3V4OA

Human malt1 (caspase domain) in complex with an irreversible peptidic inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
234
structure length
234
Chain Sequence
DQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants of MALT1 Protease Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords Mucosa-associated lymphoid tissue lymphoma translocation pro
total genus 87
structure length 234
sequence length 234
ec nomenclature ec 3.4.22.-:
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v4oA00
4QTYA 4I1RA 2HBZA 2AR9A 3EDRA 3R7NA 4EHLA 5IANA 3NR2A 3KJNA 1ICEA 3R5KA 1NW9B 4N6NA 1RWNA 3OD5A 4FGUA 4N7MA 4NOMA 4M9RA 2FQQA 3H0EA 4QU9A 5IBRA 5H0IA 2XYHA 4HQ0A 4AW9A 5IBPA 1F9EA 4AWAA 2C2OA 2FP3A 2Y1LA 2QLJA 4IEFB 4NBKA 5LUAA 4QUGA 3PD0A 5LU9A 2WDPA 1KMCA 3QNWA 4FXOA 4JJ8A 4ZVTA 4DCPA 5LUBA 1CVRA 1RHQA 4QUAA 2H54A 3UOAB 4D3ZA 1RHUA 1F1JA 5I9BA 3IBCA 1I3OA 4QU8A 4NOJA 3P45A 1SC4A 1I4EB 1RWXA 5IC4A 4QU5A 3H11A 3ITNA 2CNOA 5K20A 4QULA 4PS1A 4JB8A 1SHLA 4I1PA 3H11B 2XZDA 1BMQA 1I4OA 2DKOA 3H13A 4EHKA 4EHFA 3KJFA 1RWOA 2K7ZA 3V55A 3NS7A 3S8EA 3DEJA 3V4OA 4NBLA 2CJYA 1GFWA 4NOLA 1RHMA 3SIRA 2C1EA 4QUEA 2CNLA 4NBNA 1RHRA 4QTXA 5IAEA 3DEKA 2H4WA 1M72A 1SC1A 2CNNA 4QUDA 1SC3A 1NMQA 2QLBA 4JQZA 3D6HA 5IABA 3DEIA 5IARA 5IC6A 4DCJA 1RWVA 1QX3A 1SHJA 3UO8B 3V6MA 3R6GA 5IAJA 2H4YA 3V3KA 3R7BA 3GJQA 2J32A 2QLFA 2QL9A 2H5JA 4D3XA 3GJTA 4JJ7A 4LSZA 4PRZA 4FEAA 2J30A 2C2MA 4N6GA 4QUBA 3R7SA 2C2KA 3H1PA 2FUNB 3V4LA 3GJSA 3R5JA 4DCOA 3NKFA 4JR2A 4AWBA 4EJFA 1JXQA 1K88A 4PS0A 4HQRA 4ZVSA 4NOKA 4ZVPA 4ZVRA 2H51A 2P2CA 3R6LA 4JQYA 5I9TA 2H65A 3D6FA 3V6LA 2CNKA 1QTNA 3RJMA 4D3YA 1RHJA 4EHDA 2XYPA 4QUIA 3GJRA 2NN3C 1RWWA 4QU0A 2CDRA 1NMSA 1CP3A 1NMEA 1RWPA 4PRYA 2J31A 3PCXA 4ZVQA 5IASA 1PAUA 3IBFA 4QUJA 2HBRA 3S70A 3P4UA 3BIJA 4QUHA 2HBYA 1RHKA 4JJEA 2C2ZA 3EDQA 4HVAA 2H5IA 4EHHA 3K7EA 1K86A 4FDLA 3D6MA 1IBCA 4ZVOA 3DEHA 5LU8A 4EHNA 2HBQA 4IYRA 4ZVUA 2H48A 2XYGA 1GQFA 2QL5A 4EHAA 4N6OA 5IAKA 3E4CA 1RWKA 3SIPA 3PD1A 4N5DA 1QDUA 2QL7A 5IAGA 4JR1A 1I51A 2CJXA 5IBCA 4JR0A 2Y0BA 5JFTA 3KJQA 4N7JA 1PYOA 2XZTA 1RE1A 2J33A 1RWMA
chains in the Genus database with same CATH superfamily
3N0WA 4V0MA 3KYCB 2V59A 1Q0RA 1KI7A 2GF2A 3E48A 3OCVA 3CZ4A 3QX3A 3HMQA 3KXDA 3REQB 3TPCA 1G3QA 1ZRMA 2W22A 2ZJAA 1CB7A 3NTVA 4N0MA 5KCMA 3T3MB 2P0AA 4GZLA 3ZYZA 3LDGA 4GGMX 2WB2A 2IOFK 4I1UA 5AVYA 2KPOA 1IUKA 1D2HA 3JD2A 4C4PA 2IUEA 1D6JA 5A7GA 2WFLB 3BM5A 3IFSA 4JP2A 2NXCA 3SX0A 2REXB 1MT0A 1OREA 2Q5HA 3DAYA 3R4VA 4FDUA 1RRVA 3FDZB 4TKUB 2VNJA 4GEGA 2OZEA 4NH4A 3A28A 3N2IA 4YRIA 3LRPA 2A1IA 4JKYA 4X8MA 3QBDA 3ZBUA 2VP2A 3JQ7B 4E0BA 2XCQA 1U9CA 2DOKA 3R9XA 2D1FA 3GARA 2GXQA 5FUQA 1ZKMA 1R8SA 2QJTA 3M3PA 3ZLVA 4A8JC 3DL7A 3ANYB 3PXXA 4L07A 4JOQA 1V37A 1VI6A 3BMXA 4TVSA 2H4JA 5LA6B 3VI4B 3DJFA 4LZWA 1NVVQ 5J5CA 3QFCA 4UREA 4JKOA 5E2AA 4DHEA 5AESA 2XW6A 4EX6A 3ZD7A 5JDCC 4ETWA 1X42A 3N58A 2H1RA 4QAJA 1YBAA 1FF9A 4I99A 1OIWA 1RADA 4TKMA 4D02A 1JIIA 5FBZA 4LFBB 3C70A 4N01A 1K63A 1JL3A 2GRJA 2BN4A 3M4ZA 3MVEA 2IYWA 1YZYA 3KR9A 4I1OA 4KV9A 4OXYA 3T38A 1Y0BA 1MO6A 2VHYA 4HDAA 4AKSA 3MT9A 4Q9IA 1G3RA 4DAOA 2PXHA 2OXTA 4J76A 4LBYA 4A5OA 5E9JA 1KEEB 4JLPA 4C4ZA 3QTBA 2EG9A 3FLEA 4F11A 2XOKA 1W8DA 4UVIA 5HKLA 5KYUA 3DMPA 3PFNA 5AW8A 1P9RA 5LQNA 1C3OA 1S3IA 1L4GA 1XZGA 2J07A 4I4IA 5JADA 1L5FA 3ICPA 1S1MA 2C2KA 1TEHA 3EVDA 2GI4A 5I47A 4NULA 1N0UA 1KZ9A 4ZDIA 2HKIA 4WY5A 3FPFA 5JQGF 5AVUA 3QJYA 1P4HA 3IOYA 3ANLA 4TUYF 1LNSA 2FA9A 2GGSA 4I4TB 4MZXA 5BMVB 3C6ZA 1RHJA 4IYJA 1KH2A 3QU7A 3FVRA 4I36A 4BTVA 5G4LA 2AF4C 3FCYA 2F1JA 5DHTA 5DNVA 1V41E 3ZK9A 2ERYA 4C21A 3K5HA 2J3MA 1TTQB 1YC5A 3IVXA 4Q34A 1T6YA 1V0JA 4V02A 1MX9A 5ECWA 3ENZA 4H1TA 3UCFA 1J1UA 2BKLA 1LSOA 4TSFD 1L7XA 1ODCA 3OOYA 3OIGA 5FPPA 2XX3A 1II8A 5COAA 3OJCA 1KU6A 3SGLA 4WZZA 1XQVA 3IOMA 3X1DA 3ZWMA 3JRXA 4ZVOA 1XVAA 4KQCA 4Z7OB 3MB5A 2ID4A 1V16A 2SCUB 3FTNA 4M55A 2EP7A 1FIUA 4C0BA 2W4IA 3LZDA 2J3IA 4CUKA 3RU9A 3G0CA 2GEBA 2VJKA 3R5SA 4BQOA 1R6AA 2CUKA 3QGMA 3MLBA 1U0OC 2PUDA 1NGSA 3KJQA 4UHFA 1UIRA 5LDHA 1Q91A 4R1QA 2EZTA 2VNAA 1CR2A 2VUTA 3NH9A 4R1PA 5T8KC 3T5MA 2FLWA 3RYFB 1SBQA 1RABA 3NBKA 1I32A 1ULTA 3WP0A 2GM3A 2VZ8A 3PICA 2QD2A 2YWHA 4N49A 5FOWA 2G0NA 3H2BA 3NRJA 3TAUA 2NTNA 4XFDA 3O8OB 1GO2A 4Y1RA 2NUPB 4BFUA 3S1LA 4MULA 3KBBA 5IAAA 8ATCA 3OF2A 4RHTA 1A4IA 4UHJA 4O2AA 3V48A 1E2HA 4B3CA 4DTIA 2LP4Y 5JVDA 3ZKAA 4YJ2B 5EXEA 1RE0A 1UPCA 1J8FA 4BKRA 2VH5R 3EQ9A 3C14C 3T9BA 3ZD6A 5JS8A 2Y1KA 5DBIA 3D8SA 4H3VA 1QVWA 1SCAA 2ROQA 4L95C 5B58C 2PUGA 1I10A 2IGBA 1ZGCA 1IXYA 3REOA 3L6EA 3MT0A 2PGOA 2L82A 3H13A 4ESVA 4V03A 1E2UA 4Z4CA 4MAFA 3BQMB 4GBJA 2BTQB 5LQJA 1LLCA 1AV7A 2H16A 1PLLA 2OAGA 1QP4A 1B3RA 3TW8A 3W04A 1ACLA 4L4RA 4V0SA 3LNTA 4ND7A 3HZRA 2QX6A 3ZHCA 1OU4A 1SKQA 4U4AA 3NXKA 3FSEA 3PQDA 5ALHA 1H05A 4PAWA 3HPQA 4BCCA 2HGSA 4EF6A 5B6IA 4EJ2A 2G17A 4XDYA 3GVCA 2GS9A 1HTWA 2QRKA 1KVRA 5AVZA 2GAOA 1CDDA 1A7UA 1O6CA 3FUWA 3JTMA 4RABA 5B3AA 4ZYUA 4A10A 4N5HX 2MR6A 4B8ZA 4C3OB 5BYAA 2FSUA 3GZ4A 4P4SA 2PANA 4WIAA 3RRXA 4HMQA 3G1TA 4FEAA 2NZWA 5JEDA 1Q20A 3D6TB 1YKSA 4K9OA 5JYDA 3AP3A 3ZWYA 3NANA 1W0JA 1N9ZA 3PUWA 4X1IA 3QIVA 4IF4A 4XZ3A 5E4YA 3JATB 2BDEA 2B98A 1JUDA 2GEFA 2COEA 2IDKA 2QORA 3PDIB 5DHFA 4EL5A 3DOJA 4XDGA 5FTKA 4GEKA 1W4ZA 4OKIA 3I0ZA 1TB4A 2WKWA 1UM9B 4G0OA 2HPVA 1G5RA 8AT1A 4QU0A 4JLVA 1ZG3A 4M1TA 4CU5A 3F4KA 3ML1A 2FSFA 4K46A 3LUKA 4D99A 3PCXA 4DMHA 2VATA 3LRXA 1G2OA 5HIMA 5FFNA 4MLPA 1TO6A 1IU9A 1TF2A 1IIRA 1KK2A 3VNUA 2PMFA 5HIJA 4UARA 5C4GB 3EDOA 5CVDA 3PE4A 3IAS6 1CUIA 4XXHA 3B8HA 3U0VA 4ZJUA 1JJFA 3OE4A 1NBOA 2A1TS 5K2OA 1U31A 4G6ZA 1Z34A 3Q1LA 5HK8A 2Y6UA 2HHJA 3E23A 4QHTA 3ZWWA 1Y34E 3PENA 4HJRA 3QHQA 1TLTA 3P1JA 3H83A 2I71A 4HF7A 1LUAA 5DMXA 1KEUA 1NOJA 1JPUA 1ZISA 2EOAA 3HWRA 3G79A 4DAEA 5KPJA 2NU7B 5BOVA 3GG9A 2VJCA 2W4QA 4Q21A 1GVHA 4DZTA 3CF0A 5DOZA 1SCKA 1WLSA 1I5EA 2OSVA 4B34A 3S2UA 2PD3A 5AOBA 2AR9A 3S55A 3MINA 4LJ5A 3NHYA 1WPGA 1AKQA 1M6HA 4JC4A 1KAQA 4MS4A 4BYGA 3LHFA 3ZU2A 1O0SA 3ONFA 3S44A 5BSKA 3AU9A 4HLDA 3S6JA 3BJZA 1CQXA 1KZ1A 1NDHA 1QF6A 3I6MA 4PTZA 1AGYA 1EAYA 2Y1LA 3OE7A 4H3KB 4CL8A 5GOZA 2PY6A 1E3QA 3CT6A 3CMMA 4GI5A 4GR9A 1GUDA 3NJ8A 3S1AA 2AN1A 2AE1A 2F3SA 1FW6A 2JKVA 2YC2C 4QARA 1Z4MA 1GL9B 5A3RA 3KOZA 4EKNB 3KUUA 1VE5A 4KTVE 1C7JA 3RU2A 4AY3A 2UXBB 1YCHA 3DAOA 3GA5A 2ID7A 2R6GA 2W90A 2WA2A 1DHRA 1EEHA 3BTVA 4I9GA 4WFJA 2HF8A 3V8NA 1SHLA 2CHFA 3VJMA 2RCYA 2HN9A 2YRFA 5E6RB 5DNCA 2EGHA 1YIAA 4RSMA 2GDZA 5IDYA 1E6LA 1GQRA 2A0UA 2FZWA 4RA6B 3RIXA 4YAIA 4FYHA 2DWPA 1O94D 1I1NA 4QOGA 3JQBC 2IEAA 3PTLA 5TVKA 4BMPB 1XJWA 4UE6A 4X3PA 1FU7A 5BUCA 1SZPA 1KJWA 1HG1A 2XMQA 3BEDA 3VTZA 4OXIA 4HEA6 4AZTA 5EQJB 4QUDA 3AH8A 1MX1A 3HJAA 3JQGA 1GAQA 3TXXA 3CB2A 1YKGA 2IPOA 3SC2B 5IABA 2J09A 2Y3IA 4WSOA 3VH3A 2CMHA 5AO9A 3SQDA 4FBGA 1U2GA 3CZAA 3WOHA 2C2BA 2L42A 2QRJA 3EWIA 4D8XA 3MN1A 1MJGA 1GQOA 1GSHA 1PGOA 2VJQA 1Y5RA 4A0SA 5LP6F 3K0CA 1S2IA 4U0KA 5E9WA 1PNTA 2PX2A 4Z2AA 3JZMA 5A9TA 1Q17A 1Y6RA 2JGNA 2NZJA 4RTSA 4FYVA 4BMZA 2QN3A 4EKDA 1YRHA 4G5RA 2A78A 5AJVB 4KXUA 1QVVA 3AERA 1ZLYA 1KGDA 3FPAA 3FSJX 1P9OA 4BQFA 3IQFA 1M9NA 3R74A 2QY6A 3SQMA 4BGDA 5TLSA 1CUHA 3D3WB 3SC4A 4TWRA 3P52A 3NEYA 4LJSA 4DOMA 1S0UA 1O95A 4GWLA 1KAGA 1YDEA 4RIFA 2EW2A 5FFMA 4EPRA 4CIDA 4J2HA 2CDRA 2OVFA 2H8KA 1EVEA 4TV8B 1JT9A 2HWXA 2FRVA 3HNOA 3SS7X 4G84A 5JY6A 1DEHA 1WUHS 2W83A 4R3NA 3E7FA 4OMDA 1RM3A 4PC2A 5AI6A 3SZGA 2P6NA 2Q6VA 4RYDA 3RIMA 1JHXA 1KMHB 2BKXA 3BHMA 3E84A 1P2GA 5CLQA 3TIXB 1DRWA 1T10A 1AA6A 4MOWA 2N46A 3VR5H 1QYIA 1PT6A 2ASVA 2XQVA 2Y2UA 3GGGA 2XEDA 3OI7A 4NF2A 3KQYA 5EWLA 5A06A 4C2UA 3MPOA 1OIXA 1ZINA 3W7AA 8MHTA 1LSUA 4OFWA 1EK5A 5JJLA 3BAFA 4IMPA 1MEEA 6PFKA 1NVVR 1VTKA 1WUTA 1SXHA 1TT5A 3TOXA 2AN5A 4BVKA 4B6OA 4JBWA 5MN5A 5HIAA 1Z5UA 2Z98A 2BT4A 1CYEA 4ZD6A 1JA0A 2YNMC 4N3CA 2V1UA 2E4YA 2OCAA 3D4OA 1WP9A 1DDOA 4B0OA 3EGWA 1OVGA 3SSAA 2XDQA 3THXB 1VPEA 2XA9A 3BMOA 3FNBA 3IVGA 1REQB 2ZYHA 5EE0A 1FFYA 1E7MA 1CX9B 1ILWA 4MCJA 3AGQA 3EC1A 3IURA 4II2A 5FYQA 3CKLA 2PMWB 2PM8A 3JQFC 5CM9C 3UMBA 1OE0A 1IZ7A 3AZPA 4IH1A 3WNCA 1EA5A 1JEQA 4JYPA 2BGUA 4C7XA 3I1IA 5JISA 2VPWA 4C89A 4YQFA 3CHYA 1X9HA 2YV4A 4JP3A 4DQLA 4WESB 2XNDA 2GYVA 2R87A 1R15A 3V80A 1JXAA 4QT4A 3RSSA 4UVHA 4FFBB 2AC7A 2UYQA 1YUMA 1TGYA 1OH5A 3RADC 1Y5IA 1EEXB 2QG4A 2BPOA 5K6AA 2P41A 2W8BB 3RYIA 1GR1A 3C3PA 4FXPA 4F2PA 3LW7A 3F46A 2J8ZA 4XGRA 4I1PA 1P6QA 3DLCA 3NW9A 4TYYA 3O7WA 1GUBA 1JHZA 2C03A 4CIVA 3ZVMA 1EP3B 2PE5A 1DBPA 1L1EA 1U65A 2JZCA 2YMLA 5BV7A 1XA0A 4W1RA 4CFYA 1AKNA 4G9BA 2I91A 4J49A 1T9GS 4Z4EA 3AONB 1A9ZA 3BT7A 2QZJA 4U3JB 4FNMA 3U3XA 1Y8RA 2GCOA 2J6IA 4FONA 5ALJA 1N5RA 4P83A 2ETXA 5HKKA 1NVAA 1CUXA 1UOOA 2LWIA 2PMKA 4MPTA 4OJQA 4XX0A 2RGCA 2WUDA 2E5LB 1NYLA 1ZD1A 4Q4HA 3IVCA 4Q7JB 1GPBA 4U7GA 3GAZA 4K05A 2P1DA 4FE3A 4G24A 4PQRA 5IDQA 3S27A 1BROA 1J8MF 3AHDA 3GRRA 3GBSA 4WECA 1T0JB 5FCDA 1QR6A 5DT9A 821PA 3JQPA 5I8WA 1H0KA 2PKYX 2ZIFA 4ARCA 1HTBA 2GBPA 2QZ9A 1NHGA 4RV9A 1AGPA 2NACA 2PZBA 3KELA 3OLCX 4HQRA 1BCRA 2FZKA 1QHHA 3L49A 4ZVRA 2JLYA 1N5JA 4UM9D 3KXPA 3HBMA 2WNIA 4D3DA 1SWWA 3U3JA 3GGDA 1U8AA 3WIVA 1NJ5A 4CLXA 2ECQA 5CFRA 3C8DA 4ZCQA 3SI7A 1U7PA 4K2AA 4J03A 4N5LA 4CV0A 2GXUA 3GI1A 5CB6A 5M34A 3KWLA 1ODLA 1UQUA 1QYVA 2Q5OA 1LRKA 3TNLA 4C7KA 4RTQA 1W4RA 2YQZA 3GGOA 1NI4B 4PRYA 3W5AA 1ADFA 1T2EA 2AS0A 4JP1A 3GLIE 2QYOA 1MPXA 3HVUA 5EVJA 2AI3A 3DBRA 3EF0A 5GY7A 2VRNA 4JJAA 2F1RA 2F8TA 2X0JA 5AUOB 1VLJA 1VYTA 1GNPA 1LLUA 4J91A 5CTAA 3T5PA 4EG4A 1AQJA 1ZUWA 1JF8A 3PC6A 3T0IA 1FSPA 2WILA 3ZCQA 4MVJM 3AQ4A 3CBQA 2J7KA 3O4RA 3AY6A 5CUQA 5KYWB 3EZ2A 2XCOA 1MQAA 3L6DA 3PG5A 2JGLA 3OG9A 4RLSA 3U0BA 3W5JA 2JPDA 2XQKA 1Q3TA 2VAVA 1TJ5A 4AN0A 4K2HA 3VPCA 4ZYTA 1Q92A 3PSHA 5TSDA 3PC7A 2VQ6A 2X7JA 1L1QA 3I1YA 4Z1OA 1L5HB 4MQ6A 2UYCA 4F3RA 1P1CA 3GMDA 3HYRA 2WVJA 3EFEA 4MQMA 4G0QA 3JU3A 3CRRA 4MV4A 4G5YA 4MYRA 4C3ZA 3EZLA 3NBYC 3FF1A 4KZPA 4X60A 1QX4A 1RR6A 4YX9A 2C99A 1ODSA 2PLFA 4X00A 1DXQA 1GU7A 2ZIZA 4PXSA 5LP6C 3W3AH 2GZ2A 2XUAA 3F5MA 1U6KA 2ZULA 1Z6GA 2YJNA 3IAM6 3LUDA 4S3MA 4ZREA 1FFSA 2R00A 3TCNA 4N0QA 1EA7A 4NONA 3TOCA 3VVCA 3U7GA 4HHEA 2Z6UA 5G2OA 2OD9A 1MOPA 3PP8A 4D25A 3K92A 1ZCBA 2R7AA 4Q4CA 1B6TA 3WJAA 2ZIVB 2ZSUA 3B48A 3BD6A 2QBYA 4CT4B 2AJCA 4C01A 4MGEA 5E7IA 2PGNA 1AY0A 3UUEA 2R6AA 4Z51A 3QA9A 3RYTC 2OC9A 3H11B 3OTQA 4R9NA 1ZCJA 2CL7X 3B6MA 1A50B 3DO6A 2EW1A 4D7AA 3HB0A 1UFOA 1FNNA 2CMDA 1ANKA 3JQAB 5FV4A 5LYJB 4DRZA 4KQWA 5HFAA 1Z3IX 3DC2A 1EGVB 4D56A 2XNKA 3IHLA 4AQDA 4GP6A 1GN9A 3RV3A 4D79A 3CRQA 3CX3A 5DW3A 1EGQA 1I94B 4NMHA 3LQ1A 4JNKA 4OHRA 5EIBC 4XJXA 3KSUA 2XMGA 1CDOA 2DULA 2CFCA 1CRLA 4WLEA 3GYGA 4HB0A 3SS9X 3WGMA 3JD4A 1GTRA 1JDJA 3I76A 2ORVA 3I8OA 2B1JA 1Z0UA 2QTBA 4XQEA 3VU1A 1SXJD 2OV2A 2EFGA 1EWVA 2D1SA 2QB5A 3GLKA 2EZ4A 5BN5B 4LSZA 4D4JA 4OFXA 5JO0A 2OHOA 1H2XA 3O8QB 4E4YA 4GL2A 3W6NA 1SRRA 3OKAA 2J9ZB 2WWHA 3M6LA 1UP7A 2H07A 1KIFA 1E8NA 2QDKA 3C3DA 3BD8A 4JL6A 4OLHA 5K3SA 4ZAVA 5SZKB 1NX6A 1SJ9A 2NYVA 1CG6A 1UK9A 3K3PA 2O7NA 2QV0A 3CIFA 3WIUA 4AJ4A 1YOVA 1M34E 2C9MA 1EE1A 2F1HA 3O94A 1WSBA 1JYFA 2IEIA 2XYPA 1LVHA 3FBTA 4X1IB 5EHGA 1HC7A 2QN9A 2QTCA 1G9XA 1OPXA 1JSCA 2V9PA 4LNUA 4MUGA 1FXUA 4PYNA 1Z8DA 2O3RA 2ONCA 1R6TA 2REOA 3WIBA 1IAVA 1PJQA 4D8WA 1WXHA 1F3LA 1Q16A 2BF7A 1CRPA 2F90A 5EP4A 5BXQC 3I09A 1X9GA 1KYWA 4CM9D 2RGXA 1UQTA 1ZW1A 2Q4BA 4GIBA 3ZHYA 4B8WA 2Q27A 3CPSA 1G1AA 2V7XA 2IYAA 3L84A 3DH0A 4X71A 4RCVA 3SLKA 4KU4A 2DTEA 3CNQS 2ACVA 4QJBA 4TS9A 3NIBA 1DV2A 3HKCA 2ZYVX 1VZ3A 3QH4A 3WWPA 4DR5B 1MO4A 2YYZA 4FYKA 3U62A 4JR1A 3I92A 1JAHA 4IEEA 4W1SA 1GQQA 1P1FA 4K9PA 4Q0MA 3G02A 5I45A 1QU2A 2BAGA 1YJCA 1NI5A 2W6NA 1K9VF 3PUHA 1N8SA 2OA0A 5CLJA 2DR2A 4KR2A 4K1XA 2HIGA 4JL5A 4G1UC 2HXGA 3NASA 3FRHA 2R1TB 3CV3A 2IYXA 2VSOA 4DUGD 1SD5A 2QKYA 1Z4KA 2EGUA 4Z9YA 4B3SB 3DV0A 3O75A 3RWOA 4KITB 3BCSA 4JYMA 3ZY2A 2BZ1A 2OKCA 2VYND 1J0BA 3BVPA 2OP0A 4UXHA 4KIUA 4ZAZA 3N05A 4YO8A 1GZ7A 1RYNA 4JUIA 4U63A 1NUSA 2R6R1 4CODB 2OC4A 4MROA 4UHKA 3DWIA 4ECAA 2JFHA 3HI6A 3DHEA 2VYFA 5AP9A 4PX2A 3VHRA 2F59A 1CUYA 2N1MA 4JB0A 4KXLA 4TWIA 5DGCA 4PVCA 4DM7A 1IZ9A 3CX8A 2H9IA 3AUTA 1QWSA 4IIUA 3V9AA 2PZEA 2F48A 1RJDA 2Q4EA 2O4CA 2ZS7A 3L8DA 3MERA 4GSYA 2JNWA 3TRJA 5ICEA 3MJCA 5EIHA 1K08A 2Q3MA 3EQ6A 1F0KA 3R5TA 4JVMA 3ET5A 1KI2A 1BWQA 2HIHA 1I4OA 4EG5A 1KA9H 3FOFC 1ZEJA 2CV0A 2VPTA 3AFIA 5REQB 3AUFA 2ZUDA 4TXMA 3L46A 2OBMA 3A04A 3MLAA 3L0YA 5D86A 3RNLA 2GFHA 3HJTA 2JI9A 1NLYA 2VNHA 1ORRA 1GFWA 3FJ1A 3I72A 4V0ME 3UT0A 4F7DA 5IG2A 4I8XA 4JAVC 1G4UR 1G291 1SR8A 4KX5A 4BO6A 5CBKA 4ZQBA 2CXOA 2R00C 1RLOA 3EEIA 3HGQA 5FAKA 4MWSA 4ZC8A 5F52A 1QHSA 1O57A 1HETA 3ROXA 4YP1A 3LQ2A 1M54A 2Z2IA 2ZBDA 3LY5A 3FMPB 1JDNA 4JUCA 4AROA 5KHLB 4NYIR 2ZKIA 1IHPA 4YAKA 1FDSA 1R12A 2JIOA 3K9LA 4TV9A 3K8OE 4W5NA 1CS4C 1RQGA 1VKJA 3KYCA 3W77A 2AOTA 3UWOA 3ZV7A 2H6EA 1LJUA 4GQBA 1SU4A 3BHNA 2QD4A 2YINC 1PD0A 1CY2A 3ESBA 4PWZA 3DLBA 5JNWA 1P4JA 4UQLA 1BOFA 3ZK7A 5BWOA 1LZLA 1VKNA 2BELA 2DHDA 5ALLA 4C87A 3RSHA 1TD1A 3B2NA 2OCPA 2XLCA 2KJQA 5ENVA 2V7QD 2V5AA 3UG6A 2JC3A 4KIFA 2QYHA 5DIFA 2V7BA 1EFDN 5DTJA 1XMQB 4EVRA 3HO1A 1P44A 2BLLA 3CUEF 2FUKA 4TZ0A 3KXIA 3MF4A 4Q7MB 4TYPA 4XUCA 2V5UA 4G8JA 4F92B 1I2ZA 1B0ZA 2XGSA 2CLFB 4ZAYA 3C24A 3ROTA 3UGJA 1BJTA 2R65A 3CNNA 3ZGOA 4EI2A 4UUAA 5CVUA 1FFDA 1FVFA 1IQ0A 1VLVA 2P9FA 2P68A 3QEOA 4GD3Q 3ZGYA 5CB4A 4JLMA 3PFCA 5KMGA 2HBYA 3G2MA 2P1RA 3GLGE 4JH0A 1H2WA 3S8MA 2R1VB 3GJ4A 4XDZA 4FYMA 4F4HA 3UMVA 2AMFA 3A9WA 4R5MA 5JDIC 3JWJA 4I3HA 1II0A 3T1QA 3UM9A 3S99A 3U80A 3VPFA 4WNAB 3TUIC 3KG2A 4XLTA 3P97A 3M3HA 3NAGA 3SQNA 1DINA 5U4QA 1JS1X 3JR3A 3KSDO 1LVGA 2EDAA 2MIIA 2XECA 4CG3A 3I23A 1QH8A 2OHFA 3CUSA 3FG9A 4YQEA 2O8BB 1TM2A 1HV8A 2O2YA 3PVCA 4MR8B 5GJCA 1G20A 4M4SA 1QJ4A 1ZJWA 1EFAA 2ECFA 2OLJA 3P9QA 4Q4HB 1J42A 2HA4A 3AY0A 3HCRA 2E85A 4N3AA 1X94A 1XDZA 3D8HA 3UFXA 3R9XB 2GBFA 5L51A 3I53A 1WKCA 3NOOA 5DKFA 3AFNA 4UOEA 1S01A 3ICEA 1CK4A 2QLJA 3C4QA 4TWZA 4A1OA 4QUGA 1PIWA 3CEJA 2IUTA 2POQX 3GT3A 4H6PA 5EG5A 1YU6A 2JDID 1OW3B 3TJMA 3SBOA 4DMKA 3H9BA 3KV1A 4XASA 4XVHA 1ZRSA 4NECA 1L7DA 4YT5A 1SGWA 1E3TA 3MWKA 4GSKA 1EUCB 2V3VA 5K0TA 2A9OA 1VGRA 2QR2A 3LCJA 3Q8LA 2XTJA 4KRYA 1ULAA 2FDRA 1ZONA 5K0FA 3PE3A 3NO4A 4HZIA 5ALOA 4D4HA 1AXRA 1SVKA 4UFPA 3PQ5A 2ZTSA 5HF6A 4MR7A 3HTXA 4MTCA 2YDXA 1TLLA 3I39X 3ISVA 4REQB 1COWA 3PD7A 4GUAA 3A6GA 1O4VA 3HJGA 3NS7A 1PFYA 2IU6A 1CF9A 2WF7A 4YECA 4AJKA 2PMDA 5JZSA 1IUPA 2ST1A 3UY4A 1LS6A 1ZOOA 5E3HA 1Y8AA 3I2JA 2O8CA 4WZBA 1HDOA 1JWBB 1SXIA 3I2GA 4IDEA 5KNCD 3DGFC 2ZJYA 3FLAA 1L1RA 4YJFB 2OGTA 2R11A 3I6ZA 3WYCA 4F1WA 4ZARA 3V1YA 4ZCRA 3PQCA 4O3MA 2Y68A 3L7AA 2PGXA 3ZGVA 5LR6A 4R8LA 1X13A 3EG9B 3HWX1 2WU4A 1VL0A 3LCCA 4ZYLA 2G1KA 1JG1A 1EUYA 1PYGA 1LX7A 2BEVA 1ZWKA 2Y1GA 1W75A 1SUDA 2B8EA 1SB9A 4MI1A 3BB4A 4IXDA 3QE9Y 1W44A 4MQLA 5J59A 4OHCA 4E5NA 5ICCA 2C9DA 3CRZA 1DBSA 2G3YA 3GJ7A 4RANA 4Y9SA 3CNBA 5KNCA 3RTDA 3O47A 5DTRA 5JFOA 1V47A 1QR2A 4AS3A 2YASA 3SIWA 1G19A 4BATA 3STXA 1DGQA 4UMDA 1MBZA 1CLUA 4AQYB 2NO5A 5L3SB 3G5TA 1ZGJA 3QVGA 3W2IA 4C4XA 1Z4IA 4ND1A 1P7ZA 4ER3A 2V6GA 4QO8A 4M9CA 1PTJA 4A23A 3N2KB 2RHTA 1EXWA 3FX2A 4LYJA 2H2AA 3K4QA 3SIXA 1K66A 2O0LA 3GT4A 3MGKA 1R37A 3FFAA 2FQ1A 5JH7A 2X2PA 1SKBA 3Q10A 2XWBF 3LSTA 2NZ8A 4O4LB 4RVOA 1RHKA 2IPAB 4AO6A 4D0NA 1IATA 3TLYA 4ILEA 2RI0A 2FEWB 4IY1A 3W78A 1WXGA 4JJ6A 1J2YA 3L0BA 4EY7A 1KBQA 5KWVA 1RW4A 3FUVA 1GQFA 2ATCA 2M1ZA 1VIDA 1P4SA 4EO9A 1XN1A 5HKOA 3VVMA 4BQRA 3B12A 3OLWA 1H9BA 4W6ZA 3TW8B 2B69A 3WDSA 2A7XA 2W2KB 2VBCA 3JASA 1ESCA 1CP2A 5CT8A 4EG1A 1HT3A 1D6SA 1W4LA 3TTVA 2HR1A 1RWMA 3PJGA 1SK9A 5K8JB 4G5FA 2I22A 5EPUA 1TQHA 2AF3C 5B64A 1NA5A 2PO5A 2HJGA 2YWDA 1ICEA 2CLKB 4QGHA 2IPXA 2XWSA 4GI3A 4B35A 3IKVA 2C2GA 2CUTA 2E89A 2K2WA 1Q0HA 3UWPA 4DDTA 4IAOA 4AUNA 3IOEA 2V7EA 4DIEA 2C59A 3TZKA 1GU1A 4IILA 2PUVA 3JVIA 3Q9NA 1T1IA 1IN7A 1U3VA 3U31A 2C31A 3C6YA 1KMCA 1JDZA 3AL2A 1JFSA 1IB6A 5L7TA 1XZIA 1KDOA 2BM9A 2PCJA 1GNLA 4TTVA 5IYZB 4IOKA 5JXJA 4MYCA 4GMDA 1S8AA 3PF8A 4DB2A 1XVTA 2HXYA 3FKJA 1NR5A 4MR9B 3TAHA 1O8BA 3U1VA 1SC4A 5JNUA 1K5PA 1PJCA 4XD7D 2NADA 1KIAA 5HEKA 3TQCA 2A0KA 4IM7A 3Q3EA 3CC8A 2A5JA 3MWLA 5GZ1A 1J8VA 1KC1A 1D9XA 2QRUA 2RGBA 3W5BA 2G76A 1SCIA 3Q0TA 2CKMA 1P4GA 2KE5A 3O83A 4H77A 1RTKA 2NVUB 1Z7YA 2C3UA 1X1DA 1I9CA 1SWVA 1HRKA 3GCWA 1RHMA 3T4UA 4ZEMA 5ELMA 1LX6A 1OA0A 3ECCA 4AQ7A 1NW3A 4YUZA 1OV4A 4RV4A 3N8DA 2IXEA 3FD8A 4K6MA 4TPKA 5HILA 4UD2A 4LX0A 3WRVA 5ABPA 2GZDA 3LW8A 4MYTA 5EXXA 1LSJA 1WCIA 3GEBA 2GSWA 5JMPA 3HCBA 4FGLA 1RXSA 5GMOA 5E4FA 3DZIA 3AESB 4UEKA 4X93A 1OZGA 1DUIA 1G5PA 1YB7A 2NG1A 4HMPA 4TTAA 3ZV6A 5HS4A 5HRAA 1IJBA 3T1HB 1N2SA 4IVNA 3ZXIA 3U09A 2VSYA 3Q98A 4BGIA 5K7SA 3A7DA 3QG1A 2ACEA 1I6LA 4RHUA 2IA5A 4IOLA 1GNTA 1QSGA 2Q7XA 4MA0A 3QZUA 3OZGA 3K0KA 1Z18A 1RCTE 1TE2A 3OPYB 4DJ5X 1E60A 2OL4A 5HX7A 1HQYE 1ZNYA 2GKGA 3C6KA 5DK6A 3TF5A 2F55A 2YMPA 1PJRA 4MQUA 1N5DA 2RIRA 4FR0A 1GRNA 3BFJA 4HWGA 1T8YA 1MLDA 1M2GA 3DZDA 4ZOCA 3UMFA 2I7CA 4F9GA 1T1EA 4L8VA 5LXTF 3G49A 1JR6A 3N2LA 3QU9A 2XT9A 2H08A 5JSZA 2Z2KA 2WC1A 1CEEA 1KETA 2UUAB 1FRNA 1E20A 1W46A 2Z1NA 2FVYA 1Y63A 3IUNA 3MXOA 2PRKA 2IXGA 2X5OA 4G07A 4RQAA 3L07A 3Q3GE 4D8YA 2APJA 4M53A 2XCRB 1E92A 1N2BA 1X9IA 1RLJA 3L8YA 5L53A 1SULA 4B4UA 2O2XA 3J81A 1VIVA 4DDMA 4R1NA 2CCJA 2WVHA 5L45A 2Z3WA 1U99A 1XG5A 4LGMA 1Y5LA 3NXSA 3T8YA 1ZI9A 3O4JA 1IEXA 4P4LA 2BHRA 4XWTA 1KXJA 2BGRA 4YUVA 1WMEA 1VLHA 1NZDA 2ZUFA 4DBLE 1WHTB 3DPIA 5C46F 1WBBA 4MJ3A 1Q0SA 3CURA 5DW0A 1RFLA 2PUEA 4FTWA 1BKDR 2AC2A 3HJFA 1NN0A 3IESA 2VQSA 4MJLA 4R2HA 4IVQA 1KHTA 3W9UA 2OZVA 3KLPX 5KAPA 1XTRA 5JECA 5I4KA 3ZQUA 2FFBA 1AQLA 4CUJA 1FP7A 1NV9A 2KS6A 2F2TA 3RYHA 3CZQA 2JLVA 2AMYA 4CQMA 3OIYA 4F85A 3QHPA 1RXYA 2JAOA 2WNHA 4O63O 4OK6A 3X2FA 4CF7A 4CIXA 4LHYA 4KE6A 3IIKA 3THXA 5H80A 2PH3A 1IK6A 4YCBA 3ZPXA 4HX2A 3VR3A 4BB6A 1TQ2A 3LHIA 4ZN6A 4UBOA 1EJ0A 4KE7A 2FRXA 1U2SA 2BMDA 4LZAA 1ADJA 1LBHA 1PJLA 3PR3A 5JS6A 3MTBA 2PWZA 5EXSA 5EAIA 3D81A 4GZMA 4JBIA 5FKJA 3K71B 2PZMA 2I1LA 2A59A 2XDAA 2WK1A 3MJSA 4RIHA 4D45A 3BTUA 2E4ZA 2PPVA 3H87A 4H3SA 3RRJA 4ALIA 4AZWA 4UUBA 2DQ4A 2FOIA 1RZ3A 2AFIA 2LVBA 3HFRA 3ES9A 1NF8A 3NLLA 2DPHA 1YB4A 2V7UA 4GX0A 4B7XA 3AJAA 2FWJA 3CVWA 1C0KA 3E9NA 3E35A 3IDAA 4FMDB 3ONNA 1ZNXA 3WMFA 2DLDA 3T3EA 1A9QA 4BFWA 4QYMA 3AI7A 1I2BA 1MIOA 3HN6A 4MKFA 2HNBA 3A31A 1XL1A 4OY3A 3WGVA 3AJRA 4OAQA 2ZWOA 4H7HA 3ZTYA 4BO1A 3SE7A 1QAQA 1YS1X 2EL7A 2GBCA 1I2DA 3ZLUA 3WA7A 4GPAA 4TT3D 3KPVA 1JKJB 2QTHA 3ZOZA 1XAGA 1G38A 5T8KA 5K3CA 2WUFA 1CJTC 1MTOA 2ODWA 4YEDA 5BNTA 2CFRA 3TBHA 3ZNOA 1NAIA 4F84A 5BV2P 5CBPA 1QQAA 1GA4A 3KWJA 2ZI6A 4K1LA 2P90A 1Z73A 5SYMA 4LECA 2ZIXA 4IVPA 3OVMA 4PZEA 4BV9A 4HT3B 4MW4A 4LGYA 3D6FA 4XAQA 3QA3E 1KORA 5L40A 4IPTA 2EZ8A 3KTAA 2VJMB 3KEFA 4EFMA 2CNWD 4W63A 4LCEA 3O21A 4FOTA 1XZEA 2QPTA 3RC8A 3OCJA 5HJ2A 3FM9A 3L7BA 2RFLA 2PBFA 1ADCA 1N6KA 2PBZA 1HL3A 1AUVA 3PIIA 4QQFA 2H4HA 1UJ5A 2QTZA 3O82A 4ZODA 3VJRA 2G88A 2PWPA 1VQ1A 3RS4A 3H19A 1Z5PA 2X23A 2JAPA 4UJ5A 2GPYA 5C8YB 4DV2B 1E5TA 2GZMA 4BNDA 1BH2A 1X0XA 2FW0A 1KSFX 4NPHA 3OURA 1XYYA 2ZRQA 3QFTA 4JBHA 1GSOA 2FGKA 3OHSX 4JJFA 2ZTHA 1GFZA 3LPDA 4HLQB 3E3AA 4X3CA 2GPWA 4J0KA 4Q3EA 2XNHA 4LHZA 2MSCB 1RC0A 5EPOA 2G80A 3E3OA 1TZJA 4K9MA 5J4LA 4LXQA 1XYGA 2EZUA 1BGWA 2VHVA 3LO5A 2SNIE 3L43A 2BKEA 3EVAA 5HIKA 3UBTA 5CJ2A 2NUAA 3RC2A 4E5VA 4ER0A 1PBNA 5K6RA 2N9UA 4II3A 4Q5IA 1YA6A 1HY3A 3VR4A 3E5MA 3EG9A 4UBKA 1X14A 3HE3A 2CZGA 5JAPA 3C85A 3DBVO 3G2NA 4LTMA 1YE5A 4WDQA 4GM1A 1US8A 1SD1A 2D2IA 1W36B 2DUJA 4RZHA 2FP3A 2OG1A 1BDMA 3WSVA 3G5UA 3W6UA 3KP1A 4U2GA 2SBTA 1IQUA 2V9ZA 3KR0A 3QM1A 4ZO7A 2H2DA 3M5WA 3KTFA 1FLVA 3IGFA 1WXDA 3ZJ4A 3MIIA 5HDQA 2CVQA 1AG9A 3WB0A 4IGFA 5GJWC 4CCAA 1WETA 3ZE6A 2PGJA 1DAMA 2P9JA 2YQ5A 4TKVA 1ND5A 2RHOA 4NYMQ 4TXLA 3VISA 4KLNA 4GI2A 3EY4A 2C1XA 1F2UA 5D5QA 5IDXA 4G63A 5THXA 2H0QA 3KZKA 1U0LA 3M6VA 1AA9A 3O2NA 4FS8A 1T0PA 4O29A 3S7TA 2K7ZA 3GJ8A 5A1TA 3DLHA 1Z4QA 1VE7A 4CLEA 2IYVA 3G5MA 4DDUA 4BUJA 3C8ZA 3C15C 5IZCA 4XRGA 1K7YA 3ASUA 5ALYA 5CB0A 1E9RA 4I4NA 3TLAA 4Y2TA 2IYSA 1DV1A 2QJWA 3D31A 5FOSA 5LKAA 4ZI3A 2GMWA 4QLBA 2BGTA 3RQSA 4F3YA 5L6LB 1OJ7A 4CG0A 1GZ6A 2JCXA 4FK8A 4DXAA 3ELWA 3TL3A 3S0JA 3ZBPA 3U7QB 4G97A 2IY8A 4DLBA 2XRFA 2QT1A 3AEKB 3BA6A 4K03A 1XAIA 1NX9A 1FSSA 3N75A 4KBFA 3G88A 5TPWB 1V3VA 1E3WA 3NBMA 3H9JA 1GPH1 2PA3A 2A3RA 4OHBA 3GDHA 2NW6A 3Q88A 1ML4A 3GDWA 4TQ9A 5AI9A 2ZJBA 4ZPXA 3CY6A 3O9MA 2P2SA 3FWNA 5ALUA 4U2KA 5FL7A 3ZDDA 3BGIA 1VCNA 4HXEB 4LHVA 3ZLTA 4FLFA 4G3XA 1UK6A 3U61B 3QF4A 4WXMA 4MHOA 3OPMA 4L1KA 4X91A 3WK5A 1YJBA 4AURA 4RD4A 1YDWA 3BD7A 1AC5A 4ARUA 1EIZA 1CRWG 2KBFA 2FPGA 2Z1DA 4GMGA 5EZYF 4C4TA 3GDFA 1IY2A 1CIPA 4OQDA 1GPNA 2AFVA 3F1LA 4CNQA 2ZRGA 4U7PB 4A8TA 1WR8A 4GS5A 3NM6B 1SHKA 2WHEA 4BZQA 3DBLA 5GADl 3GMSA 1C50A 2IU3A 3H0KA 2R7NA 2IY7A 4NE9A 2JHPA 3QITA 4YCJA 5DCYA 1U8TA 2VKQA 2YZGA 3O95A 1WZIA 4E7PA 1SK8A 5A7HA 3ZCTA 2OHHA 1SXGA 3NIFB 4JXZA 2XMPA 3A37A 3E4CA 1YCDA 2I55A 1ONBA 2BDUA 4DV6B 2V9CA 1RMQA 1NY6A 1Y1QA 1THZA 5AXDA 1Y6FA 3DLTA 4AUKA 3FW1A 1OC2A 1P7PA 3WXMA 4F2GA 4RUKA 2HZ7A 3P0EA 1N2EA 3B1ZA 1E0KA 1YZQA 1NBIA 3DTNA 3HVRA 2G9QA 1Z88A 1DADA 2OILA 4ISBA 4E6PA 3GY0A 1YR6A 4NEGA 2OCXA 4Y2JA 3VDXA 2FHSA 4G0UA 1IC6A 3BMNA 5FR1A 1DFHA 4JEHA 2H06A 2WYIA 4NZNA 4YP7A 4UAVA 1TT7A 2WYVA 2AJLI 1RSZA 2IOYA 4INZA 3VR5A 4ITRC 4BNWA 1N6HA 4Z4GA 2ZYSA 3C8MA 3CG4A 3QKSA 2B78A 2QAGB 1GPKA 2VTBA 1C30B 1GZHB 1RWBA 2DJIA 3FVVA 3ZNPA 5BW5A 1Z6QA 3BQ9A 4CI9A 4ND4A 3Q6NA 3IBCA 5CX1B 3A2MA 4EO4A 1R6BX 3CS3A 2MYTA 3D7SA 3I58A 2AI1A 4G25A 3QRWA 2FK8A 1KPIA 1SOAA 4M7PA 4RK0A 5BWLA 2RKOA 3ABOB 5BV8A 1XTJA 2JAQA 2ZANA 4XX0B 2RH8A 2XBUA 3UW3A 3SEZA 1NQTA 2XZDA 2O2CA 2VWQA 4O0MA 4WNCA 3JQ9A 5G4KA 1IWOA 2VYQA 1U2RA 4P5EA 4O2BB 4LY0A 4IV0A 3WRYC 4DG8A 3KHKA 4YXWA 3ACDA 1XDBA 1LWNA 4TL9A 2WJYA 5MF6A 3NP7A 2WE7A 1W34A 3AETA 1A5SB 4XEHA 4LISA 3TIIA 3EIFA 4I9UA 1ZITA 4C88A 4DQVA 3DNMA 3GLTA 1D4AA 1DCTA 3Q0IA 3BKWA 4NCNA 3V6MA 1K4KA 5CYFA 1DPFA 2Y9PB 3DKVA 1ST2A 4J90A 3B51X 4QASA 4J4BA 4BP3A 3EK2A 3VM6A 3WRXC 2FPUA 2XWJI 1NW5A 1DPGA 3DSRA 1B3BA 2AEMA 1L8QA 3R9IA 3EQ2A 3LOQA 4L0MA 4MV9A 2PHZA 2ZYDA 3BFKA 3IBYA 3FCAA 4WZBE 4C0QC 2IF2A 1YZNA 2IIQA 4RW0A 3SZLA 2BEKA 5KSOA 3MCAA 1DAKA 3FWZA 1N25A 1JLRA 4P53A 2MR5A 1Z17A 4M1WA 3WE7A 4F86A 2JBWA 1GQ2A 1Q6YA 1UF9A 1FS5A 2WT4A 3RK4A 4IJ5A 4ZMBA 2J41A 5J2TA 2UUBB 3COSA 4RGYA 3S2GA 4UAGA 4BZXA 5A4KA 1TZBA 1EM6A 1S2LA 2CBZA 4BO8A 5IKXA 4PGHA 1FNBA 2DFTA 2OAEA 2P5TB 4HYEA 4LF8B 2DWOA 1Z68A 3PKJA 5DI3B 4OP2A 5T64A 1KOLA 5D8DA 2GN6A 2IEGA 4OAOA 3BTSA 1SD2A 2WWWA 3AI1A 1GTG1 1NW6A 3AGPA 1Y1SA 2YHUA 5K8TA 2CFIA 2WFLA 3O73A 2MCFA 4CR6A 5JW6A 1VXOA 4N9WA 3I5YA 3RS9A 5EWLB 3H9CA 1R0LA 1ZMRA 4I5DA 4PG5A 2O8EA 5CA0B 4I5GA 4MS1B 1N7HA 1Y8RB 2BONA 3RG2A 3OT4A 1R4ZA 2QGZA 2CCGA 2VF2A 1H5QA 2GR9A 4KYTA 2R2AA 2B8NA 4URVR 1SBCA 3W90A 4BNVA 3NWOA 3WISA 4GP9A 2YWCA 1P33A 1Z6XA 3CZRA 2OV8A 1U11A 2IVZA 1S6YA 3T7KA 3HGMA 4FEYA 3WYEA 3B6IA 3VYVA 3EVEA 3F6EX 4FVTA 5LB2A 1SIWA 1C3OB 2PRSA 5HWSA 5AW0A 3HZHA 3JQAD 5JXGA 2XH8A 1ZP6A 1L3CA 2ZDQA 3E18A 1CQPA 4JBGA 4NZ9A 4DQKA 2EAUA 1FZTA 2RB5A 3I42A 3HEMA 3Q12A 4UZFA 2IZ0A 2JLQA 4WBXC 4BX3A 1HTTA 3LHSA 4PLCA 1ESNA 4BNGA 5KJEA 1H8EA 1CY7A 1EFCA 1QYCA 4TQGA 2RIPA 4OQZA 4B44A 3ZBQA 1YFJA 1I14A 3LY9A 4KLZA 3L1VA 1BH6A 3L6UA 3S68A 3X0DA 4EGSA 4JBNA 1T2DA 3G17A 3G8CA 3LBIA 3MBKA 3ORQA 3IAS1 4JVLA 3REFA 1SVUA 4Q6WA 1KYVA 1F2TB 4REQA 4YK7A 3JYOA 1R8YA 4DCGA 4GP7A 3V4VB 1OBVA 5K0CA 3HWWA 3SXUA 1NU8A 1PT9A 2EZ9A 5LA6A 5CDSA 2CZCA 2PZAA 3EXAA 5JZBA 4URXR 3ENNA 3KDSE 1E89A 3R3HA 1KZGB 3ROGA 4EW6A 1WDKA 3EXIB 4LF6B 2CJPA 3C8UA 4MGHA 1QIJA 5LXTA 2DWCA 1JSLA 2V98A 2Z5FA 1T1JA 2ATIA 1CJVC 1LJ8A 2H7XA 2NYRA 3HCEA 3QI7A 4QE3A 1WEKA 3FGZA 1KPGA 2R85A 3KQQA 5AKKA 5IVDA 4U3JA 3FKQA 2HWYA 2PWAA 3FWYA 3MFYA 3TW0A 5C51B 5H8WA 1JSZA 1MF7A 4H3HB 1I1HA 1BO6A 3OCUA 2X15A 2RARA 4OUKX 5C4MA 3PX2A 3EJ6A 5M2QA 4UMFA 2J3HA 4WBNF 3OLVA 4CT0A 1U7ZA 4FQ5A 2GN4A 4QYSA 3BWVA 4M83A 5JCZA 4B2PA 4UTXA 5JQWA 4U02A 1UFRA 1GNSA 1TADA 2D13A 5LL6P 1KVSA 1YE8A 2CBGA 2DGDA 2A8YA 2XAUA 3IB3A 4LRQA 2EC5A 2JD2A 3L7IA 2VUUA 4YBZA 3M5PA 5AR1A 4EGCB 3G2PA 5CDGA 1XZFA 1SOWA 4QSMA 3CONA 3G0BA 3NTLA 1K6IA 2PKCA 5JWOA 4BXOB 4YJ3A 4ZI5A 2PBRA 2HHAA 3ZE1B 5KTYA 3B3FA 3ZQ4A 5JNSA 4B3TB 4TZTA 1MP0A 2WTEA 3ND7A 4DDVA 3C3CA 2PQ6A 4LAFA 4ENWA 1EDEA 1M34B 1NYRA 4BB0A 3K9HA 3JAMA 1Y1KE 2HY7A 3LBAA 3GJRA 2BFBB 2G04A 4NC9A 5DWDA 1I80A 2IHBA 4ZDJA 3GLFE 1YL5A 4HTFA 7REQA 3GEHA 4L6CA 2DHEA 2C7GA 3O03A 3I4CA 4RKWA 3UWSA 4LYAA 4A16A 3DE6X 1BVHA 1R2QA 2VJMA 3QKWA 4Y2HA 5FHQA 2G8LA 5ITVA 5T4EA 3OC0A 4F5EA 3TM5A 4Q19A 2NXEA 5TF4A 4E1BA 3KT6A 3WRWA 4B4OA 1QTQA 3EDQA 1RCFA 3EVGA 1ENZA 2E7ZA 3AEZA 3WLTA 5EHXA 3MGAA 1V1MA 1XFAA 4IOJA 4JQSA 4YREA 3EY9A 3D59A 1W2HA 1KSGA 1JMKC 3TFWA 4B84A 2GK7A 4XYLA 1FQOA 2R1ZA 3PL1A 3QJ5A 4IW3B 2J0VA 2QOEA 2NUTB 2F8MA 3UV7A 3CBGA 3ABSB 4G37A 9MHTA 4I4TF 5BMVF 3HP4A 3U3ZA 2O3JA 3MUOA 1KO8A 4RZXA 4NI5A 3W9SA 2BEJA 4KWCA 1P0IA 3I9NA 1IY1A 4J75A 5G3ZA 1DJNA 1FYEA 1IMOA 5CJPA 3R09A 4ZJPA 3PJRA 3RVPA 1AUXA 2PX8A 2O06A 4K9KA 3URKA 2WUVA 1JN0A 1USGA 1R0XA 1ZQ9A 2VSXA 1BFKA 3LP5A 4HX9A 2I33A 2VAWA 3E7PA 3DM9B 1ORVA 2C5LA 4KN6A 1GWNA 3BILA 4TVOA 5LBUA 1Q50A 3WDLA 3PIDA 5T4HA 1VE6A 2QR5A 3JZFA 4RVSA 2J6BA 4RD3A 5I5GA 2NU6A 4DZZA 1QBGA 1AQNA 1VG1A 1Z9BA 3OT5A 2BOVA 2ACWA 3DCNA 5BN3B 2H1WA 4J07A 1SQFA 2ODTX 5JYBA 1SQGA 3OLQA 1PQUA 4XPZA 3BRWD 4QJ4A 2N1BA 3D64A 1C1YA 2X1MA 2QAGC 1JQBA 3BJEA 3G0IA 2DZDA 4PZUA 2I3BA 2I6TA 4ENRA 3LC1O 4IIHA 1X7GA 4CEHB 4CEIA 1LDEA 1YJ8A 2JA2A 4Z1MA 3LA6A 5K6AC 2DWUA 4B3IA 1NMXA 1CZOA 4YI3A 4DIFA 1L7RA 1XTBA 4FGJA 5KTSA 2EJUA 2FMIA 2FRDA 2WM2A 4QUKA 5B6JA 4LHEA 3OEHA 3SD7A 1JPVA 4OGFA 2E0IA 1N8TA 1MC5A 2C1EA 2EKZA 4H08A 3SHWA 4TKLA 3ZOKA 1M72A 4ZV4A 2AQKA 4LI3X 3E2IA 3IHWA 3JQFA 1RC1A 2OXFA 1W93A 4FEGA 4QOJA 1HBJA 5C0OE 4D4MA 5HQ3B 2JARA 1EAMA 4ZDWA 1XTPA 1COWD 3DE0X 3G59A 5A5VA 1E7RA 1MEOA 3D3KA 3D2CA 2A5LA 4I9FA 4PCLA 1OX6A 2HSJA 5B2ZA 2J32A 1FXWF 2WZCA 4JJIA 4Y6SA 2SKEA 3OP1A 2I4MA 2IXAA 1Z06A 3GOQA 1SBZA 4IKPA 4RPLA 3RHFA 4KGDA 5C7IO 3BPSA 1JALA 1NF2A 3MK31 3MJFA 5TF0A 2Z6AA 3OF5A 1NJ8A 2IYFA 3VH2A 3EZFA 5F1YA 4DQXA 6GPBA 5C52B 1Z33A 1Y9DA 4P6VF 4MHTA 1DCFA 1H8HD 2NU8A 1R4AA 4JI7B 1J8QA 3CPEA 2BGNA 1SN7A 3HCDA 4J3FA 2XCLA 4ZXFA 4YRDA 4BDTA 2CEAA 2JJ8A 4AMVA 2C7PA 2WP0A 2G9RA 2IODA 3AU8A 3A58B 4PSDA 4OM8A 4ACBA 4JY7A 2AYXA 3HBAA 1BA2A 1KNXA 3FGOA 4J2OA 4OXKA 4DSOA 3EJWA 4KFRA 5KOIA 4BMVA 1F5SA 1OGYA 4MV1A 4ADSG 1XZCA 3NJRA 5IUKC 1UJNA 5JSYA 1R9GA 4IUCS 5BYJA 3QXHA 2E37A 4YRMA 5CTJA 4X65B 2EFDB 4E70A 3LDFA 2D7DA 2Q1WA 4ZIRA 4K0KB 5KEIA 3KQOA 3U4MA 1MVNA 1YH3A 4ESHA 3IAM1 2W2PA 3WLIA 4F72A 3L4BC 4OLAA 3TXYA 2C4WA 1K8YB 4GOMD 3EAFA 4WK6A 2AKYA 4PR0A 3OSZA 4BP8A 4N47A 4RXMA 1JU4A 1YQDA 3E0XA 3THYA 1AJEA 4FYIA 3SYKA 5DM70 4LZZA 8ADHA 4F6LA 2C2YA 1PJSA 3H5LA 3Q40A 4CLOA 2PBLA 2AMJA 3KCNA 3EGVA 4HFRA 4KVFA 3VOBA 4CKWB 4MZDA 1MX5A 4C05A 1SVMA 2XB8A 1LBQA 1AMOA 3S81A 2GA8A 2LTAA 3FVQA 4YCMA 1TF7A 2PH1A 1J2RA 16PKA 1A72A 1L6RA 3CR8A 4CQMD 2H2HA 2WYOA 3LYHA 3F8WA 3NKVA 3F8SA 4DIKA 3P9YA 1CU1A 1UK8A 3W7VA 2X4LA 1C8LA 1E5XA 4FGZA 4JQOA 4MW5A 5BQ3A 3OBBA 5IUJC 3K96A 2HREA 2ERXA 1LPAB 3P9SA 4BCDA 2O19A 1NXXA 2BZ0A 1B8UA 3EMDA 4IIVA 5DBEX 1OR8A 2JLRA 3V2IA 4IDNA 1KJQA 1KMIY 2X6QA 3T15A 2JATA 4K0RA 2WTAA 3EAGA 4HGZA 3C5HA 3QI2A 5CCXA 3R5HA 3EW9A 1UBLS 4TVKA 4MQEB 3HXQA 1YU9A 2HMTA 2ZXEA 3DL2A 5AHOA 3CG0A 4FDAA 3IDOA 4RZIA 4YRAA 3T7RA 4GXTA 3TNYA 3KTDA 3K35A 4PSUA 3O8LA 1T9KA 3FE2A 1L9KA 3EPPA 1KAMA 2CJWA 3JD0A 4OQMA 5D6OA 5A71A 3GLIA 1V9LA 4IDGA 4LRTB 4YLEA 2IUUA 3V8BA 2FYTA 4IX1A 1E9SA 3F2IA 3QMWA 1DG9A 4BTLA 1CSEE 5IZCC 4BLWA 2ZB2A 1RIIA 2XLBA 2NT3A 7ABPA 4HZUA 3MCVA 2R7MA 3GEPA 1EKXA 3IJ5A 1IYZA 4P2GA 5J40A 4JBYA 1T8SA 4MDEA 3OSUA 4H6WA 1E5VA 3C45A 5DK4A 1J2UA 4HL6A 1EXDA 1Z2AA 5CDHA 1B26A 3KNZA 1X74A 3X1MA 3ZI0A 2VPZA 5KNDH 3C3MA 3GLVA 5JVDF 2GUWA 4G5HA 1ZH0A 2ZB3A 5SY9A 1C1DA 2IQ5A 2P4HX 3MG9A 1ZEMA 3NTQA 4Q01A 4RPCA 5DBOA 3NWJA 4D96A 4DCVA 5EOVA 4A73A 3UV3A 3BRSA 3D3JA 2VUIB 4EFLA 5JPCA 2PV7A 4HB3A 1JI0A 1FUEA 3U3DA 1IONA 1G3UA 5CLHA 5I7AA 1DMSA 2KW5A 2Q1YA 5IDWA 4FSDA 1Z6ZA 2RMKA 4K9RA 5T5QA 1BXKA 2XOEA 2XNDD 2ZIGA 3AW8A 1U7TA 2CXPA 2O07A 5AHWA 1YGYA 1HDCA 5A03A 1C29B 3FGPA 3HUTA 4LJYA 1FYWA 1QCZA 1RCUA 3LQKA 5HGXA 3OM0A 2VTBB 2RBEA 5GPBA 5LLSA 3ILVA 2P2DA 1DBVO 4LYHA 1IXZA 1XTTA 3K7EA 1V11A 4KO4S 4YPOA 3KQSA 1W5AA 4IYRA 1JZSA 1QOZA 4MS3B 1UWCA 2JRLA 3KWFA 1N5IA 1Y3FE 3SQOA 2A9KA 1V5FA 3OCWA 1F2DA 3E82A 3ZVRA 5ADWA 3NGXA 3KQUA 5LSAA 2FXIA 1A9RA 1Y8QA 2Z43A 3WV4A 1FRVA 4D0GA 5JSFA 3AF6A 4JVNA 1QIKA 2I4RA 4WOBA 1OZAA 2H18A 5JZVA 3EVCA 3EE6A 4J0DA 4RFSA 3RUHA 4XYBA 4LXUA 5CHYA 4A92A 5GAJA 2PS1A 2GJKA 5KTTA 1BXGB 3LVQE 4P22A 1KEEA 3JWEA 1XRPA 3MS4A 4E33A 5C1IA 3I6YA 3A4YA 1QHGA 3M2TA 1N2GA 3HY3A 5FNVB 5KKAA 3B9BA 2IOFA 4TL6A 4YRLA 5IBPA 4DMGA 2JAWA 1U0RA 3IKJA 4RSRA 3FSGA 2VC2B 2KLBA 4IEFB 1OAKA 3KS9A 4BJ6A 1E77A 3M1IA 4A03A 2AZTA 1FMJA 1CETA 5LUBA 1Y3DE 1OXKB 1K6XA 1Z5GA 2OFPA 1P17A 4YTEA 3TBFA 3F6SA 4AECA 4OX9Y 1EVJA 3EWAA 3TD6A 1TMKA 2ZZMA 4D9JA 4CIAA 4ARZB 5G0SA 3AEXA 2H85A 1WMAA 2WD8A 3GCZA 3L6OO 1Y33E 1IZYA 4JMPA 1TCAA 1BXRA 1I0LA 2HMYB 1I33A 4V0KA 3FDXA 4OXQA 4U2DA 1ECLA 3NBFA 2AQIA 2FGJA 4MITA 1TJ3A 1FDOA 2VHQA 4NMXB 4B5KA 1K3UB 1RQ7A 2N42A 1VMIA 2DSNA 5KVCA 4DRYA 4Z4IA 3NHUA 5EJMA 3VGPA 2W6ID 4HK4A 1U9IA 3DDHA 4GSLA 2UZAA 2HT6A 1MB2A 3VXKA 4DLZA 1Z6PA 2LIVA 1D2AA 3V8VA 4ND2A 3V4ZA 4Q18A 1SU7A 2D7JA 3M6IA 3QEBZ 2WIGA 1JV2B 1S4MA 1Z28A 1AURA 4UPVA 3KM0A 5CVVA 2LIPA 5FUVA 2NMVA 1OXVA 2PL3A 1QRUA 3RYCB 1U0BB 3OESA 5CFMA 4MP6A 1MB4A 5CIYA 2IHYA 4NE2A 3PXBA 3BFXA 3U4DA 3GLHA 3UW1A 4JI1B 1AHHA 2C78A 1GADO 3V9PA 4HDKA 4IHQA 5HMLA 1E2FA 1EZZA 2VJDA 2XKAA 3CLTD 3DMFA 4BJ1A 4DLRA 4MMZB 5F7JA 1BKYA 1GTZA 3PWTA 4PQGA 4HC4A 2PLWA 5F2OA 3CGWA 3O1JC 3RVNA 4JV5B 1UIMA 2G70A 2JGIA 3A32A 3HR8A 4CKBA 2EATA 4RLFA 3G2KA 2ERCA 1US8B 2XNCA 4RESA 3SBEA 3ESYA 2JG3A 4KJXA 1MJFA 1NPYA 2XT6A 2VHXA 3OQJA 3GDGA 1TZ2A 2ZDGA 3J7TA 3PEYA 1I7QB 1R8JA 4ZWNA 4E30A 5H1YA 3THWB 1VM6A 1N2CA 5BNFA 1C0IA 1D2MA 1VDZA 1LBEA 4R05A 2BEWA 2F3PA 1FVHA 2C7OA 2GUGA 3DE1X 1BHQ1 5CGQB 1HA3A 1UODA 1R8QA 2B37A 1FSZA 2B8WA 2IEYA 1AS0A 1XHLA 3BIJA 3NOQA 4I55F 4EB6A 3DDSA 1FMLA 2DM6A 1FNCA 3A6ZA 3HB4X 3INRA 4Z99A 3W05A 4C6RA 4WA7A 3VDQA 1W73A 5AVTA 2UU9B 2OMEA 3PZBA 3SEAA 2ENUA 4Z8XA 4IDBA 3WWZA 1V8DA 3SIPA 3JRNA 3CRMA 3MW8A 2ZAGA 3LI2A 1V1MB 1D9ZA 1SPXA 3ECSA 3L7KA 1XIVA 4BKPA 3LLMA 1E64A 5DNDA 3USZA 4RH0A 3ZQJA 1NBHA 2FWRA 3CN7A 2FW8A 4BFCA 4ZCTA 3MGCA 2HSGA 2J9GA 2WM9B 6REQA 2G71A 2EX1A 5FOQA 4P2BA 1I7PA 4D4LA 5FTLA 1QNLA 3VRHA 3DZJA 3GU3A 4BRZA 3QENA 1Q14A 1YQTA 2O7VA 5CPBA 1JXOA 4LJRA 3KEMA 4PHCA 1GT91 2AUTA 3UAOA 1A8QA 1I24A 3F49S 4AW9A 4ZQFA 2O5EA 3MA0A 4O1MA 4YACA 5GINE 4A1FA 3EF1A 4ATNA 5EE9A 1XLTC 1YE3A 1TYCA 4A2QA 3QNWA 1A9PA 3OPXA 4F56A 1CJCA 2D8AA 4U6NA 1NBAA 1NQUA 2QJRA 3PGLA 4ZVTA 3W06A 1TKRA 1LQ2A 1QK3A 4BO9A 3GGPA 2AFIB 3NGMA 5KTMA 2AYYA 2PX4A 3A1CA 1EQ2A 1WULS 2CF6A 2OHXA 2ZLBA 5IZ4A 4P08A 4BYMA 1WM1A 3NDRA 3E70C 1I2MA 1RWXA 3QLTA 1J1ZA 3KHUA 4WD3A 3HZOA 5CM2Z 2Z58A 3BCUA 4BRWA 4PPNA 1N7JA 3D7KA 4HD8A 2B6HA 4DANA 1E1RD 2NO7A 1NBMA 1GQYA 4JJGA 4DKJA 4I46A 1IHDA 1UJ6A 3CXRA 2XA1A 4B83A 1GD1O 5M3BA 3DMYA 4GPD1 1TPYA 4A36A 2GBLC 4JLBA 4ZHQA 5IJ9B 2FEMA 3CW2A 4QDXA 5IM5A 1UZLA 1N34B 3MWJA 5HOEA 1LQTA 3O93A 1NVUQ 3DOOA 1M66A 4R16A 5JJCA 3I28A 4NESA 4HAOA 5BUQA 4QG3A 2DH6A 3E27A 1ONNA 3LO8A 3N70A 4N3BA 2FPLA 3UK6A 5AIBA 2FCAA 4MRMA 5KTKA 4DR3B 2X22A 1S8NA 4JXJA 3AZQA 3IMCA 3PCRB 3GOHA 3PXGA 3OJWA 4YV0A 2FZCA 2GO7A 3ICOA 1JH9A 3GZJA 2REQB 2C29D 2PFGA 2QK4A 3A2LA 1IUNA 3FMFA 4PGMA 5ER6A 5A3JA 4IRMA 3OJ0A 1KZ4A 1RQNA 2F67A 2Q4OA 4J9VA 1IK4A 3W9YA 5JBQA 2TRSB 3K32A 5BWCA 2VN8A 3ELUA 1Z2PX 4WKOA 4YRQA 4LXTA 4RULA 3N6VA 1UR5A 2C2MA 1E3EA 3LRTA 1C9EA 2X2EA 5T4BA 5D5HA 3CF2A 1ZW6A 3KKMA 5EQFA 4H1HA 3ACCA 3OKFA 5IJ0A 2EERA 3T4PA 2X0RA 4FB4A 3F9CA 1R4NB 5ICSA 2AG0A 4BPRA 1YZVA 4UATA 3ZTWA 4P81A 4MQ5A 4D74A 1SKYE 5CNKA 1R18A 1YJAA 2GEDA 2NAPA 3TZLA 2WV9A 3UF0A 3WK4A 4A9AA 4BE4A 4MB0A 1EBUA 3RC1A 4BX9A 4CL3A 3QX9A 3JD3A 3DGEC 4F4DA 3Q0EA 1NDUA 2A6PA 3DOHA 2QRNA 3WP1B 1TXGA 3ZI4A 2CLOB 3TTTA 2UV8A 3HL0A 4DBVO 3I4LA 3AR7A 2QXYA 2BKVA 4GLBA 1RI1A 3I04A 1DTWA 7YASA 5IP5A 1S1CA 1G16A 10MHA 5JDIA 5K3FB 4Z7NB 1U2TA 1J9EA 1ONOA 2QTNA 5AKXA 2WHRA 2XB4A 2QD5A 1M33A 2XI4A 3N6RA 1XVVA 4P86A 1ENYA 4Y0NA 4ZCMA 3GZNB 3RUEA 5JC8A 4M37A 3OMXA 4B48A 1JPNA 4MP3A 5E4TA 1U7UA 2XVYA 4F4UA 4BVAA 3H5IA 4I50F 4ND8A 5LYJA 3BWXA 3YASA 5AW5A 3FTCA 1NPTO 5JT1A 4IJ6A 3H5AA 3LC2O 2WABA 1W36C 1ADYA 1FTQA 1V26A 5LMUB 1DXHA 3CZ9A 4RZSA 5HFNA 3G7UA 3L8MA 3ICVA 1NKTA 3IP6A 3PEWA 1W5TA 4DG5A 3D6UA 3DS8A 1CJMA 5JD3A 3UATA 1XCOA 2VH1A 4K6FA 3SZOA 2ZR8A 3VYRB 4B4WA 4D57A 1FXWA 5DGDA 1KS2A 5LUAA 3U16A 2PJUA 4G1FA 2Q2NA 4KXYA 2B5OA 1JHYA 1H1LB 1UEIA 3DZCA 4P92A 2H4ZA 3WMRA 1ZOLA 3H1EA 4OI4A 1U7HA 3RVQA 4BNNA 2QUBA 1GG8A 4IUBS 2GPNA 4PC3A 4WXEA 1RHUA 4D42A 1R5NA 1P1JA 1JFTA 1T8RA 2OVBA 5TT1A 4ER6A 1GV0A 2NYUA 3DMGA 4Z9FA 1XD8A 4KEAA 1ETUA 1AKEA 1Z5OA 3NAQA 1D4OA 3TJRA 3H2IA 3LT4A 4EG3A 3I30X 4WPGA 1ZWLA 3WZMA 1OZFA 3H6KA 2EHJA 3K9WA 3AJEA 1TYAE 5DM0A 1G5IA 1LH0A 4YMWA 5FEMA 4CCYA 4DLKA 1VOTA 3ODGA 3ADDA 1SZCA 5MGNA 3A26A 2RAPA 3ZW8A 1ZMTA 3BXEA 1XXHE 2VDPB 3SHVA 1F9AA 4GYKA 4BFTA 2MU1A 4JA2A 3ITKA 1E3MA 5B3JA 4GOLD 2EP5A 3PTAA 5AMXA 4ZRMA 5GIPE 4WKBA 4F0JA 2Z3VA 5AJWA 3ER9A 1X7WA 1NVXQ 4Q4AB 4GZ3A 1BFUA 1ONSA 1DARA 2YFQA 4PAGA 5WRFA 5A1JA 5AM3A 5IVKA 3AI3A 3JQEA 3VUEA 1P0FA 1WOMA 2FV8A 2O50A 1XA4A 3C3EA 1GN8A 3OFJA 5T3YA 3W7BA 3SYNA 4DNOA 1O1YA 3EPRA 4HVLA 2AJBA 1O9HA 2GEJA 3EQ7A 3GP3A 4P0TA 4O59O 4PEVA 4C6TB 1L3BA 1C3LA 3O8CA 2W00A 3X2EA 4WJLA 3BMQA 4P98A 1YV9A 3GRFA 3LKVA 3QKRA 3SJ7A 1D09A 3E3MA 4YMUA 4K3UA 2P2NA 4DCOA 2WYWA 4EA8A 1LK5A 4JLKA 1L4EA 2J45A 3GEGA 1ZICA 2ZRAA 1UBNA 3L40A 2GNAA 1JR2A 4HPJB 4KQIA 3K9GA 4CKEA 3KEOA 3INGA 3OZCA 4MQFA 4D6PA 1S3SA 3QP9A 1VBFA 1FU8A 1HOTA 3F3MA 1KEWA 4QHYA 1F51E 1NN5A 1WF6A 2GRUA 2OORC 4M6WB 1KYZA 1NSTA 4DM3A 5K99A 4I1VA 5DLYA 3E7WA 2X8JB 1QF7A 4XSGA 2D1YA 1OXSC 3GVXA 3IE2A 2HRQA 2JI8A 3NTUA 2HU8A 3AKEA 2JH9A 2OBLA 3PEVA 3OTIA 4J0HA 3C6BA 3F96A 3OZFA 3SKVA 2H3EA 2Y67A 2HQBA 1NXTA 1Y7PA 1XF1A 2O52A 3I9V6 4RQUA 1PG5A 2VOJA 1LLFA 2R79A 4QRIA 3VZQA 1TIKA 3PHIA 1D4FA 1D7AA 4LSMA 1D6NA 1HT1E 3IODA 5L4NA 2QEQA 2O3UA 1J21A 4LHXA 4MWOA 1QDUA 3UKJA 5HF5A 1KY5A 4G9EA 2Q5FA 4M38A 2QNRA 3O2QB 1BQ3A 4UM7A 2VDWB 2F7SA 3BWBA 4NJEA 5CXSA 5IKEA 2XYVA 1QO7A 4ZFNA 3C7TA 4N6NA 3VFDA 1EYZA 1IZ0A 3W3AD 4M9RA 2AXNA 2TMYA 3CNHA 3ZJTA 1V8ZA 1DIHA 4KYUA 2VTDA 2Y1DA 2CV1A 3KOOA 1YS7A 3CLUD 5JSKA 3CSSA 2IH5A 2G8NA 3MMPA 3ZW7A 3PGXA 5K5EA 3T5AA 1L0BA 4K6OA 3EMBA 3RFVA 4S2UA 3SY8A 2UYHA 2MOKA 4M98A 1ZAYA 4XB1A 3TKLA 4I8IA 4QVKA 1DSSG 5KIAA 3E22A 4I9HA 3BTOA 3FMVA 4R84A 1EX1A 4TYMA 2DUNA 3UJ8A 3RS0A 4DEXA 5SY4A 4DN6A 3ZHXA 1A8IA 3A1EA 2OBXA 3W4IA 4CV1A 1YMQA 4D43A 2QM7A 3ESDA 5FTMA 4UQPA 3BMCA 3MTGA 1QYXA 3QVVA 4B3BA 2IBSA 2BFBA 3VR6D 3RFTA 5AW1A 3ME5A 2DFNA 1H8ED 3A6FA 3KXLA 3LUFA 4DADA 1XJ0A 1KY4A 3SHQA 4CM6A 4X1YA 3EW7A 1PT8A 4RQTA 1Z22A 4OJYA 3MJDA 4YP0A 2JB9A 2WWTA 1LDGA 4I3GA 2ZIAA 3ZU6A 5DT2A 3DYIA 4BLQA 3L4JA 2G6BA 3SHOA 2NO4A 2WVGA 2Z2YA 4EF5A 3SVLA 4RH1A 2IYUA 1L4HA 3T3NA 4DJJA 4MVJA 3QOWA 1QB7A 4BAZA 5F73A 3ZJ5A 3ZWDA 1SRQA 3UQYS 5A9SA 5EXPA 4NBVA 2QVYX 4JQZA 5LZ2A 5IPFA 1WDLA 5JXHA 4HGRA 4MINA 4PINA 4RK6A 3AWIA 1EWTA 4JN6B 4RETA 4QX6A 5EUBA 4EMUA 3AX6A 5HCIA 1U0JA 1VHDA 2DHCA 4KQKA 4O4LA 4QQNA 3OZWA 4MMXB 4NBTA 5C37A 3WDMA 6REQB 3C48A 4JSTA 4RGBA 3LIIA 1JDBB 1HH4A 2B3TA 3NIDB 3QVUA 4JENA 4KN8A 3SLGA 5BW4A 2WJJA 2HA3A 1WEHA 4KW7A 3CLUC 3LYLA 4PZ0A 4RPJA 2DBQA 4JJKA 4PYLA 4TTPA 2I7TA 5JV5A 1OFVA 2Q3JA 4I08A 1FSFA 4JU9A 1E3IA 1ID8A 2JJYA 2Q9BA 4ZYVA 2NU6B 3H9UA 4LA4A 4N0PA 4PNPA 3AF4A 2OZKA 4MV6A 2PO7A 4MV7A 4NQRA 1XV5A 3TB4A 1Q12A 1TTPB 3UK0A 2BCJQ 4MI3A 3WLPA 1VHWA 4GYWA 5KYXB 1YCFA 3UUFA 4FBLA 4R3WA 2ZWPA 4HWTA 4D8UA 3KLMX 3G9XA 3LLUA 4ERXA 3R9KA 2V65A 1Q3HA 4WBNA 1MW9X 1E66A 3QXXA 1U8ZA 2ZP1A 2UZ0A 3IPCA 7REQB 2PKQO 1GRRA 3HCFA 3NC1C 4RMGA 1ZZEA 2O2IA 3QE0A 2WIFA 3FUXA 3FB4A 3LKZA 3HY4A 3QVSA 3MRVA 2OMKA 4AMYA 2DHRA 4F71A 2ZUUA 1JSXA 3F6PA 4URFA 1WQ3A 1NXSA 1V11B 5BR1A 1F0NA 1PJ8A 1IDOA 3HLYA 5SY6A 1C0PA 1RBMA 4WN9B 1WE2A 4TLDA 4PX5A 4ECEA 1HZZA 2FX2A 1SM4A 1GYQA 3PYXA 2C9OA 2H1CA 2YJ3A 1I51A 3OOHA 3IX7A 4BO5A 3AINA 1VBNA 2AN3A 3CEHA 3ED5A 3BDVA 2A86A 4G8BA 3BSSA 4D0LB 2PRZA 4CQNA 5E6SB 2WT9A 1KJYA 2BFOA 2ZVPX 3KC2A 4PHGA 4R5HA 1Y89A 2ONZA 3IERA 1M6VB 2BRUA 2RC6A 4YCAA 3ZVLA 5ALXA 1M6EX 2C07A 3B78A 3WWCA 1FQWA 2VF5X 1WZNA 4HQ0A 4EY5A 2AQHA 3AEUB 3EGEA 1FP4A 4AY5A 3A9RA 3LT5A 1Q44A 1DOHA 1G6OA 3ZX5A 1FW8A 1VIMA 2FW6A 3IP9A 4HTAA 1MRNA 3RU7A 3UIEA 1Z4OA 2QN6A 4PV7A 3UH0A 5IHXA 2DYKA 1ECGA 1P60A 4JSRA 5DEOA 4HXYA 3K1YA 5AI8A 1ESEA 1C9KA 1PR2A 3GCXA 4BO2A 3EUEA 3IIJA 4IMJB 2O3QA 2R6JA 3EG5A 4AO7A 1LW7A 3K9FC 3AESA 1LBIA 2W2VA 1IFXA 3AFMA 3O91A 4QPCA 4N39A 4KKXB 3DO5A 2WYUA 3CT4A 3MCTA 5ICFA 1JDPA 2GX6A 3QFFA 1TIPA 1UMDB 1ZK4A 2OM6A 2X3UA 1BGVA 2RHLA 1EK0A 4QTTB 5KINB 3WA6A 1Y81A 1BRTA 3CTPA 1WXXA 3QBVA 3LUGA 5GVSA 2G0TA 1WLYA 2M6KA 2VHEA 5JYCA 3ROEA 1HDEA 2CUZA 3HM2A 1GAWA 1PR6A 3MOIA 4IHJA 1HT0A 4QBIA 4TT3A 5AICA 4E5YA 1QRTA 1SEVA 2XDYA 2ZSEA 2G9VA 4WFIA 4G4IA 5F5LA 4D44A 3P2JA 3NPMA 4C7BA 4C22A 5DGTA 4HDOB 1OGIA 2X6RA 5FRDA 5FXMA 2O2JA 5HKAA 5KPDA 4V1CA 1CFJA 3TW6A 1N6LA 3CWCA 2JGRA 4RXTA 2H9AA 3QWAA 1KARA 5AFSA 5D5PA 2HK7A 3CUTA 1Y42X 1T6ZA 1SUWA 1JTEA 3WQRA 4E21A 4EABA 1FQKA 1XEXB 4Z3OA 3U4QA 5J2TF 2DECA 2RGUA 2KX7A 4P84A 1PZFA 4M8KA 4MWTA 1GJRA 3MCUA 3D2BA 5CCEA 1WXQA 5C9ZA 5EJ7A 1R5OA 5DSTA 4BGVA 1XVUA 3DUFB 3FWKA 1UBUS 1TM4E 1W59A 1KO1A 2RONA 4JC5A 5LVAA 3KX2A 1MAVA 1D8AA 4LDAA 4A5SA 5BN4A 4IBOA 1N1EA 4U9UA 1QLHA 2ZS8A 3QUSA 4BCBA 2XD4A 4IR7A 2P2YA 4IDFA 4O4JA 4Z86A 5FO1A 3LUHA 1K27A 4GW3A 5AXBA 1CLEA 5EHNA 2BM0A 3ZKWA 1J39A 2QUAA 4DL9A 2VP9A 2VS1A 5IRCD 2XZOA 1A4RA 2PRIA 4MRSA 1B43A 3KYDA 3Q7RA 3AXSA 3QELA 3HEBA 5KC8A 1WS6A 4ZJZA 2IJGX 3NBQA 5CLLA 3H99A 5ALVA 1TA4A 3AVXA 4DGSA 1HYQA 2KMLA 3B1FA 3FMOB 4Q9LA 1MDBA 4E14A 2E5FA 1UPUA 3LCVB 4CL2A 1E8DA 5BPFA 2ZR9A 2GM4A 3NYRA 1MJGM 2BMVA 1LY1A 4R31A 4O6VA 5B53A 5A5FA 1FJXA 2PUHA 2C7RA 3KJHA 4HEHA 5ECGC 1CY8A 2B9EA 4ITVA 3SOPA 4D9HA 5EWJB 4Z0TA 1YAHA 4PBTA 4TZKA 4RKFA 3EYWA 4FCTA 1CQJB 2AOUB 2HAEA 4LDJA 3B60A 2YV3A 3WIDA 3SM9A 4L3VA 1TC2A 2R60A 4YONB 3VJLA 1MU0A 1K4YA 3OEYA 1BXGA 1UWLA 2IXTA 4QG7A 1U5BB 3ZD8A 4DILA 4IGKA 2QTVB 4H0CA 3DXXA 4L50A 3I2YX 1QH0A 3T52A 4QXAA 2VNIA 3ASZA 3BG5A 5DB4A 4YB8A 3ONEA 4DFDA 4ARAA 4FJ2A 4P3OA 4BMDA 1UKZA 3RVJA 1QIIA 1YMUA 1U9JA 2EBHX 4W5QA 2YRXA 4OREX 3NDJA 4P82A 1Y8CA 4F3KA 5JZ9A 1PEKE 1UBTS 3AI2A 5ICGA 3V1KA 1W5FA 4C2TA 3EIXA 4CGYA 1QG2A 4G65A 3K9QO 1SQ5A 2MSLA 3T9DA 3WK6A 2FW1A 2NZ2A 1FE8A 4EVQA 2F1OA 3ZGZA 3MM4A 4Z7QB 1UPAA 3T6KA 3QKRB 4QXMA 2XUGA 3A6KA 1QHNA 3Q7IA 2CSXA 1Z0FA 1V5IA 4YFYA 4XOUA 4JX9A 4LFAB 1DRKA 1XK7A 4E5DA 4HN4B 4FNOA 3RC7A 3FVTA 4E46A 4G0ZA 3MGBA 3KKQA 4B3DA 3RFCA 4V0QA 1F12A 1QM5A 2PV0A 4P3NA 2XVXA 3L4EA 3Q3CA 3LWNA 4UMEA 1YJXA 3EGOA 5CXXA 5AK4A 1EI9A 2P35A 1QFZA 4O4IF 1AQIA 1RM0A 2HA5A 1GPWB 4O1HA 2IVFA 5CDTA 1GTVA 4WLVA 1VCHA 1XNQB 2RK3A 1DELA 2ILVA 4G4GA 2OT3B 4Q7EA 2M6LA 1Y4DE 1BS2A 1GZVA 2BI8A 2BUAA 1HQCA 2IYQA 3NHWA 4CCYB 3GFQA 2ANCA 3G1WA 4C20A 4UCFA 3GFVA 1R5JA 1IN4A 1ZLXA 1FMFA 3ZZ0A 4BE7B 1N5MA 3UAZA 3PE6A 3W5UA 2QX4A 3CA8A 1TM5E 3PVZA 4LDQA 4YLGA 2PG3A 4WCDA 4IFTA 3GJQA 1W87A 3V2GA 1XMOB 3OJLA 1KAOA 1M3SA 2O7SA 3A2NA 4NCXA 4RQBA 1AK9A 1HDIA 3OJOA 2HX1A 2UZ4A 1E2NA 1S5PA 4S24A 1BQEA 1JP7A 5IM4A 3SF8A 3C8HA 3CO0S 1BMDA 4QJ5A 2OBNA 2XUOA 4IF6A 3ZY5A 2FB9A 3P9XA 1NLMA 4LJLA 2J4FA 4Y6OA 4JQYA 2WZQA 4US1R 1VDMA 3R7WA 3VNSA 4OYHA 1WD5A 2H52A 2PZLA 4KGXA 4IXMA 2ZRHA 2ZOSA 4KLRA 1G0NA 4LS3A 4U6QA 2OQVA 4POOA 4YYZA 1TCCA 4YJGB 1MVOA 2FSIA 2JAHA 4PYOA 4X62B 1NBME 2HCBA 4M60A 2VEDA 3CU5A 3DTYA 3TUJC 3COJA 2AIRA 1DI0A 2W37A 5HM6A 1ZC3A 5A4MS 4URHA 2VUHB 4TLEA 3CH6A 1TEVA 4PLTA 4BU0A 3P4UA 4YO7A 3WZ2A 3ZCRA 1VSQA 2B30A 2F3UA 2BFDA 4BTEA 4BX0A 1VBMA 5ALWA 4WL0A 2AN9A 2N47A 5DTEA 2UYYA 3C5WP 2XYGA 2ZJOA 5ECDA 3ZHUA 3U6KA 1FDUA 1R6XA 1Z63A 4DWOA 3UN1A 4L6IA 2XGOA 1IJFA 3MELA 1OLXA 1KFKB 4B43A 4G2TA 5D00A 4A8PA 2A1UA 5TPZA 4ZTUB 2I62A 4OH7A 2QLTA 4PE5B 2ZM5A 2N3ZA 1TFRA 3BERA 4IXWA 3WMGA 4V3BA 3EFBA 2GD1O 3JQRA 4FHFA 1T9DA 4Q02A 4AJEA 4ZYYA 1L5YA 2DERA 3ZY6A 4CM8A 1DKLA 1Y6QA 5ALZA 5LQKA 1UAAA 4HEJA 5B7QA 4FCVA 2OV3A 4I6JA 5T67A 2XB9A 4GC9A 5K8LA 5ED4A 3MWYW 1CPYA 2W48A 4L22A 2CBXA 5EL0A 3RC3A 3TDKA 1GCOA 1JU9A 2AL7A 3HJRA 1GU0A 1ZJZA 4X8HA 5JDCA 5LQUA 2HPHA 3RABA 3LL4A 3ZX4A 3V5NA 4MIKA 3VPSA 1H1LA 4LOJA 4D5GA 4GVXA 2HXSA 3FNEA 3C5EA 4R4JA 1IVSA 4G1VA