUA 5CDFE 4JH0A 4MB2A 2CFOA 3RIMA 4BKPA 3BSFA 3G0OA 521PA 1L7XA 4G0WA 1SUBA 2EFJA 2QGFA 3H11A 3IQIX 3KELA 1TYZA 1PLKA 3NBUA 4FPXA 2R1TB 4HXFB 5FADA 4LW8A 4G0ZA 2QG9A 4WBNB 2H7CA 2IV7A 2LW7A 2HLDD 3OZVA 1PFVA 1WB9A 4D9JA 1Z6XA 1W1WA 4E7PA 2YMQA 5JZBA 4KPUA 4M7OA 4W7HA 4BNDB 2XHZA 1C7JA 2C7OA 1M1YE 5FO0A 2MYTA 2WNSA 3NCHA 5IABA 1TYDE 1G6OA 1OXUA 2D00A 4UTZA 3BMQB 4DCTA 4GVPA 5JNTA 3RANA 1VQ1A 3FKJA 5IAKA 2AR7A 1C0IA 5IF9A 5CFLA 1BQEA 1C7QA 4E4RA 3R0QA 3MMXA 1IPFA 4AJKA 2EQAA 1QH9A 1YB5A 4BVEA 3H13A 1E1KA 5AXAA 4AM8A 1RJFA 1XQXA 3CLTC 4R54A 1C0EA 4AKIA 3B6EA 2AJCA 3UN1A 2MOKA 3NT5A 4JELA 4R2KA 1HT3A 1V9LA 1WMFA 2ZRHA 4HMOA 4Y2YA 2QUBA 4A73A 2VUTA 5FNZA 5I9TA 4RW0A 3AIKA 2QSYA 2WD9A 3FPCA 3TAHA 5T67A 4EZEA 2A5YB 3O0TA 1V3QE 3HNRA 1JJIA 1F2UA 1XYGA 2Z9CA 1TM4E 1T25A 4FHEA 4DQKA 4RA6A 1W9HA 2NSYA 1N7IA 2HTFA 3W3ZB 3B3GA 3IHTA 3AY0A 2Z8YA 3S1SA 4I46A 3OUUA 4BNNA 4LMPA 2FWJA 4LJYA 4DF3A 4F21A 3ESRA 2ZJOA 4TKUA 3OQHA 5AMXA 5HKAA 2VP5A 5TT0A 1I0IA 2XDYA 2RHTA 4IINA 1GSAA 3TRKA 3FDFA 3ZWDA 2B34A 1WV0A 2RGCA 4B3JA 2YOHA 3GQVA 5B3LA 4GW3A 2VP0A 1RYEA 3O82A 4C30A 3WSWA 2QDXA 4ZJPA 2QU8A 2FTKE 3ZJUA 3WFJA 4DUYB 2XUJA 5CG1A 1ENPA 2G1JA 2OM6A 1BFKA 3JQ7A 3N9IA 3OO1A 4IIVA 5IARA 3RSQA 1IONA 4UHCA 3T1YB 2I7TA 2DLDA 3SQMA 2W6PA 3DDNA 1NUSA 1ORDA 3ONEA 4KZKA 1F2VA 4E09A 5AW1A 3OQNA 3LXUX 3EZ9A 4GMFA 2LWIA 2QG4A 2XTAA 3N86A 1MJNA 3Q3GE 2B8JA 4IICA 4RAQA 1PJAA 2OZLA 3CGWA 5CDGA 5DNYB 4G24A 3QE9Y 5HJ5A 1KY4A 4MW7A 4XAQA 3AL0C 3WLJA 4QOHA 1DI0A 5KVQA 3GPLA 3ESAA 5JNVA 1G8MA 2FI1A 1APBA 1M1ZA 1M83A 4NBRA 3RCBA 3D0OA 2AF3C 4GR4A 3O38A 4DMLA 1OFVA 4CKCB 4KFSA 1QBKC 3SLKA 4YRCA 3OTGA 2OGSA 2PX8A 1B0AA 3TTUA 4EKIA 1N7HA 1YGPA 2KJQA 4IZOA 2Y0BA 2WFLB 4MV6A 3B53X 4IM7A 1EK6A 1K2VN 2R9VA 3DB1A 2GF0A 2JHAA 2K5UA 2NG1A 4ZT7A 1FY2A 5TMDA 1CY8A 4KFTA 1RBZA 1ONSA 1YTLA 4IH1A 5EXTA 5FLEX 3WRXA 1BJRE 2OBYA 1O5OA 3MWLA 4OQLA 4B4VA 3MXTA 4DR6B 1UZAA 4XPIA 3GLTA 1FFWA 2XDAA 2G9UA 4HXYA 2ZFUA 2WV9A 4OJMX 4HNTA 1XCGB 1W96A 2OXTA 3K9WA 2XTMA 3OY7A 1TZJA 2VP2A 3AZQA 2XB9A 3W6PA 3LK7A 4C14A 5HQTA 3PLAE 2ZRKA 3QFHA 2FHSA 4UCQA 5EXPA 2WJIA 1CDDA 2PQ6A 4IDEA 3SYTA 3NYWA 2HZ7A 2J3MA 3DWIA 3EXHA 5I7WA 1ST3A 2XEXA 3GZTB 1W94A 2OVBA 3W3AD 3ZE9A 1H1LA 3HB0A 4X54A 1ELOA 2BT4A 4YV2A 1QPZA 3O4JA 2EHJA 3C6ZA 4PCUA 1EE1A 4YRLA 4PLGA 2O7VA 4QTYA 2ZRIA 1GL3A 1IEXA 2EQ5A 3MQ2A 4XVQA 1CCWA 2DR2A 1Z9BA 2H65A 1I3KA 3LUHA 4HGRA 2IVZA 1OLUB 3GI1A 3WLNA 3ZKAA 1WU8A 1PG2A 3R3UA 1QCDA 4XJSA 2WKQA 3DDHA 1QIKA 3L8MA 4NHEA 1X86B 4MUBA 5ALWA 4EGQA 1J9EA 1FP2A 3H99A 1AQJA 4LKOA 2VTDA 3L02A 1A1SA 5CAEA 5TMPA 1OPXA 1Z5UA 5MFZA 1ULTA 4U02A 4GR9A 4FYIA 5ES4B 3M5PA 2QF7A 4YFYA 5FOTA 4D42A 1QIGA 2QRZA 4R83A 3G5AA 2AYXA 4N0QA 1VLHA 2YYSA 4BMXA 1N75A 4OKIA 3V00A 4NF2A 3SLGA 4B34A 4C05A 3L0ZA 2ZI6A 1BXKA 3O4VA 3PRKE 3ND7A 5BQ5A 1YOVA 2FQWA 4J0DA 4NS1A 4RSHA 1CUWA 5G0WA 5H4HA 1RLJA 3QYJA 4CM5A 1TGYA 2I6UA 1P81A 2XKAA 3E9YA 1DAOA 2AKAB 2OAEA 4IWNA 2B30A 2XNSA 5DK6A 5BWBA 4X95A 4BJ3A 1WXXA 4D98A 4D9EA 4D0GA 4IO0A 3DZIA 4GGMX 2IYPA 4PYOA 4R2HA 1FFCA 2GEKA 3C3AA 3SYMA 2GAIA 3DDOA 1TIBA 2BPOA 4I5EA 4JB0A 1INLA 4QVKA 4WASA 1F4VA 2YZNA 1SCAA 2BGNA 2HMAA 1KF0A 1B8UA 4NMWA 2DHCA 3MJTA 3LM8A 3OH8A 1KK3A 2A4MA 7MDHA 1VJ5A 2I65A 3Q5DA 4X84A 5AJYA 4JWTA 1KAQA 1DIRA 4UC0A 3HLKA 3HXPA 2WU0A 3TF5A 2ID9A 4V0SA 1GPUA 3F8WA 4K8RB 4EA9A 4XYLA 4ZZ0A 1JDBC 1TTHA 3FI9A 3DEIA 4MVJP 4O2LA 2VUUA 3PI6A 3LP5A 4JHLA 4MS4A 3PQDA 3WWEA 3IOBA 1H4SA 1UOQA 1JR3A 3BFVA 3JQ9C 4JUFA 4W1RA 3WJ7A 2C9BA 4Z4EA 3MWKA 4BZQA 2B7LA 1HPLA 3AEXA 2EJUA 4UJ5A 3BD8A 2Z4SA 1AS0A 4O5OA 1T26A 1ULBA 1JEJA 2B0CA 3C7DB 3WGGA 1N6NA 2WSMA 3N2IA 3OT4A 2CXTA 3PKZA 4PBSA 3PITA 3CJRA 4BNKA 2G83A 2GKGA 3GA0A 1GU1A 2XNDA 4HAWA 5MHTA 1UPTA 3C8HA 2WZCA 1L4FA 3T5CA 2AH5A 3PDIB 2QN9A 3K71B 2JVJA 1Y5IA 4MR9A 1YXMA 3AHEA 4ML3A 3P9IA 2AN5A 2PD3A 1OIXA 3LUKA 3Q3HA 3U2QA 3Q0EA 3R44A 3ETLA 5F2KA 2IHVA 2VSYA 3BCRA 3OCXA 3HACA 4R0NA 2X0IA 2OO7A 4JC5A 1U2DC 4ZA2A 1JEYA 2DBZA 3DNMA 1YQDA 3GRUA 1DBRA 2Q3CA 3O1HB 1WTCA 1AK9A 3VZRA 4CMIB 3ZW8A 5TX7A 4IAOA 4QBFA 2NO1A 3WB1A 1QHYA 4GM4A 3GBVA 1LI5A 3JZIA 3PKIA 5IPFA 1FJHA 4EJSC 4ZTBA 2OBFA 2V96A 3UIEA 3U80A 2FLKA 2GBFA 1JXQA 3NHRA 1FYXA 2OMEA 1XE3A 2QRVA 2W8ZA 3WLFA 1QP0A 3RT1A 3MQ4A 1LRJA 1WQ1R 2B5OA 1IQUA 4BGEA 4DFDA 3GLIA 4U7TB 5IAGA 2BEKA 2ORVA 2HHCA 1U2QA 1KZHA 1JEQB 2H0AA 4AL4A 3OQMA 2O3TA 1IC6A 1PAUA 4MP8A 2ZIGA 3AM3A 3HA7A 5EIHA 2AZ4A 4Q4HA 4MVJF 3LY8A 1X80A 2G72A 4AW9A 2WABA 4A91A 5E7MA 1JI0A 1P44A 1MAWA 2CHUA 2OXCA 2WHXA 3HB4X 4PHGA 1CZOA 1T2DA 4RACA 1UC9A 1WB4A 4HYTA 4PNHA 3ER8A 1JKMA 1H2EA 2LTAA 3H1PA 1JX6A 1PJ8A 1YL5A 5IXYA 1ULAA 2ZRLA 5EMHA 4ZVTA 5BW4A 4OM7A 4X3CA 1B7GO 1Z2AA 3FUXA 3HG7A 1Q15A 4EMBA 4NV3A 4AI6A 2R8OA 1QK4A 2PU7A 4XCVA 4G5HA 1P3Y1 3AGPA 3T1HB 5TQ2A 2DT5A 4AX8A 4BY9E 1E2NA 4GPTA 4C0HA 5A05A 4DUZB 2VRCD 4N76A 1SOUA 4Y2VA 2ZIAA 2IPNA 1TAQA 4IHJA 2CD9A 1CQZA 1SOVA 4X00A 4YMWA 3S8EA 3DOHA 1M2OA 4D96A 1W36C 2BMAA 1QK5A 1LSUA 4B79A 1DLJA 2VCYA 3GT3A 4FB5A 3ABZA 4UNQA 1L3CA 4OIFA 4J2OA 5FFMA 1J6UA 1E5VA 2B2NA 1HDEA 4MHTA 4R1SA 5ALLA 1Y7TA 2I4IA 4UNRA 4E1BA 1Z7WA 1SPXA 3HXTA 5SYNA 3O2JA 1NNLA 3KB2A 4FMBB 3UWMA 2D1FA 3RW9A 1JH9A 1TA4A 1NN0A 2VYNA 1QH1B 3I4FA 5IT0A 2Q8PA 4LF7B 3EFBA 2GFHA 3L46A 4PZDA 4HX9A 4MYHA 5EZYB 3HO1A 1A9XB 4OK5A 1EP9A 3D7NA 3G1UA 3WHLA 2O1SA 2GESA 1USIA 3MS4A 5FTKA 5CT5A 1OA0A 1X74A 2YJ4A 1D4OA 2JBWA 2WKPA 3C1OA 3SIWA 1YR8A 2A3RA 1FSSA 3ZQUA 4MW5A 1G3MA 2GASA 3K1AB 2YHUA 1DG9A 4EG7A 4UOQA 4G8CA 4LRQA 5TS3A 4Y9UA 5C3MA 3CR3C 5BOSB 5IBCA 1NRIA 1DBVO 4WFIA 3E2MA 4A3SA 4JI2B 3CUVA 1LRKA 4M6WA 4OK6A 1EI9A 4NJEA 1ZL2A 5F2NA 1IJBA 1M2KA 3A2LA 5CD1A 4IXWA 4F56A 5SY9A 3HA3A 1CS0B 1L6RA 3OEYA 3RWBA 5IASA 1UT8A 3RR2A 3S3TA 1I4LD 3CVJA 4EY3A 2I91A 5JNUA 1MJFA 5IRCD 3GFQA 2VHQA 2JCSA 5GVRA 1ZMTA 3P2JA 3H7IA 3UMBA 5KVAA 1TKRA 4D6XA 3MM4A 1CUCA 2F3TA 3T7KA 5FUMA 1I13A 1WDTA 4IIBA 4YXFA 2CMGA 1YB7A 5IDYA 5DCLA 4PCVA 5JAQA 1QLHA 3LQRA 4PPNA 4XR9A 3SP1A 4KDCA 1WXFA 3NIGB 2A57A 5IJXA 1LJLA 4AYWA 1M8GA 5T8KC 2DQ4A 3BDIA 3LJKA 4LJ5A 4MTCA 1H94A 2HH9A 2I2WA 4BO7A 5E2BA 1LQ2A 2CHFA 1XYVA 3B20A 3BA6A 4PC1A 2G6BA 5LOVF 4FDMA 3SDZA 1KOLA 1I7NA 1RKVA 3J81A 1KVQA 3KB8A 2V7XA 2WIJA 2XGJA 1TNDA 5ETJA 4ACAA 3R3JA 2YFYA 4G85A 4QFDA 1NDHA 2B8NA 1QIDA 2HCFA 4GL4A 1CUBA 2XUGA 3CO0S 3RTBA 3IP8A 5ALOA 4BX3A 3VBCA 3TDMA 2SKCA 2EP5A 1TKBA 2J0UA 2RKWA 4Q4AB 5GPBA 1EA7A 3EZ6A 3KO8A 2IBMA 4CTKA 1MCZA 4HSGA 3F67A 1WV1A 2XYHA 3I73A 3LYAA 1MG0A 1S7CA 5DASA 4DPLA 5HIJA 2TMDA 4PYNA 4J6FA 3ZW7A 1PV1A 2R1TA 4BKMA 2VI5A 2W98A 2UYGA 4Z6KA 5A9RA 3DPIA 4U6NA 5B53A 4RHFA 2VP6A 3DBIA 2OR3A 4CIVA 4YQYA 1CQPA 4XIFA 4AN1A 4H3VA 4KLAA 5HILA 3SC6A 1QXSA 1K4MA 1AKRA 1XTQA 2D1RA 2F48A 1WUTA 2VJLA 1F8FA 4JDPA 4ZVNA 4GPBA 4ZMBA 5C5EA 3X44A 4GKVA 1AA9A 1E4EB 2DH6A 2LKDA 4HAUA 4IX9A 3RARA 3BMQA 1VKOA 1IU9A 4B3DA 2K7FA 1Z35A 5EJEA 1KA9H 2B21A 2AQIA 2HN9A 5H1YA 4E15A 2BBTA 5E4TA 2QL5A 4ZU1X 3DEKA 4WECA 5CBKA 3UMVA 4F1JA 2X3FA 4A6XA 2WOOA 2JIZD 4UBLA 3WLAA 2BI4A 4WRRA 4FYWA 4ZO9A 5IUJC 1T2UA 1R6VA 5F1OA 4CUJA 1OBOA 2LCQA 4DLTA 1K86A 4D56A 5KTRA 2F1KA 1B1AA 2R8YA 4UVHA 1V47A 2BUCA 2O57A 4I8IA 4IUCS 3T7AA 4LECA 3VI3B 1LXCA 1FDTA 4EKYA 1I2MA 1NVAA 1R9NA 4OUDB 1P3JA 2VAWA 5BW8A 4M0CA 4ZCMA 1JPJA 3GLGA 1EK5A 3FOWA 3IODA 4KXXA 4QYWA 2PXAA 2B78A 2YHIB 1BKYA 5I4CA 5BYJA 3AUSA 3O47A 1FVOA 1NDQA 3T7SA 4BMNA 2GKSA 2PX4A 3FHJA 1E7SA 1G5IA 2ZIZA 3IP9A 3ZCRA 1CY7A 3DG9A 3FMPB 2BGWA 1ZZGA 3EGEA 2IW3A 1GFZA 3EDCA 5EJAA 1WHSB 4QT0A 3LC0A 3ZZTA 3DV9A 2QMUA 2PAAA 4KXLA 1SXQA 4CKXA 1Q7TA 1AO0A 1KH1A 3IT1A 5IM4F 2REOA 3PUJA 4WEQA 4KZPA 2JNWA 3F98A 3M6IA 2F1JA 1YAHA 3KXLA 1DNPA 2V5VA 2YMMA 4TWZA 5ALQA 4JWKA 4AN0A 2BMJA 5AJZA 1ENOA 1PS9A 4RIEA 3JPWA 4UHFA 4KO8A 4WMLA 4YAOA 2WILA 1L3IA 3MWEB 3NTVA 3OAAA 3VJKA 4BYMA 3MTBA 4L8WB 3OCJA 1NTOA 4PQRA 2B94A 4TLCA 5TRTA 4KKXB 3TQSA 1V41E 5F7XA 3AJ9A 2XYGA 4C7MA 3RAFC 4RF2A 5IC4A 4I9HA 4CU2A 1Q1QA 3AR2A 3QVXA 4FX2A 1S8FA 4PNZA 4U8HA 1ZM4A 1NXPA 1JJBA 3RRXA 3H84A 1D2MA 3LCRA 1GPMA 3AVVA 4Z0HO 1PVDA 1JDPA 2FFQA 4N8EA 1MHPA 1WSBA 2FMXA 2JIOA 2QTVB 3EODA 3WO0A 4KR7A 4CF7A 2P77A 5IVKA 2HM7A 5KWEA 1KZGB 1BWRA 5EJFA 2O8EA 2GPYA 2HIGA 1CV2A 2WA2A 3NAGA 4YQZA 4CKCA 3U56A 2P11A 2B4YA 4Y2UA 5BV2P 5J43A 2Z56A 5DK4A 2WUDA 2R6R1 2IH5A 5A4AA 1XAGA 2WFLA 4PIMA 4DKJA 9LDTA 4C7OB 1ISGA 2E4YA 1T6NA 1XPRA 5JWRA 5C4MA 2DFLA 2BBSA 3C48A 3ZDAA 2OHHA 3KWJA 3W6OA 1LJ8A 1W1UA 5JDIA 4KE8A 3CLHA 3U4QB 3AEUB 3TFWA 2IA5A 3O2QB 1KRHA 3AOEC 5JS1A 3K8ZA 2P27A 2PLNA 1D1SA 3G2PA 3JPYA 3B60A 3IIJA 4ZRMA 1FUEA 1D0VA 1XTSA 2FEKA 3FR8A 4PHHA 4Y9RA 2FPMA 1RQPA 4HNQA 3VO1A 1DL5A 2H5LA 3AR4A 4WXPA 2H4XA 3GZ4A 1JG6A 2VNIA 3PXDA 4Y9SA 2YWHA 3UJ6A 1DBQA 1GZSA 1H2HA 1R0XA 2IYEA 3THXB 2ZTMA 1RRVA 3GAMA 1R9GA 1REQB 4FZ3A 5KDDA 4D8VA 1DT5A 2QOEA 3AESB 4YCNA 1ZK3A 3KQQA 2NSLA 1SIWA 2C3PA 3KHUA 2AWNA 4JLPA 3I9MA 4G1FA 2IUUA 3DO8A 2XY4A 2GCOB 2A59A 4D9KA 3HVUA 2FPGA 1SIOA 2JGLA 4GFDA 1OLUA 1SKAA 1J2RA 2W48A 3PJEA 4NAVA 4A9AA 2FDXA 2FWNA 1P4AA 3QXGA 1HZZC 2FDCA 2EERA 1R6TA 4WKCA 4UZEA 2UXCB 4PZ9A 3EPRA 4EA6A 4GXTA 4RKRA 1CFJA 1H2YA 1XMPA 2WY2D 3CG4A 3TCNA 5JH7B 1DKRA 2Y8EA 2GN8A 2GBIA 3CTMA 1IBRA 5A5EA 2X76A 5JC8A 2ZSBA 5IK2A 1H6DA 4DDVA 3VKVA 3ILSA 3V8PA 3MUNA 3AEZA 3BWEA 1Y3IA 2ODNA 1UXOA 4OGGA 3BAFA 4QGBA 3DOFA 2GBLA 5BRNA 4ZIRB 3ZTWA 4FGUA 3NGMA 1R15A 3QW2A 3PXEA 4TWJA 1JG7A 1DU4A 4YXWA 3I9OA 3AHCA 4RTQA 1NONA 2EAUA 2X77A 1NY5A 3TUZC 2G71A 3GBPA 3MEQA 1CUSA 3CY6A 4DWOA 1J4AA 4L1KA 2AI3A 3FGPA 2SHKA 1BE1A 2BGTA 3E4DA 2PKQO 3B6JA 4I08A 2PXXA 3FPLA 1ANKA 4CRWB 3N3AC 2O19A 1RQ7A 1M6HA 3MTIA 4YJDA 3RBAA 3IESA 5DI3B 4AB1A 4Q3KA 1JIIA 3KZOA 5L3ZA 5JQGB 3C1UA 4TL6A 4Y6SA 3I32A 1J22A 1Y82A 1MRNA 1CUIA 1IY2A 3OWOA 2EJTA 1P77A 4TMFA 1TJ5A 3OHMA 1GUFA 3Q5GA 4UQOA 4M0LA 1SBYA 3ELYA 2GZDA 2H2HA 4JR1A 1KEPA 4Y2XA 3T7RA 2QJRA 3RS3A 1C1YA 4KO2S 3HEBA 4GOND 1L4HA 2I66A 2WKSA 3BE4A 4WWHA 3O95A 3VR5A 3TQOA 3KT8A 3QYFA 1NQ5A 4HMPA 4NY1A 2PS0A 3IQXA 3RWOA 4GEKA 2FMFA 3B1XA 1E6LA 2OE2A 1VRVA 1B1CA 3K1ZA 5BMOA 4KFUA 1E89A 1G9XA 1OZFA 1UKCA 2CJYA 2XMCA 1LNSA 1SKBA 1JSCA 5IC5A 4KUGA 1ZI6A 3PJFA 2O52A 1XU9A 1ID8A 1E8NA 4HDSB 1JB9A 5EWMB 1S96A 1IEVA 4OJKA 5H80A 3C7KA 4KB5A 4QYSA 4TQ9A 3PDIA 2VUSA 2X8WA 3HLTA 3JALB 1T1EA 2FPKA 2WYIA 4UMDA 4XUEA 3V48A 1T13A 4GX5A 3GH1A 3OZGA 4RK6A 4WCFC 1GT6A 1NKVA 4MHOA 4BE7B 1X1BA 1ZGZA 3I6IA 2JS7A 4BMSA 2FUCA 3DTVA 1Q3HA 1P7ZA 1Z17A 3H17A 1TZ2A 1XRQA 4RZSA 5HTOA 4KVGA 4KFRA 2OHFA 3ETHA 5IT5A 1MQ9A 3AW8A 3AB7A 3FNFA 4ZVLA 3M4YA 1H2WA 1R74A 1Z37A 1JQJC 1E2JA 2HQ1A 2ZUSA 3CHYA 4RK4A 4QPZA 3RVLA 1M7HA 4BDTA 2QX7A 5E1OA 2RHWA 1ZK2A 3QPWA 4UPDA 4WTOA 3KWFA 3TW0A 1P2BA 1Y5MA 1Z6QA 2F3RA 3MWJA 3KFXA 3HBFA 1JHMA 2G08A 5CMLA 1ZM3A 4KI0A 3ZCUA 2RGBA 4F4JA 1VTKA 1WUIS 3F97A 3LS2A 4JUIA 1HG1A 3QIAA 3GUUA 2WHEA 3D7SA 4Y0AA 3DBLB 1I4OA 1U1IA 1FL9A 5IWAB 5ENZA 1G8JA 1YZQA 5IKEA 1WIWA 2YS6A 3BL8A 3KSDO 2OFWA 1N2BA 3ADKA 3WWZA 1PP4A 2RHGB 5KHAA 1J21A 3KOWA 3TLMA 3TJZA 5H7XA 5DBIA 2O8CB 1CLUA 3UXYA 3DBRB 1ZU4A 2ZS7A 1F0YA 1ZM9A 2NV6A 3BOSA 4BO5A 2WM3A 4O8CA 3TECE 4V2UA 1M2VB 3PK0A 3QHAA 4C4SA 2V9CA 3G3EA 2XR1A 2GETA 4Q93A 3KKEA 4Z9FA 5EYPB 3CWQA 3U0VA 2NO9A 4E2FA 5JANA 5JAMA 4KIFA 1CQXA 4PU0A 4HXGA 4UE6A 2VR1A 3IHLA 2YL2A 4TXNA 5DCYA 3UOGA 4C1NA 5CA0F 4DIMA 4S1OA 3ZWAA 2QNRA 1S8OA 3IP1A 1THGA 4ZYZA 4GLBA 2HBQA 4ZVUA 2ZW9A 2ZBQA 2AI1A 3QF7A 1Q84A 1UXKA 2XXAB 5LBIA 4NU5A 4TTJA 1LKZA 5LFAA 4B3MB 1VSBA 1RI1A 1E1YA 2LPMA 1ZXLA 4LOJA 3BL6A 2JGDB 3NJ4A 4LOAA 1XTKA 1PL0A 2DWPA 1R0KA 3OCUA 4MUGA 2HIMA 3HFGA 3BCHA 4G0NA 4ITUA 2W2KA 1T5LA 4M46A 5HQ3A 1T5HX 5I6DA 1IG3A 1AGRA 1ISPA 1XSEA 3R20A 2IY7A 4YJGB 3IA7A 4AZWA 3V8NA 5LXTB 3U44B 3V55A 2BZ0A 2C8JA 2VL7A 1F38A 2XMDA 1GKYA 5WRFA 2H08A 2XCIA 4DDTA 1OFUA 1PNQA 5EZYA 4RD6A 3C41J 3UHAA 5LNK6 1A9XA 2VSQA 3R3HA 3KTAA 3TBFA 4US0R 2R4QA 3KPJA 3PDWA 1FRQA 1LLFA 1YT5A 1R5OA 2GGSA 3HZRA 4RPLA 3IQZA 5KUTA 2GJ8A 4ASUD 2H1FA 1CUUA 2NQ2C 4HNSA 4RHCA 1QGUB 1CR1A 2HJGA 1OIVA 1RPTA 3W34A 1XRSB 2ZRAA 4MIOA 1A8UA 3RLFA 4Q3BA 1GP2A 4XB2A 3A0RB 5BOSA 3SE7A 2IH2A 4PZYA 1J5XA 2FP4A 3B9BA 4HOYA 4I1OA 4ZJZA 2GYUA 4HX2A 2I2XB 1HO3A 2HOQA 2VHXA 1H2BA 5KVVA 2X1MA 5HZMA 1RMQA 1T0IA 2ECFA 3QKTA 3CINA 4MIKA 1OAOC 1W44A 1Z3IX 3C3BA 2NWQA 1TK3A 3HH8A 1VLQA 3RSHA 3TOCA 3TD9A 2XI4A 4HDRB 4U6QA 3RH0A 2QX6A 2LVBA 2WYOA 1Q83A 3AM4A 1TIKA 4JVLA 1NVVQ 1CUYA 4MZXA 5EKXA 1NURA 2YHAA 3IAFA 2VPPA 2CFRA 2EOAA 4HQFA 4P34A 4BXOA 4QA9A 3FSEA 1SC9A 4ZVKA 1G5TA 4FBMA 2ZJ4A 3X1KA 4CTNA 3WMRA 4C3ZA 1XXHE 3QUCA 1MZVA 1KO1A 3UCFA 1V37A 5EJ2A 1H8EA 5BMVF 2IEBA 2DPHA 3STUA 2V6IA 1NFQA 2ZJBA 4WESA 2IHNA 3P9CA 1MJ5A 4M1EA 2WYUA 5BT9A 1HKUA 3ZE8A 2O2XA 4RPIA 5EP4A 5EWJB 1UM9B 3DTTA 1KFJB 4MUEA 5AQ1A 3U4MA 4LDJA 1OGJA 2ZRNA 3D8BA 1H23A 3GZJA 2VDLB 4D81A 1Z63A 2BEWA 3O93A 3KJXA 1ZXBA 4RM3A 3R7DA 2G25A 4Q47A 1T0PA 4Q4AA 4P3NA 3VUFA 3FE2A 4G01B 4JGIA 5JFGA 3DDCA 1WAMA 1WDMA 4NYIR 2Q1UA 4P9NA 3T5MA 5JAUA 2PUEA 1NPTO 1ZUNB 2OHXA 3O6VA 1XHEA 5DTRA 3U5ZB 4X91A 4NXNB 1XCLA 3H65A 3MJDA 2OYRA 1YKFA 3JQPA 5LKAA 1U2RA 1YJ8A 2HRDA 2HWXA 3KVVA 1OI3A 1U2ZA 1HQDA 3IO5A 4OHMA 4R1PA 4TTIA 1EDZA 3REFA 2GLTA 4PTYA 3RTGA 5KVSA 1LPPA 1PNOA 4O2AB 3ZNPA 1TU4A 1Y7IA 3F96A 5D6NA 2JC3A 2JA2A 1T91A 3GUHA 3LF1A 1FSPA 4ARVA 1Z22A 3QENA 3AI7A 1F51E 2RGNA 3D8HA 3I1YA 1S01A 4PINA 5ILQA 2VATA 2VAPA 3FROA 3L1HA 4Z8YA 1B4DA 4N47A 1DELA 5HOQA 3KU4A 4UMFA 5E8RA 5ER6A 1DC8A 1DSSG 3MJ4A 5F7JA 5LP1A 3OECA 1J42A 4XIJA 3RV4A 5AW0A 7MHTA 2FPPB 3TD2A 2ZB2A 4ND6A 4LYJA 3S1AB 4BL5A 4TYYA 1JSXA 2AWOA 2C97A 5FRDA 5GIOE 1DCFA 4MV8A 1JQ5A 1X1TA 2IJGX 1MENA 3DYBA 5B3JC 2MSLA 3GGPA 4HN9A 4KMOA 1SG6A 4OUDA 3IPXA 1MKYA 3QOXA 5K3FA 4DNOA 1FQKA 4BE4A 2RKBA 1SK8A 4W9NC 2YHIA 2P8SA 3WGNA 4O1MA 3G02A 1XFAA 2ZYGA 3KQLA 5EIXA 1MJGM 4PZUA 3VVCA 3I6QA 2XYQA 3OIDA 3NXSA 1D4ZA 3NEYA 1RFLA 5TXGA 3KKNA 2X5NA 1QSGA 1U9IA 1CFZA 2PGLA 4YONB 2ZUEA 2HWUA 3NVAA 4AKSA 1I7LA 3R6LA 1O77A 1WLYA 1HE4A 1QG4A 4KWEA 4PCAA 2GN9A 5LWQA 4ZI7F 2VNJA 1XOIA 3EGXB 1BXZA 4ZCSA 3GLFE 3MOIA 4MV7A 2O5VA 5CYOA 4CCAA 2G5CA 1RHRA 2DQZA 3A6JA 4GPIB 4Q37A 3O8QB 3VR2A 3SDBA 3SOPA 1KL7A 2EWVA 2JFHA 4MO9A 3KR9A 5CLHA 4I55F 4O4LB 4Z4CA 1CJMA 4F9GA 1ODSA 2C9MA 2QV0A 4IQ8A 2WV7A 5LIPA 1F2DA 1TU0A 1JLRA 1V4NA 1NVMB 2WUEA 4HSEA 4PIVA 4TLAA 5ILGA 3ZD7A 3MWEA 3LVBA 3DT9A 2W9XA 5J2UA 3A6FA 3IDSA 3SZ3A 1YRHA 2UYOA 4NCKA 3JQFC 4MW4A 5FLYA 5AK3A 5I48A 3GLSA 4IMPA 3EASA 5AK0A 2R79A 3HKDA 1TYAE 3WRYA 1XFDA 2XVXA 5FD8A 2QN7A 3MUEA 2RI6A 2CDAA 3NJRA 4UVIA 3A1VA 4LGMA 4ZOAA 3WZLA 4ZZIA 2FQ1A 3UUFA 3FLMA 1C7ZA 1LF0A 1Z6TA 3QJ5A 4J1QA 10MHA 1GIAA 2I7DA 1HR0B 2VYQA 1ZOOA 2QTVA 5F52A 3VU3A 5A0TA 3NWOA 3Q98A 1P7VA 3T1QA 2B1GA 1B6TA 4MUJA 4MJ3A 5FTNA 1XQ1A 2HWKA 1Y3CE 2G8NA 4OSPA 3BPSA 2QEQA 5FBVB 5TVKA 3ZUPA 1A2OA 1VHTA 4PWYA 3DT6A 3WAJA 3RO7A 4GYYA 3AWIA 4C7OA 4DCGA 1RYBA 2C2KA 2JDIA 4Q01A 4X61A 4AJLA 4EZBA 5J4VA 5AW3A 2WWFA 1Q14A 1FQJA 4TS3A 2I4RA 1RJGA 1EFDN 4KQFA 1KE1A 1DKPA 3AEUA 2B25A 2QUZA 4PTZA 4EI2A 4Q7LA 4FMCF 4S1PA 3GG9A 1WNFA 3QXSA 1G2IA 4MKIA 3I4CA 4M1YA 1U3TA 4MPJA 1SBTA 2QZPA 5E6RB 4B2YA 1V7QA 4N5NA 3OIGA 3C6QA 1ZC4A 3CURA 4MWSA 1Y1RA 4ZZ1A 3NOQA 1XVUA 1TM7E 2VPTA 3GEHA 3TMYA 2NNWB 4DDUA 4HQKA 5DCUA 5DX1A 1T5IA 1FFYA 1D4FA 1V8ZA 1REQA 3EDYA 3FMFA 4OVKA 4PG4A 1QAQA 2DC1A 1HLGA 3CWCA 2OY0A 1NF3A 3W5IA 1E5QA 3H9JA 1Q0QA 2W71A 3KKMA 1JHRA 3O1JC 4YNBA 1UQUA 3GAZA 3QBJA 3R77A 4HL6A 1JBEA 4BPBA 1KI8A 5A5FA 1BS2A 2Z2KA 7ABPA 3HVHA 1YASA 2QN1A 4HH1A 3RGWS 1K6XA 3LCMA 2I6TA 3SWWA 5KPDA 4FN5A 3B7PA 3H19A 4J3FA 2W2MA 1FLDA 1XI2A 2IPLA 2IDZA 2ZUWA 4KLZA 3OLXA 4KVFA 1EUDB 3H6HA 3QUAA 4BKRA 2P65A 3VQTA 2JJ1A 2I3AA 5KJ6A 4ZHQB 4HDNB 3UMGA 4RQUA 2BFNA 4ENWA 1ZQ9A 1S9HA 4MIEA 3NGXA 2HR1A 2EGHA 4LYAA 4ALNA 1S2GA 1W85A 2PGOA 4RXTA 4ZIRA 1MD9A 1QE0A 1T2EA 4YC7A 1E2DA 1BTOA 2J4CA 3HWX1 3MD0A 4CXMA 2HSZA 1MUUA 2V55B 4IV5A 3WMWA 1A4RA 1SGWA 3P9SA 3ONFA 3STWA 4R2XA 1PRYA 4G4SO 4LXTA 1VLJA 1Y63A 2QRNA 4ZI2A 3D6AA 3K94A 5B6PA 3EC1A 4R71A 2VT7A 4M0FA 2J8ZA 3TPCA 2H4YA 3GXOA 3KPWA 3QUSA 3TMAA 4DZTA 2PRIA 1O97D 2HJVA 2W22A 1R6XA 2XRMA 3SQDA 3HMKA 4E7OA 1GGMA 1FW8A 3M6XA 4J0GA 4QDUA 2O14A 5E9AA 5DI3A 1Y3BE 2JW5A 4UNSA 3L40A 5JQGA 1PKEA 4IDGA 1ITZA 1DV2A 1FTQA 2HUNA 1NVWQ 2VDRB 2Q07A 4FT4A 4ZOLA 3JR3A 1AUOA 1T35A 3A1FA 1C0KA 1UMDA 2I4LA 2XGSA 3ZNNA 1L0BA 3D2BA 4BLPA 2LGJA 2V54A 4L2IA 4HGPA 1XRRA 3KYBA 1GZ6A 1CVRA 4AMGA 4IDBA 1EMDA 2Z30A 3DE0X 1LDEA 1XUOA 4LGVA 1P73A 5IYZB 1P1JA 3R5SA 4KEAA 3ZHUA 1LC0A 2UUOA 2VP3A 3UH0A 3USCS 5ICGA 3H7AA 3RHFA 1HBJA 1U0BB 5TPZD 1V2HE 3CIFA 1IBKB 5AOCA 2R97A 1Z4NA 4Q9DA 4QHYA 4TUYB 5EWMA 3W6ZA 1FXSA 3WV5A 3G68A 4P7JA 1N3YA 2C2GA 4JB2A 1QCYA 3JALA 1NBOA 1O7JA 4BYGA 3SC3A 3ONNA 2PUVA 2M1XA 4KN8A 4YCDA 4YRPA 2IPMA 4Z1MD 4DPKA 2O4CA 3AUJB 3WL5A 2YVLA 4PFJA 3W77A 1X1QA 3BT7A 4BMOB 4CCYB 4LZLA 2OYCA 4NMXB 1LSJA 3I23A 3WR5A 2UXDB 2HCBA 1N1EA 2E49A 3ZHBA 2E55A 3I42A 1P5JA 1F4LA 2VAMA 3MUOA 1L5MA 4WA7A 3TZQA 3M89A 1SU6A 3JWJA 5JCJA 2Y1KA 3UAWA 2JLSA 3RF7A 4I4TB 2M6SA 3RU3A 1FVFA 2E5LB 3CKKA 2Q1SA 1UAYA 1QOZA 1X1SA 1PJZA 1OBHA 3QW4B 3KZVA 2Q6OA 1NP6A 3KQNA 121PA 1T3GA 4J3NA 1SFRA 1EFKA 3WRVA 4J9VA 1XA3A 4M60A 2YNMC 3ZBTA 4H15A 3U4IA 1NUTA 2QRQA 2W4QA 2ODQA 2WSIA 5DYIA 3MS7A 3W8NA 1YS9A 2G9VA 2KLBA 2X5XA 1C9JA 3DBLA 2D3WA 4UXHA 3O75A 2C59A 3IVRA 4QELA 5BW6B 1EWVA 3WK4A 2H16A 2IUFA 3TNFA 4P86A 4XGRA 2WFZA 4GQAA 3WL3A 2DHRA 3WNBA 4MRMB 1GRVA 4EHKA 1JKJB 1NLUA 4L72A 3DBRA 2GEJA 4LZOA 5FLXA 1M2VA 3ETGA 1IXYA 3LQ2A 1B6SA 2QTZA 5EYPA 4WUVA 4GF5A 4MB0A 4C9BA 4YRBA 4ZFNA 2BBOA 2QZ4A 4UUOA 5FAXA 4IIJF 4GMGA 2V97A 4LEIA 4LRYA 2IOYA 1NBMA 2OV2A 3U13A 2O1EA 3I1IA 2DZDA 2IYUA 1DXYA 1HE5A 3L04A 4CQMD 4EX6A 5D6OA 1XP8A 2WHRA 5THKA 4FIZA 3D9QX 3O9ZA 3B38A 5LMUB 3TMKA 5CUQA 1KETA 2VTEA 3IAAA 1BROA 1XEWY 3RUEA 2OL4A 3EH2A 3JWIA 3GT0A 1FP7A 5DNCA 4Y2PA 2JGDA 5AM3A 1AHIA 1QB8A 4Z4IA 3IS3A 2FETA 3E5NA 4RDXA 2ZOSA 3OO0A 3CNBA 1KYWA 3ZDQA 1E92A 3QHPA 4YJGA 3DW1X 3HJFA 3U44A 1K7YA 2Z4RA 1B6GA 4BPRA 4S35A 2GEDA 5GV7A 2DCUA 3U7QB 4QARA 4A2CA 5LUAA 4FBLA 4NBTA 3O8RA 4YUZA 3U7FB 3DV0B 4TXMA 4P7GA 3ZE7A 4EHAA 1J1UA 3LC2O 4K3UA 5CCDA 5DM2A 1JHXA 3TXYA 2COEA 3WWOA 1X7YB 1NZFA 3PGVA 2X14A 5DMHA 4A2PA 1E6UA 2PTHA 3PFGA 4B81A 4ZV4A 3PYLA 4QOEA 3VZBA 5CA1A 3CZMA 3H2ZA 2LDXA 4JL5A 2NPIA 1TZMA 2CVOA 5DP2A 4WJKB 3EMVA 1W0JA 2SCUB 3MMNA 4WZAB 3KT3A 2DUNA 2B5VA 3OCCA 5EIAA 5HF8A 3RU7A 1IYZA 4PF1A 3CB4A 4OI1A 5TQ0B 2V9PA 1JVNA 3N0XA 2VEDA 4FC7A 2AFIE 2W90A 4TYPA 2WSSA 3ASVA 2QR5A 2BM0A 1QHNA 3L7CA 4KNVA 3LKBA 2GEUA 2B4TO 3TVDA 4O4IF 1J2EA 4NDNE 4D97A 4IDFA 3Q9NA 4OQ4A 3GG2A 3SE0A 1WQ3A 1J23A 1SQ5A 4O0LA 3CEAA 4FDLA 3NP7A 1BE6A 3SIPA 2YIDA 3IBGA 4UEJA 3FCXA 5B55A 2PVCA 3BBPA 4MW2A 3OLQA 3PJRA 2J08A 4HQRA 2P9BA 3O4GA 4YACA 2Z09A 5ICSA 2D3TA 3RB8A 2RGAA 4BVKA 4XVCA 2ZM6B 2IP1A 1U2EA 1GPWB 3AR6A 3F78A 4BU1A 1E2LA 4LXHA 4UTRA 1SK9A 2YQ4A 2YR0A 1YIAA 4US1R 5EP1A 3ZHXA 4ZVRA 5AVWA 3K0BA 1VE9A 2YWEA 2GZMA 3HP1A 4YAWA 3LXRA 1L6IA 4K9NA 1N2EA 4D82A 3RIXA 3O4RA 4MUAA 3Q9SA 5EWLB 1E5LA 5C8DA 1N34B 3VH4A 4JQYA 2BW0A 3WOVA 1NNI1 4A8JC 2I8LA 3L0OA 2ACKA 4QQ8A 1YR6A 4J43A 3EQ9A 1UM9A 4RUKA 5EWJA 3HVIA 4ROTA 4UTXA 1K7EB 1U02A 2G36A 1PQUA 3WGTA 4KX5A 1KXZA 1G8KA 3KUKA 1T9HA 2WTAA 1B74A 3DCJA 4O02B 1O08A 1RIFA 4CE6A 1NAHA 1AZSC 1BFDA 1P4GA 2CLOB 2JLCA 4IJ6A 3FVQA 1D07A 4RGYA 5A3QA 3HXQA 1J8FA 2C82A 4C87A 1IVSA 1ZUNA 4MGHA 4QUJA 2HO4A 4NCHA 3WTBA 2XOXA 1WB6A 2V8BA 4G9GA 3CN9A 3W9UA 2FZWA 3ZWPA 4DAOA 8AT1A 1DUSA 3M5CA 3PI7A 4GRIA 4JLBA 3PE6A 3NGLA 1AA6A 5TARA 3D64A 1LPBB 2JKYA 3P52A 4O2AA 4AF6A 4C7XA 1CX9B 5KTKA 2QMEA 3D3KA 3VTAA 1GDHA 3CRNA 3WISA 3PR2B 3WXBA 3Q11A 1IWBB 1ML4A 4MAAA 3VSDA 3L0YA 2OBBA 2GPNA 1PR6A 4DA6A 5EJ8A 2ZB4A 2J9YB 4PPYA 3P71T 1PGPA 4BFTA 5BYKA 1M54A 4MTLA 1PUJA 4Q02A 3TKAA 4F3TA 5CIYA 3WL7A 1CF9A 3IQHX 3CRRA 3ITDA 2F00A 4RKWA 3RBXA 5G0TA 4XB1A 2OZKA 3BZUA 3SX4A 2FN4A 1FDIA 4DLAA 2CBXA 5FUWA 5TMBA 3TAUA 5CURA 2I4MA 1U0JA 1N0IA 2GK6A 5F4BA 4WL0A 3TOVA 1TQ2A 4FMPA 5B58C 2X58A 2PBRA 2CJXA 5FORA 3EF0A 3D7RA 3M6UA 1TIPA 5EAIA 1EAYA 1GTSA 2REQB 3AB8A 3SM9A 2BTQB 4NZOA 1DE0A 2VK8A 4AC9A 1K97A 1M2WA 4B82A 1P1CA 1KFCB 4DCPA 2CLHB 2RIRA 2X2OA 3H9BA 4Q39A 4AU1A 5AFSA 3AQ4A 4QXQA 1OWNA 1QHIA 4HDAA 2OHOA 2PL3A 2WI8A 4NONA 4ZC1A 2ORWA 2QD1A 5EQFA 3T0IA 4BFVA 4MPRA 5DOZA 1RKXA 2AEMA 4I4IA 2O3RA 2VK2A 2J3JA 2DY1A 4KJZA 3ZY6A 2J09A 5A02A 4XYEA 3EEQA 2DUJA 1JQKA 4P35A 4XD7D 4Z9XA 3GFOA 4I1YA 1Z38A 2JIMA 4E32A 3L7JA 2FUG6 3O8QA 2PFGA 3I76A 1I0ZA 1VXRA 3R3WA 4XDGA 5BUQA 2L82A 4B43A 4QT4A 1E1MA 2R7AA 3L1UA 4NP6A 3COWA 5JVDB 3ZDFA 4O4LA 5CFRA 3MILA 4KX3A 2P4EA 1C7RA 4G1VA 2I6GA 3RSFA 3S29A 4EFMA 2ZJ5A 4P5DA 1WZ2A 1VSUA 4PC3A 2V74B 3OPXA 2W70A 4KQXA 2KW5A 1Q3KA 2H5JA 1OU4A 3P0IA 4IH9A 4FOLA 2C83A 5EZ5A 3VR6A 1DXOA 3KL4A 1JR2A 2WU8A 3PT9A 1FNCA 2DFKB 4BMVA 3ZV4A 1TUGA 4ALKA 3AO0B 5HP4A 1Y6QA 3UEOA 5JZSA 3CVWA 5DZSA 1NSFA 2QTWB 2QTMA 1NLZA 3L7MA 4IIGA 3F9IA 3FD8A 3B48A 3GMIA 4IIXA 4Q3NA 3PEYA 1H2XA 3LVQE 2E4WA 4UPEA 3IIKA 3JWGA 4KGVA 3NKFA 5C32A 1UPUA 5JLJA 5C8YF 1IZZA 2VHYA 3UICA 4M1KA 4BGVA 5LQAA 5JD6A 2ZRFA 4FFMA 1CYDA 3OD1A 3ND6A 3OWHA 4UTPA 2DWQA 2NUPB 1QTIA 2YJTD 1VG8A 3DAPA 1QQ5A 4RCVA 1QOPB 4YT5A 5I9SA 5GVSA 1FJGB 3UBMA 3JQ6A 4C6SA 5A4JA 4OHFA 3T3HA 2DPGA 4PG7A 4U2CA 3R74A 4GZ5A 1VKNA 5JJCA 1GUBA 2O7QA 2X4IA 5JY6A 1AXGA 4FUQA 4RH3A 4AWAA 3HEAA 4S2EA 4OLBA 1PVOA 1TVKB 3R3VA 1KORA 1IXKA 4M3NA 3NBAA 3MPUA 3KPYA 2VZEA 4N5HX 5E95A 3TI7A 4JYPA 4Y6GB 2BRUC 3WZMA 2JFOA 1I32A 1U80A 3OLWA 2XT6A 4FHZA 4LVCA 3UT6A 2VIIA 4YGXB 3WK9A 3ASZA 4JU9A 2UDPA 4KBFA 5K8JB 4KKVA 4YMIA 5F2EA 3SFTA 5E6RA 2BFEB 1Y3FE 1EX6A 1V9SA 2GSWA 3DONA 3SICE 4Z49A 3IVGA 4JEHA 3UGKA 4ON9A 1RIIA 2FZEA 3F7MA 1IAVA 1N2JA 2CVFA 4MQEB 1W87A 5HQJA 4D99A 2X2PA 1DCMA 4S2UA 4FFSA 4B31A 3FY4A 1NDUA 4AUMA 1I51A 3UG6A 4BJ5A 4FM9A 3G17A 4U3JA 4ZU3A 1YTUA 1AKYA 1Z4MA 1OUMA 2ONYA 4YJ3F 3EC2A 4B4KA 2C5BA 4ZVMA 4ZYVA 4HKTA 5L3QA 4IG9A 2VZ0A 4BTLA 4BWVA 5A3JA 3NS7A 4E2WA 1U31A 2PZMA 1KZ9A 3CLSD 5M29A 3HU5A 5FPSA 2BHNA 1PNVA 3DEYX 4OXIA 1DUVG 2RJ3A 1T0HB 4GZMA 1GRQA 1FU8A 1TRKA 1EUDA 2CEAA 3R3XA 4DSAA 2LUOA 1C7FA 2V3CC 3AGQA 1Z5VA 3INRA 4HDNA 2Q4DA 1EFLA 2D06A 3MQFA 5H82A 3DF9A 2WFAA 3KM0A 1RYDA 4HN2A 2R5FA 3MBIA 4OBBA 3TQQA 2P9ZA 1XQWA 3R4VA 1RAHA 2H1WA 1MQ8B 1WCIA 1G8SA 3QSGA 4MWDA 3ZZ0A 3T3EA 3QEKA 4YP7A 4P4TA 1JAZA 1P2GA 1YL7A 3CX3A 1WG8A 1NT4A 2R84A 3DZ8A 4XFJA 1NIPA 1UBCA 4P22A 3QU5A 4MQ4A 2HEIA 4L78A 2W2QA 3B8EA 3CCFA 5JXIA 1K7SN 4RTJA 4DT1B 1WB5A 2PWPA 4C4AA 4UOEA 5AHOA 2PM8A 3ABOB 4E11A 3WTCA 2BFDB 4HNHA 4DM7A 2C4NA 4L73A 1US8B 3H16A 1LDMA 1GUDA 2W4MA 3GWZA 3L4EA 4YP1A 4JODA 4AQYB 1FU7A 1RQ2A 4PZEA 3WRXC 3W8EA 2ZT8A 5IEBA 2J7PA 3ZLUA 3HN2A 3KEGA 3H2HA 2PNJA 4UVGA 1W4BA 1DJOA 4H35A 5ICFA 2XCOA 3S2IA 4H1WA 2HF9A 2ZAMA 3GFSA 3BCUA 4RKQA 1GGVA 4B6FA 4EGFA 3NC1C 2YY5A 1YI0A 5C51B 1TLLA 4J1NA 3R0VA 4BGIA 5F33A 4EDFA 2Z2ZA 3QQ5A 4L7QA 5K9ZA 1JWAB 4JT9A 4OV6B 3VVBA 3KSBC 4GOLD 3COJA 2WWVD 4GLLA 3NH6A 2JKZA 2VF7A 1N6PA 3T35A 3EXHC 2IHJA 5DJ5A 1L3BA 3RWMB 4FFWA 4I19A 1ZBDA 3ZK7A 4CQMB 4PN3A 3RC2A 1KYVA 1RHMA 2ZIXA 1RYNA 1RWMA 3T9DA 4HAIA 3N70A 5KSPA 5ALTA 3MVEA 1NF8A 4O4HF 3V1NA 3OP1A 3RBZA 3IKMB 2VYFA 2Y2UA 1WF3A 2WE8A 2R62A 3HWWA 1PEYA 1UJNA 2WJVA 3HRHA 3WHIA 2DPMA 4IDHA 1PLLA 3PTAA 2BZSA 2YQZA 1U63A 2QY9A 1ZGBA 2IHYA 2P9HA 3EB9A 4YT8A 5KNBD 3RC8A 1CP2A 3IV6A 3WB0A 3AHJA 4OYRA 3NHKA 3MJHA 1O6BA 1QAMA 2ESRA 2CXHA 1UBHS 3IAS1 1I14A 3JD2A 4ITRC 4CCYA 2Q5OA 3V8VA 4ODIA 1G1AA 3C4VA 3RC9A 1SUCA 1U8UA 2W6JA 3NHJA 3OICA 5T4EA 2KQUA 5TJ9A 3T9AA 2I9PA 1MR3F 1KY2A 3MRSA 4AZSA 4DCOA 4H1VA 4XDHA 3KV3O 4WZBE 4E6PA 5CVJA 4F8JA 5LMZA 3BIFA 3OQ1A 4HYYA 3L8YA 3TZLA 1AF4A 3DVQX 2B61A 4GECA 5HE9A 2HQBA 3F3KA 3SHWA 3SKYA 1F6BA 1P0QA 4IG4A 3TCKA 2H2AA 2RK6A 2F8TA 1I36A 5KCZA 4LE1A 3A3YA 3H2GA 3ESQA 1GCUA 2Q4BA 1EJ0A 4TYNA 1PZNA 3ZHSA 1U7UA 2D74A 4B3CA 1F2TA 1M5TA 5ECGC 1KO5A 2B37A 3HZOA 1KBQA 3WLOA 3AETB 3PYMA 1WY7A 1N92A 1D0SA 1MA0A 1QKJA 1BEEA 1RAGA 1U7DA 2PZGA 4BN0A 1I6MA 2QA5A 2R6HA 2VJMA 1QUEA 3ZJ5A 4R8SA 3IEMA 3WL4A 1NZJA 5IAJA 1YS2X 4PAMA 4GBMA 3IJRA 3FCOA 3PBKA 3QKWA 4GI7A 4BFXA 5I7FA 1NJSA 1F06A 1L7MA 1RCUA 2F1OA 2NTJA 3JQBA 4I99A 2H4HA 1N9ZA 4KK4A 3S2UA 2EKDA 1R5JA 2HA5A 3ESXA 1OYOA 2PMBA 4HB4A 4OQPA 3Q10A 3RAJA 1E2QA 4BVGA 1GG5A 2J46A 1TAGA 3FHLA 3KOUA 4E5DA 1G5FA 4ZJUA 5C5IA 3PNQA 3I5AA 4Z7JA 1KQGA 2HF7A 2NXNA 3D4BA 4OBXA 4P4SB 1DUIA 1J0AA 1UDAA 4MX8A 3PFNA 4EMTA 4AICA 1V11B 4BQOA 1HE3A 1VPDA 5ALVA 4ID3A 4OMFG 1DDOA 2EBUA 4ZVPA 1U4SA 4UCXA 3EFOA 5DSZA 1LV7A 2GYYA 3EVAA 1JN0A 4FD3A 1IY8A 1NT2A 1I80A 2X9LA 2ZZNA 4XM2A 4NU8X 4UEQA 5SY6A 1QFJA 3MB8A 4XPZA 1I1OA 3V6LA 4HWOA 1JV2B 1LD3A 3H2IA 4MQUA 1UWKA 2ASEA 1PYDA 4IJKA 1W2WB 1O9GA 1R0LA 2XUZA 4MV9A 2C4KA 1VMKA 2Z6VA 3U7QA 4F46A 1ZRHA 5MN6A 1IUPA 1XAHA 2REXB 1IEWA 1KP9A 2QN6A 1CR0A 1Z4JA 3DV0A 1F48A 4JSTA 1G66A 1P9OA 1SKQA 4LDZA 4YWJA 1ZUIA 1THZA 3D5TA 4JI1B 2Y0PA 3ADPA 2PYZA 2RBGA 3RRMA 4AJOA 1DZIA 2DBRA 2XQJA 4NCJA 2Q21A 1SZCA 4AROA 1A72A 4AKGA 4EPWA 4DR4B 3L1KA 1K6MA 2QAIA 4G1EB 2CNLA 1DBWA 4US2R 5KQLA 2GK4A 2SCUA 4Z7QB 4WZAA 3DMTC 2BE9A 3WY9A 5CB4B 1X7XA 4FI3F 4I1UA 4FGWA 4QDXA 2M2IA 2BI7A 1KP2A 4QRIA 3V4RA 4M8SA 5DU2A 2MJLA 1N2XA 4CIYA 3Q3IA 3I01A 4TYQA 3SZRA 2Y93A 3NBMA 4J8PA 1J8MF 4QUGA 1UBEA 4MUIA 1XZAA 4TMKA 4XWTA 5F1KA 1QMPA 4LRWA 3TZKA 3OOEA 1NYRA 3D3EA 5AKEA 3WNZA 4O3FA 2HLDA 1L4KA 3RI3A 2LIVA 1FXUA 3WWDA 4UPVA 3LHSA 1SCBA 3O3MB 1JHDA 4OYYA 5B1DA 3PDJA 3V34A 3WK8A 2R6ZA 3E27A 3EVCA 4A6DA 2P8JA 2PZAA 3K9HA 4MYTA 5ALKA 3AFIA 2AMVA 4HPWA 5F5XA 4B9AA 1JDBB 2OP1A 1QF7A 4MXDA 4Q05A 2X9NA 1QFXA 1MRZA 3CLVA 4U7WA 4KRXA 2EG5A 5EWLA 7ADHA 2C0CA 6Q21A 1TUBB 3CPJB 2XUQA 2Z98A 2IYOA 5TGDA 2V7WA 3GRZA 4LOKA 1MH1A 1M1NA 2MSCB 1V4BA 2OWDA 3D2LA 3DQZA 5EE1A 2PZEA 1F9EA 3RJMA 4XZ3A 1CVLA 3I2HA 2IYWA 4Y2TA 2H2DA 4KV7A 1Z34A 1G20E 3WDMA 1OIWA 3OFVA 5JYBA 1XCOA 1UC5B 4RVDA 2K2WA 3VR5H 3VGPA 1QGAA 1P7PA 2YICA 1C29B 3C87A 1ZM7A 3MOSA 2QW0X 1CB7A 3EEBA 4MMXB 3W5JA 1NRXA 3ADOA 1ETUA 4PYJA 1D4AA 1ZD2P 4MI3A 3WSVA 1XLVA 4DLKA 1S9DA 6REQA 1NGSA 1G38A 3W6UA 3QZUA 1V6AA 1WZCA 1ODLA 3ZDXB 2Y1DA 1F9AA 1OI4A 5AXDA 4BNFA 1XMQB 1ZN8A 2RB4A 3SXJA 3TE7A 3ER9A 3N3BC 3QPVA 2Q62A 3M82A 4UASA 4EFLA 2FFAA 4FTWA 3V4LA 2IEZA 3A4TA 4XM1A 4Z3OA 4TV8B 4M83A 5AK5A 3UWDA 4EENA 1V26A 2Y9PB 1K8ZB 2PBLA 1C1DA 3DEAA 2ZYUX 1PNTA 3DAYA 3LLUA 3ZC3A 2PKCA 1K9SA 5C7IO 3ZU5A 1J99A 3KDAA 2WQ7A 1X9HA 1YZLA 4X1IA 3ZQ6A 3WVNA 2NUBA 3PC7A 4FZJA 1JHUA 2ERXA 3OU2A <