3V4OA

Human malt1 (caspase domain) in complex with an irreversible peptidic inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
234
structure length
234
Chain Sequence
DQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 87
structure length 234
sequence length 234
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4oA00
1I51A 4FDLA 4N6GA 2CNKA 2H65A 5IAJA 1QDUA 4QTYA 3GJRA 4QUIA 2QL9A 1NW9B 2H51A 2C2MA 1PAUA 3V55A 3V4LA 3SIRA 2CJXA 4NOLA 1NMQA 1SC1A 3GJSA 3S8EA 3PD1A 3K7EA 2CDRA 3GJQA 4EHKA 1GFWA 1SHJA 1NMSA 4QTXA 4NOKA 1RWOA 1PYOA 3H11A 4I1RA 4AWBA 4AWAA 1RWNA 5LUBA 3H1PA 4IYRA 1RWMA 3V6MA 3PCXA 2QLBA 2H5IA 4PRZA 4EHLA 1RHJA 4I1PA 1KMCA 4ZVQA 3BIJA 4ZVUA 4QUGA 4HQ0A 1SC3A 4D3YA 5LU9A 2XZDA 1K88A 1I4OA 1RE1A 4EHFA 5IC4A 3SIPA 2CJYA 3D6HA 4JJEA 2CNLA 3S70A 3P45A 4N6OA 1RHQA 3IBFA 1IBCA 3NR2A 4JJ7A 4IEFB 4QU8A 5H0IA 2XZTA 4LSZA 4N7MA 1QX3A 3KJNA 4FXOA 3H11B 1RHMA 3EDQA 1SC4A 2Y0BA 2FUNB 3KJFA 2WDPA 3D6MA 3DEHA 3ITNA 2HBZA 4NBLA 4ZVPA 1QTNA 2H4YA 4HVAA 4JR0A 4QU9A 1RWPA 1CP3A 1JXQA 3QNWA 1RWKA 4QU0A 2C2KA 2XYHA 3UOAB 2DKOA 4DCJA 4QUJA 2HBRA 3UO8B 1NMEA 2QLJA 3GJTA 4M9RA 4QUEA 4ZVTA 3H13A 3R7SA 3V3KA 2J30A 4NOJA 4PS0A 3OD5A 2CNNA 4JJ8A 4NOMA 3EDRA 1SHLA 3E4CA 1M72A 1RWWA 2H4WA 2HBQA 2FQQA 1I3OA 3H0EA 4JR2A 4QUAA 2CNOA 3R7BA 5JFTA 1K86A 2C1EA 1RWXA 1ICEA 4NBNA 4QUHA 3R5JA 4JR1A 1GQFA 2NN3C 2AR9A 3R7NA 2Y1LA 4D3XA 5IASA 4EHDA 5IC6A 3KJQA 4EJFA 4HQRA 4ZVOA 2XYPA 4PS1A 2J32A 1RHRA 1CVRA 5IBRA 5I9TA 4AW9A 4QUDA 4JQZA 3D6FA 4QU5A 2H54A 2C2OA 2H48A 3NS7A 4EHAA 2HBYA 4FEAA 4N6NA 4JB8A 1RWVA 4FGUA 5IBCA 5IARA 1F9EA 1RHUA 2C2ZA 4DCPA 2QL5A 2XYGA 5IANA 4EHNA 4PRYA 5IABA 3NKFA 3V6LA 5K20A 3R6GA 4ZVRA 2FP3A 4D3ZA 4EHHA 5LUAA 4N7JA 5IAGA 3RJMA 2QLFA 1I4EB 3V4OA 2H5JA 4QULA 3PD0A 4JQYA 1RHKA 2K7ZA 3DEKA 3R6LA 5IAEA 1BMQA 3IBCA 4DCOA 3DEJA 5LU8A 4ZVSA 2J31A 5IAKA 5IBPA 3R5KA 1F1JA 5I9BA 3DEIA 2P2CA 3P4UA 4NBKA 4N5DA 4QUBA 2J33A 2QL7A
chains in the Genus database with same CATH superfamily
4V0SA 5EN4A 1WMSA 2G9VA 1KZ4A 1QQ5A 3G5LA 1PL0A 2VSFA 3WB9A 1D0VA 4JDUA 1A7AA 4TMXA 1E3SA 2Q4EA 5JXHA 4K8RB 3ZC3A 4H35A 4IXTA 5K6RA 3CX3A 4X92A 1NJFA 5EQFA 1JE1A 3O4VA 4Y7CA 3CSUA 4ZEMA 1CDEA 5T64A 4ER3A 4HNSA 4M0LA 4F46A 4D02A 4MQBA 3WAGA 4PM4A 1PR3A 1O77A 3NBZC 1SBYA 4EYGA 5IT0A 1Q3KA 1ORVA 4I50B 3K2QA 3AJEA 1YKGA 2JLBA 2P3LA 4U6NA 4IUDS 3OFKA 3U4CA 2VA8A 3L82B 1EBFA 1EXNA 4BP8A 5KU7A 2M9MA 2VEOA 3OLCX 3AVPA 4IVNA 1B15A 2HMSA 5E1BA 2NGRA 1JL3A 3DVAB 1W7AA 1OGJA 2NVUB 1NE2A 4G4SP 2HRZA 1PSZA 1OPXA 2LD4A 1RM4A 4ZVQA 4LWPA 1JB9A 3NDPA 1V4VA 3OKFA 4KXMA 4O63O 4FYMA 5CYFA 3Q5EA 1KMHA 3SP1A 3T9CA 4CQLA 3CW9A 1WCXA 4S35A 3UFXA 3MLAA 3HBLA 5EP3A 2PH3A 3GGCA 4UTRA 4Y2UA 4B71A 3FPCA 1XMVA 3LZCA 5B37A 4JT8A 3H2BA 3RQIA 1YL7A 5C81A 3AGPA 1S01A 4J1TC 1PLLA 4WMLA 2QYOA 3KVVA 3E5HA 1UZUA 4W5HA 4W6ZA 1IY0A 1NR1A 1JIUA 1KK2A 5HPYB 2YMLA 3RVMA 5C3MA 3A05A 1JTVA 1Z6XA 3MAAC 3OOJA 1JVBA 4RV4A 3HYLA 1P2SA 3NRBA 3DUFB 1UKCA 1JFVA 1W5FA 1ORHA 5FV7A 2LCFA 1FLNA 2BTQB 1Z2CA 5L6LB 4M9RA 5HIAA 4IJWA 3PGJA 1CULC 4P92A 4BO4A 2RGEA 2D2VA 4BRUA 4EO7A 1PSWA 3FDXA 5DJ5A 3V8NA 3LX5A 2ZAIA 2XHZA 1JAZA 1H1TA 4KQIA 4TGLA 1KQGA 3GT0A 1FXWA 2ZDHA 3TTTA 2RGYA 1WXEA 2JGDA 2YN0A 3M5PA 1SXHA 3RUIA 3J7TA 4CFYA 2B1IA 4D82A 5C8XA 3GT4A 3FTNA 5ITSA 5EIBD 1YJCA 3WRYC 3U3JA 1Z38A 2OXCA 4D3DA 1D2HA 4F8JA 3GJ7A 4W5OA 1NBMD 2NIPA 4JOQA 1R6BX 4LNAA 2O8VA 2J32A 2PBZA 1GU7A 7REQB 1KBZA 5T67A 5EZSA 3CPEA 4JLMA 4JKYA 1NFRA 5I9TA 1BHO1 1QIEA 1VYUA 3HYCA 3MWFA 3HDYA 4PE5B 2OFFA 3ZV6A 2WWRA 3L0PA 1J0EA 2CY0A 2FPGB 4AZ0B 2OYRA 3ZCXA 4JK3A 2WHXA 3RBAA 1KJQA 4KIFA 5E2IA 4PXYA 2ZSHA 4RKYA 1T8SA 4UXJA 2I6GA 5LQKA 4DA0A 3JX9A 2P3SA 1T0IA 3HUTA 3W5UA 1X3LA 2AZ4A 5KMGA 2JRCA 1Z75A 4C78A 5HF6A 1WVIA 1U3DA 1YRBA 4JBNA 1XROA 1D6MA 4WXHA 4E5NA 1FP2A 2JFYA 3HGTA 1KWKA 4OXYA 1J2UA 4DPMA 3VPAA 4BMYA 1V96A 4MUMA 1MW8X 4HZUB 1XTVA 1G19A 4M9ZA 4YRPA 3OEHA 3I9V1 3AUJB 2ZVPX 4CMKA 1F2UA 3HLKA 4BAGA 3L3BA 1JQLB 3PUYA 4MW4A 4D9FA 4F5DA 1VHDA 1YMVA 4B6PA 1F4VA 1KAHA 1NXVA 5BSTA 1EA5A 3PGXA 2XKKA 3EHEA 2EFEB 2D1QA 3GJXC 5BQ5A 1ENOA 1EZ1A 5KTMA 1FMTA 1XTJA 4LFBB 1RWMA 3NHWA 1JR4A 1VPEA 2C5FA 2NSLA 3K1YA 1L5SA 3KS9A 4ZOCA 1WQ1R 1EFAA 4HNHA 4LJ8A 5JMTA 2AW3A 2AVNA 2J07A 1Y42X 3OZTA 4M8NE 4P36A 2XVYA 3AIKA 4OQFA 1IUKA 4D74A 1HEYA 1L7OA 1R0LA 4D0SA 3QYPA 2QRLA 1PU2A 4L9AA 4LDQA 4BO2A 4N6OA 5ITWA 3B1XA 1W49A 4WLFA 2HWXA 1T13A 3DO8A 4XVHA 4B8YA 4JJ7A 3LK7A 4BNDB 4LSZA 4BMPB 3R41A 1D2MA 4NPHA 3ROXA 2VBIA 1FTSA 4B85A 1M74A 4NYMQ 1NDQA 2XNHA 3SU8A 1LDMA 1N0VC 3DQQA 2O8CB 1PK8A 1YB1A 4E07A 1U5BA 2OQVA 2ZLBA 1JJAA 3I04M 1HQCA 3I1IA 3U3ZA 1JNYA 5HKLA 3VAAA 3VU9A 4X44A 4UZSA 1LFAA 1JQ5A 4L0QA 1AUOA 1Q95A 4KO8A 4LDJA 3NX4A 1P77A 3IUBA 4ZQCB 5JZ9A 2WUEA 2JFOA 2DFDA 3AP3A 3IUQA 4G5FA 1OZ0A 2YWEA 2EW2A 3EB9A 3VH1A 5A5VA 1E5VA 1KIFA 1IUPA 1L0BA 3DE1X 1WD7A 3WGJA 5C35A 3QK7A 3AWIA 2JH8A 1HOTA 4X1YA 4WCFB 5DPMA 2IYEA 4PO9A 4UMDA 3L5OA 4M1SA 3HZRA 4FUQA 3QOWA 4MKZA 2HSDA 3FPAA 4W7HA 5BSUA 3VKWA 3RYCB 4L22A 3D0KA 4B09A 1AHNA 4XQCA 4BAUA 1E2PA 1U0LA 1IHPA 5KTYA 1L5ZA 2AH5A 2WHRA 2BF7A 3D0OA 5BPFA 1QP7A 3OOHA 2II6A 4G2TA 1MP0A 3C3JA 4HPWA 3MMZA 3G9XA 3E8XA 1H3EA 2G04A 3V4ZA 4INPA 3ROZA 5EP1A 4Q00A 1HTTA 3B20A 4WX2B 4KZPA 4EX7A 4LCEA 2GPYA 2I34A 3EULA 3OJ0A 3QNMA 2CVOA 4KFSA 4KDRA 1CP2A 5KYXA 3VYRB 4YC7A 1L6RA 2Z8XA 5BQXA 3ZUPA 2B36A 4FR5A 3KEQA 2XMCA 5A3JA 4GKVA 5DNYB 3R3ZA 1PJ3A 3S1AA 1KVQA 3CJQA 4RVDA 2PUJA 1GEEA 3C24A 1Y3IA 5PNTA 3T41A 2HMWA 2XXBA 4X7RA 3U4AA 3VTKA 1OT3A 1XHEA 4V0NA 4DDMA 4DNOA 2ZJAA 4QQNA 1G5FA 2XNDD 5FX2A 5LP6F 4URXR 1ISFA 5CX4A 5FYDA 2WSBA 4RZ2A 5KVCA 3JQ8A 3VVBA 1N5LA 4XVUA 2ZPTX 4X8LA 2JDID 1F1BA 4GMXA 1G17A 1E5XA 2ZXEA 4C20A 3TLCA 4CMEA 3Q72A 5IJ9B 3WK4A 2EWVA 4KXYA 3ZD9A 3AR5A 3Q7IA 1F8FA 3E22B 1JVNA 4L9RA 4H7KA 2PMWB 3U2QA 4EF4A 1Y3AA 2PMDA 3AKCA 5U4XA 4DY4A 4ZO4A 3OO0A 1K7SN 4A6DA 4F5WA 1ZAYA 4LYFA 1U1EA 3IX7A 4TZTA 5GOTA 4CHGA 1AQYA 1L7NA 1RIFA 4WT7A 4B7UA 5J2UF 4WKOA 1LK0A 4LJ7A 3PC6A 1QB8A 1HLPA 1QYRA 3C3PA 3JARA 3T7EA 1PTJC 3SQDA 3F6EX 3TLGB 3UJCA 3LT1A 1VPWA 4LF8B 4J0GA 2JIQA 3NEYA 4FHEA 2B69A 4LOIA 3PLRA 4JL5A 3RJZA 4WCDA 1XDSA 1SJ9A 2JHAA 1PQUA 3DYIA 4LNUB 4R7TA 4PLWA 4PCVA 1G2PA 1L9KA 1NQ5A 2O7VA 1N2GA 1QOPB 1A2OA 4O1IA 1Y33E 3V8RA 1NNLA 3W3AH 4YXWD 4R41A 2G5CA 1KHTA 7ADHA 1QVWA 2CUNA 3K72B 4Q3CA 3JALB 5GQSA 4H0NA 1S3FA 3S70A 2IVFA 4GI2A 1U7UA 2YFQA 2RHDA 5CVVA 4U2FA 3FRJA 2QNIA 1CDDA 2JGAA 1SG6A 2QRVB 1NAHA 2JAOA 2VN8A 5CUQA 4RK0A 1SC4A 3TOXA 2IU4A 5AKZA 1UP4A 4A91A 1VSUA 4FFLA 3RS8A 1XWWA 3C3XA 3GNSA 4TOIA 1NJ2A 2I8LA 4I1OA 2W00A 2W6IA 2YBDA 1VG0B 4WY8A 5HCIA 1JSRA 4ZYZA 3EGEA 4J2OA 1ESEA 4ETMA 2CNWA 4LE2A 3MAJA 3WBFA 4BRWA 2REBA 2ZZMA 1DBPA 5FP0A 2X58A 1UOQA 2A0WA 4DRXA 4OBWA 2OCGA 1ABBA 4HXEB 4JJ8A 2Q1WA 5DHRA 1SCKA 1C7IA 3QI7A 4PSDA 5ITZB 4L85A 4XWYA 3AF2A 1E2LA 1GFIA 4ITRC 3HFRA 1JR3D 1C7ZA 4IOJA 3WNDA 3OT1B 1XTRA 1EFDN 3GA7A 4LYEA 4ITVA 2I3BA 1JALA 1GDTA 1TYDE 4JJZA 3Q41A 3MTIA 1UOEA 4KIJA 1H0SA 5CAEB 1OH6A 3OBBA 4H4DA 3G9ZA 3T9AA 5IHPA 4IDFA 4G1FA 4YGXB 4MRRA 3DAFA 4KLZA 2F55A 1J99A 4N8EA 4EEXA 2X0JA 4GSLA 3EIXA 4P35A 3SEAA 1KY4A 1P9NA 4IR7A 4ANFA 4TLCA 2I80A 1JBKA 3DE3X 3R8XA 5IG2A 2VAXA 4MRAA 1ORDA 4XYLA 3WLEA 4NEHB 1P6UA 5IAGA 4D41A 4AKIA 1HE8B 2WT4A 4LG1A 1HQYE 1Y1KE 5K3OA 3C3AA 4UTXA 2WF6A 1GUDA 3IBCA 2UUPA 4JC8A 3TTWA 4CT5A 1D7AA 1NKSA 3B5JA 5I7OA 4XYGA 1W4CA 2HSEA 3E3NA 1LLCA 4J7XA 2PMBA 2HU8A 1A4RA 2ZYWX 3P4UA 3T34A 3YASA 4N40A 5DBHX 1MC1A 3V1KA 1VIVA 3W7BA 4ZDJA 1Z8FA 2M6RA 1O96B 1D6SA 2NXNA 3PVCA 1VMDA 1QZXA 2W98A 3UXMA 4UXHA 2OCXA 1NGSA 1HEUA 3UZUA 1ZIXA 4YROA 4D3FA 4E33A 4NI5A 1E1DA 2O48X 3DNMA 3UAOA 3E5RA 2W2KB 4ABYA 2GLXA 1AQIA 3HB1A 5D6NA 2XQIA 3K6SB 2B8EA 4B6JA 1KJ9A 1VHJA 3FN4A 1H22A 2ZRIA 3ZGNA 2OZVA 2BSXA 1NUHA 4D8TA 3OJXA 4JEIA 1WB5A 5FJIA 1WHTB 1IIBA 3CX4A 1GG2A 3MAGA 3TW0A 2XA1A 1NXQA 3R0VA 1GU0A 5CJPA 4L95C 4QRIA 4J7CA 3M83A 2WSYB 3FY4A 1EP9A 1NBAA 4WN9A 5IDQA 3W3ZB 1E2KA 4ESOA 3MUNA 3DF9A 1GVNB 4REOA 1ZOLA 3EG9A 4FC7A 4L2IB 1XZPA 1NY6A 3FCOA 4WSOA 5EUMA 4YREA 2M6KA 1FXWF 3MOIA 3WK6A 1XK6A 2BGJA 3MIIA 3OTQA 1F6WA 2YC2C 2YCLA 3UJ7A 5IVKA 4Z51A 2RK6A 4FP9A 3UKOA 2O2DA 2EQBA 5E1OA 3UJAA 3W77A 2ZWMA 4M76B 4DMMA 4JI4B 3DAYA 3FPJA 1HFWA 4I99A 4UVEA 3GLUA 1Y82A 3KJHA 1I33A 2OUKA 4YBRA 4Q4JA 3MJVA 1KVSA 2IOFA 2QMUA 1J0CA 3CB2A 2HL6A 1ODKA 2YHIA 3CEAA 3DVQX 3GCZA 4MV7A 4U7FA 2DWCA 4LPKA 4LVCA 4JVOA 5TVKA 3IODA 4PSAA 2WJGA 1EK5A 4AMUA 3FKSD 1V3TA 4AROA 1ISRA 2P2DA 1IN8A 3QNWA 1CRLA 1RWKA 1S8NA 2VZEA 1A7KA 3HP1A 3KDSE 2IXTA 2JIMA 1VE6A 4NKRA 3WL5A 4N0MA 1JUDA 3UVEA 2I2DA 2ID4A 2IY9A 1TL7C 4R8MA 2OBMA 4RPCA 1Z88A 1I2DA 1Q7EA 3DOCA 3NAZA 3IBTA 4FFNA 4I4TA 1ZH6A 4PO3X 4EENA 1Z26A 3C3EA 4KR7A 4D6XA 4DUGD 1G5RA 1Z0UA 2P2ZA 3R7BA 2VJPA 3TIXB 4HJXA 2IYQA 1W36B 4QOSA 3OC0A 3QPWA 1RPTA 4R2IA 1MT0A 5AOVA 4OK3A 3TCKA 2GBFA 1E9CA 2MMGA 3LE8A 2NP7A 1YA4A 1K8YB 2WF9A 1JJVA 4MARA 4B46A 4RTPA 2FUKA 3ZZ1A 2LR0A 3UT5B 4AW9A 4AMBA 3PNBA 1ZC4A 2CHEA 3W5VA 4BGIA 2VAWA 3JAKB 2QTVA 4IJMA 5AUNB 2FPPB 1RI2A 2O2IA 3AOEC 4EY6A 3U6KA 1W5EA 4D8YA 5C4IA 2XZPA 4XB6B 5IBCA 3FAKA 2BKLA 1F9EA 3HP7A 3R20A 3W8NA 3OQMA 2XYGA 4MPTA 3MQ2A 1CEYA 1M1ZA 4CM4A 5HK9A 1N4DA 2IDMA 2HF9A 2NQ8A 1IJKA 4LYHA 1BG6A 1JDVA 2PO7A 2EHJA 2PRIA 4IFIA 2VHXA 2ZIFA 3MSCA 1EZ4A 1P9LA 1TVKA 1XZQA 2HSJA 4MCHA 1K5DA 2OZKA 3V7NA 3B3JA 4I08A 3CS3A 3URKA 1POXA 1DO2A 1TU3A 4JBLA 4OD0A 3T99A 2VG8A 1GO2A 5F51A 5B1YA 4KTTE 4O4IA 4K9LA 1VLLA 4MUNA 3S1LA 4DPKA 1L1QA 3E18A 4G3XA 2D1SA 3BHJA 1J33A 2CD9A 3PA6A 4CCYA 6REQA 5AW7A 1Z4JA 5J4HA 2JJQA 4UBLA 1LC3A 3AK4A 4RGBA 1D1TA 2CJFA 1EAMA 4B6SA 1PEKE 2C97A 1CQZA 5E3HA 4DLRA 1SEPA 4ZU1X 1SXJD 2ZRJA 2IVZA 2JS7A 4HDRB 4P82A 3SLGA 3ZCPA 5LKAA 2HEIA 4LRYA 1GRCA 1L7AA 4TT8A 1E0DA 3DL0A 1QIFA 4GOND 3H3FA 2WZDA 2GYYA 2YQ5A 1OA0A 4F6CA 3SG0A 4KQEA 1PJCA 4MVJD 2O3QA 4UM7A 2HADA 1U99A 1YZQA 2DOKA 4R2MA 1U1FA 1NUQA 4EYKA 3QJYA 4HSGA 1CDZA 2FP4A 2OAP1 3OF2A 1QGOA 1ZH0A 2JFVA 5JJLA 3EW7A 1L7XA 1SVWA 1Z0DA 3MXOA 3FI0A 4AO6A 2Y71A 1XFDA 5HGJA 1RVV1 4UMEA 4GE3A 4F86A 4FCVA 2C2GA 5B4TA 1OHHD 4EGFA 3OC6A 2R9VA 2ZAMA 2QT0A 2R6HA 3ZHZA 2Q29A 3IUSA 4KLAA 1RYFA 5LB4A 4PTLA 4EJMA 4WKPA 2X1LA 4GOJA 5EIWA 4ZFNA 4ZZ3A 2X8JA 4LY6A 2D1FA 1FUYB 2YL2A 1NUTA 3DVSX 4QU8A 4A15A 1M10A 3NNDA 4EGAA 3QFTA 1CUCA 4MR9A 2BBSA 3F74A 1QX3A 3FBTA 4FXOA 5AW5A 3VR5A 4D8VA 4TZ6A 2WFLB 1W4AA 4XX0B 3VU3A 4XDGA 5BNIA 1C1DB 4MMYB 4YJ3B 1HKUA 4L6CA 2IYUA 3PNKA 3IV9A 3TRHA 3KR9A 2P77A 3OHSX 5CB4B 3GELA 4L8VA 4U0JA 3UPTA 3BWCA 2G25A 1XDDA 4YRGA 3ET4A 3ZX5A 4UAVA 1GA6A 1U4SA 3GU3A 4U7TB 2GEDA 1Q5PA 2C07A 3DCIA 3I32A 2QD1A 1TEHA 1VCHA 3H3JA 3WO0A 4K9OA 2PS1A 5JI2E 1M72A 4REQA 3OTOB 4R6WA 4GKKB 4ROSA 2O57A 1SELA 5KKAA 1IMOA 3EEBA 3F5QA 2GN8A 2YMQA 4PGAA 5AUPB 1RC8A 4R2KA 1KEEA 3E2PA 4JJAA 1MQSA 4ZDWA 4OHFA 1FNBA 4LQ4A 4W99A 2IDKA 3USCS 4EPRA 3V2HA 1E6UA 1HE1C 2XGSA 4P98A 3IERA 5TRTA 3IOEA 2ZI6A 4GNKA 4Q4LA 4H6XA 3UOWA 3G2OA 4BEJA 4DMCA 4P4UA 3WWDA 2G88A 4B4OA 3BB1A 4J0FA 2XAUA 4AK9A 2ZAGA 4Q7KA 4EJSB 2WYIA 3GGOA 4NEGA 4MQMA 4FGUA 1HWYA 1X7YB 1LKZA 4GI1A 1V5WA 1BJKA 1PR2A 3R6GA 1K4YA 4YJGA 1VA4A 3G89A 2UYYA 2O50A 4BN5A 5TPZA 1DG1G 3L07A 1OFGA 1RQ7A 1TXGA 2V6BA 4FINA 1OBOA 2BFNA 1AK1A 5BY2A 2GN4A 3B6EA 2QVXX 3I53A 2RGDA 4Y2JA 4L75A 3WK7A 3JAWA 4C0WA 4QXAA 2JW5A 3SOZA 1BVYF 2ZSEA 1UXJA 2DWOA 1N77A 4ZVLA 4NBWA 4D9GA 1Z7BA 2C84A 5D3QA 2H1IA 1OWNA 3EFOB 4DM7A 4EJ0A 4XVCA 3D8SA 4CKCB 2VATA 3UGQA 4FK8A 4G97A 1GLNA 5FPKA 2F67A 1UMBB 4FYIA 1J97A 1O0SA 1A5AB 2R7LA 2YIDA 3WIBA 4FM9A 2HU5A 1OZAA 3ZE6A 3NUGA 5HX7A 2C2MA 4L8YA 1P4JA 5IN5A 5HUJA 3CLTD 3P1JA 4F71A 2DCUA 5IWCA 1R8YA 5FV4A 4J7UA 1XYYA 5E3JA 1BGVA 5E9QA 2UZAA 3ERCA 1X8XA 3SIXA 2KE5A 3LI2A 4EPVA 1WF3A 3A4TA 1AK2A 4G0ZA 3K70C 2X3FA 2G9UA 3GLFA 3ULKA 3GRVA 1RWBA 3N07A 2ZM6B 1N5JA 4E09A 5A3SA 1P18A 1H2BA 1GOTA 1YR2A 1FBNA 2AKAB 2HO4A 2G9RA 2XUOA 4QGFA 5LUBA 5AI9A 3DOFA 2YXPX 3M4XA 2XVAA 4TV9A 4ZQHA 3LDAA 5BSHA 2P9JA 3PQFA 1OLXB 2H9YA 1R4AA 2IUTA 4U02A 4UZEA 1W94A 1WJGA 1HURA 1M6EX 2ASEA 2YHBA 3GVIA 4F1WA 1EUCB 5K03A 2JD0A 1U0TA 2JJYA 3AUXA 3NTUA 5IU6A 4WXEA 1XP8A 3B13B 3PI7A 3N3BC 3QTTA 5T57A 3A4VA 1QPBA 4QDOA 2XITA 5J9FA 3ZVLA 1XCPA 3SX4A 1AMNA 3MRXA 1V9SA 5AXBA 4OEHA 3AIIA 3BE4A 5ER6A 4EABA 5EWMB 5FBVB 3TSCA 1DV2A 2CLCX 2WE8A 2PT5A 3H11B 2MCFA 2RHHA 1TUEA 4J76A 4RBNA 5EGNA 2C9OA 2JJMA 3H05A 2V7WA 5F35A 5H81A 1OYWA 1GP2A 2JCVA 1LSOA 2RI6A 1UQUA 1SBQA 1WPXA 5IC5A 3TGWA 3I92A 1DIGA 5B4VA 1B41A 5LP6B 4KE9A 5BOSA 4UCXA 2FHPA 5E4YA 3HDHA 4AMYA 2GK3A 1CYDA 2C0PA 4Z99A 5F21A 3IP6A 3BWBA 1X14A 2XB4A 3D4NA 3EGWA 3LT0A 4LJ5A 5CM8B 1JEEA 4JYPA 4RZ3A 2W6QA 1NSTA 4DYHA 2DJ5A 1Y5IA 3SYMA 2B2XA 2SBTA 1GLGA 2VHQA 2WEKA 3LY9A 3HA5A 5DKFA 1KVUA 2ECPA 1OBFO 1UPTA 3VNBA 2P6RA 1B7GO 4OHKA 1SKQA 3ZBUA 1B8PA 3O91A 4CMJA 1SAYA 4NBNA 5LWHA 3HLTA 4LHSA 3RYHB 1W5SA 4UMVA 1V9LA 4WOBA 4TTTS 2V7QA 2GPWA 5J2UB 1JHUA 2WJ6A 3OCXA 4EUNA 3NBXX 4Y2PA 4DY6A 1T3ZA 3INYA 1SCDA 2I65A 4C6HA 4O3MA 4R51A 3RNOA 4UHEA 1GSAA 1Z8HA 1T1JA 1M7GA 4WY2A 4OLAA 1V71A 3RF7A 2D3WA 4UHKA 3FCXA 3D2LA 1USIA 4Q9NA 3BORA 4PZPA 2HHCA 2MYPA 4UVHA 4AKTA 3HKDB 1A8HA 2D5BA 4MUGA 3IHLA 4RD3A 4TKMA 4AP9A 3B38A 2XA9A 1UMKA 4XKJA 4XYEA 1XZNA 5AVKA 3CVVA 4K9PA 5GVRA 4G23A 1GIAA 4DWVA 4W4TA 5JZOA 3OIDA 2VP0A 1K27A 2FUEA 2D4HA 2Y77A 3MINB 3IXMA 5KAMA 3U1TA 2WIAA 1Y4SA 1SUAA 5I9BA 4GLBA 5SZKB 1QBGA 2BN4A 3NM5A 4BL5A 4CR6A 4RKFA 5WRFA 1XQVA 1VJDA 4LYGA 2BFPA 3UV3A 3A28A 1A04A 1WZEA 2B25A 4GBGA 4E22A 2ANCA 2J0UB 3B2EA 1CEXA 4MAMA 3ASZA 4B6FA 2QBYA 4YMIA 4B3RB 2B2NA 5BMVF 3EN0A 1K8ZB 4NY1A 2QN6A 4HN9A 3RDPA 3EAQA 1JNXX 2APJA 1Q12A 5AIAA 1KDZA 2HW8A 1V5GA 3M7IA 2GZRA 3MUOA 1JIQA 3PEVA 1GR1A 2PX3A 3P32A 1RLOA 2BFOA 4OF4A 3LFUA 2Q0XA 2PIDA 1V4NA 5FHQA 5HM8A 1ZD1A 3AF5A 3FETA 4WKNA 2H1HA 5AXAA 2OKGA 4OJQA 3TJRA 4FOSA 5BWNA 1ENZA 5CFMA 1C1YA 2JFBA 3CNEA 3OWXA 2Z9BA 4MITA 5BSFA 1QB7A 5C52B 1FDSA 4KN9S 2VRBA 2PYIA 1DRJA 4XJVA 1AV6A 5T4BA 2QPLA 5FA5A 3QX8A 2QVGA 5LLDA 1BZYA 4G0NA 4UM5A 3T3EA 3LRXA 3THSA 4DPLA 1XTTA 2VEDA 4I4TF 5EJFA 1KYZA 3H6KA 2UZIR 4ADSG 1F8GA 2G76A 3M4ZA 2I5PO 2V6FA 5JT1A 4LMBA 3OD1A 4OFZA 3DM5A 3KZVA 4Q1DA 4HWTA 3DCNA 3N3AC 4RCZA 5E2AA 4JB0A 2GCOB 3WHLA 3J81k 1MENA 1V7PC 3NR2A 5EMHA 3R77A 1N32B 3L40A 4YRFA 2NV6A 3ZOKA 4ID9A 3ZU5A 4DJTA 4V1CI 3TOSA 1O95C 2HUNA 4TXMA 1IY8A 5FULA 5CX1B 1XXHE 4HGPA 2V3WA 2V7BA 4BS9A 1U0OC 3KHTA 3PQCA 4BZQA 2HFJA 1TT7A 3IFSA 4Q15A 5LBIA 4OPMA 2Q6OA 1ECBA 3KLBA 4JUAA 4IIYA 4LOAA 1LBQA 3T5BA 1ZIDA 2HIMA 2NUTA 1DJPA 5ETJA 4K28A 2Q7OE 2C4NA 3PLAE 1O58A 1M0SA 1GUAA 1NVWQ 1W1WA 4L7VA 4B4UA 3VVMA 1UJ2A 1C41A 3V8PA 4D4KA 3T7CA 4JQOA 4KV7A 1OX6A 4RD0A 4X6UA 1YR1A 2OHXA 3AOGA 3RJ5A 4BO3A 2Q4TA 1CW2B 1M76A 2KMLA 2VCEA 3PHHA 4FDMA 4NYIR 1KI6A 1MX5A 2RHTA 5HF8A 3U1VA 6Q21A 5JJCA 2WNSA 1L5FA 3M6AA 1PS8A 2DQYA 1RPAA 3VR4H 4M7OA 1RWXA 4O4IF 1I36A 1Z5GA 1L4KA 3KYJB 4QUHA 4ZO8A 2YW9A 3BC1A 3W2GA 3FRHA 4L9WA 5JW6A 3K9NA 1E64A 1OE0A 2JVIA 3IKMB 3ST7A 4IMPA 5KIAA 1GVHA 5JFGA 1SUSA 2RB4A 2WT9A 3V46A 1ZOSA 4OM8A 1GL7A 2E21A 4MAFA 1G55A 1OCEA 1ZKMA 5KOHB 2OO7A 3L1IA 3NT2A 1QHHB 2IYYA 3RARA 2NXEA 3MS2A 3PRHA 2P1DA 3F8SA 3IULA 5K20A 3C3MA 5DVZA 5DLQC 4JZYA 4FTWA 3UMJA 4DLKA 3RJMA 1L3CA 3MCVA 2YWXA 1X7XB 2JD2A 5GJCA 5THQA 1G63A 4LIPD 3TLYA 2QD5A 3EDMA 4OQ4A 3E9YA 1M1YA 2VCHA 5ERXA 1H5UA 1ZGZA 2AR7A 1QMPA 2B4QA 3QFHA 4FNMA 4OFBA 4E1VA 4DR6B 1EINA 4DFDA 5DGHA 1FP7A 4E4RA 3I5UA 3FZYA 4LTMA 1J8DA 2WHPB 4MQUA 5DW0A 2JCGA 2GD1O 3CFYA 5GJWC 5EKXA 5AVVA 4JVNA 1M1XB 2P6NA 4AXXA 4K8OA 1ISJA 3IV7A 2IY7A 2MIIA 4V3BA 2AOXA 1JG4A 5D6OA 1Z2PX 5EIAA 4YAKA 2HHJA 2IXBA 3VOTA 2D00A 2EU8A 2ZYUX 1PGJA 2CHQA 1AVTA 3H5OA 4CCWA 4HQ6A 1JBEA 1P3DA 3WGKA 3F3MA 4OL0A 4BNYA 3DPIA 3IQIX 2AKYA 4UTNA 1DLIA 1CRQA 1NATA 4XWWA 1V37A 1U0BB 4A0SA 4EYSA 2QZPA 2RI1A 4HRVA 2N47A 2ZI4A 3PYXA 5FFNA 1RLJA 4KYUA 3C1AA 4ZDKA 2ZJ2A 1JAYA 4TZKA 5A7FA 2OCKA 1PNOA 4JJ6A 3EZ7A 1ISPA 3DFUA 3R3XA 5IT5A 4B3BA 4IBOA 1G5PA 1PT9A 2PX4A 3QEOA 1BDJA 3D8NA 4Q1BA 1VKRA 4BNVA 3F4KA 4DQKA 3ZGZA 1EEHA 5K8CA 4AM8A 1Q91A 3S6JA 3SEZA 5A1JA 3PDIB 3GUYA 4D5EA 3LY5A 1N2EA 2KWIA 4Y98A 3J7AC 4O0MA 2NQTA 3QA9A 1KDYA 3TLEA 2A4MA 3K0KA 1RW4A 4WDQA 2R751 3UA3A 2CHUA 4TWZA 1QRSA 1SKMA 1CEQA 1PNTA 3BD9A 1UT5A 3IP1A 1RC0A 1QFZA 4HNGA 2BFCB 4AUNA 1UEXC 5JDIC 2BGWA 4ZCMA 2ZSBA 3GFBA 4U7PB 4UEJA 5C34B 3VU0A 4OHPA 3LPNA 1HDYA 5COQA 5KO2A 1M73E 3LH5A 3FCSB 2FZ5A 3TOVA 5AJZA 2RAFA 4YJFB 1PNQA 4QU0A 3RU3A 1HT1E 1MCZA 3CEPB 3A7EA 3THWA 4KB5A 2BT4A 3Q7TA 2QTZA 5B2ZA 5CA1B 4UHJA 4DXDA 3Q98A 4NE7A 4O29A 4U63A 1NMXA 2HIGA 2IC5A 3E4CA 4R3NA 2I66A 1A95A 1PUIA 2RGNC 2BI4A 3P71T 1TLFA 3QW4B 4FGWA 1Q6ZA 4K6MA 4YRMA 3R9XA 3M4NA 3OQIB 1T10A 4RMJA 3TZKA 2W4IA 4P7GA 2JB9A 3C14C 3U13A 5JY6A 5LNK6 4RJLA 1E6WA 2P2NA 4BFSA 3A06A 3TMKA 1AMUA 2AQ8A 1DCKA 3EVCA 2OMEA 1VP9A 4OB6A 4RLFA 1XX6A 2IBMA 4RY2A 5IC6A 3VU9B 421PA 1VHQA 4B4DA 4DLNA 4DRYA 5IMSA 3A6PC 2LW7A 3LV8A 2GRUA 4JC4A 4QGAA 1CIVA 4Q9KA 1BXGB 1MQ8B 1OXVA 1T8YA 1ZM4A 3KM0A 3VI4B 3GOQA 2W70A 1QV7A 3L93A 4COOA 5CIYA 1M5RA 2H2DA 1PW5A 1R37A 2HCRA 4XJXA 4ZCQA 3QEKA 1NP6A 4B2IA 4W9NA 3RAJA 1WDTA 2AXPA 2QHXA 5HDQA 1HLGA 3RE1A 4AI6A 3GQBA 1L4MA 2A8YA 2TSYB 1W36D 2HIHA 4CM9D 5KINB 2P0AA 1EI9A 2R8OA 5BYJA 1BHQ1 5KHAA 3DCYA 1XI2A 2BBWA 2AK3A 2HGSA 5EC8A 1U9IC 3FWPA 4FUTA 5EGSA 3AR2A 2QRNA 3LUKA 1T3TA 2PXAA 3QEJA 4Y8VA 2VHWA 1JN0A 1BDBA 4TLAA 1ZQ9A 2ALJA 3UK6A 3P9SA 2VHTA 1WETA 1R8QA 1GPWB 4AKEA 1W59A 1EUDA 3AEXA 5BT9A 1SG0A 4KXLA 3VJMA 3I61A 2V6MA 2V3CC 1UDAA 4KFTA 3DE4X 1J8VA 3CH7A 2C2WA 1V0JA 2O8DB 3GLGE 4AJOA 1Y4DE 2ONYA 3NASA 3PNPA 4EH1A 1KU0A 4DA6A 1KMMA 1TKAA 5AYVA 4HSEA 3A9SA 3N70A 2LWIA 4GX1A 5HDBB 5FPPA 3GMDA 3KQMA 1J56A 4ENQA 1AH2A 2GD0A 5FPSA 1H3FA 5KYUA 1ZCFA 2C9ZA 4BB5A 2ZR9A 3A14A 3UMBA 1LY1A 5JATA 5K2MA 4OHZA 4I19A 4GSYA 1TK3A 4FNAA 1U9JA 5FUBA 1Z2OX 4K6FA 2MSDB 5IXYA 4XIGS 4MH0R 2BJWA 1Z45A 2VF2A 1IZ0A 2IXFA 4O4HA 3P4YA 2XDYA 4NESA 4YCJA 1M8FA 3HR4A 3RVJA 3W06A 4D80A 2IOQA 4E32A 1BS9A 1C9EA 3O92A 3OZAA 5DZSA 4B82A 3OX4A 3T5GA 2VTBA 5FCDA 5BQOA 2A92A 1U1IA 2DPYA 3M89A 3HABA 4U7JA 4CL8A 3QUQA 3W6NA 5KVVA 1I94B 4KMOA 1J20A 4I1YA 4N12A 1J07A 1ZRMA 4TKUB 4N5IX 4EKEA 3FKJA 3LHFA 5AW9A 2JLAA 1I4OA 4EFLA 1WX1A 1ARZA 1GGNA 2GLTA 4YNBA 3IMFA 4XEHA 1G8FA 3TOZA 1HT2E 4IXNA 4ESHA 2CXRA 1QLHA 5JPCA 4YQEA 3O4JA 1SUPA 2RKOA 3LT5A 4DDVA 3IBFA 4QELA 4KN5A 1JXOA 1Y37A 4QDJA 2Q3CA 2ZTSA 4DC1A 1GZ6A 4IINA 2ORVA 3ZJVA 1MRSA 3HNOA 3EWAA 1VJ5A 1T9KA 3ZKAA 4CEIA 2QSJA 1OYOA 3QLVA 1IEVA 2JGFA 2QMOA 4CLRA 3ENVA 1YUMA 3KEGA 5TR9A 4OJMX 4EL5A 4W1SA 1W2WB 4I5DA 4GX2A 5GGYA 1ZVJA 4IH1A 1TC1A 4LV8B 4UQLA 5KOJB 2OHOA 3VA7A 2WU1A 1PTKA 1CZKA 1ODFA 1NXPA 3K2IA 4IIVA 1UDBA 3HZHA 4FWBA 4RU1A 5TXGA 3OWOA 3VISA 1Y5RA 4KMSA 3D0RA 1UPBA 2PKRA 4TWRA 1SVNA 3SEFA 4Q4AA 2EQ5A 1P4HA 3CKYA 1L5GB 4TSFD 4A8JA 1KZ6A 3KBOA 5TT0A 3I5XA 1XZGA 1DO0A 2HNKA 4MO2A 4U2DA 1F38A 1ZPDA 3O75A 4BNGA 1T9GR 3M0EA 1MAAA 4AUEA 4EPYA 1SCJA 5LLTA 2H7VA 1E6CA 3H2SA 4WOPA 1PNRA 4DC9A 2AR9A 3MYRA 5ERYA 3TUJC 4YQYA 3KJQA 3TVTA 5ARCA 3MQFA 1Z5ZA 2EJBA 4NXNB 3S2FA 4GUDA 2WIGA 1A69A 2NTYC 4NF2A 2VYCA 2AJLI 3O4IA 1DAGA 3SVZA 2O07A 5JJIA 3WL8A 2ZXUA 2C4MA 1KOGA 2XAAA 2NAFA 2VAPA 1QIGA 1SIOA 4DMLA 2J1LA 3ZCUA 1NF2A 3DONA 2VF7A 2A6PA 3OCJA 2EKDA 4U9IS 3WYEA 5LMNB 4FWTA 2O6LA 3QGMA 3VKUA 3IT3A 2HQSA 4JXJA 4ZCIA 1GNRA 1R0BA 4RGVA 1R16A 1Z2AA 2ZUSA 3G6WA 3IAM6 4KWIA 4LBWA 3FWHA 1W34A 4PZEA 4TV8F 3C5WP 2GD6A 4FT4A 4ZREA 5AXCA 3WKEA 2XXAB 4L4UA 4JP8A 1Z6QA 4GRAA 2QMHA 1KA9H 1SHTX 2AV6A 3IOYA 16PKA 1DOHA 1I2AA 2EJCA 4TX1A 4DABA 1JG6A 4EY8A 3L7CA 2Z3VA 3R74A 3IPLA 1Y34E 3STYA 1H0KA 5BUQA 1QQ6A 2O06A 3D54D 5JCJD 3STHA 3UC9A 2Z58A 4DF3A 5LQSA 1GM5A 1V11A 1BTOA 1DX9A 2DQKA 4V39A 4GBMA 5EKUA 5LPNA 3DVLA 3Q85A 2ZSIA 1CR0A 3KQLA 2CLFB 3MF4A 3E3OA 3FUWA 2DG2A 4P31A 2HM7A 3T5MA 4YUZA 1ADCA 1BCSA 3NVDA 3TSZA 4ARZB 3SICE 2Q4DA 3T7TA 2QORA 5IT4A 4XB1A 3SR4A 4OIMA 4Z2AA 4DSTA 5J4YA 1PYOA 3KR0A 4BKMA 2BEKA 1FFEA 3O7WA 5L4NA 3QYAA 1ONNA 3EE6A 1AGRA 5DEIA 2RHOA 1ZSYA 1PGPA 1L5HB 2QYHA 4IHJA 3M33A 4JROA 5BSWA 1E1MA 1TT5B 1U8AA 1O9GA 4J9UE 5EHGA 3ZI0A 1WU8A 3ANXA 3ND7A 1XGKA 3HP4A 4L4XA 4Y30A 4TLDA 3OCYA 2CSUA 1QANA 3QFRA 1T6XA 1T5OA 1TPYA 1Y1PA 1YE8A 2IEGA 2VRNA 3A1WA 3F6RA 3LECA 2VWGA 2OXIA 4EPWA 2B21A 3FWKA 1IZYA 5TEVA 2FN7A 3GPCA 3FZGA 4UUMA 4DYVA 1OILA 3KR1A 3BJIC 3CLUC 3ELUA 3GAAA 3K0CA 4LJAA 1YS2X 1L7EA 4LBVA 4Q1VA 1NKVA 3RYFB 4AY4A 3LUBA 1VBNA 2XUAA 4KFUA 3O8BA 2GJSA 4CKXA 1ZCBA 5KDDA 1GKLA 1I4LD 5K3AA 3PPYA 2GPJA 4WESA 3HXPA 5E3IA 1GY8A 3THXA 2AB0A 2FFJA 2QIPA 1THGA 1HDEA 5JWOA 2ADMA 5FWXA 2PBRA 3VR6H 3SHTA 2XLCA 3MGBA 1CUVA 4OKSA 1Q1BA 2XMZA 3WA6A 5CW1A 1YMUA 5HFAA 1B16A 2HCFA 2QSZA 5K0SA 4ZJYA 4JI8B 3CRQA 1NAIA 4PS0A 4EAAA 5BMVB 4JXXA 2CNNA 4CG0A 5LQAA 1AY0A 3JV7A 3I4FA 4ASUD 2ZIXA 4YRBA 1MJGA 2A78A 2FZCA 2OBFA 3KTAA 1FPMA 4RZQA 3LS2A 3U62A 1U6KA 2YUIA 1DADA 1FFCA 1YS7A 1ZJ5A 2X0RA 4F5ZA 2C59A 3L02A 2CK3D 1AK9A 3TW6A 5LSAA 3A3KA 3WFIA 1Z3IX 1NI5A 1DC5A 5LA6A 3OUUA 4UBIA 3ZDFA 4A6EA 4C4OA 4CMIB 3TX6A 2OC4A 3ZTTA 1JQEA 1KY3A 3DHEA 4LHWA 3QXSA 3IURA 3KLOA 4IJ5A 3SVTA 3T06B 5C7IO 3D7RA 5EWLB 4J4BA 4G67A 1XD8A 3MJ4A 4FEAA 3OEEA 4FHDA 4PTYA 3H19A 4DWJA 3ZCRA 4EF5A 4ATNA 4EITA 5BV1A 5HR5A 5ARDA 3RLFA 1Q17A 1DINA 2IZ0A 4I4TB 2MTBA 4KXQA 1XEAA 2VP2A 3AVUA 2EKPA 3BICA 2XUGA 2XD4A 4KAXA 4JVMA 4BJ1A 1GV0A 3VSEA 3R6DA 1FOEB 4L08A 4CTOA 1P2UA 5AHKA 5IAEA 4WBXC 1EX9A 4P38A 4XGIA 4E15A 2P8JA 2RE8A 2RH8A 1LEHA 1NXSA 2O2GA 221PA 2VK1A 3GJ8A 3O3CA 5ALRA 5I51A 4D26A 1Z7WA 3FYDA 2WV9A 2IJGX 4KI0A 2IYXA 3NNSA 1DJQA 1TA0A 2QTVB 1N7IA 5L4SA 1QAQA 4L6IA 1VC2A 3OQVA 4YXFA 1KFKB 4O4LB 4BQEA 1XCOA 3P0RA 5A4IS 1RM3A 1NWHA 1PR0A 2GWRA 5K4GA 4KPYA 3LLUA 4HLUA 3LUPA 4BRZA 4EA6A 2AZXA 3M5CA 4B47A 1ULZA 2C54A 3IPCA 2VXOA 4WJZA 2R8EA 2JHCA 2F43B 2IF0A 3NM4A 2HXYA 2QTAA 1YJAA 5CTJA 1PFKA 3VZSA 4CTJA 2RGGA 2XUDA 2YS6A 4UBKA 4X54A 1ZINA 1WBJB 3RFCA 3CO5A 4NYMR 4B3TB 5EA2A 1N34B 5H9WA 4PX5A 4AZSA 4MHTA 3L7LA 2C96A 3HA2A 3S5UA 2OZPA 4U00A 4FSDA 1ABFA 3W9YA 3OJOA 1KK3A 4GZ5A 4MGZR 3HY6A 1FFWA 1KJNA 1WHSB 3HN6A 5KYKA 4RM2A 1E2EA 4DC0A 2AFVA 3P5BA 3OPYA 1FUKA 1F0YA 4YAEA 5DASA 5TB5A 4I1PA 5KWVA 3FSGD 4V0QA 1OZHA 3GLSA 3BIJA 2BFBB 4MA4A 4BX0A 1R74A 1TX4B 1W2GA 4XJSA 2JLRA 4S1NA 5KNBH 1EB8A 5LIPA 5MGBA 1KE1A 3GB9A 5E9AA 4K9DA 3KJXA 1XLTA 5HRAA 1V8ZA 2FRDA 4UM8B 3ZJTA 3ZE8A 1ZOIA 4Z53A 2PRZA 3JASA 3PXDA 2Q5LA 1P81A 4X61A 5JQWA 1V1RB 3EVEA 4EY3A 3G49A 3QEBZ 2IIPA 1Y1QA 1UZLA 2I03A 1Q7RA 5HVNA 3P94A 1SBIA 1TJNA 3LU1A 1PD0A 5HKAA 3V2IA 2E5WA 1G2QA 1O0BA 3BL6A 4M1OA 1WLYA 1S0UA 2QG6A 4LZZA 1V8PA 1THTA 3FA2A 1GRRA 1OXMA 1BXRB 1IC6A 3N2EA 3VPHA 2JL1A 4C89A 1R6XA 5MN6A 4QYXA 4DM3A 4DV0B 1LTHR 2FEPA 4IQ0A 1YGYA 3IT1A 2QR3A 2X8JB 4WK0B 2Q21A 4JGIA 3U9LA 2XB2A 1I3OA 3GV0A 4ITUA 3REQA 2XCRB 4XIYA 2QQGA 4PXAA 3RVBA 4M0PA 1NRIA 2MSEB 1H69A 2O6HA 1WXGA 1Q92A 2PT9A 3HKEA 1B2RA 3WTCA 3I9MA 5JECA 1SB8A 1ZKDA 2HWWA 2BUCA 2PLWA 3K09A 5G0UA 4CEHA 1U3CA 2EG5A 3BXGA 3AV3A 2UUBB 1USKA 3KAJA 2EEZA 4KU4A 2WM2A 4HDOB 2IE8A 1J21A 4DAOA 3HWSA 5YASA 2BMJA 1XDUA 1R9JA 4ND8A 4UC0A 2ZEJA 2JJ1A 5H8WA 3BFXA 3X3HA 3NS7A 4RSHA 2FUG1 3C1UA 3BWEA 3CF4A 3S1SA 5DDIP 3IPXA 5HJ2A 3CIFA 2C99A 1BMFA 1S7GA 2F3PA 2HA3A 4REQB 4EI7A 4F92B 2LVBA 4UPVA 3DDOA 3F3KA 2WNHA 4CLEA 2VDKB 3NBKA 2AE2A 3P4XA 3TUIC 5IJ0A 5L3SB 5DSXA 4J6FA 1QZZA 1NUAA 3W1WA 1D6JA 5F2OA 5KYTA 1XCGB 5K3SA 3G2JA 5MHTA 2WIFA 3W5HA 5JAUA 5KTTA 2Q7DA 5DHTA 4NNJA 5ALLA 1N8KA 2F1IA 1D3AA 2CMHA 2W93A 1YNOA 1JQKA 5TGZA 3TRKA 2GILA 3Q9NA 4C7XA 4J8PA 3QEMA 4HCJA 5IEJA 2VAMA 1Y1TA 2WUVA 4LHXA 4B31A 3ZU4A 4RH3A 1SK8A 1DXHA 2GN6A 3KKZA 4F97A 2CEAA 5J58A 1XLVA 1A8SA 2CUZA 1QVAA 4JNCA 4EM6A 2WUFA 4HFRA 4M1ZA 1UXOA 3EDCA 3P9QA 2BGMA 4ZJPA 3D2CA 1L1RA 5LBTA 3UF0A 4HYTA 1D07A 4ND3A 4UATA 2GJ8A 3O4HA 1KHHA 3BMCA 3ABOB 1U2RA 1LH0A 2PWPA 4EKNB 5BQFA 5AI6A 1KAQA 1JDSA 2WUDA 5C2JB 2VH1A 4M36A 1NTOA 5TF0A 4F6RB 3PHJA 5CA1A 1DEOA 1UKBA 1CLEA 4HGYA 8LDHA 3O4RA 2FSVC 4GWLA 4WV3A 2Y0DA 1PZXA 5DM1A 1DKQA 1UPAA 4YP9A 3HN2A 4JNKA 1N7GA 3V7FA 1QKIA 3PV0A 1KPIA 4NK4A 4LGYA 4QBKA 4XFDA 4B3FX 3GPBA 5GV7A 5HZGA 5JLAA 2FF7A 2PUTA 5KYVA 3SFTA 5JYDA 4J4TA 3KD2A 1PBNA 4LVUA 4AECA 3R0XA 4KV9A 4AU1A 3O73A 1O6GA 2R1VB 4EGQA 3AHFA 1PLJA 1AB5A 1T25A 3QU9A 1SEVA 1RPNA 1E8NA 2JFGA 3LPCA 4IV0A 2EF1A 2CWWA 4UW9A 3ND5A 3T15A 3VNAA 10MHA 2O5CA 3T7KA 4RF5A 3H16A 2RAUA 1JH9A 2JIPA 1YCDA 1ETUA 5DV9A 2WUWE 5K3DA 3DG9A 4WA7A 2G1JA 2QW0X 2ZJ7A 2AMYA 5D8DA 1E77A 4IS2A 2V4MA 2X7HA 2E4YA 2P68A 3BGSA 4KW7A 3AMVA 2HWYA 4OVKA 3A2LA 4QUAA 2N0SA 4RJIA 5DTJA 4M9QA 4EUEA 4Q12A 1PR1A 1AUXA 1E6EA 5I7UA 3ACCA 1QKKA 3ENNA 4C2TA 2R6R1 3DE2X 1E2JA 2ZR7A 3GT3A 2IZ7A 2Y1EA 4ENRA 1JB1A 3H1AA 3N5CA 2A3RA 1XZAA 2QNRA 2BSQA 4IDQA 3I3SR 5IUKC 5BOSB 3CURA 2HFKA 1E5DA 3B7PA 2H07A 3DZBA 3B8EA 4UE6A 2FWBA 5L7YA 1HNXB 4ZYXA 1PS9A 3H4VA 4IYJA 3G0OA 5J59A 4AJ9A 4Q1AA 1TTQB 1MDBA 3EH1A 4PGMA 1ZHFA 4CM6A 1YC2A 1Y9DA 1WUHS 2FPXA 4A92A 1QIJA 2IHZA 5JTUA 1W0KD 4N18A 1X7WA 3OJCA 1JG7A 3IH5A 3T3DA 1FJ2A 2W2PA 1Z4QA 2K7ZA 5EZQA 2GH1A 4IDOA 2P35A 5F1KA 4IHJF 4FD3A 3O47A 2VPIA 3GBPA 1FMLA 1N0WA 1XIVA 1LPOA 3E0XA 4LDAA 4XCVA 5DP1A 5ED0A 3RSZA 4PY2A 3AINA 1JIVA 2N9UA 2FK7A 4DNPA 1Q21A 1XN1A 5H3CA 1UDWA 4BMSA 1PYGA 2CWDA 1JPJA 2PZFA 2A5GA 2XPCA 3VZCA 4E1AA 1EESA 1EE1A 4ZC1A 2X3UA 1TU0A 4ZDIA 4LV5B 1B93A 3B53X 1M6NA 3K0AB 4DQ0A 4FGZA 2J67A 3CZ9A 2I6UA 2JIDA 1ADFA 2H2GA 1L4UA 2BFDA 5DFAA 1MBZA 5EE5B 4V1CB 8ABPA 2B3DA 1GQ2A 4GAEA 3W78A 3NHAA 3HY4A 3TLAA 1BRMA 3E82A 2R97A 1LX6A 2HREA 3RC9A 5LQNA 5JS1A 4CCSA 4JA0A 4H08A 1D6NA 4GI3A 4YMGA 2BJVA 4GLFA 2O0KA 1Y63A 2VP5A 4XD7D 4U2KA 4D81A 3MWDA 4TYNA 2ZJ0A 4JI5B 4JT2A 5K6AC 2JBHA 5B64A 2D5CA 3R3YA 1I5OA 2PAAA 4K6GA 2QA5A 4NMLA 4OOEA 3PUJA 4N1AA 1BN7A 4DDHA 4V2IA 3FZNA 4RMGA 2DCMA 4MOWA 5CDYA 2E5LB 5ICSA 1JIJA 3WX0A 1AGXA 2QPOA 3U0BA 4K9SA 4HB4A 4WJLA 2H1LA 2JAHA 1AUPA 5J2TB 1MH1A 3AEUB 4XPZA 3SFZA 2ZVQX 5AT1A 1XPUA 3E1GA 2CGEA 4BVHA 3MHTA 3PR3A 3TQIA 1N3YA 2PJZA 1I01A 1OT5A 2CLHB 3B1ZA 3R5XA 4NJMA 3I30X 3OSUA 4TV8B 4ZTBA 4NCBA 1A88A 1LTKA 1M6VA 3GRYA 2A9JA 1UJCA 4W8HA 2YJGA 3JRXA 5FTLA 1WO8A 1T24A 3CO0S 4Q3AA 3NC0C 2ZRMA 3VGPA 2BKEA 9ATCA 4QGGA 3GGJA 5JYBA 3BBPA 5IX8A 1VCMA 3AHEA 3FWZA 2P9QA 5B57C 4MWSA 2P7IA 2YCBA 4LXIA 2OBBA 1YBAA 2YJNA 1G20E 3AY6A 3LQ1A 4OATA 2HJSA 4QHYA 3U40A 5ALXA 3T3PB 3ZZUA 2ZRLA 1W85B 2Q2VA 5BN3A 2CYCA 4B76A 2H06A 2JASA 3NXKA 3A11A 4IICA 4HX2A 1A9XA 4XPIA 4ER5A 1CNEA 1HPLA 3B82A 1C0KA 1S02A 1UIMA 3N6RA 4IX9A 4AXBA 3WLHA 1YZTA 2QXUA 1N2CB 3OPNA 1XJ5A 2ATIA 3RUHA 3HXKA 2B98A 2XQFA 521PA 5DLEA 4KEAA 1UBUS 1UKZA 4RW0A 4EYEA 4KIGA 3Q3JB 3G8CA 1XEWX 1FXUA 3G2QA 4I4IA 2FK8A 5CHEA 5ALOA 3NLLA 3U7HB 2I2CA 4IVQA 1HFKA 3SD7A 4JELA 5CNMA 1AZSC 1XE3A 2X0NA 2X19A 4JYMA 5K3EA 3U16A 1VI6A 5CVJA 1LI4A 3A26A 5G53C 3UM9A 3ADBA 3NAMA 3EMBA 3OX1A 1HTWA 1KKUA 2OSBA 3TUZC 2AQKA 3U4QB 2XMQA 5AKLA 4HFNA 4B3DA 3EQZA 3K0SA 1BROA 3ANYB 4UNIA 5D87A 4PG4A 3CR8A 3STVA 3ZWYA 4Z0HO 4RLHA 2OC9A 3AONB 2J5RA 4RY0A 1Q44A 3WIEA 1MRNA 1USGA 1NW9B 2W11A 1A8UA 2IHVA 1P17A 2W9XA 1FFHA 3CZQA 4FIZA 2ACKA 1J5XA 1DRWA 2EVWX 4AY2A 2FW8A 2ECQA 3BHIA 5BWMA 1NNSA 3BWXA 3A70A 3SE7A 1GZDA 3RVDA 1TA4A 3FLAA 1D5CA 1NBWB 1SHJA 4EHKA 3O3OB 3L7DA 4CWAA 1DWUA 3NRCA 2V1UA 3R3UA 5I8PA 1DC8A 3X2SA 2QP4A 3LW7A 1KSJA 2PNJA 3UW1A 1FSPA 3CRZA 1AIPA 5EL0A 3Q6NA 3GCWA 1G3RA 1A8PA 1H4QA 4Q93A 1S2IA 2G8NA 4JOSA 3ZWAA 1Q0SA 4ER0A 5EZ6B 4M3NA 1BJTA 1ULSA 4KAJA 1OVMA 3MBKA 2CFOA 2L69A 2SECE 3OZVA 1FUEA 5FBKA 1Z06A 3HJGA 1Y4ZA 5JAMA 1XF1A 5FIUA 3VJKA 1IXYA 4AS1A 3RVKA 4CR7A 2WJ3A 2EBWA 2VHYA 1ZXLA 4HPXB 4LA4A 1JDNA 5F5NA 5C1DA 4PNPA 2RGAA 4WFKA 3PCRB 3OOYA 3VU8A 2RD2A 4AP5A 4TL6A 4OXKA 1WXQA 3DWIA 3RFXA 1MO5A 3ROQA 1W25A 5TQ2B 1TVMA 5K0FA 4M8SA 1KP2A 2ECKA 1Z16A 2ESRA 4LXTA 1YRWA 3SBOA 3M70A 1XV5A 1KZ1A 3HXTA 3VVLA 2IYPA 2QL6A 4DKJA 4HVAA 4ENUA 1QJ4A 1NQUA 4HMOA 4I2NA 2WYVA 1LQUA 2M98A 1HE4A 3EOAI 3RS2A 3VV2A 4OXIA 4GP7A 4RPIA 4TM7A 1KZ9A 1ZRNA 2GKOA 3EY9A 3VR1A 4QUKA 4IDNA 3RBXA 5D00A 1FZTA 1XALA 3EQ6A 4O2AA 2P9EA 1NQOA 3G68A 2HNBA 1Q0LA 2OD7A 1KERA 2N42A 4MGIR 4WLUA 1T4MA 4FFVA 4RVSA 3L05A 3UIEA 2VOJA 3ONDA 3DOEA 1ZN9A 4E5PA 5JARA 4KYTA 3KK0A 2OO3A 3U4HA 3QH4A 4PWYA 2IKQA 5JCZA 1NT2A 4DV2B 1CYEA 3SHVA 2OK8A 1UADA 2WM9B 2XYPA 4RWZA 3ENZA 4L74A 4P83A 5AJUA 2BJHA 1JHPA 3ZWXA 4CT0A 1CE8A 5MFPA 3F8TA 3SHQA 2X5OA 4R5HA 3P9RA 5E7QA 3ZDAA 2X9NA 3GROA 5H4HA 1SVSA 2X5KO 2YWJA 3B6MA 1YASA 2ZBDA 3LYAA 4HAUA 3QSYA 2RIRA 2EV9A 3EIEA 3W34A 4D9IA 3SSAA 4HN4B 4JYZA 2HD4A 2FMIA 1B0AA 1WL8A 1M8JA 1EFKA 4Z8YA 4M9XA 4NC9A 4V02A 2H1WA 2NPOA 1ONPA 2QE7A 3IJRA 1SQ6A 2CXXA 3LUFA 1NX6A 4PZUA 3PK0A 1NVFA 1VL2A 1DOAA 1NW8A 2XGOA 5M5BA 3ZJUA 1BOFA 4IGAA 5CT4A 2Q5IA 1QZUA 2PFGA 1VLZA 1AGNA 1SWWA 3L49A 4OHMA 3ZWDA 2QRGA 5CG1A 1UAGA 2O0MA 2QUHA 4PYNA 2YYSA 4QOEA 4TQAA 1E0KA 4WFQA 1AG9A 4HLQB 5TS2A 4BLRA 4CM8A 1Q50A 2CXNA 4N5HX 5EJ2A 2HKIA 3K1ZA 4HAIA 1Z2DA 4HWOA 5EJ5A 1B8OA 4D0GA 3H6HA 1E61A 3DBVO 4WBNF 2QGNA 5AJTA 4DRZA 4B6GA 4RIHA 4DXHA 3GGDA 4DXAA 3KG2A 3QE4A 3GQBB 5C7LO 5E2BA 3JQBA 2HK8A 1EM8A 4K46A 2DFPA 3LNTA 2K87A 3HB5X 3OZEA 1X7DA 2C7VA 3QY9A 3QMWA 5F2EA 1H65A 2R8RA 4NPCA 3T9EA 5JAQA 3WLRA 5KOYA 4XDHA 2VO1A 4Q7JB 2RGCA 3TQTA 3ZWKA 1MVNA 2Z5LA 5THXA 5DM60 1L7DA 4DLWA 2FR8A 5JBIA 3DDWA 3FJOA 5AOAA 4PX9A 3DGEC 4ZO9A 4KSYA 5BNZA 1ZHHA 5DI9A 1B74A 1C8BA 5BQPA 3W05A 3GP5A 1QH8B 2A9RA 2JKYA 4QQRA 4KPFC 1X9HA 2BH2A 1Z0JA 1OREA 2QAGA 5F9HA 1QHIA 3AFOA 3H8SA 5BR1A 1CZLA 5D7BA 4KNVA 3G9QA 1IDOA 3WLLA 2R6ZA 3MJHA 4EI8A 2PZLA 1I3MA 2CFSA 2YTZA 5JUWA 2ZYGA 2CJYA 2N3ZA 3IEPA 4LFAB 1KDOA 2O0LA 2VTKA 3ADDA 3S8YA 4JLSA 3ZZ0A 4Z4EA 4IUBS 1L5WA 2E4AA 5E0OA 3FTEA 3K70D 4TVSA 5CYPA 1Y8CA 1L6IA 3AFMA 4AYTA 1Z4NA 1NJ8A 3H8JA 2RGUA 4JX8A 1TO6A 3EDQA 3HBJA 1G5QA 4LCJA 1E2NA 5DNDA 1N5DA 1LI5A 3F90A 1NY5A 5DE3A 5EPOA 1Y1RA 1MIHA 1VHWA 3TF5A 3TAHA 3U5ZB 3D64A 3E2MA 1PGQA 2DJIA 5EPEA 3TJMA 2O20A 3JD3A 2WT8A 2J5BA 2ZIGA 2XOKD 2CLDX 3SN6A 4GD3Q 3HV2A 3KAPA 4BDTA 2CFIA 2QIOA 3VSBA 2B20A 1NLYA 2B78A 2Z1DA 3B36A 2VH2A 4L8FA 4PO8A 4B2LA 2CJPA 3PG5A 2PEZA 4ZT3A 2UUCB 1ZH2A 2IW3A 4OGFA 3L9XA 4EHJA 1BKSB 3KPJA 4DSNA 5M2QA 1B1CA 2ARKA 5EJIA 1IPEA 5GADl 3UMYA 2ACWA 1AHIA 1H9AA 4AX4A 4DIFA 1AN9A 1MC5A 1T3GA 2DWQA 2OOKA 3QUSA 5DGTA 4A0FA 3NP9A 4CEIB 4RHCA 1XMSA 1SUFA 3BD6A 5HRUA 3L8YA 2J5QA 4PHHA 2OLKA 3WRXA 4NCAA 3UENA 1U7OA 1U4OA 4TUYA 2GDZA 3B3GA 3VO1A 2BGRA 4BZWA 1Y9AA 3BE6A 1Y4AE 5KB3A 3HDJA 3NH9A 1PEDA 3GJYA 4EB6B 3SBDA 4EHNA 3RHZA 5IABA 1E18A 4RK6A 2DERA 2VP9A 1WP9A 3M81A 1Q2XA 5JNLA 2V58A 1FYDA 1HYGA 2TYSB 4HDCA 2VKQA 3BL5A 1R0XA 2YBEA 3NG1A 4NWIA 5EHQA 3RSFA 4KLNA 3TTXA 3PVZA 3TW8B 1Z12A 2XB6A 1THZA 3BDVA 3NP7A 4KJZA 5G1OA 5AVRA 3HRIA 2ISQA 5BQ3A 4UQOA 3STTA 1HDCA 1XTKA 1R5BA 3RBZA 1O2DA 2J85A 2BFFB 3ZGYA 4DA7A 2AEMA 3K2EA 4LXUA 3RTDA 1Z56C 3VHXA 4MVYA 4R2XA 1NIJA 1RFLA 3EXEA 1TUBB 2I2XB 4G1EB 1G9TA 1QDUA 3OICA 1BU8A 1T29A 1M75A 3IDOA 2P0YA 1GDDA 1QC5B 1AKUA 1PAUA 3H17A 1SUBA 1OC2A 3IC5A 1RYDA 3A25A 3LQ2A 1BYIA 1RSZA 1PEAA 1SUEA 2XUIA 3LF1A 4Q9DA 3V7UA 3VNVA 4N7RA 4OJYA 3U7QA 2Q2WA 2ZT5A 2DT8A 4E88A 2BUBA 2WNIA 3EGCA 3RIYA 2C3YA 3FNGA 1MXFA 2YVLA 3TR5A 1SULA 1MJFA 1NL3A 5KNCA 2IBSA 1KI4A 2NO5A 4YAOA 3W4IA 4KRFA 3T3GA 1Y98A 3DPUA 1AC5A 1O97C 2NT4A 2QX7A 4EI2A 5KSPA 1AF4A 1QU2A 1RWNA 3NH6A 2OILA 2I62A 3TPFA 3EVNA 4HDSA 3PCXA 1HUQA 4LOKA 4CTMA 2DBZA 2BM1A 4KN6A 4ZI2A 2L19A 4RV9A 3OWHA 4GLLA 3BJRA 4Z86A 3OMXA 2FDXA 3PPIA 5CNKA 5FWAA 1AE1A 5IWAB 5FLXA 1GGJA 5AVOA 3NHMA 2HPAA 4RDHA 3I12A 1D2CA 2HLPA 3FYUB 4IG4A 4ZVUA 1Z8NA 3QU4A 3PXGA 5C8YA 4RS4A 1KFCB 1OX4A 4PZAA 5BW5A 3VNQA 2B99A 3TL3A 3T1TA 4H1TA 2XMSA 3Q7PA 1DTWB 1UF9A 4RJKA 1NP7A 1KEWA 1QXSA 1QYXA 9GPBA 3EQ8A 2MJLA 4UUBA 5AKHA 1G5IA 2ADFA 3EC7A 1DOZA 1FNSA 1N9KA 5CCDA 3NWJA 3DBOB 4UBNA 1YOBA 1YZKA 4C3ZA 2JCSA 4AURA 4D4LA 4PX3A 1NA5A 2Z2XA 4HAZA 2AE1A 2CN1A 5AHOA 3VU1A 3DBLA 3L1KA 1ELOA 1N6HA 3AJ9A 4I2VA 2XBUA 4JLVA 1Z47A 3K1AA 4OJKA 5GM1A 2OY0A 2JZNA 4F3RA 4ZTZB 1OH8A 4CIVA 4F3KA 4QNNA 2ZE8A 1T4BA 4UM9B 3MWLA 2O54A 3NHZA 8AT1A 3M3DA 2AZDA 3D4OA 3FTDA 4WZBA 4G4IA 1CY4A 1O95D 2V59A 1RRKA 2ZT6A 1U3WA 3IBYA 3KU4A 1EUZA 3N2KB 4IZIA 2EHDA 3T3IA 2O3RA 3C5CA 3MTJA 3BXPA 4WESB 1P7YA 1B3BA 4KGVA 4ZALA 4P3KA 4DIUA 1E1RA 2E6UX 1GZ7A 4QU5A 1RXEA 1AQ6A 1CUFA 3OX3A 3UMSA 3AI7A 4IMRA 2JCXA 1JIKA 5T41A 1QSGA 2HGZA 2VTVA 4LISA 4E12A 4KQHA 2Q0QA 5CPFA 1P6XA 1UZAA 2BPOA 5TF4A 2XH8A 3GD7A 2CFRA 1VZ3A 5BRNA 5C37A 2ATXA 4MCIA 3DKRA 4CKWB 9ABPA 3L4BA 4GZ6A 3PDCA 2COKA 2ID9A 4ES6A 2HWKA 4BGVA 2GF9A 2IEAA 2QTWB 2GHRA 1G21E 2JVKA 2FX2A 1ZUIA 3JQAA 2HBZA 2J33A 2IIVA 2PJUA 3MWKA 4AJLA 1KYQA 4LDZA 3TXYA 4D9JA 4FYHA 1U7DA 1YTLA 2QRKA 1PIWA 4MQLA 1VGQA 2B8WA 1G18A 2IHTA 2VYNA 2VF8A 4B35A 2QL9A 4WAUA 1L8LA 1W29A 3ICPA 2W6JA 1JEYA 1T8RA 3QM1A 4GECA 4NYJQ 1E4YA 1NBEA 4OP2A 3HDQA 5L53A 1HZZA 4I55F 3EHDA 1A97A 2D0IA 1GUZA 4RFVA 1RYHA 4DGSA 2FG7C 4FHCA 2EKBA 2R6DA 2CEKA 4RXUA 2V7TA 4GDMA 3H9BA 4J0CA 4UPDA 3C74A 5KNDA 4LOHA 2B34A 1RD4A 1UBSB 4RYDA 2HRQA 1RJGA 5LDDC 4GO1A 5EXSA 1MEEA 4D9HA 1KDTA 3KEMA 4DG8A 4B3MB 1DELA 4PGFA 2EAUA 1RT9A 4KO2S 1U0FA 4MS4A 4D7AA 5L6MB 4EHLA 4ZAZA 4RGYA 5T8KC 3SI7A 5FR1A 3KC2A 2HRBA 1UKEA 2B30A 2GEFA 2GBIA 2ILVA 3E5NA 3NNNA 5DBFA 1ML4A 3L1UA 2AI2A 3RBVA 4KXVA 4N3AA 3HL4A 2V7VA 3DFIA 2ZCVA 4JVLA 3MSXA 4LS3A 2B6HA 4A0RA 1Q14A 4HWRA 1W75A 4FR0A 1XZ8A 4CU2A 2XF2A 3AR7A 3CWCA 3C2QA 4XYBA 4W6QA 3BDAA 4O5OA 1RI5A 3PL1A 1BXKA 2C7RA 1YZNA 2DBQA 4NBVA 5EEGA 1ZX1A 2PN1A 2X9GA 3LSTA 3OPYB 3UB2A 2CLMB 4Q37A 4L1KA 5CGQB 3T95A 5TSDA 3VOAA 1JEAA 3FOEC 1CR1A 1IFXA 2V96A 1T4CA 2DWPA 4LE0A 4UOZA 2G3YA 1MU0A 3WO1A 2B82A 2PA0A 4CIBA 2ZRNA 5IUJC 4MW1A 1E9SA 2ZSUA 1FW8A 3CU5A 3DKPA 4TKVA 2AKEA 5EOVA 4EVIA 3N28A 4NABA 2PLFA 4Q7MB 3A3NA 2QUJA 4JYCA 4DE5A 3FUUA 4ZAXA 1T91A 1IUOA 4BXOB 1YKSA 5CBPB 2WWGA 4BU1A 4D0LB 5FB3A 1H6AA 3H9UA 1FQWA 4OQQA 3PXEA 3PHIA 3P2YA 3PTZA 2IYFA 5EMLA 2PS9A 4GQIA 1DKLA 1OMOA 1U31A 4R8RA 3A6HA 1DO8A 2ZAOA 2QTMA 5F73A 2POCA 1FVXA 4MWBA 3VBEA 1KC3A 3LBIA 2OV6A 2WWIA 1Y4UA 2EGHA 1ZAKA 1U3FA 1EX6A 3B48A 3E3LA 3ND6A 4FFBB 4X7MA 3PUZA 1JLLB 1G8MA 3LWDA 1UDCA 4PAWA 3C6QA 4MW9A 4XJTA 2C8LA 3O8NA 3PJRA 1LLUA 4FJ1A 3JATA 3WZLA 3NGLA 4M9UA 1SIBE 3K9LA 1JQDA 4H9GA 4JUIA 4K0KB 1DT3A 2W8BA 1MABB 4GKBA 4INAA 1WQ3A 2QROA 3CSSA 4ISBA 3FW1A 4ZCSA 2J9GA 3ESZA 1RJWA 1Q7BA 1W46A 1GSHA 3MGKA 2BZ0A 4RTSA 3A9CA 3WLKX 2VYFA 2XHEA 2HA0A 3W4KA 1IIRA 3QLUA 1TQHA 1XKTA 2C42A 2OV3A 2R7MA 1FTGA 3DFZA 3K5WA 4ND8B 5KSYA 2LV8A 1RLMA 2GNOA 4MR7A 2FSIA 3DW3X 2REXB 2VF5X 3B70A 3TQHA 3VYSB 1CQJB 3FBGA 4L73A 1YRYE 4KVAA 3BIFA 2OE2A 2PRYA 4GE0A 3VPXA 3H9QA 4H0FA 4S1VA 1M8GA 2GGSA 2B4AA 2PZMA 4BMNA 3LIIA 2WF5A 3L5KA 1SCIA 4HLCA 2AQHA 4G1MB 2XTAA 4HEA1 3SY8A 2WTNA 3UUGA 3DLBA 4CGZA 3FUTA 5G1NA 2G4LA 3A9VA 2UVPB 3LM8A 4LGMA 5EUBA 3UHAA 3V48A 3BVPA 4DJ5X 2VOEA 3W6OA 3N2ZB 5DCLA 5ENZA 5JPIA 2J6IA 3PPVA 2QLBA 2GJ9A 3IAAA 3K0BA 3KTFA 4M0MA 4RD4A 3OA2A 3RROA 3STWA 4CVNA 5AW8A 3WB1A 4QSHA 4DCUA 3M1LA 4CI0B 3EXHC 3IT0A 2K7FA 5JOQA 2ZYHA 1ZNQO 2MR6A 1VGRA 4Y1RA 5MFZA 2R8PA 2YJTD 3FF1A 2HHHB 4QECA 2D2EA 4R81A 3QG1A 3ILXA 3NIGB 1LCIA 1U7PA 4V0RA 3RKRA 4NZMA 4PPFA 1B42A 2X8WA 4RCYA 2OWDA 1LSSA 3NYIA 2VK8A 5REQA 5D51S 4Q3BA 1T3HA 1OXTA 2R8BA 2Z4TA 1IPHA 1Y6QA 3FB4A 3G17A 1EWVA 3EMDA 3NQ41 2B4KA 2H4YA 3VZRA 4B9AA 5ADUS 1TJ5A 1OV6A 1Q2UA 1SBZA 3L46A 5KQMA 2EBHX 2A3NA 1ODSA 3LPAA 2Z2IA 3B1JA 3THYA 1JBQA 3OE7D 4WBNB 1LC0A 4M0CA 4Q9HA 3O8CA 1IWPB 1FQKA 1QE0A 5DOZA 2FXIA 5GY7A 4LZAA 4PXSA 4H77A 2IYWA 3SZLA 3JWEA 1DEAA 1L5NA 3UG7A 2ORED 2XVMA 4FLFA 2PANA 1QCZA 4Z9YA 4C9BA 1Q1AA 2NZVG 1KZGB 3ZJ5A 1E6KA 3Q3CA 2R6CA 1PL7A 3ISVA 4JT4A 4ZOLF 3ZHSA 3UPUA 4Q4HA 2NO9A 1RIIA 3OZIA 3JQGA 2JFQA 3A6ZA 1QWSA 2P41A 1YI8A 4ZMRA 2A94A 3W0LB 1E2QA 3GLIB 1B73A 4WK6A 1KZ7B 3U80A 3BF8A 5DTMA 4CW7A 5AP9A 2QN1A 4HDMA 3ZGXA 4H7JA 3T7RA 2I1QA 4B33A 3W1VA 4EYQA 5B1IA 1QP4A 1E1QD 1OJ7A 3QOYA 4KWTA 4XVQA 4WADA 3CJTA 2WOJA 2HPHA 3PD7A 4WRRA 5JS6A 3CW2A 4MHSA 1CY0A 1MGPA 1NXTA 3U5TA 4MLDA 3TIIA 1II8B 1Q1ZA 3AHGA 3G2NA 2JZOA 3ICVA 1HNNA 5BN5B 1PX0A 1EEXB 2C8KA 4KH0A 4MUEA 2NSJA 1XZHA 3GUZA 3RYTC 3HHPA 1K3TA 1MC8A 5KYNA 1QP0A 3IE0A 1YUBA 1T5HX 3HS3A 4XLTA 5FL7D 4EQ6B 2DXIA 5C8YF 3MB5A 1HDOA 3CTMA 3NMUF 4IGEA 2YFKA 2QM0A 5A0FA 1UIRA 1P75A 3TBHA 5CLGA 3BCUA 3GK3A 5A4AA 4BE7B 1ZD2P 5DISB 3QBJA 3G1WA 1ZICA 4LQDA 4PEVA 3S8EA 4G07A 3EC2A 2PJRA 4CDRA 4ERXA 5D3MA 1ACJA 1EK2A 2BP7B 5F3RA 1GQSA 2RH9B 3QKTA 1BO6A 1K6XA 3JQ7A 1E3WA 3WGIA 4DCMA 2YYAA 4FFPA 3H1PA 3BSSA 3IAM1 3PIRA 4LC1A 4OQNA 7MHTA 1VHTA 1VJ0A 1AKTA 2SKEA 3DHNA 3E3AA 5JLJA 2XNDA 2VP3A 4MP6A 5TIIA 3Q0TA 4ZWNA 4FOOA 1UEIA 3RADC 3P0IA 2YOFA 1EFVA 3GN1A 5C8VA 3UB4A 3LCUA 1RAEA 2JDIA 2BFDB 4JODA 1ECCA 2R84A 1AGYA 2X6QA 2V7UA 4M4SA 3WGYA 4IJKA 4DDWA 2FZ4A 4FYWA 5FTWA 4Q3OA 4DQUA 3I2HA 4IRXA 4RJ2A 5IKXA 4RVNA 4TL9A 3G0CA 1I0ZA 1OF1A 1YCFA 4KXXA 5BN4B 3ZKWB 2BGTA 2G07A 3OP4A 4C01A 5M34A 3VNUA 4MQFB 1LPAB 3ZZTA 8ADHA 1O89A 1T36A 4YLEA 2PD4A 2HMAA 1NJSA 3MB8A 3I9V6 2OWEA 3NCTA 4WL0A 2O3TA 3JTEA 3ABSB 4K26A 5DXJA 3L06A 1U5AA 1XP5A 4QUJA 4WK4B 1XBTA 2I3GA 4CMCA 4UCWA 2XWBF 3BEDA 2GCGA 3IKTA 1N1EA 3JQ9A 4M1TA 4NSNA 2ODAA 3SE0A 3DO6A 5C5DA 3ZCSA 4PZ9A 1YUNA 4GBED 2XSZD 1FFXA 4ENSA 5GVSA 1W73A 4YXWA 3C85A 3KWMA 4LF5B 3BREA 1PQ4A 3WJAA 4ALNA 1AZLA 4UAJA 3SQOA 3LD9A 1S1MA 5KWSA 1JHRA 3QPBA 1M0EA 2CC2A 4FEEA 2JHGA 2X86A 5GIOE 1W87A 1PFGA 4D99A 1IY1A 3TGPA 1W4LA 2UXBB 1PDOA 1JKJA 2Q45A 3VR6A 3V33A 3HYTA 4L0DA 1YVDA 3NW9A 4XIFA 2FW1A 4QTZA 4MKGA 3T3OA 2OHHA 2H48A 2PKWA 2VBCA 4OYLA 1LPNA 2BFAA 4BAZA 1BA2A 3F6BX 5K8TA 1EK0A 3FYHA 3QF4B 4PBRA 3FTFA 3H75A 5DN6A 1Z6AA 5HBGA 1QF7A 3JVUA 4NICA 3R7WA 3VRHA 4HDNA 2BEUA 3DB1A 3D2AA 4CQJA 2XCUA 3FBWA 3R44A 2J41A 4QEKA 2YZNA 1FRNA 1CIPA 1CKEA 2EERA 2H16A 4XPIB 4C7JA 3CA8A 3L43A 4NQZA 4EK9A 5K01A 1CNFA 5BSRA 3H0CA 3VUEA 5LKRA 1ZESA 3QVOA 1JR3A 4JBIA 1V2GA 1XTUA 4CKEB 4ZK2A 5AQ1A 1XZJA 1ZCAA 5HZKA 5DX1A 3ORFA 1JH8A 5CVCA 1AUQA 1DWPA 1F3OA 3I8XA 2CLOB 2DULA 4OTZA 1G3MA 5HMMA 4DOMA 1PZNA 3ZH2A 2W42A 3GVCA 5FUQA 3GEHA 1RXYA 3NPMA 1KVTA 1T6YA 2NYUA 4IMIB 1TZMA 5FPTA 1IEXA 1UPXA 3LBAA 4OJTA 3WYCA 4QG3A 1SNYA 4GC9A 2G09A 3QWHA 4KIUA 1F7UA 1IM2A 4L9SA 5CDHA 2WIJA 1KDVA 4UE2A 4BQPA 3LQ4A 5CEFA 1PLKA 5TPWA 1KEZA 1T2CA 3EOZA 3T7DA 1L7BA 1Z6PA 4DN6A 1FMFA 3TKYA 2HWUA 4C22A 1DRUA 4KX3A 1NV8A 3PJGA 3JZIA 5CP8A 3RIXA 2PUBA 5BYKA 3K4HA 5H59A 3I4CA 2F90A 1P1IA 3E61A 1GRVA 1UFQA 4ED9A 3PE3A 5CDFA 1GQYA 2DAPA 2WRZA 1GQQA 5AESA 4M9CA 1XQ1A 3QW2A 4MIEA 1JIXA 2CZGA 1Z35A 2I76A 3RAFC 1XQXA 4OO3A 2WP8J 3SDSA 4WUTA 4YT8A 4AZ3A 2E89A 4NCNA 4ARCA 4K0RA 4L16A 1PE0A 2ZWVA 3EXG1 2MSNA 4CF7A 4ESVA 2VA9A 2GO7A 2QJTA 2WHEA 3RWOA 1M2JA 2Q46A 5ICMA 1QG6A 4JCCA 2ZJYA 2WTAA 2PUFA 1U9YA 1C7EA 3RFVA 3KJNA 2AFHA 2ZI9A 4Q3LA 1K68A 3IUJA 2GVDC 4QT4A 2H4JA 3KZNA 3G82C 3Q4GA 4JU9A 1F06A 5AMXA 3KJIA 3Q8WA 4F2GA 3CNLA 4WLNA 1TLLA 4JXKA 3MZ0A 5EP4A 1RLIA 2ZBPA 4UTPA 1UMCA 5F2KA 4ZI7A 5GOZA 2UYGA 5EVJA 4W9NC 2PSFA 1XQ9A 3TK1A 2I7XA 5BYAA 5JEEA 1GNSA 4FOPA 4PNHA 3EBOA 3GHHA 3PR1A 1Z0ZA 2QTHA 3IIKA 4UUOA 2ECOA 3JR7A 4YAFA 3CCBA 3EWIA 1G2IA 4J0HA 4ER6A 5I48A 4CODB 4YAGA 4DV4B 1GGVA 3UY4A 4N8SA 4L4ZA 5I4BA 1UBNA 1M0WA 4P4LA 3TNYA 2VAVA 2Y92A 4HLNA 1MNAA 3VH2A 2BE7A 4YN3A 4I55B 3WMWA 4LF6B 3CZAA 4B3GA 2WU8A 3MRTA 3R5JA 1FNMA 1I2ZA 4G65A 5HE9A 1GQFA 5LOVA 3CSDA 3NVAA 1ZA1A 2ENUA 5BV8A 4JH0A 2ZJZA 2GJ4A 3SJZA 2OR3A 3IRUA 3TQRA 1ISMA 4E5UA 4TPKA 1BA3A 1D9ZA 2SCUB 4GC5A 4WNAA 3GUHA 2Z1MA 4JQZA 1QLJA 4LKRA 5DTIA 1GKUB 3QKSA 1LXCA 4ZP1A 3RTAA 1NG1A 1RS0A 2JJ2D 3FKSA 2Z5GA 3L8GA 3RODA 5IARA 1H5NA 2UZ3A 5DT2A 4DQDA 4Z9AA 4BFLA 4UM9D 2O1WA 5E4TA 4QDUA 5DXFA 4EELA 1ZR4A 1E9RA 5B53A 1EZZA 1PK9A 2GK7A 3WAJA 1QGUA 2B4YA 2QUAA 3BH0A 3N7AA 4P22A 1N3BA 4URUR 4XDZA 3WNZA 3ICQB 3O7MA 2A5FA 1YDWA 3KYDA 1G16A 3QZUA 2JIBA 4MA0A 1EFTA 4EI9A 4RQUA 2B37A 3GY0A 3VPGA 4DUGA 2PUHA 3NORA 5L3QA 4Z7OB 1P4SA 1M0TA 1ORIA 4X3PA 4RENA 5M7EA 1EVIA 2VPYA 3NOQA 1L4NA 4H60A 2JZCA 4F60A 3KJGA 3PC7A 4A27A 1HF3A 3NIWA 4FR2A 2A5YB 5I01A 3EPKA 1Z4OA 2OG1A 4JLJA 4DT1A 4HRAA 2WIBA 1VSBA 3GT7A 2AQIA 6GPBA 1M34A 4R1OA 3S2YA 4XB2A 4FN4A 1BDIA 4AJKA 4J0DA 4HTFA 5JY1A 4O8CA 4D25A 2JGEA 2ZQZA 2B94A 5E9JA 2IELA 2IPXA 2GHIA 4E31A 2JCYA 5MN4A 3K92A 3E7FA 2H92A 3RHSA 1GGHA 2R1UA 2REQA 2X22A 2AYYA 4P84A 5L9AA 4NP6A 1VL0A 3U7FB 3I28A 3QLVC 4WDRA 1QG2A 3V34A 4CM8B 4PFSA 2VDRB 1WSWA 4D98A 3U09A 2O8EB 1R0RE 2IHBA 3D3QA 3DKKA 4YX9A 3KNZA 1CRPA 2C9DA 4IHAA 1B0UA 1X1QA 3REFA 3V8EA 4HX5A 2VJMA 3WBKA 4AQYB 4KNWA 4J16A 1G66A 1RKQA 2BKAA 1CXZA 3UKDA 4KHPB 1E2IA 2FWAA 4QVKA 1DJNA 4CLDA 4BECA 4PZLA 1C7FA 3WOHA 2D0DA 2FJ0A 4TTSA 1K7XB 3IESA 4A8JC 4HVLA <