3V4OA

Human malt1 (caspase domain) in complex with an irreversible peptidic inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
234
structure length
234
Chain Sequence
DQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 87
structure length 234
sequence length 234
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4oA00
3H0EA 2AR9A 1RWPA 5IBCA 3K7EA 2QLBA 3KJQA 2H5JA 4FDLA 4HQRA 3R7SA 4ZVSA 1SHLA 5IARA 1NW9B 1QTNA 2H4YA 4EHDA 4QU0A 1CVRA 3R7BA 4FXOA 3PCXA 5IBPA 4QUHA 4ZVQA 4EHLA 2QL7A 3D6FA 2P2CA 2CNOA 3V55A 4DCJA 4FGUA 2C1EA 2XZTA 4N6NA 4JQZA 4N5DA 4I1PA 4QTXA 3R6LA 5IBRA 3H11A 1QX3A 4PRYA 2H5IA 3D6MA 4NBNA 4AWAA 4EHAA 5LUBA 4EHHA 3H1PA 3IBCA 1IBCA 3GJSA 2CNKA 4NOJA 4QUAA 2NN3C 2HBYA 3V6MA 1RE1A 2J32A 3E4CA 1ICEA 2WDPA 3P45A 1CP3A 3BIJA 1PAUA 3R6GA 3QNWA 4PS1A 3V6LA 3SIRA 3KJFA 4D3ZA 4QU8A 4AWBA 2H4WA 3SIPA 5IANA 3NKFA 2CDRA 2CJYA 1F1JA 1RHKA 1RWNA 2QL9A 3V4OA 3DEIA 4JJ7A 1RHQA 2J33A 2QLJA 2C2ZA 4NBLA 3DEHA 1BMQA 3R5KA 5LU8A 1GFWA 2CNLA 3P4UA 1KMCA 2XYGA 4IEFB 1RWVA 4PS0A 4ZVPA 4D3YA 4NOLA 4QUGA 4ZVTA 1RWOA 1I4OA 3H13A 2DKOA 1NMEA 3EDQA 2H54A 4N6GA 5K20A 3PD0A 4QU9A 3NS7A 4QUDA 2XYPA 4LSZA 1RWWA 1K86A 2XYHA 3S70A 2QLFA 2HBZA 2HBRA 3D6HA 4JR0A 1SHJA 2J30A 1QDUA 1JXQA 4D3XA 4ZVUA 5IAKA 1I4EB 1F9EA 4ZVOA 2J31A 4M9RA 1SC4A 4JR1A 4EHNA 4I1RA 2FUNB 3GJRA 2H48A 5IC4A 3KJNA 4HQ0A 3H11B 4EHFA 3DEJA 4FEAA 1PYOA 5LUAA 2XZDA 1I3OA 1RWMA 5IABA 4QUIA 1NMSA 1K88A 3R5JA 4JJEA 4ZVRA 2CNNA 1NMQA 4IYRA 2HBQA 5IC6A 1SC3A 4QUBA 3UOAB 5IAEA 1RHMA 4DCOA 3S8EA 4QUEA 2Y0BA 3V3KA 1I51A 3ITNA 5IAGA 3EDRA 5I9BA 5H0IA 4QU5A 2FQQA 4HVAA 3DEKA 3R7NA 4N7MA 4JQYA 4NOKA 5I9TA 1SC1A 4QULA 2C2MA 3V4LA 1RWKA 4EHKA 3RJMA 5LU9A 2CJXA 3GJQA 5JFTA 1RHRA 1RHJA 4JJ8A 1RHUA 4N7JA 1M72A 3IBFA 1RWXA 4JR2A 5IASA 2QL5A 4PRZA 4DCPA 2H65A 5IAJA 4AW9A 3GJTA 2Y1LA 1GQFA 4EJFA 4NBKA 4QTYA 4QUJA 4N6OA 3NR2A 4NOMA 3UO8B 2H51A 2C2KA 2FP3A 2K7ZA 3OD5A 4JB8A 3PD1A 2C2OA
chains in the Genus database with same CATH superfamily
4G97A 2HI0A 2FN3A 1HOXA 2V6FA 3UT0A 3K8ZA 3UPDA 4B79A 2H3EA 3UMVA 3OZWA 4HNGA 3VHXA 1RAIA 3T41A 3PWZA 1GPLA 3QVGB 4RK7A 8ATCA 2EYQA 2UVPB 4Q66C 3DM5A 4QO7A 1TM2A 2K6GA 3KLOA 3X2EA 5KYKA 5CCDA 4XVCA 1QK5A 3CXUA 4I1VA 3GEPA 5AKYA 1S8NA 2GK3A 1DVRA 4TWAA 2VDMB 5BMVA 4KU4A 5JS7A 4LJ4A 5JW6A 1ZOSA 1E3EA 4K9RA 5KSYA 3AW9A 3IH5A 4L28A 1P5JA 3ZHYA 1N7GA 1LS6A 3JU3A 1NSFA 3LCUA 4FFMA 4KE8A 2JCYA 3KSUA 1XMIA 4HADA 4KPGA 5DSXA 1ZRNA 3JR7A 4MWSA 1EFVA 3DFUA 4FBLA 4DKXA 1BX3A 2DHDA 1NJ6A 2EDCA 3TRJA 3DNMA 3EZ9A 1SH7A 3PQ3A 5COAA 2YJ6A 2QL9A 5J2UA 1HZJA 1PQWA 4IFBA 4QICA 1UBTS 2FOXA 2VYFA 1GUAA 1XEXA 2FEMA 4PU0A 3ZJUA 4Q15A 4EYKA 2BZ1A 3CRNA 1RXUA 1JR4A 2KLBA 2ZRAA 1IJEA 3RU3A 3T34A 4TMTA 4HVTA 4S04A 1A27A 4MYHA 1O3YA 2PGAA 3PUJA 3RS8A 2R8RA 5I5GA 1K68A 2F3SA 2Q5QA 4KRXA 5A2QA 1ENOA 1PDWA 1T1GA 1Y63A 2VYQA 3GMTA 3RRMA 4Z1MA 4YCNA 2ZT7A 5D86A 1JDBC 2HTEA 2KI5A 3K0AB 5F2OA 4Z99A 1WZCA 4ZVOA 4WY8A 2BL4A 5BMVF 1GG9A 2YWRA 2H48A 1VHTA 1QYIA 3CLVA 3E48A 3IYLW 1C0EA 1COZA 2QYTA 5AW9A 5KWJA 2RJOA 1KPHA 4CG0A 2A7QA 1A8HA 3BBPA 3EBPA 4G0WA 1V5GA 1HNXB 2VEDA 5JJ5A 2A8YA 2BT4A 4NG4A 3U3XA 3N59A 5JXIA 2WWYA 4AZ3A 3OSZA 1EGVB 4UHBA 3GBSA 1W1WA 4QUBA 2BMEA 2QMHA 3IURA 3WGHA 1R8QA 2WHRA 1SXHA 3X44A 5I4BA 2ZAIA 3DGEC 2QMYA 4IM7A 1BVRA 2BGTA 2XQJA 3RG2A 2YFKA 4Z54A 1U6JA 3KV1A 3WOVA 3K5IA 3TPFA 1NN1A 5K03A 4NZPA 4DR1B 1G63A 1KEEB 3QE0A 5LLSA 2G1PA 3PG5A 1CQPA 3RUFA 2CXUA 5EZYB 1CCWA 3WK8A 2O5VA 5TQ0B 5JSHA 1FFBA 1Z83A 4ZP1A 1EFUA 2P27A 1OXSC 5BNFA 3UAWA 4DY6A 3F6EX 1JDPA 1T9BA 5GONA 2X0KA 1U81A 1UM9A 1HT3A 2FR1A 2JD1A 1P5ZB 1W76A 1FX0B 2AKYA 2YXNA 4O2BF 2UYHA 3HVKA 2IYOA 3PV0A 4L5AA 4M76B 2QNIA 1J5PA 1P4AA 4NE7A 4RY0A 4LHZA 5K0BA 1GPNA 4MITA 5D3ZA 4AT1A 1ZD8A 2JPDA 4K6HA 5C46F 4LF6B 4JJGA 2QG4A 1Y3CE 2Q6VA 3JZFA 2G40A 1J1IA 3MJRA 4QRDA 2FQXA 3SLRA 2P6OA 3C1UA 3O74A 3W5SA 2NZVG 3F2VA 3HR8A 3THWA 1XEAA 3CONA 1ZSVA 1FZQA 1ZGAA 1HMPA 4FWBA 1JDJA 4UD2A 4MUBA 4PZDA 3ZW9A 4UUPA 2AJBA 3VFDA 5CVJA 1E1QA 5FPTA 1M6YA 2Q0QA 1VHQA 1Y82A 3EARA 3VAAA 2HWKA 3TRHA 3I2JA 1TJPB 2IVZA 2Q8NA 4YJFB 1EKXA 3V7YA 4F1KA 6PFKA 2XJ4A 3BCHA 3LVBA 2Q49A 1D1SA 5JCXA 1JDNA 1JDBB 2IIQA 1C7EA 3AHCA 3PI7A 3NUQA 2XD4A 4X1YB 4EHAA 3CISA 4PRLA 3K9WA 1I1OA 1ZD3A 2HHAA 2YMQA 2EZTA 1QSGA 1TYDE 1M1YE 2HRBA 1YB1A 2CKMA 2P79A 3AETB 3ASVA 3NHYA 1T2AA 5JAIA 5JXWA 3HBNA 1OA1A 2OVFA 4BV3A 2PAAA 4RBNA 1A7UA 1WKCA 2VG8A 1IN6A 1VG9B 5J4VA 1JEOA 3FHOA 3ICPA 4GE3A 2OHHA 3U40A 5HJEA 3IP3A 4KAJA 3BRSA 1GM5A 4ZZ3A 4IKPA 5KNBD 5GONF 2WF8A 1Y34E 2Q6IA 2XUFA 3FZQA 3E0QA 3Q7PA 4WRRA 1T2DA 3A04A 1L5YA 1PDVA 4N7BA 3GJ7A 5TT0A 1Y1LA 4Q3EA 3UPUA 1OWMA 2GCIA 1B16A 2AUTA 2JZOA 2KPOA 3HRHA 1AM4D 3RU2A 4Z6KA 5AQ1A 5AJTA 2VSNA 1G60A 3F47A 4OQQA 2CE2X 5L3QA 2BFEB 4IUCS 4IO0A 1C3EA 1FQWA 1M2VB 3OOJA 4OIMA 3WRYC 1OU4A 4CQLB 4AZ0B 4EJ2A 4WY2A 5CNIA 5AHXA 3AR4A 1QH0A 1TL7C 3JQAD 1DWPA 2BC9A 1SHUX 2FF5A 3A9WA 5TB5A 1XQ9A 1FCJA 1T1IA 5ERXA 1RWWA 4Q7KA 5DFAA 1UKAA 1WQ3A 4TMVA 4J49A 5B3LA 2H2FA 4XIFA 3T0GA 2JFYA 3TAXA 2ODWA 2PYIA 3CSSA 4BWYA 2XA1A 4P2GA 2A9JA 1I4EB 2OAEA 1GPKA 1LA2A 1RYBA 3PSHA 4KFUA 4R1SA 2VJAA 5H70A 2C5LA 4LAFA 5JJKA 3FD8A 3ZGYA 3LYHA 3SX0A 5GZ1A 1PTJC 3NHAA 1FMLA 1DJPA 1WKBA 3EUWA 4KIJA 4QDZA 4EW1A 3BS4A 1H2EA 1UEJA 1SBQA 2ZE5A 3Q7EA 3QXGA 1L9KA 1QONA 2HCBA 3O90A 4TSKA 2VSXA 1M2OA 2XUDA 2YCBA 3AZPA 5E9AA 3U7QB 1F14A 2NM0A 1FFGA 3LAWA 4Z0TA 3PWSA 3T9DA 3WS7A 5C7IO 4P86A 2X4IA 2HO5A 1L6IA 3WGNA 5F51A 1MAWA 4G1EB 3COSA 4GOOD 4KXNA 1HDOA 2EARA 2D1YA 5JR3A 3HM9A 1YBAA 3NHRA 5EWMA 4ZXFA 2XF8A 3PKJA 4ZEWA 1CRPA 5CLLA 2QRJA 1YS4A 1ETHA 3EVZA 1YCDA 4TWZA 3NHKA 2F90A 3H75A 2Q5CA 4NBTA 3OIWA 1JBQA 4ZAFA 2PLRA 1C1XB 1HE5A 1MFZA 1NL3A 1R6BX 3GCGA 3IT3A 3AFNA 4LXYA 4MJ7A 4O4HA 4TZ0A 1E2BA 4F6RA 4GM1A 1YIDA 4JB3A 4BMVA 3BM5A 4ENVA 1E3LA 1SK9A 4XFDA 5I5EA 4TL6A 1DP4A 2GZDA 2OCBA 3DB2A 2GHTA 2EFYA 4PSKA 3OU7A 2BFFB 3JWEA 3R1IA 1CY6A 1U2ZA 1VA5A 2MSKA 1Z6YA 2DHQA 3EH1A 4J4HA 5EOVA 2O8DB 1EVQA 3I01M 3R76A 3O9ZA 4JUCA 5DXFA 3RSQA 1IY0A 1G8PA 2CYBA 3Q0TA 4FHCA 3SYMA 1RQRA 3I92A 3LNCA 4XB1A 3SGLA 4RTKA 1OY1A 1VFNA 2ALJA 2YOGA 4RJJA 5I7UA 4JGGA 3C1TA 3G8YA 4HN9A 3FPGA 3OZAA 3IEMA 2J0QA 4R2MA 4GGMX 3SWWA 4DG5A 2GF2A 3IKVA 1WB9A 5C18A 1MENA 4HXYA 3IDQA 1KRXA 3HUEA 3R40A 1QHGA 1QV7A 3B78A 5F7XA 4CCYA 3P8ZA 2PM8A 1UMBB 2V4ZA 4QXPA 4MR9B 2P69A 3KLMX 4BNZA 1WU8A 4L7VA 2OPBA 4IUDS 1J6UA 1EGHA 4NNJA 1DMRA 4BO6A 2CLSA 3AHJA 5B58T 4P9NA 5ICEA 4RAOA 3I1FA 1SIUA 3SF8B 4O4HF 621PA 3CZ5A 1GQOA 2QMOA 4OFXA 2FV8A 5HZMA 1SBTA 3UT6A 3EULA 1R66A 1N75A 5I7VA 4C2UA 1I13A 3LHIA 4R69A 1NR1A 1QKKA 1TPZA 2JLCA 3C6BA 5EQDA 4DRYA 1L5MA 4KVZA 5FJIA 1E3QA 1M2JA 4URFA 4AULA 2GWRA 5F4ZA 1FQJA 1H2FA 1KOJA 5JECA 1USVA 3P4UA 1NP7A 3QOYA 3QPUA 2G3YA 1T1RA 2PA3A 1VL5A 2XHZA 2WU8A 3KSZO 2IUTA 3GL9A 2P7HA 1HDZA 4OM8A 1RJEA 3SFTA 1L4NA 3DT6A 4MNTA 1MPXA 2CEAA 2DPHA 2XNJA 3SF0A 4XX0A 2JFUA 3N05A 3KOUA 3VJKA 1G8MA 3NBFA 2J4FA 3BSFA 5FUMA 1CZLA 1MBZA 1TK3A 3D6JA 2AC2A 1MOQA 3HKCB 3K3PA 3N8KA 4QAQA 4A6XA 4MP3A 4BZZA 3KOYA 2BGWA 2GVNA 1MJNA 3LMKA 2JH9A 4JJ4A 1H42A 4I99A 4JOQA 4YJDA 821PA 3A1DA 1HLFA 1VMIA 2QGNA 1XVUA 1FA9A 2YHAA 3OT1B 4EHFA 4YRSA 5K8CA 2I6FA 1N4DA 2JDID 1D2CA 4WGFA 3OM1A 1RRMA 5DNEA 1KBZA 3DMYA 1T34A 2D7JA 2NACA 2XNCA 3EZXA 3I2FA 3HNOA 4MP8A 4MVJD 4UU1A 3QELA 4V1CB 4RDCA 1JQ5A 3E1GA 2X14A 5BN4B 5IAEA 2VN8A 2CDNA 3I45A 3T7AA 3IIEA 1V3VA 2PPLA 4L8GA 1QGOA 3VNRA 4LXXA 4K6CA 4EGSA 4XX1A 5BN5B 3KKKA 1C41A 4PF1A 3WMXA 5KWEA 1B6TA 4MWBA 2JANA 2GNPA 3Q10A 3DV2A 1S0UA 2O3UA 4WE3A 4CF5A 2R4TA 2WSIA 3CWZA 1OHHA 2FXVA 1D8AA 2JGAA 4DANA 3ZDEA 4ND3A 3AVYA 4XD7D 4L6AA 4KMRA 1SN7A 3GRZA 3GYGA 1V16B 1QF9A 4WXEA 3VH4A 3RM3A 4QFBA 4AQDA 4LSMA 2DU8A 2QTFA 1WD7A 3EA5A 1X7YB 3KOMA 4FOLA 4G5RA 4MARA 3HO6A 3QFRA 4P38A 1ZHFA 3ABRB 5H16A 5JSKA 4NSNA 5TQVA 2OP0A 3OZXA 1OWLA 3BGOS 2H0RA 4E1BA 1S02A 4YLGA 3TCXB 2WM3A 1YZKA 1QH1A 2ZULA 3RUIA 1R5BA 4AKIA 4RAQA 7MHTA 2I6UA 3VI3B 1N77A 2HCJB 2HHJA 4ECEA 1C8LA 3QUBA 3TOZA 1OFHA 1IK6A 2ZRQA 4IAOA 4P7KA 3FCCA 2XJ9A 3QU5A 4H77A 3U37A 4A2CA 2B8NA 4R7GA 2BFDA 1X19A 1KIFA 1GR0A 3DE1X 4V0KA 2VA8A 5AKXA 5B1SA 1GSHA 5KI6A 3EVBA 2V1UA 5DRYA 3DAYA 4JLPA 4R2KA 1ENPA 3FBWA 4UASA 5BUCA 5IXJA 2XRMA 5KOIA 3E7PA 4LDQA 2HHHB 2BZSA 4FFLA 4GPBA 4RM3A 4D9KA 1C7ZA 3T3MB 4E0BA 3TIGA 5FQOA 3NHJA 3S2EA 2DBRA 5LLDA 1HYEA 3GQBB 4Q3LA 3WI7A 3QEMA 4D80A 2D2VA 1IIRA 3KT0A 3QWAA 4YRIA 2GJ8A 1EFKA 1EQUA 1EWTA 1OFVA 2OR3A 3E2MA 4XIGS 1Q6YA 5AKKA 3UKOA 4RYDA 3WMFA 3ANLA 1QIHA 1TQHA 2ZBFA 1DAMA 1GP2A 2PKCA 3UJ7A 2YC4C 1QR6A 4D98A 1HYBA 3OZDA 5CITA 5AVVA 3CVWA 3I9V6 4GKAA 4V0QA 2IIPA 5DP1A 1U0RA 2OZLA 4G4JA 2XPCA 3K0EA 2PBLA 2JL1A 1JVBA 1GU7A 3DYVA 4P2BA 4YJ2B 3EQ7A 3K9CA 3TLKA 5A04A 1N3BA 1G2OA 5AI0A 2COKA 1ONOA 1OBOA 4F11A 2VPXA 2AFIB 3PJEA 2Y67A 3FNGA 1HA3A 2DFDA 3FGZA 3ETDA 1CFZA 5K4AA 2VDNB 4N3CA 1O54A 1OB2A 1T29A 3CUKA 3V33A 2XIJA 3W0LB 3T12A 1ZZEA 3N39C 3TIIA 4CHTA 3RT1A 4D4HA 1Z5PA 4DMGA 1WMDA 4F86A 3ZXUB 4B5LA 1F9EA 2GBFA 4IIGA 1NV8A 4Q48A 3RVNA 3FGOA 1DHRA 2DEUA 4X54A 3IQXA 3KZKA 3UAXA 5KMGB 4UHEA 2CSXA 2R6DA 3G5LA 4G0XA 3B9RA 5DOVA 2KM1A 5EZQA 4DBVO 2ZYTX 5K6AA 3ICVA 4DQDA 3DWFA 3AEUB 2G1KA 2HYDA 3UK6A 1KBQA 1O94A 3RGWS 4AICA 4AJ1A 1JEYA 2W6PA 4DSUA 4AMUA 1XTKA 3DTTA 4J94A 4RTQA 5BQPA 1ZGZA 1RJ9A 2C54A 1KK2A 3NATA 1SXJD 2XAUA 1D6NA 3QZUA 4FCVA 4G8BA 4H4DA 4WOKA 2ZTSA 3B2NA 4XVHA 4YC7A 5SZIA 3FHCB 1RIIA 5DM60 1W30A 2ZJ5A 3OCWA 2CJPA 2ADMA 5BT9A 3HJHA 3UCXA 4KOAA 4K9KA 4L4UA 1PJQA 3GPCA 1RLMA 1XNGA 3C3PA 2JCGA 3SPXA 1QVZA 2AMLA 1LWOA 1N8SA 1UT8A 1WY7A 2C5FA 2IW3A 3MCZA 2Q41A 3MGBA 5ESWA 1NVTA 3V8BA 2HNBA 5TJ9A 3SU8A 4QEDA 4E30A 4UOQA 4OYHA 4LWZA 2H65A 4A5SA 1UPTA 2Q07A 3THXB 2J6BA 4YHBA 5KTMA 4HB3A 4MYUA 3EXEB 4INPA 2BEJA 2H4HA 3FNIA 4IDNA 3U3DA 5LWHA 1PU2A 3GU3A 2EKBA 2FPMA 1TU0A 3E9NA 1C3VA 3FOFC 4RFSA 3EPRA 3JQ7A 4WCFC 4JI3B 1USUA 3ZKWA 1AK2A 4QG3A 2AD1A 2C8LA 3VKVA 1BWSA 1QNFA 4FBGA 1VHJA 4BQEA 4FOSA 1IVYA 2IPXA 2ACKA 3CQ9A 4G4SP 2RHHA 1XZQA 4GDMA 5FTMA 5A6SB 3FNFA 1AHNA 2G0TA 4R8KA 1NLZA 4FK8A 1IOZA 4OSEA 1F48A 2CFOA 2OORC 2CXOA 4HWPA 5IJ0B 4RPCA 2INGX 3DAOA 3QI2A 4HTFA 4OCZA 3GPDG 4BFXA 1SMKA 3DVAB 2YC2C 3UXYA 2FWJA 4JXXA 1Q14A 1CY1A 3T35A 1PR2A 1UBUS 4HY3A 421PA 3GAZA 3MINB 2IRWA 1IB6A 4DCGA 4QUAA 2I6SA 2PVSA 4JWKA 1SCUA 2HXSA 3EXG1 3TLXA 3R3WA 1KEWA 2JKZA 4Y0NA 4NCXA 1JXAA 3SKVA 2C7PA 1OXVA 5G0VA 1BFUA 1MG5A 3D2LA 1QIDA 3QF7A 2ZB4A 5EP1A 4YXWA 1S2DA 4Y98A 1H8EA 1OC2A 2V74B 1VM6A 4GPEA 2IITA 2Y92A 4HSGA 3EF1A 3Q0IA 3ZDRA 2N42A 2R7KA 3GT3A 1K66A 4M1TA 4C1NA 1KL7A 1RD4A 2XIQA 3IQWA 3IAHA 2R6GA 1V7ZA 4IOKA 4Z8XA 4NYJR 3WSTA 2O9JA 3OG9A 4Z0PA 3O8LA 1LVUA 2I1WA 1Y33E 3AO0B 3EZNA 3MJFA 4MCAA 1IIBA 2QAGC 3JARB 1FJGB 1OYVA 4E7PA 4IDPA 4NIMA 4RMGA 4UPEA 3DCIA 2FPPA 1V11A 1XROA 1O4WA 1W4BA 2C92A 2Q2VA 3B8EA 2I55A 2FUG1 3CZ9A 3THSA 1SCKA 4ZC8A 2UYOA 3RD5A 4BEVA 4Q18A 5LB2A 3AONB 1JNXX 1KI9A 1S2IA 1GCOA 3PQ6A 5LZ7A 1SAYA 4WCFB 4F56A 1UZNA 3TS1A 1FYDA 3TOCA 5FQNA 1D6MA 2QM7A 2WMNB 1JA1A 2BBWA 2YHSA 4J29A 4KPEC 3PKZA 3ZVMA 2PMDA 6Q21A 2XZLA 2WAYA 4HNHA 3KQNA 3UHFA 1XCPA 2VAVA 1S7CA 3EQ8A 1T5HX 3I04M 4J2OA 3OZBA 3V4RA 1BH2A 1RQXA 5MDHA 1YT5A 4P3OA 1MEOA 3G13A 4Z9XA 1A4RA 2YOHA 4D9FA 1WCIA 3ECCA 3NQ41 3W34A 4D8XA 1QC5A 4N7MA 1K6MA 3O5AA 3HDHA 1FNBA 5JOQA 1I01A 4QEKA 1Y3HA 3UJDA 5IZ4A 4ID3A 2X3FA 2FLKA 1PVVA 4TYWA 1U6IA 1UF9A 2X86A 2DWPA 4J1SA 5EWJB 2PSFA 4MLPA 4EKNB 2WD9A 3HBFA 5LBUA 3WLIA 2ZSUA 5AO9A 1COWA 3O91A 3GJTA 3QJGA 5HS6A 2XUOA 1YXMA 3C7CB 1CB0A 121PA 2Y05A 4O1HA 4OQNA 3KYDA 5HKLA 3WLJA 2BFAA 2H2IA 4HAVA 2ZCJA 1AA6A 1KSHA 4MIYA 2O3QA 1P3Y1 3R3SA 4W5HA 1P2TA 2G1UA 1FE8A 3H2IA 1WR8A 3G8AA 3H2ZA 3LPLA 4TVBA 5FBHA 1DIAA 5A7HA 4RM2A 3DXXA 1XDZA 4FDLA 5KNDA 3VOBA 1EHYA 3GFBA 3FB1A 1VSVA 1TW3A 2PTGA 4JX8A 4BFZA 4XUEA 1XDWA 1N9ZA 2QAGB 3PNVA 3T9CA 3FLAA 1ZU4A 2VRCD 2YIJA 2IYWA 5IXSA 2J0UB 2NVBA 3RC1A 4AJ2A 5F1OA 1D2EA 1C3XA 4GXNA 4P1ZA 3TN7A 1VE9A 1RYDA 3JXEA 4DQUA 2B99A 3RIMA 3BGDA 4D6PA 3T5MA 5M5BA 3TQCA 3GRVA 1H22A 3SZLA 5EIXA 4E51A 2EG9A 1SR8A 2YXBA 3OWOA 4HHEA 3IE0A 4CN8A 2R96A 4DZRA 4JUAA 2O1SA 4G0MA 4AXXA 4BDTA 1FP4B 4PZ0A 5DT9A 1JFFB 3EA4A 2WLSA 3WC4A 2JFBA 5IWCA 4TYYA 1OE0A 5BP7A 1KF0A 1MRNA 2G4LA 4RY9A 4HLUA 4MKIA 3IKLA 3ONEA 1G9SA 4W9NC 4WUTA 5B64A 1Y37A 2QJTA 1K92A 1QIFA 1UUFA 1W48A 1JE0A 4NZZA 4R31A 5CH8A 3QMPA 1X8XA 3SQOA 2BR5A 1U63A 1TT5A 2OFWA 3E35A 4ENTA 2BUAA 1RXWA 2CZQA 3VISA 1EA7A 2ZAMA 2MHCA 1WTAA 1V5EA 3ZZTA 1YZ3A 4NF2A 1F7UA 4LHXA 2VOEA 4U3JB 2ANBA 5AKEA 3RVPA 1PGJA 4JELA 4I5IA 5KJ6A 1WCWA 1GQSA 4WBXC 1HY3A 1ZN9A 2NU6A 2O6HA 2PS0A 4C06A 1K5PA 3E4DA 5ITSA 1Q0UA 4HDKB 3ISVA 2DM6A 3OCJA 1NI3A 4RQUA 3RU9A 1AH2A 4B3IA 3ZCXA 2OHIA 5K0EA 3JZIA 2PSDA 2J5QA 5FWYB 2PUEA 3R9XA 1YHZA 4YPOA 4RGQA 4F4FA 4MVJP 1H66A 2II6A 3B5EA 4D6YA 3OX4A 5FBZA 1EB9A 4CMEC 1A2KC 3L04A 3B6ZA 4JAVC 4CKEB 3ZDAA 2JK0A 1GTZA 3IUYA 1QFMA 1EVZA 1V6SA 3O1JC 5AVJA 3CPSA 5HF9A 5LCXA 4G5QA 4P3PA 4MWCA 4EQZA 1UBKS 2YJ4A 4YALA 3BMCB 5KC9A 3PIIA 3IP5A 3JVVA 3JX9A 5FT9A 4E4TA 2BWJA 2FI1A 4PYJA 3OY7A 2CSUA 4LMBA 1EE9A 2I6TA 3DEZA 4PAWA 2LXNA 3HDVA 3IULA 4KI0A 4LCJA 1KK1A 1GGMA 2HPAA 3M6VA 4ZOEA 4H27A 4L50A 5IUKC 4BP1A 4D42A 5B12A 1ISGA 3IBTA 4GPZA 1QO0A 1LDEA 3IUJA 1VG1A 1C4KA 2WHYA 3BMOA 2AYYA 1GAJA 2ZE7A 3MRTA 1UBHS 4MW5A 4RSRA 4W1QA 2AN3A 5FA8A 2X0EA 2QUIA 3OQVA 5HK9A 3ANTA 2CD7A 2YXDA 5TGTA 4CL3A 1XU7A 3DWIA 5KSWB 1NU8A 5LU9A 1NSTA 2IVFA 2OHOA 3SIXA 4U4AA 4Z8YA 4M9CA 1CRLA 3A6EA 4P8RA 1NBWB 2QL5A 4QASA 4TROA 5BPHA 5AKIA 4DR3B 1D5WA 4RXTA 3TLAA 3H2SA 2Z6VA 4C3VA 1YVRA 2DHRA 3DPSA 4GPTA 4U7GA 1RPZA 1PNRA 2CN1A 4NOMA 2QD3A 4WBNB 1P2SA 2OENG 4TT3D 3STVA 1VLVA 4GXQA 5L53A 1DIOB 1HTWA 1PF7E 4ZIRB 2OZVA 3OT4A 1XLWA 3TR5A 2ASEA 1CHNA 5JY6A 3EDCA 4KXFB 1GLNA 1EDBA 3GIWA 3I9OA 1E1MA 3UFXB 1I2ZA 3DBOB 3OPVA 1VKHA 1Y9EA 2P3OA 4QNRA 5E4FA 2I7VA 2HMSA 2NSLA 2P2CA 2UZ1B 4NV1A 1Z73A 1CJCA 4GI1A 3LOQA 5BRJA 4CKZA 3IAEA 2I34A 4W5NA 1C9EA 4GIBA 4E13A 4CTOA 1V6AA 2PX0A 1EA5A 3L79A 3I1JA 4U9UA 1PTKA 1GGFA 2CUTA 2I6QA 1ZVMA 4L72A 4CI9A 4YRLA 4HFJA 5FV4A 1L1QA 5K3OA 1XTSA 4LCBA 2ZB8A 4MW2A 1F6DA 4TV8B 4UMFA 5AW8A 5G02A 3P45A 3R6GA 1VIYA 4PS1A 4QVKA 2I3BA 4N54A 4NICA 2CE7A 3EGOA 1IEWA 4PQFA 5E8RA 5G0UA 1VE6A 1B26A 1VL6A 3C1AA 4WINA 3I5YA 2NUAA 2PSSA 5SY9A 3V7NA 4K28A 3QWFA 3AK4A 5CT6A 2R65A 2WIKA 5GJCA 3VYRB 1TYEB 2C4HA 3EVGA 1GKLA 4GX1A 4X63A 5BO5A 5DK6A 1ZINA 1YR6A 1G21A 2VH1A 3KO8A 4Q4DA 3RIYA 3AHHA 3AHFA 4OHXA 4DG9A 3MNFA 5B1EA 3WY9A 2VEOA 2P5YA 3AESB 4F2PA 1DTWB 3LQFA 4MI6A 2VJMB 2B30A 2J7PD 3CBQA 4HKTA 4NFLA 2VHQA 5DBEX 5IK2A 1VGQA 4LW8A 1E2FA 2QX8A 1RLTA 4MUMA 2XSZA 1I6MA 4JA0A 1U8AA 3ORHA 4CMHA 4GZ3A 3C41J 3VO2A 2QPLA 3DAFA 1WCV1 3UUFA 2PN1A 3SBEA 1PD1A 4AM8A 5JLJA 1NYLA 1P9RA 3LE8A 3MS2A 3PZRA 4CT0A 2OHXA 4KTTE 2XCQA 3HO8A 1U0OC 3G8BA 2ZROA 3GJRA 3C6YA 3N74A 2BGJA 2WYVA 1LC3A 5AUPB 5T4FA 4NU8X 3ROZA 4NU0A 4EJMA 1K8XB 1X7XA 3CRRA 3HFSA 3UF0A 3U56A 5JXJA 2YIVX 3WMEA 4DKJA 5DULA 2C99A 2O54A 2P2YA 4FYYA 2N3ZA 2ZIEA 3BRWD 4BB9A 5IVPA 1QIKA 2VAMA 4OQYA 5ALLA 4E08A 4BRWA 4V0LA 2ZJ8A 1IZ9A 3AOEC 3EMKA 3U3KA 1NFQA 4F6CA 4PVDA 3LKBA 1IG0A 2I80A 3SE7A 3SXJA 1WDMA 3PB3A 5EHGA 5M34A 1CU1A 1IG3A 1W4ZA 1ZESA 4NOKA 2XRZA 3V34A 4ALKA 4EJSC 4MUJA 2C2MA 1U2DC 3QMMA 2XWJI 3C70A 1E92A 1T8WA 3LUAA 3GJQA 4FCTA 3OZGA 5AOAA 1XMSA 3V8PA 3SC2A 3TWOA 2XUPA 1K89A 1Q0ZA 1HQCA 4EA9A 2ZETA 5DYIA 2FJPA 2PG3A 3NAZA 3QIAA 4A0GA 1PR5A 4GM4A 1EK0A 4JOCA 3WQQA 2NNLD 3D4PA 5ICCA 1BJTA 1NZFA 4WLFA 1J9GA 5JTTA 1DIRA 1SG6A 4PYLA 3SSMA 5EGNA 3T54A 4LKOA 5JDIA 4I9FA 2SNIE 4MO2A 3OE7A 1DX4A 3CVVA 2AEMA 4F4CA 2WZBA 4OQZA 3R7SA 2H59A 4DLTA 2JD0A 2BONA 4EOGA 5FWXA 4WLNA 5FPYA 1D04A 3LO8A 2NXCA 1BGVA 2VK1A 5DB4A 2GI4A 5AKLA 4OUDA 4A8PA 5TQJA 3D3NA 5LBTA 4E31A 4BEWA 3CX4A 2XDQA 1N8TA 3PUVA 4IKOA 5CFZA 3UGQA 2C7RA 2P9JA 1PNOA 3FJYA 3E5NA 3WGJA 3RC3A 1GEGA 5E6SA 4FGZA 1VSTA 1H05A 3HWWA 5C9ZA 4PX2A 4X5OA 4NFSA 1DKLA 4AN4A 3GFVA 1G1AA 5AJHA 3E3AA 4BAUA 2ZOSA 4IGAA 4AJ4A 1JJFA 4AKEA 3MRXA 3D8BA 3LCRA 1ZWLA 2I1LA 1OI4A 3ESAA 2Q4EA 3TW6A 3X43A 3ZWBA 3OTWA 2JJ2D 1NQUA 4YUWA 3WGYA 2WFAA 3SHVA 3FTCA 4QBGB 1GARA 3C3MA 2JIPA 1E2UA 1CXZA 2HDOA 2ZYRA 4F3RA 4LDAA 3WGVA 4DNPA 4X62B 1M33A 4AXBA 4O2AA 1DEAA 1J8MF 3K2IA 4IXNA 2R4QA 3O73A 4CR6A 3CCFA 4CCAA 4FI3F 2A1UA 4O08A 5YASA 2RHLA 3DMDA 4ZOLF 1XIVA 1VIAA 1DB3A 4DGSA 4EJSB 3WLLA 5AVKA 3ES9A 3EC1A 4B84A 3EDQA 2F8LA 4HGRA 3TTTA 4BP3A 4L07A 4DY4A 1JR2A 1RJFA 2IEDA 2HBZA 2JI9A 2PSJA 2QRVA 4Q9LA 1XC7A 2WAXA 2EG5A 1VHDA 4M9UA 3SE0A 4D5GA 3MPUA 1UQUA 1B4DA 2NG1A 3E3NA 4FX5A 5FWDA 5BSVA 3U13A 2HLDD 2CJWB 3UOWA 4M0EA 3HM2A 1A9QA 1JH8A 1W85B 1N34B 1CR2A 1N2HA 1DQYA 2GEDA 3QU7A 1S2MA 2LNDA 4GAEA 4HJXA 4MYTA 4WFJA 1JZTA 3AH8A 3K5PA 3TDMA 2MR6A 4OHCA 2XCOA 2IYPA 4WOPA 2Q6TA 4CTKA 5JNRA 3KPJA 2DAPA 1ZISA 3AF3A 1DAPA 1VCHA 2PL5A 3OQNA 3AL0C 2ZS7A 3ESRA 1SBHA 3H7AA 3K1AA 3GNQA 4UBIA 2QSUA 3BFXA 4GYJA 3ZUPA 5BWMA 2EP7A 2GB4A 3QW2A 4NYIQ 2NO6A 4IIVA 1CUVA 3RU7A 3AYXB 3VUEA 4MGYR 1CV2A 4JQYA 2WILA 4BO0A 3ZWQA 2A92A 1EM8A 1QDEA 1DQRA 3DE0X 5AJVB 4CFSA 4G1CA 5BMVB 7REQB 3QPAA 3VGPA 4MWGA 5KNBH 5FO1A 5KQSA 3NGMA 3EFEA 3SQLA 1TK2A 5BXQC 1C3OB 5CTAA 4XW2A 1KHHA 1AKRA 4FZ3A 1N36B 5KQGA 3CVXA 4OHMA 4ZDWA 1Z33A 3ZG6A 3NR2A 3WZLA 4LN1A 4UHKA 1AK1A 2JI8A 1VCOA 1IZYA 1L9XA 1QHHA 2XTZA 3D4OA 3IV7A 3LQYA 2HU7A 3NC4A 4RCYA 5F2KA 5FEMA 2PMEA 1XKTA 3S2GA 5L9AA 2AFIE 3W5CA 1ZL0A 1T9ZA 3NYRA 3R0QA 4IP0A 4WKBA 2X3UA 2R00C 1C30A 3W9YA 2Y6VA 5U9CA 3VDMA 4YYZA 3KT8A 3QKRA 3T3IA 4QYWA 4CQMA 4TYNA 1TZJA 3NEAA 3DBRB 2GCEA 3CN9A 2X5OA 3ZWPA 1G21E 1IXZA 3GAMA 2DFNA 1SK8A 3DBIA 2RGEA 4YCCA 2Q1SA 4F5ZA 5GOZA 4D4JA 4D99A 1VYTA 4WK4B 2YOFA 5BV8A 5ER9A 3H11A 1QV9A 3KQWA 4XGRA 1C81A 4GICA 3T1TA 3KLBA 2DP4E 4G5FA 1NW6A 1KC1A 4O2BB 1Q17A 2Z9BA 3TNLA 4ZT6A 4HZUB 5DW3A 3E4CA 3T15A 1N3YA 1P7WA 3OKCA 4ARSA 2VWGA 1S8FA 4HGNA 1GRRA 4IIDA 1UEIA 3SIRA 3SHOA 1DKRA 3URKA 3RDPA 1W35A 3V1YA 4BL5A 4DLXA 4KPUA 4CUJA 4F46A 3G5AA 5IARA 1O87A 4NBRA 1D7AA 1P7PA 2D74A 1RHQA 5CLQA 5AM2A 2HY7A 2R1TB 4BKOA 4GH5A 4LX0A 3JYHA 1ZMOA 2OAQ1 2O50A 3HLYA 3I6YA 1Y81A 2BY4A 2FLWA 4LNAA 4PV7A 4UNIA 1P2UA 1E5LA 4Q4HB 5HQ3B 4P7JA 4ZI2A 3BXZA 1PWHA 4XJSA 1R9MA 3TTUA 4DRZA 2D1RA 6ADHA 5B1IA 1AS0A 3RABA 1NXQA 4GI3A 4QL3A 5I7AA 3OO1A 3L4EA 1A2QA 5L95A 4KO1S 3Q8WA 3OM9A 4UXIA 2XDYA 1JIIA 1FNNA 2H5LA 2QTWB 4HX9A 4I55A 4BBZA 4HNAB 1YQWA 4J3FA 4ZOBA 1MNAA 3E9CA 5GONB 3NDPA 4HQ0A 2AMYA 3BL5A 1Q21A 4NAVA 1KSJA 2AHRA 3RNOA 4BAZA 1TUGA 1OROA 1QZXA 5GM1A 3DMHA 4LOJA 3CTMA 3TNYA 3HXMA 5I8WA 3SVTA 2XMSA 1XNJA 1PFWA 4PYOA 1JQBA 2V0CA 3RV4A 5IZCA 3C8HA 3QPVA 2GCOA 3FTQA 4ER0A 3QLTA 1IXKA 1NBME 1QRRA 3KM0A 3AVWA 2CF5A 3M7IA 3GV0A 5FLEX 4E22A 2F2TA 2LR0A 5FI3A 3ADBA 4BYGA 4ER6A 4LFCB 2ZJ1A 2QN6A 5CIWA 2Z98A 5DYWA 4ZK6A 5T41A 5HQJA 1OH5A 1NJSA 4B87A 4FFDA 1XZHA 3G59A 4B47A 3PSAA 5FF9A 5EL0A 4YXFA 1Z82A 2AUMA 3PQ8A 3EHEA 3GLRA 4Y1RB 2GZRA 3TQHA 4CMJA 2R47A 3L7YA 4RC9A 4XYLA 3FOWA 4OQFA 4UZEA 2H92A 4LC1A 1SD5A 2PXXA 2GO1A 4QYXA 4LG1A 2XRYA 4ZRDA 3PRHA 2PKEA 1V7QA 4GX5A 4YLEA 3PVZA 4RPKA 3DFMA 1U7TA 4FYIA 4JEIA 1Y6FA 1ULHA 4PLHA 4WXPA 5GJWC 4DJEC 2Z6AA 1SBIA 1SB8A 4YONB 5B2FA 3COWA 3LG2A 5IFKA 1BQ3A 2QG6A 3VHLB 3MD0A 3VYUB 2J0EA 5HUHA 3GZNB 1YVPA 2GEVA 1G98A 2D2XA 3VJLA 4YMLA 3EPKA 1MKYA 1W34A 2EGGA 1DC7A 1OTYA 5FOVA 1Q0RA 1IM5A 1PT7A 3L1IA 4MQMA 1A82A 3KR0A 5K7SA 3WZMA 3JWPA 4OJKA 4MKHA 4R98A 5EKTA 3ET4A 4CKBA 4X7RA 5CFPA 2ZI6A 2Z04A 4P3KA 1P0MA 1ZK4A 2JJ1A 4WESA 3CZAA 4EKEA 5EEGA 2Q5LA 5DTIA 5FLYA 4KQHA 2OXTA 4DIFA 1NXWA 5JU6A 2QF7A 3BD6A 3D3WB 3M1IA 3OKAA 2LUOA 4BO9A 2OCYC 1U8EA 2YV2A 2Y1KA 4WFQA 3RUCA 1C3LA 3KJFA 4O8ZA 2C29D 5EE3A 4OQXA 1UBOS 4LDRA 1PZGA 6YASA 3SNKA 5ALEA 3ONNA 5F21A 2C2ZA 4BE7B 1KPIA 1M9NA 5HIIA 1QS0A 4GEGA 4GEKA 4QLBA 3EQZA 5J2TF 3EPJA 1SIBE 1T5OA 1HSZA 3GBPA 1NYTA 1CRQA 4XQGA 3N0XA 5H1YA 3ZU3A 3O4VA 1BU5A 2OT3B 3PD0A 5KJ1A 4EQ6B 4X3CA 2IZ6A 4WXMA 3ZV3A 2AQKA 2P3SA 2ERXA 3PCTA 5AJWA 1R0XA 4B2LA 2C7OA 3DLAA 4Y67A 4EM6A 1GNRA 1O2DA 2ZS8A 4MB2A 4O4HB 4NG5A 1T15A 4UE2A 4ABTA 4D0GA 2V7VA 1RCFA 2L2QA 4D46A 2HDNB 3PVSA 1WZ2A 2WIGA 3NZEA 5IJAA 4YLYA 3AVVA 3R9IA 2F67A 4DA0A 1EESA 5A4KA 2IY9A 4CKCB 1G3QA 5K05A 3NAMA 2WFLB 2E4XA 1E2EA 5E9WA 5IMSA 5IS2A 1IXRC 3L4JA 3FYUA 3KQHA 1Z29A 2RGXA 3Q2IA 1QBKC 4I14A 4Q24A 3SS7X 1QHYA 2NU7A 2HLPA 3KUKA 4KLNA 4LXUA 5D01A 3DZKA 2R6FA 4EF5A 5CDUA 2GA8A 2F55A 2OO3A 1BKSB 3T5BA 3DZ8A 2P65A 1NVGA 2JGJA 3C5EA 2NO5A 4WFIA 2VTBB 1U5BA 3IB6A 4OB8A 1LLQA 1PZXA 4XM2A 4XSGA 2GJ4A 2PRJA 3CNLA 1IUNA 3PFGA 4UM9D 3NJ8A 5DHQA 5HILA 4BP8A 2UUAB 1J90A 1E0JA 5BSUA 2F59A 1A1VA 3PX7A 3MGGA 4ZU6X 4F72A 3RT9A 1AIPA 3DMPA 2FK7A 5D5HA 5T4HA 3REGA 1YB7A 4TMFA 4D56A 4A92A 2G06A 2Q3FA 1L4UA 1C9KA 2V5AA 3I8OA 3PC8A 1R37A 4MRVA 4B44A 1EXDA 2EJUA 1JG6A 4RVHA 4URXR 3LGAA 3HCOA 4X00A 2B1QA 1EU1A 3GX1A 1EXVA 5KYVA 1M2HA 1NTRA 3H05A 1IPHA 2QW8A 3QWHA 4WVFA 3KALA 4A5OA 1E99A 5JQWA 3KXIA 2PUCA 3F74A 3R7FA 3JASA 4L9SA 2TMGA 1STOA 1VYVA 3ZWAA 2X5XA 4HT3B 3R3XA 2WUGA 1C4WA 2PTHA 3DKIA 5EE5B 3WBJA 2FN8A 3F8TA 8ADHA 4IDEA 1ZH2A 3E53A 4KQ6A 4M98A 4DL9A 1C7QA 1B8VA 1N2JA 1PJLA 2C9MA 2GDJA 3I6MA 4DA8A 1ID8A 3X2SA 1YAHA 4OB7A 3USZA 3NASA 3MRVA 2PGDA 3KZXA 3U44B 2H9YA 1FYVA 2FSVC 2VDWA 1GTJ1 2V7BA 3FGPA 1J8FA 4XE5A 3RHTA 3WNDA 1I0ZA 1XZFA 1DC8A 2BMFA 1QHEA 2LGJA 4ECAA 7MDHA 1U3VA 2VUUA 2WSYB 4TL7A 1CS0A 1DT3A 3GMIA 3H83A 5EMKA 3WK5A 2XDWA 4PZPA 1XA3A 3ELBA 1QQ6A 1GSAA 5CDFA 5BWLA 4LY3A 5FNVA 1NIPA 3IA7A 2C2HA 4K46A 4MUIA 4CMCA 2EFDB 3TBKA 4IH4A 1KNQA 2OYCA 3VPXA 1TVEA 3QVWA 2JBWA 5K3FA 4OXXA 2BBSA 1IY2A 1NZJA 3P0IA 4JBHA 1OVGA 2ZYWX 4R0MA 1UP7A 3RRBA 1OLSB 2C2XA 2EJVA 2DBYA 3M9WA 5SYAA 2A94A 4CFZA 2FX2A 4KWCA 5D3MA 2V6MA 3G8CA 4L9RA 3RC2A 1KNXA 3L05A 3RYTC 2O0HA 1Z4KA 2Q5JA 2JCBA 4IDGA 2CXQA 4MV7A 3MWEB 3R5KA 1Q5PA 1V47A 4RVUA 4OBWA 2H18A 2DPGA 1N0UA 2Y3IA 1L5VA 5AJXA 4F97A 1FF9A 1YDGA 4DTCA 3CXRA 3DWGA 4CU2A 4AY2A 3UV6A 2CK3D 1DO0A 2V7QD 4IQFA 3OQPA 1YB6A 3RVDA 1E3DA 3I8XA 1T2VA 5K01A 4Q34A 3SX4A 3FUWA 3KUCA 4FCWA 4U00A 3GLFA 4LJ9A 1G5QA 4QC2A 1TLFA 4GU5A 2Y2UA 4O4IA 5CH5A 4QZVA 2GWHA 1TMOA 4NU5A 2DTXA 3FG9A 4F3CA 2IYTA 1C8KA 2E48A 2NO9A 1C9JA 2JGMA 1TEXA 3PDIA 4DLKA 5SICE 5DW0A 4GNRA 1O08A 3SCZA 1FDSA 1KA9H 1QH1B 1RCTE 2BGRA 3BWBA 4HRYA 3K72B 3C1OA 4QUEA 3V8EA 5JUWA 1FU7A 4EYGA 1F2UB 4HEA1 4L95C 4COOA 5ISMA 3G6WA 3DPIA 2PIAA 1FBNA 4GSKA 1JLMA 4KYUA 2JGDA 3EYWA 3OEHA 3EZLA 3SMVA 4AQ7A 2ZWIA 4JP3A 2HLNA 3G2PA 3COJA 4MUKA 1CULC 1E9CA 4G5OA 1IY9A 2X15A 3UHOA 4B73A 3JALA 5E9JA 4H9GA 3BUSA 3LUKA 5DI3A 3PFWO 3RSFA 3RSLA 1VHWA 2BZGA 2WKRA 4W63A 3WA7A 3OTOB 2LDXA 1XPOA 3CO5A 4NZNA 3VKWA 2EJBA 2XVMA 4ZO8A 5ILOA 5TARA 5EG5A 1G8YA 4P3XA 1FP7A 2HWYA 3REOA 1LCIA 1JHRA 3IB3A 4HLQB 3VH2A 1RZRD 5JC8A 1CJBA 5DCWA 1ZD2P 1F9AA 3CB4A 2UYQA 3IAUA 2WA1A 4HXFB 3FSGA 4WKCA 3JVIA 5SV2A 3GZJA 3R7DA 2XR1A 4NCBA 4C04A 2VZ0A 1TVKA 1Q44A 3L8CA 3CKKA 4J0HA 3ZTWA 4K26A 3CRQA 1GTSA 1ZIXA 4JSRA 5JZBA 1EFPA 3PYMA 4O29A 3ZQ6A 1DXYA 2WJ4A 1TO2E 1NW9B 2IU6A 3GLHA 1WMEA 1XTVA 1YVUA 4FXOA 3ICQB 4OATA 4BKMA 1N2XA 3PI6A 5BW6B 3MQ4A 5FBKA 1CEQA 4HQLA 4QG7A 4HH3C 1R0LA 3PQEA 5EGSA 1MD9A 3A4MA 1XX6A 3BQMB 3IILA 3WWOA 2E87A 2XMZA 4J0IA 3ZIAA 2PX4A 1X9GA 3PICA 3V48A 4AFNA 3GLGB 3G88A 2HOQA 1ZJ5A 2WSSD 4TXLA 1KGDA 4DM7A 3WLMA 2IV2X 5BSFA 2O23A 1G64A 4IIEA 1QG6A 2A5JA 2BFNA 3AEKB 2PWPA 3IIIA 2W2MA 2QX9A 3FKSA 4V0SA 5C1IA 4JC8A 4TN5A 2IS6A 2PJDA 3GXBA 1OAAA 4JX9A 4LVOA 3A3OA 5CB4A 4HDNA 3SDSA 1QOQB 3VH3A 3U4QB 3WLOA 1U3CA 4QXRA 3SBXA 2NO0A 3CT4A 2RGAA 3FHJA 3HPQA 1B93A 3JRXA 3CLTC 2JGLA 2P30A 1P29A 4MVJI 3RAPR 4EEXA 3GA7A 2WU1A 5BQXA 1NJ1A 5JJIA 3FUXA 2YJGA 3H8WA 3UAVA 4RMJA 4WJKB 1UBNA 3FFAA 3U3RA 3WGKA 2APJA 2P5TB 2IYRA 4RD0A 4C4SA 3BQ9A 2QYHA 4FHEA 4X3PA 4BB0A 4PAMA 2B8EA 1CUCA 4IDDA 2DKOA 3WIUA 3ZWYA 5CXUA 5I7SA 1K1EA 3AKCA 2FPIB 1XCLA 1NVAA 1X1AA 3E81A 1MJ5A 4UD6A 4XYEA 4ETMA 1H5QA 4UHJA 1VL8A 3B9QA 2YJ5A 2G76A 3DMRA 3F1LA 3GCWA 1C9YA 4PANA 4YJ3F 4CMIB 3IVRA 4Q4LA 3SZGA 2ZJBA 4QM6A 3EHDA 1XPUA 3TLBA 1DO8A 2E4ZA 2FGJA 2ZTVA 3N2KA 3TXAA 3WQRA 4HDRB 1NQOA 3I64A 3MBOA 6AT1A 1I94B 3KKQA 2GO7A 4P0QB 1QFYA 3STXA 3UWOA 3LP5A 4JIGA 1RFLA 3K2EA 3X1KA 4CT4B 2O8FA 3S2FA 1IRIA 4WKGA 4KVFA 3X1YA 3R3ZA 1LNSA 2AIRA 4IYRA 4ENUA 5ITZB 1ML3A 2CLCX 4BVHA 5CB4F 1UJBA 4FMDF 1G59A 1NW3A 1T8TA 3MOIA 3LBIA 5J43A 3INTA 5GGYA 4ZZ0A 4YI3A 1SU8A 2BM1A 1DEXA 2E4YA 2REOA 4Z86A 2Y1CA 2WB2A 1DO2A 4L9AA 2PUTA 3UGTA 3A1CA 2IODA 2J3QA 4G1MB 4IHKA 2C4VA 2P1ZA 3C7DB 5I51A 5K8UA 3TRFA 3CWCA 1KVTA 2QRZA 3LUJA 1FFXA 4HTFB 5BR1A 1OPXA 3B53X 2I6XA 1BHO1 1P6XA 3PE4A 2Q99A 4WMLA 5H82A 4CM5A 3NIFB 2O1WA 4JOBA 5DBOA 2UYGA 2V6IA 4QPDA 5FI1B 5TF0A 2J48A 2YY5A 3BGVA 1PEYA 3EOBI 4KZKA 4XDYA 1ODJA 2GXUA 1M6HA 1E2KA 3KV3O 1JEDA 2K7FA 2P2DA 1OT5A 2G6TA 3BF8A 2W4IA 4QXQA 2P4HX 4OSPA 4BVKA 3NHUA 4R8RA 1ZXXA 1J33A 1E3IA 2W6ZA 1RLUA 1MH1A 2QUHA 2YZ7A 1CQJB 4PQEA 4U9HS 3FDXA 1Q74A 3KXPA 4BWGA 5KVAA 2AMVA 2QY6A 1P4HA 4YREA 4RK4A 1I7NA 1MOZA 1FTNA 2BOVA 2WM2A 1IDN1 1QFSA 3KYCA 2DFPA 4G2TA 3VU3A 1XCGB 4AC9A 4YDSA 5BXYA 2GN6A 4B3RB 2I3AA 2ODBA 3DMTC 1PV4A 1R4MB 1OX4B 1TKCA 4Y2JA 5CNJA 1GL3A 3KZVA 3NWJA 3QVLA 4LHWA 5FNZA 1DQPA 5H83A 1ZXBA 1YNSA 4E5SA 5LJLA 1Y8ZA 5U4QA 1HNWB 4MINA 4CR7A 5MGNA 3EZ6A 4E94A 2X9QA 4IILA 4BMPB 4WNCA 1X1TA 3H1PA 5G4KB 1XMOB 1AX9A 2VTVA 4ZCTA 3PTLA 2ZITA 1IHYA 1SQ5A 3IOMA 4INZA 5B6IA 3QNWA 3PT9A 2XT6A 3N2NA 4BN5A 1WWKA 1YKFA 3TE7A 4IDFA 3TQOA 4BVBA 4LXGA 2D54A 3B6EA 2HIAA 3O4FA 2H0AA 3SIPA 4MIEA 3L0BA 2HDWA 3KD3A 1F1JA 2DCUA 4HAUA 5HE9A 4D8VA 1EFRA 4L9WA 3R6WA 5ARCA 1JDTA 2YFQA 2NZJA 3E8MA 4G4GA 4NARA 3GEHA 3R09A 4QQ8A 2V4MA 1AVTA 4JI6B 4EKYA 4D9IA 3QRWA 3QXHA 3B82A 4JENA 4MROA 1P81A 1NMEA 2KX7A 4FWTA 4KFSA 5D1HA 5C80A 5DYNA 1QC5B 1Y8QA 3IJEB 3OJLA 4EB6A 3NC0C 5JAQA 3BTVA 4QSMA 1S5PA 1TCAA 4ONEA 4US0R 5IULC 2ERYA 4DAEA 3FKJA 3UH1A 4X7PA 5B4UA 2BF7A 1NW4A 4QJBA 5GWXA 5HMMA 2VYVA 3NV7A 4I5GA 1VIVA 3DE6X 5AVRA 1UC4B 2J0SA 2EL9A 5DWQA 1E1CB 2XAAA 2CFIA 1WXEA 3R6TA 4WJZA 2BAGA 1EXWA 1TKBA 3GJXC 4IDCA 2XE4A 2ZRKA 1LH0A 2JRCA 3AU8A 1CRZA 1Z56C 1X3SA 2KW5A 5JNTA 2P3QA 4Y2TA 3KVRA 2AYZA 3L0DA 3LDAA 3VOSA 2H85A 2JIQA 4RK0A 1Y6RA 2O52A 4UUBA 1I1HA 3QVTA 4RE5A 1UDAA 4KXMA 3BIFA 1BCSA 4R9UC 5CDHA 3MPOA 1B6GA 1EJBA 3EASA 1JECA 4BCBA 2YBEA 3AM3A 4E6EA 1N1MA 5HPYB 2PWZA 2WTNA 4G6ZA 4KQKA 5KNLA 4EENA 1QCYA 3DMGA 2I6GA 5JFTA 1YF3A 4PC6A 4I36A 2NPFA 1H94A 3GFPA 1M72A 3NT5A 4FINA 3Q2KA 3ZS9A 4DREA 1KQ3A 1UOEA 3O95A 4PYKA 3PGMA 4DT1B 4D25A 2PR2A 2ZTLA 2IBTA 2ZYDA 4M37A 1OXXK 2CZCA 3BMNA 3DMNA 3SQWA 3GJ3A 2GHRA 1K27A 3ROMA 2NUPA 3G0GA 2B4AA 5K3BA 2A9KA 4AJLA 4B34A 4YMHA 2AN5A 3VO1A 3ZGOA 4JU8A 4Q3KA 1ZH8A 3D7SA 1XXHB 4KQCA 3UNXA 3V2UA 2TMDA 4I1IA 4E2XA 2O3TA 3SFVA 2HDHA 2ZJYA 3ZBQA 2V7WA 4LI3X 4EHDA 2R8ZA 2H7YA 1GXSA 1DPFA 2LZ0A 2M6SA 3L4SO 3GELA 3PBKA 4Z7JA 2C1EA 1DXQA 4XPZA 1DIGA 3E5HA 3O93A 1E94E 4PWYA 5AXDA 1JAXA 1OJ7A 2B1JA 2GFQA 2XADA 4IH9A 1C9DB 1FDVA 3AR8A 5DJ5A 5DBHX 5ALZA 2J9FB 4UHFA 1SHZA 4Y6QA 5D7BA 3PC2A 3R2JA 4C7BA 4YGXB 1FPQA 1B6SA 3Q3VA 4NOJA 4CUZA 2UVQA 4PGMA 3CY6A 5HA5A 4DZTA 1HYGA 4PCUA 4W7IA 4M46A 3WYAA 2OQIA 4DWOA 4MP6A 5AVQA 3INGA 4EPVA 4HYTA 1F51E 4ARBA 1PR6A 2Q4BA 3EEQA 4G8CA 4AMZA 5M7EA 1NNI1 4IV0A 1HZZC 2IDKA 3NHBA 1SQFA 2AUNA 1E89A 2R1UA 3A28A 4XLLA 4I66A 4X93A 4XQCA 5CUQA 1XE3A 5MF6A 1VP9A 3DTVD 4A4DA 2JIDA 2G6BA 2ZYIA 2D59A 1KAHA 5BVHB 4X1KA 3R5SA 3VR5D 2VP6A 1JRLA 2QK4A 3OEWA 3RR2A 3FVWA 4CTJA 3J80A 4JLWA 1WRBA 3TSAA 5FD8A 2UZ3A 4GC5A 4FC6A 2VRNA 1IPFA 3GF4A 3CF6R 4B7CA 1O5OA 2P78A 2WAOA 2PLFA 3FM9A 1T2EA 5KYUB 1RVV1 2QRGA 3ABOB 1IJKA 5HTOA 4J0QA 4OX9B 2Y27A 3TLMA 4YUYA 1J25A 1VI2A 3EF0A 4LE1A 2F4NA 4PNPA 4RIHA 4ZU1X 4BLTA 2IEAA 5HRAA 1IQ0A 3V46A 4GWGA 4C7JA 4YJKA 2C5SA 1XTRA 4CKXA 2QV0A 4IDAA 3DQQA 5B1HA 2GTPA 1YRYE 3AV0B 4O1MA 5CLHA 1VCNA 3QP9A 5BYKA 5CBPB 1P74A 3ETGA 4JLOA 4KDRA 2PZGA 3SZRA 4CLEA 2IF0A 2FPLA 4UJ3A 4A36A 3A6ZA 1H5UA 1EFHA 2E7ZA 1HDIA 4B31A 2ZJ0A 3PQ7A 2I8CA 1E63A 3EUEA 5CPFA 5K0LA 5JXGA 2H08A 3DC7A 2QTRA 3N9IA 2J9ZB 1X87A 2IXAA 2QWXA 5LZ2A 4ZYVA 4NESA 1TQ2A 1LK7A 3N8HA 1H8HD 5JALA 1QU3A 1ADGA 2CNWD 2I78A 2VXCA 3CUUA 4XR4A 3DBLB 2XT9A 1SC1A 4ZPXA 5GPBA 4YUVA 1N6OA 3V00A 3DSRA 4LRTB 4RVOA 4HRVA 4X20A 4MKGA 1IEQA 2PU7A 1NRIA 4J7CA 4K9PA 4CF6A 4TL8A 4TLBA 1E4EB 1NU6A 3HR4A 3M4JA 1H4QA 4R01A 4TUYA 1NW7A 4QTYA 1GDHA 3TFOA 1Z6QA 4GLLA 2JKVA 3O38A 2H51A 1XCJA 4ALLA 5K0SA 3D8NA 2C4KA 4FS3A 3D8RA 2FKAA 4JI1B 1AZSC 4RDHA 3L7CA 1YMVA 5LNK6 2E3JA 2EDAA 3TYXA 5KNBA 4P58A 1GNQA 1FUUA 4P4LA 2UU9B 3DDNA 4M1MA 4RD2A 3FIUA 5KTKA 5SY6A 1PI3A 3VZPA 4FI3C 1KDTA 2XYRA 1WOMA 3A26A 4C5BA 2FEPA 2VK8A 5C8YF 1ZHOA 4KUGA 1BE8A 1VL1A 2IHYA 1DX9A 2WTMA 1GV0A 2Q3DA 1PZEA 2UZAA 3ESCA 3PXXA 4TX1A 3ULKA 5IKPA 2OWEA 1JKFA 2J9GA 3L0ZA 1ZJ6A 1E32A 1OILA 2WBLC 1ZJ4A 1DBSA 3UEOA 2F17A 3GRYA 3NEJA 4DCMA 3GIDA 3JQAA 3HFGA 1V3TA 3K8QA 5DM1A 3DONA 4ZD6A 4K1XA 5LQMA 4IO1A 2RG7A 2IYZA 3JQPA 2QUZA 3O92A 5CT4A 3W2HA 4F5EA 3KHKA 4URYR 3UZUA 1UDRA 1VMKA 3G1WA 2XKBA 3CA8A 1R9NA 3KDAA 3E7DA 4OXRA 3UV7A 4AJIA 4AY3A 2FMTA 4C6SA 3F9RA 2FETA 4JKYA 4Y6OA 1HT1E 3FJ1A 3I42A 3GRCA 3NKFA 1GZDA 3CCBA 4AP5A 2OOKA 3E9RA 5GV7A 5CXXA 2BR4A 2R1VB 3ND7A 4DSTA 3QLJA 1D9ZA 4AIRA 1E4OA 1NXPA 2IGBA 2YHIB 4OKNA 2GPBA 3R6DA 1P3DA 1PNTA 5DHPA 2NQ2C 5G1NA 5K51A 1ZH6A 3TF5A 1UAAA 1Z2CA 3KYBA 1ISFA 2NSYA 2W2QA 2FW9A 4F1JA 4Q9DA 4PGHA 4EA7A 4EB0A 3ZEAA 3WFZA 3I4LA 4UEQA 2BEVB 1VLZA 2LD4A 3ZDYB 4Q01A 2HJ9A 3EXFB 3V7WA 1KOLA 2HF2A 3LVFO 2VDRB 3QKUA 2FMUA 5FYQA 2J85A 1R0CA 1TOAA 3KEFA 4E33A 1VLHA 2ZIUB 3FYCA 4D3SA 4D0LB 1CYEA 2H17A 2LTAA 2RSLA 3OVMA 2ZI3A 3RFCA 1M6EX 5K4HA 1ADFA 2DQ4A 3OPNA 3OWXA 4XGKA 1JQDA 2FAXA 3KVVA 1PLLA 5J58A 2AE2A 2R48A 4JJEA 3HL0A 1W8IA 1HYHA 1ZLXA 1Q7EA 2X8LA 1IK4A 3B52X 3MGKA 4MR8A 4UU7A 4WPGA 3W5UA 3WLFA 2WVAA 3BTSA 4ZOLB 4RMIA 3IO3A 1P1IA 1EP1B 2C07A 3IO5A 4EY6A 1JUDA 4HDSA 4IWXA 4JI5B 4BNFA 1FLAA 2Q2OA 3GFTA 5ALTA 2H2HA 1C0PA 5I7WA 2ID7A 1T3ZA 1FVHA 2IP2A 4QIHA 4OUDB 2EWWA 1XLUA 2YTZA 5DCUA 1QE5A 5A9SB 3M1LA 4HNSA 2R6AA 2QZPA 2XDQB 4PLFA 3H04A 2BCJQ 3MWDA 1E1YA 1DQZA 3ROGA 3V7FA 4GR4A 1N9KA 1VG0B 2YQ5A 4PCAA 1K5HA 2BGIA 4MEAA 1MQAA 3EOZA 4X64B 4FEGA 1VMAA 1NBHA 2MU1A 2QXYA 1SXGA 3DYBA 2GMWA 4JP2A 1E9RA 5DYYA 4CKWA 4HVLA 1QM5A 4IIHA 5ITWA 1S8AA 5B53A 3TD9A 3RFTA 2BFBA 3W6NA 1KE1A 1HRKA 1FIUA 3U2QA 2HIHA 4QJIA 1KTIA 2P4SA 4JC5A 1T26A 2JGRA 3L02A 4PLWA 1BMFD 5EUMA 2YY7A 2PUJA 2QLBA 1W36D 1BH6A 5AXAA 4PC2A 4XM0A 5D51S 3SSOA 3WK6A 1GPAA 3ZBPA 2JAHA 3BZBA 4ZCSA 3UWPA 3HQ4O 3ZDBA 1HDEA 2Z3ZA 1OAOC 1Y9JA 3K5HA 4QPPA 4PX9A 1U7UA 3TTXA 3CH7A 3FPSA 1E1QD 1F12A 2RC6A 2OLJA 1KMHB 3DD5A 3ZHBA 5BMOA 3KHTA 2BMDA 2PRSA 2R8BA 3PP8A 2OHJA 3JQGB 4UDOA 3T7EA 5CB6A 3PHHA 3H86A 2BGNA 3PPIA 1ND6A 3R74A 2XB2A 1PT9A 4G0YA 5AHRA 3WLSA 4IQGA 4C0KA 5DRTA 1O6ZA 1WUKS 2IW1A 3M4XA 4IHQA 2RHDA 4XA8A 3IDZA 3BIJA 3SYLA 2YZGA 4HYQA 1P9NA 3HLTA 5DNWA 4ZYLA 1U1CA 1YDEA 5AUOB 2DECA 1ZOIA 3CF0A 2QTHA 2YRFA 3ZBTA 2ONKA 1RTTA 3GEDA 4QKQA 3SHWA 3HCAA 5JQGF 5CGZA 2JDIA 3WTBA 1Y3AA 2I76A 4IPTA 2ORVA 1WUJS 4W8OA 3Q15C 4KAAA 4BNHA 4MVJA 3CGWA 2WMOB 3IUPA 4FU0A 4QFCA 4QNMA 2YYSA 5JSUA 1DJMA 3RRFA 1CY8A 3HJAA 3I73A 1YAJA 1DQSA 4AY6A 1Y1TA 2XTNA 2FWAA 1YB2A 4RLFA 3KJEA 3OECA 4Y9DA 1JQ3A 1OAKA 1OIVA 4F3KA 2VP2A 1XF9A 3S7ZA 2HPZA 3ONVA 2QZ4A 1JG1A 4B48A 4QM7A 5L4LA 3DULA 4D81A 3SX2A 2YNMC 5EZ6B 1QCCA 1FNSA 5DM2A 1TA9A 4XD7A 2XEXA 3I9JA 3R0IA 4N3BA 1KU6A 3WL7A 1GG8A 1XCMA 3PXUA 3ZD9A 1YS7A 4G0OA 1Y3BE 3COYA 2MYTA 3B1JA 4OYLA 2EERA 3ZHSA 1WXIA 5JSQA 4UTXA 4W5JA 3ND9A 3AKZA 3GBVA 3DHVA 2BGUA 1MUUA 2Q21A 2ZIGA 1NLYA 3LV8A 3KQVA 1EE1A 3GLGE 4J0CA 4MDHA 4JUFA 4HUTA 3ZLJA 1TKAA 3LPDA 4IVRA 4KK4A 1C30B 2QT1A 2YDYA 3JATB 2HSJA 4H15A 1C9MA 4BMZA 2Z4RA 5B3JA 1BU8A 2QR3A 4YPVA 5KX5A 2Z6QA 1Z6XA 4YAUA 4QPNA 4JOSA 4PPQA 4UW9A 4BCDA 5I45A 3E82A 4LGCA 4E2WA 5FAKA 1NWHA 2QTCA 3CW8X 3P71T 4U2CA 2YINC 5T4BA 1JN0A 4ENRA 3GDWA 4MB0A 3LIPA 3CN7A 1V37A 2KJQA 5L3RA 2Q7DA 1YZVA 3I5AA 4MEJA 4RZIA 8ABPA 5A4JA 2QUJA 1YOBA 5FR1A 5CLGA 3UB4A 1JE1A 1SXQA 1OQAA 2EIHA 3KB6A 4L8FA 2RGRA 1G8HA 3GA5A 1LBHA 3ZGLA 1AB5A 3EUAA 3A3YA 4KP7A 1AKUA 1GAQA 1PWXA 1XQYA 2G09A 2JZNA 4KAFA 4FTWA 4RE6A 1R3DA 4LOHA 4ZO7A 1KVQA 1JI0A 1REQA 1W29A 1PJBA 1MVLA 4LE2A 4M2LA 3KHUA 3UHPA 5I4KA 2N1MA 1IEVA 3B1WA 4NBUA 2X1LA 1NR5A 1NF8A 4C0WA 4Q37A 3FOEC 2GESA 1J1UA 3NEYA 1FDWA 3PRJA 2JFXA 4HG2A 5AWFC 1OV6A 3R9KA 3TOSA 2C83A 3HCWA 4ND6A 4EAQA 1SOMA 1RAHA 2BHSA 4H4CA 2FWBA 3VPGA 2JGNA 1P5FA 1SUWA 3BHIA 3FDJA 1M66A 4IGEA 1YJBA 4XH9B 2WD8A 4IS2A 3AJRA 4IOJA 2HSGA 3ZK8A 3F2IA 2CLKB 2HHLA 4OH7A 4PYNA 1L4MA 3OPXA 3W5IA 3ZDFA 3NHPA 2J5RA 3EWSA 4G01B 3ITDA 5ICMA 2ZUWA 1UDCA 2KQUA 2HPHA 3HU2A 4A82A 1L8LA 5DTMA 2C9DA 5DASA 2PUDA 4FLEA 4XEHA 3MN1A 4B71A 1I4TD 4TGLA 3WWEA 1R6XA 4HD8A 2BTQB 5F35A 3KE8A 4A23A 4EDHA 2AXNA 3LPNA 4QOEA 1JHXA 4XQEA 1NM5A 3UJPA 3RYIA 2XVYA 3ICEA 4NC9A 4H17A 5FULA 4V2UA 5HFJA 4BFUA 1YCGA 1D0IA 3B7GA 4W5QA 3JVDA 5HCNA 5I9MA 1ABEA 4LWOA 3D2CA 3KHSA 1APBA 1SFRA 5BYAA 1AG9A 1PV1A 2OBNA 1KFKB 4G3XA 4NOLA 1U0SY 1WNTA 3THYA 5DMHA 3V4ZA 3E05A 1SXJA 3BMXA 4MO9A 4NRDA 2LV8A 1PNVA 4D8YA 5ARBA 3A1FA 3BXEA 3L8DA 4IIUA 4O4LF 4WNAB 5TLSA 3IT2A 4DDTA 4ZI7A 4AX4A 1IM2A 1QQ7A 3FPEA 1KPGA 3I6ZA 4I1UA 3ZIUA 1C0KA 3GGSA 3JQQA 5AYVA 3UKJA 3UWMA 1QP0A 4M0MA 3E8XA 4ND8B 1BDJA 3RVRA 4YV2A 1P62B 3KSBC 1FW6A 3HYRA 4MUGA 3O1HB 3LYUA 5DO9A 3S1LA 3BWMA 3ZLVA 2ZBDA 2JH3A 4Q7MB 5L3SA 2H6EA 4FFBA 5AHOA 4E70A 2Q3MA 4W5TA 2H3HA 1B0AA 1OXBB 2YY6A 3KKZA 3D4LA 4UUNA 4HGOA 1BSVA 4CIBA 3P2JA 1KQNA 1ZJZA 3GUHA 4KBYA 4YRAA 4OQMA 2RMKA 5DGDA 5GVSA 3OEED 5BNWA 2VVTA 4JUDX 2VF7A 5J2TB 3PF9A 2CF6A 2XMCA 1CJUC 4UXJA 5KYTA 1JJVA 2FPGA 1M7HA 3ABSB 4PN7A 5MHTA 3OFJA 1Z74A 3A10A 1IN1A 2BLLA 2GTHA 2QAJA 2B4KA 4L0DA 5HZHA 1BFKA 3B51X 5HJ2A 1OA0A 3ENNA 3G6KA 4GBJA 1YI8A 1USWA 1GRQA 5IVHA 2WFMA 4ED9A 3ANSA 3NHWA 1G0OA 4R0NA 5C4IA 2B7CA 3UUEA 5EJMA 3GGJA 4NMLA 2E49A 4RVFA 1EP2B 2NZUG 2JBHA 4ETNA 1XCOA 1Q2XA 1DAEA 2NVWA 1Z22A 1Y4UA 3HUUA 4FW9A 4YRRA 2FP4A 1DAGA 2IELA 4PPYA 1RABA 5ALKA 2FEKA 1NVMB 4HQNA 2WIDA 2FFRA 1WZEA 4S2UA 1KZ6A 1ZN2A 3GRKA 4LF7B 3QY0A 2OQ2A 1QTNA 4X84A 4Q4JA 3R8XA 4UVHA 3R7BA 5JASA 1XJ5A 3C3JA 4HJRA 3VNQA 3EBOA 5LJIA 3PLAE 4KUHA 4XFJA 3BFPA 5SZJA 4ZYWA 4I9NA 3ZCVA 3IUMA 4DPKA 5JVDF 2WP0A 1WETA 3TNDA 3RAJA 4G85A 1PLJA 1AQJA 3U6KA 1R7RA 4MPTA 1X1QA 3UJ3X 3J81A 1SWVA 4EEKA 4D8WA 4J3JA 4PCLA 4H59A 1PUXA 4KEAA 4B6RA 4FGJA 2HNKA 1JJIA 1ZW1A 3V6MA 4AO8A 4QREA 1KO5A 2QBYB 1EAMA 1FJHA 1W0JD 3C39A 5FEUA 2Z08A 4CLXA 4FDVA 3B1VA 4H6PA 1YZNA 2WJZB 2ZAYA 2ZR0A 2DJ5A 1V1RA 4AMYA 2QRPA 5C8XA 3HYTA 1S01A 2AGVA 3FZYA 4DHEA 4C03A 3E2IA 2GF0A 4RD4A 3LT4A 1BJKA 1JLLA 3FAZA 5C51B 1SOVA 1U7DA 3OX2A 3GOHA 2NU7B 2O48X 3DBHA 1F2DA 3AFIA 2PKXA 2V96A 3F6RA 3BE5A 2AOTA 5BWCA 2CMDA 1Z7WA 4MPDA 3K32A 5HHTA 1MV5A 4JFRA 3ZHQA 1SZDA 1SC6A 1WW8A 3O8QA 4IX1A 1A8QA 1EX1A 3W9BA 4PHCA 4MCHA 3IP1A 1TEHA 2XMRA 1XR3A 2VDVE 3B3GA 1Z8FA 5BR8B 3VAZA 4X7MA 3FPKA 5DGCA 1F2VA 1JIJA 1Q12A 1MC1A 1XXHE 4AZVA 1T9HA 2XA2A 4MWZA 4OA8A 3T0IA 1QFXA 2VBFA 1U7OA 3F6YA 1XAIA 2IPMA 1E2IA 1O5IA 4QNNA 2CXRA 5IP5A 5M04A 2UZ4A 2AEFA 5AW7A 3TTWA 5AVYA 3EFHA 2EX1A 3RV3A 1RKVA 4C6RA 4RVNA 2XUIA 2G9NA 1PO7A 2Z2IA 4HAZA 4K5QA 3KFLA 3ORSA 4DLYA 3AR7A 3K35A 1R9JA 2WD7A 1EUZA 1R6AA 2AN9A 4R40A 5CGQB 3WDMA 2B37A 3L9XA 5EYPA 4BNGA 2CWDA 2DH5A 3D8SA 3GRPA 3WV5A 1A9OA 1HT0A 4FEYA 3QV1A 2W6OA 1GPJA 1TEVA 1XP8A 2HMWA 3ONWA 2SBTA 4O1IA 3D6VA 4YI5A 4K6FA 2P9YA 2RHGB 5TMDA 3FBTA 3NW9A 4B6EA 5K2MA 2FZCA 4KR9A 1XQ1A 4BNDB 1LX6A 1E3SA 4U2EA 1WPXA 2JCXA 1GPH1 4EMUA 2IOQA 3GC6A 4QARA 1M5TA 2FGKA 2ZJZA 3S8MA 3LC7O 3WV4A 2B83A 1PR1A 4HTAA 2I1VB 3KRTA 4KQGA 4M1KA 4LPSA 1CK4A 4REQB 5HGXA 1QVRA 3S6JA 1J00A 3ETNA 2JA1A 3I1YA 1CS0B 3WL5A 3CX7A 1O58A 4TV9B 4BY9E 1V8PA 4EHBA 4AKHA 2Y93A 4G5GA 4P7BA 4YBZA 5E8JA 1P1KA 4FQ7A 4CXMA 4AO6A 2CD9A 2G28A 1G3MA 2DYKA 3BE4A 1YTLA 2ZB2A 3HGQA 2N1BA 3C6ZA 1QVAA 3O3OB 4EW6A 2OD2A 2BI7A 1SCNE 3MBKA 1QRTA 1BQEA 2QQ5A 1RI4A 1WLYA 2CUZA 4L4SA 4M0KA 5HS4A 5H3CA 3O94A 2F3UA 4OEHA 2VPIA 3PEWA 2FTKE 4PSCA 2H2AA 1G3IA 4KO8A 2XVZA 1S2LA 1M34A 2YS7A 3KIPA 4R3WA 2ORWA 2Z09A 5JI2E 2Z1MA 4PHTA 3AVUA 1H85A 4DLLA 1GHTA 4TMZA 6LDHA 1XAGA 4NXNB 3S5UA 2WNIA 3EXHC 1BWPA 3DCNA 3IIJA 1PJCA 2QX4A 3A4VA 4GMDA 1XTTA 1EK1A 3M6AA 5FJJA 5A3JA 3N2EA 4H1HA 3OTQA 5IYZA 2BRUA 3DJFA 2QXTA 3AHDA 3TKAA 1ZDMA 4YT8A 3DFIA 3TM4A 5JNUA 2QW0X 4RVGA 4X91A 2VHVA 2O3RA 2W2XA 4GPIB 3OLZA 3HABA 3WBBA 4RMNA 4V39A 2JLXA 3KQQA 1AUQA 1PS0A 4LUCA 5LKRA 3GLFB 1H2WA 2XUHA 4WFKA 1V45E 3OM0A 1EGAA 4JT9A 3N8IA 5KTOA 3ILSA 3BEDA 1HH4A 4NTZA 4DJJA 3PDIB 4U63A 3WDSA 4UCWA 2Q3LA 4QJ5A 2CXHA 2GM4A 1JFRA 3LU1A 4CEHB 4ACBA 2Q28A 2OD7A 3FCSB 3K0FA 4BJHB 1MR3F 2POQX 2WWRA 3EGXA 3T4UA 1U8FO 1T8UA 4XCVA 2ODNA 3FHLA 4MTCA 4J1TC 4Y2PA 2CBXA 1YA4A 5BV0A 3O2NA 1CC1S 3D1LA 4C4OA 5A2GA 3G49A 4PONA 4UEOA 5C34B 3Q6NA 4KE9A 1GGEA 2IE8A 2V8BA 2ZIVB 3QV2A 3OE5A 5F52A 4EB3A 2G1JA 3VKUA 5T3YA 2CXTA 4IF6A 4D4KA 4RY8A 3D54D 1SUDA 2OCGA 1B0ZA 4XYGA 4R83A 3I6BA 4RJ2A 2ON6A 3L8YA 2JGKA 2DQSA 4QE3A 1C7IA 1NMQA 4XVRA 1GDDA 2NTYC 4OSOA 4YRCA 1CUUA 1CX9B 1Y3FE 2GD0A 5FR2A 3VPDA 4E5KA 1VJCA 2NADA 3PHGA 1D2MA 1NMYA 1Y7PA 1J97A 4TT3A 3A2KA 1NR7A 1ZD5A 4BZPA 1OIXA 1T6ZA 4MWDA 4R8VA 5A0VA 2A78A 1H0HA 5F2NA 3BFKA 2ZYUX 3DC2A 3HU5A 3I72A 1UWLA 1ZO8A 1IHXA 4GE0A 4JB2A 4YDHB 5AI5A 4Z9BA 4ZEXA 4CM8A 2XYQA 2OYSA 1O96A 3DKPA 2PYDA 2JAPA 3AKDA 3EVDA 3Q4GA 4BNMA 1CLUA 1D5CA 2NAFA 1VIMA 3N6RA 4KMMA 4YJ3B 4B1FA 4CN9A 2GOYA 1Q7RA 3IELA 3SYRA 3V7UA 1PE0A 3T38A 4EUFA 1J06A 4BN4A 4UHDA 4JJ8A 4UTRA 3U1BA 3NRJA 1MV8A 2C88A 2Q1WA 2A5FA 3GVXA 4QFDA 1E7QA 1BX1A 1UMKA 5LIRA 3LOPA 3U9TA 1Q3TA 3I0ZA 2VUIB 4C05A 3PHIA 3EY4A 3F96A 4DQXA 4E5PA 2ZRCA 2PD6A 5JHHB 5ILGA 3CM0A 4S0XA 2YWCA 2ZIXB 1PJ3A 3TL3A 5CB4B 3UV3A 2HJSA 4FMDB 4YT5A 3ZS8A 5EJ5A 2RFLA 3TFWA 4L75A 1NLMA 1NHWA 1ZOOA 2WTEA 4INJA 3B1ZA 2CFSA 4NS1A 5FPSA 2UDPA 3T3GA 3A1EA 2ZPAA 5CT8A 2PT9A 1T0IA 1XPJA 1QGAA 1I36A 1N9GB 4ITUA 3REQB 3RWBA 3IAM6 3S1AA 1W73A 1FSSA 1DOAA 2CCKA 3FUTA 4QX6A 3KKMA 2CDAA 3QMWA 3T95A 5HBRA 3HA3A 4CBVA 9GPBA 3TLCA 3TFQA 3NI2A 4EVIA 4B76A 2J7PA 1TLTA 3QG1A 1ZCZA 1L7PA 1QCDA 2ETVA 4RX1A 5D3QA 1ZGGA 3SYNA 4M6WA 2GXSA 2F43A 2QA5A 4MEBA 3ZJ4A 1L5WA 3AZOA 2I29A 3HYNA 1Y4SA 5D84A 1LRJA 4FOPA 3VR4H 4XIJA 1UMDA 3GD5A 3H1EA 4N3NA 5HOEA 3UPTA 4DLUA 4L3WA 4EZBA 4JYMA 3U4AA 3ECSA 5J4KA 2HA7A 2H4WA 3JQ9A 3RLIA 1SQGA 4UBNA 4AS3A 3DXFA 3IDFA 2VR1A 4J16A 1VE5A 1F8UA 2J4CA 1NI4B 4M7PA 5LXTA 3BE6A 4FONA 3WHPA 3GCDA 4FHGA 1SY7A 3CUEF 3I4FA 1C0IA 3QPWA 1RPNA 1ZC4A 2YVKA 3BH6A 3BRWA 5EUCA 4C08A 3CSDA 5INTA 3P0HA 3PA6A 3MA0A 2Q4DA 3ZWMA 2FSFA 2J6CA 3T5PA 4TZ6A 3EIOA 3ESQA 3HB9A 1XK7A 5DV9A 3RC8A 2OC9A 3W8NA 1IZZA 1Y8RB 1K86A 5CA0A 1A5AB 1XQXA 3P1JA 3LKVA 3RROA 2QORA 4K03A 4NJMA 3GEMA 3WXMA 1QF7A 2H1CA 3GRRA 1PR3A 1JEQA 4KK3A 3KJIA 2VH5R 1X92A 1XYYA 2ZBUA 3O2SB 3OHPA 2ORIA 3PA8A 1X1RA 3KQMA 3QPCA 1AGNA 1KS2A 1POWA 2X8JA 2XQVA 4P7GA 3BJMA 4J07A 2ZUEA 4N1AA 4Q21A 1Z7GA 4G2NA 1Z4JA 4GQIA 5F64A 4NXMB 1N78A 1DQNA 1CB7A 1OZFA 2AG8A 2ZRJA 2YWGA 4UCXA 2NZ8A 1EBBA 1UT5A 3HZRA 3BCRA 4PIPA 1Z3CA 3R77A 3HSKA 3V5NA 3U4DA 2XMBA 3P2YA 3QOWA 1RAFA 1U94A 3H4MA 4FXPA 4H4EA 1QIEA 4L85A 5EMLA 3S81A 5REQA 3JQFC 1GOTA 3BRCA 2X0FA 2ID8A 3GLVA 4XRGA 5LXTF 1IRXA 3W3AD 2A9VA 4AJ9A 4QBHA 4ON9A 3C3EA 4Z0NA 5A5FA 4QULA 1ITZA 3R0JA 2FLVA 2V58A 3NETA 6GPBA 3RVSA 1BN6A 4DZZA 4KQJA 1JS1X 4QOFA 3IQZA 2ID9A 4WZAA 2J59A 2ZRDA 2ACWA 3Q7QA 1MVOA 4MRSA 4PRZA 3NMUF 3WGZA 3LOUA 1Y7TA 3MJHA 4YRJA 1II9A 1R0KA 1X7ZB 2YXPX 4QXOA 1E6CA 4EF4A 1AC5A 1GSOA 5C4MA 4UPVA 5BR4A 4DLAA 2WHEA 2E4UA 1M83A 4MB6A 5D00A 5FIUA 4DXHA 2GN0A 4IF4A 3H5NA 4HV4A 4B6GA 1N2CA 1T4MA 3OC0A 2WF7A 3L93A 3NTRA 1LPMA 2JJ2A 5IF9A 3VR5H 4ERXA 4A0QA 5CAEA 2XGJA 2IPAB 3EGDA 2IYSA 4RHXA 1P60A 1O9BA 2REQB 4BKPA 5JZSA 3AR2A 5KHOC 2Y0EA 4QUHA 2HPVA 3NYQA 4C2BA 1D03A 2E2WA 2PKWA 3OUZA 4LDJA 1ZVQA 2R5NA 3UENA 3M6LA 4DCJA 4CLOA 1RM0A 4AECA 1BDHA 3A4TA 1KI3A 3BJIC 3DDSA 3OETA 5ALVA 5JS2A 4Z0HO 1NNEA 2H0QA 5BWBA 1U7HA 2D3WA 2Z58A 2Q2WA 4BYMA 3OJEA 4MVXA 4C4YA 2AOVA 1QX3A 3W4IA 3W4KA 4E07A 3OQIA 3MM4A 4AWAA 2O7SA 2B4TO 2XI4A 1UKBA 4H0NA 2JLZA 4L8WB 3NT4A 4MS4B 3SQMA 2B4YA 1LF0A 3HGMA 2P68A 2SCUB 3GT7A 3SXPA 2H31A 3ECAA 2M6RA 1D1PA 4PBTA 2AFVA 2PWAA 1SHTX 4RACA 1WSWA 3K4PA 5CDTA 2OK8A 4PQRA 1GEEA 2HSEA 2HLDA 3SHFA 2WFZA 2XXBA 3DOCA 2ZUUA 4KVGA 1UBLS 2E0IA 5AM1A 1LSUA 3CUVA 2QKYA 1M1NB 5IANA 3EGCA 1FS5A 2AW3A 4L5BA 4RULA 4RF5A 5F98A 3WB0A 5EERA 4H1TA 1RC8A 1G2PA 2R8EA 1QLJA 3OKPA 2PX2A 4LKRA 4LJ8A 3UT5A 3ZY4A 1SVUA 4ZMSA 3AG6A 4NPHA 3USES 1ODFA 4IZHA 5L51A 4A6PA 4F84A 2X2EA 3ESZA 4L5IA 1P2FA 4TTAA 4QUDA 4BNVA 2C8KA 2EBHX 2H4JA 2QROA 2ZIFA 3S70A <