3V4OA

Human malt1 (caspase domain) in complex with an irreversible peptidic inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
234
structure length
234
Chain Sequence
b'DQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 87
structure length 234
sequence length 234
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4oA00
2H5JA 1SHLA 2K7ZA 4PS1A 4EHKA 4EHNA 2H5IA 4PS0A 4EJFA 4D3YA 4NBKA 2XZTA 2Y1LA 2HBQA 1M72A 4JJ8A 3SIRA 4DCPA 5IABA 3V4LA 3R7BA 1PAUA 4HQ0A 3UO8B 2C2OA 3IBFA 4N7JA 3V6LA 2CJXA 3GJQA 4JR2A 1K88A 3NS7A 3QNWA 1I3OA 1RHJA 2HBZA 4QULA 1I4OA 4JR1A 4FEAA 2QLJA 4EHDA 2CNLA 2XYHA 2CNOA 3R6GA 1RHUA 2CNNA 4HQRA 1SC1A 4AWAA 1BMQA 5IASA 5LU9A 4IEFB 3R5KA 4EHLA 4DCJA 4QU8A 4QUEA 4IYRA 3EDQA 5IC6A 4QTYA 5IC4A 4JJEA 2C2MA 3H1PA 3V3KA 3PCXA 5IBPA 2QL7A 1NW9B 4N6NA 4ZVOA 5IANA 1GQFA 1RE1A 2FQQA 4N7MA 1ICEA 3RJMA 2XYPA 3KJFA 3IBCA 3R7SA 2QLBA 4ZVQA 2CJYA 1RHMA 4QUIA 5LUBA 2XYGA 4QUBA 2J31A 4LSZA 4QUJA 4DCOA 4AWBA 3ITNA 3NKFA 3H13A 1RWPA 3R7NA 1F9EA 5IAGA 4N6GA 3S70A 4EHHA 2H4WA 4EHFA 2H4YA 4QUAA 2H51A 4AW9A 3P4UA 5IAEA 2P2CA 5H0IA 5I9BA 1NMQA 4EHAA 3V55A 5LU8A 4NOJA 2H65A 4ZVUA 1IBCA 1RWOA 4NBNA 3H11B 5I9TA 2C2KA 4JB8A 4JJ7A 4QUGA 2WDPA 3K7EA 4FGUA 3DEHA 3V6MA 4I1RA 4HVAA 1JXQA 1RHRA 4JR0A 4N6OA 3H11A 3DEIA 2J30A 3EDRA 1QDUA 2FUNB 1NMSA 3P45A 4NOLA 1I4EB 3V4OA 5IBCA 1QTNA 3DEJA 2CDRA 2DKOA 3PD1A 4M9RA 2QL5A 4JQZA 1GFWA 3GJRA 3R5JA 4QUDA 2QLFA 4ZVTA 4ZVRA 1RHKA 3GJSA 2J33A 4QUHA 4PRYA 3KJNA 4FDLA 1KMCA 1CVRA 2Y0BA 3OD5A 3R6LA 3D6FA 4PRZA 1RWWA 3H0EA 1SC4A 2J32A 4NOKA 5IARA 1RWMA 2FP3A 3SIPA 4ZVPA 4N5DA 4QU9A 2CNKA 3S8EA 1I51A 4FXOA 2QL9A 3BIJA 4QU0A 3KJQA 5IAJA 1RWNA 3D6HA 1CP3A 3D6MA 5LUAA 1NMEA 5IBRA 1RWXA 4D3ZA 4D3XA 5JFTA 3E4CA 1QX3A 4I1PA 1F1JA 4QTXA 4ZVSA 3UOAB 2HBYA 2XZDA 2C2ZA 5K20A 1RHQA 5IAKA 2H48A 2H54A 3PD0A 1SC3A 1RWKA 2C1EA 3GJTA 4JQYA 1PYOA 4NBLA 2NN3C 1SHJA 2AR9A 1RWVA 3DEKA 2HBRA 4QU5A 4NOMA 3NR2A 1K86A
chains in the Genus database with same CATH superfamily
3GGCA 4RDXA 4CLHA 1DMSA 1HK7A 4X3OA 1F2VA 4P8RA 1Y34E 3LRXA 4LSGA 4UDXX 1O7JA 3K1AB 3VYTB 3W78A 4TS3A 2CXSA 2HA6A 1HG1A 4D96A 3NT5A 3MG9A 3PQ3A 4HQFA 4U2BA 1MTOA 2BN4A 3E3MA 5DNVA 5HQ3B 5LWQA 1TF2A 4UTVA 2HNKA 2FPSA 4LNUA 1ZNQO 1QYWA 1QVRA 2CUZA 4NBUA 1RADA 5FKJA 4CODB 3MJHA 5AVWA 2IYTA 5CAEB 1U9IC 3OEEA 4D4IA 2WYUA 3WP1B 3EWNA 4GWLA 2FX3A 1JFFB 4MLPA 1IC6A 2PKXA 5AHOA 5HIIA 4N7BA 4MCIA 3PDIA 4BJHB 5ITWA 2BH2A 2GEKA 3UV7A 5HK9A 2O23A 1MFPA 2IITA 1RLMA 2EWVA 3BF7A 4NRDA 4YCAA 4ZI7B 3WRYC 3O9ZA 2WNHA 1LFDB 1QH8B 1KBOA 4HEQA 2Q5CA 2YV5A 3AKCA 3PB3A 1PD1A 4NNJA 2O1EA 3DEAA 1RBYA 3N2LA 4ZI7A 1ULUA 5KMGB 3MQFA 4C4SA 5TJHA 2DCMA 3EOBI 3WSTA 2Z6VA 5C8YA 3TMAA 1UBUS 3KU4A 1Y9AA 5B1HA 1U9YA 5EKDA 3UJBA 4DM3A 4D4GA 3PNQA 3LS2A 5A03A 2BE9A 4RHXA 1HFWA 3DOIA 3UC9A 3I01M 2I22A 4EPWA 1LNZA 1ZM7A 5FNZA 5EP2A 2JLCA 3KRTA 3AZQA 1JEDA 4O0MA 4JBXA 3IAS1 4FCCA 3K9BA 1ESCA 3BL6A 1UK7A 1LJUA 4HDNB 5KYYB 5GIOE 1E9EA 1JEQB 1K68A 2II6A 2QE6A 5JROA 1XNGA 2GHQA 2J09A 1HE5A 1CUSA 4CLEA 3B2EA 1E1DA 1NMZA 5DLDA 5HJEA 5CD1A 1D2HA 4EPTA 3DOJA 3DZDA 3ROZA 1UL1X 2DFKB 1RJWA 1V6SA 3ORYA 3V4OA 3QI7A 4G24A 4FUTA 1SUSA 1HE1C 1ZVQA 2B3DA 5TF4A 3FHJA 4AJJA 5AM2A 1RLJA 4H18A 4KVAA 1E3MA 3SR0A 2IYQA 1C9NA 4D82A 2PA0A 2XZLA 7REQA 2ZIXA 4RX1A 3SNHA 4YCJA 1H23A 2RK3A 1FYVA 3L7DA 5K0LA 1ZRMA 3JQAD 2DPYA 3ONNA 4L78A 1J0XO 4YNBA 4QUKA 3LC2O 2IYUA 4KO1S 2A9QA 4RETA 4ZHQA 2E37A 2YVLA 1QOQB 4ENTA 1MCZA 1VL6A 1GKKA 3QK7A 2VJOA 3K4QA 1O9GA 4EBBA 1KYVA 3VX3A 5DOZA 1J0AA 5JT1A 4YCSA 4WOPA 4U2EA 2Q0SA 3D6HA 4OH1A 5BUCA 1M7BA 1YOVB 3G7UA 5TY0A 3KJHA 5DHQA 3EA5A 2BMDA 2ODTX 2IY9A 1Y37A 3KOMA 2PUWA 3IP1A 3RGWS 4ARIA 4YUYA 3D7LA 5IFKA 4TV8B 2CHUA 2ANCA 5CUQA 1YHNA 4Z8XA 1U7WA 3FGPA 4H60A 3NKVA 2HZ7A 2OBMA 4ZCIA 1ZD9A 2WZDA 4YK7A 5DNCA 3BJEA 2DR0A 3G2KA 3DZKA 3IEIA 3NVMB 1R0YA 5D51S 1KEEB 2RIPA 4Z49A 1IJEA 2GPYA 2HRDA 1SKYB 4TQUS 4NZ9A 2IHBA 4FMCB 4BJ6A 2ES4A 3IERA 3UGQA 4EHNA 1V96A 4MYDA 4UHKA 3QVGB 2DUUA 3INRA 1TM7E 3A9UA 1KEVA 1GLVA 1O97C 1ZKMA 2D8MA 3I32A 4X92A 4Q9KA 1IY9A 1HLDA 1EU1A 2B5VA 4OYRA 1N2XA 1WTAA 4CLRB 4WBNB 2VNHA 4W7HA 1M2EA 1WEKA 2PH1A 5B6IA 3B7PA 1FOEB 5C2JB 3KDPA 1SIUA 2YFHA 4G56A 2DOKA 4OSEA 1N2ZA 3ZVMA 3DONA 4JYMA 5J3JA 5HUHA 4PWZA 4QXAA 1GGNA 4O2BB 2M6KA 5HKKD 5BNZA 1AMUA 2QX7A 1U1IA 3BD6A 1PT7A 1KAGA 1ZVKA 4ARZA 2ZVQX 3AI7A 2R84A 3DBHA 3PCXA 3NVAA 4MGZR 5CRIA 5AUOB 2M98A 5CDUA 1G20E 5E6RB 2OLKA 5ALVA 5JHHB 3IBCA 4IJUA 1WPRA 4KDEA 1SVNA 2XCRB 5LIPA 4BC0A 2IP1A 1TA0A 1XP5A 2P4EA 3C7AA 5LUBA 3ROEA 2PKRA 2XMPA 3MC1A 2E55A 1I7SB 5KEIA 2IKQA 3B3AA 4K9RA 1LBSA 1AUQA 1UIMA 1W25A 4UEOA 4MGHA 4LSMA 4OQFA 5IHXA 4TT3A 1U2TA 1UJ4A 3R7LA 4EUEA 5IAEA 1KHHA 4DSTA 1GL9B 1DKPA 2DTEA 4PSKA 1DC5A 1ZBQA 2RIRA 4P4SA 3ZHSA 2YIDA 1J00A 4NDAA 4BP3A 3AKDA 4BU0A 4OPMA 1XDGA 4K1LA 3HB1A 2BJWA 4B71A 1PR4A 3NP9A 1Y3DE 4GP7A 4QSMA 5HZMA 5T67A 2FUNB 3BMQA 3K2BA 5GAJA 5T8KA 2M2IA 3HEBA 4QRDA 1RXIA 3W2TA 4EENA 1Y3FE 1YGYA 2XSZA 3R3YA 2X7XA 3FTQA 1A5AB 1X1BA 4G8BA 2IPAB 1EQ2A 3EMVA 4R8MA 4TMFA 3K0KA 1U0FA 1U2DA 1WV1A 2O8EA 2KS6A 3VZRA 4XI9A 1BE6A 2VTKA 4P7KA 4QREA 2EC5A 3OQIA 4ZT6A 1C50A 3TD2A 5DBIA 5BO5A 2RKBA 5IK2A 2YH2A 1EZ4A 3WWDA 2Q2NA 4JI1B 3BDAA 3LGAA 2R2AA 3W05A 2LKCA 3RT1A 2G5GX 4AJIA 3B8HA 3H7AA 3ADDA 4UUOA 2NO7A 3ESRA 5GPBA 1YQUA 4IJ5A 4C0SA 5ICCA 2DPLA 5BSMA 2RBEA 3VKHA 2O8BB 1PEKE 4YWHA 3WRVA 2B8WA 4GM4A 2V65A 1ZK2A 2IHNA 4NBVA 2FR8A 2A0FA 4Z2YA 3C8DA 2CVPA 3L7NA 1NC3A 3MVEA 4LQDA 3ZHRA 5ALTA 1SH7A 1CFZA 5HDQA 1G8YA 2H2AA 2JGJA 1NJ5A 1QC5B 5M7EA 2ZBGA 3X1XA 4RQBA 1HDEA 1CJSA 5LB2A 4Z3KA 2VH1A 1VM6A 4PAGA 1ZM9A 3RM3A 4BQSA 3TNJA 1LLCA 4PO3X 1ZGGA 1ULTA 2ZJ0A 4FMDB 4QVGA 1JEOA 1K08A 1MA3A 1AK1A 3SVTA 2OK8A 1FXWA 1MH1A 1RAHA 1YBMA 1Z08A 2H7YA 2P3OA 4NIMA 4OF4A 1D0SA 1H3FA 1IN7A 2EATA 4JQOA 2QRLA 3D2AA 3M6LA 4IMIB 1OLUA 1FNCA 3ZE1B 4BLVA 5JPDA 3V4LA 4AZVA 4TL6A 4AY2A 3OEED 4Q01A 4A23A 3A6HA 4NMXB 1FCJA 1VKZA 4M7PA 5ALHA 4Q7MB 3NS7A 4FZJA 5TMDA 1KJ9A 1P6UA 4GG1A 1T6XA 4G0XA 5EYPB 3JQ9C 3FMFA 2BKVA 2VXOA 4MKXA 4WZBB 3TEMA 5FBLB 3PE6A 2XB8A 4I9UA 4HR7A 2C83A 2JLXA 3LC7O 3GI1A 1EAYA 1J22A 4WZBA 1E2DA 2IYYA 3ZUPA 4C3OB 5ARBA 1PT6A 5IT9A 1M5RA 4IRUB 4CTOA 2LNDA 5TE9A 4IHJF 4QDJA 4ZCSA 1Q1BA 2FK8A 1CUCA 5T3YA 2UDPA 3FCCA 3H9QA 4GR4A 1ZN7A 2LGJA 5IDXA 4G5YA 2DLCX 3NTRA 1THTA 3OCVA 4BIIA 3WNZA 3GVXA 5CT9A 4CDMA 1GPUA 2GX6A 3DDZX 2OCPA 4WLOA 1EFAA 4DCOA 4B3SB 1FFWA 3PYLA 3O4RA 3O9VA 2QTMA 3LC1O 3OIYA 2GTHA 1P44A 3IHKA 4HWSA 1WCV1 2MOKA 3A2MA 5CIYA 4EFLA 3LO8A 3PPVA 3DCJA 3P8ZA 2RJ3A 3LUKA 1NOJA 3Q1KA 4Y6SA 5TQ0A 3TDNA 4ESVA 2H7XA 1RABA 2WJPA 4RPIA 1G6OA 3CISA 2O20A 3UUGA 2YWJA 5B7GA 4TPKA 1BD3A 1UPXA 1P45A 4Y1FA 1E0JA 1O6CA 2ZT7A 5AKHA 5G0VA 3VYVA 1SHKA 5EE1A 5G0WA 4AP6A 1SA0B 4ZA2A 1ZH8A 1ZR2A 2FSSA 4Q1AA 4J2OA 3U6BA 3G2IA 4RKQA 4UBIA 4YXFA 3VUFA 2A9PA 5KNCA 1VCNA 5BQPA 3HKDA 2A86A 3MXTA 2CFRA 3AV0B 4BDTA 1X8KA 1CUIA 5IYZA 3S55A 3OUTA 4JBGA 2H63A 2PVSA 3CRMA 3EISA 3OFNA 3SVLA 1XLUA 4QUDA 1BX0A 2RGNC 3K31A 1DU4A 4KQ2A 3BOSA 3WNDA 2G25A 4YCCA 4EW3A 2XXJA 4FNMA 1JALA 2EGHA 2W42A 2QLTA 3ZNOA 3ZCUA 4IJMA 2EX0A 2W5UA 1MGPA 3Q6MA 4MULA 1II8B 1NWCA 1VPTA 2R87A 3AY7A 1FL9A 2VAPA 3C8HA 4B1FA 3FMGA 4P5DA 4FYIA 4KLZA 4I9GA 1F5NA 2VAMA 4BCCA 1K5PA 1P2FA 2I4TA 3AY6A 3EZ6A 1QP7A 1XRQA 3HI4A 2XMDA 2HHLA 4JP2A 4GRAA 1XSEA 4PGAA 3DL4A 1Z6GA 1ADFA 1H2RS 2V4ZA 1B16A 1S3FA 1HPLA 1YDFA 2H18A 3RRYA 1DP4A 3KE9A 2R86A 3NTUA 3N2EA 2CE7A 1NAIA 2J3DA 2XKBA 3HKCA 4MVJA 5GVRA 5C7YA 2WBLC 2UYCA 2J1LA 3VPSA 2QB5A 3MT0A 4BNFA 3OQOA 2MINA 4OAOA 3DTVA 4UJ3A 1YZKA 2JIDA 1GRNA 3ZVLA 1RYMA 4F4CA 1EK0A 5KOIA 2GO7A 1NBHA 3LSYA 3OF2A 2Z98A 3AHHA 2DG2A 1I3NA 1XZIA 5ED0A 5E3HA 5BUZA 1OWMA 2FRXA 4O2AB 4CXMA 1RACA 2GAAA 2GN4A 2O7SA 2X9VA 2PT9A 1YJAA 4JP3A 3QLEA 3ZWCA 5KHOC 1ORIA 1W0JA 2RB5A 4PZLA 4XA8A 3LL7A 4YAWA 4AIRA 2C0CA 1T5IA 1Z5GA 3BGWA 3EQ6A 4QDKA 1FEZA 4QPZA 4XPZA 5EHGA 2G4VA 5JALA 2LDBA 3RF6A 5GTDA 3WLQA 2XVXA 1POXA 1CU1A 3OIWA 4RANA 3GP3A 1YR2A 2LWIA 1Y8QB 2DB3A 1GGVA 1FLNA 2R2GA 4OEHA 4ZV9A 4HZIA 5CNKA 2GDZA 1BX1A 1MQ8B 2O8CA 4QOFA 2ZIVB 3ZDDA 3I8OA 3N0WA 1G8HA 3AUTA 3CJQA 3RVSA 3DEZA 3RYCB 1PJAA 1NRXA 1P9RA 2GN2A 2EFGA 2W58A 5F76A 3LI2A 4UNPA 3T1VA 3ABOB 2Z6QA 1RYEA 3BCRA 3L9WA 3NIWA 1T5TA 1PNQA 3EEIA 4R3NA 5BYJA 2ZBFA 4EHJA 1ENPA 1W88A 4P4LA 2A0WA 5HRCA 4LNAA 2CDCA 1YJCA 3TSYA 4LCBA 4XASA 5DP2A 2R66A 4TT3D 1QIGA 3D6TB 4KXYA 5K45A 3QJ5A 2DR3A 3UHOA 4K86A 4LZJA 4DMCA 3DE4X 4DVGA 1OIWA 1MVLA 1V4NA 3M4NA 4FGLA 1CY7A 3USCS 1LK7A 5JG7A 2WUGA 1XZEA 1S01A 3C5HA 1U8UA 2Z58A 3WRWA 4YJGA 2ZYAA 2IP4A 4QT4A 3K1YA 2K4MA 3N2KB 4MICA 4YV7A 2JLBA 1NQOA 5H59A 1AO3A 4U8HA 2PUBA 3FNIA 3UG6A 3DC7A 4GYWA 3ENZA 4IF6A 2PWPA 2XSZD 3TEFA 4WLUA 1M8JA 1OTHA 4UHCA 5EXTA 2I0FA 3H5RA 1G7SA 1FQJA 3DCIA 4KKVA 3AG5A 4KUGA 2G4CA 2IOYA 3GCZA 4RGBA 3GPCA 1HWYA 3L7YA 2EEZA 2HRRA 4QATA 4Q9IA 5KSPA 3N2GB 1NXOA 3FTEA 4LAFA 4UNQA 3U26A 4XXHA 1HDIA 1KJJA 4XPIB 1ECJA 4LYFA 1OTYA 2XWPA 3WHPA 5IK2D 4DCSA 4YV1A 1WA5A 2BBOA 2QR5A 3CLUD 1VHTA 3JQ6A 3THRA 2FCAA 1X1RA 2WF6A 3REFA 5BQ3A 3TB4A 1PFWA 3AEUB 3I64A 3EF3A 5CLGA 4ZI3A 1LC3A 4YDQA 4Q7KA 1FP2A 2IPXA 3KVYA 3LUJA 3P9IA 5JRZA 4DIBA 3FPFA 2JFHA 2RGEA 1NMYA 4WNIA 4E5UA 4U9UA 4B79A 4FXOA 4MV0A 3GOQA 3L3BA 4BBZA 3NWPA 5KYGA 2EARA 2EFYA 1NXTA 2WTEA 5ARDA 1P72A 1QLHA 4M1WA 4OBEA 3RYFB 4ETWA 5F51A 4EW1A 1KZYC 3OETA 3A4MA 2GUWA 3VC2A 1KVSA 3K2IA 1PEAA 2X8JB 3V8VA 2WWGA 4DPKA 3A2NA 1KAQA 1GZ6A 1B0AA 4P80A 1B23P 5FPSA 2DHEA 1N5JA 3QX9A 3M9WA 1DJPA 1LBQA 5TQJA 3UMVA 3DDHA 5EHQA 3DSRA 2GERA 1FIUA 3JQ7A 2IBSA 1I4DD 3GT7A 4YRSA 1AH2A 3ILVA 2ZBDA 1MQ9A 1T34A 2HDHA 2V7TA 3MIZA 4HJXA 5FWDA 1DGQA 4FNGA 2H5IA 4CF6A 3OFVA 4BYGA 2C5SA 2JAQA 4ZDJA 2CKMA 4MB0A 2O8DA 1UQTA 2AJDA 1KZ6A 1JLKA 3HCPA 1W36D 1NQWA 1WCYA 4QICA 5BOSB 5JLJA 4PG4A 4PHFA 4XQEA 1CEXA 1HH4A 1V8PA 4Q9NA 2F3UA 2IE0A 2WABA 4XJSA 4YAEA 4EPXA 1ZNZA 4D6PA 3NOOA 3GFPA 1G3IA 4G85A 3BE4A 5BN1A 2GJ9A 3K5PA 3DE1X 1NG9A 2XV1A 2J9XB 3CF4G 5DBOA 4NK5A 4DV1B 4NZNA 1JYEA 5CIWA 1VE5A 1JTFA 4I6GA 5ICFA 3L7LA 1DARA 3BH0A 5D5PA 4R8RA 3T3PB 3R6DA 3OOEA 3BT7A 3P9KA 3QE2A 2GD6A 4IL5A 3ASZA 1ZFNA 1AUXA 2IHJA 2JLRA 3LY5A 4HN2A 1IIBA 4A10A 4PXYA 3SIXA 4CV3A 2E85A 1M54A 1R0LA 2W2NA 3P5BA 4MW0A 4CM4A 3E8XA 1M66A 3D0QA 2B4TO 2J45A 4DG8A 1W73A 3K6RA 5FRDA 2XQJA 2VNIA 2ZSBA 3IKLA 2CJPA 1Y1QA 4LRUA 4C4AA 4TWZA 2J0SA 3U80A 4CL2A 2C3UA 3G5UA 2XCLA 4IVNA 3PXGA 5KBYA 2CXOA 4D1YA 4HDKA 4G4GA 3H5OA 3C14C 5JATA 5EKUA 2ZRIA 1BMTA 4NJEA 2HCJB 5KNCD 3GNLA 1FNNA 1NYLA 1Q92A 3RABA 5JV5A 3D5EA 2ZYSA 3AHFA 1A9OA 1NI3A 3OKFA 1YI0A 3F5MA 3UHJA 1BS9A 1JJIA 3NHKA 4CQLA 1OXTA 2JFZA 1FFXB 3OFND 1JSCA 3B8EA 4GT1A 1TAHA 1D2EA 2DPGA 3B5EA 1V8DA 4FB5A 3P45A 4LJ6A 2G6BA 3K9QO 1T9GS 4NOLA 1FYDA 3WGZA 4BNYA 3LVRE 3LG2A 4GLJA 3ZDXB 3IKTA 4LXQA 3JQGB 4UD6A 1JQDA 3C16C 4XIIA 3FKSD 3SHVA 1IY2A 4FDTA 1XAJA 1P9OA 1R9NA 1Z2EA 3I76A 3OJ0A 4EDHA 4LYDA 4Q4LA 3JSXA 1KI2A 3CUWA 4TUYF 5ANRB 1V71A 2WSLA 3IE1A 3ETEA 2FUCA 3D0KA 3OQVA 4UKDA 2NU8B 2V7EA 2GCOB 2OCLA 3HZRA 2ADFA 3KQTA 4ER5A 5F98A 1DBRA 1VHLA 2D2EA 3OJLA 1VTKA 2NU7A 3H7IA 4NLLA 4E21A 1JG4A 4LDPA 5E4YA 1YS6A 4MVJD 4C2TA 2WJHA 4LXHA 4Y2QA 4OHYA 4XUDA 1DRUA 3BB4A 3UB2A 2J4FA 3A32A 2O3JA 2V9ZA 1N7IA 2VDJA 4PFSA 4BTVA 5IJ0A 4JU9A 4J43A 4ND8B 3GN2A 4ZVSA 2P77A 1ELOA 2ZQZA 1TLTA 4V0RA 1CF4A 3ZHZA 2GZSA 3ZG6A 1L8AA 1OKKA 1UJNA 2NO4A 1DFHA 1JMYA 1AQNA 1RWVA 1CRPA 1B41A 4OIFA 3TUJC 5K05A 1NUTA 1ZD5A 1W0JD 4RY0A 3A04A 5C46F 5LQUA 2PU7A 2WVGA 4YT4A 1SQ6A 4CL8A 1V45E 3I04A 3V32A 4RNCA 1YIDA 4L8LA 1BDHA 1IPHA 4LRQA 5JBIA 4QLOA 3AJEA 3PNPA 3NYIA 4ZMBA 2OQRA 2P1ZA 3C4JA 1NUSA 1JE0A 4I55A 1QZTA 4XSVA 4BFVA 2BFBB 4KQ1A 1H5QA 4RQUA 1H6BA 3N86A 4DUPA 3ZDZB 5EXEA 4ER3A 3GFTA 1X13A 4OHCA 2AZMA 1OV6A 1F8UA 5CX1A 2ZI6A 4S1VA 4YI5A 1V0JA 4D8VA 2BMAA 2JDID 1JFRA 1ORDA 2OXFA 3FPBA 3I92A 3LVBA 2C88A 2OUKA 4BQRA 5JTTA 1BHJA 4QOEA 3OH8A 4MQ6A 4G4IA 3C97A 3R3HA 3MWLA 2R7LA 1S9HA 2GWRA 4L8WB 4ONEA 1QQ6A 1ZHFA 1IIRA 1CRZA 3OZVA 5AXBA 4B32A 3BERA 8GPBA 3DT6A 4DXHA 1PFQA 4MPRA 1ABFA 4Y2HA 2VR1A 2P4QA 1JDBC 2ONYA 3MK31 1N3IA 1MVNA 4FKZA 5DYYA 4GE0A 4ND5A 4WADA 1AUVA 4B3BA 1PD0A 2ZWAA 4DIUA 3F7MA 4H77A 1G5FA 2AFIA 3EVEA 1D8TA 4UASA 4UHJA 1L5HA 1F2DA 3VZCA 3WQSB 1DX9A 1L8XA 1QWSA 2RBKA 5F5XA 1WB6A 2BGJA 3HWRA 4JI8B 1PFVA 4OJTA 2QWXA 3FMVA 1DAHA 3KB6A 3HRHA 3T4UA 2H4YA 5DM4A 1ZI9A 3HLYA 1AD2A 1F0PA 1YKGA 3CVOA 4X93A 5DSTA 4BLOA 1P1JA 3TOXA 4UNRA 2BHRA 2OHFA 1O9HA 4CQNA 2EQAA 1GCUA 3IX7A 3D8HA 4FDUA 2ZWVA 3GLSA 4H7PA 1XD8A 1A0OA 1Z7GA 5CBKA 4AXXA 3DEIA 3ODPA 4XW2A 3ROPA 4ER6A 3G2NA 1RXCA 2A5FA 3HR7A 4WXEA 4ZQGA 4FMBB 4Z1MA 2JNWA 3ZV4A 3WBKA 3HBLA 1RYZA 1ZK1A 1J0EA 1JIKA 1CFJA 3RSCA 3STXA 5CB4B 5SZIA 1LTHR 1UXHA 2YINC 5DLEA 3SHWA 1G5QA 2AWOA 2FUG1 3K72B 5ALXA 3VPDA 2ZPTX 1E9FA 1CY8A 2ZWMA 3IC5A 4QAQA 4XIYA 5B30A 3OP4A 3NBAA 4WUTA 4KTTE 1PBTA 5FCDA 1IVYA 1UK8A 1DV1A 1XG5A 2GRUA 3VC3A 2QQFA 4RVUA 4F93B 5KJEA 3NC1C 4C76A 2DBYA 3ECAA 5B4VA 2XDQA 1T9CA 3RD5A 3SBDA 1U4OA 1PTJC 4EOGA 1E58A 3B1WA 5F1KA 3CVUA 4QYSA 3AUKA 4HDQB 3GGJA 1DKQA 1DBPA 5DTRA 2XZDA 1PSDA 4MOWA 1G60A 5EQFA 2PJZA 3C3YA 2B1QA 4ON9A 3OBBA 4RAOA 4WECA 3VAAA 4OGKA 4BEWA 4WX2B 1MPTA 3QV1A 4E5YA 1YMQA 2JGLA 4Q03A 4HX9A 3IEPA 2P5TB 5BVHB 3BYZA 1SVWA 5H9WA 5ICEA 1CUAA 3S4YA 2JG3A 4WK4B 4C78A 2DFNA 2CLFB 1PWHA 4EG5A 4PO9A 1VXRA 2IOHA 1L4FA 2YRWA 3O9MA 2G09A 4KAXA 2XZTA 1MZPA 3FNFA 4WJZA 1VJGA 2GTPA 4ACAA 1XJCA 1P81A 2AEJA 1GYQA 2IA5A 4P5PA 5IMSA 4O08A 5H02A 5JBQA 3OCYA 1XD2B 2QXYA 1SUDA 1WULS 2C0PA 4Y2VA 5CH3A 1KSHA 3I05A 1GDDA 1GGHA 4LRSB 4ZOLF 2ZATA 2ZSEA 1EVKA 2PT6A 5FTWA 2JI9A 1OLXB 3ICPA 3OEWA 4PFQA 3ZWOA 3RVBA 4ASUA 1T1GA 4UPDA 4EAAA 3JV7A 3P26A 3QEKA 4MGKR 1QSGA 5BW8A 1OLXA 1XQYA 1G5IA 3RREA 4AZSA 3NGLA 4MS3B 2B2NA 1QONA 5A9SA 3C6ZA 3EMDA 1F51E 1J4AA 1XZPA 3KKEA 4KLNA 1JZSA 4GBGA 3S1AB 4RF3A 4C07A 3NCHA 3QVSA 1RE1A 3RANA 4TYNA 3N07A 4ZZIA 3KHKA 5LQNA 3KQVA 1FP6A 2J4CA 1C7FA 2P2NA 1NX6A 2NXEA 4IUYA 3AF3A 2J6IA 3BIWA 4GYYA 5D2CA 5CDFA 3ETDA 5FAXA 5AIBA 1PR2A 2XKJE 4WZZA 1AK9A 1TM5E 2GF9A 4QJIA 1ZOLA 2AT1A 1UP6A 3NRBA 1I3LA 4BXOA 2ANBA 4OQXA 3PR1A 3U3ZA 1TQ4A 4CMIA 5K4GA 1GCIA 1R0BA 3IIIA 4LXYA 4EHHA 3COZA 2ZYUX 2WF9A 5EJFA 1I2BA 2JAOA 4L07A 1UPAA 4CQMB 4FFBB 5DIZA 2K2QB 5F7OA 1RYFA 1IQPA 5I8PA 4RVDA 4C7MA 3M3PA 4P3YA 1RLUA 4D92A 1PJ4A 1A7KA 2BTQA 4TWBA 5FUQA 4FGUA 2DSNA 3ONFA 4Q02A 1G8AA 2J5BA 4F0JA 3FHCB 4Q34A 3HVIA 4Z6KA 3ZNQA 3QBTA 4ADSG 1N34B 1EVLA 5FOUA 4Y6OA 3RRJA 2UZ4A 3QA3E 1KDYA 1NONA 1WQ4A 1GKYA 1YVRA 2BZ1A 3AUUA 3FG9A 4NMMA 4IG9A 5IU6A 2NNWB 3VNUA 3OTHA 3OEHD 1FSSA 1K6IA 2H17A 1OYOA 1PK7A 2HK9A 2P7IA 4NG4A 3VBEA 1QE5A 2FUEA 5K4AA 4AY5A 5AJYA 5BR8B 3W6NA 4XYGA 4TQ9A 3WGQA 2VH2A 3CG4A 5GGXA 5T7BA 2R1VB 1D2AA 3H0EA 1P0MA 4D8XA 1C3JA 2BWJA 2QSZA 1U8YA 2ZAYA 2ZQ5A 4R1SA 4PNZA 3TZEA 3VDXA 1E18A 1XTPA 1Z6AA 3H99A 4M7RA 1HTBA 5IDYA 4PN7A 4OQQA 4QLAA 2G83A 2JHAA 3SKXA 3OAAA 1U28A 3KM0A 3IQFA 3CNQS 1GTSA 1U7HA 3D6MA 1DUVG 2H7CA 1T3ZA 4GOLD 2JARA 3UT5A 5CA0B 5I7HA 1S2LA 1BKYA 3RRMA 1CS0B 1T3SA 2JFXA 3M5DA 2GILA 3GLTA 4O0LA 3RF7A 4ZOEA 4EJ2A 4ISBA 5DM60 4YMGA 1OW3B 3VRHA 3RAJA 1X7ZB 2VUIB 2AF4C 4EUKA 2CJFA 1U0HC 4R6XA 4CDRA 4EZIA 2NN3C 1TZJA 3WGNA 4GKBA 1D2MA 5NULA 2QROA 4AYXA 4DSAA 4MV8A 3T3GA 3WMXA 1C29B 2B2XA 1UWVA 2G9NA 4CIYA 1EBBA 3A1DA 1TC1A 3L7CA 2XCQA 1U31A 5IZ4A 2N0SA 2O3RA 1XROA 1A2BA 2XAAA 3BGVA 4IUCS 2NACA 2IJGX 4HTAA 1E9CA 1HOXA 4N82A 5AKJA 3W7VA 4C22A 1J20A 4CFZA 3LUFA 3MJDA 1V8OA 1K88A 1GNSA 2C5FA 4P33A 5TT0A 1RR6A 3TQQA 1P2DA 4D26A 2QN9A 5HNKA 2OV1A 1LU9A 3DDWA 3JWEA 4PYRA 1A4RA 2IYLD 2ZI9A 5AW1A 4C7XA 4NZPA 3TIVA 4GEGA 1AGPA 2QN7A 5DPMA 2FLVA 2GPWA 1BDIA 2PUCA 1PJ3A 3D3JA 4IDHA 1Y1TA 1KK0A 3EPLA 3Q12A 1IEXA 2DFTA 4OI0A 3F3MA 4KL8S 3ZN2A 1J2EA 3M5PA 5AKLA 3Q7TA 4HZUA 2AZTA 2ZRGA 3FUUA 3MT9A 4RD6A 1TQ6A 1EWRA 3MTEA 4HBGA 1XDBA 3DDNA 4QEZA 5FV4A 2AD5A 3B1FA 2ROQA 2RH4A 3K05A 4N7MA 4X95A 3KJFA 5AKKA 3R7SA 4B76A 3AJAA 3VZDA 3A31A 3G59A 2PUJA 1CY6A 2VWGA 3SOZA 2JJ2D 4E11A 5DMXA 4YT2A 4QD3A 2GHIA 2L69A 5A62A 3IP8A 1NYTA 2H3HA 1WUJS 3LPNA 3PIRA 4RHYA 5FADA 1KAHA 1T5LA 1E66A 2YWGA 4L08A 1XV5A 4QUAA 3X43A 3QLVC 2C8VA 3HUDA 1RZVA 2EFDB 3RBVA 4R2XA 3AG6A 1AS2A 3FWNA 4Z4IA 4OYYA 3HZZA 1JDUA 2TRSB 1OXSC 3MBIA 2GM4A 1N9GB 4G1MB 4Z1MD 3K7EA 3KT3A 3ZGLA 1FUIA 2DWUA 4JVSB 2C3OA 4N39A 3VKFA 4ZJYA 3WLHA 2WC1A 1VFNA 4KFSA 4YRZA 3F47A 1L7PA 2NQ2C 1HA3A 2N1BA 3E2IA 4OATA 1IUNA 1LLUA 1QTIA 2HMUA 2KMLA 3CH4B 4IHQA 3IR7A 3GFRA 3E0XA 2R5FA 1PL6A 4OHXA 4V38A 1X8XA 4QJ5A 2GEFA 3W3AD 5CEJA 2C42A 1XNHA 5FBKA 1QV9A 3I9V6 2MTBA 4FYVA 3UK7A 3LM8A 5FD8A 1BDBA 3UPDA 1G2QA 4FD3A 4CGYA 1D09A 3WIDA 3Q7IA 3O82A 4A7PA 2R6JA 2VPXA 3Q7PA 1VMAA 3BF8A 2MR5A 2CD7A 4D9GA 5FQOA 4C0WA 1KO8A 2VBCA 4JVOA 4OAQA 4B74A 4FJ1A 2WU1A 3EASA 2HPAA 3F8WA 4DLPA 1FPMA 5KJCA 4L15A 4A0RA 3VKGA 1A8UA 1HDZA 2A9KA 2DUWA 1N92A 4IGAA 3T8YA 1P5RA 3QG5A 3ZWBA 5L4SA 2AC4A 2OGWA 1ZCAA 1RVV1 1VMKA 2QTGA 3HO8A 4WESA 5KYUA 4BFLA 1Y0BA 5A02A 2R6AA 1IZ7A 1Z34A 4OUKX 5K20A 2V55B 3R20A 3TZKA 3OT1A 3U9LA 5ADVA 3CW2A 5DGTA 3ZKWB 3OCJA 3SPXA 3UA3A 4XVCA 5JZMA 3P4XA 2Z95A 2BEWA 2RGRA 5DN6D 1B0UA 3GHHA 3I9JA 3RUAA 1Z4NA 3DLPX 2HA5A 5IPFA 1XMSA 1SHLA 1ONOA 2IZ7A 2O2SA 2OHOA 5DVZA 1DKLA 4QIHA 1TIPA 4E2YA 2JZNA 4LK2A 2VP4A 2ZM6B 4LJ5A 1XQXA 1LNQA 1MUUA 4QDTA 3KWJA 2HBQA 4MVJP 4DKJA 5ADHA 3CJTA 2JS7A 1UKZA 2YFQA 4WMLA 3N9IA 1DWOA 1UMBB 2HL6A 2W4QA 4B82A 4LQCA 4DR5B 1NV8A 1WHSB 3DD1A 3QNWA 4WLNA 4ASUD 4D9HA 5BUSA 5L6LB 2ET6A 4UATA 2I7VA 4KO2S 2C5BA 2COUA 5D84A 1VECA 4M0LA 3I2HA 1O6BA 2D2IA 3GFFA 3KYJB 3M2TA 5DX1A 3ZTYA 2KYRA 1ZNYA 1QGED 3V9PA 3WLNA 1XQ1A 1NN1A 4IV8A 2P5UA 3ZV7A 2SCUB 5KCMA 2JEYA 1BXRB 1VLQA 1IWOA 3KZCA 2PV7A 4F92B 2XT6A 3JVUA 1OB5A 3CV3A 3MJ4A 5D5QA 4DZZA 1X87A 1NVXQ 4MW9A 1NY5A 2PPLA 4DIOA 4G9GA 3SQOA 1FPQA 5SZHB 1FUKA 1HQDA 3TD9A 1CEQA 3I2FA 4OJKA 4BP9A 4CMGA 1GPDG 5IF9A 1WB4A 5JS6A 4I50B 1XCBA 1ATZA 4R6WA 1FYEA 3H13A 1IOLA 3L0PA 1SXPA 2R65A 3U3JA 2VFAA 3EQ2A 3MRXA 4DA9A 1XHEA 3FYUA 3RGGA 3S2FA 4A27A 3GIWA 3OQPA 2A4KA 2C94A 4I50A 4QGAA 4FFDA 3SXUA 3E81A 2H65A 3ORFA 2RGAA 1II0A 3I1IA 1L4LA 2DM6A 1AIPA 4L5YA 5CVUA 5K1ZA 2IEZA 5TEWA 3UJPA 1L7DA 3P5SA 1JDNA 2DPXA 2BY4A 3KZNA 5FOQA 5KOHA 5ESDA 2ZJ7A 2JFBA 4P4UA 4JLJA 1VLZA 3NTXA 4YRQA 4C5CA 4HXYA 5LZ9A 3K5WA 4EL0A 2V9PA 1BOFA 3DEJA 3IBGA 3KEOA 3U09A 4TM8A 5HEKA 1HGXA 3NM4A 1KI3A 3BPSA 5CB0A 5DDIP 1G42A 1EFDN 4JUCA 1RRFA 2WVAA 2C3MA 4Q1BA 2CB9A 2J3LA 2IOFA 5G1NA 3B6MA 2W43A 3LQKA 4REQB 4KO3S 1T26A 1Q0PA 2ACKA 3QUTA 5F2KA 3OAAD 3ZD9A 1ISRA 4DYDA 5BT9A 5CB6A 1UIRA 5CNJA 4RTQA 4F86A 2ZVDA 5MGBA 1Q0LA 2XHZA 3CRW1 2E0IA 3CLTD 1GT6A 2VP6A 3F1KA 1WPXA 4EG7A 5DXAA 3TD6A 3K0FA 2GNOA 4DZTA 1Z18A 1WBJB 1A8HA 3U7QA 3FWYA 4J07A 2HSZA 1E7SA 1PSWA 4P2BA 4MYUA 3RTBA 3DV0A 3GZNA 1IXRC 4EITA 1OIVA 1XVLA 4TTSA 3LDHA 1EAMA 2UZ3A 3GT4A 2B92A 2E82A 4R5MA 3JATB 3O95A 5EMJA 2PO5A 4TTRA 3EBOA 5IN4A 4LPKA 2GHTA 2H48A 2I76A 4DR1B 2ESRA 3ORRA 5HX7A 1W1IA 2XEDA 3NXSA 3KO8A 1M2HA 4ZVVA 4N49A 8AT1A 3CB4A 2X14A 1YZFA 5GJCA 1EWQA 5AUQA 4YAFA 1Q3TA 5CLHA 3Q9SA 3H4IA 4EY4A 2K7FA 3ASVA 4TMVA 4U2FA 1DAEA 2ZBRA 3J80A 2WHYA 2GESA 3QNMA 2A84A 2PTGA 4MUFA 3WAGA 1QFZA 3MTJA 1LQ2A 4X1KA 3OLXA 2ORVA 1J06A 4QQNA 2Y2UA 4X41A 5DH9A 1CC1S 4K5QA 1SOAA 4A16A 4TXJA 3ZWXA 2ZJZA 3VVBA 3KEFA 2R1TB 2QNIA 5CDHA 4B6GA 2XYRA 4IFEA 5E2BA 1F12A 3SX2A 2CLKB 1XQVA 4Q4AA 2QXTA 4W99A 2DEUA 4YLYA 2XEXA 1U0EA 3JQQA 3FHLA 2RJOA 4M54A 1PV2A 2PKCA 4TTTS 2XJ9A 1E0DA 3ACBA 3KR9A 3NBUA 4H7IA 4RVOA 5DCLA 5G1PA 3EGDB 4PO8A 2AGVA 3GH1A 4K9QA 1FS5A 4YC7A 4G67A 5EHIA 1V25A 3B3QA 3VO8A 1CY1A 1E1KA 1P0FA 2PSHA 3RS4A 1HZZA 5KKAA 3FKQA 1C9KA 3RFUA 1XEXB 3D6VA 1TLFA 3ZXSA 3CEHA 3C3DA 3GRVA 1YS1X 1YZ3A 1GQFA 2REQA 3PHIA 3A6DA 5FWXB 5G40A 3ZCXA 3QBDA 2RH9B 2NYUA 2VUHB 2X3UA 1ESZA 3THWA 5U4QA 4UOQA 2YR0A 1HFEL 4WW0A 4IQ0A 1PNOA 3Q5GA 4YHHB 2INGX 1KK1A 1XTBA 5JZBA 4KAJA 4TXLA 4JB2A 1V3UA 4B8YA 2V7PA 3GFVA 3GLQA 3A4LA 3OO0A 3RHFA 2XA2A 1WZ2A 1NRIA 3EA4A 3ICOA 3LECA 1OWNA 1FP4A 4EFMA 4HWRA 1YSCA 4OVKA 1IE3A 3ND8A 2OV3A 5HF6A 3C5WP 4MQLA 1BMFA 3NTLA 4NBNA 4NH4A 2P69A 3UGKA 2G8LA 3FOWA 2CXRA 2BJVA 3DFKA 3EXIB 4MUEA 3L4BC 2OQVA 5KUTA 1HQCA 2OYRA 1KJYA 3HKBB 1PZNA 3DVAB 5AVKA 1S3GA 4LY6A 2LE0A 4N6OA 3IT1A 2W00A 3LQRA 4KPUB 5C81A 4TL9A 5B1EA 3EXIA 1VB5A 4C87A 2X2EA 1PUIA 3ZI4A 1NULA 3GJRA 2F4NA 3I45A 4A8JB 2NTVA 5AQEA 3WO0A 1H2HA 3BWVA 3KJNA 3ZY2A 1W6UA 1TKAA 8LDHA 1JWLA 5AK6A 3E58A 4M87A 1X1AA 3S1SA 4E30A 2ZCJA 5FUYA 1Z88A 1MO5A 1IRXA 3N75A 4MQ5A 1QRDA 4DTCA 4LOJA 5EWJA 2AYXA 2BC9A 3KKLA 2WUDA 3LBHA 4RZ3A 1RP7A 2CLSA 2DAPA 1FTNA 3I6QA 3QQPA 4KZPA 4Q93A 1DRWA 4AY4A 5ADUS 4X7RA 3G2HA 1Y5NA 2LV8A 4ETMA 1L5VA 4KDRA 1WZUA 3ZW7A 1ODFA 4EG1A 3D4LA 3ZR4B 3HYLA 2BCGY 1RPNA 4PCLA 3VTFA 4YB8A 1Y7IA 1JHVA 3BK2A 1N5LA 5E95A 2XCIA 3DM9B 5TGDA 2Q1TA 4GC5A 2DBZA 3MCUA 4RA9A 1GZVA 2WIDA 3R0VA 5DLYA 5GP1A 2ACEA 2AQIA 4ENPA 4KE8A 4KFTA 1IOVA 4NOMA 1UDRA 3Q7SA 4QUEA 1SUFA 4B2IA 2K7ZA 4JQSA 2DF8A 3CEPB 2O2EA 1MV8A 3EMKA 4MZDA 2HMTA 4IJ6A 5TS2A 3SYNA 1PGNA 3E23A 3WICA 2DQ4A 1GZ3A 4I08A 3F8TA 1Y4SA 4LGYA 4BE4A 2FEOA 5C1BA 1G8MA 5B5SA 2CYBA 2ZZKA 3UWKA 2NSYA 2DLNA 2QRVB 4H0NA 3W2FA 3AQIA 4K6OA 2GM5A 1EFVB 2PSDA 1CD5A 2M6RA 1UP7A 2C4UA 3GCWA 4ILEA 3WSVA 1RKUA 3L1KA 2HGZA 2PGLA 4ZTBA 2Q9BA 1SURA 2P4HX 5JFGA 4IIYA 3M5CA 2C96A 2QRVA 2NGRA 1VJCA 4NONA 2Q0XA 3IO3A 4II2A 3O8NA 1EFVA 5I7FA 1RC0A 3IBTA 2H85A 2HH9A 4XWGA 3O8BA 2ZRHA 1S89A 4DCGA 1IZ8A 3AYXB 3ACDA 2JPDA 1CBUA 3W5HA 3SBOA 2NT3A 3FYSA 4YO8A 2EX4A 3RWMB 5A2QA 3CW8X 4UM5A 4CT4B 1EWTA 3DAOA 1XKXA 3V7NA 1M1YB 4J0FA 4XGKA 2KJQA 3TM5A 2V5AA 3NX4A 3EZYA 3PDCA 4FINA 2KHZA 5AI9A 3PGMA 1TD9A 1EQUA 2QW8A 1PRYA 1UUFA 3GD7A 2P6RA 4ZDIA 1W0CA 3ZE2B 2ZB7A 1Q22A 1OX6A 3E9QA 3D8UA 4G5GA 4M21A 3MUNA 1TRKA 4D9IA 4N6GA 4HUQA 4A6XA 5ED4A 4EAQA 3FWZA 3HA5A 2ZZNA 4JD5A 1NUHA 3K6KA 3LNTA 4EWLA 1K2VN 2OCYC 4YJ2A 2RDMA 4C5BA 4LYEA 5CVEA 3A0RB 3AETB 4GVPA 1M1NB 3H1FA 4L4YA 3RAGA 4Z7NB 1YCDA 1KY5A 1ZPDA 1LB1B 1M34B 1PEDA 2E5WA 4YUXA 2F6RA 5LZ2A 3VU3A 4IY1A 4WOCA 3G9UA 1V8ZA 4A36A 4PAQA 1AUPA 1NXSA 1M1NA 4HWPA 4O59O 3RVRA 1V9SA 4XGRA 4X6XA 1KKLA 1N1EA 5AVTA 3GYGA 2IPOA 1A8QA 5KQSA 3BIXA 2GBPA 3KQQA 2RK4A 2VQEB 1ZEJA 3VR5A 3TG8A 1L0BA 1T5HX 4ESHA 2OBFA 3RR2A 3HK2A 2XXAA 3Q2IA 5JQGF 1EXVA 5E9AA 1ECFA 2JAWA 1E0AA 1XAGA 3LPMA 1U94A 1VSUA 4A73A 4RKYA 4PF1A 4DNQA 1TA9A 1Z3CA 5BUQA 2OENG 1DC6A 1YE8A 2DT8A 2FSFA 4JUFA 4INOA 5GQSA 4BRWA 2C3YA 2ETXA 4LVCA 1RXYA 1EGAA 2H1CA 4FZVA 4XRGA 1C9YA 1MEEA 1RWXA 2DKFA 3QHAA 3HXMA 2I1VB 2A5JA 3HDQA 5HBRA 5JFTA 1SVLA 4ZU3A 3MT8A 3DULA 1YACA 2I2CA 3MSCA 4KEAA 1FZTA 4DXDA 3WYGA 5IAAA 1ULZA 2YN2A 3EVNA 2D06A 1MOQA 5JNSA 3RRXA 2HSDA 2O5CA 1NVFA 1NOIA 1NOKA 1QO0A 1Z0KA 3D2CA 4X00A 1E3QA 2DH6A 4XWTA 2YN4A 4K9PA 3ZHVA 3G68A 1B14A 1WP9A 1ZH2A 3FR8A 3GLVA 3OX1A 4M76B 5DCYA 1BIFA 4EVSA 6Q21A 3Q88A 4I4TF 2R751 4RVFA 3S68A 2A1UB 2VXBA 3D0RA 3S2EA 3UK2A 3VNBA 3WWOA 2O52A 1MB2A 5TF0A 2GLUA 2W4MA 3HXQA 2FR1A 1JQEA 1USGA 1RIIA 2IUTA 5LYYA 4DWVA 1FMLA 5JO9A 2R8OA 4FJ2A 1W4CA 4MQEB 4BWGA 2YZMA 3SJZA 2XUIA 3KXLA 5DM0A 4NK4A 3G88A 3I53A 3WL6A 2YV3A 2OPHA 1A9XB 4GZLA 3SM3A 4D57A 3HY6A 3PEYA 3H2ZA 3IURA 3PSAA 2F59A 1B3BA 4LI3X 4G5FA 1ZA2A 4N01A 1E3TA 1TO6A 2UVPA 4ZRNA 2Y4OA 1VPWA 1A9XA 2WWWA 5FI0B 1D1QA 1V1MB 1DINA 3FIJA 3PNOA 4HDOB 5A7HA 1XZBA 2QZPA 2JKVA 1IBSA 1XXHA 1N8TA 1G55A 1LV7A 2IXTA 3KHSA 5EI5A 1IN1A 4R8VA 4J2HA 3BEDA 3GEHA 4KB5A 4RZSA 3R0ZA 4RTRA 3EG9A 4O4HA 1STOA 3LUDA 3NANA 1LW7A 4A9AA 4PZDA 3T5AA 2C7QA 1G21B 3CZCA 3OQ6A 5IZCC 4DYHA 5TGZA 1U0RA 1DJQA 3H1BA 4D02A 1KO1A 4HB2A 3IPAA 3R5HA 3WWPA 4A2QA 3FUVA 1M0EA 4OQPA 3QXGA 3H5WA 1G21A 1BMFD 2OC9A 1ZD8A 2JAUA 1O08A 4I2VA 4LXXA 4NQZA 1RI5A 1JHZA 2O8VA 3MJSA 3ROTA 4IXMA 2O4UX 1JI3A 1X70A 1T4CB 3KFXA 4LOKA 2WF7A 5ARCA 4L6CA 4PQFA 1H1LA 1SZPA 1E64A 2O7VA 3FTPA 1QQ7A 2QKYA 1BH6A 3K15A 3M7IA 5FV7A 3FUXA 5FA5A 1FVHA 1DQRA 4MW5A 1T4CA 2B7CA 2QG4A 2RHOA 3ANMA 3GMSA 3EGWA 1VGQA 1G1AA 3HCEA 5LXTF 3D6NB 5DHFA 2ZR7A 2RGGA 2VF5X 3CURA 3O8LA 5CLQA 3SKYA 4BMDA 1B4DA 2BCJQ 5CA1B 4B8WA 4IPTA 2FEMA 5JDCC 1W6RA 4TTVA 4P83A 5K6RA 1REQA 3R5TA 2UUPA 2XOEA 5JAZA 3V1UA 4YRJA 2G6TA 3QYAA 4AD8A 4DG9A 3VHXA 2IZOA 2QN3A 1KZGB 1Z45A 1IHYA 3Q5EA 4DWOA 5K4HA 4NH0A 1CQJB 1ISFA 3WBBA 3OTWA 1OFHA 1BRTA 2CWDA 1IPEA 4EFNA 1U8ZA 2JRLA 4JY7A 4ZAGA 2PBFA 2BAGA 4CTJA 4O33A 3U39A 2HSWA 2ZUVA 3D3WA 4BQPA 4ZU6X 1KYYA 5TSDA 4DT1B 3AM4A 1RTKA 2VLBA 3E5NA 2ATXA 4L3WA 5A06A 4MUGA 4PYJA 2PGAA 4U7PB 1Y7TA 1EK5A 2HBYA 3QYFA 3PA8A 3DFIA 3S81A 1WZIA 1CWUA 1TQHA 4RPKA 2RSLA 3QE3A 4MXDA 2UYGA 4DT1A 3QXJA 2FH5B 3OPYI 3TW8B 2XX3A 4X3CA 1ECCA 1HDCA 4OU5A 4RZQA 5P21A 5KSOA 3HDHA 2NV6A 1Z2AA 3LMKA 1XDDA 3R76A 5JO0A 2HBRA 2VUTA 1PG5A 1RU3A 1U3VA 1M75A 2IX9A 2PLWA 3A10A 3C7DB 3KTOA 3KOXA 1G6Q1 5AWFC 1L1FA 4YV0A 3CX4A 4UNSA 5BWNA 4NBRA 4JS0A 3ZDRA 4K8OA 3RT9A 3GGPA 4KSYA 1M6VB 1XALA 4C0KA 2JH3A 1YB1A 1FUYB 3N8GA 3HU2A 2A2ZA 4KV7A 4K9OA 4XAQA 1H0RA 3C1OA 2PSFA 3UWMA 3KUKA 1N32B 2IV7A 1M6VA 1NP7A 4L2IA 4QGBA 2OHVA 3GX1A 3MLBA 3BXEA 3A9RA 1W8IA 4LJ4A 5T4HA 1NQ5A 3UFBA 3EY4A 1Q2UA 2ID8A 5KVCA 4XQ9A 4LF9B 2IW3A 3BD9A 1Q16A 1RXEA 2DHDA 3IKVA 4D6YA 1LBTA 1CHNA 3P2YA 3OE5A 4JJKA 3GNSA 1CUUA 1F0NA 3ITDA 2CLIB 3OIFA 2XH8A 3GEPA 3R5SA 3I73A 2QHXA 2X4IA 4HNAA 1IM5A 1HYBA 1XLTA 3AY3A 3NZEA 4N3BA 4OP3A 1E1CB 2BGLA 2GEVA 4BQNA 2OGTA 1IOWA 4N3GA 2IS1A 2C58A 2PX3A 3LLMA 2VHVA 3V1NA 1Q21A 4CKWA 1FFYA 1E1CA 4N40A 2PN1A 3P52A 4REOA 2VJPA 5EJGA 5LQJA 2QTVA 5SZJA 2ZUEA 3JAWB 4V0KA 1JHPA 1PJCA 3TMKA 4I9NA 3BQ9A 4UUMA 1XU7A 4GNRA 2WKSA 2HDNB 1EHCA 1U5CA 5A7GA 4Z4HA 1C1XA 3KK0A 3QVLA 1VMIA 4DMHA 5KVAA 3JAWA 3ICWA 4PGHA 3GLUA 3EH1A 3H1TA 1WM1A 3DGFC 4OQNA 2EAUA 3D7SA 2GK7A 2QUAA 4HAWA 3THSA 4BZQA 2I7CA 3LUHA 2CF5A 1U3TA 1Q2XA 1TJPB 4QARA 2CXXA 3ZBTA 1SCIA 1OAOA 1YR1A 5JRDS 5JCZA 1Y3CE 4HAOA 3R7WA 2BEVB 4GR5A 3B5JA 3KQNA 4EPYA 1W35A 3VR5D 3LOQA 3DKRA 4RV4A 4UAJA 4P1ZA 5BPHA 4YR7A 1HDOA 4BEBA 4MIEA 2HUNA 1YL6A 5KQRA 1J70A 4LDJA 1KIAA 2ISSD 2IUFA 3IBYA 2G07A 1GKLA 3GC6A 2TMYA 3OKPA 4Y0VA 4BNHA 3DAHA 5FTKA 4O8ZA 4ZO8A 1ZY2A 3IOBA 1KMMA 3NIFB 1P73A 3M6WA 5L7YA 2BPOA 3CPSA 2D8AA 2A0UA 2IXEA 4O4JF 5CMLA 1KTIA 1WMSA 3QXXA 3RSLA 5LD2C 4TKVA 3T7CA 4ZYVA 1PO7A 4CW7A 1AF4A 4LECA 2K2WA 3AIKA 5CT4A 4YAOA 4UDNA 4BFYA 2DR2A 4A1FA 2O8NA 4C6RA 5IJ9B 3PXAA 3TZ6A 5A0TA 4CEIB 2J6BA 1GFIA 1MC5A 4ZYTA 5BR1A 3I01A 2YUTA 1X80A 1QO0D 4JLDA 1S2IA 2X9GA 4UTNA 1Z4PX 3U4HA 5IJ9A 4AZTA 4YTEA 5AM3A 2CVFA 2XJ4A 3KSMA 1G9TA 2YXLA 1JA0A 3G7SA 1FDWA 4K88A 1GV1A 3T5DA 1ADCA 5ALDA 1W5EA 4XWWA 1TVKB 4X71A 5LMZA 5K6AA 1GTL1 2XE7A 2JA1A 3C2QA 3UWSA 1BA3A 1F8YA 4JYPA 1A5BB 3B6JA 3W6ZA 2H59A 4HJRA 1FU7A 5AVJA 1K7FB 1LD3A 1DTSA 1JBKA 3I2KA 1N1GA 1TVKA 2ETVA 1YJBA 4GZ3A 5EEGA 5E6UB 4BNJA 3GLIA 3BMCB 4H3SA 2C0QA 2CXNA 2GRJA 4XVQA 1EVZA 3DOUA 4FKMA 5HIJA 1E3SA 1USVA 4M0EA 4PICA 4ZYZA 2HWUA 3ED5A 3LZ6A 4Q3EA 7MDHA 3KSDO 4TTJA 4JR2A 2B5WA 4OSOA 1IM8A 3L0DA 1I4OA 2Q7DA 5LN1A 1NT2A 3IIEA 2PUAA 3CUEF 1QHFA 4N0DA 3NBXX 1BA2A 3B9RA 5A2GA 1CS4C 2OTCA 4MKRA 4G1CA 1P2GA 1DUSA 3EVCA 3GWZA 1P4SA 1W96A 2WTNA 1K8ZB 3BWEA 3ICVA 3IVGA 4PC1A 3JVEA 1DQYA 3HA2A 4K9NA 1NF2A 1QIKA 3H6KA 4KXNA 1Z4KA 4HRVA 4PZAA 5EFZA 1N2BA 4CMAA 2ZAIA 1QO7A 2C2MA 3EVZA 4X97A 1EXDA 1SNYA 2AMLA 3X1DA 4F2DA 1YNOA 4GI3A 1W4LA 2PIDA 2XMQA 5K0TA 1R4MB 1P1CA 3HYTA 1BJTA 2FWNA 4HEA6 5F3DA 3H5IA 4AS1A 1KU6A 2XYPA 3BC1A 1JKXA 3N8HA 4I4TA 4JEIA 1SKUA 1H1TA 2HKIA 3M1YA 3V00A 3T41A 5FOWA 2CXPA 3PE3A 5LOVA 1GGJA 2H1IA 2P9CA 2HCBA 5INTA 2ZE6A 5EHZA 4F2HA 3IDSA 2I8LA 5JJ5A 1Z7YA 1DIBA 2PLFA 5THKA 2EFHB 2EGUA 5BURA 9LDTA 1XBTA 1ZH4A 2JGAA 1I2CA 3NEPX 5LM3A 1PLJA 5KNDH 3HKEB 2IWHA 2J9FA 5H4HA 3FOCA 2RGNA 4YN3A 4R1LA 2OXRA 5EJ5A 1OFUX 5D01A 3SC2B 3T5CA 2QQ5A 4G8JA 4A8TA 1K7EB 5PGMA 3OUUA 2WJ6A 1PHRA 4LF6B 1QE3A 2E48A 4RGQA 5JAQA 4K2HA 5DK4A 1JHYA 4DPLA 1EGQA 1C3VA 3H8WA 1O96A 4IZIA 2VUUA 4LKRA 2W6NA 4US1R 4HCJA 3VOTA 1YIOA 3Q8WA 4KMMA 5LQAA 3MZ0A 2UZ1B 1MX1A 1SVMA 5FYDA 3K0CA 4F3NA 1MABB 2BFDB 4OXNA 5KTKA 1YZQA 1UOQA 2OZLB 4WCFC 1S7GA 3RC1A 2N3ZA 1GTG1 3I52A 3K92A 2RCYA 1T0PA 3BZUA 2UZ1A 3GZ4A 1IHPA 1Q3HA 5FBWB 4ZQFA 3BA1A 1RZ3A 2Q8NA 2Z5VA 4ZRDA 4V0LA 4WLEA 2QD5A 2FSHA 4KI7A 3UHPA 1ZESA 3EZGA 4K9DA 4YV2A 1SKAA 1MAAA 1LJ8A 2YIJA 5B3JA 1IFXA 3VR4H 4ZANA 3WQQA 4E5MA 1KPGA 2CXTA 3AL2A 2B5OA 4LRYA 4S3MA 1T43A 1RWKA 3CQ9A 3KAKA 4LYYA 2Q4TA 1MEJA 2QTBA 3Q9NA 4L5CA 1NM5C 2X0DA 3TTXA 3C39A 4QDOA 3UICA 1AKEA 2Y76A 4LISA 3TOSA 4B7ZA 1XDWA 5ILGA 2J6CA 2G82A 1DEKA 1NASA 1U1EA 1WZCA 4IF4A 4IOMA 4BKRA 4PZ0A 3G9TA 2AOTB 3INTA 3DMTA 4KO8A 3JQBA 1TYZA 2QRPA 1YZNA 2XWQA 3ADPA 3BK7A 2BZ0A 3C8MA 3AFGA 4Q18A 2XIQA 4B6EA 1AV7A 3G82C 3FVTA 3I62A 2WQ7A 2YXPX 2GN0A 3QPAA 4V1CI 1QVAA 3GXOA 3AX6A 2NXCA 3C8ZA 5IKEA 5KX5A 2PWYA 4JLAA 1OI7A 1X19A 2WIAA 3NUGA 3OQHA 2OV6A 3QELA 3TTUA 2WHXA 1FXSA 1O0CA 1MB9A 2ZU0C 2GBLA 4IVQA 4LI0A 4F38A 3N0VA 6LDHA 3EZ7A 1P8AA 4FGSA 3KB2A 4QBIA 5K0SA 3MIIA 3HUUA 2J8ZA 3KSAC 1P5FA 1D2RA 1QVWA 1YDEA 1SXGA 1B93A 3ENNA 3E4DA 2VK2A 4KQJA 4CT5A 3GW8A 5FP0A 4YMUA 3IVRA 2N47A 2WT4A 4QPJC 2YWHA 3OQJA 3TSZA 4KIUA 1KYQA 4LZPA 4P82A 3ZWQA 1SU6A 1VLHA 3HU5A 4X20A 4XTRA 3GY0A 3P0FA 4CF5A 2HHHB 3WZ2A 3SEAA 1TA4A 1OA0A 2EKZA 2GEUA 3K53A 1UKVY 4L27A 1E1RA 2ZETA 3E05A 4FSXA 2OFWA 1DIOB 3NHZA 2D3TA 4GYKA 3SBEA 1MP0A 3WRXA 1PW5A 3L46A 4IX9A 1SPXA 4S12A 3SKVA 3M6AA 5J4YA 1W1WA 4KFCA 2DY0A 1IK4A 3FF4A 1RT9A 4I1VA 2C59A 1LPSA 3EZ9A 1QB8A 4KBFA 2CDAA 4GSLA 1XE3A 4LJKA 3OWXA 3DJFA 2A1IA 2HSJA 4BBAA 4PANA 4ZTZB 4QFDA 3OQ1A 1AGXA 1WMAA 2RHLA 3IOMA 3C3MA 2W6IA 3U62A 2XCSB 3IPCA 3I5YA 1AZTA 2W9XA 1YKFA 4IDPA 5REQA 4F4FA 4ZMSA 3Q41A 4W8HA 2OA0A 3T9CA 5IDVA 3PWTA 2EKPA 4M1OA 2F8TA 2JJYA 2YCBA 5JVDA 1V5EA 3O3CA 4RJIA 4DDKA 3F5DA 1WUKS 3HBJA 4EKIA 3OPQA 4R81A 3JRNA 4YR9A 2NX2A 2Y77A 1IVSA 3E35A 3UHFA 4L74A 3IR6A 1HF3A 2OB1A 5MDHA 3M0EA 5ERYA 2GEBA 3RK0A 4A82A 3GRYA 3FR7A 2OXEA 1K75A 4LOAA 1GITA 2WV9A 4FGJA 3L6UA 4MRMA 3AIMA 2I9KA 3WWCA 4H3HB 4K7JA 3E53A 4ED9A 4LWZA 4XD2A 3UAWA 4LHZA 1E7WA 1O8CA 3DVRX 4GOND 3HVHA 3Q6IA 3EWSA 3U17A 3TVYA 1XWIA 5AJTA 3DZGA 3UAYA 3LOPA 2YV4A 3KL2A 2BFWA 4YDSA 5BV0A 4BV3A 3PFCA 5KOJA 4LQ4A 2ZCVA 3N7TA 4L6AA 3GJ6A 4JXJA 3V1MA 3WGUA 1S2DA 2YN0A 2AEMA 3LE8A 3SYRA 2HUPA 3AJ8A 2IYVA 3IQDB 1G9XA 2Q3EA 3OWOA 4FOOA 3R8XA 3RG8A 3UEOA 5JTUA 3GEDA 3HXOA 3GEMA 1QJ4A 5AVYA 4WXMA 3ZVKA 3UH0A 2ECFA 1L5FA 2RKWA 4EZEA 3RJZA 4H3KB 4HPXB 4L50A 1E89A 5L40A 4FWBA 4R2WA 1T3HA 1AX9A 2WR8A 1X15A 3X1ZA 4P4NA 2VHUA 3IUPA 2I9PA 1LSSA 3PT9A 4HI0E 4RBNA 1TJ5A 4EGJA 3FNRA 4TXHA 4XLTA 4R84A 3WLRA 3DKVA 2QOEA 4F3RA 3U44B 4ZVKA 5K3FB 4IHJB 3TX2A 1HYGA 4A0HA 3QEOA 3O73A 3ZVNA 3GJQA 5I3CA 5TPWB 3TRKA 4O02B 1B8NA 3HRKA 2XVMA 3SHTA 1F4VA 1Y5IA 3AW9A 1SQGA 5B4UA 2GZ2A 5K3EA 2AJ8A 5LDHA 3N05A 2QMYA 1ULSA 4INAA 5TPWA 1Y4AE 4WWHA 3HY4A 2J0UA 3QKRA 1I0LA 2QR2A 4IILA 1HT1E 1ZEMA 3BDIA 4BMZA 2XB2A 4GR9A 3U7IA 3QKSB 5H70A 1WXDA 3GEEA 4UULA 3B38A 3H1PA 2JFQA 1ACMA 2Y1DA 2YIVX 3N0XA 3FMPB 2WMOB 4G8DA 4DBVO 1P7WA 2AOXA 1T0UA 2GM3A 1XTSA 4IDFA 3IV9A 1QZUA 3LLUA 3NRCA 3QBEA 1G17A 1L4EA 1Q84A 5K3CA 3VAYA 2GKGA 3ZW8A 2JD2A 4M8SA 4KIJA 2C4TA 2KLBA 2ODNA 3FNHA 3KKPA 2I5PO 3Q3GE 1I94B 5LQSA 3VAZA 2ATIA 4LDAA 5IF3A 3EE6A 4LPSA 3REQB 2CN1A 5K7SA 2E7ZA 2PSEA 2J3EA 4HO1X 2ZS9A 3WQBA 1NUAA 2OMKA 1E6KA 4ENWA 3U48A 4MQ4A 4JJ7A 1P61B 3A1VA 3UJDA 4FDAA 2RGBA 3SZUA 4X6LA 3SHQA 1YO6A 3EW7A 3HS3A 1YS4A 4PVDA 4I1RA 4NS1A 3G2OA 4MDFA 1O2DA 5TB5A 3X2EA 2NUTA 1GV0A 4YA6A 1ANKA 1T24A 2FFJA 4Y30A 3BWYA 3ZIAA 3R5JA 2D0DA 1TTTA 4A0FA 1VA5A 5TIIA 1ZMTA 3FRIA 1N0UA 5IH3A 4GUAA 1RQXA 1GQOA 2J3QA 3SJCA 1V3TA 2G9ZA 2Q5QA 3NBFA 4MWSA 3VPHA 3PPYA 4BFXA 3ZK8A 1I7NA 1Q83A 3P2KA 3A3OA 2WHPB 3ND9A 3COSA 1NF9A 3E9DA 3CKLA 1L4BA 4TSRA 4AMVA 3FCAA 1G8PA 1RQ2A 2QGNA 3I9FA 3IQIX 4O4IF 3PEEA 2YZ2A 1AXRA 1X8JA 2O0KA 4WXPA 3PKJA 4NU0A 2ATEA 2QENA 1XZ8A 3OOWA 3ET4A 4NNOA 1BE8A 3K0HA 4HUJA 1C5KA 2HYIC 1EP1B 3GAAA 2O3TA 1JPNA 3K70D 3F6PA 4CBVA 2IIVA 1J9ZA 3F90A 4MROA 4MYHA 4NDZA 1KY3A 4AJHA 3ROMA 4ZN6A 2EU8A 3QMVA 5ALGA 1CYDA 1DAIA 1TF5A 3IT2A 3KHUA 1NN0A 4UVIA 4X94A 1SUBA 1UMCB 1OXKB 2D5IA 5AT1A 1AHIA 4ZOCA 5KTPA 1OJLA 2J5QA 2OQIA 2XPCA 3QEAZ 1ZHOA 5KU1A 5AW3A 1UMCA 1PNVA 2VATA 4YRFA 1J7JA 3HJFA 3Q8MA 2HV9A 3CBQA 3O4HA 5CU7A 5D7BA 3TDKA 6ABPA 3OTGA 4U6SA 4YFYA 3ELYA 5DBGA 2D0PB 2C5LA 2J0VA 3PC8A 4NCIA 1KXJA 5IKMA 1RRKA 3BQNB 3N2ZB 1PR0A 1JDBB 4BKUA 1INLA 4RH3A 4RY2A 3MSXA 4JBIA 3K6SB 2O1SA 3QMWA 2GA8A 1QAQA 1R0SA 4OK6A 1I0IA 3SLGA 2AE1A 3DOOA 3B1JA 3LHIA 3KNZA 2GN9A 5EZYA 3VI4B 2P30A 3KKQA 3VFDA 1HDGO 1T1JA 4QFBA 2Q3JA 2VJLA 4IS2A 5IN5A 3LDAA 1DKNA 1GA4A 1E1RD 4UE3S 1A9SA 4AZ0B 2ZUUA 4CKBA 2AXEA 3H87A 4FFVA 2HJVA 3EULA 3FI9A 4TV9A 5JANA 1BN7A 3LXUX 5TQ2B 1FDVA 3MTGA 3DZJA 1ICEA 1PFGA 3HJCA 4UTZA 3T6KA 1D9XA 1LVHA 2VYCA 4D74A 2UXBB 3IFSA 4EYOA 3RARA 1LEHA 1RKXA 4WNCA 3ZDFA 1CZRA 2HAEA 3TTWA 3QWIA 2QORA 2VEDA 1BZYA 1E2NA 1J2JA 4NFYA 4CKEA 1E32A 1NLMA 3SYTA 3ZXXA 3X1YA 4GICA 4B09A 5BV8A 2BMWA 4D7AA 2YRXA 4EQ6A 4B33A 2PZFA 5AHWA 1U7ZA 4QPPA 2EWMA 2I4RA 4AO6A 1HSOA 1H4SA 2DHRA 1XK6A 5E4JA 1JQLB 3M33A 1GA6A 3AESA 2H1HA 2HJ9A 1P17A 2I3DA 1RQGA 2NVBA 2CFTA 2QTTA 2ZYDA 1XWFA 5CVCA 4ETIA 3ZWPA 4EW6A 4LJYA 1GPKA 4W6QA 3AM1A 1KOJA 4HWOA 2GF2A 5LC1A 1TRHA 2A7QA 3EVFA 1RQLA 2ACWA 3PQCA 5H7XA 3KUXA 1KWKA 2Z56A 3FHTA 1WOYA 2FSVA 2JK0A 3C0KA 1O89A 4J4TA 1ENZA 3BSYA 5KPJA 1DT3A 2G1JA 4R1QA 1DEOA 1GCAA 3QVOA 2YC4C 4CMHA 3DD5A 1AGNA 3E82A 3R4CA 1JHUA 3RW9A 2I1QA 4NS4A 5LA6A 3ZU6A 1QPBA 3OSUA 2HT6A 4LRWA 3GELA 3HTXA 1E98A 3VPGA 5LOVF 2G0NA 5H1YA 4RQTA 2HSGA 4XX0A 3S2SA 2ZUSA 4AF8A 3QXCA 4GMHA 3BGIA 2OBXA 1DJLA 3OUZA 3ZJ5A 2VQ3A 2YTZA 1J25A 2PS1A 3LW7A 4W82A 4M1MA 3OX4A 2OBLA 2PZMA 2J3MA 3SZRA 4IXNA 3ENKA 1HX7A 3V46A 3L0YA 4I1PA 3I30X 3U4AA 5WRFA 3NU1A 2JRCA 4ALLA 2GPBA 5EE3A 2A58A 3A4NA 1XJQA 3DTNA 3D4OA 5EKSA 3ZD6A 1OR8A 4RGVA 5EG5A 3W0LB 2P5SA 2AJTA 1KY4A 4NBLA 1VCMA 3RIYA 3LBIA 1K8XB 3THXA 1GUZA 2BR3A 1PSZA 4XEHA 3S0JA 1JS1X 1JI0A 3IOEA 4MLCA 5AP9A 3TH5A 1MAVA 4ZHSA 4MVCA 2HXSA 2XB9A 5LPNA 2FEAA 3BXOA 3W79A 4E4TA 3ODGA 1I7PA 1DAOA 1PKEA 5ALYA 2E6KA 4HDRB 1F4PA 2X23A 1NBEA 1H2FA 5L51A 3PX2A 1SCUA 4JJ8A 3PHHA 4PM4A 4OCZA 4CG1A 1YMUA 5JSZB 3KOOA 4JENA 4CPDA 1T1EA 3N28A 2ZT8A 3PHJA 2Q45A 4P58A 2Q5EA 4RF5A 3TLZA 4A26A 4ZPJA 4OGWA 4D9FA 2XMSA 3QX8A 3KKZA 2EZ4A 2WKWA 4FEAA 4GVXA 1VI6A 3W5VA 1M6NA 4QELA 3ZXYA 3PJEA 1NVDA 3ENQA 4BDSA 3W5JA 2EL9A 1XCGB 1ZJYA 1DNPA 2HWWA 2PYDA 2ZYVX 2JK1A 3L0BA 4OGLA 4RHEA 5G4KB 4K3VA 3TKLA 3TLJA 4YUZA 5KB3A 4HYQA 1F9AA 4RKFA 5HFNA 4K6FA 5DHUA 2JBAA 2IEGA 3BFKA 3DZFA 4ECAA 2ZT6A 2YJ3A 2CCKA 2XAUA 1NBOA 3FX2A 3MYYA 4ODIA 4YDRA 3TE6A 4B5LA 5AVZA 3PC6A 3R0IA 3ZJ4A 3GLRA 3NBQA 4R9VA 1XTRA 2F00A 4TKUA 1P1FA 3GLFB 5GONF 3IEUA 1JU4A 3Q0EA 4XSGA 1FDRA 1K27A 1WXHA 1M8KA 2ZE5A 1NURA 1T6ZA 3EG5A 1NSTA 2HWKA 2A5YB 3I9V1 4G1FA 1E2KA 5H4GA 3IUYA 3JQRA 4KVGA 2GD2A 4JVNA 3GLFA 1GVHA 2YV2A 4LWPA 2Q4RA 5K0JA 3W90A 3VM6A 1VKOA 3FSRA 1U9JA 3UZUA 1FQWA 4Z86A 1T36B 2R4UA 2F1RA 1BQ4A 1C9JA 1MQSA 2V3WA 2X41A 4GZ6A 2BP7A 3KPWA 4JCOA 3EIFA 2G04A 4BNMA 4YGXB 2GARA 2V59A 4BWVA 1P19A 5LP6F 1FX1A 4MQUA 4CU5A 1S3IA 3SCZA 4ME6A 1L2TA 3DFZA 3TLGA 3SJAA 4DJTA 4JOQA 1K5HA 3E9YA 4UXIA 3NI2A 4Y18A 3WL3A 1MKYA 3NUZA 3TVTA 3NEAA 4CN9A 4KUHA 3QUQA 3CM0A 1H5UA 3BTVA 2FVYA 1AKQA 3H0CA 3LLCA 3LPCA 1AO0A 4MHTA 4MIYA 3IUJA 4L4UA 2OAGA 2V7BA 3U4QB 1DL5A 2VPYA 3B1KA 3UY4A 3U4DA 1WXXA 3BXHA 1AKTA 2F1HA 3WX0A 4BUCA 3R41A 1NR5A 4N8DA 1H65A 1ONBA 3PQEA 5KYVA 1QPGA 2FJPA 1IQRA 3FFAA 3PI6A 3GJ4A 5BSVA 1TEHA 4QVKA 4MVYA 4X3PA 1Q0TA 3CR8A 5JI3E 1W5TA 4C0HA 4PV7A 3ZLUA 2HR1A 3IESA 5JNVA 1ZJJA 3GLGE 2Z1DA 1D0VA 3F8SA 1NHWA 3O93A 4P7JA 5A1TA 3EUWA 1YC2A 1CEYA 3EDCA 3KWLA 1P5HA 1OX4B 2D74A 4DLRA 1VYTA 3AFMA 3K0BA 4XLLA 1E2EA 3FIUA 4LSWA 1SR8A 1N6HA 3MFYA 4LXTA 4EUNA 5C3UA 1G4HA 1PE0A 2J87A 1QK4A 2QTRA 3CW9A 3UKDA 4EQZA 4GPBA 3WV4A 3E70C 2E18A 1ACJA 3NG1A 1K4MA 3R75A 3VZPA 3A70A 3QOXA 4DJ5X 1J23A 1UPCA 3CNEA 1MT0A 4UUBA 4GPEA 5HPYB 1Z6ZA 3RVQA 4QA9A 5DYNA 3VH1A 5GZ3A 1W49A 2PR2A 3LT2A 2A92A 3NALA 1M6HA 3I12A 1NW3A 1KFCB 3C7CB 2NZ2A 2EQ5A 3ES9A 4UHBA 4PCUA 4GC9A 1ZUNB 1UT5A 3SYMA 5KVSA 2VZ9A 4JSRA 3PIDA 1YVDA 2Q5FA 4DEXA 3CEJA 4HH3C 5HGJA 4C3ZA 3DMDA 4I1OA 4AP5A 2XMRA 3BVPA 5FPPA 1NXWA 3REOA 2GXAA 1SG0A 3D8SA 1OF1A 1QCZA 3CSUA 1AZWA 2HU7A 5EWLB 3RS3A 3Q98A 2PMCA 3G1UA 4LDRA 1GILA 4U7HA 1ESMA 4IIFA 2ZB4A 1RAAA 4OQLA 4CF4A 1NRWA 2QEQA 1IQUA 3CCCA 3OG9A 3RU9A 1ECGA 4C6HA 4JJEA 4JP5A 1JFTA 3KYBA 3CIFA 3UMMA 1I3MA 3NAGA 3AVWA 1ZCZA 6REQA 4KRGA 2Q6OA 2WIJA 2P9BA 2KSQA 2QN8A 5JH7A 1CQZA 2Q27A 1WDMA 4FNAA 4UQOA 1KZ9A 1H6DA 5A4JA 5F23A 4H35A 1R4NA 5HKLA 2WTMA 1W1UA 2HF2A 4JI0B 3VU9A 4F9EA 1Z25A 3CBGA 1N0HA 1EUZA 1QHHA 4MV9A 3D3EA 3SFZA 1G8FA 4YRTA 3WKCA 1U3DA 3S7TA 4B31A 1SXJE 1ODSA 4ZEMA 1PEYA 1WXWA 1O54A 2P3SA 5IWCA 4KNWA 1Z16A 4HDAA 3L1HA 2I1WA 3OMLA 4YJFA 5IFLA 1J9GA 2C97A 1IG0A 5DGDA 3IAM6 2GPTA 3FCSB 3QVXA 4OQZA 1W93A 5AR1A 3U3OA 3SF8B 3NHYA 4AURA 3G49A 3IB3A 4Y6PA 4CM7A 3TNFA 3GAZA 5JNLA 4ROTA 2Y1EA 4NKRA 1I1OA 2C9ZA 4BO2A 1YQDA 5LIRA 1VJ5A 3W6UA 3HB0A 5LLSA 3X2SA 2P27A 4RWEA 1HNNA 1JDSA 2DU8A 4XFJA 1Z73A 1LK5A 1ZLYA 1N36B 2NTYC 2VOJA 4AUMA 1AZSC 1K7XB 1QQTA 4OD0A 2QUIA 1G98A 4FHEA 2PNJA 4CL3A 5JAMA 1JAZA 3QMMA 2AC2A 4MPPA 1P4HA 1T9KA 1YT5A 2HIGA 2IXDA 4HAZA 4V2UA 3WNQA 1EGVB 5EGSA 1WB9A 4QYXA 2EVWX 4ZC1A 3L1JA 1JNXX 4ZVPA 5AW4A 3ZXIA 2WINI 1UM9B 4Z4FA 3OQBA 3G9QA 4QOHA 3V48A 2DSTA 4JJ6A 1FTSA 1XTVA 5AO9A 3Q9LA 4JI3B 5CDGA 4FT2A 4DPMA 2BKEA 4JT9A 2IXBA 1UM9A 3C3XA 1LTQA 4MR8B 1XEWX 2X9LA 3HJTA 3O1HB 4KXUA 3KELA 1H85A 2LW7A 3QX7A 2OT3B 4ZT5A 4LF7B 1B00A 3K5IA 4LZOA 1HRDA 3SU8A 2AN9A 4D44A 4ZQCB 5ALPA 4ZOLB 1BEZA 2MSCB 4LS3A 1HYHA 1ZMRA 2V3VA 2X0NA 3CB2A 4NYJR 4RMIA 2C4WA 4JXKA 4PX2A 4DYVA 2VKTA 1NTRA 2QRQA 3MBKA 1TMGE 1T9BA 1NJFA 5F7ZA 3LYAA 3T3MB 4R2MA 4QVIA 1TAUA 4GWKA 1R9GA 1LQUA 2EERA 2HQOA 4KUEA 1TL7C 1B26A 1YTLA 1KSGA 3WDLA 5J2UF 5JDIC 2XB6A 5KTMA 2ZXFA 4TS9A 5DLPA 4DCPA 4REMA 4EI8A 2HA2A 3ZNPA 2Q6TA 2BTEA 3CVYA 3OZ7A 3R4VA 2CEKA 3E2MA 1E9BA 3GG9A 3TBHA 1QZ3A 3Q1LA 2G1UA 2AIRA 2FG5A 5JS7A 4MYCA 1QF7A 3C24A 4GOJA 4W5TA 2J5KA 1GG9A 3GJ5A 1T8RA 2JLAA 4NY1A 1DZIA 3QF4B 4JSTA 4BHTA 1U0TA 3D02A 2NO6A 2XQIA 3AEQA 2C98A 3DW1X 2H8KA 3DQPA 3NJ4A 4JT2A 3F7NA 5FFMA 2NO1A 3FCXA 2OMEA 3IMCA 5A0VA 2WM2A 4DA8A 3IE0A 3GEBA 3H86A 3W7BA 1XLWA 1H9CA 3PVZA 4MVJI 4URVR 1LF5A 1RTTA 1RYDA 1Q3KA 4HGPA 4LCJA 4QDZA 3PUZA 1EVYA 1HMYA 2E9SA 4X84A 1PL7A 2G72A 4AICA 2WTBA 1SBCA 3G2LA 4HD8A 3TECE 5A1JA 2WWYA 4G6ZA 1UJ6A 1V16B 2MMCA 2YMLA 3BSWA 4KWIA 1R88A 4H3VA 3ZLJA 4QOIA 4C7BA 1GNTA 1QU3A 4GZ5A 1Z7BA 1S2GA 2C4KA 2LKDA 2X86A 1E6EA 2I2BA 2IUSA 2ZJ6A 2IZZA 3W5IA 1TYDE 3AHEA 2W0SA 1QG2A 3QPVA 1O4WA 4KC0A 2QW0X 5A9TA 1J8MF 4R2IA 3WL5A 4AC9A 3EGXB 4JBNA 4J3NA 5DHRA 3I1JA 3E5MA 3BRCA 3ORSA 5LP6C 1E4EB 1M9NA 1C4XA 1MENA 3B9PA 4B40A 4MS1A 3TR0A 4LBZA 4YP6A 5BORA 3IR5A 1A1VA 1VPDA 5ADWA 4C5AA 2ZBEA 1K4KA 3L6DA 4GMFA 1OU0A 3O2SB 1JF8A 3TB6A 3WNVA 3O8QA 1T0BA 2ZRDA 4ZO6A 2ZSIA 4B3XA 4RXTA 4IIDA 1KA9H 4XKJA 4I4LA 2Z8YM 1SVUA 2BGMA 3TEJA 3NBYC 4CCYB 3RK1A 2P78A 1QHYA 4H4CA 3BXGA 1ZUHA 1ZOSA 4UEWA 3ZC3A 1H2YA 1QP8A 3EXHC 4ZAZA 5ESWA 4US0R 4HV4A 1H2ZA 1H4QA 3DM5A 1BEUB 3DZIA 4F2WA 1KQGA 2AW5A 4WXRA 4BQFA 1DAMA 2X8BA 1FSZA 2OSBA 3BFVA 1T9DA 4UMEA 3SR4A 1XZAA 2Y0EA 3Q10A 3V2IA 4OLJA 1G4UR 4DLYA 4RS4A 3LP6A 3SK0A 1G38A 1YK0A 4HPJB 3KXKA 3HR4A 1NW6A 2BFCB 3QEMA 4CTMA 4HNUA 1TO1E 1ZU4A 2JIQA 4BFZA 1FXUA 3PD0A 4N5NA 3DMRA 1CY0A 1V2GA 2C1EA 3EFOB 5FUWA 1Z62A 4H7HA 5IX8A 1QGOA 3KQHA 2X9QA 2XWSA 5G0TA 4H6VA 4HPWA 1QH0A 1WCXA 3VVMA 1JDPA 2ZYIA 3CT6A 5BN3B 1ZM2A 1LRKA 1N5DA 1RM3A 1EIWA 3A9SA 1FA9A 1NU6A 3B7WA 1VHDA 1W94A 2E4YA 2RI6A 4J0HA 4P5EA 4PIMA 4YBZA 4AWXA 1QGUA 4YXWA 2Y1LA 2OPBA 1YB5A 5DYGA 1FTQA 3W8RA 1GPH1 1ZZGA 4BO9A 3SFVA 1KYXA 5JR3A 4KQ9A 2C9BA 1Z06A 1P2VA 4MJ7A 5KWVA 2BLLA 3CF6R 1JLLB 3MD0A 2L19A 3PLNA 4E94A 3NP7A 1USIA 2J7PA 3JYLA 3E15A 1XL0A 3EZFA 3MJTA 1K8RA 3PGLA 4DNOA 3F6RA 2IV3A 3T7DA 2AMFA 2QIOA 3JD2A 3PEVA 3GF4A 5THXA 2P6PA 4H1TA 1P7VA 1T2AA 1JMKC 2YXDA 1NZJA 2YRFA 4X5OA 3GB9A 3PQ8A 1GSHA 3TQIA 3D3QA 1XTTA 2AC7A 1NI4A 1VKRA 2H2DA 3CVVA 1I6LA 4JBYA 4YX9A 2IH5A 2BZSA 3F4KA 4J94A 4DQDA 5K0GA 1GGFA 4X62B 3WMWA 2YKGA 1D5CA 3ND7A 1XKLA 3FLAA 5BRNA 2CYAA 1M8PA 5CJPA 3NTQA 1I1HA 2ZBPA 5BMVA 4UFOA 1R64A 2DWCA 4CETA 1W75A 2BT4A 4QASA 5FOTA 1C4KA 1K63A 2ZYHA 2I2FA 4EX7A 5C8XA 5C52B 2VJMA 4KXVA 3WWYA 3PJDA 1RWPA 2GWHA 2OZKA 4ZVNA 3MAJA 2G8NA 3KPUA 5FTMA 4B17A 1PKXA 3H2BA 2AK3A 3HJNA 2J3IA 3FJYA 5EIXA 4WZAE 3Q85A 3C4VA 1HE8B 3PEFA 4F6RB 1DDOA 4H0CA 5BPFA 3CRQA 2R00A 2ZTVA 2GSDA 2MYUA 3U5ZB 2O8FB 1L4YA 1T4BA 3PT5A 2JGDA 4KW7A 1VG0B 4RTJA 3A3YA 1IWBB 2R97A