2J5BA

Structure of the tyrosyl trna synthetase from acanthamoeba polyphaga mimivirus complexed with tyrosynol
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
338
structure length
321
Chain Sequence
DHTNNEHRLTQLLSIAEECETLDRLKQLVDSGRIFTAYNGFEPSGRIHIAQALITVMNTNNMIECGGQMIIYIADWFAKMNLKMNGDINKIRELGRYFIEVFKACGINLDGTRFIWASEFIASNPSYIERMLDIAEFSTISRVKRIFYPCMQAADVFELVPEGIDICQLGIDQRKVNMLAIEYANDRGLKIPISLSHHMLMSLSGPKKKMSKSDPQGAIFMDDTEQEVSEKISRAYCTDETFDNPIFEYIKYLLLRWFGTLNLCGKIYTDIESIQEDFSSMNKRELKTDVANYINTIIDLVREHFKKPELSELLSNVKSYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSYL-TRNA SYNTHETASE
publication title Virus-Encoded Aminoacyl-tRNA Synthetases: Structural and Functional Characterization of Mimivirus Tyrrs and Metrs.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Ligase
total genus 127
structure length 321
sequence length 338
chains with identical sequence B
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2006-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2j5bA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2j5bA01
1M1ZA 2A1TR 5TS2A 3IMCA 4MVWA 2O8VA 4XFDA 3ISJA 4DDKA 1MB9A 1GTSA 1O97C 2D54A 4A91A 3SZGA 4QBTA 4NZPA 1NUTA 5JBNA 2V0GA 2GKSA 3FDXA 4MULA 3E27A 4MUNA 3S3TA 1H3EA 4G5FA 3SEZA 3FETA 2CV1A 2DLCX 2JAXA 3P52A 1M8GA 1ILEA 3DO8A 1WQ4A 3H9BA 2A7XA 3CR8A 2CT8A 2CYCA 3ZXSA 4GU5A 4ZT7A 2CSXA 5K0TA 4L2IB 2A1UB 3L93A 1QU2A 3P0IA 1NURA 3AG5A 2PXHA 2CYAA 4EGAA 3GMIA 1N3LA 1X8XA 2NSYA 3FWKA 1J21A 4ZT2A 1N78A 4OUDA 1PFVA 2ZP1A 3IVCA 3KT0A 1N2EA 2Z08A 1I6MA 3PNYA 4NX2A 3IH5A 2IP1A 5J5AA 3TQOA 1R6XA 3RFFA 2QTNA 1WY5A 1WQ3A 3IODA 3IDFA 4YBRA 4CDMA 3ZJUA 2BYTA 2PIDA 4Q16A 1Q15A 4U7JA 3PNBA 2A88A 2EJCA 1QTQA 2HMAA 4KR6A 5K0SA 1J70A 1N2HA 2B7LA 2Z09A 2VTBA 1T6XA 4MW9A 4DE5A 1TYBE 1O96A 2J09A 1JHDA 3MUEA 1U7DA 1IQUA 3GLVA 4NAHA 3MXTA 2X3FA 3AKZA 4K03A 2V0CA 4S1OA 4MW4A 2QJTA 3IUEA 3RK0A 3Q12A 1QRUA 1R6UA 1OBHA 4EG3A 3ZJVA 1XJQA 4KR9A 1EFVB 1KR2A 1T9GR 3CVXA 1T6YA 1MJHA 3P0JA 1V8FA 3CLSC 1XNJA 4P2BA 4YMIA 1O0CA 3LOQA 4U8HA 1F7VA 4I6EA 1WXFA 4E1AA 5HUJA 1TYCA 3M5WA 2X0KA 1O97D 3COWA 3UC5A 4KPUA 1IHOA 3H9CA 4CQNA 4JFAA 4JXXA 4ARIA 4ZCSA 1ULHA 1TFUA 2H29A 1Y42X 3AFHA 1N75A 1IQ0A 2PZBA 4MWCA 5J59A 1O95C 1X6VA 1JIJA 2JA2A 3D6UA 1JZQA 1GAXA 1NUUA 3CVYA 1K97A 1KORA 2A86A 4ZT5A 1QRTA 2XRZA 4MWEA 3JXEA 1KP2A 1TQ8A 2DUMA 1TYDE 2DEUA 1XNGA 1NYLA 4EG1A 1MC1A 3A04A 3QTTA 4WNYA 4PBTA 4EG4A 4F4HA 2PG3A 1HYBA 1D2RA 1MB2A 3HZRA 2E18A 4MUFA 1RQGA 3DPIA 3FIUA 4CDNA 3IOEA 4HJXA 5KHAA 2E89A 1MOPA 1O0BA 3D6VA 3MLAA 3CVVA 1N1DA 5LFAA 1PFYA 4MLPA 4ZCPA 3QE4A 3X1KA 4EF6A 1PFWA 4FZJA 4HJRA 3N05A 1T9GS 1G8HA 1OWMA 4EG6A 5LLTA 2TS1A 2X1LA 1JILA 3HMQA 3NBKA 3H97A 2GOYA 3VGJA 2AZXA 2QUJA 3NV7A 3IOCA 3SYTA 2QJFA 1WXIA 4XFJA 4MVCA 1J09A 1IRXA 3CLSD 1EXDA 3VU8A 1NZJA 1ZH0A 2J07A 1F4LA 1I2DA 2RE8A 4MWBA 3PRHA 4R2MA 3ZXIA 2IJGX 4OJMX 4MW1A 3DLAA 3UY4A 1TEZA 1NSYA 1EFVA 3U1VA 2QUIA 3AG6A 3X1JA 3FG9A 1GZUA 4HPWA 1F7UA 4JXZA 3A2KA 2QTMA 1O95D 1QU3A 1JZSA 2OQ2A 1I6KA 4YP7A 1COZA 1JIIA 1J20A 1J1ZA 1KH1A 2HZ7A 3K9WA 4PBRA 1KKUA 3K32A 5J58A 5F23A 1EUYA 1G8FA 3AL0C 4NATA 1PG2A 2QJOA 2PFSA 3G6KA 3MMXA 1YUNA 3HGMA 1KAQA 1UFVA 2BTEA 1NP7A 1K4KA 5LM3A 2A1TS 4ND6A 1H3FA 3UOWA 1EE1A 3INNA 5FO0A 5KCMA 3G5AA 3HV0A 1BS2A 2DPLA 2ZUEA 3I05A 3KT3A 1P7PA 1KAMA 1GPMA 4CT0A 1OWOA 2EL7A 1J1UA 3UK2A 2DR2A 3TNJA 1V47A 4MUIA 2I1LA 3FY4A 1NUPA 4G6ZA 3CVWA 4HK4A 4I6GA 3IVXA 1QRSA 1U7XA 5HUHA 1NUQA 1U3DA 1ZUNA 4MUHA 4MVYA 4Q93A 4X0EA 1MBZA 3TQIA 1KH2A 2A4MA 4MW7A 1OWLA 3MLBA 1VBNA 5DEOA 1WXEA 4OUDB 1S4MA 1XNHA 5FO1A 1EFPB 4DDMA 3SEQA 3OTWA 4YP5A 3HFJA 4YP6A 2WQ6A 1IQRA 3FI0A 4KR7A 2G36A 2VXOA 2YWBA 3CVUA 1SURA 1I6LA 3F3MA 3GUZA 4MQ6A 4ZCRA 2CYBA 5DB4A 3CLRC 1JEDA 4MUEA 4L2IA 1FYDA 1MRZA 2A1UA 4WSOA 3LCJA 1JMVA 1KP3A 3HL4A 3FHJA 1N2BA 2J5BA 1T6ZA 3NBAA 4F3RA 2O5RA 4EFKA 3CLTC 3FNRA 3RJZA 1M8JA 3ZIUA 3G59A 3L92A 4UZFA 4QREA 1YULA 1KQPA 1NUSA 3ND7A 4U63A 1WJGA 2QTRA 3OP1A 3ND5A 1FFYA 1LI5A 3COVA 3ELBA 3TZEA 4PY2A 3PXUA 2PZAA 3H05A 3RK1A 3BL5A 5TEVA 3KFLA 3ILVA 2YWCA 3FH0A 3DV2A 1YIDA 1OWNA 3C8ZA 1IVSA 2E0IA 3SP1A 3IOBA 5KWVA 1B6TA 3IMEA 4MWDA 5BNZA 4R2LA 1YIAA 3A4IA 3H99A 3QTBA 5H7XA 1K92A 2CFOA 3TS1A 1H1TA 4KKVA 4I6JA 5HG0A 5IJXA 4XSVA 1GTRA 1EJ2A 2Z3VA 4MAFA 1U0BB 1M8FA 1OD6A 1WKBA 4DDHA 1N2GA 1YI8A 2E21A 1VLHA 4EG7A 2DETA 1WXGA 5EKDA 1PG0A 4TS1A 3CA8A 2QUKA 1N2IA 2HGZA 2CV2A 4ZT4A 3VRHA 4EG5A 1KQOA 4UZEA 4ZCTA 4R0NA 1O5TA 5H16A 1O6BA 1ZJWA 4MVXA 4AS1A 1DNPA 3RHSA 4DLPA 4QRDA 5IHXA 4PBSA 3COYA 1H3NA 4MW0A 1EFPA 3CLRD 4DJAA 3SZ3A 4NDAA 1M8PA 4ZT3A 1ZH6A 1O94C 5TGTA 2XRYA 3CLUC 2H2AA 1KH3A 1MAUA 1VBMA 1PFUA 3P0HA 2ZUFA 4ZT6A 1JECA 2YXNA 2PZ8A 2QUHA 1IFXA 3CLTD 4RUKA 1WXHA 1R6TA 1F9AA 4BWVA 1OBCA 4MW5A 4EG8A 3ND6A 1KQNA 1JGTA 4DNXA 2NZ2A 4JZYA 1G8GA 3FOCA 1QJCA 1TYAE 3N8HA 1QNFA 1U3CA 2AKEA 1GLNA 1JIKA 1LI7A 2CUZA 1MAWA 5DASA 3KT8A 1Q77A 2WSIA 3SDBA 5TEWA 2CV0A 3COZA 4G5YA 4MUKA 3A05A 1IH8A 2J4DA 4J76A 3Q10A 4K0RA 2DERA 4GRIA 4MW2A 3ZUGA 1LW7A 1Q11A 2GM3A 3Q4GA 2RD2A 4AQ7A 2X1MA 1EUQA 1M8KA 2J08A 1M83A 3AIIA 1VBKA 4NAUA 5DK4A 4RPIA 4ZCQA 3IVGA 1QQTA 1G59A 2R5WA 4MW6A 2JANA 1N77A 1NI5A 3IUBA 2AG6A 1Q19A 3X1MA 2VTBB 4H3SA 2WQ7A 3KT6A 3RBAA 2D5BA 1JEEA 1O96B 1VL2A 2DXIA 1CT9A 1A8HA 2D13A 4JYZA 2OV4A 3ZJTA 1OWPA 1K4MA 2WB2A 2A84A 5AHWA 2IELA 3IMGA 4MUJA 3N9IA 1N2JA 2C5SA 1O94D 4MUGA 1YUMA 3CLUD 4ND7A 4ARCA 1GN8A 3PNVA 3TZLA 1N2OA 3LE8A 2YY5A 5FNZA 3UMVA 3ZGZA 1WOYA 3N2YA 4KPUB 1WZ2A 4J75A
chains in the Genus database with same CATH superfamily
2HRQA 3KSUA 1XCOA 2YDYA 4PV7A 2GYVA 1I36A 2D8MA 1SUDA 2ECKA 1NRIA 4WKNA 4YI3A 2I2BA 4LBWA 1XCJA 5KPDA 3BERA 2C7OA 4GR4A 2J46A 3R7LA 4TMXA 1XMOB 2D3WA 3Q8LA 2C03A 1NNUA 2Q62A 2D54A 2X6RA 4XE5A 4DPMA 3QX3A 1FMFA 3KBBA 4WA8A 5EXDA 5B4TA 3RSFA 5K45A 1A77A 1YACA 5SZHB 1R12A 1XD8A 5KEIA 3S3TA 5K2MA 4JX9A 3HJUA 4HT3B 1VRWA 2PX8A 1A7AA 3PYLA 3R0IA 1F2UB 4FYXA 4LHWA 2FLKA 2M1ZA 3KV1A 1G5RA 4WKBA 3H9BA 3CF4G 4DQVA 3CR8A 2ZB7A 4F84A 1R8JA 4PX3A 3ZXSA 3DUWA 4LZLA 2ODQA 1GHTA 1S8AA 4EO4A 2CSXA 1ADJA 1JG7A 3OCJA 5FAKA 1K2WA 3MGGA 3WIBA 2ILTA 2IEAA 3INGA 2DFLA 4UUPA 2QRVA 1DTWB 1SUCA 1KO8A 1OTHA 2WJIA 2GHRA 1HYHA 3OUUA 3GJXC 4A03A 4D8YA 2FKAA 1XMVA 1OBFO 2AQKA 2BCJQ 2GUGA 2HWYA 3JZMA 5B3JA 5WRFA 2SHKA 1P0PA 3NVDA 3OJOA 2E5FA 1XNQB 4NCAA 1TAQA 4UUAA 4IFIA 2FWIA 3HXMA 5DM1A 3QHAA 4Y1FA 1JLHA 4BQPA 1YS1X 5GQSA 4QO7A 2ZAIA 1ZBQA 2CHUA 3TQOA 3RFFA 1G20E 1HE4A 2QTNA 2R8EA 1WQ3A 2YH2A 3JQAD 5LYJA 1T43A 2VAMA 1XD9A 3VR3D 1Y8ZA 2FWMX 2WZCA 2AJBA 1M6HA 1YB4A 1P3Y1 4N5LA 1Y3DE 4TMVA 1WSAA 4YJGB 3PEUA 5FI5A 4DA0A 2BEJA 4RC9A 1XMJA 4TS4A 2A88A 3CLHA 2GAAA 4C05A 4UXHA 1C30B 4KR6A 1AXRA 3C45A 4EHHA 4UNNA 3SS8A 3O4VA 1EEXB 2ZJ1A 1T6XA 1A98A 2P2DA 2WTEA 1N1EA 3HLTA 1BEEA 2VWPA 1YJ5A 1XF1A 2C4NA 2HJ9A 4W5HA 5JYCA 1DKRA 4V0LA 4OQEA 1BX0A 1TW3A 2O14A 4MVJH 2JGNA 3NHBA 4HC4A 4EO7A 8ADHA 3L8ZA 2H4FA 2I1WA 1NG9A 4H6VA 3ABSB 3DW3X 3MUFA 2WG1A 5DHTA 2FWBA 4D81A 1I32A 1U8CB 4RGQA 2IEZA 1EWRA 2BEWB 2VPPA 3GEGA 4QRIA 2PZJA 1FRNA 4NCXA 1W8IA 2B2CA 4PYKA 3V4PB 1E9CA 3WLOA 3P7MA 3K1YA 4BP3A 4N54A 4DRXB 2CUTA 1M2GA 4G0MA 3ROMA 1ENYA 4I6EA 4J0JA 1R0WA 2JAUA 3M5WA 4L85A 2IUYA 1NU8A 1MMFB 2LVBA 1HYEA 4W7IA 4MTLA 3IDSA 3MHPA 3ZS8A 1M54A 3C3KA 1FA9A 1P0QA 5EEHA 5LKAA 2RGEA 3DXZA 3AFHA 1OXXK 1HLPA 1G291 2NXWA 2C9YA 4QECA 4GP6A 2GKOA 3ODPA 1J0CA 4RXMA 1LQUA 5DTRA 5LD2C 1GXSA 1XRLA 4N9WA 4PYQA 5DWQA 4HFRA 3J81k 3F7NA 2G5PA 4D97A 4BXOB 1PS8A 2ZB3A 1EWQA 3T0IA 4KXVA 5KAMA 3CTPA 3NDRA 1JX6A 1N8TA 3GRKA 5M7EA 2BHRA 4NICA 5E2IA 1P74A 2E5WA 4KQWA 4F93B 1NYLA 1LLUA 4RS3A 3ZWWA 2RH8A 3X44A 1GZHB 1BQ3A 3PEEA 4RESA 3LCMA 4UOQA 1EFTA 4KDCA 5EUCA 3VOTA 3QBDA 3O8QB 4ZEOA 4XASA 2REBA 1USVA 2L18A 1RHKA 2QTLA 1S5PA 2VFAA 3JD4A 4XM2A 3U31A 1YL6A 2CZQA 3HU2A 4Z7OB 2J45A 3RWMB 2QN3A 2UUBB 1MEEA 4DR7B 4G4IA 3B60A 1IEXA 4EA9A 5K3FA 2OBNA 2P3QA 2Q45A 3B3QA 2I33A 5SY4A 3QA3E 1KMNA 4M88A 1ZH4A 3TQTA 2FN9A 3KJEA 3R41A 4EMTA 2QD5A 2XT6A 3MCWA 2CWDA 5IKXA 1N7HA 3TSCA 4WD3A 1T35A 1G64A 1NLMA 1Y5IA 4HLUC 1VYUA 5CVVA 4A2WA 8OHMA 1IG3A 4KR0A 4TLMB 2CVZA 1Z4KA 1MOQA 3OFND 3W2IA 1D6NA 3EA5A 2CJWB 4BS9A 1J7KA 5BW5A 3QE3A 2X1LA 4YDSA 3T5PA 1I1QB 1XQ9A 1QVZA 2F1RA 4JJZA 1NSFA 1OLSA 3SZMA 1U0OC 2WNHA 2R79A 2YDXA 4KTTE 3IHKA 4X3OA 3HMKA 5AI6A 2DBZA 3AR6A 1TZBA 4YUVA 2ZBQA 1KYWA 1D3AA 2JFXA 1FLAA 1ZC4A 2IPOA 5KQMA 3KTFA 4I1RA 4NBLA 4CR8A 1Z12A 4GLJA 4HEQA 1ZJ6A 1NNSA 1CUHA 5A4MS 1TB4A 1E1MA 3IVAA 3KQTA 2YN2A 1W73A 4X61A 1AQUA 4GZ3A 2F48A 3MOIA 1U7WA 3RIGA 1V5EA 3JAWB 1GL7A 1M1NA 5AD1A 4MARA 4KB5A 1R5OA 1XPJA 2Z04A 2CVHA 3LC2O 1FX0A 2PUWA 2W9XA 2VCEA 2X8LA 3KEMA 3CIFA 5JNVA 1UPAA 3KFVA 4TQUS 5GGYA 3VNSA 1KKUA 2C58A 3HB4X 3SQDA 1ENOA 1MIHA 1JTEA 3U9SA 3S7ZA 3RHTA 3COSA 2E4AA 3FCUB 5AI8A 4LMRA 4V0QA 5KYGA 4UVIA 1QFJA 1SC3A 4GMGA 5GM2A 1G5IA 2QT1A 1PG2A 3O1HB 2C7QA 2QJOA 3FCAA 3L0OA 1MR3F 2PX0A 1CU1A 2LXNA 1QG0A 3BCHA 1N57A 3GAMA 2I4LA 2ZBPA 2MSEB 3HYNA 3K35A 1XJ0A 4ISBA 4M98A 3E18A 5T64A 4G97A 1FPMA 2OYCA 3OCUA 3ZLTA 1Z2PX 3BRWD 4ESEA 3TEJA 3VDQA 2VOEA 2JLSA 1II9A 2IA5A 3HV0A 5EC8A 1OB2A 4IO1A 1PW7A 1R5BA 3KT3A 5JDCA 4Q3LA 3GPLA 2HJGA 3KU4A 1RJDA 4D9JA 4RULA 1UODA 3GLFB 2DR2A 3S8YA 1X8JA 3EVCA 1P7ZA 2I9PA 3Q7SA 5B12A 9ABPA 2OV3A 1E2MA 2H85A 3NOOA 1OOEA 4B3HA 2BM1A 3TECE 1YOBA 3OT1A 3VO8A 1IN5A 1DRVA 2YVKA 4I6GA 2ZDGA 2A94A 5DHFA 3IL2A 2JGMA 4OBBA 4ZYYA 3DE2X 1D0VA 1IHXA 3EF0A 1PJ4A 1L1QA 2QYOA 3AUFA 4YCNA 3VYVA 1SH7A 2ATIA 5U1PA 2O7QA 1RMYA 4TXNA 3WL4A 4I66A 4Q3OA 1YZLA 4BFYA 3D0OA 4ALKA 3R3XA 4C9BA 4LJ6A 2IZ1A 4MW7A 4AG3A 3QKTA 4Y9RA 5HRUA 1E2EA 4C6TA 3ESBA 1N33B 1WMSA 4NYMQ 5CIWA 2NU9A 4H2DA 4HVAA 1NYQA 1ZHOA 1JXAA 2BVNA 1UJ6A 1I10A 2ONKA 2QP3A 1SVKA 4CV0A 2WDZA 3WVNA 4ZQEA 1LH0A 1TD1A 3HABA 1N0UA 1EHCA 1E6WA 1MZPA 2R8PA 2Y76A 4UZSA 4ZCRA 1J39A 1PSWA 4U7WA 4LTDA 2P0EA 5A9SA 1UM8A 5DB4A 1E3EA 2J6HA 2F59A 3C3PA 4YRPA 1N8NA 4MUEA 4G0OA 4OTZA 3SHQA 4YP1A 1GKYA 1Q1NA 3MJHA 4RSGA 2GRUA 1J4AA 2VJLA 2QPTA 4GMFA 1ZGGA 2MINA 4R8LA 3OZ7A 1SHTX 1KP3A 1QH8A 1R5NA 2REQA 3RV4A 2PS0A 1K5GA 4LJSA 3WWDA 3NBFA 3X2EA 4KXQA 4Q7EA 5EZYF 3ZZ0A 4KZKA 4ETMA 4B7ZA 3OM9A 4US2R 5GZ1A 3ZH2A 3IQDB 4IZIA 3CNNA 4CM6A 4HLDA 1FB5A 2NO4A 1Z5OA 2ADMA 4J2OA 1IDN1 2QG4A 2NUPA 3WB1A 2QXTA 1GPYA 1KSJA 1V3UA 3DXYA 2G76A 2LR0A 2WWFA 3ND5A 4UVHA 3OKCA 3QSYA 1W5FA 5IVHA 4FHZA 1SB9A 2ZBUA 3ZU5A 4INZA 3JQAB 4DLUA 1IN8A 1L4BA 4TV8B 1R6BX 3TZEA 4OJNA 2O5CA 4MGKR 3CWZA 3RGGA 1KEPA 5DNAA 5TEVA 2ZSHA 1FNDA 4FYHA 3TUZC 1QZZA 1ESZA 3ANNA 4LDZA 4LS3A 4BZQA 2I03A 2OORA 2C3YA 3RWBA 1AURA 4I4LA 3EJ6A 4EW3A 1C1YA 3OMLA 5EZSA 3KRTA 3PQ4A 1UOEA 1IXKA 2GJ4A 3I4LA 1L7EA 4ZVUA 3LXRA 3WK9A 3KXPA 2H2WA 1RYFA 4BNYA 4GP9A 1C2TA 5LXTF 3FB1A 5H81A 4DDVA 3N0TA 1ZJYA 4LNHA 1F8XA 4F7WA 1KDYA 5AXDA 5ICCA 3GEBA 4PPFA 1SZDA 1XCGB 1ZD3A 1YBMA 4EY7A 4AK9A 4IXTA 4BGUA 1H8ED 4MP8A 3HM9A 4M54A 5EE1A 1EWKA 2X4LA 3H7IA 3KBOA 1ISSA 5G53C 2H1WA 4DRYA 2WD8A 4I1YA 3OJEA 2XUZA 3Q0EA 4KRGA 3PUIA 4X63A 3TIIA 5FTLA 2E21A 1VLHA 1VPVA 2VA9A 2ZM6B 2O7VA 1DRUA 3KXKA 5AJUA 4C7KA 4M36A 1XDUA 4C0WA 3PL1A 1JR3D 1W4LA 1RYMA 3A1TA 3FA2A 3I5UA 3RYCB 1OU0A 2AC7A 3LTNC 4LHVA 4ZT4A 2AD1A 1PQPA 2LNDA 2Q50A 4HMPA 4OGFA 2DLNA 3UIEA 5C46F 1SBYA 2H17A 1TMGE 4QA9A 3SFVA 4C7OB 5DKFA 4JBXA 1QQ5A 3BTOA 4ZGBA 2XCSB 1MOZA 2R6R1 1V96A 3HRIA 4X1IA 2Q7XA 3IULA 4RTLA 2IYAA 5EUQB 1EFPA 5GOZA 4FYWA 2JFYA 2D2FA 4N7BA 5D8DA 3WMXA 5BUQA 1I14A 5JCZA 2IS2A 3RVMA 2UVDA 1I5OA 3GGDA 1ZH6A 2VEOA 2Y9PB 1R64A 2ZIXB 3QEKA 4JKOA 1H2HA 5ICEA 1Y5RA 2XH8A 3KTAA 2W6IA 3DLIA 1RZVA 1ZN8A 1U28A 4OHVA 5JARA 1CZLA 2D2VA 1CRQA 4ENUA 2ZUFA 4ZT6A 3FAKA 1LPPA 3HJCA 1GA1A 4LRXA 1CIPA 3MPOA 4XDHA 3A1DA 3G0OA 3FBGA 4QDXA 3V4SA 4TMZA 1NY6A 4FCCA 3OF2A 4A0RA 3TW0A 1Q0QA 2WFLA 1O89A 2ACEA 2ORED 3ETLA 4Q4JB 4KE6A 3G2KA 3S68A 2C98A 3SMQA 4C6HA 4ZU3A 1B76A 4AP9A 2VJMB 1BYUA 4HAWA 2BJHA 1JBEA 5CLHA 1U7ZA 3PRKE 5AT1A 4BC0A 4GLFA 4U02A 4Y7DA 1NIPA 2FPWA 3H3XA 4KODA 4F5WA 1VP9A 3K0BA 2P40A 4R1TA 4EB6A 1W0JA 1U3CA 1X94A 3D7MA 3T3GA 1F8YA 2C1ZA 5H5JA 3U3ZA 3AZQA 3EQ7A 1UWKA 1JDSA 2VH5R 2D2IA 2IPAB 4UM7A 3V8RA 5BR1A 2B7BA 3UNXA 3SHOA 4RABA 3DQPA 2PSSA 5JDIA 4XARA 1A4IA 1H2BA 3RVJA 4OXQA 1N9KA 3UJPA 3JYHA 1R9JA 3WNVA 1TTTA 2C7VA 3HJRA 1TADA 3CFYA 1TTQB 4AQ7A 1M83A 2CLMB 3AIIA 1G2OA 2DP4E 3D5EA 4REQA 1NHGA 3S2ZA 1TVCA 3TQHA 4YRAA 3RVOA 1UBCA 3PSHA 3E05A 2LIPA 5B58C 3BWBA 4JLOA 5IDWA 3EW7A 2A9KA 5JJCA 3HB7A 3EPRA 3GFVA 4GC5A 4QTZA 3WLPA 1KI6A 3C3MA 4TTTS 2FMIA 2DR3A 2PRIA 4UKDA 3JATB 3QBTA 1N77A 1P1JA 3DV9A 3NONA 2FEWB 3HV2A 2P9FA 1AE1A 4O4HB 5E7JA 3RRNA 3W4KA 3WWOA 4JV5B 1EK1A 1YS2X 5T41A 2IEIA 3C74A 4OREX 2HIHA 5JSUA 1KNXA 1Q0RA 4PNHA 2PCJA 3CF0A 4ID9A 1OC4A 3OECA 1RWXA 2HUPA 2HHCA 3UV3A 1VL2A 2P78A 3ZCSA 1P2FA 2XECA 1C1XB 1G6Q1 1QVRA 3CJQA 3E22B 4GMHA 3I8XA 4KPGA 4YJ3A 1W4AA 5K3EA 3N2LA 1AMNA 5JSFA 1K4MA 4YCDA 3LM8A 4LBYA 2I29A 2I4IA 5TQ2A 3A0RB 3JRXA 3PJEA 2P2LA 4MUJA 4CM9D 1O94D 3U4AA 1N2XA 1ZRHA 3B2NA 3JW8A 2HWXA 1ODIA 4E2XA 4ARCA 3LL4A 1X7WA 1XEAA 3DPUA 2VT2A 2QF7A 2YY5A 4RVCA 2QN9A 2X9QA 2VPWA 2ZRAA 2HRCA 5J63A 4TS9A 1FLNA 2W2LD 1Y3FE 5I7AA 4BAUA 3BAZA 4R81A 2FSPA 1NBMD 1P2BA 3DV0B 1I4TD 2PWAA 2YMMA 5JD3A 4OYYA 3PF9A 4JVMA 1E9DA 4CKCA 3ET5A 4ZTZB 2OCYC 1QP0A 1GFSA 2QTCA 3AUSA 4HHEA 1U3WA 4QG3A 4KIGA 2PLNA 3MFYA 4CLHA 4DDKA 3FPSA 1SUBA 5DNEA 3RTAA 4FGWA 4JD5A 1K3FA 1RRKA 2W0SA 3GEMA 4F5DA 1EM8B 4PRZA 3TAUA 4UU8A 2VF8A 3CUWA 5FCDA 3TI7A 2J33A 1U7OA 4YRMA 5DV9A 1C7ZA 3P52A 1M8GA 4RJKA 2D0IA 4UDYX 2ZSDA 3UTDA 2XY4A 1ZH2A 3VBEA 2RH5A 5BRJA 1RYNA 3FSRA 2H0RA 1IJEA 1ZH8A 5ELMA 2OC4A 2CVQA 3JZDA 3ITEA 4AECA 1IJFA 1E63A 3OA2A 3H13A 1NURA 1TKBA 3AG5A 3AVPA 1GNRA 4HSEA 3V8VA 5I48A 2V7GA 2PXHA 2ZAGA 5IASA 1UEXC 3C5VA 3WL7A 1V1MA 4Z0NA 4CLOB 2A78A 5F4ZA 4WH0A 3E9QA 3SC4A 4PO9A 5KI6A 1NUHA 4IZ6A 4R7ZA 4LRWA 1FNBA 1GNLA 3KT0A 1AKVA 1N2EA 3OCCA 2D1SA 1RZRD 5B37A 3P4XA 2H5LA 2XGGA 3OZGA 4U39A 1J06A 2FMXA 1IU9A 3KKNA 1JQDA 3DLCA 1TVKA 2PTGA 3EG9A 2EFEB 1QTNA 3L8GA 5ULLA 3E84A 1G7CA 3G0HA 1M3SA 1UQRA 3MGBA 3PGA1 4YUWA 2GZ3A 2R8OA 3A11A 3OO1A 3U7FB 2GH1A 3EC2A 3TAHA 3WHIA 2QDKA 4MEJA 5K99A 4Y2PA 1JMKC 4BX9A 3I8OA 2ZM5A 1IL0A 5KJEA 1U0FA 1E3TA 4FPXA 1D9XA 2ODEA 3BJMA 4EGCB 4LQDA 2J41A 4JT4A 4EPWA 3KXIA 3C8MA 5LP6B 1N2CE 1I5EA 1QTRA 3I6QA 2FPIB 2PD3A 4KE8A 4FQ8A 2A5YB 4ZOLA 3RRYA 2Y1FA 3P0FA 1V48A 3CZ9A 4MV0A 1GEEA 2IYFA 4RHFA 5C4GB 3H5IA 4MVJE 3Q12A 4QGHA 2JC3A 3QQPA 1JN0A 4QWWA 2PGDA 4FKMA 4UEKA 3BS4A 3HJGA 4BO1A 4HX2A 3T7EA 4H1WA 4BNZA 3FNFA 4MDYA 4OQXA 2D7DA 3CCFA 3VISA 4CMEC 3ZYZA 3D8RA 2O6LA 1CVRA 1JT2A 1XLWA 4K05A 3KQHA 5HP4A 4MYSA 1VC2A 3SBOA 2C2GA 3ZU6A 1YE3A 1BFUA 2X0KA 3B70A 4RGYA 3THXB 4BHTA 1DEHA 1SCQA 2B5VA 2Y1GA 4CQNA 3HQ4O 3AF5A 7YASA 3IXMA 2DHEA 3S5UA 3T1YB 3TAXA 1ZHFA 4O4IB 1E66A 3SE7A 3DDZX 4JSYA 3VMMA 1CVLA 1GV0A 5FJJA 1M75A 3ETEA 3VQTA 1N75A 1TECE 4DMCA 2ZKLA 2YUIA 1BU8A 1K98A 1M1XB 1UAAA 1V2HE 4NZYA 2ERXA 2PH3A 1KDRA 1XTPA 3OQVA 2YWDA 1RJFA 1K97A 2OAEA 4IY1A 4KRFA 1ZA2A 3KKQA 4F9FA 4MA4A 2R60A 3OMWA 3E53A 5IN5A 1LLFA 1NJFA 1Y0BA 4MPPA 2AC2A 4FVTA 2G7MC 1TC1A 2ZYTX 2UVPB 1XBTA 1JKFA 4QT4A 2E3JA 4U6QA 1ENPA 3DFIA 3P96A 5A6SA 4HQKA 4QQRA 3AHEA 1TE2A 2AZMA 2LKCA 5TQ0B 5JSZA 3ZY6A 1YCHA 1MB4A 2E4WA 3GPCA 4QHTA 1U7TA 3LP8A 4WHMA 3WSTA 4V1CA 4GOOD 3TNDA 2PV7A 3TR5A 1V16A 5A05A 4BBZA 4AMZA 4RSMA 1MOPA 5DXAA 3DVSX 1C41A 3B6IA 2K2WA 4XCQA 3U40A 2ZVQX 4WCFC 3TLBA 1I4OA 3MJTA 4HB4A 1FTNA 1YHZA 3ORRA 4EF6A 3H2HA 4JP8A 1QQ7A 3QNMA 1AS0A 3QHPA 1V3VA 2GARA 3G8BA 2B4RO 1F38A 2C00A 3NQ41 1H0HA 3VUEA 3WTBA 1XVLA 5C4IA 1R3UA 4LOAA 4Y6OA 4QTUB 4YMSA 2D4AA 2IPNA 1QLHA 3B7GA 1HZZA 3I32A 3NEJA 4UC0A 2I8AA 4D42A 4DJJA 1HR0B 5I7VA 3IUMA 4DXHA 1XOIA 2QV0A 5CUQA 5EJIA 1AU9A 2HFJA 4FD2A 2QUJA 5GAJA 3L6DA 4J43A 4EOGA 4OFZA 3DTTA 4AO8A 5F76A 3QY9A 2QJFA 2V8OA 4AFNA 1F6WA 1P2SA 3F6BX 1IRXA 1E8NA 2GM9A 2JJ1A 1JU9A 3AI7A 1VYHA 1L5SA 3GUYA 1UPXA 4DVGA 3GDWA 3L40A 2GYYA 1KEZA 2FK7A 3CR3C 4ONEA 5C8YF 5JBIA 3A1WA 3QKIA 4ZI3A 2R7MA 4RF5A 2PWPA 4N5DA 1A82A 1E4EB 1I80A 1QBGA 1RR6A 2X15A 1SUWA 3FPKA 3CO5A 3KEFA 2FH5B 5DTJA 3BSYA 3CRZA 1NWCA 3FHLA 3HUUA 4IKPA 3UMBA 2QHXA 4CDRA 3ERCA 1R8YA 4R2JA 2VI5A 1F7UA 2FEAA 2Z8YM 1Y89A 4I4TA 4LZWA 3B38A 4Q12A 3OY2A 5DX0A 4WERA 3WWCA 5FTJA 4J94A 4LJ8A 4L22A 4RVFA 1J20A 3U4MA 1JPUA 1PR2A 3EAFA 1H2EA 3QVGA 4JLJA 3AHCA 1F2TB 5CHEA 1KTVA 4ZT3A 1A27A 5FUXA 2H4YA 3U4CA 2ZS7A 4Z9YA 4BUCA 4CT4B 4DNOA 3OF3A 2W7TA 3BH0A 3EW9A 4KOEC 1ZONA 1VPWA 1P7VA 3CXUA 3NWPA 4AZ3A 1RS0A 4U7PB 3S2IA 1BKSB 2Z6VA 3OE7D 4ECEA 2PDAA 3RSCA 5JD6A 2WW8A 4N76A 1NYTA 2HA4A 2BW0A 3HGMA 4K9QA 1YTUA 1V4NA 1CUJA 1PFGA 1V4VA 4LDPA 4ND6A 2INGX 1ULZA 2X3UA 3LTEA 3KG2A 4BRSA 4CM4B 1XQXA 3EIEA 5HGXA 5LB4A 5KCMA 4H7KA 3V32A 1O54A 3MS4A 4W1QA 4RMNA 4RK0A 3LOUA 4UCWA 1Z7EA 4G5HA 3Q8WA 4KGVA 3RKSA 2XUGA 4JUCA 4DJDC 3B1WA 4Z4IA 1X1EA 2GEFA 2YBDA 3MJ4A 4WLUA 2BEVA 4O08A 5AJVB 1RJ9A 4YXFA 3PFIA 5CM9C 5TMPA 1P45A 2CL5A 3HCRA 4HAIA 4XB6B 4A0FA 1I7SB 3DEZA 3F9IA 1C9NA 1YONA 2AG0A 3I5MA 5EPEA 2GRJA 3QKUA 4U9UA 3GFOA 7REQA 1PN3A 4GOXA 1L7DA 2FPXA 1N0VC 4MVYA 5DTIA 1K89A 2PUEA 1DO8A 5HJ5A 1UANA 2O3UA 1T4DA 4WASA 4QYXA 3L9XA 1UC9A 1C4XA 2E37A 2W71A 5G1NA 5KU1A 4X97A 1MABA 2PBZA 1TYEB 3OWOA 5B4VA 3I9JA 2G6TA 1Y7HA 1J0BA 3BRCA 4DF3A 2NZ8A 1TJYA 3UJHA 721PA 1L5YA 3PVSA 1GDDA 4MXDA 5EFOA 3ZYCA 1YZYA 4G1EB 3A58B 2E82A 4DDMA 5MN6A 3LQQA 3OTWA 2JBHA 4TLLB 3SF8A 1D09A 4Z6KA 3DMFA 3G2JA 1W5EA 5GM1A 3A0UA 1YZQA 1PQUA 3SNKA 2YWBA 1I6LA 1UXJA 4V0SA 1RJWA 4FE4A 1OY1A 2J31A 2XEDA 3BM5A 4L0CA 4PYMA 1N9GA 1U1FA 1H4VB 3K9CA 4OAOA 5JNWA 1E4YA 3ZXUB 2X13A 2EEZA 4HH1A 4L2IA 4UHKA 5C3UA 3LT0A 3LUGA 5EZYB 3J80A 1LNSA 1TTHA 1EVQA 5EERA 4RHXA 5CDSA 3LCUA 2NADA 5BV1A 4BIMA 3KB8A 4OEHA 1T2FA 1PAUA 4FSDA 3WK7A 2IXEA 4QU9A 2J5BA 4YT8A 3PF8A 4YAWA 2OQRA 1LX7A 3CLTC 5EWLB 3PNQA 2H1RA 3UJ3X 1VPLA 5FOVA 2Y2UA 1JHUA 3SZOA 3GLTA 5CIQA 1R74A 3IQIX 3PQDA 3P4YA 1SXJD 1NBEA 4JR2A 4KFUA 4D02A 3PC8A 3WNQA 4F5YA 1SK8A 1ISJA 3C98A 1Q12A 3FTCA 3VKWA 4IWYA 3D0RA 3GYBA 4C20A 2C5HA 3BL5A 4LAFA 4JLAA 1AOXA 5GONA 1Q3TA 2BFOA 3PA6A 4QX6A 3M3HA 4PHHA 4JJFA 2Q07A 3H11B 1S2OA 1OVGA 1XZGA 1P73A 2C5GA 4S24A 3RKUA 2EKDA 2B2XA 5F12A 4Y6SA 3QF7A 3V7UA 4RH0A 3VVLA 2HMTA 4AW9A 1QZTA 4RA9A 1I3NA 1NONA 3SZRA 2ZRGA 3BREA 3H99A 4UDNA 3SYNA 3O92A 4HEJA 2HAEA 2PTHA 2WFZA 3IBTA 3QFCA 5AOAA 2VDOB 1BYIA 2WA1A 1QONA 3CWCA 4PC2A 3NHAA 4LJ7A 1GCGA 3FDFA 1GY8A 1JDBC 4W63A 1W5BA 2J8ZA 2VNJA 3EXFB 2OBYA 1MQSA 4KN5A 1MGPA 4K9LA 1BFKA 1J99A 2GAOA 3CA8A 5DHAA 1YIOA 2OENG 5EP3A 3VR2D 2WLTA 2ZSJA 2FFJA 2RFLA 3IP9A 1QB8A 5JCJA 2IUEA 4RMIA 5AM0A 3WB9A 1KQOA 4P38A 4ZCTA 1I7PA 3OOSA 5B7QA 1AKNA 1N5KA 1Q21A 2WMOB 2WNIA 5IJ0B 3QWHA 4BQIA 1BXGB 2EKPA 5BR7A 4TMWA 1DS6A 1P81A 4BTLA 2AC4A 1OX5A 1SXIA 3VU9B 4ESHA 3UGJA 2R84A 3N2ZB 3OZUA 2QM7A 1L4YA 5IZ4A 2XCUA 4W1RA 4A6EA 3CLRD 3DNMA 1MTZA 4MLDA 2YV1A 1GITA 1X7GA 3BXZA 3LWDA 4TLEA 4DB2A 2AHOA 4G1BA 1YAJA 4LHZA 5AKZA 4C4AA 3H9QA 4DCJA 4CKYA 2IZ5A 3GGOA 1GKLA 3KV3O 1YR6A 4I55A 1VI2A 2J6CA 2ZTUA 4C4YA 2CLLB 4GQAA 4J16A 2CB9A 1O9HA 4R2KA 1B42A 4D6PA 4GO1A 4DYVA 1XZKA 2O3QA 3TI9A 3RQSA 4YDHB 1HG0A 2WTUA 2DSNA 4IV5A 2I6SA 4JAVC 3CPSA 3ZDEA 4AZ0A 4EG8A 1M7GA 1TKAA 3DZ8A 2RC6A 1TU0A 2DH5A 3CCCA 3R3WA 3R7WB 4B43A 5C7YA 5HBGA 2ON6A 5IC6A 3QNWA 1M1UA 2W6ZA 3BMCA 4HZIA 4LZPA 4F4FA 4AJ9A 1XTJA 2OGTA 2Z6QA 2OK7A 2V5UA 2JEZA 3EZLA 3VHQA 2AZ4A 2AKEA 2HU2A 2VRCA 3LBNA 2H1CA 4RORA 1MW8X 3HR7A 2IC5A 2VP4A 3PI7A 1GZ4A 3OPYB 4URZR 3AILA 2J0UB 1X13A 3ZD6A 1FYVA 2HXSA 2ZUVA 1U8ZA 4ZJPA 4DWJA 2WB4A 3DBIA 3UHJA 3A05A 3ZHTA 3FRHA 2BR5A 4MW2A 3MLEA 3VHXB 2WVHA 4GZ6A 3EPKA 3HVKA 2W6CX 2OWEA 1Y3CE 1T1RA 2XF8A 4MRPA 4X6UA 4ZVOA 3EPLA 4N5NA 1RVV1 3ANXA 4F0JA 5LBIA 3W6PA 3AHJA 4CCWA 5I9TA 1AXEA 1RQNA 4KVZA 4NOLA 3FGPA 3N2KB 4WXMA 5J1SB 5EJ2A 2HV9A 4UE3S 1X87A 1MX1A 1GTVA 2J7PA 3EWNA 2JG3A 3DWGA 3QOFA 4TLDA 2DT8A 4PAWA 4WKOA 1AN9A 4R6WA 2B0CA 2FUCA 4FNAA 5HQ3A 1UINA 3K53A 1KO5A 3BWMA 1E79A 4B0OA 5L4NA 1VM6A 3RGWS 1KY3A 1O87A 3DBRB 4W5OA 2O8BA 2C5LA 3JQ9C 4J07A 1JJAA 4UBLA 2QE7A 2DXIA 2GZDA 2IZ7A 3NYIA 4WCDA 2ZT6A 4PX2A 3C15C 2G1KA 3ZD7A 3M4ZA 1MO3A 2XIJA 5FBZA 1WMFA 3K0AA 1IONA 3EHDA 1E96A 2J0QA 2VTKA 2CDAA 2ZWVA 5EIFA 3WRYA 5KMGA 1NVEA 2FZWA 5EIEA 3T61A 2HIMA 3LOPA 2R8YA 4DCMA 5HCNA 3GJSA 3I04M 2GPAA 2NACA 1Y4SA 3G0BA 2FW6A 4P32A 4HL6A 3NP9A 3GLGA 3ZWBA 1WO8A 3G0CA 4HY3A 2PYIA 4BLSA 1JH9A 1K7CA 2FEXA 3IBGA 3KDSE 3PRYA 1VJ1A 4QDUA 2PSJA 3DAGA 2C0CA 2J6BA 1I3LA 3IEXA 5K6TA 3A6ZA 3LHSA 3GI1A 1X9HA 1BA3A 3K9HA 2GA9A 1EYZA 3D6NB 4JGIA 5B3AA 4XM1A 3BKWA 4TOIA 1E2GA 2WYIA 4BEVA 5ENDA 3GC6A 3W9YA 5CDTA 3WYFA 5IYZA 4LNUB 3W90A 4BJ6A 3R7BA 4U5QA 5E0KB 1Q0HA 1ZGBA 3AI3A 3P8ZA 5FOUA 3ZX5A 3DEAA 4E3WA 2HUNA 3U7GA 1JFSA 1JIUA 1ZMRA 4PZZA 1AGRA 1G16A 1R0BA 3SEZA 3EDRA 1E9SA 3FETA 2CHFA 1VJGA 2CV1A 4BUZA 4XM0A 1D0SA 4Q01A 4I2NA 4MPTA 3QXHA 3U09A 4XQEA 3JTMA 1V3TA 5T67A 3OSUA 2JLVA 2AZTA 2FUG6 4RK4A 1OHHA 4ZT7A 3S8EA 2GVNA 3HNRA 3KSZO 3P97A 4RVHA 5FTNA 5EJ8A 3L93A 3M6AA 3UAVA 4YT4A 1PLKA 1PYOA 1H9AA 3CEMA 3EMBA 5T7BA 1JHOA 5LA6F 3CMCO 4DR5B 1E94E 3G1WA 4JWTA 2NU8B 4ENVA 1OI7A 1PHRA 1VL1A 3IFSA 2RHOA 1V43A 2HWKA 4L75A 5E95A 3JYPA 5E9QA 1H1DA 3VR6H 5JR3A 5BUSA 2ZIVB 3BFXA 1JAIA 2XRMA 3KL4A 4D99A 2ZRFA 4EKGA 3QX9A 5KNDA 1ZSVA 4PO8A 2WZDA 4XEHA 4IIYA 3GVCA 4YCBA 3G0GA 1EE2A 1V5FA 4HZUA 2BFMA 4CQMD 1G3QA 3UXHA 1ZD8A 5CFLA 1VKHA 5BV7A 3Q88A 4Z7JA 1NIJA 3C85A 2YKGA 2AA3A 2PPVA 3TIVA 3TM5A 4RAQA 3L1IA 1WUJS 2BUBA 3IKMB 2NV0A 3LVRE 4JC5A 3THWB 2H9AA 1YZKA 1I1OA 5IKMA 2ZXEA 3K4PA 4M6WB 3ZW9A 2ZXUA 4ISCA 1KSFX 3GGGA 3DMDA 4HQOA 3IA7A 2Z8YA 2VYQA 3L8HA 4LYFA 3VNBA 3Q41A 3M4JA 1EAMA 2O2CA 2XVZA 1NVVQ 1T36B 3GD5A 4H17A 2A7QA 2JIQA 2QVXX 1O95A 3K4HA 1UM9A 3KSRA 1ZM7A 3SD7A 1GSIA 1YASA 2QZSA 2XXBA 1SXJB 3BKXA 4P4SA 3GFRA 4U7GA 3LXMA 1R6UA 2QLLA 3BDIA 3G82C 3LYLA 1XXLA 4GR9A 1X7YA 2Q6LA 5EPOA 3MAAC 1AXGA 3A4TA 4JP2A 4Q3EA 2JDID 2EDCA 4URFA 1WVGA 2BBSA 4U8HA 5JI2E 5IWCA 1F7VA 1JEAA 3ONFA 2VYCA 4QATA 5CA1B 5HUJA 1CF2O 1O97D 2QIPA 821PA 2O6HA 1JH8A 1XVUA 3NDIA 4ILEA 1UXIA 3Q9SA 4MICA 3HFGA 5CCXA 1OFTA 3ZWOA 1UKEA 3BMQA 4QGBA 4MS3B 3OJLA 5JO9A 5JW6A 5DGCA 1MZVA 4DMFA 1SEVA 4L5AA 4M46A 3L4JA 5AR1A 2AYXA 1ACLA 1JIJA 3VSBA 1HFWA 2XT0A 1KRXA 3AMVA 1X8KA 1H93A 2MJLA 1OAOA 3KJGA 3ELDA 2ZTSA 4HTFB 5TQJA 2R6HA 5EKXA 3M6LA 5KSWB 3F5SA 1F2UA 1XZPA 2XOKD 3A6FA 4PSUA 2ZYHA 4N3GA 4Z3KA 3NWJA 1ZQ9A 1K7SN 2LTAA 5KTSA 4HX9A 4MHOA 3SYKA 4W5WA 1LDYA 2YIVX 3K20A 1UBMS 2H1SA 2PT5A 3BOSA 4Y6PA 5KWSA 3TYXA 3PTLA 4MB0A 3N70A 3UBTA 1WABA 4G0XA 4BVKA 5JAOA 1P7CA 2WKPA 1DTWA 3HLYA 3CUEF 5GVRA 3L5KA 4B8YA 5CB8A 2MWMA 1IM8A 3WRXC 4G65A 4MEAA 1KVSA 1XZNA 4ZYVA 3AP1A 1PJRA 4TN1A 3EWAA 2GD0A 2Z1NA 1VDMA 2RAVA 3FR8A 1PDWA 2PS3A 3Q6IA 3WRWA 4ER3A 4RV4A 1CRLA 2IYPA 5GIPE 2Q21A 4IICA 1XB2A 4MV3A 3C7DB 1K0FA 3ZV4A 1JQKA 3E9YA 4HDCA 2VLIA 1Z0KA 4ABYA 4M55A 2BDTA 2OECA 2QQEA 3TL6A 3ZWNA 1X7DA 3TSWA 1FXWF 1TIPA 1GQRA 4C0KA 5C51B 1I0ZA 4OBXA 3D2CA 1R0CA 1L5QA 1E7RA 1LRLA 1C30A 4OATA 3ZJ5A 3COJA 5DP2A 4BNNA 3A3PA 5J2TF 1F14A 1KY5A 2B83A 5ALKA 2R8RA 1VIAA 3IRUA 1X1AA 1XMXA 3OIFA 2ZIZA 2H9IA 2ZYWX 3GY0A 4BNLA 2CDRA 4NPAA 5D3QA 4DQ0A 3ETDA 1J09A 4J9UE 5JNRA 1CRZA 4UPVA 4W8OA 3PV0A 3GFFA 4YJHB 3CX7A 3VZPA 4E70A 1RFGE 1WMAA 2RE8A 2JIZA 1HDYA 4M49A 1CF9A 2IHTA 2BEWA 2PR7A 2UZ3A 1E7YA 3U1VA 3AJ9A 3PWSA 3BF8A 4BVLA 3M5DA 3PYMA 1GR1A 5CW1A 4KBYA 4DRXA 2BFEA 4TVKA 5KC8A 3L7AA 1MEJA 2Z58A 4S0XA 4B4OA 1NAHA 3QJGA 1DIGA 3HN7A 4P3PA 3BHIA 4KFRA 4RQUA 2WE8A 4BECA 1PBTA 3FKQA 4DR6B 2IYSA 1FJXA 3P9ZA 1VYTA 5IVDA 2LCQA 2CY0A 3VZRA 5LOVF 1KYVA 1TW2A 2WKQA 2I3GA 4EYGA 4QDTA 1OIWA 1Q22A 1JFLA 2HCFA 2HK9A 2IDZA 4B7AA 1RHMA 4E5MA 3PX7A 2P9EA 4A0QA 4YP0A 4E7OA 2K7ZA 2HDNB 4BFTA 3JQBA 1YUNA 4MUAA 3WIUA 3WLFA 5AI4A 1KAQA 1RNLA 1JRLA 1PQWA 1T1JA 2XTAA 3BZWA 4HDRB 4JQZA 5FLEX 5DSXA 3V2UA 1R9NA 1Z2CA 1MO2A 2C97A 1ZGJA 4WLFA 1KIMA 2G67A 3DE5X 1SBHA 3HGQA 2IKSA 3LPLA 1BS2A 4Y6GB 3FPJA 3NHZA 5ALZA 3W4IA 5FBRB 3LRTA 1B8OA 3QPVA 3ZCRA 4BC1A 2RGBA 3LHKA 3O8QA 3OWHA 3Q6MA 4DMGA 3LWBA 2HK8A 4EBBA 1R4ZA 1K8YB 1NF9A 1U1GA 1ZYUA 3Q15C 5E6RB 3NRBA 3QY0A 3D7RA 4BLRA 1GAWA 1QIDA 2XMGA 5AXBA 5JFGA 3FTFA 3RIHA 5KJ1A 1C1HA 4BZWA 4FDMA 5ICGA 3VKHA 3IQFA 4M8LA 4LV8B 1EWVA 4FOOA 5CT4A 5JEEA 4BNDA 3FZQA 5JZOA 2C07A 2P41A 3ZKWA 1OFIA 4MUHA 4EYOA 1IBCA 4W6QA 2D62A 5HJ2A 1KPIA 2JAHA 3K9LA 4MGYR 1RBZA 5AI9A 3SQMA 3C3DA 3TQIA 2GUWA 5JALA 3E2MA 4WZBA 2OFPA 4GOJA 5CT5A 4CN8A 3ZHYA 2B21A 1M34B 1F51E 1U3TA 3HDYA 3V8EA 5AW1A 1H0RA 4QHYA 5K2OA 3ULKA 2N42A 4G01B 5L95A 1BHO1 2VDRB 1XPOA 2C20A 3GMSA 3KWLA 2ID9A 3MCVA 1C5KA 3G8DA 1TIBA 1CR4A 5K6AA 1M33A 2YZKA 3CUTA 3OBIA 2EFGA 3CVUA 3S28A 3AJDA 1LPAB 5IJAA 2ZLBA 4N8DA 3UMFA 3NH6A 1YB6A 3HCAA 2QYTA 4MYHA 2XWBF 1M1YA 4RD2A 4W9NC 1G2IA 1JEDA 5DNUA 5A1TA 4ZQFA 1RD4A 3VU3A 4DA7A 4JLVA 3AB3A 5KHLB 3JQ8A 1GTSA 2XZLA 2C4KA 3ZK9A 3FHJA 1H2FA 2JLRA 1FYFA 2F9MA 3ZDYB 1U94A 4FHCA 4DV5B 4F4CA 2JEOA 3AKEA 4OHBA 3H8VA 3JAKB 4IOJA 2PV0A 3LVFO 3JAWA 3SI7A 2D0OB 4QGGA 3KZXA 1VHWA 3MAGA 4NZNA 1YDHA 3NM5A 4EZIA 5B30A 2VT7A 4GX2A 4C08A 2IYVA 5ADVA 1Y1RA 1TAHA 1RPAA 1MC8A 1QTIA 4WNCA 4CQMB 2J67A 3I61A 2IBTA 3R5FA 3A3KA 3FYHA 3SGLA 2E4UA 3HI4A 5AHXA 1DIHA 3LLCA 3Q2OA 1K7EB 5JIBA 3TM4A 1N5JA 1DKOA 5JRDS 4Y9SA 4FEEA 4O2BF 4TRNA 1O4WA 3DOFA 1V8DA 4RM2A 4Y9UA 3KFLA 4FZ3A 1O3YA 1Q91A 2X9GA 3MCTA 4C1BA 1S3SA 4GSLA 3FB4A 1YIDA 2B1QA 3P9XA 1Z34A 1T0IA 3CUUA 1GG5A 2QAIA 1T4BA 2JFZA 3CW8X 3JD3A 4M9QA 3GN1A 2L82A 5EMHA 3UCEA 1MPXA 5IZCA 4EVSA 1UZMA 2P30A 1IEVA 2XSZD 2BRUC 5CVTA 1H1TA 3RG2A 1VL6A 3O2QB 2B78A 1H65A 2XRFA 4IIJB 3NALA 4HV4A 2YRWA 3BDAA 3FYUB 2I5PO 3I04A 1WXWA 4LC0A 3WFJA 2CBXA 3WAKA 3ZCTA 3L0IB 2Q8NA 1D1PA 1MN6A 1TUIA 1JDUA 1JMYA 1YI8A 3NU1A 1OLUB 2CNDA 3EXAA 1L4UA 3FNIA 4KV9A 1PG0A 4LSZA 1WHTB 3RSZA 4TS1A 1N34B 3I1JA 3RAPR 5EJ5A 2H59A 4LJLA 5JNUA 2BMFA 2H1VA 2NX2A 1GSOA 3QXSA 1A5AB 3EC1A 4G84A 3JV7A 3IOYA 5BSWA 4KN8A 4EWLA 2PL9A 3ABRB 2QMQA 4G4GA 4IHJA 4NCJA 4FD3A 4JHLA 4PCAA 5C1BA 4DEVA 5KX5F 4JC8A 2ZFUA 1B43A 3BXFA 4FYMA 3F6EX 2CSUA 4MQEB 4WOPA 3WE7A 4MO2A 1O08A 2I7DA 4XQGA 3T9AA 4RPGA 4HLQB 1SIBE 4P84A 1Z73A 3WLLA 1B16A 4UNQA 3H1PA 2NSLA 3IV7A 5KJCA 2XADA 1QCCA 2RHRA 4GNRA 1L4FA 1XIVA 4V2UA 2BKUA 2ZPUA 1M8PA 1I2ZA 3T3EA 2V97A 2QVGA 4URHA 1L4HA 1LSOA 5IAKA 2C83A 3I0ZA 2N3ZA 3QBJA 4BNXA 1APBA 1E3MA 1RKQA 1S8FA 1JAYA 2BM0A 3C6MA 3RT9A 1ARZA 2VIIA 1C9KA 3Q9LA 1PR6A 4H08A 5A3JA 1M0WA 1EX7A 1IFXA 2IDJA 3JR3A 2FB9A 2HSJA 3AC0A 3ORSA 4C14A 2DBYA 4NYJQ 1DJOA 4V38A 1RHQA 3PITA 1QX4A 1AUOA 2YXEA 3WV4A 3AFNA 3B1YA 4WL0A 3DOEA 1NI4A 4POAA 4MVJI 4QICA 3DVAA 3RANA 1C8BA 4CG1A 3PXDA 3HZOA 2EX4A 2X5NA 4HAVA 5EIXA 1G8GA 3H84A 5FOWA 2EGHA 3O31A 5KAPA 3LDGA 4PG6A 1BN6A 4G8BA 1DGQA 3S8MA 3VH4A 1ATZA 3IBCA 4D3FA 4B74A 3TKYA 3VR3A 3JQAA 2XQIA 5FI1B 4L72A 3C5HA 2QG9A 1OFVA 2LGJA 3WO0A 4QL3A 4ZYXA 2JZCA 1A9XB 1W9HA 1HDOA 3AEYA 4OXXA 2ZWIA 3DTNA 4GRIA 4KDFA 5JBQA 1FMLA 1X7XB 1QR6A 1Y1KE 3VJRA 2D1FA 3PC7A 2RD2A 1VCIA 1UBJS 3KCQA 5BWOA 1VBKA 4L4SA 4LJYA 2G1AA 3SJ7A 2RBKA 2PXCA 3RVSA 3LX8A 1HUQA 2ZZNA 1DUIA 1BRMA 1RM5A 4XWKA 1SRRA 1OXMA 3RS4A 2FRDC 5IPFA 2MR5A 3ORYA 2JCSA 2FLVA 2NSJA 4PNPA 4C3OB 3ZN2A 3U61B 1FF9A 2PRZA 5DCWA 2B8WA 5FWDA 2P4EA 1ZL2A 2Y1DA 3PWTA 2Q9CA 3V4OA 4MAAA 1ZFNA 2PU7A 4KWCA 4E5DA 3V1YA 5C3MA 4RTKA 1LWOA 3N6XA 2QJRA 4BMSA 3EZGA 4WVLA 4C2UA 5HF6A 5HKKD 3JZIA 2Q1TA 3F2IA 1ZM3A 4BQSA 3M3DA 3KT6A 1CZHA 1ZRSA 3DKIA 3GRCA 1SOWA 4EI9A 3FTNA 3SNHA 2VH2A 1WUHS 1KEUA 3HCNA 3ZY2A 3F4KA 4X95A 4BY9E 5IRCD 3GU3A 4GI7A 1ZUIA 1M6YA 1OZ0A 4EPRA 3QWBA 1U2RA 3EISA 4FM9A 3RYCA 4NCHA 5BWNA 4NWIA 4ZQBA 2DY0A 4BXOA 4KXNA 4RXTA 3KO8A 4BJHB 4G23A 1YJBA 1CBUA 2YN0A 1ZIYA 2D1TA 2GNAA 3IT3A 3CLUD 1HEYA 1LK5A 4C7OA 3P2KA 4QUGA 4CM1A 1R0LA 3D3NA 5F7XA 1N6KA 4KLNA 4HMQA 3W8NA 2AHRA 2DFPA 1PZFA 2GPJA 3D4NA 3QM1A 4D9KA 4DV6B 3C0KA 1GA6A 1GNPA 1GPLA 3WK5A 2GHQA 4JKIA 4QODA 4FWBA 3ZDZB 4KFCA 2ZIXA 4J75A 1G3UA 3ESYA 5TF0A 4Z4CA 5KTRA 5MN5A 4IRUB 4GSYA 4G86A 2EP8A 5TS2A 1JVSA 5G02A 5JXIA 4YJ2F 4RIEA 2V3VA 5EGSA 1J6UA 1SC1A 2JJMA 2VTDA 1PV4A 1L5ZA 1Z6QA 5A4FS 3ED5A 2GETA 3IPCA 4NZPA 2Q29A 4CODB 4Q7KA 1IN7A 4Q4JA 4PZ0A 4GE0A 3G7UA 2NSHA 3MRVA 5AKGA 4I81A 3IMKA 3HCWA 3VYTB 3SS7X 3H2ZA 1U9YA 2VZEA 3FYDA 4KLAA 4WI1A 1TNDA 5HIMA 1RZ3A 3JRNA 5IP5A 3LA8A 3D3QA 5FQOA 3MQ2A 3HE3A 1JXQA 1LGYA 3RYIB 2P2SA 3AUYA 4L8VA 2F1HA 2JA1A 5FAXA 1RM3A 5FPYA 1K06A 2WKRA 2PH7A 2PYZA 3AO0B 1SM4A 2Y05A 1ZNXA 3Q40A 4PXSA 2VNAA 2ZQYA 3EXEA 1N3LA 5IN4A 3JY6A 4WGGA 4MV8A 5LU8A 3F73A 1T1SA 1XYGA 1A2OA 4NU5A 4C07A 1J21A 2C5FA 3V4RA 2VJQA 1XUOA 4MWZA 2X9NA 3TCNA 4F4DA 3NVAA 3KVNA 2JNWA 2Y2VA 3AETB 4R9VA 4P5DA 3MRSA 4L8LA 3IUNA 1ZBDA 4U9IS 4UHDA 4BIIA 1XTTA 2RSLA 4LYDA 2FWRA 5MFPA 5FPHA 3KSBC 5A0VA 2IEYA 3BG5A 3IAEA 4TUYF 4X7PA 3S27A 3WAJA 1HDZA 4ZXFA 4FCWA 3HHEA 4H4EA 2IF2A 3GXBA 3LZ6A 1SG9A 2IYYA 4N5IX 5EAIA 1ZK3A 2XKBA 3H1BA 2G5GX 3MWKA 1SKYE 4L76A 4QPZA 1RBQA 3JATA 4QU5A 1VL0A 2C3MA 2H0QA 4I9GA 4XVRA 2EJCA 5FADA 1SHZA 2H5IA 4P1ZA 3VZSA 2V59A 4AJIA 4BBAA 1QB7A 4HS4A 4EUSA 3EZNA 4IXMA 1QVVA 2CZGA 5IVIA 4OI0A 5EIOA 5REQB 3AFIA 3GHHA 3PGKA 1RBYA 5EUBA 1DWOA 3IQWA 3UHFA 1WBDA 1XVAA 4LY0A 1C1XA 1IC6A 5K4HA 2G71A 2Z3ZA 2A30A 1HTWA 2CVPA 1Y33E 1NSTA 3AVXA 2RHMA 2XF2A 2X3FA 2Z9CA 1V26A 2FLWA 1NVMB 5CIYA 3H5LA 3KYDB 1KAEA 4AZSA 2FG6C 1H94A 1DC6A 2JLZA 1JXMA 1G55A 4WXYB 2PK3A 4DB4A 1Y7IA 4OYHA 3FWHA 1EFVB 2Q9BA 3OETA 2YWFA 3KB2A 1FNSA 1UKZA 1Z45A 1QE5A 3ILHA 3UMMA 4ZC1A 3LGAA 4KQJA 1BMQA 3UWOA 4J3NA 5AVTA 4IH4A 1UR5A 3FYTA 1PQ4A 4AZVA 4BEJA 4LZOA 1SVWA 5D5HA 2QRJA 4PZEA 3DV0A 4ITUA 4Z3OA 5CG2A 1G2PA 1VTKA 2NU7B 3BRWA 4IRMA 1E0SA 2VHQA 2DFDA 1GZVA 1GCIA 3FUVA 1SUIA 2X76A 1XDSA 4K9OA 3AR5A 4C4OA 3N7AA 4DMUB 2PJZA 4EELA 3RVDA 2FR1A 4PPQA 4ALMA 5IU6A 2EYQA 2C29D 4FFBB 4MYUA 4CCYB 4ZT5A 3RUDA 3DD1A 2BFCB 3D4PA 3K96A 4KQKA 4RH1A 4MGHA 4P7GA 4B7XA 4ZP1A 2CL0X 4JI2B 5ARDA 4N0EA 3K30A 1ORDA 1EQUA 1AQLA 3Q98A 3U7QA 1U0SY 1O77A 3B12A 3ZV3A 3IEPA 4E1VA 1I2BA 3FHCB 4E6EA 1V35A 2Q3FA 4A15A 1MC1A 4JH0A 1XN1A 4CFZA 1W25A 3H75A 3WQHA 3PDIB 4OMDA 1VSBA 1H2XA 1NRJB 2V6BA 1P3JA 2YVLA 4WY5A 1EFAA 3GPBA 1NLZA 4V39A 2XNJA 4CLOA 4N48A 5ALJA 4QNNA 2ZIAA 4MV9A 1HM5A 3SVTA 4LVCA 4TTSA 4GGOA 3PB3A 1KEEB 4NY1A 6NULA 2HXYA 4UTNA 3E9NA 2SCUA 2CMKA 2X0DA 2QU7A 2F3TA 3IALA 2N1BA 2VAWA 3STYA 2KBEA 4IFBA 2B1IA 3W8DA 3WX0A 5GADl 3H0EA 1W5AA 1KQGA 1H0KA 4ZODA 1BMTA 1DJQA 5KSPA 2YIDA 2NN3C 4BB6A 2Z2XA 1T9GS 2EKQA 5IK2A 3AR9A 1DO0A 4JEHA 4FZVA 5C8XA 4GT1A 5EG5A 3B7PA 3PE4A 3NBUA 1GFIA 1TMKA 2CHEA 2GS9A 3QYFA 4QPNA 1D2GA 2XMDA 3R7SA 1NFQA 4UATA 3B51X 4D0RA 4D79A 1OH8A 4B87A 2EU8A 4PTYA 1A8SA 3VZQA 5MGNA 1IK4A 5FBHA 1HPLA 3PIDA 1IMJA 3BTVA 5FPQA 3HNOA 1KKLA 2VPIA 2QD4A 5KJFA 5LP6A 2Q5FA 3EAQA 4FT4A 1Z7GA 2FPIA 3C7AA 2ID4A 5HYVA 1JNYA 2R25B 4KG7A 5AM2A 3JYLA 4RCZA 3QNUA 5IHPA 1YXMA 1Y7LA 3VPGA 2XUDA 5B57C 3K6JA 3JVDA 4H0NA 1L7MA 4PRLA 1OFGA 2YMLA 1EFCA 3KZCA 1L8XA 4Q3BA 5EJAA 2IHZA 3GUUA 1KGDA 3W5JA 1EMDA 2X5KO 3O83A 5HIKA 1HT2E 5EP2A 1NSYA 4F6RB 3S6JA 2B8NA 4I4CA 2J48A 4D3SA 3SSMA 1HRDA 1IVNA 1IULA 1CR1A 2EW1A 2PRYA 3UH0A 4JXZA 5ALMA 1JI0A 3L7KA 3TBKA 3EIXA 1SWVA 5I7OA 1A9PA 3P9CA 1R15A 2LP4Y 1DFIA 3DOJA 4KV7A 3MCZA 1FL9A 2NPOA 3A37A 5KTPA 2DQSA 4OQFA 3LLUA 1OPXA 1VB5A 2PXAA 5ALFA 2BGWA 4O4IA 3SG0A 1LVUA 2PU5A 4L15A 4WTOA 4G5XA 2BJWA 5CLGA 4F8YA 3KTDA 4WEOA 4X91A 2JASA 3S40A 2PKQO 4Q02A 2FU5C 2H92A 3FPAA 2R7AA 3IE2A 4NJMB 2XUIA 4GXNA 1YZHA 1P4AA 3CSDA 2WM9B 4G24A 1C0KA 1H9BA 3GRVA 1PS9A 3DT8A 3GIWA 3EXIA 3K09A 2FWNA 3KVVA 2FPLA 2DPHA 3DE1X 4EM6A 5IS2A 3TR0A 1U31A 1MA0A 3NIBA 3DW1X 1X1SA 2CMHA 3UT0A 2ETXA 3ZDBA 1JR3A 4OGWA 4UOZA 2XYQA 5EVJA 3ZE9A 5LIRA 1G9TA 5KYTA 1X3LA 3ZHUA 4DG5A 3L4BA 4RY9A 3T9BA 1NC1A 5L7TA 1W0CA 4IV0A 1SBTA 3UK2A 3O26A 3OTGA 3A1EA 3BQ9A 3AU8A 3GNLA 1BXKA 3NTVA 4TL8A 4UAVA 5ALVA 2IBMA 1CNMA 1IE3A 2CFCA 3GR6A 3O8DA 4I2VA 4MGZR 4P33A 4EY8A 5HJ7A 4XWWA 1Q0LA 2PZLA 3ZWCA 4BYMA 5J40A 3DOCA 2GZSA 1QRRA 1FNMA 5HUHA 1RI4A 2C88A 3Q72A 2VF2A 3ETGA 3KKLA 1N8KA 2CWWA 4FMDB 1EFDN 1S7CA 4RZIA 5DNVA 2IU3A 4Z0HO 4MP6A 5ITWA 3DMHA 1E7QA 1RHRA 1UDXA 2ZJ0A 2BE9A 3ONDA 1R4NA 4IGFA 3FLBA 5CD9A 4LF7B 3ENKA 4LXUA 3QPAA 1E3LA 3D7KA 3VH2A 1GUAA 2HD4A 1NJ1A 1Y5LA 2ILVA 3NCTA 3EPJA 2J0SA 1NXWA 1W2WB 1RLTA 4OOEA 1B6GA 2CLCX 2MR6A 4JUBA 3OM1A 4MJ7A 3TPCA 7ADHA 2WA2A 1SOVA 1JPJA 3E61A 5EINA 4E13A 4GI5A 4UASA 3G5UA 4FE3A 2XWQA 1SKQA 3TVTA 2PUCA 5AH0A 1ECLA 2AMJA 2HN9A 3DMRA 3K4QA 3OEWA 3R7AA 2SKEA 1V7CA 4KAAA 4QOHA 1YNOA 4BNWA 3TRKA 4WBSA 2BMEA 1HE1C 2WUFA 4BNMA 5LYJF 4JEIA 1NN3A 3G7SA 2HBQA 1PT5A 1WL8A 3OKAA 2I3AA 4U5XA 1M5UA 1XTKA 1UKAA 1E4EA 4JOQA 1JJVA 3IKTA 3ACBA 2YHUA 3R0VA 4DOMA 1XRQA 1FXUA 2QMHA 2VVTA 3FNRA 1ODJA 1TF7A 1OBOA 3PS9A 4ZCIA 5AQ1A 2I4MA 5DWDA 3U3RA 3KKPA 1IXZA 1J90A 3BAFA 3VBCA 3O2NA 5KNBH 2TYSB 1E1QD 2BUAA 3O7WA 2KYRA 4H60A 4IDEA 2V58A 3K70C 4XDGA 3M33A 3QF4B 3NR2A 4IXWA 3O8CA 1F2TA 1YU6A 1X2EA 3C7TA 3LPCA 5EMLA 4ZI5A 3SC2B 4F4IA 4LWZA 3HJNA 2P2ZA 2J9YB 3DTVD 4OMCA 4GUDA 3RYFB 3C7KA 1C4WA 3EDYA 5ADWA 1RCUA 2I2CA 3GJYA 4G5OA 2YWCA 4R9SA 3LNCA 3PR2B 1CQWA 3I9V6 4I1OA 5BXQC 2F8SA 1B6SA 2N9UA 3M3PA 5GZ3A 4GZLA 3C8ZA 3W5HA 1R88A 3SLRA 1SXGA 3A6KA 3O74A 5TMBA 4B3JA 4E12A 1PDOA 2YL2A 2BD0A 2Q2VA 2W90A 1QS0A 4CM4A 3WJAA 5ICFA 4RE5A 1GVHA 1E2JA 4H7HA 1U9CA 1KK2A 5DI9A 4V3CA 5AW0A 5JD5A 3B1FA 4KHZA 2F8LA 3DG9A 3FR7A 3LFUA 3RHFA 5JCOC 3IQGX 5CPBA 2VK4A 2H0AA 3N3AC 3KSMA 2C99A 4KKVA 4I6JA 3IP5A 4PAGA 3OX3A 4CM9A 5JAIA 2QU8A 1O94A 1V9SA 2ODWA 2ZRIA 4KC0A 1K66A 5CR9A 4QD3A 5ED4A 5I9SA 3R9WA 5FNVB 1KNQA 1RC1A 2ZJ4A 3B9BA 2BPOA 5EKUA 1PZXA 1E9FA 4R8MA 3KK0A 5KX5B 2W6PA 3L77A 3BRQA 4X7BA 5AICA 1YFJA 1NBMA 1MB3A 2VSQA 2VG8A 4EG5A 5FA5A 2OO5A 1QF7A 4EQ6B 3STUA 4JC4A 3WKAA 4Z4HA 1DQPA 1SVOA 4PLVA 3ICPA 2X8JA 1K8QA 5A1JA 3GW8A 1ZN2A 3HKEB 4HAUA 1S1CA 3K0CA 1U8AA 3CUKA 1TCAA 4N3BA 3COYA 3H2GA 5C5DA 3BSWA 4KO1S 1D4AA 4DR4B 5CT6A 2Z30A 3FUXA 3KVOA 5F1YA 1C14A 5DCYA 1TM5E 2Y0DA 2YRFA 4LE0A 1QGDA 4NH0A 1JU4A 1O2DA 2WTXA 3R3SA 4RJLA 4IS2A 4YAGA 1L5OA 2YXNA 2Z8ZA 3IC5A 5AK6A 3HADA 1J2YA 4BWYA 2I4OA 2R11A 3CF4A 1IZ7A 4ZO9A 5EQFA 3NEPX 3WYGA 5EQTA 3DLBA 2NAPA 4Q24A 1WR8A 2UUAB 1JLRA 3ED1A 4NU0A 4A7PA 4IF4A 4UEJA 1KQNA 2W6JD 1EFLA 3IAFA 4URXR 1FDTA 4FJ2A 4DJ5X 5KTNA 1L9KA 2Q3HA 2IYQA 3LX4A 5EWLA 2GTHA 4MK4A 1PHPA 2ZBGA 5CLQA 4Z5XA 4ON9A 3IJPA 3PLNA 1QYDA 1IPFA 1D5WA 5AVKA 4TWZA 3JQ7A 3PCXA 1RLOA 1AHHA 1RLMA 3N39C 1E2PA 2I6TA 5HDBB 3O3CA 2CNLA 1RXIA 2FR8A 2HRBA 1DVRA 1Y80A 4BCDA 3JQRA 3R5SA 4DCSA 2G09A 3NT5A 4AKSA 1CDZA 1OYYA 2J4DA 3FMFA 2VF5X 1W0KD 2P9BA 1SCBA 4K0RA 4Q37A 3U7RA 1UDWA 1P5RA 1QYXA 3W1EA 4M76B 4HAYA 3VTKA 4IUCS 2ATVA 3M8KA 2HT1A 3PPVA 1QV7A 1TPYA 1HEUA 4TTVA 4CKBB 5ICMA 3KP1A 2IZ6A 2OHGA 1PJLA 3WICA 1Q6ZA 3RS3A 1VG8A 4B6EA 5C53B 3NDBB 3W3AH 5DI3A 4DSZA 4OU5A 1DC7A 2GO7A 3BIOA 1R3DA 1NQWA 4X62B 5L3ZA 2WYWA 3Q7RA 4GM4A 1OC2A 3EQZA 4K6OA 4CQJA 1Y5MA 4M7WA 3W5AA 1Q19A 1XJ5A 2NAFA 2VDNB 2X41A 1WCIA 2ZSAA 3CG0A 4PCLA 4QDZA 3V33A 1U1EA 4HVLA 1AKYA 4LPSA 4MRVA 2HJHA 1K5PA 3ML1A 4XLTA 1Z28A 1DJNA 3DDSA 4I3HA 3T5MA 2FMFA 3EXFA 3OJXA 2XGJA 2W8ZA 4GI1A 3HCPA 3OU2A 3GOQA 3WIDA 1H2WA 4LECA 4B76A 5ILOA 3R9KA 4KDRA 5AYVA 5GINE 3EOBI 3SQWA 3PPIA 4G56A 5JI3E 4YUAA 1OLOA 2HRDA 3MUNA 1TGYA 1N2JA 2R87A 3V1LA 5IJ0A 1TU3A 3DZJA 3Q11A 2HA2A 2DF8A 4WDQA 4ID3A 3HBAA 1NRXA 2YYSA 1GN8A 1KO4A 1Y8QB 4RD1A 3VU9A 1T9ZA 5HA5A 4D4HA 1KVTA 4N3CA 4DTIA 2HA7A 3HI6A 4G2TA 1SKAA 3GVXA 3RU3A 3DMNA 3DZGA 4S2EA 4YRJA 3TNLA 5HKOA 1GLVA 3HO1A 2GCPA 1GGEA 4L9SA 5D2CA 1VCNA 5K8TA 3L0PA 2ZJ6A 1MC5A 4FC7A 4GIBA 3IIMA 4MSUA 4XPIB 1YHNA 5AOVA 1KWKA 4KEAA 5EHZA 2V6IA 3NNSA 1TKCA 2F3SA 2H54A 2YNMC 1LDGA 2YXBA 4PPYA 4Z7NB 3V6MA 2NMVA 5SY9A 2E5LB 3AHIA 3BSSA 5JBNA 2OVBA 1KYZA 4MULA 3WGJA 2OGWA 5FWNA 1H4QA 2YJZA 2ONJA 4BX3A 3R7WA 4C0AC 2IKQA 2W2PA 4DARA 4I50A 4LJAA 3NHJA 4HNVA 2H4HA 1NVGA 5HTOA 5SYNA 1NLYA 2WUDA 4L9RA 2PMWB 3HWX1 2CT8A 3PHLA 1CD5A 1HDRA 1TUGA 3UW1A 4BO5A 1F12A 5JY6A 1NBIA 1FFWA 4EEKA 1EVLA 3P0IA 3O9VA 3T3MB 5BPFA 2AEJA 2J0VA 5JJLA 2IGTA 2V6FA 2J0UA 2Y1XA 4RADA 3D6JA 1HETA 4EF4A 3VM6A 3ZUPA 4B40A 5KNLA 4O4LB 4D8WA 2XV1A 4Q1FA 1NMZA 2ZI7A 3OZDA 5AM5A 3VHXA 3DEIA 4RDCA 2ZTHA 4R8RA 2X6TA 2XYRA 2P9ZA 3F5MA 2QVZX 3ROPA 1MJFA 1XQYA 3EGDA 3FCXA 3NJ8A 3WLQA 1G42A 3HUDA 4ZI7A 2UU9B 3N2KA 1WY5A 1OZAA 1G21B 3EB9A 2W48A 3WK6A 2PT6A 5JRZA 1I7QB 1M2VA 2OHOA 1ONPA 4LN1A 1HL3A 1ISPA 1KC1A 3HCBA 3AVTA 1CY7A 2NQTA 3F6RA 4U6NA 3D54D 2YJNA 2REOA 3T5CA 4CLXA 5AFSA 3TGLA 1ODSA 1UP4A 1IRIA 2OXEA 3QE0A 4KDEA 1O6CA 1THZA 1RI5A 2B7CA 2QR3A 3FVQA 4FTWA 1U1IA 5IBQA 1QG6A 3L84A 3X2FA 4D0NA 5JFTA 1J24A 4DGSA 1F9EA 1T0HB 1IG0A 2ET6A 3C6QA 2UZ0A 3PHJA 4IJ6A 2FSIA 2ISQA 5JH7F 5AESA 4K9MA 1BG6A 3IP3A 4IRXA 4RS4A 3N59A 1JHDA 3ZNOA 5B3JC 1NASA 4TV9B 4JQOA 3G9XA 3S1LA 2H7YA 2JBWA 4HQ6A 5LDDC 1V11B 1I3KA 3ESCA 4KSBA 3IUEA 3FUTA 3HH8A 3PXXA 4PONA 1GO2A 3OQMA 3LXUX 5HIJA 3T54A 3QWFA 3DTVB 3ESRA 2CL7X 4QOEA 4RVNA 4PZPA 5BR4A 1KJIA 3ZQ4A 3OE7A 3DNPA 5FBVB 2GKGA 2IOYA 4FJ0A 3EIHA 1LBSA 1D7AA 1PW5A 2QGFA 3AF4A 2ZG6A 5CDYA 2R7LA 4EVIA 2PHZA 3GLFE 1LF0A 2RBEA 3FFBA 3LQ1A 1EQ2A 3UC5A 2EXXA 3UAXA 1CKEA 3IP6A 3OZAA 2VDWA 4KPEC 3H1EA 2VDQB 5C18A 1W36C 3NC4A 4M9SA 1CZKA 1ULHA 4NPCA 2JGAA 1DT5A 1YI0A 2OXRA 3V9PA 3H3JA 1Z2AA 2BGUA 4AIRA 1U2PA 1QH0A 4YT5A 2FX3A 4LNUA 5AMXA 3STTA 4M22A 1LUAA 4Y2SA 3F4LA 1ZDMA 4UUOA 3B6ZA 2NTVA 3SVZA 2B1JA 2C31A 2J5XA 3NEYA 1T3TA 3VC1A 3VPSA 4IIDA 3L5OA 1EP3B 1Z6XA 2YWEA 5FOSA 2JKZA 2CBZA 2GN9A 3H04A 1QK5A 5TNXA 1GPNA 3DAOA 4MV4A 2HOQA 4F4HA 3KU1A 1ZNWA 4M1KA 4PG4A 3WDSA 4CNBA 4H18A 1HYBA 4IQ8A 2QP4A 4XJVA 4U1RA 1Z0UA 3ZHZA 4DSTA 3K6SB 2WF5A 5BO5A 3L8CA 2NU8A 1IXSB 4KW7A 1W6UA 3VZCA 4QOGA 3RQIA 1PSDA 1U2SA 1HSOA 2NXJA 4KQ1A 4MUBA 2G6BA 2FPGB 4JXKA 3ADDA 3MLAA 4IVPA 3GH1A 1P75A 4W5RA 2G1PA 1P9WA 2AI3A 1DAGA 4P7KA 1YQ9A 2NO9A 2QVYX 3CBGA 3VOAA 2HH9A 3PJRA 4ZCPA 1A8UA 5KQPA 4GPEA 4RU1A 4XRRA 1ISRA 2BM8A 4LWQA 1HE8B 4WUTA 1VG1A 3ZV5A 5JUWA 2PLFA 2WHEA 1R0RE 2DFVA 3BE5A 3D3JA 3V42A 1H6AA 4R1QA 3UQZA 1X1DA 4B6RA 3WQRA 1E3WB 1HL7A 2JH9A 4UNSA 3I72A 3UJBA 4EW6A 1B8NA 2RAPA 3CEHA 5JISA 1HF3A 2A9JA 1W19A 1NV8A 4FMCB 1SUFA 2VXYA 3ILYA 4ZOBA 3RU9A 3WSVA 2B6NA 2RK3A 2JI4A 4M6WA 2AZXA 1WXDA 1ZNQO 4W5TA 3N2IA 2X7JA 1Y81A 3ZZNA 5HE8A 1V8OA 3ICOA 3D6AA 5FL3A 4BWFB 3DHNA 4ENWA 1U6KA 1Y7PA 2GBCA 4IKEA 2AJLI 5EMJA 3NVKI 1SXJA 4QM7A 1F4LA 1WU8A 4OU4A 4P22A 2HRZA 2IPMA 4P7BA 3ZWAA 4EPVA 3U5ZB 4EMSA 4NOJA 1FW8A 5TGZA 2OBBA 4XYLA 4KQ6A 4BNGA 1OH6A 1OYVA 4FOTA 4ZYWA 1ZJZA 5F1OA 1WZEA 1RAHA 1FQJA 4D3ZA 3HWWA 1I4WA 1ESMA 1VIMA 3K2QA 3MQFA 1KOGA 4H27A 2O9JA 3CNQS 1P5FA 4D80A 2YCBA 3OHMA 2RHJA 1OJLA 2FPOA 1COZA 2FOIA 1XU4A 1GNSA 2O52A 2XKJE 4KLRA 5A3SA 5K0EA 1TIKA 1EIWA 1FP2A 1QIGA 4YJ3F 1Q0SA 2QY6A 4IZHA 4MS3A 5EE5B 2AMYA 5L6MB 2PUAA 2CHGA 3G5LA 5I9NA 5IJ9B 1UXKA 2JPDA 1GYPA 1TDJA 1O6ZA 2WU1A 3IQEA 4EHAA 1PD1A 4LDJA 2RCYA 3ETHA 4NQRA 4D25A 3I53A 3FFTA 3FZEA 5JTUA 1JHAA 3MPUA 4YONB 2N75A 4UHBA 3RVRA 4EY5A 3AP2A 5FO0A 3HEMA 1WDKA 5DM70 1ZU5A 4UAGA 3KQYA 3OM8A 1DT3A 4MMXB 3UK1A 1QG4A 4LOHA 4K40A 3VR2A 1KI1A 5CFPA 3X1XA 2J4CA 3RLIA 5DOVA 1J97A 2C82A 3AY7A 3LCRA 1JQAA 4FHFA 3VYSB 4G5QA 1JEYB 9MHTA 1QHYA 1L9XA 2XYHA 4C2TA 1T5OA 4DFDA 2WD9A 2EJVA 5ISMA 2C4WA 3WADA 1JPNA 2GLTA 1NBWB 3W7VA 1E20A 5A4DA 2AR7A 1U7XA 4XGRA 5B6JA 1Y6RA 4AY2A 3LJKA 2XDWA 1IY1A 3A9RA 4QELA 2G7ZA 3MC1A 1JTFA 1RC0A 1GU1A 1A71A 4EI7A 1C4OA 3TVYA 2AEFA 3DA8A 2YFYA 3UWSA 4XGKA 3MFQA 4FUTA 5LQRA 3LBAA 4IL5A 4HGPA 4IDPA 3ZR4B 1E0KA 1L5MA 4RHUA 5DGDA 5JDCC 1YAHA 3L4SO 3HEBA 1ZD9A 3LK6A 4OJYA 3H19A 4GKJB 1SK9A 5TVKA 3DM9B 3DKPA 4HYTA 5FBKA 3WSWA 1EJBA 1FFEA 3CZ5A 3QEMB 4F6LA 4TKVA 3T3NA 1J8MF 2WSSD 1RQ2A 2OY0A 3EWIA 3TNFA 3U2QA 4B3TB 4B4VA 2PMCA 3ICCA 2DECA 3KZMA 3H8JA 5AKHA 5DSTA 3MTIA 5L45A 4A6XA 3ZBPA 2OT3B 5CMLA 4DIMA 3H3FA 3IUSA 4C0JA 4JJGA 4CKZA 3WDMA 1BVYF 2JRCA 1E2NA 1THGA 4EEZA 3R6TA 4J1SA 4IIEA 3LCJA 3AGPA 4XJTA 1MA3A 2IHVA 2WJVA 3B3FA 2E4ZA 4OJKA 4BVHA 3OQBA 1PZMA 1F20A 1VMEA 2JFFA 5KDOA 4M9UA 3IR6A 5F3RA 4RGVA 1R2QA 1XVTA 1XZJA 5G40A 1JFTA 4U63A 4QVKA 2WK1A 1A0OA 2NUTB 4IUYA 4FUQA 2XE7A 1Z0SA 2O3JA 4ZOLF 3RNOA 3HACA 2JVJA 2IUTA 3CT6A 1KR5A 4IMJB 4RJTA 1UBFA 5GGXA 5JQGA 4R31A 5JG7A 3F5DA 5BVHB 2EZ8A 5AJWA 1I7DA 3AR3A 1E2LA 4RYDA 1RYDA 2PGXA 3B1JA 4N5HX 4ZOQI 5C8VA 2ZB2A 3WB0A 3UKOA 4FGUA 1KHHA 2GVZC 3MT0A 4YX9A 2BSAA 1KPGA 5FPPA 1S9DA 1WHSA 2VT3A 4RPLA 2GBFA 3FCCA 4HDRA 1QZXA 4J1TA 4ZTBA 3K9BA 5IAOA 2WBLC 3L4EA 3DO5A 3NTRA 2XA2A 4MINA 3AV0B 3WJ1A 5KTKA 4LJ4A 1B6TA 2WF8A 4KGZA 2IVFA 2JK1A 2TSYB 4FMBB 4S35A 3WLNA 2ZU0C 3AI2A 2C8VA 2HGSA 2ZI9A 4KQIA 3PQFA 4EFNA 1AQYA 4MKXA 5F7ZA 4NV0A 4RANA 3AUUA 5CH5A 4MAFA 2WWTA 5E6RA 2A3NA 1J1IA 1N4AA 4B84A 4GWKA 4FOPA 5KQRA 3G2HA 2YHAA 4LC9A 2C2BA 5MF6A 4BPBA 2BLNA 2QAGA 3UJ7A 4C2BA 1PR4A 2W6ID 2QW0X 2OM2A 4QUIA 1MRNA 3L49A 5BP7A 1U8FO 2JLCA 3U13A 4RDHA 4NFHA 1A9SA 5DVZA 3NC1C 2HMUA 2OORC 4NV3A 4B9AA 2AG8A 1WB9A 1XTSA 1SJ9A 3GLKA 1AC5A 2OV2A 2WWHA 3W06A 2BSQA 3ZKAA 2H2GA 4IDFA 1QHFA 2IF0A 1L5RA 4MVXA 5DWVA 2OEPA 3GRUA 3TFOA 2FJ0A 3JQQA 1P77A 1M34A 4IIXA 3K9GA 4LF8B 1Z5UA 1EFRD 2IXBA 2FN3A 5HZHA 1NVUQ 4QPCA 1DEXA 3F97A 2HPAA 3KVRA 2WVJA 1FZTA 2FZKA 4WAUA 4TLCA 2H2AA 2Z6UA 3UAZA 4E7PA 1UBHS 2FZ4A 3LPNA 1DPGA 4EL0A 1BGVA 2G07A 5A2QA 2Q1XA 3GEHA 2GEKA 4MTCA 1PFUA 2AVDA 4Z49A 5KNCH 5LJL