2J5BA

Structure of the tyrosyl trna synthetase from acanthamoeba polyphaga mimivirus complexed with tyrosynol
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
321
Chain Sequence
DHTNNEHRLTQLLSIAEECETLDRLKQLVDSGRIFTAYNGFEPSGRIHIAQALITVMNTNNMIECGGQMIIYIADWFAKMNLKMNGDINKIRELGRYFIEVFKACGINLDGTRFIWASEFIASNPSYIERMLDIAEFSTISRVKRIFYPCMQAADVFELVPEGIDICQLGIDQRKVNMLAIEYANDRGLKIPISLSHHMLMSLSGPKKKMSKSDPQGAIFMDDTEQEVSEKISRAYCTDETFDNPIFEYIKYLLLRWFGTLNLCGKIYTDIESIQEDFSSMNKRELKTDVANYINTIIDLVREHFKKPELSELLSNVKSYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords TYROSYL-TRNA SYNTHETASE
publication title Virus-Encoded Aminoacyl-tRNA Synthetases: Structural and Functional Characterization of Mimivirus Tyrrs and Metrs.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 127
structure length 321
sequence length 338
chains with identical sequence B
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2j5bA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2j5bA01
1VLHA 4MVYA 1QRTA 1T6ZA 3ILVA 3N05A 4XFDA 1O0CA 3A04A 4DE5A 1HYBA 3CLUD 1WQ4A 1GPMA 3SZ3A 1N77A 1JEDA 4QRDA 3DPIA 3ND5A 1KP3A 2B7LA 1OBCA 3KT6A 2WQ6A 4RPIA 1KQNA 3OP1A 2X1MA 5KCMA 4L2IA 3RK0A 3CVWA 1OWOA 5DB4A 3FH0A 1O97D 3GLVA 4G5YA 1VBMA 1IRXA 1GAXA 1MAUA 4WSOA 4ZCPA 3F3MA 3QTBA 4I6EA 1OWMA 1KR2A 2AKEA 3CVVA 1LI5A 3FDXA 1PFWA 1WXIA 2QTRA 3CLTC 3ELBA 2AZXA 2A7XA 4PBRA 2QUJA 1OWLA 1TEZA 3COVA 4KR6A 1R6XA 3RJZA 1NYLA 2PXHA 2J07A 4YP5A 2R5WA 5J59A 1G8HA 2I1LA 1H3NA 4ARCA 1J20A 5IHXA 2D13A 1GZUA 3S3TA 2D5BA 5K0SA 4CT0A 4ZCTA 2QUHA 4OUDA 4GU5A 2CV2A 3MLBA 3JXEA 1JILA 1EFVB 4R2LA 3CVUA 5H7XA 1GLNA 3IH5A 1MOPA 3NBKA 1J1UA 4NAUA 4K0RA 4X0EA 1PG2A 3UY4A 2PZ8A 4EFKA 1KQPA 4UZEA 1K92A 3KT0A 1KKUA 3CLSC 1MRZA 3AFHA 1FYDA 1O96B 1BS2A 2H2AA 3NBAA 4MW1A 4Q93A 3TS1A 1EUYA 1TYAE 1WXEA 4F4HA 4YBRA 3P52A 2A88A 3IMEA 3C8ZA 1ULHA 3IUEA 2BYTA 2X0KA 1Q19A 4ND6A 1JHDA 2YY5A 4NAHA 1N78A 2O5RA 2CT8A 1N2GA 2HGZA 2BTEA 1WXGA 4EG8A 3N2YA 2IELA 3AL0C 1N2JA 3HL4A 1SURA 2PIDA 1OWNA 3ND7A 1JGTA 4R2MA 2NZ2A 3COYA 3IVGA 4MUNA 2WB2A 1R6UA 4MWDA 1ZJWA 2DLCX 3Q10A 1X6VA 1PFVA 1N2OA 4DDMA 1JEEA 4EG4A 2QTMA 4DJAA 2V0GA 3G6KA 2JANA 3GUZA 2A84A 3ZIUA 2CV1A 1Q11A 1J21A 3FETA 1K97A 1MB9A 3TQOA 2WSIA 4UZFA 4PBSA 1U3DA 1N2IA 1JMVA 2QTNA 1NP7A 3KT8A 4MUIA 3DV2A 4MW0A 1NUSA 1LW7A 5KWVA 1WKBA 1IQ0A 1GTRA 3MLAA 4ZCSA 2VTBB 3Q12A 2NSYA 5TGTA 3UK2A 2CYBA 3FWKA 4MW6A 3TQIA 2RE8A 1QRSA 2E89A 2GOYA 2ZUEA 5TS2A 5K0TA 2YXNA 1VL2A 2YWBA 1WOYA 3HZRA 5HG0A 3LCJA 4YMIA 1KH2A 2A4MA 1H3FA 3UMVA 1H3EA 5FO0A 2J09A 3AG5A 1QTQA 4ZT2A 3ZXSA 1JECA 1KAMA 4HPWA 2J08A 2PG3A 3IOCA 1S4MA 1M8FA 1WJGA 2XRYA 4DDKA 1TYDE 5DEOA 1WXFA 1KH1A 4EF6A 3P0JA 1JIJA 3LOQA 1XNGA 1QQTA 2IJGX 1G8GA 1NUQA 4EG3A 1IQRA 1O95C 4BWVA 3H05A 2Z3VA 1EFVA 4YP7A 3CLRC 1NUTA 4CQNA 3NV7A 1YUMA 2A1TR 5FO1A 1N2BA 1R6TA 2VXOA 3BL5A 3ZGZA 3IMGA 4FZJA 3H9BA 3CLTD 3AKZA 4PBTA 1O96A 1MC1A 1T6YA 1D2RA 3SP1A 5HUJA 2XRZA 3X1KA 4ZCRA 4U63A 1WY5A 4EG6A 3VU8A 1EUQA 2GM3A 1M8GA 4MWCA 1N3LA 1NUPA 3KFLA 1J70A 2GKSA 2G36A 1H1TA 3PXUA 4MW4A 3LE8A 2QJOA 2CSXA 3QE4A 3PNVA 1QJCA 3A4IA 4E1AA 3M5WA 1WQ3A 5EKDA 1F7VA 3H9CA 3FOCA 1PFYA 3KT3A 4MAFA 1NSYA 4JZYA 2DETA 5HUHA 3VGJA 3CLSD 1P7PA 3N9IA 3IOEA 5IJXA 4MULA 3HV0A 1F4LA 4ZT4A 3PRHA 3ZJTA 4TS1A 3G5AA 3CVXA 3K32A 1Q15A 1VBNA 4EG1A 1JZSA 2PZBA 2OQ2A 4KR7A 1EFPB 3HMQA 1IFXA 3G59A 2PZAA 4XFJA 1OWPA 1B6TA 1WXHA 2DPLA 4R0NA 3ZJUA 4DNXA 3RBAA 3RK1A 2CYAA 1KAQA 4NATA 4MLPA 2VTBA 1O6BA 4CDMA 4NZPA 5BNZA 3MUEA 1QU2A 2JA2A 2CYCA 1TYBE 4S1OA 4NX2A 4A91A 2RD2A 1O5TA 4DLPA 4JXZA 1XNHA 4ZCQA 3IODA 4MVWA 3X1JA 3H99A 4G6ZA 1M83A 5TEWA 2A1UB 1N1DA 5LLTA 1MAWA 2DUMA 1ZH6A 3CR8A 1M8KA 3SDBA 3A05A 4K03A 1M8PA 3FIUA 4ZT3A 1O94C 4KR9A 1XNJA 1ILEA 1O94D 4MW7A 1G8FA 4ZT7A 2YWCA 1EXDA 3ISJA 1I2DA 3DLAA 4MVXA 4RUKA 2WQ7A 3QTTA 3IOBA 1K4MA 2EJCA 3IVCA 4YP6A 2X1LA 2OV4A 1F9AA 1IQUA 2AG6A 1EJ2A 4ARIA 3L92A 1YI8A 3ZUGA 1M1ZA 4MUFA 1ZH0A 1I6KA 2QUKA 1I6LA 1YIAA 3H97A 2CFOA 3X1MA 4J75A 1T9GS 4KPUB 4I6JA 1JIKA 3TZEA 5J5AA 4Q16A 2D54A 3UC5A 3MMXA 4U8HA 3VRHA 4MWBA 2E21A 1O95D 2J4DA 1TYCA 2EL7A 1QNFA 3CLUC 3CLRD 1KH3A 3FHJA 1J09A 1CT9A 4HK4A 2E0IA 5DK4A 1Q77A 2H29A 4MUKA 1M8JA 3AG6A 1NUUA 5H16A 3ZJVA 4DDHA 1NI5A 4ZT5A 1Y42X 2DXIA 1J1ZA 1O97C 4MUEA 4QBTA 2DEUA 2QUIA 1EFPA 1YULA 1V47A 1K4KA 1O0BA 3SEQA 5FNZA 2E18A 1YIDA 1QRUA 1TFUA 2HZ7A 5TEVA 3D6VA 4MUHA 3FY4A 1GTSA 3D6UA 1FFYA 4HJXA 4U7JA 3RHSA 4EGAA 2J5BA 4L2IB 2X3FA 1T6XA 2QJFA 5KHAA 4PY2A 1A8HA 1TQ8A 1F7UA 2DERA 1PG0A 1VBKA 3COZA 3TNJA 1DNPA 3SYTA 2V0CA 1G59A 1X8XA 4OJMX 1T9GR 2IP1A 2Z08A 3E27A 4EG7A 4NDAA 3L93A 1LI7A 2A1UA 1KORA 3COWA 3AIIA 1I6MA 4KKVA 4MW5A 4MUGA 4MW9A 1N75A 4AQ7A 3U1VA 2O8VA 3IVXA 1COZA 4J76A 3I05A 5F23A 4XSVA 1XJQA 3MXTA 5J58A 1N2EA 3K9WA 4OUDB 1JZQA 1OD6A 3FNRA 1GN8A 4MW2A 3PNYA 3SEZA 3Q4GA 1IHOA 1OBHA 1U3CA 1MJHA 3RFFA 1KP2A 4P2BA 3N8HA 2TS1A 2ZP1A 5AHWA 3IMCA 1EE1A 5DASA 1PFUA 4HJRA 3HFJA 4ND7A 3CVYA 1RQGA 1YUNA 3GMIA 3PNBA 2CUZA 4CDNA 2ZUFA 3ZXIA 4KPUA 3FG9A 2C5SA 4MWEA 2A1TS 3HGMA 2QJTA 1U0BB 1U7DA 2JAXA 1UFVA 3OTWA 1KQOA 1ZUNA 4MVCA 5LFAA 1WZ2A 1MBZA 3FI0A 3P0HA 5LM3A 4ZT6A 1V8FA 4AS1A 3UOWA 3CA8A 2Z09A 4G5FA 4JXXA 1IVSA 1U7XA 2A86A 4MUJA 4JYZA 4EG5A 2PFSA 4I6GA 1IH8A 1QU3A 1JIIA 4MQ6A 3A2KA 4F3RA 3P0IA 2HMAA 3IDFA 2DR2A 1N2HA 1NURA 5JBNA 3TZLA 3INNA 3DO8A 4GRIA 4WNYA 4JFAA 1NZJA 3ND6A 4H3SA 3SZGA 3IUBA 2CV0A 4QREA 1MB2A
chains in the Genus database with same CATH superfamily
4ZEVA 2D2FA 1UBJS 3VC1A 2F3PA 3YASA 3PA6A 4REQA 1Z06A 3E4CA 2QVLA 3IJ5A 2ZIEA 1KE1A 1N77A 3GLIE 5A2QA 3U09A 1VIAA 3RIEA 2B7LA 2ZT6A 4EPWA 4EB0A 1OBCA 3KT6A 4MR7B 4RPIA 2DKNA 3IEPA 1DQRA 1VPEA 4BMPB 2VH2A 2H2HA 3IEUA 3TKYA 4XTCS 1TQDA 2IV2X 3URMA 3GLGB 3V1LA 5LDGA 1NBMD 1YFKA 3ROXA 4LOJA 3WGKA 1PWHA 1E60A 2ZJAA 1FTYA 2VHQA 2ZJZA 3ANXA 3FCSB 3NHMA 4DMMA 2ZT8A 2TYSB 3VDRA 4X44A 1EX6A 1J23A 1MXHA 2VZLA 1RT9A 1G7RA 4RQUA 4DG5A 5IMSA 1K6MA 3FDXA 5EMHA 2XE4A 1GV1A 4X1KA 4K8RB 4CV1A 5BUQA 1A96A 4NABA 1N2SA 2J0EA 4HNTA 1UM9A 1SBHA 1E6CA 3A9WA 3C6MA 3CONA 3KCNA 4LPSA 4XDGA 4XDYA 3SDSA 5A4JA 3QEBZ 5AI9A 1XMOB 1W7AA 1E64A 2NTEA 5AM1A 2IITA 4FW9A 1QO0D 4DM7A 2QAGA 4J1NA 4K9RA 3JTMA 5JYEA 3L9XA 5T3UA 4AIIA 3GU3A 1QP4A 5B58T 4IYRA 2FPRA 1R1DA 2PS9A 1Q0UA 1GCAA 2UVQA 2WJVA 3H1AA 4MICA 2XUAA 1YFJA 1KI3A 4I2NA 4XIGS 3E7FA 3RSZA 4GU5A 3H8SA 2X4GA 2NU8A 4XM0A 4ERNA 3MLBA 1HMPA 3T1QA 3GRYA 4BUJA 3CVUA 3G02A 3O0DA 4GM0A 3DLTA 2BKUA 5CA1B 4PX9A 3THOA 4P0PB 1PG2A 2A59A 4X45A 3HU1A 4WLNA 3SYNA 1I1QB 2O8DA 3HN6A 1KMNA 1C9KA 2HHCA 1TL7C 3CLSC 2WV7A 1QJ4A 4A27A 4CKCA 4MHOA 5FXMA 4PFSA 1UXGA 1XN4A 2PMWB 1V37A 2YWDA 3V97A 4KQ2A 2RK6A 3Q7QA 4GGPA 2WYWA 3D8TA 3EGIA 2A5JA 3UJPA 1D8AA 1FRVA 2WEKA 4MYDA 1E3IA 4B4DA 5J1SB 1VBFA 2G1AA 3D5EA 4IVRA 1GIAA 5ISMA 1ENYA 3KYDB 2EX4A 5AKIA 4BE4A 4ZYZA 1UKVY 2XQGA 1NKSA 1SG0A 1LVGA 2EZ8A 2GKOA 1F0KA 3NQ41 1E18A 3DEFA 5TXGA 3VDNB 5F35A 4A2PA 2VHEA 4BNKA 2ZPTX 1IHPA 3D31A 3TN7A 4Z3KA 4R7TA 4LWZA 1JHQA 4IG4A 2WHRA 1PJBA 4FYKA 4D6XA 2Q3EA 1UP7A 4M37A 3UKDA 1A9TA 1QCYA 3GT4A 4D3FA 3H5LA 3W5VA 4TS4A 1Z0UA 1D5WA 2IEZA 4IILA 1TM1E 1RADA 2AF3C 4OKSA 1M2NA 1G6OA 4FM9A 3USZA 3MCUA 5IM5A 4DC0A 5JY1A 5CPBA 4WINA 4QOEA 1HORA 2WJZB 1H2HA 1YMVA 1KEWA 3BHMA 3BTVA 3NWJA 3EY9A 1UBSB 3GGSA 4QM7A 2GF2A 4GP9A 1ZIOA 3GJ4A 2BGIA 4KV7A 1LPMA 4W7IA 5H83A 1W4CA 4NFYA 2W70A 3VPDA 3AO0B 2CD7A 3OKCA 2XWPA 4IJ6A 4ZANA 2YV4A 3BWXA 5ENDA 1R5OA 1PTJC 2Q3MA 2DHDA 4MMZB 3G0GA 2I2AA 1QIDA 2JAPA 2PH5A 5AJWA 3KT8A 4ND2A 2YJ5A 5TJHA 1R74A 1XTKA 3WL8A 3CUTA 3ZVKA 1AXRA 3T6KA 4C0WA 3WHKA 3UJNA 4JQYA 4LRYA 2CNWD 4OHUA 2PUTA 5CM9C 3CJRA 1NZDA 1Q3KA 4PX5A 2FX2A 2V7QA 2VJPA 5DCYA 1WAMA 1VLVA 2W0SA 3ORRA 1XE3A 2EGGA 4Q3AA 4IX9A 4WY5A 4MVJH 2I3AA 5FA5A 4DZRA 4KI7A 5AVJA 2QA5A 1F20A 1M0TA 5ITVA 3ZCVA 4DTIA 2FP3A 2COEA 3QLTA 4U8GA 5C1BA 2DCMA 2AJBA 2E55A 4LDQA 5F51A 2PL3A 3U60B 4AZSA 2I65A 4BO2A 4D4JA 2B78A 2VLIA 1UWLA 2H4YA 5LD2B 2BH2A 2PG3A 2CXSA 3DOUA 2D59A 4FQ7A 4S12A 4D99A 4GWGA 3EIUA 3ZGLA 3IAS6 2HHHB 1TYDE 2XQKA 1QRRA 4YC7A 6NULA 3CB2A 4UHCA 4XYMA 4B4UA 4Q9LA 4GX1A 3BF7A 4R1NA 4ARAA 1Y3HA 4V3CA 1PJZA 2G9RA 1XNGA 3CBQA 4U0KA 5FAXA 4E3ZA 2D3TA 1NOJA 4TKUA 2FUCA 3H1TA 3QUTA 2O8BA 4G2NA 3ZE6A 1V4BA 2AL7A 1IQRA 4S1NA 4G26A 1K7EB 1KOLA 1JKFA 4IQGA 4M76B 1P7ZA 1EFVA 1MH1A 2I4NA 1KR5A 2YJTD 1NUTA 3I9V6 3V7WA 1T8UA 5IH7A 3K70D 1UCFA 2QQFA 3OLVA 4IH1A 4G1BA 1XTSA 2XB8A 4IEFB 5B1DA 3DZFA 1KJNA 3LSTA 1ZOIA 4GBMA 4LRUA 1GSIA 3HFSA 3EQ6A 1O96A 2B4AA 3R7BA 4DQKA 2BCGY 4R2KA 5LKAA 3R9XB 2C3PA 1DAPA 1WY7A 2Z2JA 4QQKA 4BNMA 4X7MA 4ZRMA 3WSVA 3IAS1 5DH9A 3N0VA 2VAWA 4HV4A 2R4UA 5CFLA 4ABTA 1V5WA 1W75A 1P0IA 1P18A 1XRPA 1IZZA 1VGQA 4ZQFA 4F2GA 3G7NA 3DMGA 3B7GA 3AHGA 1IXRC 1WIWA 4X94A 3RNOA 621PA 4NOLA 3U4AA 2RSLA 4QDXA 1NUPA 2OR3A 3ZDCA 4WLOA 2I4RA 4Q6WA 2OEPA 2PKCA 3OQIB 4D9EA 2OECA 3E22A 1R0BA 2EC5A 2AN5A 3I9V1 4EUKA 2P9GA 4NMHA 3ECSA 1D0IA 4HXGA 1Z18A 3SR4A 4AN0A 3ELDA 1J25A 3NTRA 1P2UA 1S8AA 3EC1A 1XKQA 1OROA 1YQQA 1G98A 4LX0A 3TB6A 3R5KA 4MULA 1ABEA 1EGMB 3NRBA 4UOQA 1XALA 1RLIA 4FKMA 4DGSA 1J2JA 4LI3X 1RJWA 4RFSB 3ANYB 4HDQB 1S2DA 4I4CA 5BN3B 5HK9A 3T5MA 5JZSA 4Z7JA 1Q15A 3VPXA 4MGEA 1OZAA 1Z7GA 3E9ZA 2HTFA 2YZMA 5D86A 2N0SA 2O05A 4KQKA 2XYQA 3HMQA 4RY0A 2JF0A 2AWOA 3PITA 3P26A 1YO6A 3KOYA 3QE3A 4NBUA 4Q9NA 1RXVA 2LCQA 2LDXA 3IDSA 1HLGA 4ER7A 3A4LA 3NNSA 4QASA 4HS9A 3FHOA 3FDZA 3I2YX 2WICA 3DQPA 3N70A 5BNIA 2JCBA 4HLQB 5KUTA 1WNTA 2MINA 2W6OA 4JQOA 1YK0A 3CVOA 4K26A 5KQRA 3RAFC 2R86A 1A8SA 1HDRA 1MC5A 3L0YA 2REBA 1EFRA 4Z6KA 4JX9A 4ND3A 4DIUA 5FD8A 1X1BA 2WKWA 2O1EA 3HA3A 4KVAA 4BNWA 3CISA 1GQYA 4EA7A 3IVAA 3KKNA 4F1KA 4NU6A 5EQTA 1M1UA 2ZLBA 2N42A 4HXYA 4OBEA 5HCNA 1O58A 2OWEA 3UHAA 1OASA 4BKPA 4DLPA 3TIVA 2SECE 3M3PA 4JBIA 1G8PA 3E18A 1NDUA 1MV8A 4LC9A 3RIGA 2CVHA 4P86A 3H0KA 2X19A 3MM4A 4IGEA 4YXWA 3RC1A 4HGPA 3WHPA 1GUYA 1M83A 4V0SA 4B6PA 5FOUA 2ECOA 1FSPA 2OZLB 1ZGZA 2FY8A 4PHCA 2I1VB 1DAIA 4YJ3B 4AG3A 4I8XA 3G7SA 3ZY6A 5EZ6B 2YL2A 8ADHA 2ADFA 1JYEA 1YL7A 4KQGA 3HJNA 3AVQA 4DUZB 2YWEA 3X0DA 5G40A 4OLBA 5HILA 1LDMA 3EXHA 2XBLA 5HOEA 1PZNA 4TT3D 1M8PA 4QGAA 4WESB 3D3KA 3VBCA 3GT7A 3A3KA 5DYIA 3OCXA 5BSKA 4KNYA 2QM3A 2CK3D 2V59A 3BB1A 3MJVA 3OCVA 3HYRA 4NBTA 3BCHA 5E9AA 4DDUA 1AV6A 2IX9A 3SNHA 1C14A 2G1UA 2YWCA 1XYGA 3I8OA 2QTLA 2AI1A 3N8NA 1TZ2A 5FPYA 5TGZA 4B7ZA 1BNCA 4AUMA 5LU8A 1O7JA 1K4MA 2COUA 4H15A 1QIHA 1XTQA 4TXJA 4FFBB 4YP6A 4DIEA 4ZVPA 2Q3HA 3IV6A 1SUWA 3G2KA 3FBTA 3KALA 2IXGA 5HP4A 4Y2UA 5I47A 1EVJA 1C8VB 1JSZA 3T3EA 4LBWA 5AJTA 1F5SA 2VTKA 1H6DA 2Q99A 3PBKA 3CZCA 4RAQA 3X1ZA 1PT5A 3OQNA 1DX9A 1RAGA 1MOQA 2O06A 3CGWA 3JW8A 4X5OA 3W8RA 2IC5A 5LP6A 5I9MA 2IV3A 3DJYA 3WG9A 3AF6A 3DBHA 1M2WA 5ALEA 3ZLVA 3ZCTA 3FUUA 4MIOA 4KVFA 4YASA 3OCWA 2P0AA 1KKLA 2F6RA 1B74A 2ACEA 3CPHA 5CX4A 3DZJA 1MCZA 5EHGA 3BULA 3S1AB 5AUPB 1EX1A 3SSMA 1JG1A 1N1GA 1CYDA 3CLRD 4W8HA 2P9YA 3UJAA 2I2FA 3JSXA 2E0IA 2AFRA 2VYQA 5HF6A 5TJ9A 4IAOA 1ORTA 3H5RA 1XVAA 3V4PB 2R9VA 3CNBA 4PGHA 3BHNA 5CG2A 1XRNA 1L4EA 2O8FB 1Y8QA 1C9NA 2Q1SA 2F67A 3B7PA 4B8WA 3X2FA 5IRCD 4MKRA 2VNIA 4RTNA 4HGRA 4EEXA 2AEEA 1OCEA 1OAOC 1PR2A 4S1PA 4DJTA 5GVSA 4Q4AB 2WC1A 1BIFA 3PUVA 4YRMA 4DYDA 5MFZA 4HQ6A 4PQRA 3KR1A 2AR9A 4XD7D 1LRLA 5EJ9A 1BAPA 4BNIA 1ULUA 4Q7QA 4F5DA 5F76A 1JEOA 1IDOA 1TEXA 1MB3A 2AZDA 1PJCA 3GHHA 3KD2A 5TPZD 4DHWA 1IM2A 1R8QA 3IEIA 4WBNB 5LR6A 1SAYA 4DA4A 4IIVA 1SXJC 3GNQA 3E0XA 4BRSA 3IE0A 3I2FA 5BMVF 1H0HA 1VMAA 2F1JA 2KS6A 5C32A 4X62B 2AD1A 2NXEA 1GPKA 2JI8A 5BN4A 1AGNA 2BFWA 4Q1BA 2BBOA 3WO0A 2JCYA 3D8BA 3EWSA 3R0VA 5DGIA 5ADUS 2ZKLA 3KRTA 4KXXA 2C59A 2PEZA 3Q3VA 1Q3HA 1W4ZA 1EWVA 4JLKA 4CM4B 4FYYA 4UJ3A 1GGEA 2HMTA 3QENA 3QVUA 3SHOA 2XPCA 4YPOA 2Z04A 1QDEA 4ZJZA 3EE6A 1OXMA 3JYNA 4JC0A 1NMEA 2W83A 6REQA 3SVTA 3LT1A 4HI0E 3DEYX 1BSVA 3F5FA 3COWA 1JEAA 5DHTA 3ZDXB 2WTNA 3H5NA 1C7QA 4B7XA 3P32A 4IOLA 4KKVA 2JFGA 3EMDA 4DAOA 3GWGA 4JJGA 3MTIA 4ZJUA 2Z9DA 3THWA 1JAIA 1LBQA 1KYQA 3LDHA 2Y1LA 4P4UA 4RDIA 4TN1A 4Y1FA 2HJSA 3I5MA 3OX3A 2C92A 3OLXA 4GP6A 2VP0A 3MJCA 3TW8A 2VF5X 3KPYA 3W2IA 2O50A 3AVUA 1IK6A 3B9BA 4OLAA 3E35A 4F60A 1Q7GA 4AMZA 4CXMA 2DQZA 2YUTA 4V0OA 3G5MA 1GUAA 4M1ZA 1II9A 4UHFA 3E53A 4KFSA 2Z6VA 1X7YB 2B4QA 4M21A 3U31A 1CUXA 4A8JB 4BO4A 2OFXA 2TS1A 2Z2KA 2YYZA 4KRXA 4LNUA 1CUJA 2GN6A 1N3YA 4C88A 2FOXA 5KNCA 1VE7A 1Y3BE 3ZD9A 3B53X 3O83A 5K4GA 3A26A 2CXRA 2IDJA 2I67A 1S7CA 1HSOA 4MTCA 3CIOA 2OBBA 8AT1A 3KB8A 2OZVA 2F62A 2WU1A 3EUEA 3AJAA 4HZUB 2AZ4A 4JEMA 1HTBA 4H31A 3G9QA 4JS0A 4ZU3A 4BLQA 1N3IA 4JUCA 3JASA 3GW8A 4ILEA 4DLKA 2C5SA 4FS8A 4W9NC 4J6FA 2WP0A 3HBLA 5LQCA 4FT4A 4MQ4A 1JQDA 2P7IA 2J8ZA 2QTHA 2FUEA 2YJ3A 4WZAE 4CCWA 4CEHA 3LWNA 3CRVA 1H1LB 3LU1A 2NP6A 1PQWA 1TB4A 1USIA 4KTTE 4CMJA 4WOJA 1W4LA 3PUXA 2YZ2A 3CA8A 5EXDA 2CY0A 3HWX1 4IMRA 4CLHA 5AD1A 3LLCA 1X1AA 2QI9F 4OHVA 3V8EA 3ZCXA 2A4KA 1OH8A 3TYXA 4I6GA 4B82A 2AJLI 3RKRA 1M34A 3F46A 1TQHA 2QG4A 4MQ6A 1R8YA 5CW2A 3M5DA 4RVDA 3IDFA 3DCNA 1UZNA 4D3YA 5KBYA 2WF7A 1NRXA 3ES9A 5TMPA 1LB1B 2ZBDA 1KPIA 4PIMA 3LC1O 4PWZA 3AERB 1EP3B 4UAJA 1Y3DE 4JLSA 4IDHA 3IOYA 3ILVA 4BGEA 3RJTA 1P9RA 2DG2A 2QU7A 3R40A 1BXGB 4OB7A 2RHMA 3R3YA 1CHNA 1GPNA 3UA4A 1XTZA 2BFPA 3PZBA 3PYMA 2PS1A 4WY8A 2F8LA 1DKOA 1MX1A 4ZCIA 2C7VA 1YR9A 2DC1A 2JIDA 3TGWA 1FYVA 2GSWA 2BYTA 1AY0A 4DV5B 1EFAA 1RWMA 4NMXB 3LHDA 1O97D 5LMCA 1MEEA 1IWOA 1JPUA 2C3MA 3TQSA 4W6QA 4DR3B 3QX3A 4OXKA 4DF3A 1QIMA 3I92A 1MC8A 3DVLA 4CETA 5BSEA 2QR3A 4KLAA 1TM7E 1WEHA 1LZKA 2L42A 4YEDA 5JPIA 4BNTA 1KR2A 3KAQA 3NC1C 4MJXA 3CVVA 1LI5A 2FR8C 5K3DA 2JKVA 2I55A 2EWVA 5ALOA 1T8YA 1LPAB 2HIGA 1RC8A 1QYRA 4F72A 2BL4A 2D62A 1ISMA 3MWFA 2PYDA 2LKDA 4UBOA 1SQFA 1JPNA 4Q48A 1MB4A 2B3DA 1QZUA 2IXDA 4JITA 4WZBA 5HJ5A 3RYIB 2I1LA 4FOSA 4GKAA 4ZKEA 4PONA 4EYOA 5CX1B 1NP6A 3PWKA 4FQ5A 1MTOA 1LRKA 2CFSA 3AWDA 3NAQA 3DLPX 1KEEB 1XTJA 3VR4D 4BRZA 5JQGA 5FOWA 2IBMA 4Q15A 4WXPA 1MU0A 4NLLA 1KY3A 4C2UA 2CN1A 2OCIA 1IJFA 5AJHA 3E0QA 2YQ4A 3KEQA 3SKVA 5AHRA 1PX2A 2BFDB 5CFQA 1AN9A 3AFMA 3OSUA 4R2LA 2FMXA 3ZYCA 4CQLA 4PZZA 1JX6A 3NBKA 1PQPA 3FNEA 2ZRHA 1ICEA 1XB2A 3T4EA 4C76A 1DZIA 1KQPA 4MIYA 4XWAA 1A82A 3C3DA 4GOXA 3IR6A 1GQQA 2O2DA 1YZ3A 3OJFA 2V4ZA 2VJDA 3T1NA 1T1SA 3ZK9A 1R18A 2CLLB 2OTCA 1H5UA 3ANSA 2OCXA 1Y1SA 2XYHA 5JZVA 3CPEA 1PK7A 4HEQA 4AX8A 5HBGA 4QUJA 2QTVB 3IMEA 5EA2A 4UHEA 5DHSA 3UV6A 1NM5C 1B8VA 2PAAA 3CX8A 4R6XA 4F96A 1Y9JA 4RV9A 1U0OC 3KJXA 1E2GA 1U2GC 2BJWA 1ECCA 2DFDA 2YY5A 1DO8A 2DFKB 3OQBA 2RCNA 2WYVA 4BCBA 5DM70 2PDAA 4X1IA 1D1QA 3M4XA 1KA9H 1W0KA 1KE2A 2XF2A 5CXUA 4JIGA 5T4HA 3GEDA 2HA4A 1I2ZA 3I5XA 3K73O 4DNPA 1KRWA 2GZAA 4X91A 5JXHA 1KRXA 4L5CA 5FBLB 3TO5A 4EK9A 1HQCA 1M1YA 2W11A 3CZ9A 3ND7A 4L0MA 1JT9A 1Y8RA 1D1SA 3E9MA 2FRDA 3INYA 4MYUA 2O8NA 4RANA 5FBZA 1OGJA 2CVZA 2WB2A 2OGWA 2W7TA 3E9NA 3PDIA 5LQSA 5SZIA 2CXHA 1GKIA 4ND8A 3R5TA 3QNMA 4R1MA 1L5NA 1M72A 2RHTA 3FIJA 3MAJA 3NTQA 4CUJA 3CV3A 3DSRA 4H35A 4DA0A 1GRVA 1SWWA 3O47A 1MQ8B 4LZNA 3T9BA 5G1PA 2QVYX 4A5OA 2FW8A 2YJ6A 1CYEA 2P2YA 2EKPA 3PNMA 5JZOA 3LHSA 1B6SA 2G77B 4CTMA 2W5UA 1U3WA 4LNHA 4BRUA 2NO5A 3K8QA 2AFHE 2Q2NA 4HNAB 3QX8A 2EHJA 1GWNA 3CEHA 4GX5A 3I1JA 2ODWA 4UZFA 4ZQHA 1XNQB 1EWKA 4GS5A 2PKQP 3RYFA 2O14A 3BK2A 3WWCA 4W5QA 2JI7A 5ILOA 2YWGA 5JJLA 3N1UA 2ZSUA 4BE7B 2CEKA 1KK0A 3AF4A 1V8OA 3F4BA 5DTRA 4XQ0A 4I9UA 1IQ0A 4JQSA 4EVIA 2AOTB 5KNBH 5IP5A 1E69A 1I5OA 4M36A 1KI6A 3M6FA 5EHIA 2PZJA 3PX3A 3DA8A 3OEHA 3OOHA 2GAFA 5C8VA 3I1YA 1PZFA 3ZE8A 2L69A 4AJNA 4LOIA 4BVKA 1B26A 2XUOA 3U62A 2QQ0A 3TTWA 2HWXA 5JSZA 4HLCA 5KYYA 2A0WA 1E2DA 1XAGA 4LE2A 1I4OA 1JEYA 1VL2A 2AG5A 3BMNA 5EE5B 3UAGA 1DKUA 1NR7A 4QUGA 1UUFA 3WDKA 4IP0A 2PKRA 3CE6A 3G2PA 4IGAA 5AICA 4YMIA 3FPSA 3SJCA 3HPRA 3CRW1 3TB4A 1D7AA 5LQKA 4MYHA 1A97A 5FUXA 2VSXA 4LXQA 3FF1A 5BYJA 5JS8A 3JZAA 3ETNA 4H6PA 3U9SA 5EIEA 2WAOA 3ZVNA 1TGVA 2Y1FA 1K3UB 3LW7A 5EQJB 2JGEA 3U2QA 1ZEMA 1Z33A 1I01A 3MPUA 4K40A 2XT6A 2P0EA 1A9QA 3HUDA 5K3AA 4BU0A 1Z3IX 3HJGA 2EJBA 1IVYA 1M33A 2OHFA 3PQCA 5E1OA 2HYDA 5FWAA 2QX4A 1IB0A 3RV3A 2CL6X 4EDHA 5E6UB 4DDTA 3NV7A 3R77A 3TL2A 1E8DA 4HAVA 1Y5NA 3WR5A 1RBYA 1E0AA 3LK6A 1N2BA 4DCUA 4INJA 3VTZA 2UUCB 1KYWA 3WXBA 3R8XA 4J0EA 1E1KA 4K1XA 4KWEA 3HQ4O 3NVAA 4KTVE 3Q7SA 3DUFB 1D2RA 1P81A 3A58B 3L8CA 3TTTA 4CLOB 2WD8A 3O1IC 1UFOA 1WMBA 3LSYA 3PVCA 4ZCRA 1HNWB 3JPYA 1VCIA 3OOSA 3JYLA 4EELA 3L04A 2IZZA 1XZQA 3QLJA 3L2OB 1XZEA 4D02A 3O82A 1BHQ1 2EGUA 1XD2B 3RC7A 4FDTA 4CDGA 4TKVA 4A3SA 3PSHA 1SN7A 5IULC 1V0JA 4QATA 1P4AA 4IX1A 5GONB 2KMLA 4DRXA 1VKJA 1PTKA 5ICSA 2GKSA 2HSZA 3K2QA 4RBNA 4NXNB 1OFTA 3A11A 2IYYA 2QQGA 4Y6PA 2I0FA 3DT9A 3S29A 1M6NA 3T0FA 2RGAA 4XDHA 4II2A 4OOFA 3WRYC 1PFYA 4EJMA 3W78A 4HN9A 1FDOA 1HQDA 1PBNA 4GPEA 4JC5A 4NE2A 4XTRA 3QMWA 3VSAA 2HU7A 1JWAB 5FHQA 1P7PA 3A9SA 3H5AA 4R05A 2EWWA 9ABPA 5JNWA 5DNAA 4F56A 4KO1S 3HXQA 5FFNA 4L8VA 2J31A 3TQCA 1LX7A 1NXSA 3KJNA 1AUVA 2QDXA 3SR3A 6ADHA 5FBKA 2BHLA 4JYAB 4KXLA 1XWFA 2AW3A 2I3GA 1PZHA 4RNDB 4AZWA 2PZAA 4R31A 4V1CB 2DYKA 2ODNA 4FFNA 1GPBA 2AN1A 3CXRA 4KXMA 2Q5HA 1YZQA 2AYXA 1X7ZB 2FPLA 2VEOA 2NO1A 3IMKA 5KINB 4D79A 3RK1A 2J9GA 3FYUB 3OCUA 4XGRA 4ZA2A 2HA6A 3RSSA 4B47A 4YGYA 1QXSA 2ZAGA 4G0UA 3NAGA 1OYVA 4ITVA 2LNDA 3OU6A 4I9FA 4Q9DA 1TPZA 4LE1A 4O2LA 4PE5B 3T7TA 4B6JA 4ZAXA 4D6YA 3NTOA 4NZPA 3AX6A 4TZTA 1NVMB 1R15A 4XB2A 2OM6A 1TECE 1W0CA 4MAMA 1NXPA 2BEWA 5I7WA 4ZEOA 1VLQA 1E5LA 2A1IA 3VR6H 1MX9A 1Y7IA 4BC1A 5GZ1A 1KXZA 4B40A 3EOZA 4ZAZA 4QU5A 4QOJA 2QPOA 3GGDA 3UGKA 1ZRNA 1Z7WA 4M8NE 2O3JA 3GEIA 1SKYE 1JALA 1JDZA 1A4IA 1VG0B 2JFQA 3LL4A 2PSDA 1P75A 2X77A 1AGRA 3EPKA 4L22A 2J9RA 3FVQA 4CMKA 3VPHA 2EP5A 4JEUA 5BWOA 1OY1A 2JZCA 3R0ZA 1IAQA 2GZ1A 4EY3A 1FE8A 4YYZA 5F73A 2BFCB 3LZ6A 3K0KA 3QYPA 3WSWA 1MABB 1DGQA 4LYYA 1UEIA 2DUWA 4Y7DA 1ZH8A 2RARA 4LMPA 4YFYA 1M8KA 2V6GA 4IOMA 3U40A 1A9OA 1C7EA 4RTQA 3KEMA 1I4EB 3FIUA 4B6OA 4HVTA 1GTJ1 3RASA 3QEAZ 4CJXA 1ILEA 1O94D 3BMCB 4HZGA 4EHDA 2X5KO 3C85A 1L0BA 1TVMA 1S2MA 3C7AA 3CT4A 3NFRA 1WU8A 4JC8A 2NQ8A 1QWSA 3WP1B 4DJ5X 5JRJA 3ISJA 3O4JA 1DOAA 1EXDA 3JQ8B 4EYGA 1P9OA 1TKRA 2K2WA 4NWIA 4BLTA 4RPLA 1GCUA 1H5NA 2BUAA 2JLRA 3JQ7B 4L4YA 4KNWA 2M6KA 4YMHA 5JH7F 4MLZA 5C3UA 3NM6B 1WOMA 3TLKA 3D7SA 3WLKX 4RHCA 4J3NA 2Q0HA 5EKUA 1V48A 1I3NA 4O02B 4FHEA 4DCPA 1VXOA 3JARB 1PHRA 1VHLA 2WW8A 1FU8A 2XYRA 1X74A 2ZYDA 3EBPA 2ZITA 3C3MA 4G0MA 4Z86A 4DGQA 2ZSIA 1LEHA 1D6SA 1TZCA 1YGYA 5DCWA 3U7FB 1YTUA 4U5XA 4YP9A 5ILGA 1BE1A 4AJPA 3HB0A 2IPNA 1FZTA 4I4TA 1B43A 1NVDA 3U4HA 1D07A 3ACDA 4P82A 3W5CA 4UKDA 4DCJA 1HDCA 4ER6A 5JDCA 2O19A 1W2GA 2QD4A 4BTEA 3KLOA 2A30A 1YQUA 1HF3A 2XVXA 3QIVA 1FL9A 5BR7A 5EJ4A 1VCHA 3AG6A 3RVPA 2OO5A 3FMVA 2EKDA 4NCIA 2FI1A 4ZVKA 4OBXA 5G4KB 1Y42X 2R8RA 1HBJA 5L95A 2NZ8A 2VNAA 4ZHQB 5K3OA 2DEUA 4LCBA 5FUBA 1H23A 4KDRA 5K6AA 1VG1A 3PI7A 3LGSA 5DGXA 3KD3A 1DTSA 3A6EA 2D7CA 1PZMA 4U2BA 5BSFA 5T67A 4WD3A 4CKWB 2NU7B 1ZEJA 4JUBA 4NH4A 3VMMA 2W6JA 4WLUA 1W59A 4I50F 4YREA 1XRMA 2OYCA 4IWNA 1QH0A 5MF6A 3F6EX 3T1HB 1TA4A 3KQLA 2QLTA 4MARA 1WHTB 3MWKA 3Q0IA 1JU9A 2W2OA 2B8TA 1DJMA 1IN4A 3LUJA 1UJ4A 4EUFA 1C9EA 2ZSEA 3OI7A 1Q74A 1ZISA 2PEYA 1P0FA 3IQEA 3HCFA 3U7JA 2OORC 4FDUA 2ZTUA 1AKUA 4L3OA 2AG8A 5DXFA 1D5CA 1JFFB 1JHXA 1RCFA 2O7RA 1C1YA 2IZ6A 4DVGA 4DSOA 5IJ0B 2HK7A 2JJ2A 3WKBA 1B0AA 1H85A 1ZM9A 5ALDA 3CLHA 4XUCA 3DAYA 4IIFA 4XX1A 5IAKA 1R5BA 2V7XA 3TFQA 4V1CI 4R9VA 4RA6B 3G1WA 4AMUA 1WO8A 1QVVA 4OTZA 1QP0A 1E9AA 4H16A 4WXEA 4CYMA 3AUXA 2QJWA 1DJLA 2XLCA 2Q0XA 5TARA 4BATA 4F04A 4EGQA 3S4YA 1OFVA 2Z1NA 1DBQA 3CRZA 1NUHA 3P1JA 1IULA 3SN6A 3U48A 4RD4A 1E9FA 1NP3A 3ZWYA 1XWIA 2XGMA 4Q12A 1GAQA 4JP8A 4Y6OA 1IHYA 2DF8A 1R0SA 4AXXA 4EW6A 4OUDB 4WT7A 3CEJA 4JVOA 2GPSA 3KKQA 2ZQ5A 3JQAA 3S7TA 1TUIA 3STWA 1BCSA 1G16A 5J4KA 2X76A 3U3XA 2OESA 3HGTA 2JCXA 3KWFA 3U4CA 1X1SA 3ADDA 3SIXA 2B1QA 3D3WA 1VYHA 5DASA 3S8YA 1NVXQ 5AXCA 1J0CA 2WIBA 2IDZA 3I04M 3CBGA 2FUG1 4O4IB 2QU8A 3V1MA 1RDFA 1TKBA 2BM0A 2QEQA 4G0ZA 2PKQO 3DZDA 1JE1A 4LFAB 1W5BA 1OHHD 4EO7A 1TIPA 3SM9A 3OEYA 5DBHX 5ALIA 2CUZA 1B7GO 2G80A 1U7ZA 2P91A 1N5KA 1DEKA 1H93A 1D6NA 2JEZA 3L7KA 4R7ZA 1SVWA 4ZPJA 4RIEA 3L46A 3RJMA 4DIMA 1FF9A 3PKZA 1DWUA 2CJYA 1KIFA 2BRUC 1K7YA 1G3MA 5EY5B 2ZRQA 2I2BA 3GGGA 3LZCA 5EYPB 4DARA 2X0RA 4S1VA 3W7VA 3GGCA 5CFPA 3A4VA 3FXAA 1Z6YA 3N5KA 1QP7A 1ZCZA 4G01B 2FSHA 4HRVA 3GD5A 2KB0A 1VA4A 4JD5A 2GVNA 4ICIA 3OLWA 3UOWA 4BNZA 2H92A 4I0WB 3QPVA 3U7QB 5AVYA 2IU0A 4G1MB 1PD1A 1QHHA 3BGIA 4JYZA 2PS0A 4YV2A 3LT5A 4G09A 4HN4B 2PFSA 2X0IA 4P1ZA 4P32A 4QUBA 5FB3A 3RGWS 4CMEC 4FGSA 4NYMR 2XUFA 3A4YA 5BV1A 2I22A 3TQRA 4JDUA 2HA2A 4GSYA 4ENWA 4K9QA 1IN6A 6CHYA 3FTEA 2C0PA 4V0ME 3THSA 4G5OA 1G5FA 1JQ3A 1WPRA 4X7PA 1E0KA 1OC4A 2IOQA 2QD3A 3HEBA 4EA6A 2VHUA 1OZHA 3CH7A 4I3FA 3T7IA 4YRNA 2Z57A 3CQ9A 4O2AB 4Q18A 5BT9A 4W5TA 4X1YB 3KP1A 3SHTA 4DE5A 2WWTA 5CB4B 4OEHA 3ZYZA 4HB0A 2PD3A 3DOHA 2QDKA 1Y1QA 5EUCA 4ESOA 2XV1A 3EMKA 4Z5XA 5JYDA 3EIHA 1J0AA 5MN5A 5FNVA 2B25A 1BN7A 5I9NA 1NN5A 1RZRD 3DYBA 1Z26A 5F5NA 5KYWA 4L9WA 1EVEA 1LPPA 3LYLA 4II3A 5K4AA 4FCTA 2EX0A 3E5NA 4QDKA 1J8QA 4YJHA 5ALPA 3ANMA 4FU0A 1T5SA 4YNBA 1JR3A 5CPFA 5HBRA 4CF3A 1CNEA 1V1RA 2ZU6A 4JFRA 4PO1A 2JLUA 5HRUA 3U6KA 1UDAA 2QTCA 3BAZA 2Q6KA 1Z73A 2C2BA 4MS3B 3T1VA 4HUQA 1I0IA 1IOLA 4XW2A 4I6EA 4REQB 1SPXA 1MJGA 1UPFA 2C95A 3C3PA 4OV6B 1KFJB 1EI9A 2OD7A 4QYMA 5ED0A 5LJIA 2KBFA 4YDSA 5BV0A 5AI8A 1E3SA 1Y1RA 3A9CA 1WKVA 4NYIQ 3FD8A 2AZXA 5JZBA 4CU2A 4AS3A 1IE3A 1NPDA 1MJ5A 1F1BA 1CKEA 3IAXA 3D0QA 3GDHA 4NC9A 5IC4A 1G8HA 1H94A 1RPNA 4YY3B 5E6SB 3L84A 1ZNXA 4AJ1A 1FFAA 2FN3A 2HWKA 3NHPA 3ZCPA 5BN1A 4XPIA 3VHXB 1FW6A 1LPNA 2D5IA 3H6KA 4Z1MA 4PSVA 5KWIA 2R65A 3LOPA 3MSXA 4PZCA 1NAIA 2NSHA 2VP3A 3QPAA 3R20A 3R3XA 4M38A 4R3UC 4E2FA 5B6PA 4Z7QB 5E7MA 1RM3A 3HU5A 3Q9LA 3QTLA 1HLFA 1P7VA 1B8NA 5IDVA 4BKQA 2VQEB 2FHPA 2HGSA 1L4LA 4CMBA 5D3MA 5KTRA 2YV2A 3X44A 4RJTA 4MR9A 4F45A 4RJLA 4PQGA 1Q22A 1B76A 1F6WA 1FFDA 2FLKA 2W37A 4O29A 3W1WA 5I8PA 1MZVA 5JD5A 1JV2B 3V1TC 1OQAA 4Z53A 1M1XB 2MMCA 3ME5A 2XR1A 4WN3A 3O4GA 4E2XA 4KIWA 3G89A 4TUYB 2CXXA 2J0UA 2X0KA 5EJAA 3WL5A 1FJXA 2B4YA 2Z9BA 5ALGA 1I3CA 3ZS8A 2M9MA 4BGIA 5G0VA 1R4MB 1RJ9B 1ZIPA 2ASVA 2H0RA 1JHDA 2B5VA 4NAHA 2DOKA 3PJEA 2IKQA 2JGJA 4B45A 2IH2A 3GXOA 2GM9A 3P9SA 1Y3FE 3AL2A 3AR2A 3Q7EA 2WD7B 1NONA 5KPJA 4L6IA 4M1OA 1SURA 4QEDA 1BVYF 1JLKA 4TTRA 5COAA 3LPLA 2R00A 5T64A 5JAZA 2JJQA 4WLEA 3QF4B 4KXUA 4R2MA 1OX6A 2NZ2A 1QOPB 3M6MD 3OSZA 1JQAA 4JLWA 4MUNA 4PV7A 2XOKA 3B3QA 4QVGA 2FMUA 2ENWA 1SU8A 2NG1A 2BHTA 3RUDA 4EVRA 7AT1A 2ONCA 3R5JA 1MGOA 4MWDA 3QJ5A 4P35A 2HI0A 1Z4JA 4MWGA 1ZXLA 3G6WA 4X61A 3TSAA 2GJ4A 1H2RS 5A5FA 1ZXBA 1UKEA 3GCZA 1QS0B 3QG1A 2WHQA 1Z2OX 4BYGA 3EMBA 2O1XA 1FXWA 3DNPA 4UMDA 1V5EA 3CVJA 3HI6A 5CVCA 1BCRA 5AT1A 4GMFA 3C4QA 4KAJA 3W3AD 4C43A 3IQZA 3SBDA 2QLNA 1XAIA 1TCBA 1WSDA 2N3ZA 2WSIA 3HU3A 2J0QA 2XA9A 3F7TA 5L7YA 2ZB2A 4LQCA 2QW8A 4JXKA 4YCBA 4F11A 2OBYA 1NVFA 4EKDA 5KTNA 4N6OA 1WDTA 3VOAA 4H60A 4GNKA 4TN5A 2DUNA 2VUIB 2O52A 4FPXA 4EY6A 1P80A 4BFUA 5HMMA 3UB3A 1QFYA 2V8BA 3JQBA 4FFRA 1OH5A 1EQAA 4H0NA 1P1HA 1R6AA 3PQDA 3O95A 3CNHA 5FI3A 1Z6AA 1GTG1 1VFPA 1SGWA 4W7SA 5FJIA 1WZCA 3ILXA 3NXSA 5EE9A 1KDRA 5I4KA 3OIDA 3W2FA 4AZ0A 4FDLA 5LIRA 4FLFA 2BKLA 1KOFA 3QM1A 1RRKA 4C1BA 1I24A 1D09A 4QUDA 5INTA 3HS3A 4F6LA 5H82A 1X1CA 3UPDA 5DM60 1QHEA 3DMFA 3N8GA 2XXBA 4M55A 1QGZA 4JA2A 5JVDF 2IY7A 3KPWA 3LPNA 4KZPA 4BFSA 3WGUA 1E4OA 2EQ5A 3TEJA 1L4YA 2BE9A 2YC4C 4PPFA 2HRRA 5IZCC 2X13A 1J7KA 3PLRA 4JWTA 3CNOA 1SOUA 2C9ZA 3JV7A 4OX9Y 1WJGA 2IY8A 4C29A 3DL2A 3A9UA 4Q9HA 5DEOA 1CWUA 2HAEA 4OLFA 3GOQA 1QQTA 2NT3A 1JDSA 2B7BA 2PV0A 4W1QA 3ZVRA 2WUGA 4E6EA 5CD1A 3E9QA 4FGKA 4IIJA 3ASUA 4LPKA 2BR4A 4QZVA 3ITEA 4YP7A 3GFVA 4ZQCB 1A7JA 2HXGA 3IR7A 1JKXA 3LRPA 1H8HD 3EF1A 4N3AA 5FTNA 3SCZA 1OXXK 4GR4A 2HWWA 4E15A 2RH4A 5I7FA 5IUNC 3EXAA 4FZJA 5BVHA 2A9VA 1KMHB 2Q2VA 1UIMA 4KE9A 1NMYA 1S9HA 1FS5A 2W2KB 3U1TA 1EM8A 5LZ9A 4JY7A 2HXSA 4R98A 4A9AA 4ZMSA 2NW6A 1RRCA 3CUUA 4KE7A 2D1SA 3PUJA 1QFMA 4U9HS 4MGYR 4U63A 3MRXA 4EG6A 5AOAA 3K9BA 3K4HA 4HWPA 4D3SA 3UEOA 3C3EA 1ML3A 1C3XA 1IZ9A 4NV0A 3N6XA 4TMTA 2C7QA 2YOFA 3LQQA 4TVKA 2AI3A 3SSNA 4BVHA 3AVTA 3BHJA 2VQFB 1XZCA 2H2GA 2J67A 4INOA 3RSOA 3ZV7A 1NJ2A 1GEGA 2Q0SA 2QJOA 5EUMA 5LUBA 5JC1A 4X20A 1Z36A 1M2OA 1V43A 1SB8A 1UOOA 4X1OA 3TZCA 3VYTB 4F5WA 2DU8A 3RYCB 1ES9A 4EARA 2QAGC 3CG4A 3QVGA 4FMPA 4KU4A 1EJBA 1O9HA 1OLXB 1GFZA 3RS8A 1Z12A 3HJCA 2DLDA 3CZAA 3QFSA 2GN8A 3VGJA 4JZKA 2I54A 1LDGA 3CLSD 4IKOA 4KMRA 4MQBA 3X2SA 1ZA2A 3X2EA 1ACLA 1THGA 2WIDA 4AK9A 1T24A 1IAVA 1T2CA 3GDFA 3DG9A 4R8LA 4XYBA 4E1VA 3C3BA 4CQJA 2BBTA 3AVPA 3K9CA 2NTJA 3KX2A 2F9LA 3OTIA 2XUDA 4IXDA 4QU0A 1A1VA 3T3MB 5DSTA 3N2GB 3ZWVA 1YRQA 1NRWA 2NZUG 4XUDA 3W1VA 3KWMA 2AK2A 2EVWX 4PVDA 4QUIA 4U00A 3H13A 5IAEA 3E23A 5K3CA 1O6CA 4JR2A 5D8DA 5LOVB 2CC2A 2F90A 2IYFA 4PYQA 3ZQJA 1OXKB 4HGZA 3MF4A 4MV7A 5KX5F 5F4ZA 3WJ1A 1F0YA 4NCJA 4FJ1A 3D7LA 1A9XA 3UUEA 3NHWA 3GZNB 2RAUA 2VFAA 4TV9B 2EWMA 4G24A 3CSSA 4DB4A 4PYJA 3DBOB 1JS1X 1YS7A 3M9XA 3Q3EA 3ER9A 3U7QA 4Q3CA 1SCIA 3MWYW 3FRIA 3DLIA 4H3VA 1G4UR 3DYIA 1H4QA 4RORA 4DV2B 4URZR 2O0HA 3LBFA 2I7CA 1WD7A 4M9RA 5B3JA 2GHRA 3N59A 3HWWA 4M6WA 2JIZA 3T0IA 4YTEA 5CFZA 2JVKA 1BDIA 4I1VA 6Q21A 5EP3A 2B99A 3DOEA 4QDOA 2R8EA 2AB0A 2AE1A 4I55B 3CWCA 3IODA 4LRWA 2JLVA 1DTEA 2P4HX 4LDPA 3H99A 5JS1A 3DPSA 4WEOA 3RCBA 2ZQYA 3DMDA 2V3VA 2O7NA 3A4MA 2E4VA 5DTJA 5HQ3A 3UB4A 4GOMD 3LWDA 1VPLA 4QICA 2F00A 3OEWA 2FRVA 4NENA 3WMWA 3ASYA 4ARUA 3ZDQA 4KO8A 1A2KC 1T6BY 2YQZA 2E9SA 4J7XA 3ZQKA 4C6RA 5J47A 5GADl 2ZCVA 4J1TC 2DUMA 2Q9BA 4QG7A 3IHKA 3CR8A 1JJ7A 4BN0A 4UTPA 1MENA 5DBIA 4G8DA 1C29B 5EHQA 4Z49A 2QLLA 5AQ1A 1XQ1A 4CKEB 2PRJA 3PNKA 2YICA 4KAAA 4DIBA 4BNDB 3UOGA 3V9AA 1BKSB 4YHHB 2WG2A 4NBVA 2G04A 4WLVA 3DFFA 5H81A 3QTTA 4BMCA 4R1LA 3I9JA 5I9BA 4E1BA 1K66A 3KEFA 4FW8A 4BQRA 5JFOA 4D43A 2D6FA 4MGKR 4OH7A 3PCXA 4E03A 4COKA 1A9SA 5CLGA 3AILA 1FLNA 3L4SO 3P9CA 3DJFA 4JI3B 4D9GA 2ABWA 3JTEA 3LP8A 3UMYA 4HNGA 1J0DA 1BHJA 3BILA 3NGLA 4DQVA 3O94A 1I6LA 1XEWX 3OJ0A 5F2KA 4AP9A 3HO1A 3HN2A 4OJNA 2J7PA 3T5BA 2WFLB 5E6RA 5FP0A 1L3IA 3B1KA 8ATCA 5J5AA 5AW4A 3NDBB 3E1SA 4R83A 5DI3B 5FORA 2C5AA 5CA1F 3AI2A 2A0XA 4H1UA 4Q05A 3TRHA 2E21A 2ZRDA 3QFCA 4QTUB 4XVCA 2LXNA 1E5DA 4L4XA 2BW0A 3RHFA 3A6HA 3C15C 3C6KA 1DZ3A 4F8YA 3RD5A 1D4OA 1N9ZA 3CC8A 4C20A 1DQYA 4Y1RB 5BQFA 5AVQA 3KSAC 4NHEA 3GPLA 2P2DA 1U7WA 4RGBA 1XZAA 3R0QA 4NECA 4ZGGA 1IZ8A 4ER3A 5L45A 3HCCA 2PUWA 5CLIA 4EMSA 1EDBA 9GPBA 3RVJA 3HDJA 3AETB 2QGNA 3QLEA 4IJUA 1VRVA 4M54A 5B53A 3TLAA 1EK5A 1U3FA 3WQRA 2JHAA 4FD2A 2A5LA 1XZIA 4RZHA 1TJ5A 3F7MA 5H5JA 5JAIA 1K4YA 3NNDA 1JLRA 3WMGA 4NARA 3ADPA 4K6OA 3OICA 1OFUA 1ZNQO 2H8KA 4KQMA 4ZZ2A 4FCVA 4TV8A 3RYHA 2AG1A 1XX6A 4N8EA 3ZKAA 1X9IA 1H2BA 3ZKWA 1CEXA 3F5SA 1M6VA 4OAPA 3R7FA 4DUGD 1N2CB 1QF9A 2PQ6A 1FMTA 3T0GA 1JIVA 4J29A 1GSHA 4Q03A 5H68A 1ZJ5A 3VOTA 1L1QA 3W4IA 4LF9B 3RQSA 1N4DA 3HUTA 3RLIA 2DX7A 4F2DA 4EKGA 2HA7A 3KSUA 2GX6A 3SJ7A 1ODLA 5CEFA 3KXLA 1FDUA 4XWYA 2SBTA 2A58A 3IT1A 4K7JA 1JN0A 3LBNA 1SUIA 4PY2A 2ZJ3A 3TSZA 3VNAA 1MH9A 1RHQA 1F7UA 2DERA 2A9RA 1WCIA 1K63A 1VBKA 3R3WA 2P2SA 1NN3A 1A9RA 2V0CA 1ZY2A 5AYVA 3HABA 4D57A 3KTFA 1G8AA 1TVCA 1YCHA 1E0DA 1GG2A 2CXOA 3L6DA 3ODGA 2LUOA 4H18A 3S8MA 3D2AA 4FR5A 4QGGA 4X00A 3LA8A 2ZWMA 3QPBA 3BSFA 5ALYA 3W5SA 3OJLA 3CYFA 1MA0A 1YT5A 3UG7A 3PHJA 4CLRB 5EJ8A 5CK4A 1W1WA 4G4IA 2IF0A 4N5NA 3W8DA 1XJ5A 2C9MA 2IXBA 3GJ6A 1MXFA 4XIJA 2WVHA 4MW5A 1MN6A 2YVKA 2BHNA 3A31A 1N75A 2GHIA 3BA6A 3DB2A 4NBLA 4RCYA 5KC9A 4E08A 1OXUA 2EHDA 3G0BA 2VP4A 5IT4A 1MD9A 4LOLA 5FLYA 1ZI9A 2DBQA 3EGOA 1RABA 1VE3A 3FNQA 4FFLA 4G3XA 3UXMA 2VDLB 3OH8A 1H05A 3MUFA 2C5HA 4DG8A 5FF9A 1POXA 5EVCA 1J33A 3FBGA 4GZLA 4JBGA 3WKDA 3UBMA 1MNQA 1Q5PA 3WL4A 3SWWA 1MAHA 5GV8A 1UANA 3HRKA 3ZZ1A 1T9DA 2AOWA 2ZRMA 5SYNA 4YDHB 4LYJA 3SHFA 1W2WB 3M7IA 3OZ7A 1W47A 2XH8A 3AUKA 3H83A 3WHLA 4HADA 4J8PA 5EJ5A 5F52A 1JVNA 1VPDA 3Q9NA 3HFJA 4FBGA 4OGLA 3AVYA 1PN3A 7ADHA 3VZQA 3WGHA 5AM2A 1RW4A 3IYLW 5BRAA 4KREA 2CSUA 3RPEA 2C98A 2QD1A 5DVZA 3VR4H 4CM8B 2XGGA 4C3UA 3NDIA 3N07A 2IYQA 4DT1A 1RKBA 4J0CA 3X1XA 1HYGA 2GNAA 4N3GA 2UXBB 1UMCB 4C7OA 1N0WA 1ZPDA 1UFVA 5CM2Z 1J90A 1K9SA 1R37A 1F51E 3C6BA 4DOMA 4KO3S 3QELA 2H4ZA 3HN7A 2GPNA 4NBSA 2REQB 1ADYA 1C1XB 1RR6A 4UHHA 3VSCA 3NRJA 4F9FA 1BVUA 3BMXA 4S1WA 4ZT6A 1G7TA 3OE7A 3LO8A 4D7AA 2BPOA 2ZR7A 3EXHC 5DT2A 4JXXA 1N0IA 4FX5A 5L8VA 2INGX 1EAYA 2JJYA 1KOJA 2ZBGA 4P5PA 4CM9D 3D43A 4CEJB 4B0OA 3RFCA 5IMBA 4RKRA 1KSJA 1QUFA 4KPGA 3SI7A 4BJHB 4HT3B 4JQCA 2VJYA 4RDHA 3RTDA 5AVVA 3JVIA 3BAFA 1PT7A 1ND6A 1ULAA 1OTHA 1N6NA 2WPDD 2CLFB 3GRUA 5IBCA 5CYOA 1NY6A 4P81A 1GU0A 4H3SA 4DLLA 4E3WA 3BDVA 1H66A 1U9ZA 1VLHA 3IPYA 4EP1A 4KGDA 4V2IA 5IBQA 2E4XA 3UIEA 4YJ2A 1X15A 1JJIA 4QQRA 4J0HA 1YACA 2ZUDA 3U0VA 5HCUA 1L7RA 4UNRA 5JNLA 5IF9A 3JVEA 1TNDA 2QMQA 1RRPA 3O74A 4LY3A 3PX7A 2PIAA 4H3HB 4PSKA 4RYDA 2FFQA 3VO8A 5KCMA 3TKLA 5BWCA 3G9TA 1WETA 3FGPA 3FH0A 3VAAA 3DAHA 3UAZA 4OYRA 1K3FA 4HWKA 2RI1A 4COOA 3KXKA 1KIAA 1GCIA 1MQAA 3JQPA 1GAXA 3LF1A 2UYGA 4LFBB 4UC0A 3V1KA 3L1KA 3NGXA 1X14A 1E5TA 2BIFA 4A0QA 1U0EA 4WXYB 1QQAA 5IDXA 2GCOA 2EZUA 3H87A 4PHFA 4FCWA 3LQYA 3REOA 1L4KA 3TPCA 2WTBA 2VWHA 4Q3LA 3TAHA 3S1SA 4WUTA 3V8PA 4O4HA 3RR2A 2GRAA 1IOZA 2ZZNA 1XZ8A 2NMVA 2VOJA 2RJOA 3W2TA 1AB6A 2QMEA 2O2JA 2PANA 3LKVA 4C06A 2B1JA 2JDID 4HP8A 1HOTA 3BOSA 4ALLA 3EXIA 1L4MA 5AKLA 4IDOA 4B3SB 3U7HB 2XOXA 5JBIA 1V26A 2FFRA 4DLZA 3NETA 1W93A 1QWOA 1TI7A 4REMA 4HTFA 2QUHA 1L7MA 2CV2A 3FYCA 1DEHA 1TGYA 2ZAOA 4X84A 3FPAA 2G5TA 1EFLA 2H6EA 4MVJA 2Z5FA 4NAUA 4A5SA 5J2TA 3AUFA 3AY7A 3B5JA 1DQZA 2RGNA 3MT9A 3PRKE 4PLCA 2GCPA 4E22A 2LD4A 1BN6A 3DNFA 2E4UA 3E58A 3I3OA 3Q40A 4GF5A 4PAMA 4Q93A 1TEVA 1TA9A 4FYHA 4C2TA 2CUTA 2IYPA 1DKLA 5J2UB 2PUVA 1CP2A 1LY1A 1RRGA 3SFVA 1LFAA 1PV2A 3P52A 2QPTA 3O8DA 3F6PA 3NVMB 3CS3A 2ON6A 2HSDA 1IBMB 4W5RA 3I32A 1OYWA 4N8DA 3QVMA 4ML3A 4EB8A 4EHNA 1KYZA 3LKDA 2H1SA 4C6HA 2OY0A 1R50A 1YI1A 3K0AB 4WH0A 1P6UA 3T41A 3SE0A 3ZVLA 3UAYA 1MAVA 1N2GA 3C1AA 3I3SR 3THXB 2ZTMA 3LD9A 3T7JA 1VYVA 1WXGA 4FOOA 2P5SA 2BEVB 5CR9A 4YB8A 4BX8A 1U2ZA 3PV0A 4UD6A 1QOZA 3ADKA 2R66A 3KDAA 1FFXA 4B34A 3COYA 1ZSYA 1PWXA 4NJEB 1NU6A 1GNVA 4U2CA 4UUOA 3GPBA 2OXEA 2BJHA 4FYJA 3G0OA 3KHTA 3C8UA 4UNNA 3PHCA 1QBKC 1ZHHA 2VDRB 5JTTA 3Q6MA 4ZVOA 4KBFA 4DDMA 2QTMA 1JXQA 2XMBA 3U3JA 4JUIA 1KPHA 2NUPB 2PHZA 1G20B 3L77A 1GG8A 5E38A 3MQ2A 3WP0A 4BVFA 2PJRA 1J21A 4LVNA 1EWYA 1K97A 4UFNA 4K9PA 3FWPA 1QTRA 1QORA 4GM1A 2CJWA 3NAMA 3QXSA 2QK4A 4UBNA 5CJ2A 1I14A 2MHCA 4E5YA 4NE7A 2F4NA 1NE2A 1KYYA 5AM5A 2SCUA 4IDFA 2XSZD 4P80A 5LCXA 1RP1A 3CF0A 1KVSA 1U94A 2G06A 2PL5A 4JENA 4XJTA 5ALFA 5G41A 5KTKA 1AHPA 1P73A 1E59A 4LZAA 4EEZA 5M2QA 3KDPA 4F3KA 4C4XA 4CG1A 3KHSA 4FZ5A 2HNAA 5JV5A 5KWSA 1VJRA 1SVUA 1H4TA 4CIDA 4G5RA 4YPFA 1T0BA 3MJTA 1QK4A 1I9GA 3ABQB 3HDQA 2G8NA 2R7LA 1ZWKA 3WJAA 1ESZA 4WBNF 5AM3A 3MJRA 3WYAA 2AXEA 5FR1A 4OHXA 3L7LA 4QKQA 2F1HA 1NVVQ 1KNXA 3NVDA 4IUYA 1U11A 3ZLUA 2GASA 2DFNA 3UMVA 1R64A 1I80A 2FZGA 2BUCA 4RTLA 3KL2A 3EIXA 3I58A 5C5DA 4LXGA 1IPFA 4MX8A 4J9UE 4EA8A 1T36B 3K1YA 4DDKA 1MIOB 3NC0C 5HA5A 4DV6B 4AWAA 5L3ZA 1WXFA 1RWXA 1W4AA 1U9IA 3RVLA 2QZSA 3NDRA 2FP4B 1Q0PA 4ON9A 3K2EA 3ZE2B 4BC0A 1L5OA 2HCBA 2OXCA 3NB0A 4LMAA 4OQNA 5I8ZA 5CJJA 1N6IA 1Z0JA 1WSBA 2EP7A 3BFKA 3D3EA 2XCIA 3ETJA 3QSGA 5K0JA 2ORED 3O8QA 1P0PA 1VHTA 2X58A 1SOWA 4BMOB 1NW4A 4JJIA 4FHCA 2BLNA 3ZG6A 3IMGA 1O1YA 2W6CX 4WA7A 2C1XA 1BWSA 4WKOA 1GGJA 1OZGA 1TJ4A 3B20A 3SP1A 5FI5A 5JDIA 3BX1A 5IARA 4QU9A 2AOUB 3ROQA 4EMUA 1NQXA 1WB5A 3V8NA 5K9ZA 5KVAA 1NGSA 4QE3A 4YFVA 2OBFA 2AQIA 1PL0A 2J48A 3DTVD 2OT3B 3HC7A 3JPWA 5AVXA 2HF8A 2IP2A 1D4FA 2XCLA 3VO9A 2PTGA 3LE8A 4K9LA 2R6DA 2LP4Y 4B79A 5KKNB 3QE4A 5E4JA 3I5UA 3OPXA 1Y3AA 1J0XO 1QRDA 4XIYA 4OP3A 2QX8A 1ZN2A 1JDTA 4PFKA 1G5TA 3PE4A 1F4LA 4G89A 4YMSA 1MGPA 4Q3KA 4IL5A 1H4SA 2GAIA 2GWRA 4ALJA 4N41A 2PRIA 1CUDA 1JFVA 2G6TA 2VAPA 1Z4MA 3ZWMA 2JGRA 4WERA 1E2FA 1K6XA 1JZSA 2GO7A 3UB2A 1YR3A 4MGZR 3BCUA 3WAGA 2X40A 2C94A 1FTGA 3GRAA 4YRRA 3MG9A 2Q7OE 1LK5A 3ZWKA 1GZSA 1UDCA 4QD3A 5EERA 3C2QA 3STXA 1FP4A 4GUDA 1WW8A 4DMHA 1N9GA 1YQ9A 3TOZA 5D7BA 1AG9A 1RLOA 3EISA 3GEPA 4U2KA 4A1FA 4RK0A 2O2CA 3VNVA 3JQ9A 2IQIA 1E9DA 1ZD2P 4P4SA 1YQEA 3QMPA 3QBEA 2CYAA 5CIQA 4CN8A 4XVUA 3PR1A 2Y9MB 1HYEA 5IAOA 3MT0A 2V3WA 4L6CA 4NQRA 3B60A 4PPNA 2AE2A 1AK2A 5BNZA 3IPXA 1GTL1 1QKIA 2WT4A 2O5EA 5JYBA 4M9XA 3OUUA 4V2UA 3A6JA 5C0OE 2HPZA 4GMDA 1CJBA 2B35A 4F2HA 1GR1A 1UKYA 2VYND 2PH7A 4XRRA 4H4CA 5FWXB 3FX2A 2ACVA 2V4MA 1P4GA 2AX4A 5B1IA 3EXFA 4MI3A 5AW6A 3LYUA 3T34A 2FRDC 3IIMA 1IMJA 1F2TB 4KNVA 4D0GA 4D74A 2A1UB 4C6TA 5IF3A 4PNEA 1JVBA 1Q1GA 2BHSA 3I30X 4GGMX 2O0KA 5HPYB 2Z0MA 3DXZA 1A5ZA 1V8ZA 4N1AA 1EWRA 3UO8B 1IN5A 3EZXA 2CCJA 2IYEA 3AKYA 5LLTA 3VU9B 2NP7A 4EJ6A 4H27A 3F98A 2WF5A 3FCUB 1UBLS 3ZGNA 2XKJE 3GY0A 5E0OA 2VZ0A 2IDMA 2W93A 1PU2A 3W7BA 2IW3A 4PZLA 2QM8A 2RHJA 4KN5A 1T4MA 2NVWA 5DMHA 3RIXA 2QZZA 5DT9A 1A5SB 2QTWB 5LLDA 4MPRA 2FEKA 1YC5A 5JWOA 5BSMA 1T3GA 4RY2A 1CRZA 3NYQA 1J2YA 4NICA 4GECA 1ZJYA 5THKA 4QHSA 1XGKA 3A4NA 3DCYA 1NW6A 3H0EA 3MWDA 2DWOA 4BASA 4A36A 1KJWA 1D2EA 4UULA 3CH4B 5B30A 3FOEC 1I33A 8LDHA 1BMFA 1GR0A 2L2QA 1ENOA 1YI8A 2B92A 3KQSA 4H1HA 1KZYC 1WSWA 3ZUGA 3QJGA 5DOVA 5IK2D 4XQ9A 5C52B 5DYWA 2H5EA 1W49A 2IZ1A 1WBDA 2GB4A 3PFGA 3EPPA 1C1DB 3F97A 4QYIB 5FWYA 4MYSA 4I6JA 1Q1EA 4OAOA 1QG0A 2C2MA 1YFLA 3FWZA 3A6KA 4OK3A 1X42A 1JLLB 1UT5A 4KXWA 4D4HA 1X8JA 3CH5A 3OECA 4KW7A 2JLYA 4OGFA 4YRGA 3HSKA 1ULTA 5L9AA 1TMKA 1B3RA 4PC3A 4E09A 1I32A 1ZO8A 2D1YA 4X71A 1PR0A 4ED9A 3GEMA 1CT9A 1J0BA 5C51B 5DK4A 2H29A 3DFMA 3S2UA 2NO0A 4DA7A 2GUGA 3VC3A 4LJSA 2YOHA 3IBFA 2J0VA 3BWBA 1T8RA 2WMDA 4RE5A 1NUUA 3RS5A 3C5CA 5C7LO 4EL0A 1L5RA 3M4NA 4MQLA 1X7WB 5IASA 5ITZB 2VT7A 3BS4A 4MUEA 4QOFA 2GRJA 2OWDA 3FDIA 1Q20A 1RQRA 3QE0A 4UUQA 3WFIA 1VOTA 2QUIA 1VLJA 3FTQA 4ZOCA 3CE9A 3AYXB 1RC1A 4W1SA 4BLRA 1IC6A 1XDUA 1SH7A 4NULA 3KQNA 2HZBA 4IMPA 2QSUA 1R16A 2XOEA 5C2JB 3ETHA 3UJ9A 1QCCA 3RRNA 1HTWA 1XSEA 1RWOA 2A6PA 4GGOA 3CMMA 3IALA 5BR4A 1AU9A 1GL9B 4OHRA 5DM2A 5HIJA 1LA2A 2QF7A 1GPAA 1RC0A 2I1QA 2RB4A 3KTAB 3QZUA 4LSMA 1TO2E 5K09A 1K9VF 4XQGA 2B82A 3LBIA 1DIAA 1F8GA 4IHQA 3SVLA 5KYUB 2YWJA 5KHAA 2M1ZA 4GI7A 2DSNA 3VTKA 1YBAA 1WM1A 3FPEA 5DW3A 4L02A 4J4HA 4YJFA 4FN5A 4RZXA 4UOZA 1ZK0A 3L05A 4FUTA 4C08A 1X70A 3SJAA 2W4MA 2Y6UA 4DYHA 5JSQA 3NCTA 3JD4A 4NPCA 1U8TA 4ZOLA 2WSSD 3ZHCA 2EYQA 1ZZEA 4FK8A 4YP0A 1Z5WA 4XWKA 3GG2A 3QVVA 4LV5B 1Q12A 2VDUE 5L4NA 5JSHA 5F2OA 2Q6VA 5T4EA 2IX3A 2WYIA 2O8BB 2QENA 4ZAYA 3X1YA 1JLHA 2HDOA 2BAGA 2HBQA 3TD2A 1YVRA 3ZCQA 1L1RA 1RWNA 1G6KA 4XLTA 2VHVA 2P5UA 1GU1A 1Z5ZA 2RH9B 3I45A 3U1VA 2P65A 3GLTA 5DO9A 4ZEWA 4DQUA 5HSGA 4DV0B 3FE2A 2CZQA 2JK0A 3RTCA 4C01A 3AHFA 3HJHA 1W88A 1E6KA 3COSA 3ENQA 4ZIRA 3SBOA 3G9XA 2A57A 4R69A 4J03A 1B2RA 2RFLA 2Y1OA 1P2GA 5FT9A 2A5DA 1NPTO 4X8LA 2FCRA 3SEZA 3TTVA 4B3HA 4GXNA 4NNPA 1JI3A 3EVCA 4Y8VA 1O8BA 5TPWB 1ACJA 4ETIA 2NV6A 3I2KA 2ZTSA 4JBYA 3CUWA 4JVSB 1FVFA 1GRQA 4OQDA 4R5HA 4DUPA 1NVBA 4JYMA 3CMCO 4ZZ0A 1ZSVA 2ZJ7A 3A3OA 3RF7A 4GVLA 2R97A 2E1PA 2GK7A 3FCAA 4HSEA 4KQEA 3G8BA 4WASA 4ND7A 3FVVA 3IB6A 2ZJ0A 3NGMA 2RGBA 5LB2A 5IYZA 4PCLA 3OEED 2OUKA 1HE3A 4IO1A 4CMCA 4LJ5A 1Z2PX 2V45A 3N86A 5KOJA 4M9SA 4CDNA 2XECA 2KBEA 2ZRIA 3GPCA 3KPVA 2VRWA 1L5KA 3TL6A 4XEHA 2EKLA 3RKUA 4DC1A 3ZBQA 1QE3A 2ZYRA 4OG2A 1XT6A 3IPCA 5A0TA 3LJKA 5MGBA 4L85A 1NC3A 5B4UA 2R1TA 3N2ZB 4HRXA 5BQXA 3Q8WA 1Q14A 5GY7A 1DP4A 1ZD8A 1KETA 4D8UA 1SCUA 2R6JA 3TDKA 3QXGA 1W8IA 4NZZA 2WUDA 4ASUA 2XTJA 1PUJA 1YCFA 4W5JA 3E7DA 4E5VA 3CX3A 1KEVA 4X64B 4C7MA 3OFNA 1Z35A 2RGWA 3WNCA 4ZTUB 2PL1A 3TAXA 3GAAA 1L5HB 3F3YA 4JB8A 4Y2HA 5DHQA 1VSVA 3GVCA 4OQYA 3BORA 5GONF 4YCLA 4ZOQI 5DRTA 5HTKA 1OIWA 1WKCA 3SXUB 1UKZA 1KJYA 4HAZA 1PGPA 3FN4A 2QLFA 1IEQA 3NBXX 4YUXA 1IATA 1QKKA 4NYJQ 3CKLA 3M4JA 2CV0A 4I4IA 1O95A 1Y4SA 4WKCA 1N1MA 4AXBA 2HMYB 2ZJ5A 3TTXA 1NF2A 1JEDA 4Z0HO 1UBKS 4HOYA 4CQMB 4M53A 2W2LD 3DPIA 2N46A 2O6LA 3FMFA 4YWHA 1B1AA 3LTNC 2GILA 1RQ7A 2J85A 3F2IA 3F4LA 4PLZA 2WYHA 3OP1A 4FDAA 5AI4A 1A4XA 3PQ8A 3V80A 4R71A 3MOSA 4RK1A 5CXQA 5SZHB 4DEYA 4KQWA 2PCLA 5AK4A 2WJIA 3AEKB 3DKVA 4LTNA 4BL5A 2VYCA 4NJMA 3P2YA 4LGYA 3F6SA 3P8ZA 4L6AA 1KRHA 4M9QA 3Q3CA 1FMJA 3K9NA 3SX4A 2XHEA 2B0JA 4QJIA 1P29A 3W3ZB 3OF2A 1DPFA 3P2JA 3BJIC 3H16A 1TMOA 5I7VA 2IYZA 3W6ZA 1UC9A 2W6NA 3M6LA 2ZYHA 1TF2A 2W9XA 1U1FA 2LTAA 2EU8A 2OO5C 2LR0A 5D01A 4LZPA 1PJSA 2LGJA 2GYWA 2REXB 1PSZA 3AMVA 3FWYA 3OOWA 3R6GA 4FYVA 4IHJF 5K3FA 2OD9A 4MCIA 1NU8A 2BFEB 1O6ZA 3B89A 4WUVA 3DV9A 5K6AC 1XKLA 2PT9A 1EK6A 1IJBA 4EY4A 2QX6A 4JEIA 5I01A 4U9UA 3AEQA 1U5BA 3HY3A 3U13A 1Q0QA 1TM2A 3ML1A 5JNRA 5KNBA 1QVRA 5H3HA 4B3GA 1REQB 1KMQA 4BAUA 3AR9A 1GZUA 1EUZA 2RIRA 2D5BA 3OETA 4DRYA 3VV3A 2A0YA 3TE6A 5IEJA 1E1RA 4XR9A 3PQ3A 1P5FA 2ODAA 4JCCA 2I8CA 3A7EA 5FTKA 4B3XA 3IKTA 1FLAA 2XAUA 4IS2A 4YH1A 4EFKA 4UZEA 5KYXB 2B6HA 3V48A 1OX4A 1CY6A 1W29A 3VUEA 2O8EB 3K20A 3BIWA 4NCBA 2R85A 1U81A 3C8DA 3IE1A 1AN0A 3UHJA 1OZFA 2Z83A 2GJ9A 2A35A 2H0QA 4G63A 1PWEA 3IULA 3Q87B 1WTAA 3C8ZA 1HUQA 2O0MA 2ZRPA 1UBEA 3BH0A 2BFFA 1TRHA 2HK6A 3EYWA 3G1TA 3IUEA 4UMVA 3VPAA 4E11A 5BYKA 4BB5A 1A7KA 3GROA 5GTDA 2ZYVX 3IAUA 3KZNA 5KVSA 4KBGA 4HNRA 4PQFA 5CVVA 3KO8A 4M1KA 2V7UA 1AO3A 3PSAA 3VJLA 4CCAA 2EJVA 2QVZX 4EYKA 3AQIA 2Z1DA 1UK9A 1AHHA 3NHKA 3IIIA 4BX3A 1NI3A 2NZJA 1EA5A 3AY6A 2CXQA 2Q4DA 1EYZA 2W2QA 3BBLA 1T3HA 1CQWA 1JKMA 4QOGA 3IEKA 3HK2A 2QMZA 3K9FC 4ZDKA 2WJ3A 1EZ4A 1F6BA 1S8OA 2C83A 4ZAWA 3BE5A 2C0CA 3ZHTA 2HIAA 5A5DA 4BXOB 2FYTA 2ZI7A 5LB4A 1R9MA 1UIRA 2IXTA 3IAFA 5EE3A 1TU0A 1NF8A 3H18A 3LZDA 4QT0A 3M3DA 1K86A 1L4HA 3D0KA 3KQTA 4RKEA 4A8HA 4C5BA 3PT9A 4FZ3A 3P7MA 4DSNA 4QO7A 1WXXA 2YFHA 3R7WB 1E3MA 3BJZA 1JA9A 3W34A 3X43A 1UQTA 4EH1A 3G0CA 1EUDB 2C4HA 3JQDA 4OHFA 4GXQA 4QSHA 1NUAA 2H2DA 3PQ7A 3TQOA 1FVHA 1RRMA 2BI8A 3G68A 1J99A 2CJXA 1R6DA 3PQ4A 3KSRA 2ESRA 4QU8A 2ZROA 1QB7A 4QXAA 1JVSA 2ZSBA 3DO6A 3QVTA 1NUSA 1ZINA 1XMXA 3B1JA 3JWHA 2WZDA 1W94A 1GTMA 1ESCA 4ZHQF 3GLIB 2ZS7A 3FPHA 3MLAA 4TTAA 3DBRA 2ES4A 5AI0A 2OBMA 2C97A 3ETLA 1UFRA 1FNNA 1SUFA 1G291 1WDWB 2YXDA 3GO4A 3I83A 4Q4JA 3SLGA 3UM9A 2V6BA 5BUSA 2GKGA 3WMEA 1GJRA 3EARA 4ZALA 3ZH9B 4R7GA 3IBSA 1OGYA 4GYKA 2FPPB 4CEIA 4ESHA 3TQTA 2RE8A 2QAIA 2VPQA 2QM7A 2HADA 2QBYB 5SYMA 1L5ZA 3A27A 4HQNA 4O0LA 1HE4A 3OESA 3PXBA 1LGYA 4WVFA 2PKEA 1YJ8A 3FFBA 4QHYA 3RAGA 1JSLA 1KH2A 4KLNA 2QKYA 3L6CA 5EZ5A 1KDYA 4YX9A 3M83A 4IDAA 3AG5A 2Q6LA 3R4CA 2VP6A 4RLFA 1LD3A 5CTAA 3BRQA 5G1NA 2O8CA 2HJRA 1R9GA 5EE0A 1Y1PA 4YUVA 1NQUA 4TMXA 4BFYA 4RY8A 1ZGGA 3H5WA 1SCDA 3P0JA 3BL8A 1TU3A 1BU5A 3FKSD 5ICCA 4GC5A 2OHJA 5LA6B 1DPGA 2LDBA 3PNPA 4WZ6A 4C4AA 1Z07A 3I61A 2ZE7A 2PE5A 1J2TA 1ECFA 1Y63A 2GEJA 2IFTA 3EMVA 2BTQA 1EJ6A 1TKAA 2QX7A 1DUIA 1E92A 3LXMA 5EESA 3VR6A 2GTIA 1YUMA 2I76A 2JHPA 2I29A 4TWJA 3TLMA 2P6MA 3ESAA 4Q1DA 1GARA 1QC5A 1UK7A 1BXKA 1G9SA 2DQKA 2A2ZA 2QMOA 3MWEA 2YHIA 2OLEA 3I1IA 1FZQA 3AZOA 3P20A 1R0YA 2VDVE 3G2NA 1V11A 2VDPB 5J43A 2VF4X 2O1WA 2VUUA 2P5TB 2D74A 2PPLA 2WBLC 1N5JA 3EH1A 1G1AA 2DQYA 4F6RB 5BV8A 4OM7A 4PTZA 1W4RA 1FY2A 2JEYA 1U0RA 2WOJA 4JU9A 1S8FA 4TVOA 2Q3FA 3WBBA 4RKYA 2F8MA 1EUQA 5I7AA 3LCVB 4RIIA 1M8GA 1NQTA 2KYRA 2YS7A 1NF3A 2PXAA 3H4VA 5J40A 5B7NA 2HJGA 2O2ZA 2FZCA 3PXUA 4MMXB 4HNHA 2VKTA 4C4YA 2W00A 3EEQA 3ZY2A 2Y1WA 2NVUB 2FZKA 3TW0A 1AKNA 3IKVA 4K6FA 3HJTA 4O4IF 4NL4H 3K9HA 4OI4A 2XRMA 5AW8A 3KR9A 1Y80A 4JCOA 3H11A 4UXJA 1FQWA 1W5SA 4I5FA 1KTVA 2VDQB 1OTXA 3A1FA 3PRHA 3WYEA 4QBGB 5TQ0A 2HWYA 1QKJA 4LNAA 2ZANA 5JI2E 4MB0A 4HYQA 5JUWA 5LNK6 4ZREA 4ZTZB 1G66A 3QLVA 4FTWA 4QJ5A 1JDBB 1E1QA 2NXJA 4MQUA 2OCBA 3LXUX 5TMEA 4ZVUA 4YJGA 1DU4A 1NASA 3IUMA 3F2VA 3DAFA 3HKEB 3KV1A 1SCQA 3AF0A 1WXHA 2W6IA 4R0NA 1NMXA 1XOIA 1S3SA 1L1EA 2P3OA 4QXPA 2PKXA 2Q4RA 2QW1A 3QVLA 4MAAA 3CF4G 3O1JC 1O5IA 3ACCA 3ADOA 3NPMA 4NATA 5A4IS 4OK6A 1K1EA 1KO7A 4W5WA 1LTHR 3GJQA 3FAZA 3R7NA 3P2IA 1QU2A 3TQHA 4EKIA 5IW8A 1JSXA 2Q4BA 4FHDA 4RSMA 2RHWA 3JQRA 2BH9A 5E2AA 2FX3A 4NX2A 1OXBB 4A91A 4CKBA 4MUMA 2XZDA 4QARA 1O77A 5LNK1 4O2AF 3PHIA 3CXUA 2GPBA 3SXUA 1IM8A 4G1EB 3ZDAA 4NTZA 5BN5A 3K0HA 2R00C 4Z0TA 3QVOA 2OGUA 3X1JA 3OM1A 5CB4F 2V0NA 2QTGA 4US1R 1E3WB 1DIBA 4LIPD 2GQ0A 1ESDA 1CULC 2G82A 4IIEA 3QU9A 3KDSE 1R6VA 1SK9A 1G5HA 2YW2A 1T8WA 4YRAA 3ZOKA 1DXOA 4FKBA 3MUOA 3F8SA 4WXRA 1DKRA 2UZIR 1E9SA 2ATEA 4INPA 1BJTA 2HU8A 3MC1A 2DPMA 3QYJA 4M0CA 4CG2A 4YRDA 5K0NA 2E5LB 4NU8X 4M1EA 4IW3B 2CJFA 5LBUA 4D26A 1FIUA 3K0FB 4XYGA 4W6ZA 3RV4A 2YNMC 3O2JA 3BHIA 2B98A 4RHYA 2WQ7A 4ZV9A 1PKEA 1R0XA 1S8NA 1QLJA 2EJCA 3L8HA 4KWTA 1DEAA 2VA9A 5G53C 3NM4A 1EZZA 1C0KA 2BGLA 3R4VA 1XYYA 3W5AA 2PU7A 4ZVMA 5I8WA 2IZ7A 3DO5A 3U56A 1VZ2A 2ZRGA 3BVPA 2VCEA 3JQBC 3S2IA 2A9FA 3ZE0B 5H0IA 1J5EB 3FSEA 1RQ2A 5FOTA 1A50B 3RTEA 3UXHA 4AYXA 4AN1A 1YVUA 3Q5GA 5DBEX 2Q1WA 2ZAMA 1PDOA 1U7HA 4H08A 1T9CA 4MUFA 1A8QA 1PNTA 2C2GA 2J6BA 5FPPA 4AG6A 4PX2A 2ISSD 5UKDA 3ROTA 5HFAA 3GCGA 2OFOA 4UNQA 4J75A 1FTWA 1TUBA 1YS6A 3P0RA 1SIOA 1T2EA 5IUKC 3OOEA 1B23P 1NI4B 4FE3A 3GFRA 2PSSA 3RUIA 3EDCA 2GBCA 5HEKA 3VRHA 5F9FA 1GZ6A 5HKAA 1ZUNB 1JHMA 4ITRC 3AP3A 4M7WA 4TMYA 1QNFA 2CKDA 1VLMA 3WB0A 3MT7A