3KB8A

2.09 angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from bacillus anthracis str. 'ames ancestor' in complex with gmp
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
203
structure length
201
Chain Sequence
MHHHHHHSSGVGTENLYFQSNAMMNQDIEKVLISEEQIQEKVLELGAIIAEDYKNTVPLAIGVLKGAMPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.09 Angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from Bacillus anthracis str. 'Ames Ancestor' in complex with GMP
rcsb
source organism Bacillus anthracis str.
molecule tags Transferase
molecule keywords Hypoxanthine phosphoribosyltransferase
total genus 56
structure length 201
sequence length 203
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kb8A00
5IAOA 1ECJA 3H83A 4RQBA 4Z1OA 1ZN9A 3GGJA 3EFHA 1DKRA 1YFZA 1QK3A 4RV4A 4RHYA 1D6NA 1VCHA 1TC2A 1MZVA 1P19A 2H07A 1DQPA 2PS1A 1PZMA 2YZKA 5HKLA 1XTTA 1GRVA 3LRTA 4QYIA 1NONA 1GPH1 1O57A 5ESXA 1U9YA 1XTUA 2P1ZA 1ECBA 1QK5A 1OREA 4IJQA 1J7JA 1QCDA 1ECCA 1ECFA 1UPUA 2PRYA 4KN6A 1IBSA 5KAPA 1BD4A 1I0IA 4RADA 3DAHA 1BD3A 1P4AA 1VSTA 3HVUA 3N2LA 4RAOA 1DKUA 1I5EA 1ECGA 4LYYA 1I14A 4JITA 1STOA 4P83A 5EUCA 1BZYA 5JSQA 2PRZA 4PAWA 2C4KA 4P3KA 5BRNA 1CJBA 1AO0A 1DBRA 3DEZA 1A96A 3GGCA 5KAMA 3KB8A 4X44A 4ZFNA 1A98A 1UFRA 5HIAA 2HCRA 1XTVA 1NULA 1P18A 5BQPA 2JBHA 4LZAA 3NAGA 2H06A 4LZNA 1Z7GA 5K51A 4JLSA 1HMPA 1QCCA 4RHXA 3OHPA 1OPRA 3OZFA 4M0UA 5IPFA 3DMPA 5JV5A 4WN3A 3MBIA 1A95A 4QRIA 4RAQA 1G2PA 4MB6A 1U9ZA 1I0LA 1A3CA 1DQNA 3ACDA 4P82A 1QB8A 3O7MA 3S5JA 3M3HA 1TC1A 1VDMA 4M0KA 3LPNA 4RHUA 1R3UA 4RABA 1JLSA 1ZN8A 4RACA 5ESWA 5BSKA 4X45A 4LZOA 3G6WA 1L1RA 1LH0A 2EHJA 1A4XA 4RANA 2JKYA 5BQOA 1P17A 3ACBA 1XZ8A 1WD5A 4OHCA 4QYIB 4S2UA 1ZN7A 2FXVA 4RHTA 2GEBA 1W30A 1OROA 3ACCA 4FYMA 4P86A 2JKZA 1G9TA 5E38A 4RQAA 1G2QA 3GEPA 4WMLA 1FSGA 1L1QA 3QW4B 1QK4A 1UPFA 2VFAA 2XBUA 4P81A 2WNSA 1HGXA 1A97A 3MJDA 4LYGA 2IGBA 1JLRA 4M0PA 1I13A 1QB7A 3OZGA 2DY0A 1Y0BA 2E55A 1G9SA 4P84A 4PFQA 1XZNA 2H08A 4TWBA 4P80A 4F8EA 1O5OA 2JI4A 1V9SA 2AEEA
chains in the Genus database with same CATH superfamily
1SQGA 2FSHA 1MR3F 2WSBA 4D57A 1KZ4A 1EINA 1MVOA 3T06B 1FZQA 2ERXA 3AGPA 4PX2A 1U5BB 4ZI7A 3W5BA 4QNRA 1U8UA 2GN1A 3UQZA 3ZCVA 4JLBA 4UTXA 4ZKDA 2M1ZA 2CKDA 3O1JC 4DZRA 2X2EA 3UENA 4MXDA 4XRGA 3N70A 4EO4A 2HEIA 3HP4A 5K9ZA 3IO3A 3OM8A 2DWCA 3SP1A 2PRKA 3SZMA 1HE3A 1I4DD 1RWNA 2HHCA 2K87A 2JCYA 1L5HB 1S2DA 1USIA 2VAMA 3BGSA 3B82A 3L5KA 4JR1A 4UE3S 5B57C 4NJMA 5JS7A 1U8EA 5BY2A 2NACA 1SC9A 5JW6A 3OQOA 2D1YA 2DR2A 2ADMA 4WAUA 3OFNA 4CMHA 3TNDA 3OQPA 4PBTA 5DHSA 1ZSNA 2OORC 5BRNA 3ANMA 3K1YA 2Q2OA 2HI0A 4KTTE 5AKIA 2F8SA 2GCPA 1JN0A 3X1KA 1MOSA 2B1JA 4WKNA 3ZU4A 5HTOA 4LCJA 2Q4DA 2ZRPA 4JJ6A 4GP6A 1B3RA 3O1LA 4LBZA 3ROFA 4GUDA 3OF5A 3H04A 3AF6A 5K0FA 4JI8B 1NNI1 1LJUA 4P4SB 3CX7A 3N2KB 1DUVG 4WQMA 4ZIRB 2RGXA 2IZ0A 4MCHA 1WPXA 5AW8A 5LDDC 2XVAA 5DIZA 5B1HA 4DHEA 3AVXA 3CKKA 4URXR 2OQRA 4FOPA 4XB1A 1ND5A 4Q3BA 1JJFA 3LE8A 4IY1A 3UY4A 3AW9A 3WG9A 3QK7A 1LRJA 3N7UA 2QGZA 1RVDA 3DAYA 1SC6A 3D0OA 1TVEA 3NP7A 4IGIA 2L18A 4JEUA 4FJ1A 3LRXA 3FVVA 5SZIA 1JU9A 1C7ZA 1YB1A 3H6GA 5LXTF 4MA4A 4CU2A 2FEKA 2RHBA 2Z8ZA 4XVUA 4DOMA 4NXNB 3CVYA 1JS1X 1DBPA 2UAGA 3LVQE 5I9BA 5ER9A 3V7UA 4EG0A 5DKFA 4F3YA 4FR5A 3VJMA 1YVDA 4QZVA 1F14A 4Z2YA 1X7WA 3TSWA 3SJUA 3IEPA 4KXMA 3SC2A 5CFMA 1Z83A 1OBHA 2F43B 4KFRA 4CDRA 1SXGA 1MX3A 4JVOA 4J3NA 4IVNA 2GCNA 5F64A 1XEFA 5FPQA 1Y4UA 1U6IA 3SFZA 2Z09A 1NZJA 4FFDA 2I7DA 2IU4A 5AQEA 1T9BA 2A0WA 1Z7YA 3DWIA 3MCUA 4Y98A 3OOSA 5E9JA 1LW6E 1XTJA 2YFKA 3VPSA 4C4OA 2JC3A 2VDLB 2Z5FA 3FMOB 3IDZA 3R3YA 4CTJA 3HHEA 5J3JA 1K8RA 5FOSA 2Z6QA 2MYNA 4E33A 2XI4A 1K8ZB 4JJGA 5SZJA 4W9NC 4U7GA 3OFVA 2ATCA 3UFXA 1CEXA 1NBWB 4LZLA 2B9VA 3FH0A 3K0AA 4LDAA 4NP6A 2D1FA 1JDJA 5T57A 3WJ7A 4WFQA 1E1QD 3V9PA 3CUWA 4CFYA 1E1RA 1DCMA 1DC4A 1SU6A 1XZKA 3Q7EA 4GWGA 4F3CA 4KRFA 5CVVA 1H6CA 3MTBA 3W3AA 4CV2A 4BGIA 4YAFA 2H51A 2QXYA 3IHWA 2ODBA 4D9GA 3D8SA 3TOSA 2Q1TA 3R3ZA 2ENWA 2IKQA 1Q0RA 5G0WA 3EXAA 4HSEA 1C4KA 4JSTA 4M8KA 5IMBA 1CUWA 2HTEA 2ZULA 1QIGA 2B2XA 3AG6A 2WWFA 1JJBA 1E9AA 3EQ6A 4HEHA 1W46A 4HRXA 2WWYA 2PS1A 4U2EA 3RFCA 2C20A 2VJYA 3HCPA 1VYVA 4DBZA 3IT2A 1P9RA 3AHHA 4RIEA 1KTVA 1U0GA 4J0IA 2VHYA 2OXIA 2BE9A 1L3CA 3VKFA 4CCWA 1GL3A 4G0UA 1XFAA 2ECFA 5ALMA 4YLYA 1VPVA 2A0UA 3EXHB 4MW5A 4GMFA 2FUG1 3ND6A 4B9EA 3HO1A 2QENA 4KN6A 4I50F 2NTEA 5E6RA 1MKYA 1ONNA 1WZIA 4NV0A 4NRDA 5EMJA 3R7NA 3EIXA 1GGKA 1UQUA 3GMDA 1SBNE 3OUZA 3FWYA 5HRCA 4MS1B 5IFLA 4NU5A 2IY7A 4RJJA 4B71A 4K86A 1DCFA 1KZYC 3BYZA 2VRBA 2YXDA 3C87A 1VKNA 3LRPA 4L6AA 3UJBA 1TVKB 2YN2A 2QPLA 4MUYA 3EEOA 2PDAA 4IHKA 4MITA 1QLWA 3OCYA 4MMXB 4N5DA 1ZI6A 4LQDA 2FX3A 4OF4A 1AKYA 3PF9A 3GV0A 4QPZA 5EOVA 4ACBA 2GBPA 1GCUA 4EUFA 3GBVA 3PNYA 5IABA 1XVLA 4B0OA 5J5VA 1QVAA 5JDIA 1E62A 4WOJA 5CDSA 1PIWA 1JQDA 1HMPA 3Q40A 3E82A 1KZ9A 2J6CA 4N1AA 1MH1A 2GEVA 3VR2A 3PRHA 4C29A 4BX8A 4ZTBA 3RSQA 5CB8A 4OOFA 4X1KA 4X54A 3IAAA 1W94A 3BUSA 4QD3A 3SWWA 4CUKA 1BFUA 3IAEA 3PNLA 1ODSA 2VJAA 3AHEA 4G84A 1T5HX 5TQJA 1W75A 5B58C 1G7CA 1XEXA 3E0XA 4Q02A 4ARCA 4UBKA 1NRJB 3V4OA 2JGFA 4ZHQA 4R69A 1YH3A 2GERA 2JLRA 3AKZA 1DQNA 4MW2A 2WMOB 4UBIA 2XMRA 5F7ZA 3TQRA 5F76A 4F11A 2WTAA 3RTAA 4RABA 1DIGA 3T3NA 1Z3CA 2X8WA 2QLNA 1GXSB 3W4JA 3ZY2A 5TS2A 1TQ8A 5TNXA 1RP1A 2ZM5A 2BFBB 5JH7B 1JT2A 1P0FA 2C98A 5JXIA 2WSIA 5F51A 3AVTA 3QUCA 1PR0A 2BOVA 1YJAA 4D0GA 5E4JA 1ZRHA 3MIIA 2HQBA 1W4LA 3AR9A 4TWJA 3ZTYA 3H5VA 3T3HA 3NZEA 3KIPA 1GKLA 3Q9NA 4Y2PA 3EEYA 5C31A 1AC5A 3SS8A 1B16A 4NEGA 3GIDA 4BNMA 2I22A 2RGGA 3GJYA 2WE7A 1K5DA 1UKAA 3W2HA 2VBFA 1XN1A 4JCCA 2QTZA 4B2LA 5L3QA 3BZBA 4YACA 2W0SA 5CIQA 1L4MA 1ZBDA 4OXYA 3TTSA 2OCXA 4X7BA 3AR6A 1T3GA 4IL5A 5EHXA 5K45A 5MN6A 3JTEA 4YJ3B 3Q7QA 1KEZA 3I5UA 1FRNA 3USES 5JYCA 4D0RA 4HPWA 2FGJA 2BV3A 4B8ZA 4E2YA 3X44A 3PQ7A 4TTRA 4BIMA 1SKMA 5FR2A 5C53B 2D2VA 3UJ6A 4NF2A 1IYZA 3P7MA 4GNRA 1T34A 3LHIA 1KYYA 4IJ5A 4NDZA 5D85A 2NWQA 1IRIA 2WUDA 4FFWA 4YXFA 1I1OA 3IUMA 3LGXA 1KR5A 1SB8A 5KYYA 1UOPA 2O0KA 4ZYZA 4CM4B 5B6IA 4J1TA 4WK4B 1CULC 1P1KA 5HGXA 1YFJA 4OHZA 4ZZ0A 3MCWA 1CQZA 1PE0A 1SWVA 2DBZA 2DHDA 3F6SA 4KO2S 4PZEA 2LR0A 4QUKA 2VJDA 1MO4A 2ZJ1A 4LX0A 1IHYA 5A0FA 5A04A 1GG2A 1HLPA 2QE7D 4WKOA 2F17A 3GRRA 4D56A 4LVUA 1AURA 4KMRA 3B3AA 3GA5A 4MPRA 4A0SA 5JAMA 1Z22A 3ESBA 4BMZA 4WLOA 4HMOA 1P2DA 2NO5A 5AJZA 2DBQA 5L4LA 3M82A 5CLLA 3B70A 1ORIA 2XHZA 2NXWA 5CDHA 2C1XA 2B1GA 4XVHA 1JYSA 1X1DA 3GDWA 1RYEA 4I55F 4BP1A 1PGJA 1EESA 2R60A 2O48X 5F4BA 2DH5A 1J9GA 2JEZA 2QHXA 4J7XA 4QEKA 1A2QA 1RHQA 1MH9A 3IHTA 2LW7A 2P9CA 4IXWA 4Q9JA 3RDPA 3DV0B 3WL5A 3T7KA 3W5UA 3MCTA 4MSUA 4E1VA 3TB4A 3ZS9A 1TRKA 2ZRCA 3KHKA 3CVJA 3DOFA 5T41A 1CIPA 1RBQA 5J9FA 4FYPA 3SF8B 3ZZTA 4DLWA 3KQYA 1CQWA 1HZZC 2I4MA 1EP2B 1EZZA 1TIPA 4IZIA 1DQYA 2JF0A 4ARIA 2XRZA 2OCLA 4M86A 3PQFA 4XVRA 5IC5A 4OIMA 3WQBA 2TMDA 3HBFA 2DLDA 2R00A 4M76B 3DB1A 2GEKA 3RWBA 3COWA 4XX0A 4RJ2A 2C8KA 3IBTA 3HNRA 4MCAA 1DSSG 1U7DA 1WDTA 4AJ4A 4CG2A 1Z06A 1XZIA 2D5AA 2AOUA 2VN8A 3MJCA 4I5FA 3EZ7A 2H92A 2XD4A 4L4SA 3H4VA 5EVCA 4KACA 4NS1A 2ZSEA 5DM0A 1XG5A 1YGPA 1T13A 1NSTA 2LPMA 4C1BA 5IDQA 4RM3A 3ETHA 3W06A 5ULLA 4COOA 2WMNB 1ZUIA 4ZDWA 3G9TA 1URPA 2ZIGA 3KT8A 1JU3A 2RHCA 1E9SA 2QVLA 1KOLA 1MA0A 3HCEA 3RU2A 5A3QA 4F9TA 5AVRA 1SQ6A 2J0VA 2VZLA 2UZAA 1A72A 1DC3A 1ZCJA 2A67A 2R96A 3CX8A 4MYDA 3KSAC 1ODKA 2I5PO 2RHLA 3MJ4A 2F1KA 2C29D 2CNKA 2JAXA 2QL9A 3JQEA 2W11A 3TLGA 2YC2C 1GDTA 2WIAA 3P9ZA 4JQCA 3Q0TA 5G41A 1T8TA 2P9EA 1VLQA 5F73A 1REQA 3NTOA 1TEHA 1FNMA 2XYQA 4C0HA 1V4BA 1I01A 4RA9B 1HL3A 5EE5B 4DREA 1NVKA 4HDMA 5ALSA 1L1QA 1QF9A 3H1FA 3WRXC 4GGOA 2YQ4A 2QTBA 3KHSA 4TQ9A 3KKKA 1JB9A 2IDKA 3RSHA 5G1NA 5IJ9B 2ZJ5A 3R77A 4OLJA 4KITB 2BELA 3BXXA 1MC4A 5JEEA 2HK7A 4XLZA 1XF9A 5ICCA 1FYWA 1EFVA 4EY5A 3OMWA 2ADOA 3KJQA 2ZIWB 4OMUA 2JFBA 3FCUB 4P4GA 2JRLA 4QU8A 3G9XA 3ICVA 1OI3A 3SS9X 3DFUA 3UGTA 5L3VA 2HUPA 1KSFX 3ZDEA 1NW3A 4JC5A 4D6PA 4EG3A 4MW4A 2SCUA 1GT6A 3PWSA 5DK6A 4DM7A 3E8MA 3L4JA 1CNMA 3F5QA 2QSZA 1COWA 2XXBA 3HCNA 4E09A 2FTKE 1X87A 4XOIA 3QSYA 3S6JA 1PJBA 2ZRJA 1BDMA 3OQHA 4Z3OA 3L8YA 2OHFA 4FQ8A 1CETA 2BKEA 3BGDA 4MEJA 4MYRA 4E88A 4CEJB 1MBZA 1PN3A 5HEKA 3O94A 2Z2IA 5HRUA 3S99A 2HV9A 4LV5B 1VMAA 4MI6A 1VPWA 1GGMA 3JWPA 3KDAA 3CLTC 4ZI5A 4ENSA 2VPQA 4DCSA 4DB4A 2BMVA 5EE3A 4D44A 4CJXA 2VUTA 2G8NA 3ETEA 1M5UA 4L07A 2YVKA 3HS3A 4DLXA 3CEHA 4QM6A 4OGLA 5CLIA 1YB6A 1NP7A 1GZUA 3PHCA 1K75A 1BHJA 4N0QA 4PSVA 4MVJF 1EUQA 4U7TB 1B26A 1B0UA 3DBHB 2DECA 3SOPA 1DBRA 2WJYA 5FNVA 1FS6A 3FVWA 2O2XA 5EUQB 1DWOA 1R15A 3F6PA 1PJ8A 3U48A 2C04A 2OY0A 2BJHA 3I6MA 3V1TC 1F5SA 2XUHA 3DBLA 1ZH2A 1H6BA 2OBNA 4LEIA 4MYCA 2W2TA 2V7EA 3RROA 1XD9A 3RUCA 4EF4A 4UTNA 1U0BB 3IQIX 2ZJ6A 1FLAA 2IYVA 1DBQA 1S9HA 4EGFA 1P1JA 3FNEA 4ZEVA 4PX5A 1GA1A 1KO4A 4UARA 1ISRA 1EE2A 1M54A 4P7BA 4G5GA 5EINA 4JJ8A 5C0OE 3SS7X 5CB4B 5GIPE 1MQSA 4PQGA 4WNCA 3LYLA 5HDBB 1LUAA 3C3XA 3GXBA 1HO3A 2VYNA 1Q7RA 2YXNA 3RD5A 4FOTA 4AS2A 1ZMRA 3EVZA 4W6QA 5D6NA 4G1BA 1UMCB 1K63A 1L4GA 4UHDA 1ZRNA 5JCJD 3U3DA 3J81k 2FN8A 1U9ZA 2RK3A 3ESZA 5WRFA 2FNAA 4ENQA 1A8UA 4JLUA 1VBNA 4DE5A 4ZK6A 4GI1A 5KNLA 1PVDA 3DQPA 2OESA 4MUIA 4PINA 4YP0A 5CA0F 1R8XA 4CU5A 3COZA 4R0NA 2PZ8A 4KNVA 3ITKA 4G1UC 3UJNA 1ZH8A 5A2QA 1EE9A 1SD2A 1RI5A 3ZDBA 3TXYA 2HPHA 2WAXA 1SXJA 5BW5A 4TRRA 4WX2B 1ORTA 1YO6A 3M1AA 3OA0A 4KE9A 4YR9A 4O29A 1XDSA 4QO8A 3KK0A 3QVJA 4M7WA 1D04A 4XWGA 1KK2A 3T7IA 2IBTA 1E2IA 1WAMA 1JR3E 2VNSA 1NQXA 2X8LA 4PPQA 2TSYB 1H69A 5FX2A 1NXSA 5JCOC 1SCNE 4HWOA 1QP7A 3H9UA 5SZHB 4J94A 4AKEA 2FRXA 3QOXA 3UC5A 2Q3MA 3R5HA 2XKJE 1FCJA 1HURA 4TT3A 1Z5PA 5HUJA 3AFHA 2VJOA 4F2DA 5AVTA 3SIRA 3WMGA 2B9EA 3RPEA 3L43A 3WA6A 1NUSA 2V6FA 2A0KA 4JNKA 4OHYA 3QXXA 1D0VA 4P3PA 3OIDA 5BR1A 5CRIA 2WYHA 4IMJB 1N7IA 5E7JA 3I58A 2DR0A 1TAGA 1F8FA 1E60A 1ZW1A 4HTAA 4PGHA 4E2ZA 5KJCA 3BWXA 1UUFA 4NDAA 3FZNA 5DNAA 1RAEA 1KI1A 3C1TA 4UUPA 4B85A 4RXTA 4PC2A 2FR8C 4FOOA 8GPBA 3SAJA 4LPKA 2GJ9A 4UVGA 1AGPA 3WYBA 1CSEE 1SIUA 3NH9A 1WWKA 2PLFA 1DRKA 3NQ41 2AW3A 4MVJA 1TA0A 1OHHD 1YHZA 2DQYA 1NSYA 1QE3A 4WNIA 1XCMA 2OGUA 4HH1A 3DM5A 4J4TA 4JELA 4CR7A 2AN3A 1LQ2A 1HDXA 2CL5A 5DM4A 3ZQJA 4W63A 2PVCA 2QQGA 2W98A 2HUNA 1K6JA 1XCGB 3D59A 1YQUA 4LJ5A 5AVVA 4Q03A 1BMFA 4X7PA 3GNLA 3QNWA 5BR4A 3OWOA 2JRCA 3F4BA 1JVBA 1O1YA 1CY7A 3BXFA 4LY9A 2XNDA 2HMYB 2O1SA 1P2VA 1UT8A 3C14C 4L9AA 4PLFA 5DASA 5LLSA 4QDOA 3FJYA 4MWGA 4ZJPA 1GLVA 3KPYA 4PHTA 4XPIA 4DFDA 3V4PB 5HG0A 1IH8A 4JN6B 1V3VA 2HU8A 3PKIA 4PC6A 3WHLA 3M81A 5JBIA 4EG1A 3PFHA 1NM5A 3S1AB 2JBHA 4AWBA 4LZAA 5KSOA 2HKIA 4PWYA 1DAIA 2JARA 4B6QA 4ZMRA 1IZZA 2PGNA 4K6KA 2ORIA 4JS0A 3H05A 4D8YA 4UUBA 3D0KA 3HEAA 2VI5A 4JT9A 4DSAA 1OSNA 2UZ1A 2TRSB 4KVZA 4UZFA 1BEZA 3NYWA 3GI1A 5ED4A 1KYQA 3HN2A 3TM4A 4W5OA 5DYGA 4CM9A 4OSEA 4MV6A 5COAA 4IG9A 1GPNA 1PJ4A 2HLNA 4X8HA 2XT9A 2Q6VA 3F90A 5E1DA 4BVKA 1LDMA 2ZQZA 3CTPA 4B17A 2R86A 3BD9A 1BKYA 1N5DA 3EVNA 2VK1A 5I7AA 3VPAA 4X45A 5DSTA 2AC7A 3KVOA 5B3JC 3FSGD 4ZANA 4Q4AA 4CQNA 3M83A 3MAGA 3IPYA 4J91A 4BQRA 3AQ4A 1IN8A 2JNWA 3FNRA 2GFIA 3OCVA 4MGHA 1TX4B 2D0IA 3PPWA 3RF6A 3I4FA 2RHOA 1XDDA 3IT3A 5A71A 3W4KA 2QR3A 3HY4A 4GMDA 1XHEA 3WL6A 1YS4A 1GWNA 2Z57A 3R76A 2QTRA 2FOXA 3D3KA 4RXMA 3SEZA 4XDGA 5EEHA 1GTZA 3H11B 4QLBA 1TQ2A 1VHDA 1L4FA 1E79A 3B36A 4NHOA 3HMQA 3JQGB 3LVBA 1RD4A 3DV9A 4LN1A 4PGAA 3AY0A 3TKLA 4V1CI 1XZGA 1SXPA 1TW3A 5AOVA 2IP1A 4B3JA 1ABEA 4J9VA 2CMDA 2O52A 3I92A 5JUWA 5JYDA 3CUUA 1X7XB 4Q05A 4H7IA 3NGLA 3W5VA 3ZHYA 3E3LA 4HPJB 3QEKA 1C3XA 4I5GA 1A5ZA 1PR3A 3CJTA 4OQ4A 3M6LA 1ZYUA 5LQDA 4XDHA 2QUBA 1KI6B 4C6SA 1YI8A 3DZHA 3QKWA 3E22B 5K6TA 1QRTA 4U7HA 2QRZA 3C3MA 1SCAA 3GARA 1ZN9A 2WQ6A 1RIFA 5HRAA 4OLBA 2E4VA 4G67A 5EIWA 3NXKA 1UJCA 4TV8A 4AO8A 2I65A 4CKBA 4G5RA 5AVUA 3WADA 1SVIA 1QR6A 3KFXA 3KPVA 3L41A 4TLAA 4FDVA 2VUIB 5GADl 4B3GA 4R01A 4X92A 5B1IA 3EPPA 1DWUA 4Q7QA 3UAYA 4I9UA 1BVHA 1JIUA 1N8TA 3LCVB 2XNSA 4C4XA 3GEMA 4F6RB 4A16A 1O5IA 1IUPA 3OZDA 2A9FA 1Z88A 3EOBI 1X7YA 2JZNA 3OOJA 5DCYA 1AKVA 2Q99A 3FDZA 2CJWA 2YXLA 2JGRA 4HTFB 4J8PA 5KO2A 3ZLJA 3IEVA 4BPBA 3OVMA 5I45A 1K3UB 4KWHA 3MCAA 1CJUC 1ZZEA 2C94A 2VDNB 3CCFA 1U4OA 4I3GA 1WVGA 3ESCA 3QX7A 4NJEA 1DBVO 1Y1KE 3ROMA 5EKDA 1G4UR 3PA6A 1QGUB 4BU1A 2AXQA 1EE1A 1AG9A 1M5TA 2HDHA 2WVGA 3G0DA 2F00A 1XE3A 3GLHB 1OH8A 3HUFA 4D0LB 1PWZA 2JJMA 5BSUA 3FX2A 4DQXA 4KTVE 1K2VN 2G9RA 3C24A 4LXGA 3VH4A 5DEIA 4XIYA 4M1MA 2DKOA 3FF1A 3EGOA 1QWOA 3RTBA 1K1EA 2O3QA 4FS3A 3JXEA 4U9HS 4MVJE 2OOKA 1CUUA 1GTVA 5HQ3A 2GJSA 3IVGA 2PJRA 3LDAA 1EVYA 5SY9A 1KWGA 4JI7B 2JASA 4L51A 2P9GA 4QXRA 4ALIA 3G6KA 2VP2A 3OZ7A 2H63A 3R7WB 4AAYA 3N8IA 2DJ5A 3P0EA 4AXXA 4G5FA 1K6MA 4TZ6A 2M6RA 3D6VA 4CI9A 1VZ2A 1I30A 3N2IA 1L5YA 1O95A 1O0SA 5JNTA 2CXPA 2RJOA 1BU8A 2EG9A 3GJSA 1S5PA 3Q7PA 2GEFA 2PY6A 1YQDA 1YNOA 1ESEA 2HPVA 3HGQA 3KYCB 4OH7A 1QYCA 4EJSC 4EY4A 3R6LA 2RG1A 1UEJA 2IELA 3ELWA 5E95A 1CJTC 5ENZA 4HVCA 1IPFA 3F6EX 2IYOA 1G18A 5BWCA 2FMIA 3FPCA 4IDBA 1SBZA 1AIPA 2D0OB 3KSUA 4NZMA 3ZKAA 1YDFA 1JIKA 2ZAOA 3NG1A 2VLIA 2H65A 3P5BA 1SOWA 3AEQA 1TVCA 1E3QA 1PG0A 1TO2E 3CLSC 5DJ5A 5D2CA 3SBXA 3USCS 2JAOA 1JEYA 4KU4A 4OMCA 2G83A 3H1BA 2CCJA 2E87A 2WSSD 1SZDA 5FLXA 5K8UA 1NBEA 3IYLW 3ELYA 1NJ8A 3QUBA 4MRMA 3UICA 5E7IA 1FSGA 3I9MA 1WKBA 2AN4A 3C4VA 2V0GA 4AJLA 1U0LA 2C77A 2P0AA 3ME5A 1MVLA 2GWRA 1G7RA 3FKSA 4FJ2A 4OXQA 4UHJA 4YT5A 5DIFA 5EUMA 1E3DA 2AFVA 2FUCA 3ODPA 4LGVA 5CDYA 3BSFA 2ZKIA 1ENOA 1JLLA 3ZWMA 5AUQA 2F1OA 1ZJJA 3QVOA 4CT5A 4WKBA 2VC2B 2WWHA 1T2FA 4IDHA 1WMAA 2E1RA 3FCEA 5CYGA 1PR5A 3OU7A 4MUMA 5F9MA 3ZDAA 4AULA 4D6YA 3V4LA 2F6RA 3C8ZA 3VKVA 1L4HA 4KXVA 3GFTA 4NSNA 1A76A 5FWXB 4IS2A 4CVNA 1OVMA 4FW9A 4U9UA 2ZWPA 5E8JA 1K86A 3IB6A 3AR8A 4EJ0A 2O5CA 2DTXA 4KO4S 3TI9A 1Q20A 4LCBA 4QUIA 1JIXA 4ZXFA 1ESNA 1VA4A 3UH0A 1O57A 2RGCA 5M5BA 2QAJA 1TJ5A 3QXHA 3YASA 2F9FA 3JQ7A 3QY9A 1F20A 4A5OA 4LOLA 4Q7MB 2MHCA 1W29A 4D99A 5BSMA 2WBLC 3OIUA 3VHQA 5E3IA 4YV0A 4D41A 4FQ7A 3W6PA 3NHAA 4TWRA 3K2BA 2WY2D 5IH3A 1FY2A 4UMVA 1CNEA 2P9JA 3EK2A 1JIVA 4HP8A 4KR7A 1HRDA 4IFTA 3VYRB 4Q1VA 1GA4A 3GUUA 1YS9A 3V7FA 1JDBC 2QMHA 1PD1A 3SM3A 5LJLA 2Q3LA 4DA8A 2HD4A 3O7WA 4I50A 1KS2A 4AY5A 3BWYA 3FBGA 3QW2A 5GZ6A 3P52A 5D87A 2V9CA 3N9IA 3QIAA 1HFJA 4EYEA 4R7ZA 1RHJA 1I10A 2NG1A 4CUJA 1L4NA 2R44A 4CM6A 1UMBB 1WSBA 3K6SA 1KQGA 3AWIA 1N5IA 2P11A 5H81A 4RGBA 4B6RA 1OYYA 2FFJA 3SX2A 3RSLA 2DB3A 1W25A 2HRZA 1U3TA 2QZ9A 3S2IA 4QARA 2FX2A 1FJXA 3WGYA 4A0HA 2ENUA 4O2AB 2G1JA 2VPYA 5E2IA 3G0OA 1F3LA 2DSTA 1PZFA 2AE1A 3E53A 1COWD 1RTKA 4QUDA 2BKAA 1OKKA 3CC8A 2FCRA 3OO1A 1KI3A 3AFMA 4BWFB 2RIPA 5E2AA 4C4TA 2PUGA 3HDVA 1YCGA 1NRXA 2O14A 1W1UA 3UV7A 3THSA 5ALVA 4FKMA 4K3VA 4BZWA 3GG2A 2RI6A 4NAUA 4POOA 3LPNA 4Q4LA 1V9LA 4PONA 1H8HD 4A5SA 1Z28A 1EWRA 4F06A 1BOOA 3H8SA 2XZDA 2YOHA 3PE6A 5IDYA 2HO5A 5J23A 1YIOA 3FCAA 3DG9A 1PTJA 2HRQA 4JSRA 1TM1E 4HLCA 4WZAE 4XR9A 3M4ZA 4DCCA 3PC6A 4P2BA 3UN1A 1HNZB 1E1MA 2V58A 3GJQA 3CVVA 2UUBB 2OZEA 3O03A 1WEKA 1F2VA 2AIRA 2BY4A 2KB0A 1FFCA 2ZWAA 2ZBFA 2YICA 1YJBA 4LXYA 5IT5A 1W30A 5DE3A 3COVA 5AK4A 5A5FA 4L15A 1RQ2A 1WDMA 2YHBA 3PDWA 1V11A 4RQAA 2OO5A 2GTIA 4JKYA 2PUFA 4N9QA 2GJKA 2IZZA 3DLAA 4NAHA 5DSZA 3VPCA 3T34A 1BMTA 3IO5A 1L7AA 1Y89A 4HDKA 2HFJA 4LWOA 3HZRA 3PITA 2RHTA 2P3LA 5M2QA 1KJWA 1USWA 4KGVA 4TZTA 4MS1A 2FUEA 1YD7A 3TOXA 5DGCA 4FWTA 2OORA 2QAGA 1KDOA 4N7RA 3GJXC 1ILWA 1MUUA 2ZYWX 3H18A 3IP6A 3BF7A 4Z86A 4ON9A 3CRVA 3GW8A 4FZ3A 4RC9A 3KTOA 1YI0A 3BFJA 2LRHA 4B31A 1YRLA 4OUDB 4HY3A 1EM8A 5CYOA 4PG8A 3GLFA 2QD2A 4ZV7A 2XYHA 3MC1A 3HBNA 2WF8A 1P0CA 5CG2A 1YASA 4CDNA 3G8DA 5FLEX 4U7WA 1PR2A 2BGNA 2FMTA 2HLDA 3TKYA 1QQ6A 2W22A 3GU3A 4LRQA 2B34A 5HMLA 5BR8B 2Z9CA 3L0CA 1EXVA 3DO6A 4Q0MA 1C4XA 3E7DA 1ECBA 2OB1A 2BDUA 1F0YA 4IJVA 4X1KB 4C6TB 4V0MA 3BEOA 1F0KA 2GK3A 1Q19A 3E5RA 2HIMA 3RU7A 5I7HA 1DIRA 1MQ9A 1QIJA 3WVNA 1SKAA 1J00A 1VGQA 2X77A 4RKWA 1QVZA 4IVQA 3FOAA 1G5TA 1TCBA 1C3EA 3REQB 2VXCA 3I39X 4HHEA 1P3DA 2ZIZA 5EQDA 3AIKA 4LYYA 4B6SA 3K71B 5FTNA 4D97A 3BK7A 3EGWA 2ZE7A 4XSGA 4WT7A 2WYUA 2BJVA 2I6SA 3SVTA 5AW3A 3HUDA 4RBNA 1DDIA 4BJ5A 4WTOA 3P0HA 1LRKA 1CUAA 5KAMA 1FPQA 1BQ3A 1KDRA 1N5JA 1HL7A 2A9VA 2QYSA 3DUFA 3KXKA 4ZT5A 3T5TA 1Z4QA 2JK0A 3IXLA 2IW3A 3NHBA 1UAGA 3K1ZA 3E9ZA 4IJKA 3C6XA 3SZRA 5LIRA 1GRQA 3U9TA 3V1UA 5AW7A 4Q39A 2GO7A 2H06A 2ZUBA 3JW8A 3LQFA 3TOCA 1E0AA 4YYZA 1PHRA 2BFAA 2XA1A 3OTOB 3KPWA 2BLNA 3EWNA 4RLHA 2VTBA 4EJ2A 1ZAYA 1CF9A 3EXHA 3K6RA 3H5RA 2CVZA 2OEPA 3LWBA 4IVRA 5E0OA 1G3IA 4WESA 3STUA 5AQ1A 3B2NA 4UPEA 3UAWA 4Z4CA 1DZIA 4BN4A 3CU5A 2OSVA 4NABA 1KRXA 1Z16A 3FCCA 3LV8A 1M67A 3WWYA 4LNAA 3GA7A 1RAFA 2AOWA 3L7NA 2R0QC 2JPDA 4WA7A 3ODGA 1MB3A 1TL7C 1GUZA 3C16C 4U2DA 3R7FA 3IDAA 2Q4BA 3V7NA 4DUGD 1T1GA 2P6NA 2XNKA 1OE0A 4RKFA 2ZR9A 3IQHX 4FX2A 2YRFA 2BE7A 1E1LA 3FPAA 2F59A 3MWEB 1KE2A 3PSHA 3VNUA 2G5GX 4KSCA 1GFZA 1UJBA 3EN0A 3FDIA 2WZCA 4ARZB 2NN3C 4IAOA 2UVDA 3QKSB 9GPBA 5HZGA 2H9AA 3WICA 1IM8A 1Z08A 2ZB8A 5L3ZA 1GPMA 2QI9F 2F1JA 2W90A 2JIDA 4OAPA 2FXVA 3FGOA 4INJA 4TS1A 3I52A 2E6UX 2K5UA 2J41A 1T36A 3DBVO 1WMBA 3PGXA 4HX2A 1W581 3DUFB 3FYDA 1S8AA 1NFFA 1YZLA 1MC5A 1E77A 3P71T 1U1EA 5DGTA 4HRVA 4EA7A 4UEKA 4X1OA 3PF8A 1U0OC 1W4CA 3FOFC 3OEEA 4CLXA 5KYVA 1I36A 3DZ8A 4K6CA 4WOKA 1UBNA 1UWVA 4MIKA 2YDYA 2C5SA 2Q1WA 1JBQA 3EDOA 4NBVA 1AKNA 4NC9A 1USGA 1T9ZA 3VHXB 1ZUNA 1K5PA 1XZNA 4TTJA 4NZ9A 3RFTA 3SFVA 2P9ZA 3ZVLA 5I7SA 3O4GA 1XPUA 2FW7A 2VYVD 4TMTA 4CL3A 5HFJA 1N3LA 3M6UA 4IYRA 2NU9A 2O0HA 4HUQA 1BU5A 3CN7A 2R6AA 3RUDA 1QK3A 3PEWA 3L6EA 5D5PA 1NJ2A 1XLTA 1SH7A 4B7UA 1P19A 2J3KA 3NGMA 2LIVA 2YZKA 3EPLA 1DT5A 1GRCA 2RGNC 1Z2NX 1PEAA 5A05A 3N1UA 4M0DA 3KQPA 1N6RA 2RGUA 4J29A 4O4LB 4YAEA 3PNBA 4Y3UA 5CITA 1M0SA 1X1EA 4N5NA 4ZCSA 1NBOA 2IV3A 4E5VA 1U94A 4XQCA 1MRZA 4NYMQ 5DU2A 2PWZA 4XVQA 4A8JB 2IS4A 2EF0A 1IBSA 3W5DA 3K4PA 2C5AA 2VEOA 2GBLC 1I7LA 2RIRA 4D2IA 4Y1RB 1DKUA 4M9XA 5JXHA 4GECA 1TD9A 1L3IA 2H85A 3FPGA 3QNUA 3P9NA 1HMYA 1A7JA 1PF7E 2ZI7A 4IHQA 1VSVA 3FPJA 3PPXA 3SFTA 1E9DA 1Z34A 2JIZD 2L69A 1D9ZA 2YQZA 4J0CA 5DCLA 3RTEA 1RZUA 1FRFS 1T5SA 4OHOA 5IM4A 1S3GA 2X9LA 4LE1A 3HYLA 2G0NA 1X80B 4NPCA 3BL5A 4Y0NA 4ZDKA 1QMPA 3H9BA 1UFRA 1Z8HA 3BBPA 3EC1A 4O4JA 1QTRA 4O08A 5B3LA 4ZQHA 3AY3A 3IELA 3MJVA 4P32A 2JFXA 1T29A 2CHUA 3DCJA 3WKEA 5H4GA 1M74A 3CEJA 1OFUA 1YFLA 1Z0SA 2JLQA 2O5VA 4NE7A 1RLMA 1SG9A 5DRTA 4QC2A 2JZCA 5HDQA 3SHTA 4PZUA 2C7QA 1HSOA 4KNYA 1W87A 2PJDA 3WB9A 3ULKA 5GZ1A 4ALMA 1QV9A 3NAMA 1DEHA 4H1HA 4EBBA 3L7IA 2Q27A 3SHQA 2WINI 4E5UA 3K72B 1AKRA 4PE5B 4D5EA 1AS0A 3A1VA 2BFMA 1DAOA 3PRKE 3GFPA 4L5JA 1THMA 4MLZA 1LSUA 4LSMA 3LT5A 1HUQA 3PCRB 2N9UA 3AUYA 5D1NA 2DFDA 1ORVA 5AM2A 3STWA 4MS3B 1BGXT 1KOGA 1XZDA 4JLOA 2BFDA 2WM2A 1DKPA 3KEOA 4OIFA 1Z4LA 2EZTA 2V6MA 4UASA 4YA6A 5HJ5A 3T3EA 2XDQA 4MQFA 2OO5C 1LVUA 1XWIA 3P4UA 2R84A 4XSHA 5AM5A 1RJFA 3ZGVA 1D1SA 2X8AA 2IXEA 5EZSA 1NUHA 3QPWA 3H13A 1GUAA 4RZQA 2BGIA 3ZN2A 3CA8A 3LY7A 3DMNA 1EIZA 2H2DA 4OSOA 1PFGA 3TZBA 3LY5A 5ABPA 4TLMB 3QLUA 1GCIA 1AT1A 3AP3A 3PQEA 4PC3A 3M7IA 3ZEAA 1JQAA 1Z6GA 2XHEA 1UXHA 1IEWA 4RMHA 3B1ZA 1DHRA 1BXRA 2YJTD 1H5UA 4JKIA 1WZNA 5AUPB 1EK1A 1EVLA 5I7RA 5G2OA 5A4MS 2BI8A 4DF3A 2ZUDA 3U1BA 4YR7A 3CFYA 1VB5A 3FFBA 1LBHA 4Z4FA 4ZCQA 2ZBUA 2CB9A 4JBNA 1F2UB 1PJLA 3KB2A 5BNFA 1YOVA 3OPMA 2E7ZA 4AJ9A 1EZ1A 1KQNA 1GNVA 5HKAA 2IX3A 4LPSA 2Z8YA 1NFQA 3CKMA 4LJAA 1HG1A 1Z62A 1HXHA 1LPNA 4JVMA 4F96A 1UBCA 3BMNB 5FUBA 1PLLA 3SZOA 1M8KA 1TJPB 4R2WA 4UVIA 1BHSA 3GEBA 3L6DA 3NWJA 1E9EA 1GRVA 1SKYB 2VAPA 4JJIA 4DA7A 4EKIA 4F5DA 4Q4CA 2WI8A 3R5XA 1SBTA 4BFLA 5HA5A 2IWRA 4EJFA 1GZ6A 2Y1LA 4KQ2A 2IE8A 4XLTA 2FSVA 3UJPA 3ZV4A 4YRZA 5LMZA 1PJRA 2O50A 1TNDA 1FYEA 1ECCA 5HKBA 1UMCA 3QYFA 4I1UA 1PYDA 4KE6A 1J56A 5KCMA 4NV1A 4AZVA 1ZA1A 4EG7A 4EF5A 3M0EA 1B76A 1RWXA 2ZUTA 1Q3KA 1MO3A 3KJEA 1UANA 3UT6A 3VH1A 3OQBA 3UBTA 2OVBA 2IZ6A 3AEYA 4DQLA 4W1SA 3LPAA 3U4MA 1RJGA 4AIRA 4K6MA 1C9EA 2G40A 1N4AA 4KDRA 2CSXA 5ANRB 1U99A 2PO7A 3R09A 1SKBA 3DLPX 4GMKA 3SQXA 1O58A 1CS0B 2NV2B 5KKNB 2D5CA 2VJLA 2JA2A 3ZZMA 2A1UB 2BSAA 2ECQA 2HAEA 2I6XA 2QG9A 3KBBA 3D4PA 3PQ4A 3FNBA 1T9KA 4HGOA 1M6WA 1NAHA 1S02A 2H57A 3DD5A 2GCOA 4ZVRA 1R6BX 1H8HA 2DFKB 1T0PA 5A2GA 4Y2YA 2QRJA 4X71A 4DT1A 3FVQA 3SG0A 3N2NA 3HKEB 4NCXA 3IV7A 4QDJA 1SBIA 2GMWA 3JALA 4O5OA 4WCVA 2Z4SA 4RXUA 2UU9B 2P68A 3R1IA 2ZS9A 3HJHA 1WVIA 2OKCA 2MSLA 4JENA 1RPAA 3VU9B 1L5WA 4MQEB 4QYMA 3VGPA 3USZA 1KMMA 3HDJA 2Q6KA 5DNEA 3W9SA 4C01A 3PTAA 2YCBA 3ILVA 4LRWA 3RG2A 5JSFA 3COSA 2COKA 3H9EO 3H99A 3A7EA 3CRNA 3LS2A 2B6HA 4GWKA 5KWVA 1EDBA 4ZPJA 5JFOA 3SLRA 3OI7A 1RJWA 3G9QA 5H5JA 5KNBD 2IBMA 2G0TA 1VJ0A 3GEEA 1FFAA 1YJCA 4FFMA 5TIIA 4XM1A 2JIMA 4GOXA 2A57A 3D0RA 4EI7A 2XXJA 3UVEA 1TU0A 2XF8A 3AGQA 1KY5A 5B7QA 1CPYA 4ZIRA 3GGSA 1OLXB 3KT6A 3K73O 4QTXA 5E38A 1G9TA 2ZTUA 1FNDA 4LHYA 4YHHB 4H59A 3EPKA 2HBZA 4KR6A 4IMIB 5DXFA 2OWEA 1FTQA 3L6OO 4IFBA 2V8OA 2XCOA 5DYTA 1D2RA 3NTXA 1ACMA 4ZAYA 1L4EA 3VX4A 3ZGNA 3IALA 5EJEA 1TTHA 1H4SA 1T5BA 3PVZA 2O2HA 3R6TA 3HLKA 4RMIA 3TZLA 1AMNA 4NE2A 4F7DA 4IH4A 5EJ9A 2AJ8A 2QXTA 2XKAA 3IUSA 1Y0BA 5BN5A 3GDFA 2QTVB 2IFTA 3FPEA 2CDAA 4D4LA 1AK2A 4G07A 1YFKA 2HNAA 3LC2O 4U2GA 3X0DA 1MABB 3ZD9A 2RSLA 2DPYA 3LYUA 4XTCS 5ALHA 4ZV4A 2NQ8A 1XLUA 2PBLA 1M34A 3E7XA 4MA5A 1CUCA 2FZ4A 5AKGA 2GLUA 4KPUB 2AS0A 4YAJA 3MWLA 3SC2B 3IA2A 1E2UA 1P91A 2BUAA 1RZRD 1X1CA 2EKPA 4RTMA 2WD8A 3WR5A 4FYXA 2J7PA 1NJFA 4AJKA 3U19A 2H31A 2ZZNA 3TFQA 4JLDA 3KE8A 2ODPA 2Q3FA 1YR1A 3EOZA 5IDWA 1KEVA 1M1NB 4KIGA 2EFJA 2OK8A 3FB1A 3I9FA 1SK9A 5EIBD 3S2YA 1M7HA 1HYHA 3HU2A 4ZMBA 3UG6A 1V41E 3WIOA 3WRWA 4ZREA 2QUKA 5CXQA 1YR8A 3GEGA 4YMIA 1OLUA 4RTPA 1VSTA 3HXOA 5JOQA 1RRKA 1U8FO 2HQ1A 4U2BA 3ZHXA 2MSEB 2BKXA 2EZ8A 2A4MA 1MB0A 1JHMA 2BFEB 1Q74A 3DYVA 3ESDA 2Z8YM 2J07A 1I6KA 3KXIA 4JODA 4PO8A 2GJ8A 3C74A 1MTOA 1JPUA 2AQIA 3TF5A 4HLQB 2X9NA 1V1JA 4K6FA 2WT8A 3P9CA 3MJEA 4KXQA 4NU6A 3W6UA 1U7WA 5KJ6A 5IDVA 1KU0A 2EP5A 4KQJA 5BT9A 1NX9A 2ATVA 3EFOA 3O82A 5JG7A 1BE8A 3UA3A 2NM0A 3T52A 1MG0A 4XQEA 4Z0NA 3NFRA 3O31A 2BHRA 1NUAA 3KWLA 3JYPA 3O74A 1PJTA 3TRDA 2UKDA 2VK4A 2IYNA 1R0YA 1EGVB 1T1EA 4ISCA 1SVUA 4GPEA 1WRBA 2UVQA 4NOKA 4TZ0A 2Y9MB 3D3EA 5EJIA 5HX7A 3H8VA 4HCJA 4ZO8A 3FYTA 4UCWA 3QRWA 3MWFA 3T5PA 1T3HA 1C7IA 5EWLA 1TKBA 5JI2E 3E70C 4UXIA 4YROA 2OCPA 4I50B 1R5NA 1U2RA 4CM7A 4GR4A 1HK7A 3O3CA 3V6MA 5BXYA 1L5FA 4A8TA 3VI3B 4DVGA 2NZWA 1PS0A 1MGPA 2A8YA 3QH4A 4JQOA 5HFAA 3JAMA 1DJMA 2YTZA 3R6WA 3M6VA 4IP0A 1QYVA 3FPBA 3I53A 4NQZA 4YJ2F 2CWWA 5D51S 1I24A 3T3OA 2EP8A 1P4RA 3T12A 5JNVA 2WM3A 1NASA 3K9HA 3H5NA 2QRPA 3D4IA 4OBBA 2ACKA 2W0MA 2ZI6A 5J2TB 2C4NA 2GNAA 1D2GA 3Q88A 1RT9A 3A27A 4ZOLB 1J24A 1IJBA 3A04A 2AUNA 1DAEA 3OOEA 1KHTA 2B92A 4JWTA 4TUYB 3WFIA 2O2CA 3OFSA 1CJKC 1Y9DA 2G9ZA 3BULA 3A26A 3WLTA 4WNAB 1BDHA 3KT0A 1JDSA 4H08A 2Z3ZA 4MIEA 4YAKA 1OROA 3GJTA 3NLLA 1AV6A 4MVJG 5LP6A 3FY4A 3ZK9A 4QVKA 2G17A 3S5UA 5DI9A 1D8AA 3UMGA 1DKQA 2JCVA 4TMVA 5ALRA 4EUHA 1IBLB 3EPJA 3QLTA 4I46A 4ZYWA 5K0EA 4GBED 1BC5A 2Q62A 4YO8A 1BS9A 3CNQS 3NKFA 3OESA 4MR8A 3WHPA 2Q5FA 5L9AA 3GLIE 4D8UA 4D0SA 1T8WA 4QVGA 1T3TA 2QPAA 4Q4JB 5D3MA 3B1XA 3IVRA 4FGSA 1TMKA 2P5YA 1FYXA 2BFBA 4NH4A 1FFXA 1K6EA 4E14A 3TBFA 3FPSA 4N0PA 3VBCA 4GS5A 1VL2A 5ENDA 3E9MA 2XB8A 3NT5A 2ZBVA 4EL0A 3I6BA 1OB5A 4QGGA 2Q1SA 1Q12A 3KZ1E 4BBJA 1DRJA 2YX1A 3GELA 3N74A 3R3SA 2O1EA 1LPOA 2P6MA 3ORFA 4WXHA 4M7OA 5HOEA 1OWMA 1XQWA 2ZSHA 3QQPA 1C80A 4DBLC 3CHYA 1JHOA 2Q9AA 4FEAA 3R0QA 4Q12A 2OV4A 5GM1A 1F2TB 2J3HA 3JYLA 1XA4A 1ZGZA 4C4YA 2H4HA 2PWYA 4P4LA 2RDMA 3E9CA 4O2BB 4JJAA 2QE6A 2QEQA 4PX3A 4CCYA 4H0FA 1MHTA 3I9KA 2F67A 2ZIEA 5DM70 3TLEA 1KVRA 2POCA 3DVAB 4RY2A 5ECGC 3PXGA 4BXOB 5EYPA 2I66A 2XITA 3BXZA 3P0JA 4PHGA 4C2AA 3TLKA 3PGKA 4G9EA 3UHFA 4N41A 1VBFA 2H3EA 2IOFK 4GMHA 4ND2A 1P60A 2RGYA 2MMGA 5KQSA 3PI7A 1AMOA 2VDKB 3FBWA 2ZW9A 5DYYA 2YBEA 4I1RA 3HM2A 2GQ0A 2LZ0A 1DQSA 3TD6A 4EABA 2PKRA 4EO7A 2GZDA 3PC3A 1XCPA 4N4AA 3C97A 5J4LA 2NZ2A 3RFFA 1A8PA 2X8JA 1NLMA 3BIWA 3WL7A 4TYPA 1CUSA 3AK4A 1XKLA 3ZJ5A 5JYEA 1MW8X 1JFFA 5DB4A 1RXYA 2IYYA 4L4ZA 1AQUA 3MMXA 2RH8A 2JJ8A 3E84A 1MO6A 1S2IA 1NQVA 1UMDA 1VG9B 4WN3A 3U62A 3ZHZA 4EK9A 2DXIA 4MO9A 4EITA 2ZRGA 4W4TA 1BMQA 1LW7A 4J07A 4CF6A 2YMQA 3O7MA 4K9KA 4DAOA 4J3JA 4AF8A 2BWJA 3BCHA 1VG1A 1KIAA 4PNEA 2Q0SA 1JWAB 2UZ3A 4AZ3A 3KELA 1KZHA 3AHGA 3K0HA 5HCIA 3MQFA 4KPYA 1Q84A 3LQ2A 3SDBA 1FS4A 1RYZA 3GR6A 2M32A 2Y1EA 3EXIA 1ODJA 4NYMR 4XIGS 4Z9FA 3TAXA 5JARA 4KEAA 5IWAB 3AV0B 3JQFA 4UREA 2WIFA 4YS6A 4U3JA 4RPLA 3PL1A 1U7ZA 4LTNA 2Z1NA 3AHDA 2IHUA 3OOWA 3TEJA 4RZ2A 2QRHA 1Y5NA 3UXEA 3N5CA 2O4UX 1E8DA 3O8QA 4DC9A 2W2KA 4GL4A 2DFTA 1OI4A 3PIDA 3RJTA 4UM7A 4BO3A 2C2XA 1P8JA 2KE5A 4HGPA 4M0CA 4W5HA 1ZQ1A 2BVNA 4CF7A 5KZMB 2EQAA 5J5AA 3PD1A 4RD2A 1BAPA 4EGSA 1W4ZA 4DV6B 4BQNA 4DMLA 2YZNA 1YS7A 2FW6A 4JI0B 2LUOA 4KREA 1OGYA 3FWNA 5DTRA 1JKIA 2ZT5A 3Q2OA 3REGA 1GFSA 1YHNA 3ISJA 2J0EA 2MSKA 4L2IA 4I4TA 4P4SA 2TYSB 3FMVA 4JT8A 4CIXA 4RUKA 2RAVA 1WEHA 2GUGA 1EVZA 1Z0DA 4JYPA 2NUAB 1XDWA 4QODA 2I4TA 3UMMA 4OI4A 4EELA 1NVDA 2RBKA 4Q1DA 5TT0A 1TU3A 5KWJA 3ZLUA 2BH9A 1VE9A 3LSYA 5DNWA 4CLRB 4YONB 3KD2A 4QTYA 4BEWA 3M4YA 3UJCA 2YWGA 1IOVA 2FSSA 4B4OA 1E5XA 2HXYA 1SOMA 4G9BA 4AJNA 4F4UA 1T4DA 1RWBA 3FVRA 3ZLVA 1M1UA 1DC7A 2WUVA 1Y9JA 5FT9A 4X9XA 3PV0A 3T7EA 4AC9A 4YUXA 2CV0A 2OV3A 1N2JA 2C5HA 2PHZA 2PSJA 3AERB 1UJ5A 1ES9A 1X2EA 3EAQA 3MJTA 3ZBTA 2X42A 2EZ4A 3U5ZB 1IM2A 1X86B 2BJWA 1TT5A 4G1MB 2CCKA 3WRXA 2B2NA 4O2LA 1JT9A 1X0XA 2PUBA 2CF5A 4EQ6B 2QNRA 2XECA 2H18A 4XD7D 5BVHA 3VOSA 2AR7A 5EXEA 1IY2A 3TWOA 2X9VA 3P32A 4HT3B 3HVHA 3RRXA 3LCRA 3O21A 5G4LA 1CX9B 1PDOA 1QOZA 3GLRA 3KZCA 3L7OA 2HEGA 1A4UA 1VQ1A 2X3FA 1TCUA 2A1IA 4BLQA 4R1LA 2I6QA 1T1JA 1YIAA 3V55A 3CE9A 4C5CA 4NEQA 4QLAA 3ROZA 2I99A 2C2OA 1N2XA 1ZU5A 1TW2A 2BCEA 1R9MA 3QBDA 3EVDA 2H48A 4L2IB 4QASA 5L45A 5TS3A 2ZJ2A 3ESAA 3ZJTA 2ZAIA 3M49A 3LUDA 1O96A 2TMKA 3WB2A 1R0ZA 5FF9A 5AKHA 4DMUB 1KAEA 1C1DB 2NU6A 1PL8A 3TRFA 3CGGA 2FSVC 3KALA 2XT6A 5A5DA 4ZQEA 4UFOA 3EASA 1H65A 1B6TA 2C2WA 5AXBA 4YY3B 4KUHA 1YQGA 3UK2A 1G7SA 2V0NA 1EDEA 2P3OA 4WA8A 8MHTA 4JJKA 4IIXA 4XE5A 1VPEA 3LT0A 4IQFA 4DBVO 1Q0ZA 1BVYF 3CKLA 4I36A 3ZW7A 5BRJA 4PVDA 3DOUA 4ZOBA 5BUZA 1PKEA 3UKOA 1T2UA 3BE4A 4TQAA 5BSKA 3UNXA 3TNYA 4O2BF 1I6MA 3I9JA 3ENWA 1XKXA 3VAAA 3QPCA 4F3KA 1E6WA 1SQ5A 1C9MA 4GI3A 5L53A 4F6LA 2PT9A 3NYRA 1C2YA 4RKEA 1QFZA 1GKYA 1B6SA 3I1FA 2PZEA 2Q3EA 3HY6A 3RU3A 3U7HB 1S6YA 3IIKA 5C1PA 1MZPA 2I1LA 4HV4A 1JG7A 4DLYA 5CB4A 1LF5A 3PNVA 3EVGA 2FMHA 3AX6A 3VPFA 2Y1CA 5IARA 2GK4A 2B4AA 4HO1X 4PANA 5IJWA 3WL8A 5JXGA 3RAEC 3RASA 4EKNB 3U7FB 4TWAA 1BWQA 1DJQA 4Y6GB 3G2IA 3KZVA 2PO5A 3LQRA 1ZUHA 3AFIA 4FX5A 3TQOA 3VZPA 5TMPA 2ZPAA 4FI3C 1YUBA 3EMKA 5AHOA 3SR0A 1BW9A 4DIFA 1UC8A 3HNOA 1NYLA 4DTCA 5JJLA 1KI8A 5EEGA 1P1IA 4ER3A 4BV8A 3U49A 4KO1S 3HDTA 2OD2A 3NMUF 2FZGA 5KMGB 4KB5A 4TTPA 4M1ZA 3GRUA 5BSEA 4AMGA 3BTVA 4OP3A 4DN6A 4HZIA 1LEHA 1UF9A 2Q0HA 3U1VA 1OLSA 1CJMA 1CTQA 1CQIA 2I0FA 1CRQA 2OHGA 2RHHA 2Y68A 3H1EA 3IVMA 3QP9A 1Z6YA 2HPZA 4FEGA 2DF8A 5ESXA 3ER9A 1UDWA 4GG1A 3A36A 3MT8A 3CZMA 3GGOA 5GJWC 3WX0A 3HXQA 5FHRA 3A9RA 1J42A 3TVTA 2ONZA 4CKEB 2V5UA 3V4FA 3OT4A 1TFRA 3GMIA 4RFSA 3W0LB 3KLBA 1M1YA 1TDJA 2JFZA 2P4HX 1OF1A 2YASA 1TJ3A 1J07A 1NHGA 2GM9A 4GQBA 1KEWA 4UEOA 2NU8A 1X70A 4YECA 3WYAA 4EHIA 4QUEA 1HDCA 1HKHA 1EFLA 3T4UA 4BB6A 3KQMA 5P21A 2F2TA 3LKZA 4ECAA 1AO0A 1J1IA 1HT0A 3EVEA 3QOFA 1KF0A 3AUTA 3EZ6A 4IZ6A 1FE8A 3NFYA 2BFPA 1LC0A 2QMUA 3FYCA 5JIBA 1E6CA 3PA8A 1ZOSA 4A0RA 1KJZA 2XIJA 1ESCA 3Q10A 1JKFA 3AM4A 3R23A 4X3OA 2ZUSA 4ARBA 4DADA 2ZSUA 1H42A 3JQ9A 4ILKA 1PBTA 2BFFB 1Z7GA 1E79D 1P2TA 1PDWA 1G8AA 1BGWA 1VIVA 3FE2A 3L9XA 4YALA 4E6PA 1OTHA 1ZFNA 1S3SA 2BEUA 1Y3DE 3I5YA 2OV2A 1RLUA 4B3RB 5BW6B 1C50A 4G0XA 4O4JF 2ZE8A 2WW8A 3TTVA 2EZ9A 1L4UA 1XD8A 3L0BA 4TPKA 1XQXA 1JR3A 1E4OA 1I3KA 4P3OA 2VYCA 4C87A 1A4RA 2A1TS 3MWYW 5LN1A 1O0CA 3PDIB 3FYUC 4OJYA 4JP1A 4I9HA 1KPGA 1TM3E 2OZPA 4IQ8A 4KXFB 3CVUA 3N0XA 4B83A 1G41A 3TQCA 2GPTA 2P9TA 2NXNA 3CLSD 5H3CA 4FUQA 2C8LA 1FFSA 5KOJB 1IIRA 4GLJA 4H3KB 1LSJA 5AK3A 3HVJA 4IDFA 2OZVA 3CWQA 3ZWYA 5EPOA 2DUJA 4G2TA 4AMVA 4EEXA 3SHVA 2I03A 3C45A 4HVAA 1JUDA 1UXGA 3AF1A 4EKYA 5A9SB 4RM2A 4EFLA 4A36A 5KTSA 4NL4H 4Z4GA 2WWXA 4J0KA 3QXJA 3GJ4A 4R1SA 1XZQA 1MOPA 4J43A 3V1YA 2WAOA 521PA 3B20A 1U2ZA 3DHYA 1GUFA 3TLAA 2DU8A 1CIVA 1B43A 2ZSKA 4JR2A 2PQ6A 1F9EA 2C2ZA 1DJOA 4EHLA 4PFKA 5H9WA 3S8MA 5K3EA 3FHTA 2VSNA 3G5MA 5DMHA 4MGYR 1QP0A 4JBHA 4O4HA 3TW4A 3C8DA 1JQBA 1QX3A 1MP0A 4C5AA 3I6ZA 4TS4A 1QQ7A 3D6AA 1TOAA 2PMBA 2EZUA 5EHQA 2QRMA 4CKCB 2PUAA 2B83A 2BI7A 3AEUB 4BLTA 3A32A 3IOCA 4BCCA 3LY9A 1NQOA 4R8RA 4CQMB 1OU4A 3V1MA 3J80A 2A58A 1P8AA 3G2MA 5E3JA 4PFQA 4PNZA 2UVPB 2G7ZA 3O8DA 5ADWA 1GCAA 2I8CA 1WUKS 1JLMA 1KH1A 1Q1AA 1R5JA 2NO9A 2ZVDA 4R6XA 3TD9A 3GP5A 4YRGA 2NPIA 1LVHA 1VRVA 1XBTA 4DQUA 4DV1B 2HCBA 2PKQO 2X3YA 1X1RA 4JA0A 4ADSG 1R2QA 2YQ5A 4G0VA 1AX9A 3RBXA 4ZI3A 1RM4A 2RAPA 2W6JA 2ZB4A 3NT4A 3MWKA 4MWEA 4O0LA 2O3JA 4R83A 3KDPA 5IKOA 2DBVO 3SSNA 2R9VA 3KOOA 2JBWA 4PBSA 3EULA 1PT8A 1CF4A 1IE3A 2O5EA 3E9DA 2FSGA 3VISA 2PGAA 3ADOA 1DIAA 2XQVA 3VJRA 4J2OA 2O59A 1A88A 1SPBS 1T0IA 1ACLA 2XCQA 2DWPA 3D0QA 2HBQA 3NJ4A 4LHXA 2QUHA 1FK8A 2IUFA 2QDXA 3K31A 4S1NA 4BMDA 3E5MA 2QOEA 3OPYI 4ENVA 1GARA 5KNDH 4CV0A 4AZSA 5JATA 3I4CA 3WWEA 1XHFA 2INGX 5IVDA 3HJTA 5AK6A 1XCLA 3OKAA 2DWUA 2C2KA 3IP7A 4OJMX 1CK4A 1FYVA 4C30A 5MF6A 5HQ3B 1P5HA 3MG9A 4DA4A 4LBVA 1CB0A 2C58A 5HIIA 2NVOA 3DEZA 4D9HA 1DX6A 2NZYA 4PRZA 4HN9A 2GT1A 4PNHA 3EZGA 4LOJA 3VR4H 4CL0A 1ZSYA 1E92A 3SXUA 1T6NA 5KTNA 1FP7A 3GUCA 4CCSA 1VLZA 4PPNA 4FGJA 3T7DA 4PLTA 3AM1A 1LPMA 4UNPA 5EQJB 4NKRA 1QE0A 5EZYB 4NBSA 1QGED 3OCCA 3VSCA 3BMXA 3W34A 4AP6A 4HK4A 2TS1A 3BHIA 2DBRA 3IBCA 4M0FA 3ZWNA 4DC1A 3SJ7A 1SHUX 1KH2A 4JOSA 2EBHX 1SXJD 2DRIA 1SA0A 1W34A 3IPCA 4O1MA 4PIVA 4URZR 1OX6A 1XVAA 5AW2A 3FSEA 5EIHA 4DR5B 2HZ7A 2BGLA 2ZYRA 1SWWA 4AJ1A 3IFSA 1R50A 3WLSA 2ODNA 3EFOB 3MT7A 2R8ZA 2M2IA 1MJFA 2PWAA 4RW0A 1QPZA 3R5JA 1Z82A 1C7JA 2JD2A 4O6VA 4QEZA 3DP9A 3LQ1A 4NOMA 1PFQA 2I2XB 3B6JA 3TIVA 2J8ZA 1DEXA 1EHIA 4TL9A 2FB9A 2DUUA 3NEPX 1K4YA 3S40A 2MINA 5MN4A 4KXYA 4QQRA 1UOQA 4JGBA 2BZGA 5K8TA 1QAQA 2QR2A 1ZICA 3NRBA 4MLPA 3SEFA 4O4HF 1BH2A 4FMPA 3ZHUA 3DE0X 4YJGB 2RARA 4EEKA 4IHJF 4MQ4A 3A25A 4DIUA 1N7GA 4ZZIA 1R0BA 1P62B 5CFRA 1Z2DA 3K5WA 5JFGA 1SVKA 3KSZO 4M1QA 3M5DA 3BXHA 1O6ZA 4C7BA 1V8DA 3CX6A 5GONF 1H0RA 2AWOA 5JH7F 1LNZA 3A6JA 4DV2B 1OTYA 2B82A 4NCNA 1WU7A 1RNLA 1QS0A 1UDXA 4ND3A 2RI0A 3A6EA 1V4VA 3LWNA 1FTGA 4OKSA 3WWOA 2HRCA 3LJKA 1FJ2A 1C3VA 5FO1A 1DTWB 5M04A 2FPGA 4V1CA 2IS1A 1Q7EA 3BIXA 1JYEA 1DC5A 1WULS 3WGIA 2O2YA 5TPZA 5IAOA 5KOHA 1WSWA 1PJCA 1X1AA 1ULTA 1XQ6A 2ZRNA 3IQEA 1Y6RA 1H2XA 1CW2B 2CXQA 3URKA 4L8VA 2VPPA 4HQKA 1L7MA 2QP9X 2VDRB 1MJNA 1VBMA 4FXOA 4HYQA 4IIJF 3LUBA 5AIAA 1W4BA 3RR2A 3AU8A 2IV2X 3JYNA 4BTEA 1NBMD 1N2CE 4EBFA 4C2TA 1T8UA 1LZKA 2PUVA 3DPUA 3U4IA 1UPTA 4N39A 4LVCA 2AN5A 4OREX 2XWJI 3VTKA 3I73A 4G5YA 1JMYA 5E1BA 5TE9A 3RSSA 4DT1B 4FWIB 4DCMA 2HIGA 2FCAA 1QCDA 1A9OA 2WJZB 4HS4A 1NVGA 5CM2Z 3QXCA 4X24A 3STYA 3IQWA 1BEUB 2I7TA 2LE0A 2O1WA 2WU1A 4UNQA 1JB1A 1R64A 2DCUA 1JQEA 1JTEA 3HP1A 2ZB2A 4RAOA 4Q4DA 1N75A 4HDSB 4GO1A 4RL4A 3EHEA 5FL7A 1C14A 5HWSA 2ODQA 2OAEA 1F3OA 2O7RA 4M8IA 2PQ2A 5H68A 1NRWA 4P3KA 4K6HA 2WWRA 4EWLA 1M72A 1U1DA 3BGIA 4QXAA 3C5VA 1ZGHA 5DULA 1CEEA 4GF5A 3GAMA 1PNVA 4FZVA 3EXG2 3BS4A 2DFLA 2I7VA 1NQTA 3L77A 4R1NA 3EIWA 1UXJA 2HF8A 1ZD9A 3AJRA 4ZOLF 4ZD6A 1HORA 4HEJA 4OLFA 2PSDA 1ZU4A 3QFFA 4EH1A 2WVJA 1GSAA 4RD3A 1CR2A 3QLUC 1T3LA 1F2TA 3UWOA 1X7YB 4WE3A 3VV2A 1OBFO 2A14A 2IYAA 3HCFA 4V0RA 2X22A 1J2UA 5FTLA 2PANA 2XVXA 1C2TA 1PZGA 2EX0A 4IICA 1NTOA 4PLHA 1ABBA 1H6AA 4M1YA 3OCJA 5LU8A 1CJCA 1S4QA 4D02A 4JIMA 1T0BA 3I2IA 4LV8B 2WSLA 1M2EA 3AESB 3WV5A 1SJ9A 2W48A 1GHTA 2J9FA 3NORA 4PYLA 3VZCA 4IJWA 2J5KA 3V8VA 2YH2A 1JDZA 4PW0A 3UEOA 1XNQB 3FZEA 1NLFA 1OILA 3HDYA 5H7XA 4RH1A 4W99A 1II8A 3PPIA 2EDAA 4RPJA 4Q3NA 4FLEA 3O8RA 3VKWA 3TNFA 1R0SA 1ZOOA 1B6RA 1KIFA 4PLGA 3NDBB 3RUEA 4BO2A 1ENYA 2OHJA 3L3BA 5BYAA 1XALA 5FBZA 3II6X 5C8ZA 4PIPA 1ZIOA 1ZIYA 3QF7A 3SC3A 1LLQA 3DV2A 3QMWA 1EXDA 2H5JA 1GTJ1 3BRWA 1AJEA 2XODA 1IONA 4FYMA 3EQ9A 2Z5LA 3LBFA 1SG0A 3KQTA 2Z2YA 1VMKA 3KOUA 5ER6A 4W8GA 4CQLA 4X0EA 2IYXA 1MB4A 2GXAA 2G77B 1UBMS 2RHDA 2ERYA 3FCYA 2ILVA 1KAGA 3I32A 3SYLA 3W1VA 3AUSA 5A5EA 1QFSA 1P1FA 3U1TA 3CR3C 2HXSA 3ABSB 3LBNA 1Y7LA 3OC6A 3WC4A 3JD2A 2H08A 4RTRA 3ZVKA 2HSGA 3TRKA 4DUPA 3BXOA 1W8IA 2JCBA 3DEFA 3LT1A 5J4HA 4P98A 5K3FB 3EG9A 3HV2A 1O54A 1YQQA 3PTZA 4UCXA 1V7ZA 2Y0CA 2JATA 2X58A 5AK5A 2B7BA 3MLBA 1VYHA 1TMGE 2G82A 2PZGA 2L82A 4L95C 4YAOA 3GBSA 3GF4A 2NADA 4JFAA 1ISJA 1U0JA 3PUVA 1GAEO 2O1XA 3BD8A 4MW9A 4V0KA 2BHNA 4L6CA 3RHFA 3FDFA 4LXXA 2GETA 4EDHA 5LDGA 2IQ5A 1UDAA 2YYYA 2P41A 3EQ2A 3IBSA 2RE8A 2PRYA 3ZVNA 2WHYA 2P2GA 3SYTA 4D9NA 1T9AA 3CPHA 4IJ6A 4DLVA 2G67A 2QVXX 1ZD4A 1DWQA 2FMUA 1HTBA 2I3GA 4GOKA 1QNLA 2Q41A 2GZAA 3BDVA 1J20A 1DCKA 1UQTA 4DR7B 4C89A 3MGGA 4E5SA 4OYLA 3PYMA 4YXWD 4YRCA 3HL4A 5IU6A 1L7VC 5SYMA 3K2IA 1Y5LA 3PUZA 5J4VA 1KKMA 2GEUA 4Q3DA 1M7GA 3SICE 3N7TA 1M33A 3NDJA 4B7CA 2WIGA 2QA5A 3A10A 2FHPA 4X64B 1J25A 1A5BB 3DE7X 1WPGA 5DHQA 4LNUA 2ID7A 3A6PC 2RMKA 4YREA 2B30A 2BD0A 2CXUA 2J0UA 3IP5A 2D5LA 4G8CA 4QYWA 3RRJA 1EG7A 1R8JA 4TV8F 3FTNA 2ZWVA 3QHAA 5J2UB 3AI7A 4AX8A 1GRNA 1QTIA 4WXMA 5GY7A 5FPPA 2KM1A 5KJFA 3KR9A 3TINA 3H6HA 2NYRA 1KBOA 1QGAA 1EFRD 2HLPA 2Q5LA 2WUEA 3D3WA 4LC1A 4PS1A 3WJAA 1YR2A 3HHPA 1B00A 3ND7A 5LA6B 4AJEA 1H2EA 1OJ7A 1X8KA 4FMCF 1RYFA 1UADA 2R7LA 3DFMA 3EIQA 4FNOA 4V0NA 4D92A 1K88A 4WN9A 2VATA 5AXDA 2PN1A 1QKIA 3Q9LA 2FPGB 3E05A 1DXHA 4UZEA 1NRIA 2JHFA 4KVGA 3OLCX 4GSKA 3V2HA 1E4EB 4E5PA 2NO1A 3P0FA 1OYVA 1H4TA 4PYIA 3FG9A 4DSUA 1U7HA 1YBMA 3GCXA 5HS6A 4YUZA 2IHVA 1Y1TA 2CYCA 4R9RA 2C92A 3UIEA 2D2FA 2X5NA 4I55A 5TMBA 3ZCXA 3MRTA 4QNMA 5ETJA 5KTRA 3BXGA 1R88A 3EY9A 1Y3FE 1I8TA 1XVIA 3AIIA 3KWJA 3WYGA 2ZTVA 4XUDA 2AZ4A 1CRWG 1HQCA 3RJ9A 1C9NA 1FA9A 2ZR7A 7REQA 1Y42X 1OU0A 3JQ6A 4LJ9A 2ARKA 2Q1XA 1N8KA 4F2GA 2PXAA 2Y1XA 1H2ZA 3QUQA 2HWYA 3BIOA 5DISB 2XE4A 3IUEA 1OC2A 4X8OA 4P3NA 1ZGGA 4AZ0A 1RPJA 3AF3A 4D4HA 5HUQA 2AMLA 3WGOA 1RXCA 1ZH4A 3W3ZB 2FFBA 4CIVA 3LF1A 2QJFA 3EDRA 1UKVY 1LQTA 3K0FA 4J1NA 2AC2A 4I2VA 4W6ZA 2VDJA 3U44A 3PQ3A 5LWHA 1ZEMA 1AF4A 1P5FA 1N3YA 1WQ3A 1YFZA 3PI6A 3RIHA 3EDYA 2EW8A 3P26A 3S70A 1NM5C 3L7DA 4ABYA 3QWAA 3U0BA 2XMCA 5IAEA 1M2GA 2YV2A 4NZOA 3TO5A 1JXOA 2N3ZA 2FF5A 2P6OA 2OP1A 4HUJA 3DDZX 4KAFA 4LHZA 4Q16A 4XPZA 5F21A 2FPKA 5FWYA 2AH5A 2WIDA 3O92A 5ARDA 3W77A 2W8BA 1AUXA 4CF5A 3VYUB 3QMVA 4CLEA 2ZT6A 1UOEA 4V0ME 1EK5A 4P8RA 4MW7A 1IATA 4R3NA 4MDEA 3LG2A 1KAQA 4HH4A 5KAPA 4COKA 2JGDA 1UT5A 3AH8A 3JASA 5E6UB 2PNJA 3T4PA 3GVCA 3CV3A 3V4RA 3M6FA 2C2BA 2H1OA 1WKVA 1US8B 2K6GA 2DPHA 2NXJA 3K3PA 1GP2A 2Q6LA 3IBGA 3H65A 3KSRA 1GG8A 4BATA 4EZEA 4YV2A 5C4MA 3CR7A 4NYIR 4NARA 3G2JA 2GYYA 4WLFA 1E6LA 2XWBF 2Z04A 1OLSB 4J1SA 4FYJA 3VGJA 5CAEA 3DVLA 3E7WA 4GX0A 4Y6QA 1JAXA 3L0YA 4L27A 1L0BA 2CNWA 1N3BA 3BF8A 3L02A 5L3RA 3I37X 1KNQA 4WFJA 2EERA 1QHHA 4LI3X 3LECA 4TLDA 3QENA 4DDWA 2FHSA 4ALKA 2P2SA 3FRHA 4C78A 5HKKA 3PHJA 2ZATA 3HUUA 5I9SA 1N8NA 4H6WA 2WIBA 4JQYA 3TVYA 1AZWA 3N2EA 2HPAA 3PCTA 3O8QB 1MAAA 3KYJB 4WINA 1EXWA 2XLBA 3O4IA 4E3WA 5BV8A 2AG0A 2ZP1A 1OXKB 3B3FA 4Q1BA 1WUTA 4K9QA 4J2TA 5EHNA 1I3NA 3A9SA 4DMGA 1H05A 2FPRA 2H29A 4PAMA 4DDHA 2YJZA 4DWVA 3KWFA 5EHGA 2B4YA 5JCXA 3DCIA 4C6HA 2PZKA 3MW8A 2ZSFA 1I2CA 4RWEA 3WQSB 2P3SA 2R5FA 2Z1DA 3ML1A 4XUEA 1ZM4A 3OLQA 1G8SA 3B48A 1LC3A 4F56A 3PXXA 4U63A 2Y27A 3OIYA 5JJKA 3ZTWA 3IBFA 5FPHA 1E3IA 1UBTS 4BOYA 1ZAKA 1HF3A 5DN6D 1XJQA 1BCRA 1H0SA 1ADYA 2REBA 1KK0A 3F98A 3G0GA 4LI0A 4NQRA 4RHEA 3PRJA 3W2FA 4C05A 5HYVA 3TR5A 2I7XA 2VVTA 5ALPA 3T9FA 2H8KA 4KBGA 5IX8A 1VE5A 2GHQA 4R9NA 4Y9TA 2ZS7A 1H2RS 4W9NA 5JMTA 2J9ZB 2QRUA 3NNSA 1G42A 3ZHVA 2TMYA 5BOVA 4CETA 4P9NA 5LR6A 4K1LA 1KFEB 3DJFA 4GT1A 1JLKA 1VCOA 2AOTB 4OJNA 5F2OA 3JQBC 1P7WA 4L4YA 4QUJA 2C4HA 3R7LA 3ROPA 3H19A 3T3PB 2Q6IA 3RKSA 4LIPD 2R6HA 2ONYA 4MWOA 3ZLBA 4WPGA 3TNLA 3UXHA 3ETDA 1GAXA 3CW9A 2QM0A 4Y8VA 3WYNA 2PQ0A 4YGXB 2BDTA 3HFRA 3WFJA 5K5EA 4OV6B 4RIHA 1HNXB 1FDTA 1PP4A 4EG8A 3DTVD 3R7DA 2C54A 1UFQA 3LF2A 4CMBA 1AXGA 4DRXA 4D8WA 1VMIA 3Q15C 4OBXA 4J3FA 3LT4A 4X91A 4W8HA 5CX4A 3P9YA 5DT2A 5FTKA 3SJCA 5BPFA 3FB4A 2WK1A 4RVGA 1DJLA 5EJ8A 5K0ZA 2I71A 4LSWA 4BMOB 3NBUA 3EZFA 3C5WP 2FV8A 2YZ2A 3Q87B 1QFJA 2O6LA 2QRVA 2R11A 1TFUA 3C7TA 3PC8C 4AJHA 1BCRB 4EPTA 5IBCA 2IYRA 3R74A 3QBJA 2VTVA 4GPIB 5KSPA 1NXWA 3V5NA 1TQHA 2PLWA 5KQMA 4LXIA 2ZANA 2R8EA 5F1YA 1J49A 3NEYA 4AWXA 2F1IA 4F5WA 2LIPA 4N54A 4I3FA 3TIFA 1DLJA 1QU2A 4KQ9A 4JP3A 3GLQA 5EMLA 3SQMA 3TL3A 3CW2A 5IXJA 1QR2A 3A4IA 4PC7A 3C3DA 3IV6A 4C21A 3EIUA 2CDRA 4X6YA 5JI3E 3GBPA 1EXMA 5K0NA 3QA3E 3P19A 4REOA 3C3WA 2REOA 4E13A 3VTAA 1I2AA 4RA6A 3TUZC 5JZSA 5IBQA 1PWXA 3PUXA 2QX6A 3LUAA 4PYOA 3ZWOA 3AEKA 3D1LA 3BICA 1T5TA 1CE8B 3MUEA 5BQPA 5LYYA 3WMXA 3EE6A 4YCBA 5I7OA 4RTNA 1JI0A 3JRXA 1KIMA 5FO0A 1AKMA 1K97A 3I6IA 1TADA 1UJ4A 3MSCA 4FTWA 4O3FA 1UJ6A 2YYZA 4PPFA 4K9NA 2Y67A 3C3PA 1M2OA 5JJ5A 1N6OA 4W82A 3C2QA 3A8TA 4V2UA 4IIEA 2A59A 3TPFA 1V7QA 4R98A 2IY8A 5AKJA 2VXOA 4YVFA 4S12A 3D2BA 4RJIA 4EPVA 1QC5B 4GOLD 3NIGB 5A9RA 3NV7A 3QVGB 5HIKA 1VJTA 3PJRA 1SVLA 1Z8FA 1HQDA 1ZUD1 1XLTC 1NU8A 3I5XA 4DA9A 3SYKA 3LFTA 5FBWB 2GUWA 2YHIA 3K16A 3LYAA 1M83A 4NFLA 2GN4A 1HH4A 1NDUA 2XX3A 2Y1WA 3BSWA 3RC2A 2W2PA 3Q6NA 3QFHA 4UFPA 5K01A 1Y48E 5ALZA 4EI2A 2ORWA 1Y6FA 2CBGA 5LOVA 4Y9DA 1Z47A 2X4LA 2Y92A 1KI7A 3CRZA 4JDUA 1SUWA 1IL0A 4R2KA 1P1RA 3EFBA 3K1AB 4HDNB 3ZHBA 2H59A 1YK1A 2VQFB 1AZSC 3TG8A 5T6BA 4V39A 3N2GB 4IXDA 2VFAA 2ZYDA 3FYSA 1Z4JA 3L8ZA 2KBFA 4DDUA 1OR8A 3Q8XB 1CCWA 3DL7A 5E9AA 4TVSA 2WNIA 3MJDA 5JSYA 5CCXA 5H16A 5J47A 4LVNA 3FDZB 3FW1A 1QAOA 4HTFA 1Z6PA 1AKQA 4U8HA 2NO7A 1QB7A 1KYTA 4N47A 3SZUA 2C84A 4AUKA 1PUIA 5AESA 1YS2X 3HN6A 1Q77A 3WOHA 721PA 3DT9A 3WNQA 1VRCA 1V9SA 3WDMA 2WTMA 1UDCA 2OR3A 1C0LA 4HNTA 4Y2QA 1DBSA 3CUEF 3CZ5A 1EVKA 4J75A 4CODB 3K09A 4AKGA 1GR1A 2F43A 4EYSA 5D3QA 3L01A 3QF4B 5KU1A 4B3SB 1XU4A 3N7AA 1T8PA 2FN4A 5EZYF 5JEDA 1XTTA 1KJQA 3GNSA 3IIEA 1YU9A 2E4YA 1M8JA 2ZREA 4CKYA 3MAJA 3OZIA 2GYWA 1UZLA 2C7PA 1FMFA 1UP4A 3RHZA 4BCBA 1YXMA 2PGXA 3EZLA 4PRKA 4BX2A 5CP8A 4ZI7F 1KMQA 2H2FA 3BDIA 5HKKD 4DABA 1K92A 4PZPA 4RFVA 1KE1A 5KWSA 4XKJA 5L3SB 1RACA 3TMAA 1N7JA 4EMBA 3JAWB 1FXWA 1IU9A 4ZEXA 2HSDA 4EIWA 4RCYA 1QGDA 1X15A 2NXCA 3HN7A 3VR1A 1B3BA 4C0KA 4QTZA 1OIVA 1PAUA 4EJMA 1ZVJA 3OIWA 4AJOA 2GRAA 2QNBA 3KLOA 1B8OA 5LOVF 1OAOC 4UDYX 1TTQB 2CXTA 1IUNA 2H1RA 4GZLA 1GPYA 3V4ZA 4BNYA 3CF0A 4O02B 5C8YF 5THKA 4DILA 1RBYA 2GPJA 3N8DA 1T4BA 1CUDA 1PGNA 3B5EA 3D7SA 1XTIA 5IJAA 1QV6A 3JWIA 4KQMA 1ZJZA 1T2VA 3FHLA 4X60A 1JDVA 4RJLA 3U3JA 1XTRA 4QGAA 2GBIA 3M5CA 1Q6ZA 3DMRA 4ER7A 2WWGA 3MT0A 2IOFA 4FN5A 1WF3A 4H7HA 5FTWA 3HB5X 2EFGA 4RDIA 1Z7EA 3OQ6A 5FXMA 4HAWA 1BFKA 1KTIA 4KZPA 3TDKA 2HDNB 3UHPA 1X9IA 1QDUA 1XU9A 3CEPB 4FYHA 1AGYA 4B4KA 1RXVA 4Z4EA 3M1IA 4W9MC 1AB5A 1E1KA 2QVCA 1A9XB 3D3NA 1RE0A 3TQFA 1ZIDA 4NAVA 2BKUA 4CTOA 1UH5A 1NN3A 4FILA 4J49A 3GT4A 1Q17A 1XTSA 2I8AA 4Y1FA 2YNMA 2CLMB 3SC6A 3PUYA 4WBNB 1U3UA 1N1MA 2CD9A 4JVSB 4CTMA 3PGMA 3FLAA 4OXIA 2AZTA 4RACA 4CM8B 1Y5RA 1R0RE 4YMGA 3EQ8A 4I6JA 4UUQA 3RH0A 3ZQ6A 3R7BA 5JD4A 1MXFA 1U7UA 2SBTA 5JPIA 4DSZA 3HADA 2ZTLA 2C9CA 4EMTA 4ZAZA 1NL3A 4MAAA 4KQIA 2PPVA 3QIVA 5JBQA 3R8XA 4QFDA 1GTMA 3BILA 3MLEA 3TLYA 4C2UA 3RUHA 4DHWA 4XEHA 3DGFC 3IA7A 4X8LA 3UXYA 1M7BA 3OJLA 2FW8A 2JJ2D 3CPSA 3EQZA 3LZCA 2I33A 1K08A 4LJ8A 3RVSA 3WOVA 1DG9A 4MO2A 3ZKWA 3CO0S 1JE0A 5C5EA 1QRAA 3WL3A 1X7WB 2CJYA 3RRFA 1F6DA 3PNSA 4HDOB 2P9BA 4MWTA 2FFHA 4HL6A 1OBOA 6PFKA 2ZWMA 4MIOA 1OH6A 4CPDA 2YVUA 1FRVA 1CVRA 1ZNZA 1LTHR 1I13A 1TXGA 4TTSA 4B3HA 1J97A 3LXMA 3A1EA 4FNMA 4N8SA 4BLVA 3QQ5A 5I47A 1KYVA 4BE7B 2W6CX 4R8KA 2HMWA 1P1CA 2ZR0A 4MV1A 4RMNA 4ZZ2A 2MU1A 2JI4A 5DBGA 7MHTA 4OJKA 1U2PA 2D2IA 3QHPA 4AG5A 4IOLA 1RLOA 1E5LA 4Q7JB 4J7UA 2Z6VA 3BPSA 3KKQA 1QOPB 3GOQA 3KCQA 3NIDB 3ZOKA 5BWLA 1P6XA 5LBTA 5J2TF 3S2GA 1YRWA 3KQSA 2YINC 4TKUA 4BP8A 3QX3A 4FI3F 5AM4A 2CMKA 1GEEA 5NLLA 1GKKA 3RC8A 3G7UA 3JQ7B 3LYHA 2HQSA 2ZLBA 4BO4A 2I62A 3TSAA 4L3VA 5K0JA 1VXRA 2RH9B 4II3A 4WNAA 4EFMA 3I1JA 3JD1A 4FMDB 3QFCA 1AY0A 1ZUWA 2CHFA 3LUCA 4IINA 3AL3A 1SA0B 3L7JA 4RPGA 2AJTA 3Q4GA 3T61A 4AJJA 2UUCB 1O4VA 4FR2A 3HKDB 3VR4D 4LKRA 5T8KA 4B3BA 4BBZA 2VHQA 2I2BA 4KQGA 4BTLA 1KC1A 2AC4A 3E3OA 4MV8A 2RKOA 4XCQA 1SU7A 2J59A 4C04A 2WU3A 5BYKA 1UPBA 3AM3A 3M33A 4GZ3A 2R2AA 4MRPA 4B35A 1TM4E 3DAFA 3T35A 4AQDA 2XOKD 2RHJA 4C6RA 4CM5A 2BGJA 2JD1A 3CVOA 2BT4A 5DHAA 5CDFA 2Y99A 4WCFB 2IUYA 2YN4A 3A1FA 4YT2A 1BE6A 4X44A 1OYWA 3RSGA 5L4NA 3HXKA 3OWXA 2NT4A 2I2AA 5EG5A 5CDUA 1L4KA 4PTZA 2BW0A 3CQ9A 3RVOA 1MDBA 2WSSA 2D3WA 2X7JA 4EGQA 4FYWA 1CUBA 4EFDA 1DFGA 4FFBB 5H8WA 3NUZA 5JJIA 1VKRA 1S8FA 4AROA 1XMXA 5MGBA 1AH2A 4I6GA 3OJOA 2QB5A 1V8PA 2C5BA