4BAZA

Structure of a putative epoxide hydrolase q244e mutant from pseudomonas aeruginosa.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
296
Chain Sequence
TDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWEERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROBABLE EPOXIDE HYDROLASE
publication title Structure of a Putative Epoxide Hydrolase Q244E Mutant from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 113
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bazA00
2XQFA 4W1QA 1A88A 4YX9A 3FCYA 2X8BA 3WKEA 1W1IA 1XRLA 4FLMA 5AOAA 1H2XA 1MX1A 4ZXFA 2HU8A 4RGYA 4LXGA 1ZD2P 4MXDA 1XRRA 2GBGA 1L7AA 3BF8A 4EZIA 2HU5A 5DNUA 5HQ3A 2WLSA 2HDWA 4GEGA 1TIBA 4DYHA 1JJBA 1ZJ5A 1WPRA 2HFKA 4JH0A 3FYUC 4CFSA 3C45A 5C81A 1ISPA 5JAPA 2W6CX 1QIJA 3QPAA 3JWEA 5K3EA 4LIPD 1WCYA 5FDFA 4C4XA 3NOXA 1IUOA 4GDMA 4PSUA 4AZ0A 1GGVA 4UHHA 5HKBA 4OYYA 4YPVA 1HLGA 4GI1A 5AI6A 2WIGA 2DHEA 3PDCA 2XMBA 4P93A 4B9AA 3I2KA 4ZRDA 4B7ZA 4OB7A 2XUJA 1UXOA 3R0VA 1YS1X 4N5HX 1C4XA 3FSGA 2G4LA 5IVHA 4OB8A 4AN0A 4QDOA 1ZGBA 5K3FB 2HA3A 1DTEA 1FFEA 1OCEA 1BEEA 3GUUA 2QR5A 3IULA 4ARAA 4X90A 4BCCA 2DQYA 4UHCA 4F60A 4NVRA 1CUSA 4KE9A 2XQJA 4GWLA 2OLEA 4BAZA 1QFSA 4UBKA 4PNZA 2OCGA 4UFOA 5ESRA 5JATA 1HQDA 5CH3A 2JIDA 1U4NA 4OPMA 1TCCA 3AUKA 1RWQA 5FP0A 4LKOA 4X85A 3HRHA 4UPDA 1BCSA 1R50A 3QMMA 3G0CA 1W4LA 5AP9A 4CCYA 5DLPA 4GHWA 3NGMA 3O4JA 2WIKA 1UK8A 4BE4A 5JZSA 2XUHA 4UBOA 1DX4A 1XZBA 3FVRA 3ILSA 5AOCA 4PQEA 4WY8A 4HRYA 3G0IA 1XFDA 2VJDA 3ZLVA 1AC5A 1PFQA 5JYCA 1K4YA 2QTBA 3U0VA 4X71A 1R9MA 3V1MA 4HS9A 5ALTA 1QIDA 1GPKA 3V9AA 2VATA 3TRDA 3QH4A 3PFBA 5IH7A 1ACJA 3E0XA 4BC0A 4PSCA 3ZWQA 3HZOA 4W9RA 1EVQA 2C0PA 4BDSA 5JD6A 1GPLA 4DMCA 1HDEA 3Q8WA 3G7NA 1JJFA 2AJBA 1IVYA 2OQVA 1YA8A 5ALHA 1ZOIA 3H2GA 5AK4A 5EGNA 5CXUA 3C5WP 5DYWA 5SYNA 1QE3A 5C8VA 4EBBA 1FSSA 4ZV9A 2WJ6A 4BZWA 3BL8A 1LPBB 2GYWA 1CUAA 5DTIA 2ACEA 1H23A 3QM1A 1THGA 3D7RA 1R3DA 2PVSA 1OXMA 3B12A 3C8DA 2RHTA 3F98A 2ZJ6A 2QUBA 2WKWA 4H7IA 3STXA 3WK5A 4RNCA 3EQ7A 2HA0A 2I78A 3I6ZA 5D3ZA 1XZIA 5T4HA 5E4TA 3STTA 2Y2VA 3FLBA 1EB9A 1H2WA 1HKHA 5AM5A 5IVKA 3FLAA 2HFJA 1AUOA 3H1BA 2WHRA 2QXUA 4X93A 1CUCA 1ZD4A 1UOPA 3R3WA 3DQZA 4WFKA 1ODTC 4AMZA 2HA4A 3EBLA 4MYSA 2ECFA 3F96A 1EK2A 3HXKA 4G8BA 2OPHA 2BUBA 4C6HA 4ZI5A 5LIPA 2WUGA 3WL5A 4W63A 1IZ7A 1A8QA 4H7HA 3M81A 5FLKA 1WHTA 5ALVA 4BATA 5JADA 2XUPA 4AX4A 4HXEB 1XLVA 4G5XA 1VLQA 1J2EA 2GZRA 1CUBA 2ZJ7A 4MYDA 2HHAA 5EI5A 4B85A 1Y37A 1TAHA 2I3DA 2AJ8A 4A5SA 4AO8A 2V98A 3STVA 2OGSA 4Q3KA 1ZI6A 4ETWA 3GROA 1A8UA 3U1TA 4J0KA 4J0CA 4XIIA 4BZZA 5LP1A 2PM8A 2OQIA 4RPCA 5CURA 2BGNA 5K5EA 4N5IX 4QDTA 4B9EA 2CB9A 2WJ4A 1WB5A 4L0CA 3VJKA 3FWHA 5IKXA 3G0BA 2RGUA 5LZ5A 4H7FA 5CT4A 2XQGA 1QO9A 1AZWA 5JD5A 4G4IA 1WM1A 3EF3A 1CFJA 1BROA 5H3HA 3FBWA 1CIJA 3DKRA 1DWPA 2V96A 1FFDA 4KAFA 2AJDA 3R3ZA 5KWJA 1IUNA 4OB6A 3H2HA 4XJVA 4JEIA 3LIIA 2E3JA 1CPYA 2ZSHA 3A2MA 2WHQA 2ONCA 1YB6A 1VZ2A 2DR0A 4CIAA 2ZYRA 3R3VA 3I2GA 4X91A 1JMKC 3DKKA 1R1DA 3K6KA 3D2CA 3PUIA 3H0CA 3HYSA 4AQDA 1LNSA 4B82A 2H9YA 1H22A 5ALKA 1CEXA 1AMNA 4RE6A 3ESAA 3C6BA 3C6YA 4LYEA 3A6ZA 3G8YA 2XUQA 5DYYA 1VJ5A 1Q84A 3QITA 1CVLA 5CT9A 1WB6A 4DSZA 1DT5A 1ETHA 2PKYX 5HFAA 3C5VA 3QBJA 1MAAA 1XRQA 3OTQA 1QTRA 1QIMA 4C4ZA 2HU7A 3G9TA 2IIVA 2VA9A 3T4UA 4OD0A 4BVLA 1L7QA 2DHDA 1YR2A 3R40A 1ZIYA 5E2IA 1NU6A 3DYVA 1CV2A 2J3QA 3DCNA 4FHZA 2GYVA 3D0KA 2PSHA 2WM2A 3WJ1A 2C58A 5FPQA 2BUAA 5ALLA 1XZJA 1EH5A 3CN9A 5AM3A 1LPOA 4GBGA 3WI7A 3WWEA 1E89A 5DYTA 4BRZA 5SYMA 4LXIA 3ESCA 4B80A 2PU7A 3I2IA 4GW3A 2XMQA 2X76A 4AO7A 1P0PA 2PSFA 5K3BA 1Q0RA 2PU5A 2WHPA 5FRDA 1YS2X 3FYUA 3W06A 4EUSA 1M33A 4BYMA 5KBYA 3KOOA 2WSLA 4BP9A 3AZQA 3JW8A 3ANTA 4UHEA 3CCCA 1JJIA 5AKXA 2EEPA 2VF2A 1CUJA 4KE8A 5CW2A 4QEKA 5I9IA 1LLFA 5AKZA 3QYJA 5C8XA 3TEJA 4EY7A 4HTAA 1EX9A 1E8NA 5ALNA 5HK9A 5JIBA 4X6XA 5HF6A 2C4HA 2EDAA 1B6GA 3F97A 3FNBA 1X2EA 2QMQA 2OCIA 1YCDA 1P0MA 3O4HA 3O9VA 5K3AA 3ZLTA 5AI9A 5HQ3B 3PI6A 4J3JA 2WJ3A 3EQ8A 2H7CA 3S2ZA 1LGYA 1THTA 3IUJA 4PSDA 3RM3A 1MJ5A 5IVDA 1EDDA 4MEAA 1G5FA 3H2IA 5D3KA 1LZLA 3WK4A 5JANA 2I03A 3D3NA 3AZOA 2Z3WA 2XMRA 3DOIA 2VT7A 3D4LA 3R41A 3W2TA 2O7RA 1LPPA 2PUHA 5AKEA 5A7GA 5J3JA 1UOOA 1SCKA 3WKDA 2D0DA 4QDXA 3W05A 4DNOA 4EHBA 3K9BA 1N8SA 1AQLA 2G5TA 1GQSA 3FCXA 3ICVA 1BN6A 2XT0A 4Y2VA 2QM0A 5KREA 5JZ9A 1ZGCA 4KAJA 5ALDA 1G66A 2QS9A 3AIOA 4WDQA 1W76A 5AI8A 4DMFA 1J1IA 4N8DA 4HVTA 5HF9A 1GQRA 2ZYHA 4G9EA 3LCRA 1HPLA 2EDCA 3MVEA 4FLEA 1CRLA 2J4CA 4CI9A 4X00A 3H04A 3OM8A 3R3YA 5A7FA 4X6YA 1IUPA 2BFNA 2B20A 2OGTA 1EDEA 1KEZA 3OG9A 3WKBA 2CJPA 1XZEA 3FOBA 4C87A 5AHXA 5HKAA 4Y2SA 3H2JA 4Y2UA 2JGJA 2WG2A 2XUIA 3BJMA 2OCLA 2VEOA 1XZFA 1XZMA 3QMVA 4B81A 1CUGA 1MO2A 2WIDA 3HJUA 3JYHA 5ALYA 4AMYA 4BDTA 1XZDA 4CCYB 2C5FA 1MX5A 5ALMA 2C0QA 2JGMA 3C70A 1J06A 1CR6A 1MPXA 1Q0ZA 5LKRA 1EK1A 4UUQA 2OGZA 5JAHA 5F4ZA 3D2AA 2JEZA 3FSGD 5ALUA 1GPNA 3GZJA 1DQYA 4FKBA 4CG1A 3IDAA 5AKYA 2WUDA 4BBZA 4F0JA 1PJAA 1YA4A 1BU8A 3N0TA 3ESBA 3BDIA 3G0DA 4YK7A 3SC2A 1LBSA 2FJPA 3SK0A 4EB0A 5YASA 4OU5A 1EI9A 3O4IA 5CH8A 3BWXA 2HL6A 4H7JA 1GKKA 5LKAA 1QGED 2CBGA 4TPKA 5AM1A 1P0QA 3R3XA 1KU6A 1JT2A 2VSQA 5EHQA 2YXPX 2XMDA 5A2GA 2WFZA 3H17A 3OURA 3NWOA 1DQZA 4MJ3A 5CRIA 2JEYA 5AI4A 1BCRA 4NZZA 4BAUA 3WZLA 3H1AA 4X92A 4XX1A 3G9ZA 1TCBA 1ZIXA 1EDBA 4ZV7A 2OG1A 4DNFA 2Z3ZA 4IQ4A 1F0PA 3C6XA 1QIKA 1SC9A 1MNAA 5LYYA 4OU4A 1BN7A 4DGQA 1WHSA 2V9ZA 2X5XA 2VQ6A 3SX4A 3KDAA 5AI0A 4BTVA 2LIPA 5BV7A 3NUZA 1RP1A 2B61A 2CEKA 5KWIA 1UK6A 5DTJA 4E15A 4WCVA 1N5MA 1WOMA 1N5RA 4KACA 3DD5A 1DX6A 3VVMA 4FBMA 4FDMA 2XUGA 2XUKA 4KRXA 3I2HA 4FBLA 2WILA 5LZ7A 1X70A 1UT6A 5ALRA 2V97A 2VTVA 5AI5A 4QDUA 4DSAA 1MNQA 1BEZA 4KYVA 1VOTA 4PV7A 2XUAA 4KE7A 3W9BA 4FFVA 3LLCA 4J7AA 3ZI7A 3L1JA 2OAGA 1LZKA 2O2HA 4KAAA 2RAUA 3IURA 5K3DA 3YASA 2FJ0A 2YH2A 1P0IA 1GKLA 5AIAA 1XQYA 1J07A 2PL5A 1S8OA 3WK9A 5HF5A 5BOVA 4A23A 1CUDA 3BIXA 3WWDA 1MN6A 3QVMA 3C43A 1DU4A 3RKSA 1UFOA 2H7XA 5AKGA 4AB1A 2RIPA 4IH4A 3HSSA 3PFCA 1R9NA 4QWWA 5AOBA 1SCIA 5C7YA 1JFRA 4UHFA 5EIAA 3O4GA 4L9AA 2R11A 3STYA 2Y2UA 3DLTA 3ESDA 3QPCA 4AXBA 3BF7A 4B6GA 3WLAA 1VKHA 2QRUA 5C8ZA 3FAKA 4AZ3A 5D6OA 3W9UA 1QIFA 1E66A 3DNMA 3KXPA 5T4BA 1ACLA 4LYDA 2WQZA 2WUFA 5LZ9A 1UWCA 3I6YA 4MQLA 1JI3A 4HZGA 1MT3A 3WK7A 5K3CA 2B9VA 2AJCA 5EIEA 4WFIA 3CXUA 1VA4A 3PICA 4J0GA 2O2IA 3IA2A 4U2DA 4IH9A 4K2AA 2JGEA 4QWMA 2FUKA 3DS8A 3B3QA 3BE8A 2J4FA 1CUEA 1EINA 3WK8A 3IUQA 3VJMA 4I3FA 2ZSIA 3GELA 2XMCA 4EY6A 1T2NA 1K8QA 2JGKA 3I2JA 4RE5A 3PF8A 4UHBA 1R88A 2HRRA 1LPSA 3UUEA 5FV4A 1CUIA 1QO7A 5EFZA 4I4CA 4H7KA 2WFLA 3WL6A 2BUCA 1ZICA 4MEBA 3RLIA 1K5PA 2K2QB 3QMWA 5HFNA 1I6WA 4UBNA 4WFJA 3CN7A 5ALFA 2QZPA 1C7JA 2XDWA 1E5TA 4X95A 1BS9A 4BC1A 4QLOA 2XUFA 3AILA 2QVBA 2XUOA 3EQ9A 3MUNA 5JZBA 3DL7A 4G8CA 5DNWA 2VT6A 2WG1A 2IITA 1JU4A 4YASA 4UHDA 1U8EA 5T4EA 2ZJFA 5CTAA 5JAOA 2H1IA 1KU0A 4ZGBA 3PE6A 2HA5A 4GLBA 2OXEA 1WB4A 4EY5A 3BJRA 1K63A 4X7BA 3WQHA 5JASA 3PUHA 3GBSA 2Z8XA 2HA6A 4EA6A 2C5GA 2OAEA 2WHPB 2YASA 4QDZA 1G42A 1TRHA 4Q1VA 4B0OA 1TKRA 2VJBA 3FYUB 2GBIA 2PPLA 4PO3X 4TGLA 1QONA 4HXFB 3Q0TA 5ALQA 3B5EA 4Y2PA 4C88A 1EVEA 4M0FA 1LPNA 1ODSA 2QKYA 1F8UA 5ALWA 4H35A 4JUIA 5FKJA 3IIIA 4XWGA 2HA7A 3M82A 4J0JA 7YASA 2H7YA 1VXRA 4ARBA 1DWQA 3GFFA 3P2MA 2WTNA 4G1FA 3L1IA 1DWOA 5ISMA 3WMRA 1F0NA 1W6RA 2WUEA 3QZUA 3WKCA 2XUDA 1CUHA 4FNMA 3VKFA 5CT5A 1IZ8A 4FOLA 4DNPA 3HLKA 3K2IA 5JAUA 4PW0A 4N8EA 2ORYA 3IVMA 1PV1A 2BJHA 2XE4A 3E3AA 2RHWA 1GXSA 1Z68A 3TGLA 5FXMA 5CXXA 3STWA 4BE9A 5D7BA 3MGAA 1MX9A 4PF1A 4E11A 2PSDA 1MTZA 2ACKA 2ZVDA 4B0PA 1ZJ4A 4UFNA 1CUFA 4V2IA 5EHZA 1YAHA 3M83A 4C01A 3STUA 1XZGA 3BXPA 4DNQA 5LZ8A 2HM7A 5FOQA 2BGRA 1QIIA 1BE0A 3BDVA 4Q3LA 2HRQA 5ALZA 1XZHA 4CG3A 2G5PA 2PBLA 4H18A 2YYSA 3AIKA 4Q82A 3BIWA 1YAJA 4DIUA 4OCZA 3FLEA 4DTCA 2GZSA 4X97A 1CUYA 2HIHA 4Y2RA 4BTLA 4B84A 2BKLA 5DWDA 1XLUA 4BAGA 1XQXA 2Z5GA 2PX6A 5AICA 1Y7IA 2ZYIA 2J3DA 3AZPA 1XRPA 1C7IA 3LIPA 4I19A 5ALSA 4H7DA 3L1HA 5AKIA 2DQZA 3WIBA 1R4ZA 5AKJA 4KJXA 2JGIA 2Q0XA 5JARA 1ORVA 1QOZA 4QZVA 3LS2A 4MQMA 4FTWA 3O95A 5AK3A 4Q05A 2PSEA 1VE7A 2DFPA 4Y2QA 1XQWA 2JGLA 4WY5A 5CMLA 4TVKA 2CMFA 2XLCA 2I3ZA 1EA5A 3V1LA 4CCWA 1WPXA 4G9GA 5K3FA 3R3UA 1EHYA 4MWTA 3D5EA 5AM2A 1UK9A 4MWSA 5ALIA 1NX9A 4GECA 1IMJA 1MU0A 4Q34A 4BVJA 2XQKA 5A62A 3HACA 5IVIA 3V48A 5DJ5A 5EIHA 2RONA 3WYDA 3UMJA 4BCBA 1CUWA 3C8HA 3CCBA 3GA7A 3RK4A 2DSNA 1DT3A 4KRYA 5E4JA 2OCKA 3WK6A 3DEAA 4ITVA 1QZ3A 1SOMA 3EIOA 5JD4A 4DLNA 5AK6A 1Y7HA 5CH5A 2DHCA 3OC0A 4UBIA 1VZ3A 3WKAA 1O6FA 3H2KA 3KSRA 4S0XA 1AURA 4ZWNA 5HF8A 3VJLA 1UKBA 1TK3A 3C6ZA 4G4JA 4M0EA 3G02A 2WTMA 4FMPA 1T4MA 4UBLA 5BWCA 1CUUA 3PF9A 4U2FA 4HXGA 4Y9SA 1XZCA 2W22A 4EY8A 5AKKA 2QT9A 1B41A 1QIGA 3A70A 3HABA 2HA2A 1LBTA 4OSEA 3WJ2A 4K6GA 5EHXA 1F6WA 2AXEA 4QNNA 2B4KA 4H77A 3ANSA 4BRSA 5AKLA 4FNGA 4JYPA 4Q3OA 3H18A 1U65A 1XZKA 2JBWA 4J0HA 2JGFA 1EXWA 3D2BA 3DL4A 4U2BA 1ZD3A 3F9CA 1CUVA 3RARA 4B83A 1JMYA 1ZI8A 2GBCA 2PSJA 2XLBA 2XQIA 4KE6A 4W1SA 3WA6A 2XB6A 2NW6A 3AJAA 1Q83A 1UKCA 4U2EA 4O08A 1VXOA 1YB7A 1LPMA 3ZLUA 1HBJA 2Z8ZA 1VE6A 2ES4A 4WJLA 3WA7A 1K6EA 4IHAA 3UUFA 1H2YA 2VAVA 4IO0A 1E8DA 5AJHA 3G9XA 1E3QA 3AIMA 4H7EA 1HL7A 2Y1KA 3I28A 1X2BA 4INZA 5FPPA 4X94A 4LHEA 1O6GA 3F67A 1BRTA 1FJ2A 3MUOA 4IH1A 4CIBA 4L3WA 5ALXA 1QFMA 4DM7A 4XVCA 3F8SA 5LLSA 1GZ7A 5AKHA 2G63A 2WIJA 4OYLA 2ROQA 2GBFA 4P9NA 2GYUA 5AM4A 3AFIA 3X3HA 4GXNA 4DMKA 4H0CA 2BAGA 3FYTA 5ALJA 3SWWA 1E8MA 1JKMA 3VISA 4Y2YA 4J0IA 1OILA 3A2NA 3OOSA 1AX9A 5HZGA 4Y7DA 4N8SA 1XKTA 1CQWA 3KD2A 4AN1A 5HK8A 3WIOA 3WYNA 1TQHA 1YASA 4Z49A 3HC7A 4QA9A 5LZ2A 1UK7A 1W75A 2CUTA 3WWOA 3IB3A 3TJMA 1ORWA 3H19A 3HI4A 3WZMA 3S8YA 6YASA 3LP5A 4E46A 4G8DA 2XI4A 3W04A 4BP8A 1H2ZA 1QTIA 4WDRA 4L72A 5CT6A 4W1PA 3KWJA 4W1RA 2D5LA 4FWBA 2WU3A 2FX5A 4U2CA 1FFAA 1DINA 3I2FA 1XKLA 2WG0A 3C87A 2WFMA 5LZ4A 2AJLI 4Y2JA 1QIEA 1CLEA 5CT8A 3I1IA 4JNCA 1YSCA 2HADA 4X3CA 1JU3A 4QLAA 3G9UA 3AINA 3I1YA 4G4GA 1ZD5A 3O0DA 4C89A 1EB8A 2WIFA 3E4DA 1XRMA 1TCAA 4OUKX 1G4HA 2Y6VA 1XRNA 1VA5A 2VJCA 2WFLB 1SCQA 3G0GA 4Y2TA 1GT6A 3IBTA 3T52A 1XZLA 4ZREA 1USWA 3VXKA 4CG2A 3OPMA 4M0MA 3M3DA 2O7VA 2CZQA 5ALPA 1ZI9A 4BCDA 5AO9A 5ALOA 4UBMA 2WU4A 1UOQA 3VVLA 1FFBA 5ALEA 3WWCA 4K6KA 1A8SA 3E1GA 4JYMA 5DNVA 4BVKA 2XMGA 2R8BA 1UZAA 4ROTA 4P08A 4P92A 3DJYA 3DOHA 5HCUA 2CKMA 1QIHA 4AO6A 4NMWA 4HRXA 3IUNA 5FUMA 1CUXA 3V1NA 4K6HA 1SFRA 4UBJA 1UKAA 4D9JA 5BWBA 2QXTA 1CQZA 2P8SA 4F21A 3I6MA 1NU8A 1W52X 1QLWA 3ED1A 4KR0A 1QJ4A 2XMSA 2XMZA 5EHNA 4K5QA 2QUAA 3ZV7A 2QOEA 2RI6A 5AH0A 3FVTA 5JALA 2VAXA 4FLFA 4UFPA 2DCMA 5T4FA 4X6UA 2IX9A 3D59A 2Y6UA 4KEAA 3WL8A 1AGYA 4F5ZA 3QPDA 4HAIA 1D07A 4C4YA 2JF0A 4J0DA 5AIBA 3DDUA 5E4YA 4E14A 2PUJA 5A7HA 2QJRA 1XLWA 5ALGA 1U2EA 3WL7A 1CUZA 3DYIA 4QE3A 5I8PA 1FFCA 5I7UA 1RYYA 5A71A 2UZ0A 5CBKA 2BCEA 2C7BA 3V1KA 1A7UA 4A16A 1AKNA 3IUMA 5A6VA 1XZAA 1LPAB 5AK5A 4BB0A 2O2GA 5AM0A 3WWPA 4DMHA 2ZYSA 1N1MA 3HEAA 4J03A 4NS4A 4LXHA 3A2LA 4Y2XA 2QJWA 1XQVA 4FFWA 4EY4A 1MAHA 3ICWA 1ODCA 1L7RA 1XROA 2VJAA 3ZPXA 3VDXA 3N2ZB 4U2GA 3KWFA 3O9MA
chains in the Genus database with same CATH superfamily
1WIWA 2X0IA 2XQFA 4LHVA 4W9NC 1VHLA 2CW5A 1A88A 4W1QA 5DOZA 3TSYA 2CXPA 1EA7A 1S7CA 1SBQA 3FCYA 5TJHA 3RREA 4YAUA 2VDKB 4TRMA 5G53C 5KVAA 2ZVQX 1W1IA 1XRLA 2DFNA 3EWAA 3V5NA 1PK9A 2G08A 3AFGA 3LKVA 4TYMA 5AOAA 2YWGA 1H2XA 1A76A 1H8ED 3OSUA 1IXZA 2VDWA 4BNFA 3PDUA 4DG5A 4C0SA 4CQLA 1E1KA 1P3JA 2RSLA 1HFJA 4LXGA 4MMXB 1VE9A 1MCZA 3NLLA 4AICA 1A50B 1M34B 1T9DA 1XRRA 2GBGA 2PGOA 4MXDA 2PMFA 4OUDB 4XD7A 1P7YA 1XEWX 4EZIA 1LEHA 2HMAA 2PZLA 1N7HA 5CNMA 1XF9A 5GV7A 3RYFA 1D3AA 2VHZA 4NYJR 4Q66C 1GTSA 2HDWA 2YINC 1ISJA 5BN4B 2BFBA 4GEGA 1SULA 1UBUS 2GK7A 1EVZA 1UH5A 2VYFA 3GN1A 3KZMA 4DYHA 1BJTA 4MV4A 5HFJA 3IL2A 3HB5X 1T5HX 2XWJI 4QG3A 4IYRA 1ZJ5A 1WPRA 4R16A 4IQFA 4CIWA 5KS2A 5HG0A 2FG6C 2R1TA 4E13A 1F17A 3VO1A 1U1GA 1CRWG 1BX3A 4XSVA 3EPJA 4U0KA 2IP4A 1KPHA 4LWPA 4F3TA 2HXYA 1ZM7A 3WX0A 3E2MA 4AUEA 5GIOE 5JAPA 4M1EA 1IM8A 1NLMA 3BMCA 1FMJA 2W6CX 4QKQA 2DHRA 2XITA 4MGZR 2VOEA 4E09A 4RFSB 3QPAA 1ZBDA 3HUTA 3JWEA 2OCYC 3KV3O 1JTFA 4C2AA 3R9XA 2A92A 5FDFA 1DC6A 3IKVA 1BE6A 1A98A 4CEHA 4RTLA 1M8GA 2J5KA 4GOND 4QO8A 1UDCA 3F6SA 1E1RD 4UDYX 5E9WA 2IQ5A 5IS2A 3Q3EA 4JYCA 4RFSA 4XUDA 2GN8A 1IUOA 3QUBA 2RGDA 3OE7A 3SZRA 4PSUA 3DDZX 3WHLA 4WBXC 3PWSA 1MH1A 2ZRIA 3L7DA 1KEUA 2C9BA 1NW5A 5FWAA 2GZMA 1W4ZA 3GK3A 4X8OA 1R0RE 1J1ZA 1VTKA 2C20A 3SR4A 5LCXA 2DHEA 2CLSA 2WFAA 3Q6MA 4MAAA 4ZC8A 5CFZA 3UAYA 3CVWA 1V48A 2QRNA 4UE2A 2C7VA 2JGRA 3R5KA 4P93A 5JAMA 1S6YA 3A9SA 4JSRA 3ZE7A 1P3Y1 3BIFA 4JMLA 5E8JA 4ZRDA 1J0DA 5JFGA 2QROA 1YFZA 2XUJA 4F92B 4OHMA 1B8UA 4ETIA 6PFKA 3NEAA 2O8FB 3K31A 3FUWA 3KXLA 2J45A 4HDSB 4J0QA 4EGCB 1QGAA 5CDSA 2E6KA 5KC9A 4N5HX 1C4XA 1LDEA 5J5VA 2G4LA 5IVHA 2C3MA 2FPMA 4AN0A 1L7NA 4QDOA 3CNOA 2Z5VA 2W6ID 1FDIA 3HY6A 1Z2CA 1DTEA 1RIFA 1K6XA 1YR1A 1ABFA 1Q19A 2ZQYA 3GUUA 3I9V1 3G5AA 2I6FA 1QCDA 2CL0X 2QR5A 3IDFA 3IP3A 4RV4A 3VZQA 3ZWVA 3EJ6A 3LBNA 2PS3A 4CIDA 5IKOA 3V8MA 2VF8A 3ZDYB 1SBYA 1TADA 1X7GA 3O2JA 1M3SA 1CJBA 1JHAA 2GUWA 4HNRA 1G4AE 4OAPA 2HR1A 2O5EA 3C0KA 1IM5A 5JQGA 2XXAA 1M1YE 3IODA 5EXDA 2OD2A 1CG6A 2PYZA 2CLDX 4ID3A 1L8XA 3L4BA 1IY2A 4MV5A 4OHWA 3TEMA 3ZLBA 4BAZA 3BMXA 3INRA 4PNZA 4BN4A 4LF6B 4YVFA 4BYGA 4DY6A 2EKZA 5ESRA 1CSEE 1VYVA 2F7SA 5COQA 4ISBA 1QBKC 5B1SA 3F78A 3T7RA 5CH3A 3BE4A 3KFVA 1TK2A 3LYHA 1FP6A 5JRZA 1JDTA 4Y6PA 2ZS8A 2AN3A 5T8KA 1M83A 5IM4A 1T3LA 1T10A 2R97A 2O3TA 3H8SA 4CE6A 4I1SA 5L4LA 2EHDA 4LJYA 1J8QA 1NIPA 5IDQA 2CVPA 1JSCA 4IIBA 1SXIA 2F62A 3IKJA 3Q3JB 5K0SA 3ZDAA 1ESDA 1IBSA 2VL7A 4LKOA 4QTZA 3LT5A 2PZBA 5I7OA 2OOSA 2QN1A 4LDAA 1KJQA 3DAPA 2R7LA 3HRHA 4X85A 4HWGA 4YGYA 3UXHA 1JEYB 1SBCA 1Y8QB 2PX0A 1KHTA 1KY3A 1Z3IX 2HU2A 3EF0A 3G0CA 3HY3A 4ZVVA 1D8TA 4WK2B 5DLPA 5H70A 3EJWA 1SQGA 1Z8NA 2ZM6B 1JSLA 1VL6A 2OK7A 3NJ4A 5E0KB 2VP9A 2YS7A 4CU5A 4R51A 2JFNA 4OTZA 3QXCA 3GMSA 5EZQA 2KM1A 3O4JA 5E3HA 3GUYA 4D8UA 2PX4A 3EODA 5B6JA 3PFGA 3K96A 4HWTA 2WIKA 1KYWA 3TJZA 1ZGAA 4PZCA 2X15A 1XL0A 1AHHA 1C14A 3S40A 5JZSA 2IYSA 3N58A 1AY0A 1XCPA 1QDLB 4TV9B 2ZBVA 3ZNOA 4DQVA 1WMEA 1WSDA 1T8SA 2B7LA 2EZ8A 3N5CA 2B30A 3ILSA 3PVZA 1RJEA 2FUNB 4H15A 4QFMA 3P71T 3TLAA 4WXMA 1WZ2A 1T9GR 2ZUBA 5AOCA 4YUXA 3I4CA 4P58A 2JD1A 1BWSA 1GSHA 4HX9A 1GPDG 1LS6A 1Q2UA 1TO2E 3U17A 3QRWA 2LW7A 2J31A 2Y4OA 5SV2A 3GLFB 1W36B 2ZVPX 2VPIA 4PYKA 3IC5A 2D3TA 1EXVA 1X92A 1PFQA 3OWXA 2NUAA 5JYCA 2Z5LA 1K4YA 5AHOA 4RAQA 1KH3A 3SXJA 4JQSA 4L73A 3U4HA 4C4OA 1GZDA 1RHQA 2JI6A 4EDFA 3RVSA 2HMVA 4HS9A 1SCJA 1PZMA 3MQ2A 3CZRA 3OPQA 4Q01A 4ZHSA 5ICCA 1SJ9A 5G0VA 1DKUA 4QXQA 3ADPA 3N8HA 3HJAA 4YTEA 4BX9A 4EWLA 4TMFA 4OI2A 4Q9NA 3V33A 1WDMA 5BURA 3KWLA 5LD2C 4MQEA 1XHFA 3UMYA 3FFTA 3EVCA 3DE2X 3A6HA 1GCGA 4KSCA 4GICA 4TUYA 1MPTA 4ARUA 3TCNA 4M37A 4QOJA 4M8LA 4C9BA 4D79A 3ZJUA 1L7DA 2FW0A 4QREA 1RQ7A 3ZWQA 4AY6A 3LUAA 4GMKA 3I5MA 2X8WA 4Z0TA 1JZQA 3CUKA 1XQ1A 1CFZA 2C0PA 3AHEA 5DHUA 3PC2A 4HF7A 2JFPA 4KLCA 4B6RA 5LMNB 4N0EA 2XYPA 1GPLA 4NBKA 1WBBA 3EAFA 3HBNA 5LSAA 4LJSA 3TTTA 4M0DA 4IVQA 1CDEA 4I81A 3I64A 3Q8WA 1OOEA 3DUWA 2VTBA 3G7NA 2JLUA 2QMUA 1JLLB 2VBIA 3AW9A 4C5AA 1CT9A 1E94E 1M72A 4ZO6A 1SQ0A 5BN3A 3NBUA 4PIPA 4KMSA 2CHEA 2GKSA 5ALHA 2OQVA 3R7NA 4E88A 4CKCA 5B55A 4OGLA 1G55A 2X1MA 2OQRA 1RRPA 5AK4A 1E9AA 3DMTA 3K1JA 2FWNA 5EGNA 1JXOA 2OBLA 5DYWA 4OFXA 3TQSA 4TS9A 4GUDA 1QE3A 1RTTA 3G7SA 3R4VA 1V5EA 3OTOB 2FP4B 1SCNE 4U3JB 4NZMA 2AC4A 3O8RA 1CHNA 1U8YA 1XTUA 4X7PA 4AS1A 1VB5A 2V4MA 1VSBA 1WSWA 3DEYX 1CUAA 4GBMA 4L8LA 1ZSVA 2GERA 3I5XA 4ETNA 4Z7OB 1EUCA 2G3YA 1B0UA 1P6UA 1SEPA 3A1NA 3TFOA 1T0IA 2QZJA 4IG9A 3H5VA 1QHSA 3GHHA 1H23A 3ZY2A 1LK0A 1TO6A 2QTCA 3RSGA 4TTQA 3VBCA 1OI4A 3MT7A 1XGKA 5G4KB 1KJYA 2WYUA 2BWJA 3TM5A 4QVIA 2O5VA 1FUUA 1GQYA 3L4SO 3PGLA 3M0EA 1P74A 3ZGLA 1HTWA 3LGAA 1U9CA 1Z6YA 3TQQA 5CITA 1NM5C 3DD1A 5HR5A 1HG1A 4IIJA 3QE9Y 2B82A 4LWOA 3F98A 2ZJ6A 3I30X 4H7IA 4MIEA 4HN2A 3QTBA 5KTRA 4R9NA 3AI7A 4TRJA 2GAFA 3D0RA 1IXKA 4KQMA 5B7GA 3AEQA 1GHTA 3EQ7A 3OT4A 1HV8A 4P0QB 3I6ZA 1SG6A 4Q16A 5JCOA 1OJ7A 4YJ3B 3OTWA 1UJCA 2YC2C 4OQDA 3FLBA 3SJ7A 2OSBA 4BIMA 5KJ1A 1TVCA 5CYOA 1H2WA 3ANMA 3OP4A 5AM5A 2OEPA 5IVKA 3QUAA 4B3MB 1UBOS 2HFJA 2V65A 1Z62A 3H1BA 5ILGA 1JQ5A 2FOXA 4URHA 1ZWKA 4HNAB 2P9TA 4XQ0A 1BMTA 3B1FA 5A6SB 2NWQA 1L3IA 1ZD4A 3GPCA 1GNQA 3IOBA 1Y3DE 1YWGO 1GY8A 1ODTC 1R5BA 2FRDA 3A9VA 3ICCA 4M46A 1EQAA 1TTQB 4S1TA 4EA7A 5K0JA 3W5IA 2QZZA 5C31A 3T7JA 1V95A 3PQ7A 3L92A 4QEZA 2NTYC 3ILXA 3QEJA 4RSMA 2OPHA 3T8YA 2QLMA 3J7TA 1S01A 3BULA 3SR3A 3QKSB 1FX0A 4MVJP 3EFBA 1Z7EA 3WB1A 4UEWA 5IJZA 1KC1A 2P35A 3L8CA 4IW3B 4KFTA 3EZFA 2VRNA 5E2BA 1CZOA 4YP6A 1U9ZA 4F1JA 3K30A 4Y30A 1RP7A 2UVPA 3AHJA 3RFTA 1USIA 3FMVA 4H7HA 1XEXB 2FUG1 3A9CA 3TUIC 3PTZA 3M81A 4EEZA 3QKSA 1NMEA 4GZ6A 3TD6A 1RQLA 5KOHA 2G0TA 1VRVA 4I1VA 2ZTLA 1G5RA 4U9UA 4YHBA 4CCAA 3W1EA 5C80A 3HR8A 5CG2A 5ICSA 3F9RA 3QWBA 1G21B 4N41A 1NVVR 4H6PA 3WLIA 2IHYA 1VBMA 2GAOA 1G3UA 2BW0A 4JI7B 1BVYF 1H9BA 2OORC 4HH3C 4AUMA 1LDYA 3V8NA 3KQVA 3FI0A 2DY0A 3EOBI 1NC3A 4RPHA 4LC0A 2ZJ1A 3PITA 3NWJA 3QSGA 1G21A 2DOKA 1OWNA 5BSRA 3KOUA 2OZKA 2ERXA 1II9A 1PKXA 3HGMA 1H1LB 2ZJ7A 4BECA 2WV7A 3QMPA 4M0KA 3UA4A 4F8EA 4XM1A 3IFSA 2VDPB 1XVIA 3B5IA 3OX2A 1SKQA 1VI2A 3SR0A 3DDOA 3DZ8A 2I3DA 5IF9A 4FKMA 2YUIA 1L9XA 2YOGA 3OIWA 1PUJA 2LR0A 1Y7PA 3EQZA 3IT2A 3STVA 1SXQA 1H1LA 4MI3A 4J0KA 3CTMA 2V6FA 2Y1OA 2BEUB 3OJCA 5I9MA 5I5GA 1RI1A 3BMOA 3GMIA 4BV8A 1ZJJA 2Z30A 3BTUA 3LFHA 4D43A 4L85A 5K6AC 1PTJC 2QTZA 4L08A 4ZDWA 4JKOA 1ZYUA 2BGNA 1GTMA 4ABYA 4D92A 3NUGA 2AG0A 1WMBA 5KQMA 1FDUA 1MA0A 4E6EA 2WKPA 5LFAA 3IE1A 2PGDA 1WB5A 4TSFD 4L0CA 1NDHA 2W2PA 5T6BA 2DXIA 1X8JA 3QLEA 4WECA 4PTLA 4TYQA 1E6MA 2PK3A 1ENPA 3A0UA 5GVRA 4AJKA 3CKLA 3KJNA 4NAVA 4PINA 4UAGA 3PLRA 2PXHA 4LRUA 2RGUA 1SD5A 4MTCA 4BQNA 4C1BA 2AZ4A 1TEXA 3QFCA 1BDHA 3FTFA 2W4MA 4B6EA 4O4HB 1ICEA 4GL4A 1A8IA 3GLIA 1WF3A 1AZWA 4IVPA 2WSSA 1PJSA 3JQGB 3EF3A 1I2BA 3B3JA 4YPOA 3X1ZA 3R6LA 2OBBA 1OUMA 2R4TA 1UDAA 2RC5A 3G49A 4Q9JA 3U48A 1R37A 4HDAA 3P4UA 1PJ2A 1Z4JA 3D7MA 2DH6A 5EIBD 4LQCA 1QYRA 3FXAA 4WACA 4BV9A 3ENZA 5FWYA 2H9IA 1F5SA 2PX2A 2AK2A 3EEQA 3N07A 5FPSA 1JHYA 3D64A 4IV8A 4FYIA 5CB0A 1A4XA 3VYRB 3DOUA 4BMDA 1F5NA 1V3TA 3NCTA 4LMBA 4RDHA 1DAIA 1VJ0A 2IEZA 1NG9A 1LBQA 4FFBA 3Q85A 1P62B 5K20A 2QAJA 3SX0A 2L18A 4Y18A 5D1NA 1QBGA 4XJVA 2VJLA 3C3JA 2ZYGA 1HT2E 4EABA 5G02A 4WNYA 3RGWS 4C2TA 4AUNA 3LSYA 4BJ6A 1K9SA 1CPYA 2C77A 2FW7A 4LOKA 4CMIA 3ZGZA 1L4UA 1G6KA 2J32A 3CLRD 2IYAA 1YB6A 4L2IA 5D84A 2C9ZA 3EZ2A 4F6CA 3ESXA 2QL5A 4KR9A 1E7QA 1G41A 1HE2A 3HWWA 4ZN6A 1IUKA 3GYGA 4RPLA 1FRZA 3TIGA 4FSXA 3ZU2A 3HBJA 3FVVA 4F3KA 2HSDA 5L3VA 3WHPA 1V8FA 1MH9A 2IHKA 1YS6A 3DVAB 1LD3A 1OX6A 2NT4A 3HYSA 4AKGA 3OMWA 4L9RA 4AQDA 3LMKA 3OI7A 1H22A 4IOMA 1HDYA 1GSOA 2VDLB 5G3YA 4B09A 4ZT2A 3GU3A 1ODJA 2VOJA 3F74A 1JR4A 1PWHA 1BYUA 4TV8A 4R7GA 2OVFA 1QU3A 1ZRMA 4XARA 1CEXA 1SBIA 3FF1A 4I9HA 4O1MA 2NV0A 2ON6A 5EZYB 3NT2A 5I9BA 3ESAA 1SHLA 1JHPA 2A1UB 2ORWA 2IU4A 1ZH6A 2Z2XA 3AHFA 3S27A 4MO2A 2A5DA 4Y1EA 2OCXA 1Q84A 3AJRA 4TLLB 1UQRA 3MT8A 3RVDA 1TCUA 1YCFA 2A9KA 2OTCA 1VSVA 4AL4A 2WJGA 1DMRA 3H9JA 4ZKDA 1WB6A 4U7FA 2HRBA 2P2CA 4V0SA 2PKYX 2C3UA 3N6VA 4REOA 1ADYA 1BKSB 4TRRA 5FD8A 3EGOA 1TZJA 1Z6ZA 1AZTA 1VPTA 3O8LA 5FHQA 5BV2P 1SVNA 1KI8A 3QBJA 1QZZA 1MAAA 5EPOA 4ZOLF 3VR2D 4R7ZA 4C21A 3BT7A 3OT1B 1BA2A 2C4KA 4LHWA 5JSYA 5KNDD 3DPUA 3OTQA 2EAUA 3LHFA 1QTRA 3Q7IA 3RVMA 5KVSA 3CJTA 3TWOA 3CNEA 4C4ZA 3KB2A 1V43A 5B5SA 2XVXA 5C8YB 4R1OA 4BVLA 1HE5A 4R4JA 3GDHA 1OGJA 5KAPA 1E3EA 1V7PC 2FG7C 1FF9A 2J4DA 3E84A 2CVQA 3N53A 2O3UA 1P1BA 4GRAA 4H17A 3P1JA 5FBRB 3VR5A 1O94D 1ZIYA 4F71A 4C7XA 4WBNB 4N40A 4XRGA 1ZAYA 5CFQA 4CT5A 1R8XA 3AY0A 1P4AA 1KWGA 1UWVA 1YRAA 4JLOA 3HYTA 2PGJA 4NFSA 5E6SB 4EB3A 3TTXA 5DHPA 3D0KA 4K26A 5E6RA 3BXOA 4C14A 1UJ5A 3RFUA 4EHDA 2NN3C 4W9NA 5FPQA 3OQ6A 1MQAA 2D1TA 4N0QA 4WZAA 3SC3A 5CFPA 4CXMA 2XGOA 1AA6A 2DT8A 3WGJA 2J30A 3OIDA 5ANRB 1DIOB 5E6SA 1N0WA 5EE9A 4OAQA 5AM3A 1RZ3A 4RTMA 2Q5OA 1LPOA 3MNFA 4BWYA 3VTKA 1VMDA 1B15A 2OYSA 3WI7A 3PZBA 3I9V6 2VZLA 2A1TS 1LRJA 1GR1A 1XDZA 2GZ1A 3CHYA 4X20B 3WQRA 1PJ4A 1ODKA 2PZGA 4V3CA 1WA5A 4WCFA 5DYTA 5EESA 5ARDA 4BRZA 1Z3CA 1S89A 2FSSA 3A6DA 4WASA 5L3ZA 3UHJA 4LXIA 5IU6A 3MMXA 5TY0A 5TE9A 4B87A 1UXGA 2PZMA 2NO9A 2X8AA 2PU7A 3I2IA 4IGEA 4OI4A 3UT0A 5FOSA 4DIFA 4ZEVA 2KE5A 1M6VB 2N1MA 2P69A 3L0SA 3SQNA 4BMVA 5JTTA 2DFKB 4K9DA 2WIAA 2HAEA 3EW9A 4JASB 2HJSA 1W88A 4UXJA 2Y99A 2ZIGA 4PHHA 5B3KA 4RKYA 5DX1A 5FRDA 3S1LA 1E2IA 5C1PA 4EB8A 4POOA 1M6VA 1H4TA 1O97D 1OBHA 1Q0SA 1RRFA 1QE0A 1Z18A 1TF2A 5HM8A 4AYTA 2YUTA 4N01A 1V9LA 2NVUB 4A6XA 4Z4EA 3MCVA 3H11A 3A58B 4LJ5A 2BH2A 2M6SA 1ZH4A 3JW8A 1KY2A 2CDAA 4X8LA 3RS9A 4AJ4A 5DVZA 2QRJA 2ACWA 4M1WA 2PKXA 1QM5A 4KPEC 1S8NA 2BJWA 3NFRA 1NF3A 2C31A 4JOBA 4JUFA 1JJIA 4E22A 3GLHA 1F8GA 4FSHA 1JYFA 1MOQA 2WK1A 1J56A 2Q5EA 4MUFA 2N46A 3N2NA 4E3ZA 1W59A 2WA2A 3KSAC 5FO1A 1NASA 2VF2A 1X1EA 1EFVB 1T6XA 2NLOA 3LCCA 3JCZA 3O2NA 1TOAA 2E37A 3R5FA 1NVBA 2E1RA 4OQMA 4PNPA 4MW9A 2ZT8A 3FPBA 2FZCA 5JSHA 5DV9A 1OAKA 1O5TA 1RFLA 2H08A 3QYJA 2P2YA 3WSWA 4JI0B 1SURA 1KBQA 4ZPXA 1D1TA 2V8OA 3H4MA 2M6KA 3ZOKA 4HTAA 2IIPA 5E1DA 1JLSA 4G0XA 4XM0A 2NZ8A 2XRYA 1EFVA 5ALNA 5HK9A 4X6XA 1SCBA 3ZWDA 5BNFA 5JIBA 2JGNA 2PUWA 5JJIA 3V34A 4JKIA 4DSOA 1HFWA 3AFHA 1EYZA 4L07A 1J2JA 1T4CB 2AH5A 4MOWA 1HYGA 2EDAA 4CQNA 2X6RA 2E7ZA 3Q6NA 3BXXA 1U3DA 2VEDA 3D31A 1AF4A 1WU7A 3INGA 1P0MA 1Z2OX 1TMKA 3MRSA 4XDZA 3O9VA 1FZQA 2CLKB 5IAKA 3TBFA 4KKVA 1AA9A 3W8NA 2GD6A 3DMHA 1NVAA 3NTRA 1I94B 5H4GA 4AF8A 5HQ3B 1KEKA 1YMQA 1DRUA 4GMGA 3KHSA 1DG9A 3AVXA 3ZD9A 2JCYA 1JIUA 2ZOSA 2XZPA 2QN9A 1BXRB 2CWWA 3GJTA 4LRWA 1LGYA 4M1OA 3RIXA 4C03A 4ESHA 1YIDA 3WC4A 4PSDA 1MJ5A 5D7NA 1V11B 1X7WB 1EDDA 4P82A 4JJFA 4MEAA 1B3RA 1LV7A 2NAFA 3N7TA 5FF9A 4A2PA 1DELA 2G67A 3L8MA 3LQFA 4ITRC 5HGXA 5KAMA 5JANA 2ADMA 2II6A 3EAGA 3N2KA 2XE8A 3T3EA 3ITKA 3PU6A 3AVQA 3D3NA 3AZOA 3DBRA 3K5IA 2XT9A 2QM3A 4BKMA 3FRIA 3R9KA 4L4UA 2Z3WA 2FPWA 3JARA 2ZJ2A 2VT7A 3HI6A 2VNHA 3C7AA 3AF3A 3D4LA 4BNIA 3TZLA 5IFLA 5JXHA 2XHEA 3GARA 2ALJA 4LZAA 4PLGA 1YR8A 1EM8A 5A7GA 5AKEA 1TZMA 2MJLA 1UOOA 1WY7A 2BEVB 3O82A 4Q19A 1WCXA 1VQ1A 2CXNA 1HI9A 2ZTSA 3MERA 3QVVA 3F6CA 4ZJYA 3G2LA 3WKDA 1T3HA 4NXNB 4CKYA 1ESNA 1Q17A 3JAWB 2J8ZA 3SF8A 1V71A 4YRKA 3B8HA 5TVKA 3T1TA 3CWZA 1QS0B 2IQIA 3JU3A 4KUHA 3GOHA 2Q3LA 3PTLA 4FXOA 4WKNA 3L8GA 1AQLA 2HJ9A 2XNDD 2EFGA 1D4ZA 3DBLA 4I1RA 1ORIA 3FCXA 2EZTA 1IK6A 4R69A 1M1YB 4JC8A 3SFZA 4F12A 2QM0A 1YUMA 4MUMA 4EGQA 4DJAA 4RGVA 1B73A 1P1HA 2F43A 4UDOA 1USGA 5ED4A 3UKOA 3PGJA 4PZUA 1CY6A 1ZGCA 1ZSYA 1VHTA 4FFLA 4A91A 4IIXA 2ZUCA 4KAJA 4TYPA 1CE8A 1W9MA 5C3UA 1G66A 2IBSA 5FORA 4M87A 1Y9EA 1T9ZA 3V2HA 4R31A 1EJ0A 2FY8A 5AI8A 4EHIA 3CKYA 5IKMA 1J1IA 1ZJWA 1LRLA 2LD4A 5BNWA 3FCAA 3C5HA 1DPFA 2NQ2C 3AERB 4MB2A 4CM9A 4EMTA 3GLUA 3K0HA 3UJAA 5TSDA 5DEOA 1RLUA 4G9EA 3EZXA 3RV4A 2HTFA 4YAEA 3PPYA 1TM3E 4L57A 1BX1A 5DGIA 4P0PB 1U94A 1DXYA 1WL8A 3AERA 3H99A 1YZKA 1E92A 2VO1A 3ET4A 4R54A 2J4CA 3MG9A 3IV6A 2GJ9A 4Q00A 5ECGC 2DF8A 5FWXB 4HQLA 3AU8A 1D4OA 1XZPA 4MCJA 2JIZD 3HVKA 1Z08A 1NQUA 3BQ9A 2ORED 4H4DA 3UXEA 1GYPA 4E4YA 3C3YA 5E9JA 5I4BA 5H4HA 2ZJOA 3A28A 2YFHA 3VA7A 3P94A 1FNMA 5FWXA 3UT6A 1YGPA 1YBAA 2O5RA 3IDSA 3RS8A 2ZIWB 4AJHA 2W8BB 2C9YA 4N65A 1CRPA 2QVGA 3PHJA 5C4GB 2UUAB 2CJPA 1KWKA 5C1OA 2D1FA 1RLIA 2CNKA 2J9XB 3FOBA 3TCXB 3W2EA 1CR0A 4B6PA 3VSDA 3C5CA 3HADA 1QJCA 4QTTB 4KIJA 4Y2UA 5DB4A 1JSZA 4D3FA 5F73A 1L9KA 1XOIA 5L4SA 1SK8A 1DKOA 3DE3X 1K97A 3TQRA 3AH8A 3F8WA 1BX0A 2OCLA 3E22B 4W5WA 1JQ3A 3E9YA 1I3LA 3NIWA 4X0EA 4UEKA 3RSZA 1XZMA 1W93A 1T3SA 5FWNA 3S1AA 2HY7A 1X19A 4CL8A 1PNTA 4WW0A 1E5XA 3PHGA 1GCUA 3ZTYA 2LNDA 1GPMA 1IATA 5DBGA 2AG6A 2VP5A 2SKCA 2ZKIA 3HJUA 1YZQA 3JYHA 4ED9A 2JIQA 4AI6A 4CCYB 1XZDA 1WJGA 1RE0A 4RY0A 1AXGA 1G9XA 3T3IA 1PHRA 1EFKA 4QBFA 1U1CA 3Q8MA 4F45A 3BWYA 1SU7A 1XEAA 2P3QA 4Y98A 2C0QA 2JL1A 1YBFA 3QVJA 5CK4A 3FOFC 3DWGA 2FUG6 4KBGA 1GTRA 1EFTA 1X1TA 3DE6X 2RGCA 2PH7A 3G9QA 4IOJA 4XGQA 3Q2IA 4Q9IA 1WCV1 2ZI3A 3RFFA 2H2DA 4EKIA 4XSHA 3ND6A 4GG1A 3QE4A 1K8RA 3C4QA 4P35A 5JBNA 3CR7A 3FWYA 4NOKA 2G28A 3HDTA 1P3DA 3BL5A 3K16A 5B1EA 3FR7A 3HDJA 1A9QA 4XYGA 1H0HA 2J3MA 4LISA 1D04A 1TF7A 1G19A 4M6WA 1J49A 4ZAYA 5IH3A 3GRPA 4O0MA 3EXEA 1VBKA 1MRSA 3OPNA 3T41A 1ONNA 1DFIA 1NQAO 1BU8A 1FTGA 4F8YA 2X3UA 3FYHA 1KIFA 4RLSA 1KDVA 3EA4A 4BMOB 1M6NA 2AMVA 2B37A 3GVIA 1W8DA 3ZG6A 3RAEC 2IYRA 2Q28A 3ENKA 1ENZA 4B8ZA 4YJGA 3MN1A 8GPBA 5HM6A 4Q6WA 4RM3A 3V7UA 1ZK0A 2YMLA 4OP3A 2VUSA 2E87A 2J67A 1XK6A 3SJUA 1U7OA 3GB9A 4PYOA 2WT9A 1J00A 1NM5A 1F0KA 2G9ZA 2DPMA 4K9PA 5CB6A 1CZNA 4WQMA 4KZKA 5EKSA 3Q5EA 1TM1E 3O8BA 3UGJA 4EYGA 3BSSA 3PEVA 3DP9A 3W2FA 1U0JA 3VHLB 4A1OA 3FCUB 2NUPB 2BSQA 4BXOA 4HUQB 3VR3A 2P11A 3QE0A 2CBGA 1G3QA 4TPKA 1UDWA 2QTVA 2ID4A 4NMXB 1G5HA 1EFPB 1FLNA 1EUDA 4OHFA 1PSZA 2VSQA 3OY2A 2ATVA 4YMIA 5EHQA 2NUPA 3GQBA 1RXIA 1GPH1 3BE5A 5A2GA 1KE1A 3RC8A 3A11A 2P6OA 3G17A 3L41A 1OC4A 3B1JA 3MINB 3OURA 4RZHA 5HMLA 4EIWA 5FEMA 2K6GA 3VOAA 1DQZA 1LBIA 1WBJB 5CRIA 1KVSA 4QUGA 1ZH8A 4PIVA 4EAQA 2ZIUB 3RJTA 1P0FA 1BCRA 2Y0EA 3Q12A 4NZZA 1UBRS 3TR0A 2A8YA 4U6QA 3OFND 2R00C 5JJLA 1LSJA 4KB5A 1EFLA 2RHMA 5IEJA 1ZN2A 3GJRA 3CV3A 3ASYA 3EH1A 4E7OA 4E0BA 3KDSE 1YACA 4RAOA 5FI5A 3I0ZA 1H3NA 2I6XA 3KXDA 3ICOA 4MQFB 4X1YB 2NU9A 1TCBA 5FTMA 5BMVB 4Q02A 3DCYA 3QVOA 2V6MA 4NLLA 4RQTA 4C0BA 5IXYA 5EXXA 2Y71A 3TZBA 4EMSA 2ERYA 2ODTX 2OG1A 4M9UA 2Z3ZA 4GPEA 3WGMA 3D8SA 2AFIA 3T1NA 4QJ4A 1GL7A 1OQAA 2AKAB 3C6XA 3NHLA 4UKDA 1ND5A 1HQCA 5JJBA 3ETDA 2RH8A 1JDJA 4YJFB 4L4YA 2I6TA 2X5OA 1OLXA 2HO4A 5DLEA 4ZVLA 1NUQA 1QVZA 3CRQA 3NHKA 3JD0A 2VQ6A 3SX4A 3VKUA 4C0LA 2ZXUA 5F1PA 2OORA 2HMTA 2WJYA 3AQ4A 3KKZA 4AF7A 3UBMA 1NF8A 1I14A 1EP3B 5EWLB 1U2GC 4HLCA 4B3GA 3NUZA 3BK1A 2HB6A 3R5TA 4U5XA 4GSLA 3RNLA 4V0RA 5EJMA 1QCCA 2YQ5A 4M9XA 1IE3A 2H06A 4Y1FA 1M2EA 3IMFA 5KWIA 1TECE 3QHQA 1FTSA 5EY5B 5A4JA 2B6NA 1I4OA 3AJ9A 3X2EA 5DTJA 1A8HA 1Z0ZA 2WJVA 2PO7A 4BPBA 4XLTA 1N5MA 1XTKA 5DSZA 3W5UA 1DRKA 3QOYA 1T35A 2GVZC 4M2LA 4PTYA 1Q11A 3PFWO 4ND7A 4JVLA 2HTEA 2MR6A 2YS6A 2HDNB 4NONA 3D7SA 5K4AA 1V1MA 3G85A 4KYUA 4D1YA 4JZKA 5K6AA 2EFHB 3EWSA 3MMPA 4FYWA 3W2GA 3N7UA 3R24A 4KREA 4UHKA 4QDJA 2DSTA 1R64A 2XUKA 3Q7EA 3BMNB 3Q1KA 2AOTB 4QXRA 4KXLA 4LQDA 1V5IA 5KTKA 3QKRB 4U7GA 1AXEA 3T5MA 4PLCA 3KWMA 4AS2A 4MCHA 4R8KA 1CEYA 5KQRA 1U8ZA 2O54A 1KOJA 3Q6IA 1X70A 4LJRA 3FRJA 4HRVA 1ZVQA 2P3LA 2AXNA 2IYYA 1FSPA 1PEAA 2VHEA 1P39A 5KQLA 4QUJA 2N47A 4YX9A 2TECE 3IBYA 2X0DA 4DSUA 1Z22A 2HK8A 3TZEA 1S9DA 2XJ9A 2FN9A 3AG5A 4DJFC 1JG7A 1NVUQ 1UFKA 3IR7A 4G65A 3NTQA 2VPWA 3TNJA 2XUAA 3AEYA 3NIDB 4PFQA 1RRMA 3SJBA 4B32A 4PBTA 5JNVA 5JCJD 5ITSA 4XEUA 3QPBA 3AI2A 1Y6ZA 2MIIA 3IIKA 2IHUA 1G17A 1LNQA 1K4MA 4J7AA 4BLVA 4NBNA 3KKOA 3SEAA 4F2GA 1YHZA 2I2AA 1C9YA 3RF6A 3LVFO 1Q1GA 4G37A 1ID1A 1DHTA 1LZKA 5DHFA 1E2LA 2NU7A 2NTNA 3BFPA 2RAUA 3IURA 3OEHD 4KFUA 5K3DA 4DBLE 4E08A 2FJ0A 4BO5A 4HDKB 1EK6A 4TLMB 1Z5PA 1NP6A 4FHFA 3JAMA 1TKBA 3MHPA 1QRRA 4MUNA 3U49A 2PL5A 1O5IA 1ONBA 4M54A 4KWEA 2AUTA 3WRXC 4II2A 1Z0DA 2V5UA 1ORRA 3AEKB 3KV1A 3PNKA 3HN2A 4EENA 3SDBA 3CO5A 4LG1A 3HTXA 2BONA 3MW8A 3EZ7A 3VDQA 2YWCA 1HQYE 3NEJA 1CD5A 2I1WA 3ZU6A 3WBKA 4L4RA 1QQ7A 4OIMA 4LOLA 4QRDA 2RIPA 4CYMA 5IYZB 4KQ6A 3X0DA 2R79A 3OWOA 4HYEA 4UMFA 3W8DA 1GZUA 3WYEA 2YQZA 3EPLA 2WD7A 1HYQA 3P9XA 4GYWA 1EMDA 1I1HA 4OLFA 2DU8A 3U4AA 2RJOA 1RE1A 2Z09A 3F5QA 5DBIA 4Q47A 1JFRA 1V6SA 4OGFA 2VI5A 2N9UA 3T9CA 5AVVA 1T9HA 2XCLA 3JVDA 3O2QB 4QBIA 4IVNA 3VPSA 4UD6A 1U2QA 1WKVA 2D06A 3EWIA 3UK2A 2P2NA 1UMCA 2NO7A 2WD9A 3KR2A 3ZI4A 5DXJA 4C0WA 1SVSA 4XYBA 1Q0UA 4BU0A 4RSRA 2Y2UA 3WGYA 1F3OA 3BGSA 1BJKA 3DLTA 3ESDA 1PT5A 2B8WA 1FDOA 3PYLA 4OBBA 3LVQE 4Z3DA 4U7TB 1D6MA 4D9GA 1EAYA 4OBXA 4P7BA 2IUSA 3DZIA 3N7AA 1PEKE 3BS4A 1G0OA 2XXBA 3HBLA 1K0UA 4M8NE 3RAJA 2DAPA 1SA0B 3P9NA 1Y3BE 2BTQB 4OI0A 5FLXA 4DR4B 5D2CA 3EMBA 2GPJA 1KRHA 2OO7A 4LZZA 3UOAB 1A4IA 1K7YA 1QG4A 2A0YA 3G1UA 1U0EA 3OFSA 4LVCA 1XD2B 1YQ9A 3W0LB 4DS3A 5LU8A 1RZRA 4OJNA 5E3JA 5KQSA 3ABQB 5REQB 2OE2A 2G9RA 1IMOA 2R8EA 3L0PA 4BX2A 2DUNA 2NO6A 5A3QA 4JLNA 3SLRA 4E12A 2WWYA 3UQYS 1FUEA 4I8DA 8ABPA 3AETA 3LT4A 1MT3A 4HZGA 2RAVA 1NVFA 3WK7A 2XCRB 2VUTA 1G8YA 2B9VA 3QKWA 4JT2A 4M8KA 3TRIA 4YRLA 4DIMA 5ULLA 2NUBA 2BGGA 3UPTA 1KVUA 1QKJA 1QV6A 1TA9A 4B35A 3C3EA 2GB4A 2Y1FA 1VA4A 2C2OA 3CSDA 3CXUA 4JVMA 3TXAA 1XXHE 4LV6A 4AG6A 4DUPA 3TX6A 3EX7C 3JRXA 2IV7A 4P4LA 3KM0A 1NL3A 3OLYA 4IH9A 4D9HA 1NR5A 4NCNA 2JGEA 1OI2A 4QWMA 3L5KA 2PE5A 5AVXA 4RDXA 5JY6A 1YVRA 1HOXA 3IP5A 2D8AA 1ZKMA 3BE8A 2YJ6A 1H0RA 3MWGA 1CUEA 4QQKA 4EHAA 2HCJB 1B0AA 3V3TA 4FGSA 2VYND 3KUUA 5EIBC 1KRXA 1Y3CE 3GELA 2XMCA 2NZ2A 1XBTA 2VWQA 2C95A 4YLGA 5EWMB 3IVRA 1PUXA 5EMJA 4YP7A 4DR6B 3LCVB 5KEIA 1RI3A 4RPJA 1XU4A 1Y8CA 4GR9A 2J0UA 2YXDA 4QVKA 4YJKA 4IFTA 4L4ZA 3BH6A 3RT1A 5BMOA 3HCPA 1N5JA 1CF9A 4CM4B 4E1AA 4L51A 4UJ5A 2EW1A 5L7WA 1FXWF 4HPJB 2HJVA 1N5LA 4TTRA 4CKWA 3LDAA 4LA4A 5FV4A 4ZV4A 3E9CA 5MFZA 5HJEA 2ENUA 4I4CA 3NYIA 1NKSA 5JAZA 3CH5A 1DJLA 3B60A 4CM4A 3CLRC 2BF7A 1B43A 2VZ0A 3BK7A 1MQ9A 1NNSA 2BUCA 3C85A 5F51A 5B1IA 3WL6A 4CLRB 3RLIA 3EGDA 1K5PA 2J9YB 5C52B 4YCBA 3H4VA 4P36A 3SLGA 1TPYA 3LUJA 2PA0A 2FR1A 4LDQA 5IG2A 1HSZA 2IW3A 3WADA 1I6WA 3ZE1B 1SVKA 3O47A 3OP1A 4QUAA 2RK6A 5I8ZA 2QZPA 4UNNA 4CG0A 2L19A 2SCUA 4YCNA 2JJ2A 2W70A 4JB8A 3C5EA 1BGXT 3FNEA 2DCUA 1K98A 4KUEA 2JLSA 4UNPA 2VS1A 4MR8B 2DQKA 1ECPA 3NC4A 2XUOA 2V7EA 1LUAA 3MUNA 3TLMA 4AKEA 5BW5A 5JBQA 3DL7A 2IZOA 3JY6A 1APBA 1JDPA 3ONDA 4JT4A 3FZGA 3NIGB 4L8GA 4TOIA 3SGLA 2WG1A 1TU4A 4YASA 3V8BA 4EKDA 3N75A 3D6FA 3WIEA 4AM8A 3E5RA 2ZJFA 3GJ6A 3C3DA 2ZRGA 5CTAA 1VSQA 1J4AA 1RWWA 2A5YB 2C9MA 3R09A 4JL6A 3RSFA 3K9FC 2H1IA 3A4YA 1ADBA 4M0UA 4QGHA 3IP9A 3PE6A 2HA5A 1SNYA 1KVRA 2GEFA 1GU0A 4GLBA 2OXEA 2FFAA 2FVYA 1L8QA 4EY5A 1IQUA 3OEED 5CM8B 1H6DA 1K63A 4ZDKA 2VVTA 2QQ5A 4JFAA 5FI3A 4KLZA 2R8ZA 5CTJA 3CZ4A 2RI0A 2VHCA 3IAAA 4BO7A 1QCYA 2I67A 3KZKA 1IG3A 4MUAA 1RNLA 1BC5A 2IU3A 3BEOA 4DDKA 4C4PA 3KLPX 4OHZA 3M8KA 3BTSA 2B9EA 3EGXB 3OPYA 4HAOA 1Y6JA 3L0YA 1QYVA 4DDWA 2AMFA 2OAEA 2MCFA 2WHPB 2ZSAA 4F4UA 2JI9A 4FP9A 4YJHB 1O94C 4YJ2A 2O2DA 2FTKE 2YVAA 2DC1A 5LYJB 2BMEA 1LF5A 2QJTA 2KB0A 4AFNA 1RYZA 2H5JA 2X4LA 3OESA 4DKJA 1ATIA 5JNLA 4FUTA 3M9WA 4QTXA 1JF8A 4DCGA 1Q50A 1AZSC 2I4MA 3OT5A 2O4CA 4PO3X 1A5AB 4Y9UA 4TGLA 5IDYA 1DBPA 4KV9A 1QZTA 1U7PA 4O2BA 4YJHA 3PI7A 2PG3A 4CDGA 1OH7A 4TKUB 2F90A 1S3FA 4M0FA 1GTL1 2QKYA 1AS3A 3NBXX 1CNEA 3KE9A 3G5UA 1CQIA 1C8LA 2EF0A 3BFKA 4ZOEA 4H35A 4B4UA 4M1MA 1K5GA 2PH1A 3FKQA 1H8EA 3IIIA 1PF7E 1XMPA 5FKJA 3RUHA 3NHZA 1OZAA 2AWNA 3OD1A 4OFZA 3Q2KA 1E7RA 1QLJA 4NCXA 2ADFA 1XYYA 3O8QA 4J0JA 5E6UB 1RR6A 2H7YA 1SZJG 3E15A 5M3BA 7YASA 1EGMB 5IJ9A 3T5BA 1CY0A 3GFFA 3ROXA 3CPSA 3M4ZA 4G1FA 3OZSA 3K4HA 1M75A 1X8XA 1WW3A 3WLKX 2Y3IA 1Z7WA 4JBHA 5ISMA 1F0NA 4KR3A 3KOXA 4DLAA 2OZPA 2OQ2A 4KIWA 2GM3A 2EL9A 2XUDA 3KHUA 5K4HA 4KQCA 2IXFA 4FNMA 4JOSA 2VWGA 1D7OA 2Z56A 2Z4TA 3A7DA 5CT5A 3TQFA 4B76A 4BUJA 3ML1A 3KKPA 3D5TA 4RCVA 2GK3A 1N2IA 1O97C 4P2GA 5G2OA 4WOBA 4P5DA 1Y4AE 4LXYA 1XTZA 4DNPA 3S5JA 1LTQA 4I4IA 4ARZB 1BDIA 1NBAA 4F6RB 2PZKA 3CFYA 3KQSA 3AVVA 4GKJB 3K9WA 2BJHA 4PFJA 2B94A 3PDIB 2PLFA 4FFOA 2XE4A 3BXGA 4JI2B 3NAZA 2RHWA 3I8XA 1P72A 3M6AA 1L8OA 4IDAA 5FT9A 1ESMA 2VDMB 3TGLA 4F6RA 4MUKA 2FQWA 5FHRA 1ISGA 5DLDA 3FDJA 4MH0R 4PAGA 1E1RA 2VBFA 3H3JA 3UW1A 1LY1A 2HSJA 3PEEA 2EZ4A 3TBHA 5UKDA 2FPSA 2Z98A 3OCJA 4ALMA 1MX9A 5DMHA 3J81A 3FZNA 2ZE6A 4I3GA 3I2YX 2EFCB 1C3LA 2DYKA 2WF9A 5A1JA 2ACKA 4B0PA 5BUQA 5C7IO 1E2QA 1GUZA 3FUXA 4Q5IA 4MGHA 5TC4A 1J7JA 1YAHA 2ZAIA 3MGKA 4KIFA 5D8DA 4YCSA 1XZGA 1PFVA 1N4DA 1U3VA 3GR6A 1RJWA 2H2HA 2PRKA 3NM6B 3P2JA 3PT9A 1OZHA 3LUPA 2WRZA 4JYZA 2JI8A 4BTVA 2JBAB 3LQ1A 3OU7A 1E62A 2BMVA 3FA2A 4A6DA 4EITA 4P4SA 3SEQA 4EI9A 2MINA 2YXBA 3S2IA 2A86A 3OA2A 3GCXA 3ZKWB 4B6QA 1W0CA 2ZBEA 2G5PA 2QVXX 3FNIA 3LBYA 1YL5A 4RA6B 5BT9A 4XWAA 1S2LA 2GN1A 4AJIA 3AIKA 3B51X 2QX6A 3FPCA 3RODA 3TDMA 4Q82A 3DT6A 4MV0A 4EY3A 4DDUA 1QV7A 2X0NA 4FIZA 4DT1A 1DUVG 1YS4A 3WGQA 2Q99A 5BSUA 3ZKWA 1CUYA 2ZROA 2XA9A 3KR9A 1SVOA 2W6IA 3U3XA 4IFEA 1NXTA 2J1LA 3RHTA 5MF6A 3ROQA 5I4CA 3EY4A 3ND7A 3QTLA 5J4KA 3MLBA 4D3DA 5JASA 1M0EA 5FX2A 2FDRA 1N9GB 3FMFA 4DVGA 3MTJA 3OLXA 4RY8A 1WZNA 1II8A 1Z5ZA 1ZCAA 1J39A 1WVIA 2OV8A 2GTPA 2Z1MA 2YVUA 2ZWVA 1DAEA 2JHGA 3M6WA 4JB3A 4WLUA 3IRUA 1WNFA 3B89A 4YRZA 2Z2KA 3QVGB 2A1TR 4WH0A 4FT4A 1C7IA 1XALA 4NG4A 3BG5A 1KSGA 2N1BA 3PJEA 3TLXA 5ALSA 2O1XA 3CU5A 4ZVTA 3CNNA 2DBZA 2ICAA 1IAQA 3LL7A 4ER6A 3N6XA 3LQYA 3ONVA 3QY0A 3LF1A 3CZQA 2X2FA 4M53A 2HMSA 2EYUA 4M86A 1L4BA 2IWRA 4NU0A 3JZAA 4D7AA 2DQZA 2QE7D 1AF7A 1F4VA 1R4ZA 1RHUA 4JOQA 4KJXA 4DLRA 3VR6D 4ER5A 2IS6A 3U1VA 1OLUB 4GEKA 3PDHA 4V2UA 2ZGVA 1HYHA 5CIQA 3OCXA 5C53B 3HO1A 3PG5A 2V3WA 5JARA 1NJ8A 2QPAA 4AJ9A 1A9TA 1PP4A 3JQBC 1AKEA 1ORVA 1AK2A 1XDDA 2HEIA 4GDFA 3C1UA 4D8WA 4YDSA 4QBHA 4W9MC 3LS2A 3K9CA 4NEHB 4ZXPA 4RJIA 2BFDB 3DBIA 3O95A 5AVOA 2RGNA 5EIXA 4KYIB 4R1LA 2JVKA 2GM5A 4C7MA 3F6EX 1YBMA 2PSEA 1JA1A 2DFPA 4CEIA 3T95A 1EBUA 3MCUA 4E4TA 2F3TA 2PMCA 3IAUA 4LHXA 1XQWA 5HZMA 2BFEA 1QFYA 1Y5IA 2PEYA 2PV7A 3MXTA 1RYEA 2DG2A 2O50A 2PFGA 4WXPA 3WBBA 5CAEA 1TDJA 3C4JA 3KPJA 3SVTA 5DW0A 2Q7XA 2B21A 2WWRA 1R4MA 4F5YA 1U3TA 1AKWA 1X3SA 3H7IA 3SZ3A 3T3DA 4X7RA 1QK3A 721PA 2FZEA 5IF3A 1IVSA 1J1UA 5KX5B 2GSDA 1RAIA 1QGUA 3EC1A 1LSUA 4HB2A 4RNDB 5HMMA 5K3FA 1CJSA 3BRWD 1N3IA 1WNTA 4MKZA 3UV7A 1RHRA 2JJYA 1RHJA 1HMYA 1Z26A 1OC2A 1U0SY 3K53A 2I66A 4KUGA 4EHJA 3Q7QA 3SZMA 1PT9A 2ID8A 3DZDA 5JVDF 5KPDA 4YRQA 3HS3A 1UK9A 2WPDD 4W4TA 1W85B 3CPEA 4KG7A 4UC0A 3GCGA 1UBMS 5ALIA 4A27A 2N3ZA 3BDAA 2QG4A 3ITNA 1EFAA 5LQAA 3ZQ6A 5I9LA 1IMJA 2BFCB 1TLTA 3C3CA 1KDPA 1YCGA 2D4HA 5B36A 4JI4B 2P30A 1JBQA 2QLFA 2G1UA 3E27A 2HCFA 3CF0A 1CLUA 1K5DA 2W4QA 4L15A 2XQKA 3V46A 1R5JA 4BVJA 3V2UA 1IH8A 4P81A 2JFUA 3HACA 3IPCA 2OECA 1YC5A 3I9OA 5CEEA 2FMXA 3AEUB 5PNTA 2O1SA 1A5ZA 1VBNA 4HAUA 1H4SA 6GPBA 3UQZA 3O93A 1XNRB 3CEAA 4J16C 3CCBA 3PNSA 2GWHA 4LYAA 5JWOA 1YD7A 3IJRA 4KYTA 4N5DA 2YVLA 3UA3A 2V7TA 2W93A 2XV1A 3DEAA 4H1TA 1PW5A 4EGFA 4RH3A 4LRQA 3FNGA 2O2ZA 4OK3A 1R9JA 3GA0A 4ZARA 3SIPA 2I6QA 1NZFA 1DOZA 1SOMA 3Q41A 3Q9UA 1SCUA 4QJ5A 5DM70 3MB8A 3EIOA 1FQJA 1YFJA 1MO4A 2Q4DA 2LUOA 3B1KA 5SZJA 2P67A 3U9LA 1Z28A 2GT1A 2HSGA 1GZ6A 1X1CA 2COUA 1J9ZA 3L5OA 2P9FA 4GXRA 4X45A 2FMHA 3TK1A 1P9WA 1DZIA 4YO8A 4HY3A 4GM1A 3UYLA 2BOVA 3DEFA 3GPLA 3OUUA 5DRYA 1DVRA 5J2TA 1SHJA 2JLVA 4PFKA 5AXAA 2PLAA 2HQSA 4G5OA 1RMYA 1UBGA 2QP4A 3K0CA 1PR1A 3BPSA 2VHYA 5EQDA 5IXSA 1NIJA 1YRLA 1O6FA 2OHJA 3B52X 3KSRA 4S0XA 1U5CA 4WEOA 3ZIAD 1IWBB 4ZWNA 2QT0A 4JJ8A 3UG6A 3VJLA 1YI1A 5I7HA 4DV2B 4Z3KA 2M98A 3AP2A 4I99A 5BRJA 1CULC 3E35A 4GOOD 3DMDA 3BZUA 4QUBA 5I7FA 4N54A 2R5NA 2ISCA 3DVQX 4N5MA 4RH1A 1L8LA 4ETMA 5IT0A 4B46A 1AG9A 4H2DA 1QU2A 1C1HA 3DO6A 3LG2A 1UF9A 1ST2A 4Q4DA 4JJKA 1RI4A 4NIMA 4HXYA 4YCAA 4BB9A 3Q4GA 1ZU4A 1XZCA 3MJHA 4M60A 3TOXA 2BEWA 5TR9A 3LI2A 4K40A 2IZZA 4IMRA 3K05A 1NYLA 1W35A 1IY9A 4HK4A 4ZZ2A 1T0BA 1OFGA 4QSMA 1MABA 5ARCA 2WQ6A 1MKYA 1H2FA 3IPLA 3ZNNA 3QU4A 2DUWA 2YVQA 2VYVD 3HABA 4RX1A 3I4LA 2HA2A 4JBLA 3PA8A 2Q21A 4O8CA 1XTVA 1OV6A 1T0PA 3SQOA 1RDFA 1DCTA 3OO1A 4DCJA 1WE2A 4PBRA 3EXIA 4B5LA 3M3HA 4H31A 3UCEA 2WUWE 5AVZA 1U6JA 2NU8B 1XDBA 1NRXA 4P22A 2AIRA 3HN6A 1RCTE 1WHSB 2K4MA 2ZAMA 4BRSA 5AKLA 4JYPA 1YDFA 1A5TA 1U65A 2QTMA 1GRVA 3UMFA 3ZH9B 4JCOA 3CT6A 3MS4A 2NX2A 3HKBB 1LI5A 5HWSA 3GMDA 1JEQB 3E58A 4RXUA 1THMA 3AUSA 2M1ZA 3S2EA 1B1AA 4F4FA 2QL6A 3D2BA 4Q15A 2LBPA 1ZD3A 4U2BA 3WDMA 4XYEA 2FLWA 4P5PA 3F9CA 4C76A 1C3OB 1GKIA 3KCNA 3V1YA 4N12A 1CCWA 1U2DC 3RK0A 1PV2A 5AW6A 3RVLA 2ZQ5A 4QJIA 4ZI2A 2UUBB 1GZ4A 2V4UA 1Q0QA 3A9WA 1WXDA 3BUSA 3Q8XB 1Q91A 2VDOB 3DQPA 4IIVA 1OZ0A 5AT1A 1DV2A 1QNLA 3NBQA 1RC1A 2OFWA 4C7OA 2ECPA 3LQQA 3SBXA 2Z83A 4UTZA 2NW6A 1C3OA 4QPDA 5FUVA 5KOIA 1JNXX 4AZTA 3E9DA 4PLYA 4H3HB 1BGWA 1Z36A 3OFKA 3TVTA 2BFOA 2ZR9A 3QFHA 3ZVRA 5TGZA 5IHXA 4KN6A 3ILHA 1LKZA 4U2EA 3FDZA 2QAGB 1VPDA 3GWZA 3TVDA 3W6ZA 3ZZTA 2Q9UA 3Q7TA 5TPWB 3LBHA 1BXKA 1YB7A 4ME6A 3SY8A 4OOEA 2OC4A 1C1DA 4UDXX 4IRXA 2QORA 2X8JB 4WJLA 1NHWA 1YBVA 1S2MA 3OBBA 5CNKA 3WA7A 3WLRA 2P9CA 4IHAA 4NJMB 2HJWA 4YCDA 5TPWA 4UQPA 2GZ3A 4NENB 1PG5A 1GFIA 5HUQA 3VSEA 1LLDA 4M8SA 2PRIA 4D0NA 1E8DA 3G9XA 4YWJA 1SQFA 1L5VA 1HUQA 3PCRB 1HL7A 2CB0A 3CNQS 2Y1KA 3PVSA 1S02A 4XOIA 4Z4FA 4BNUA 1IPHA 4NENA 4TLDA 3FETA 1OH5A 4WK6A 1Z06A 5BNIA 2HSWA 3MWFA 2ZT7A 3HXOA 1K2WA 3GJQA 1BRTA 1TIKA 1VDMA 2G07A 4O4IF 5ALXA 4UU7A 1IEWA 4AWBA 5I47A 4O4JA 4ZAVA 2FI1A 3GY0A 2ZCUA 5D85A 3ZWMA 1X7XB 2I6GA 1SPXA 3M1LA 4FFSA 3S4YA 3OEYA 2LP4Y 5JPCA 1INLA 3TGPA 4CKEB 4XVCA 4UU8A 2D1RA 1JHRA 3HVIA 1GZ7A 1ZU5A 3OQOA 4CIYA 5AKHA 4EGJA 3EG9A 5I3ZA 1AKRA 4O2AF 1K68A 4C7BA 4EG4A 2ROQA 1SGWA 1QOQB 4JGBA 4XDYA 3IQGX 5J5CA 1HTBA 3SZUA 3BCUA 4LXUA 4RPKA 4TSFA 4P9NA 1PNVA 1QFXA 3H42B 1NZJA 4MYCA 2BC9A 2TRSB 2I4OA 2H1RA 3AFIA 5CVEA 2IEAA 3ZZUA 3V4ZA 5CHEA 3H2SA 2KX7A 4BFVA 5ALJA 2UYCA 4HDMA 5FBHA 2NZYA 1RC0A 1J2YA 3E4CA 4CMAA 4LVNA 3B1WA 10MHA 3RYIB 1NW4A 1FMFA 3S2SA 4DXAA 1FNBA 3OQJA 2CDRA 3P20A 2X1LA 1DQPA 1JIXA 4DQLA 4EG0A 4NZYA 2FFBA 1N2SA 1AX9A 1QRDA 3LECA 3FX2A 4KJZA 4GYJA 1Z38A 5EUQB 1XKTA 3AV0B 3MIZA 5HZGA 2CV1A 1JR3D 1CQWA 3RIGA 4TN1A 3ZNQA 1K7SN 5H0IA 1ZNYA 2B8TA 2CE2X 1CQPA 3C98A 1XXHB 5B4TA 1T2DA 1L4MA 3DAHA 2AXPA 5I7SA 3ME5A 2QE6A 1E96A 4G0MA 2EG5A 2XNJA 2QMEA 4DRXA 2VYQA 5L3QA 1HLFA 4NBTA 2GEUA 2R4QA 2JFHA 4KGXA 4MKHA 2WMYA 5IDVA 2W37A 3PNOA 3GRVA 3TLYA 4EJ0A 3S81A 4QA9A 3NXSA 4QG7A 3OOJA 2DFTA 1SIOA 1KBZA 3SHOA 2WQ7A 3B2NA 4U7DA 1CF2O 2TMGA 1FUYB 2C42A 2HNAA 2D1QA 3K0BA 4NHOA 4BO9A 4EARA 3U56A 1Z5OA 1VE1A 3GDWA 1ORWA 3HI4A 3GFVA 4PLHA 1FNDA 3GFRA 3KEOA 4E46A 1JKXA 2R9VA 1JPNA 1Y81A 2PLRA 3HUDA 3OE1A 1ML3A 3LPDA 4WUTA 1N8TA 1X87A 1UBFA 1ATZA 3SZGA 4CIVA 1H2EA 1XCLA 4L5YA 4CI0B 5AW4A 4C0AC 2R8XA 3KSMA 4HNQA 4NABA 4QATA 3A14A 1H2ZA 3BD7A 4QGSA 3Q87B 2CFCA 1Q2XA 4KPUA 1WS6A 1Z37A 3PPVA 3GLGE 4UCWA 3DOOA 4C7VA 1BVRA 2PWPA 2R6FA 3H9CA 1X80A 4Q4JB 4KNWA 5COBA 3HWSA 3KWJA 4RLQA 4AECA 2D5LA 1TJ4A 3DVLA 3IUBA 2C7RA 1Y1KE 2WU3A 3LQ2A 2OFFA 1LFAA 2FEKA 4RPIA 1N6RA 2G8NA 3HCCA 4U63A 4RTOA 2PGAA 4A92A 4JJ6A 3H13A 3I2FA 3G2MA 3IVXA 2DY1A 5ECWA 2NZXA 1GPAA 5CA1A 1JIKA 4RA9B 2PJRA 3I1IA 4DR7B 4YEDA 2QMYA 2P0YA 4A8HA 3PQ3A 1ZD8A 5KZMB 4JITA 3CEMA 2CNNA 7ABPA 1DTWB 4J76A 4NE7A 1OXUA 1Z2PX 5JS2A 4HMOA 3UAVA 4DPKA 3F8TA 4RA9A 4PYIA 4AMBA 2P4SA 4MCIA 3L0DA 4G4GA 4ZCQA 1U5AA 1ECJA 1C5KA 1P61B 4MWDA 4PX2A 5ILQA 1V25A 2FX3A 3VR2A 1SKYE 4N82A 4OQNA 1ZG3A 2VSFA 5KNDA 2KSQA 2BFFB 2JAQA 2BR3A 2HUNA 1G8AA 1XDSA 3MWJA 4BNYA 4H1HA 4OUKX 1G4HA 5A5DA 1XRNA 4OSPA 4PANA 2HWWA 3CURA 3M2PA 4M21A 2HF7A 5HTOA 4L8VA 2WFLB 1YE8A 3PKZA 4QQ8A 4BLOA 4YUVA 1O94A 3RVPA 3DNFA 3G0GA 4Y2TA 2HRZA 3NAMA 2EARA 1FPQA 2IRWA 3T3OA 2QVCA 4JC5A 3SXUB 5SYAA 4FNAA 4EB6B 3PPXA 3VXKA 1S1MA 4MV1A 1M5TA 3VHXA 2O7VA 4F5EA 2CZQA 5KOJB 3ZCQA 4J4TA 5MN4A 1ENOA 3VTFA 4BCDA 5KTNA 5AO9A 4TWBA 1XZQA 4UBMA 3WGHA 3ZK8A 2FPXA 3ZIUA 4COKA 3TI7A 4HWPA 1Y8RB 1B7GO 3BORA 1FFBA 3O4RA 1QH1A 3QJYA 2M2IA 3ZVLA 3PHBE 4CDNA 1EP2B 1QRTA 4K6KA 5T3UA 2E6UX 2HBQA 1A8SA 4UREA 4WLNA 4BVKA 5KOJA 2ZK7A 3R20A 3JQAB 1QVRA 3F0TA 3KFLA 4BKPA 1JWBB 4JLJA 4OEHA 4D3YA 2P3OA 4CZ2A 3ZVNA 4P08A 5EE3A 3ACDA 5DHSA 2HXSA 1USVA 4F9TA 3DJYA 3D6MA 5GJWC 3SYRA 1YULA 1EZ4A 1XKXA 2FWBA 2FZWA 3A0RB 3DFMA 3DOHA 3KVRA 3L7IA 4KO8A 1NBMD 4P31A 2CKMA 1QIHA 4L6IA 4P8RA 4EF5A 2HXGA 2QX8A 3L93A 5JT1A 1ZLYA 2OBFA 3GZTB 5FUMA 4IJUA 4RZSA 4TM8A 1CC1S 3OETA 4K6HA 3V1NA 5ADWA 1VFPA 4DLLA 1SIUA 2GEVA 5CM9C 1QVAA 3C24A 3JQ8A 4D9JA 1XTPA 5DIFA 3C8UA 4M76B 3LY7A 4AY2A 1C30B 1VHDA 1N32B 2GPBA 2IF0A 2HQOA 1FXUA 2QD3A 2WVHA 3D6NB 1QH0A 1ZN7A 4BO3A 2GF9A 1SC4A 2YC4C 3EUWA 2A3RA 3ZIDA 3MBIA 1W52X 1YRWA 1FE8A 1QJ4A 1UQTA 3DBHB 3L7AA 4BNTA 4EFLA 2XMZA 2YIDA 4EW1A 6Q21A 2XGSA 2F1OA 5EHNA 2KLBA 2C8JA 2IEDA 3I6QA 3HO8A 4K5QA 5KCZA 2EATA 1RJ9A 3ASUA 3ZV7A 2E48A 2QOEA 2RI6A 3MSXA 4HCJA 1U1IA 6REQA 3QA9A 4FW8A 4KZPA 2CL6X 3VPXA 3PFFA 4ERNA 1IHDA 1X13A 4ND6A 4YUWA 3WZ2A 2HMWA 1PQWA 2VAXA 3LUCA 3NANA 4OXRA 4UFPA 4WHMA 2NPIA 3H75A 3L8DA 5I9TA 1T2AA 2YXLA 4D4GA 1GITA 5KI6A 3CLKA 3DTNA 5K8VA 5FA5A 4RFVA 5LLDA 3W5SA 2QP9X 4QO7A 5DMXA 3WL8A 1AGYA 2YRWA 3WWYA 4F5ZA 2MWMA 3OCWA 1Q3HA 4L78A 1CKEA 1CS4C 2ZU6A 1MT0A 5BP7A 1D07A 1U81A 5KDDA 5AUPB 1KIAA 2JF0A 4NAHA 2YN4A 4J0DA 4LK3A 2OO5A 3BC1A 3K6SA 1VYTA 5J2UA 2RD2A 3KR0A 2JIOA 1YGYA 1VYUA 2GN6A 4DY4A 1YHNA 1O9BA 4FCTA 3K0FA 4LDNA 4ZEWA 3WSTA 2EP5A 1AGNA 3ETCA 2UKDA 3CVXA 2PWZA 1JMVA 2XGGA 1H6BA 2QJRA 1EESA 1XLWA 1H5NA 3DTYA 4U02A 1E4EB 1U2EA 2ZIZA 2EKLA 3FRHA 1S9HA 3O8DA 3RGGA 1U99A