4BAZA

Structure of a putative epoxide hydrolase q244e mutant from pseudomonas aeruginosa.
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
298
structure length
296
Chain Sequence
TDPLLPGFDYLTLHTSAARLRVAVKGSGPPLLLLHGYPQTHLAWHRIAPRLAEDYSVVLADLRGYGESRALDGADYSKAALARDQLETMGQLGFERFAVIGHDRGARVGYRLALDHPQAVAAFVSLTVVPILDNWAAVNKVFALNAYHWFLLAQPYDLPERLIGADPEHFLDYTLRRMAQGRDIYHPQALESYRRAFRDPAVRHAMCEDYRAAVGVDADADQADRDAGRRLQCPVQVLWEERPYAAGQHPLEIWKTWAGQVEGAAIGASHMLPEDAPDAVLEHLLGFLASHREALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE EPOXIDE HYDROLASE
publication title Structure of a Putative Epoxide Hydrolase Q244E Mutant from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase
total genus 113
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2012-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bazA00
2WTMA 3G7NA 5HQ3B 1U2EA 2LIPA 2PKYX 3G0IA 4WDQA 4J0JA 3V1LA 3G9TA 2WIKA 4U2FA 1ZI8A 3B12A 1QJ4A 2JF0A 2WU4A 3DKRA 1CUVA 3ICWA 4DMHA 2HA4A 3G0DA 4J3JA 4EY4A 3O9MA 3QMWA 5FPQA 1LPOA 2C0PA 1W75A 5AP9A 3STTA 1EI9A 2G4LA 3D7RA 5HQ3A 1DX6A 1JKMA 4C4ZA 1G66A 3H1AA 5HFNA 4GW3A 4ARAA 4L72A 4JYMA 1FFBA 4NVRA 3L1IA 3D4LA 4JUIA 1E5TA 2WUEA 5C8VA 1R3DA 3VISA 4DNFA 5FP0A 4N5HX 4PSCA 2HA3A 3HXKA 5ALQA 3NWOA 4DTCA 4KAAA 1DQYA 1MTZA 2WFLA 1Q0ZA 4J03A 5LKRA 5E4JA 1EXWA 1PFQA 4AMZA 4Q3KA 1DX4A 2CB9A 4O08A 3R3VA 4OSEA 2WJ4A 5ALWA 2O2HA 5AI0A 3E0XA 1HDEA 4C87A 1IVYA 3AIOA 5AM4A 4BRZA 5AI6A 5HFAA 1GKLA 3VDXA 4B7ZA 1ODSA 2XQGA 5CH8A 5AICA 2XLCA 4F5ZA 4X71A 4K6GA 5BOVA 4X92A 2FJ0A 2VA9A 4KACA 1TK3A 2HFJA 3I2JA 2XUDA 1BN6A 1K63A 1C7IA 1UK9A 5FDFA 3WKEA 4N5IX 3VKFA 5FPPA 4CG2A 3WMRA 1A88A 1GZ7A 3A2LA 5LZ7A 3C6YA 1CUYA 1F6WA 3KDAA 3H2JA 5FV4A 2JGKA 2XUKA 5DTJA 2IX9A 3WZMA 4UBOA 3D3NA 2GBGA 5AOCA 2YASA 4AO6A 4BCBA 4KE8A 1XZKA 4CFSA 4HTAA 3TRDA 1X2BA 1GQSA 1THTA 1WB6A 4H7KA 4KJXA 4X85A 2XMBA 3IUMA 1JU4A 1SCIA 3DNMA 1XLUA 2W6CX 2WM2A 4IH1A 1Q0RA 1GQRA 3F9CA 2VJBA 4QDOA 1TIBA 2AJDA 3O4GA 1WHSA 4AO7A 2H9YA 3G9ZA 4Q82A 2EEPA 1GPNA 1G42A 3RK4A 3WA7A 1J2EA 4N8SA 5KREA 2PM8A 2H7CA 1H2ZA 2UZ0A 1ZIXA 3CXUA 1ZD5A 3GROA 5HF9A 2ZVDA 4LYEA 5JASA 3PFCA 5DNUA 2VQ6A 1MU0A 4W63A 3QMMA 1U65A 2FUKA 3D2BA 3D5EA 4PO3X 2CJPA 1BEZA 4TVKA 1A8SA 3V1NA 3I28A 1E89A 4QE3A 1JMYA 3IIIA 1XZCA 1XZLA 2XUJA 1OXMA 3MUNA 4A23A 2XMGA 1JT2A 4RNCA 1XZIA 2PUHA 2R8BA 3NOXA 3V48A 3AZPA 2WG2A 3WKBA 5ALYA 5K3FB 4Y7DA 4GBGA 1CUFA 3FYUC 1JFRA 1O6GA 4G4JA 4FBLA 3HYSA 2I03A 3VXKA 2B61A 1U8EA 3PUHA 5CXUA 5IVDA 3O4HA 1XLVA 4RGYA 3H19A 1LPSA 1ORVA 1QTRA 2QR5A 1QOZA 1XZAA 3OG9A 5CT4A 1P0PA 3IB3A 3I2FA 5ALXA 2DR0A 4UPDA 2VJDA 4DYHA 2QT9A 5T4EA 1BE0A 2OQVA 3ANTA 1XQYA 1JJIA 2XUAA 1CUJA 3ESAA 4CCYB 5ALTA 5A6VA 5ALLA 2Z3ZA 3ESDA 1FFAA 2Y2UA 4Y9SA 4KYVA 2RI6A 4E46A 5JIBA 1Q84A 4DMKA 4KRXA 5AOAA 4FBMA 1XRLA 2PBLA 3BDVA 4W1SA 4X97A 5DLPA 3AJAA 2XQIA 3R3WA 4MQMA 4CCYA 3C70A 3IUJA 5EIAA 5EFZA 5HK8A 5CW2A 4W1PA 3KXPA 5HK9A 3O0DA 4RE5A 5DYYA 5EIEA 2HA2A 4RE6A 4MJ3A 4UFOA 3SK0A 5ESRA 3C6XA 1H2WA 1YA4A 2QXTA 3STYA 1ZGCA 2PSJA 3WK6A 2XUIA 3I1YA 5AK4A 3WKAA 2ZYSA 2ROQA 5C81A 1UKBA 2DFPA 4G8DA 2E3JA 3WL6A 7YASA 4EB0A 4H7HA 3N2ZB 4GEGA 1SC9A 2YYSA 3IDAA 4Z49A 4NS4A 2W22A 2X8BA 4C88A 5LZ5A 1QIKA 3BE8A 3H04A 2ZJFA 1AUOA 4MWSA 4OB6A 2ACKA 1EDEA 2HDWA 2OGZA 1K8QA 5LZ9A 2ZJ6A 3LLCA 2ZYHA 4PW0A 1DINA 5EHQA 4OB8A 5AI8A 4BVLA 4LXGA 5CH3A 4BTLA 2VTVA 1QIEA 4DNOA 1AZWA 4XJVA 1VA4A 4Y2TA 5E4TA 4GXNA 3ANSA 1YCDA 1W6RA 4X6YA 4CI9A 4A16A 1UOOA 4LYDA 4DSZA 4XWGA 3EIOA 1XZMA 1LZLA 3FVTA 2XDWA 2BUCA 2HFKA 3W2TA 3M3DA 3WK9A 5ALIA 1MPXA 3HRHA 4QLOA 1H22A 3L1HA 4QA9A 1EB8A 4FHZA 2Q0XA 2WLSA 3I6YA 3I2IA 2HA5A 2D0DA 4XIIA 1EB9A 2PU5A 4DNQA 2Z3WA 3DKKA 5ALHA 5K5EA 1R9MA 1AKNA 4H7FA 5LKAA 4Y2PA 1CR6A 3N0TA 1VLQA 2ZSIA 2WFMA 3HSSA 2WUGA 3FYUA 4Y2UA 3WK7A 2XB6A 3PE6A 2XQKA 1SCKA 3ZLVA 1C4XA 1KEZA 1N5MA 1MX1A 5CURA 5BWBA 5EHXA 5AKEA 5I8PA 4FLMA 2K2QB 2JGFA 4Q1VA 2OGTA 1MAAA 4CG1A 5ALGA 3PF8A 5AKLA 3VJMA 5JAOA 4UHFA 2G5PA 3I2HA 3KD2A 4UHBA 3QH4A 1F8UA 2ACEA 3ZWQA 3HEAA 4FMPA 3V1KA 4G8BA 3I2KA 5JZBA 4MXDA 4Q3OA 1S8OA 3IBTA 1J07A 3WWCA 5AM2A 3QPAA 3BL8A 4IH9A 4BAGA 1CUDA 2CBGA 3AZOA 1CUIA 2C5GA 1ZICA 3R3YA 5ALSA 1QIGA 4X6UA 3WL8A 1ZI9A 1QIFA 2RAUA 1BN7A 3QPCA 2RONA 4UHHA 3ED1A 1HL7A 5IKXA 5JAPA 1XRPA 4J7AA 4BP8A 4Y2SA 5AKKA 3KOOA 1LPPA 5DJ5A 3SC2A 1BU8A 2OAEA 1CVLA 5AI4A 1WB4A 1LBTA 4M0MA 3HC7A 3LS2A 3S8YA 4M0EA 1J1IA 5CRIA 2OXEA 2XMCA 1CLEA 3QITA 4X94A 4G9GA 5ALMA 4ZREA 2OCLA 5FOQA 2IIVA 4OU4A 4QWMA 4HS9A 3WL7A 4DIUA 3PFBA 2GZSA 3FOBA 4OD0A 1XZGA 3H18A 5AKGA 4G9EA 1DWOA 1LPNA 3CCCA 4Y2XA 3G9UA 5JAHA 3BWXA 1VE6A 3SX4A 2VSQA 4BATA 4TPKA 1RYYA 4U2EA 2WUFA 4BCCA 2WFLB 3W9BA 3PICA 5KWIA 4J0DA 3R40A 1WCYA 4FFVA 4OUKX 4QDUA 2WIGA 1WB5A 1JI3A 4PV7A 2VJCA 4BP9A 3DOIA 1CRLA 1QE3A 5CH5A 3AFIA 4B83A 4G1FA 1X2EA 4YK7A 3VJLA 5I9IA 1CUUA 3WWEA 2AJBA 4PF1A 1FFEA 5LZ4A 2BKLA 1EVEA 5DNVA 4WCVA 1E8DA 3WKCA 3NUZA 2V96A 4X95A 3W05A 3LIPA 1QIMA 4E15A 1KU0A 4HXEB 3GA7A 5JD6A 3G0CA 2BGRA 5DYWA 3DEAA 3P2MA 2OG1A 4QLAA 4L0CA 4FFWA 4ZV9A 2X76A 1YS2X 5FLKA 4UHEA 4C01A 4QDTA 2XE4A 2JBWA 4U2GA 2JGJA 2QMQA 4KE7A 4BRSA 1XFDA 5AI9A 2I3ZA 4L3WA 4Y2QA 4UFNA 5JARA 3DL7A 4EUSA 1OCEA 4B85A 4EY8A 3D59A 2XMQA 3TEJA 4DGQA 1QO7A 1BS9A 1EHYA 3WA6A 3E3AA 3WQHA 2VATA 4FKBA 5HF5A 2WILA 2CEKA 4B0OA 1LLFA 4F0JA 2B9VA 4H7IA 4KE9A 4DMCA 5F4ZA 3C8HA 5FXMA 5AK6A 1E3QA 4BAUA 2OLEA 1R1DA 5AM3A 4INZA 2ES4A 1KU6A 3UUEA 3W04A 2FJPA 4M0FA 2O7VA 1ZGBA 1E8NA 1ZJ4A 3RKSA 1IZ8A 2VF2A 1XQVA 3LIIA 4EY5A 1GKKA 2PSHA 2XMDA 1ZIYA 1NX9A 4QNNA 1YS1X 5JANA 2QUAA 3KSRA 1CUSA 1AQLA 4BE9A 4BAZA 1VXRA 2HA6A 2PPLA 1W76A 3OURA 2RHWA 4BTVA 3DYIA 2YH2A 5HF6A 4JYPA 4EA6A 2QZPA 2XUGA 3JWEA 5A7GA 1HLGA 5JYCA 4MEAA 3QYJA 5CXXA 2O7RA 3T4UA 5A2GA 2YXPX 5D3ZA 1I6WA 1MO2A 5AOBA 2XT0A 3BJMA 4WY8A 1EA5A 3SWWA 1XZEA 3L1JA 4H77A 1RWQA 3DL4A 1UK8A 1IUPA 5AKZA 4DM7A 1U4NA 2CMFA 3D2AA 1CUWA 2P8SA 4ZXFA 1SCQA 3IVMA 3ESCA 3QM1A 4ETWA 3WJ1A 4K2AA 4WY5A 1QGED 1CUEA 2WHRA 4KR0A 3MVEA 2D5LA 3DJYA 5AH0A 5K3CA 5JATA 5IVHA 5AI5A 4IH4A 4KE6A 4WFJA 4UBLA 2ECFA 1L7QA 5ALUA 1ACJA 1R50A 2V9ZA 5EI5A 5K3DA 1A8UA 1WPRA 4DNPA 2G5TA 3C43A 3QPDA 1VZ3A 3EQ7A 3HABA 1LPAB 3IURA 4OPMA 4TGLA 3I6ZA 2WSLA 4XVCA 2RHTA 2AJLI 3FWHA 3O4JA 4QWWA 4F21A 3IUNA 5HZGA 2QJRA 3GBSA 2BFNA 1K4YA 2R11A 2IITA 3STXA 2HIHA 1CEXA 2XMSA 4OCZA 1XKTA 4QEKA 5E2IA 1SOMA 1EK2A 3CCBA 4CCWA 4Y2JA 1CPYA 5ALKA 4ITVA 4RPCA 3UUFA 2Y6VA 3R0VA 1ORWA 4X91A 1QFSA 3BIXA 2I78A 3I2GA 2C58A 4UBIA 4AO8A 1JJFA 4ZV7A 1ZD3A 2GYWA 1P0QA 3G02A 4HRXA 3AINA 5AM5A 1QONA 5LIPA 4CIBA 2HU5A 5ALZA 4FOLA 3S2ZA 1XKLA 4P93A 2JIDA 1FJ2A 4P08A 2QXUA 1OILA 3WZLA 5EHZA 3QMVA 4BVJA 4WFKA 4ROTA 3WK4A 1VA5A 2XUFA 1UXOA 3X3HA 3WKDA 1E66A 5DNWA 3DOHA 1QIHA 4AMYA 1ETHA 3O95A 1AX9A 5HKAA 2BGNA 4QDXA 3WI7A 4KRYA 3ZI7A 2BJHA 1GPLA 3Q8WA 4EZIA 4EY6A 5BWCA 4NZZA 3T52A 2CKMA 4BC0A 5CTAA 2DHDA 4U2BA 1R4ZA 3OTQA 4P92A 1UFOA 1VXOA 1YB7A 2WHPB 1Y37A 2XMRA 1HQDA 3E4DA 5AKIA 1QZ3A 2XUOA 2BUAA 3E1GA 2XUQA 4UBNA 5AHXA 3FSGD 2HADA 4OU5A 4X93A 2ZSHA 5AIBA 3UMJA 1BROA 2RGUA 3WJ2A 2JEZA 4C6HA 2WHPA 3WWPA 4J0CA 3A6ZA 1TRHA 1BRTA 3ICVA 5JD5A 3FYUB 1YA8A 3HJUA 3LP5A 1L7AA 5JALA 2VT6A 3W9UA 4IO0A 4V2IA 1DQZA 4ZGBA 3AIKA 1EX9A 1K5PA 1MT3A 3IA2A 1QO9A 3QBJA 4UHCA 2H7YA 3A2MA 4G4GA 1GXSA 3DCNA 5AKJA 2WTNA 4ARBA 1PJAA 4FNMA 1Y7HA 1O6FA 2HU7A 3EQ8A 4YASA 4I4CA 3A70A 4NMWA 2C5FA 1UT6A 1QLWA 1YR2A 1CUCA 1FSSA 1GT6A 2QM0A 2HA0A 5D3KA 3WIOA 2QTBA 2DHEA 3FYTA 1XQWA 4UBKA 5J3JA 2WUDA 2C7BA 1XZBA 5DWDA 3EQ9A 5CT9A 3DS8A 3OC0A 3EF3A 4YPVA 2HM7A 3F67A 4EY7A 5A7FA 1ISPA 4ZWNA 1ODTC 1ZD4A 2HRQA 1H2YA 5A71A 4CIAA 2WFZA 3FCYA 3K9BA 3I6MA 3AZQA 3WYDA 4FTWA 3HZOA 4BZWA 1G5FA 3B3QA 4HZGA 4F60A 2QKYA 1GGVA 1N5RA 2BCEA 2CZQA 4E14A 1M33A 2EDCA 1XRNA 1UK6A 1UKAA 1X70A 5AO9A 3ESBA 3FBWA 4QZVA 5ALFA 4H35A 4B9EA 4B0PA 2EDAA 2FX5A 2C0QA 1CQZA 4PNZA 3H1BA 1TCBA 1TCAA 3H2IA 2QRUA 1QIDA 5EGNA 4G8CA 1D07A 1JMKC 3K2IA 5ALPA 2XUHA 1BEEA 1N1MA 5KBYA 5YASA 1IUOA 2JEYA 4ZRDA 3WIBA 2AJCA 2QUBA 2GBIA 3WWOA 5AM1A 2NW6A 4OYLA 5AKXA 5HF8A 2PSFA 2ZYRA 4H7EA 3FAKA 1DWQA 3BF8A 2ZYIA 1L7RA 1CUXA 1WHTA 5K3EA 4Y2VA 5SYMA 4MEBA 3V1MA 5AKHA 4BB0A 3W06A 2VAXA 3FNBA 2HL6A 4X6XA 2JGLA 4UUQA 2BUBA 4FDMA 2Z8XA 4GWLA 4WDRA 1FFCA 2XUPA 3I1IA 1DWPA 3GELA 3O4IA 5LLSA 1GPKA 1UZAA 2ZJ7A 4BZZA 2OPHA 4N8EA 1CIJA 4H7DA 2WQZA 3H2HA 1MNAA 1JJBA 3DDUA 4J0HA 1LZKA 5JZSA 4DMFA 5BV7A 2PVSA 1WM1A 3U0VA 2XQJA 1C7JA 2DSNA 1MJ5A 4W1QA 3FLAA 3D2CA 3OM8A 5LP1A 3ZV7A 4U2DA 2PSEA 2DCMA 1EK1A 1UK7A 1YAJA 3AILA 5CT6A 4HVTA 3KWFA 2PUJA 4K6HA 1TKRA 4EHBA 5ALDA 3PDCA 1QIIA 4IHAA 2HU8A 3BJRA 2GYUA 3STVA 1XRQA 1IUNA 3R3UA 1XLWA 5DTIA 3C5VA 2AXEA 3WWDA 5EIHA 1VZ2A 1UKCA 3NGMA 4X90A 1RP1A 4X3CA 2Y1KA 5IVIA 4Y2RA 3C6ZA 2V98A 4PSUA 4BCDA 2XI4A 3Q0TA 3R3ZA 5H3HA 4S0XA 1UWCA 3RM3A 3H0CA 1E8MA 3M83A 3B5EA 1YASA 1F0PA 1H2XA 3QZUA 4JEIA 2V97A 3MGAA 4J0IA 3WK8A 5AM0A 5JAUA 3VVLA 4N8DA 1DT3A 4B6GA 2HRRA 1ZI6A 3F96A 3F8SA 4PQEA 1B6GA 4KAFA 5A7HA 1LNSA 3G9XA 2XLBA 2OQIA 4GECA 4H0CA 5A62A 1W1IA 4Y2YA 5ALEA 1VE7A 4B81A 1ZD2P 2WG1A 5K3BA 3DQZA 1B41A 2VAVA 4MYSA 4BC1A 3A2NA 1LPMA 1EH5A 3G0BA 1ODCA 2HHAA 2ONCA 4JNCA 1USWA 5KWJA 1VOTA 3AUKA 1IZ7A 3TJMA 4C4XA 3BDIA 2PU7A 1CUHA 4MQLA 2PX6A 5K3AA 2J3QA 3RLIA 1VKHA 4J0GA 1HBJA 5AIAA 2WKWA 4UFPA 1A7UA 2G63A 1Z68A 3CN9A 2GYVA 2Z5GA 2QOEA 4XX1A 5AK5A 2O2IA 3AIMA 5ISMA 1P0IA 4MYDA 1SFRA 1XRMA 3C6BA 1Q83A 5HCUA 4AQDA 4GI1A 4H7JA 2QS9A 3PI6A 3FCXA 4GDMA 2BAGA 5LZ2A 4AB1A 3IUQA 4AXBA 1XZDA 5IH7A 5ALJA 4H18A 1UOQA 1NU6A 3C5WP 2OCGA 1YSCA 1XQXA 3U1TA 2OCIA 4HXFB 5ALOA 3IULA 1W4LA 5CT8A 4UBJA 4B80A 4FLEA 3K6KA 5ALVA 3KWJA 3GUUA 3FVRA 4Q3LA 4HRYA 4J0KA 5K3FA 3C87A 1MNQA 4ZI5A 4B84A 1P0MA 3C45A 2OAGA 4U2CA 1CUGA 1CFJA 1AGYA 5E4YA 1XZJA 3HI4A 2WIDA 3H17A 4BDSA 1CQWA 4LXIA 1UOPA 2AJ8A 4A5SA 5T4HA 4BBZA 4AZ0A 4KAJA 4I19A 1WOMA 1LGYA 2WJ6A 2J4CA 2J4FA 1MX9A 2JGMA 1ACLA 1R88A 2WIJA 3GFFA 1IMJA 4B82A 1ZOIA 2JGEA 4QDZA 3HACA 1PV1A 2XMZA 1ZJ5A 1AURA 4D9JA 3HLKA 1VJ5A 5CT5A 1EINA 3JYHA 2PSDA 2J3DA 5T4BA 3STWA 5SYNA 2B20A 1R9NA 3DD5A 2B4KA 4LIPD 3GZJA 4W9RA 4X7BA 1AMNA 4OYYA 5D7BA 3M82A 2H7XA 2OCKA 4G4IA 1EDDA 3DLTA 2VEOA 5JD4A 3ZLTA 1TQHA 4LKOA 2XQFA 4WJLA 5FRDA 3MUOA 4KEAA 5C8XA 4FWBA 1XZFA 4Q34A 3JW8A 5AK3A 4BYMA 3FSGA 4BVKA 1YB6A 1DTEA 5IVKA 5HKBA 3FLEA 4LHEA 3VJKA 5CBKA 2Y6UA 4FNGA 1XZHA 4JH0A 1T2NA 5ALNA 3LCRA 4UHDA 2X5XA 3WYNA 3FLBA 3V9AA 2QVBA 4P9NA 2CUTA 3CN7A 1Y7IA 3PUIA 4G5XA 4C89A 5C8ZA 1EDBA 3F97A 3ZLUA 3RARA 4C4YA 3VVMA 5C7YA 2H1IA 1CUZA 4K6KA 1HPLA 5ALRA 4B9AA 2GBCA 1NU8A 3G8YA 4FLFA 1LPBB 4GLBA 3YASA 1BCSA 1BCRA 2PL5A 3ZPXA 4L9AA 5T4FA 4HAIA 5LZ8A 3D0KA 5I7UA 3R3XA 4HXGA 2Z8ZA 1K6EA 3C8DA 4AN0A 1CUAA 4W1RA 4K5QA 3BF7A 2RIPA 5FUMA 4CG3A 2WU3A 3O9VA 4MWTA 4OB7A 3EBLA 3OOSA 3PF9A 2GBFA 3H2KA 3OPMA 4EBBA 4AZ3A 4DSAA 5JADA 2GZRA 5EHNA 4DLNA 1A8QA 4Q05A 5LYYA 4BDTA 4UBMA 1MX5A 1YAHA 2Y2VA 1J06A 4E11A 1DU4A 1THGA 5CMLA 1MAHA 3ILSA 2I3DA 3BIWA 1W52X 2DHCA 3TGLA 3R41A 3WL5A 1TCCA 1LBSA 2WG0A 3F98A 1QTIA 5AJHA 5JZ9A 4BE4A 6YASA 1F0NA 2VT7A 4IQ4A 1N8SA 1T4MA 3H2GA 2ORYA 1QFMA 4GHWA 1XRRA 1DT5A 4AX4A 3G0GA 1AC5A 3STUA 5AKYA 2WHQA 2JGIA 1H23A 2WJ3A 2DQZA 1XROA 4X00A 1MN6A 3WLAA 1CV2A 3DYVA 1QIJA 2QJWA 4AN1A 1G4HA 1CUBA 1HKHA 4PSDA 1WPXA 5D6OA 3WK5A 2C4HA 2HA7A 1TAHA 1EVQA 2O2GA 5DYTA 4WFIA 3BXPA 3M81A 3QVMA 4LXHA 5FKJA 2OGSA 2WIFA 4YX9A 2DQYA 1JU3A 1FFDA 4I3FA 2VJAA
chains in the Genus database with same CATH superfamily
5ICGA 5FTJA 2WTMA 2YXDA 3WYCA 4J94A 3NWJA 1GYPA 3VPXA 4OI4A 2JRLA 3RV3A 1DRUA 1WS6A 3MC1A 1KE2A 4GS5A 3DMFA 3EZNA 5FADA 4BQOA 1G6HA 2PNFA 4MJXA 1RTTA 2OB2A 4ZMRA 3V1LA 1GJRA 2GBPA 2WIKA 1F2TB 4U2FA 3IGFA 3U48A 3EYWA 4E22A 4ED9A 3NWBA 2RKWA 5C8YA 2J45A 2GD6A 3QX9A 3V32A 3RT1A 1YL6A 3FWYA 2KLBA 3ETEA 3O92A 3GLHE 4KMSA 2DXIA 1Z6XA 3V5NA 3H5IA 1VKNA 4LAFA 4XUCA 5DGIA 2P91A 3SDZA 4CZ2A 5AMXA 1NVEA 3TZCA 2IOYA 2E4VA 3UWOA 3O9MA 5CNKA 2IV7A 1A72A 4YAWA 1LPOA 1U0FA 5GGYA 1BJKA 1Y1QA 4FGJA 2CDBA 2QN8A 3UKOA 4Q4HB 4FW8A 4MRMB 4HG2A 1P44A 3V4VB 4Q9NA 3VSCA 5HKKA 4ZCQA 2FRVA 3ZWCA 4DCPA 3E2IA 2A0UA 4I1VA 3U4DA 1TVCA 4RD4A 1A9SA 5T64A 5G0SA 4UVHA 3REFA 3V4OA 5K51A 5TF0A 4C2AA 1FP4A 4GW3A 4BN4A 4ZDJA 3QOXA 4LTDA 2XOKA 5TQVA 4PXSA 5CYPA 1Z56C 4RM3A 5EXDA 4JJ6A 2IKSA 4YNBA 1UZMA 4BRWA 4QOFA 2CXHA 3L1IA 4OGGA 3MS4A 4WIAA 3UO8B 4AMGA 2D3WA 3MMPA 2QROA 1BIFA 1QJCA 2CYCA 1AGXA 3TLGA 4DJTA 3VISA 4N9WA 3SKYA 4XM0A 3UJHA 5JDIC 2IYOA 1VSTA 5MGBA 3JSAA 1NQOA 3TDMA 2RHMA 3BOSA 4DTIA 4PSCA 1YZQA 2HWXA 1D1QA 2ZKIA 2HA3A 3KSUA 3QX7A 2OLJA 4K3UA 5ALQA 3NWOA 2IBTA 1UDRA 5I7HA 3AEYA 1PJZA 1E60A 2GB4A 1JPVA 3PXDA 5TEWA 2HY7A 3V6MA 3PNMA 2EBHX 3IE2A 2WFLA 4O4HB 1QE0A 2YV1A 5LKRA 1LF0A 2FMXA 3NBMA 5E4JA 2RMKA 3DWEX 2XZLA 4DC1A 3F46A 3REOA 4LX8A 1XLTA 1BXGB 2GNOA 3SOPA 1IHDA 1DQRA 4MROA 2F8LA 3TGWA 1EXWA 1ECBA 1PFQA 5E6RB 5M34A 3R6WA 4QQKA 1QNLA 1DX4A 1FFXA 4Q1AA 1Y3CE 1LBQA 1OFHA 3QYPA 4XDHA 4L4XA 3K5WA 1CQIB 3M70A 2IZ5A 4OSEA 2OK7A 3CH6A 1SXHA 3HJAA 3RBVA 4WZBB 4DARA 4C4TA 2OP0A 2PKRA 3ZH2A 2R6AA 3EA4A 3NXKA 1G8PA 1G7TA 4HB2A 3RAJA 4I2VA 3I3SR 5F64A 5I9SA 4EMSA 5C9ZA 1IVYA 2JVKA 3F6BX 1KVSA 1L4MA 5LOVB 4JU9A 3GIWA 5AI6A 4C7JA 1W5AA 4L8YA 3F8WA 1IMOA 1JYFA 1ECGA 1YO6A 4OYRA 5CP8A 3TPFA 2KBFA 4B7ZA 2OCDA 4PSAA 3ZGVA 4H08A 3U3RA 2Q9CA 2XLCA 4F5ZA 1FP7A 1D5WA 2XT6A 3JV7A 2VS1A 3BGDA 3PT5A 5FBKA 5BOVA 4KGZA 3U9LA 1NULA 1EUCB 1WZ2A 2FCRA 1CK4A 2GEKA 2D00A 4EW6A 3U39A 4QO7A 2OBLA 2IUUA 1J5EB 1NQVA 2OP1A 3S40A 4REMA 4MDFA 3L4BC 4OHRA 1Z6ZA 4KACA 3I2JA 3KAKA 2O23A 3GEHA 1YR6A 2VH5R 3ITEA 4TWBA 2ZULA 4A2CA 3AR9A 2XT9A 4DYVA 3FNEA 9LDTA 4NFLA 2FW7A 1DAIA 2ZPTX 4YGXB 4AWXA 1JEEA 2SICE 4EABA 1FX0A 4DV6B 4R3UC 1IQ0A 4MHOA 3DMHA 1KK3A 5FPPA 4MS3B 3WMRA 4CG2A 4J1TC 2E5LB 4UZEA 2ZQYA 2CLMB 5DZSA 4QLBA 2Q7XA 1QVRA 3E22B 2D7CA 4MVJP 4YHBA 4S1TA 2A1TR 2EG9A 4DNQA 3NBKA 4QX6A 3TZLA 3KS9A 2NTNA 1G0NA 4MAMA 4Q7KA 2Q9BA 1FDRA 1V7ZA 1WDWB 2HPAA 4C05A 1K8XB 2FPSA 4G5GA 3ZX5A 1ENPA 3SSNA 1CY8A 5C35A 3CWQA 2IPNA 2YHAA 3NYWA 4IV8A 2UUOA 4A5OA 1PZMA 1UDXA 5BT9A 2JGKA 2OFOA 3C7DB 3O2NA 5DTJA 3SS9X 2YHIB 2F55A 2B8TA 3V2IA 4MUMA 4R84A 2PBFA 4BPRA 1QGUB 4AN4A 2G1JA 3OM0A 2XTMA 3VTZA 2GBGA 4CUKA 2O1EA 2EX0A 3L8YA 3Q9LA 4AF8A 5TARA 1Y81A 2YASA 1VG9B 4OBBA 1ZVVA 1Y9ZA 2BMJA 3QNWA 1G38A 1QZUA 1TF5A 2TSYB 4KE8A 1WX1A 4OK5A 4HDNA 4CFSA 2QU8A 1ZK1A 4YT2A 3USZA 3BD6A 4EFKA 5EOVA 3LHKA 4HRVA 2JAWA 1QOPB 4V1CA 4QGSA 2R6CA 3PR1A 4NOLA 3S1AB 4P1ZA 1X87A 1Q50A 4FFMA 1QHHB 1THTA 4LMAA 4HRAA 2QZJA 3DO8A 2C1EA 2ONZA 3FPEA 2ZE7A 2UZAA 5JJCA 2XMBA 1PUIA 1HO3A 2PGXA 2ZYUX 4CYMA 1ECJA 3FLMA 3IUMA 4N54A 2AHRA 2VYFA 4LCBA 1JU4A 1KI9A 2QF7A 2B4TO 2HMTA 1P1CA 4MUGA 5TGZA 4DMUB 2O50A 4EJSC 1NRXA 3VQTA 4B6EA 2F59A 3D8UA 1W73A 1ENOA 3WGUA 3ENZA 3O7MA 4IH1A 1HNNA 1Q0RA 1GQRA 3Q1KA 1YJBA 4RTPA 3NI2A 2RBEA 4EKYA 3W3ZB 3AESA 2WI8A 4A8PA 1XOIA 1LV7A 4F2DA 4TSFA 4YRCA 3E23A 3LFTA 4AO7A 2H9YA 4MVJD 5G0TA 4C76A 5K8VA 4DR5B 3AVTA 1NJ8A 1TZJA 2MR6A 3H11B 1H65A 1JFLA 1RYEA 3VOBA 1OWLA 3I4LA 3RRMA 3KLOA 1G42A 3ACDA 3WA7A 3OHSX 3FF1A 4BGUA 2PZAA 1Z83A 1C2YA 4GPEA 1SQFA 2IEZA 4P3YA 4RPGA 2R87A 4HPWA 1XYGA 2FFHA 1PVOA 1RFLA 3NXSA 3UW3A 1Q6YA 4NYMQ 2XH8A 3GROA 4D80A 4W9NC 4BMCA 5L51A 3L8MA 3GCZA 5EE5B 4Q3EA 1T5LA 3K8OE 4OMDA 4WY2A 3CC8A 1B15A 5BXYA 1EQ2A 1FYFA 2BMWA 4GYWA 3ISTA 3D2BA 2IIBA 4EG5A 1WVIA 1F06A 3FDIA 1LBEA 4MPDA 1QFJA 4PO3X 3T54A 5I8WA 2R8ZA 1XR3A 3DOFA 3E6AA 3LNCA 4GM1A 1JEYB 1SY7A 1XZPA 1ZJYA 4RY8A 2BD0A 4Y0NA 4DNXA 2KI5A 3AOEC 1ECPA 3D43A 1JMYA 2YCBA 3IIIA 4R2JA 2GTPA 5C80A 1OR8A 1FQOA 1XZCA 4BGIA 2NU9A 1W59A 1T5TA 1OXMA 3MUNA 4NOKA 4XARA 4WZAA 1Z5WA 4A23A 5LL6P 1E4OA 1KEVA 1NVVR 3HYLA 4HYEA 1PFKA 1U2RA 2XNKA 3QUTA 4MARA 1II8B 1DCTA 3ZD7A 1R6UA 2Z43A 2PVCA 1AGNA 2QZSA 2KHZA 2EXXA 3OIVA 1KQOA 1QH8B 4RJJA 4Q9LA 4X1IA 3UOAB 3ZKAA 1CR0A 2Z9CA 4GBJA 3OMWA 3CUSA 5KVVA 2DFKB 3WKBA 1NUTA 4TT8A 1AF7A 1DSSG 1QCDA 2H5LA 1XTUA 2A59A 1G8AA 3PQCA 1ULSA 4FFSA 1E6UA 1DX9A 2IOFA 4HYYA 3R7WA 2XCTB 1IU9A 3RAGA 3OKAA 3VR2A 3HB9A 1I7LA 3KB2A 1SWVA 1SZDA 1EKXA 3H5TA 4FBLA 2QWXA 2I03A 4HH1A 4L2IB 1ZQ9A 3C15C 1E9DA 3DEKA 1KI6A 3VXKA 1SD1A 1V5IA 3BORA 3HJBA 1F9AA 1ZNXA 4U02A 1YT5A 3WWZA 1W2HA 4KO2S 1Y6GA 3NTQA 3EFOA 1RRPA 2AYYA 3TD9A 1EUQA 4JITA 1KK1A 2PXXA 5EY5B 3IQZA 1RAGA 2L42A 4EIWA 1MAVA 1B7GO 1NXPA 1XLVA 4NK5A 4DG5A 5F7XA 5LQRA 4J7UA 3IUYA 4ETNA 1CY1A 2EBFX 1SHUX 2WF8A 1N2OA 5GJWC 2WSSA 3I9OA 4MVJF 4M21A 121PA 2DH5A 3TCKA 3PVSA 4P7FA 1ORVA 1N6RA 4J1NA 3L43A 1ESNA 4ZYUA 2R2AA 1ZN7A 2NNWB 4P4SA 1U3VA 4M86A 1E1RA 3KBOA 2H1WA 2ZM5A 3HP7A 5BSHA 3HTXA 1J24A 1TJNA 1XZAA 1Z3IX 5CD1A 4M98A 3G1WA 5TIIA 4JLOA 1O8BA 1R0RE 3UXMA 3IB3A 3I2FA 5DYNA 2DUMA 3WQBA 3MMNA 3SQOA 1A98A 1VHJA 4UPDA 2EKZA 2W58A 3AHDA 4CM6A 5KCZA 1TAUA 1Z12A 2QT9A 4P81A 4U7DA 1WG8A 3AONB 1JJIA 3FUVA 4IWYA 2YHUA 3G2JA 1T6YA 3GEBA 2B4YA 4LPKA 1T9BA 3WJAA 5L9AA 1BXRA 4KN9S 5ALTA 2P5TB 3FPKA 4DY6A 1L8AA 2HDOA 1P4GA 4TMTA 1F51E 4KKVA 4MVYA 4NSNA 4NP6A 2GN8A 3TZQA 3LO5A 1S6YA 5FI1B 4LNUA 1P5RA 1Y4ZA 1VE5A 2CNBA 1FFAA 3ECCA 1Q7EA 3ESDA 4OG2A 3U7EB 2GN2A 1PJTA 3UJ7A 4AMVA 3JQ8B 4DLBA 2K7ZA 4ZYLA 4LDPA 1TO1E 4G01B 4UHJA 5BQXA 4FZVA 4MKIA 1VCNA 3NHUA 1SVKA 2ZR0A 3TPCA 2X77A 3JZFA 1FVHA 3G8BA 3S2EA 4MK4A 3L8GA 1P18A 1Q84A 4DEVA 2Z6UA 3VTKA 1ZN9A 4JSYA 2AXQA 4LK3A 3INNA 2HLHA 1T26A 2QMYA 4ZRNA 2Q50A 4RSHA 1GNSA 2XWJI 1H6CA 3OKCA 5J5VA 3C4QA 3IV9A 2HHLA 3AJEA 4DR1B 3IT3A 1SRQA 3UMVA 4AJOA 2FEXA 1N2BA 3AJAA 4FQ7A 4V38A 5AHRA 1RMTA 4RTSA 4CCYA 1KHHA 2Y1CA 1KDOA 1QTNA 3IO3A 3ELYA 3SIPA 5HK8A 2Z2ZA 1LBHA 1JRLA 2HDHA 3L0BA 4N40A 2GLTA 3SHWA 1T8YA 2IUFA 2R4QA 3NC4A 3DBHB 1IM5A 1JHMA 4JOQA 3DJFA 4I5IA 4RE6A 3VDMA 3RSOA 1I2ZA 1SR8A 1SQSA 1A50B 3N6RA 3IP6A 5A6SB 1IN4A 5ESRA 3B3AA 1IOLA 1TT7A 3GG2A 1MV5A 1Y5NA 4D3YA 3C6XA 4DDVA 3IBFA 4C7KA 1T1JA 2DM6A 4LZOA 1DQNA 3ETCA 3EXEA 5JC1A 4RKEA 1DO0A 2X1VA 3BZWA 3N5KA 2P4EA 4WNAB 2CLEB 5AK4A 2ZYSA 3WKAA 2H85A 4E2YA 4S05A 5C81A 1UKBA 4IP0A 2DFPA 2BFBA 3BWEA 2R6HA 4X20A 5BN5B 1IWOA 2RAFA 1L7MA 3VC2A 1XK7A 3WL6A 4EAQA 5C1BA 1Q1ZA 4UU0A 4TUYF 2IYEA 2BMVA 2YHSA 3EXHC 3KPVA 4OI1A 2I3BA 3A10A 2D3TA 2XIJA 1KEUA 4GEGA 4IVRA 4PR0A 4X45A 4RTKA 2W71A 5JRZA 4NS4A 3A27A 2HWUA 2W22A 1N4AA 2EVWX 5B4UA 3FCEA 2PX2A 2A1IA 2RH4A 4C88A 2P8JA 2PAFA 4NMXB 1NJ1A 2Y1GA 4C7OA 1U8FO 2H17A 4JCCA 1Y6FA 3BE8A 1I4WA 4AK9A 2H1CA 5IDQA 3QFFA 4Y3UA 2Z5VA 3IC5A 1W34A 2RGCA 2H1OA 4MLDA 4UTVA 5I7EA 3FBGA 4YI3A 1IVNA 1E62A 1EDEA 1ZKMA 2PTGA 3B82A 3I53A 4NJMB 5BSEA 5FYQA 5KTOA 2Y0BA 2P5YA 3OF5A 1NJSA 2ZJ6A 3H5VA 4GMHA 3FZYA 3S1LA 3LMKA 2WMOB 3QNMA 4D4HA 1CNEA 1NE7A 4PW0A 3ORRA 3OJ0A 1YK1A 1EVIA 3ICQB 3KETA 2VHJA 3NYIA 2XE7A 1FEZA 1S8FA 4R16A 1RCTE 2JNWA 3DW3X 5CH3A 1EGAA 2WWIA 1ZO8A 4O5OA 1X86B 4TSRA 4LDAA 4MQ5A 4GT1A 3T7CA 3B1VA 2QAGA 1WD5A 1E2LA 1AZWA 5I5GA 3BL6A 1R8JA 2IU3A 3L04A 3BGIA 3NQ41 5FBZA 1CZKA 1IN6A 1UM9A 4YS6A 2ODBA 3LI2A 4HKTA 1YR7A 1R64A 2ZWMA 1L3CA 3A6LA 2R7MA 3QQPA 4Q7EA 4BKOA 4BMNA 2FLWA 1ZGJA 4GXNA 3KUDA 3WMGA 4ZFNA 4KGXA 1YCDA 4Z7JA 1M34B 4OXIA 4FDUA 1DBRA 1U3DA 2FHSA 3A1CA 3QVWA 4A16A 2ZRNA 5REQA 2PKCA 3LZCA 4KC0A 5DM1A 4PLYA 1PYOA 5BQPA 1PZGA 1G2PA 3GGGA 4FR5A 4XWGA 4EF5A 4OFBA 1GGEA 1QOQB 3WDMA 1VGQA 4UVEA 4BFXA 4E21A 1HYQA 2BUCA 4EKGA 3R7DA 2ZSFA 4TYPA 5CB4A 5AVRA 3MTIA 3M3DA 3WK9A 2IH5A 3AV0B 4WK0B 1BG6A 3WFZA 3COJA 2FRDA 1G6KA 4QLOA 3O2QB 3LHIA 3R7LA 5DVZA 1MQ8B 3T1VA 1KDYA 3WFIA 1J42A 4FW9A 2X4LA 1YA6A 2VHWA 1VLHA 2HRZA 3HV2A 4FHZA 4MW4A 1D1SA 3P9XA 4NZ9A 3X2EA 4EA8A 2A3NA 4GX1A 5LWHA 2QJTA 2IWRA 3HCOA 3I2IA 1YE3A 2DTXA 4B75A 4GL2A 1JEQA 4KQJA 2PBRA 1N5LA 4IGAA 4GICA 4MR9A 4B3TB 1QHNA 1Q44A 4M54A 1RBQA 1K89A 1UKYA 2AN9A 3PQ3A 4K6FA 5KYUA 4PGMA 1N9GB 2I7CA 3DKKA 1XU4A 4LJ4A 1X7WA 4B35A 4BQSA 5KKNB 1D0SA 1N6OA 1Y6RA 5K5EA 1W1WA 5BSMA 3S2GA 1SCUB 4JI1B 3RFFA 4KQ1A 3AFMA 5FX2A 5ADHA 4UEWA 3UVEA 4MWEA 3JQCA 1AHNA 2ID4A 2O5VA 4Y2PA 1CR6A 4YB8A 4CLOA 5L40A 5LKAA 3A1DA 1PJBA 2KLHA 3EGDB 2WD9A 3C1AA 2ZSIA 3H1TA 1T3SA 3M9LA 3OZGA 3ZJUA 2QSZA 1R6AA 1XCLA 3D6MA 3DBVO 1XTRA 3ETGA 4YONB 5JQGA 2WUGA 4Y2UA 2Y0CA 2IQIA 5CX1B 3B9PA 2AT1A 2XB6A 3FX2A 1KMHB 3QOYA 2E37A 3RC9A 2XQKA 3HGTA 1ZITA 4GXRA 2F9LA 3JXEA 3RDPA 2PZFA 2JLZA 1N5MA 4HC4A 1UWKA 4LE2A 1G41A 3A28A 3P9NA 3PXCX 4I1SA 4ZGGA 4IY1A 5B58C 3FNGA 4AKIA 5BWBA 2BYTA 1NN1A 1WZCA 4Q9IA 4R8MA 4FLMA 5HEKA 3KQYA 1RACA 4EEKA 4IGEA 4IJWA 2D5AA 1JEJA 2HKIA 3VNQA 2OHXA 4EG0A 1N3LA 3DF9A 1JG1A 4JGBA 4UXHA 3FH0A 5DHAA 3UOGA 4IGFA 3PF8A 3SMQA 4UHFA 1IAQA 3P9RA 2UZIR 4KXLA 4LZAA 4KLAA 3KD2A 4HH3C 4OTZA 3CO5A 3NHJA 4KFRA 4MVJH 4WK6A 1G8SA 1F8UA 1GGMA 1ZX1A 4JHLA 4BNNA 3HEAA 1JJVA 2IOQA 1FRNA 1V71A 4IRUB 4MV3A 3AUAA 1Z8FA 4YWJA 5JNRA 4XB6B 3MHTA 3H4IA 3ZE9A 2VBIA 4Q4CA 3EIEA 2ZRIA 3E3NA 4Y2HA 4HX5A 4Q9KA 3DTNA 4B6OA 4IIEA 4F4UA 4BNKA 1X80B 2R8RA 3ERCA 4ZVPA 1SHLA 3JQQA 2W6IA 1Y8AA 1Z0UA 2BFFA 3CZMA 4WINA 3SHQA 3LX5A 1B0UA 4PX9A 5DN6A 4GOKA 4TQUS 2GPBA 1RZRD 3GDWA 4RD6A 4HDCA 1CJMA 1JHYA 3AVUA 2XRZA 4BAGA 3CEPB 3AZOA 1CUIA 3M33A 3R5HA 5FR1A 3W78A 1RIIA 3R3YA 2HLNA 1G20E 4N39A 3D6VA 3PIRA 4J91A 4X6UA 3TM4A 4ERNA 4IKOA 1JW9B 1MQAA 1ZUD1 2ZAMA 4KXNA 4YCSA 1KARA 1F4LA 4JLJA 4JJZA 3FN4A 1QIFA 2RAUA 4R9RA 1EP3B 2J33A 5T6BA 1Q16A 2QLFA 3RKRA 1HL7A 3EMBA 4KPFC 3OFVA 2P2LA 3I42A 2ENWA 4X7RA 1GKYA 2DULA 1XRPA 2B78A 1UP7A 5CG1A 3AB8A 5KNCD 1LTHR 1G7RA 1L7XA 3C39A 4BP8A 3RBAA 5KX5B 4DCGA 3JQRA 3LDGA 1JHOA 4DQDA 1LPPA 2PT5A 3IUBA 3ENQA 4D4IA 2JASA 2WD7B 1XCOA 3T9FA 4E32A 1SXJC 3PEEA 3DXYA 2OAEA 2CXRA 3TN7A 1E4VA 1EG7A 2IDMA 1AD2A 2VT3A 4P7JA 1SBCA 1WB4A 2W2XA 1L7VC 5F3WB 3DT6A 2MYTA 2QUKA 1UZNA 5H81A 3G2NA 5CRIA 3IE0A 2J30A 1TIKA 4EHKA 2WMNB 3E5HA 4F85A 1NRJB 1KMNA 1H5UA 1X7YA 1EM8B 2JGDA 4X94A 4ECEA 1U1EA 5ALMA 3QE3A 2OCLA 1K68A 2IHVA 4EYQA 3WGNA 2DY0A 2QN3A 1GADO 2A5DA 4UREA 3UXYA 3WL7A 2V54A 5ITVA 4FR0A 1CKEA 5EMLA 1JKXA 3RIMA 3A05A 2I65A 4JP1A 3H18A 3MRSA 4GMGA 5AKGA 4Y2XA 4TVSA 2YOFA 3G9UA 6Q21A 3DOUA 2HIAA 5ADUS 1NBHA 2O8FB 1XE3A 2A0YA 4F9GA 1Z2NX 1AQJA 4PX2A 2G1PA 4ZT6A 2E55A 3PWTA 3NDJA 2E1PA 1RYYA 4QU8A 1HQCA 4U2EA 4L3VA 2PEYA 1HR0B 2VZLA 4MUJA 1YJXA 2VNJA 1JBQA 4BO3A 5JXWA 1X38A 5A0TA 1R6TA 4HYQA 4KRFA 4NTZA 1L8XA 4GOLD 4J0DA 2Q4OA 3R40A 2IYYA 3DVLA 1H8EA 3B5JA 4POAA 4FFVA 4QDUA 3THYA 3N0WA 4P34A 1UXJA 2O6LA 4UEKA 3L0PA 1AM4D 1YACA 2A0FA 4LX0A 5FOWA 1T9HA 2P9QA 3EUFA 4D82A 1GKIA 3AY3A 4BQIA 2V5VA 2D8AA 4WECA 3CZRA 1FFHA 1F8GA 3HKDA 5CLFA 3I1FA 3K0EA 5EMMA 5GOTA 1RJEA 3AHEA 1VJGA 1PGQA 2INGX 2LWIA 1CY2A 1KC1A 2V7TA 3DMTA 3DOIA 3MQFA 5KI6A 4L16A 2OSVA 7ABPA 4FWTA 5CH5A 3HZHA 4K9MA 1KAEA 1KOFA 2AG1A 2FR0A 2WUVA 5CR9A 1YE8A 2AMFA 5DYGA 3TQQA 2XHEA 3FNHA 4R1LA 3EOAI 4ZVSA 4UNRA 4EA7A 1E0AA 4BNJA 4DIBA 1V8PA 3QUBA 1JXOA 3E0QA 2FFRA 3IB6A 3AM4A 3KXKA 3FHOA 3WS7A 2WYIA 1Z6PA 5FEMA 1CUUA 2YCLA 1A96A 5AXDA 2ALJA 3WWEA 4NMHA 3HB0A 3PUYA 1XJQA 5LZ4A 3G6KA 1DC7A 1V39A 1BMFA 2R00A 3QVKA 1ZGAA 4WCVA 5BURA 1JQBA 3T5DA 3QSYA 2HREA 3UA4A 3WKCA 3UBTA 2JI4A 3K0AB 3QVVA 2OB1A 1IE3A 2TMYA 3IP5A 4X95A 3PEYA 4C6TB 1QIMA 5EE0A 4JC4A 3UTDA 4CEJB 4BJ5A 1PJ2A 1XAJA 5JD6A 4PBSA 3G0CA 4FCWA 3TG2A 3B85A 3L8EA 4O0LA 3VI4B 2BGRA 2VDKB 4EG3A 3F49S 3U49A 4INOA 3P2MA 2OG1A 3FNFA 4KDEA 1TTQB 3CBGA 4ZV9A 1HE4A 3K32A 3P2YA 4PZCA 5BSVA 3OLYA 4GEKA 2P1ZA 4D4JA 3NWPA 5AVZA 3UB2A 1HYGA 5FL3A 3RUEA 1S2OA 4H27A 1OY1A 5FFFA 1ZVQA 4KWEA 3UAVA 3CKLA 4KE7A 2PXAA 1YWGO 6GPBA 5DM60 3D6NB 4Y9RA 2ON6A 1XFDA 3GLKA 3A4LA 3NEYA 4J16A 5B58T 2W93A 5FL7D 3K1TA 1CNFA 4DZRA 2I3ZA 4L3WA 1A2BA 1FW6A 4OXNA 5JARA 3IPAA 1OCEA 2QTLA 3BRCA 3CGWA 3FWKA 4RTMA 3UV7A 3D59A 2XMQA 3EIXA 3PCTA 4AG6A 2JFXA 3INGA 2BP7B 3C3WA 3Q6MA 4AT1A 3VJRA 1C7EA 4UDXX 5DCLA 2EATA 3OU6A 1VC2A 3QY9A 4AF7A 1E7QA 3V97A 4ZOQI 2WA1A 1XZ8A 5IASA 4F5WA 5B3JA 5HF5A 4PRYA 4DKXA 2CEKA 3H2ZA 1LLFA 3NV7A 1O9BA 1YVEI 4KE9A 3R44A 1JFSA 1R4NA 1NP3A 3UMGA 1FE8A 4YCAA 4AJ4A 1EUDA 1I5OA 1OLSA 1W4RA 3LUGA 3O84A 4G36A 4RQUA 5BVGA 1IEWA 2F7SA 2HC9A 3DLIA 1R1DA 4NNJA 5AM3A 4KVFA 3I5XA 2ETXA 1SOUA 1SXIA 3W04A 1JG6A 4M0FA 3ETDA 2IU6A 4YDQA 3U7HB 2HMWA 4GLFA 1NT2A 1YDWA 3TNJA 4M49A 3U37A 1T91A 3HRIA 1NUQA 2VXOA 3FUWA 3I6BA 4RLHA 1II0A 3PHLA 4C0BA 3OE4A 3LYAA 2BTQB 2G0TA 2ZVQX 3HBNA 2WTXA 3LPNA 4RHYA 4RZHA 2G36A 3KWLA 1H1LB 2DOKA 4IDCA 4ER6A 3LTEA 1U0EA 5GONF 2K7FA 4EY5A 1UMBA 3DBLB 4XSHA 3UAZA 3GLVA 2LXNA 4AYWA 1RSZA 2BKEA 1N3BA 3W1VA 3ET4A 3KZMA 3N8HA 4URFA 1U2GA 5B3LA 4KFCA 2GEBA 1EMDA 3MRTA 3MJSA 2QUAA 2JJ2A 4WKGA 1T3TA 3DUFA 1C8BA 3DLCA 3WLRA 1CUSA 4FFDA 4RA9B 3R6DA 5FNVB 1S4QA 1MB0A 2I1LA 4A1OA 4AS3A 3L41A 2IS1A 4J6FA 3EPHA 2O8BA 4XW2A 1QM5A 3B6IA 3CE6A 4OXQA 1WF3A 4P4TA 3ZCQA 5SICE 3KVVA 1TJ5A 5A9SA 4DQXA 1KVTA 1N6IA 1YIDA 3AOGA 3G68A 2W6QA 5HNKA 2FQXA 3BYZA 3OURA 3RSSA 5JVDF 1RCUA 4IEFB 4ZEWA 1ACMA 3GW8A 4X1YA 4JKOA 3OIUA 1TLFA 2PKQP 3V00A 3X1KA 5K4GA 2RHRA 4WGGA 1Z74A 2TRSB 5J4KA 2JD0A 4TMZA 2EKLA 2J3JA 3F78A 2HLDD 1VJTA 3VM6A 3R23A 4QXOA 4ALJA 3NHKA 3TECE 3PHIA 3MTQA 3G8DA 1RLMA 5BW6B 4F46A 1TW3A 4TN1A 4NK4A 4DA6A 1SK9A 4FN5A 1XN4A 3FHJA 1VKZA 3KHUA 2JHPA 3BFPA 3WICA 3T4UA 5A2GA 3NZEA 1R0SA 3IEMA 2YXPX 2A7QA 3DDSA 3OUUA 4TSFD 2Y1WA 3K5IA 1BVRA 3V34A 4YRAA 4WKPA 5IVPA 1W7AA 4I6EA 1MO2A 1LJ8A 3B89A 3MUEA 4B8YA 2GPTA 3I05A 4GU5A 5AOBA 3NBQA 4MB0A 4HGOA 3I52A 3BJMA 3GARA 1QYCA 2BRUA 2NPIA 1P2SA 3DMPA 3ESYA 1A9RA 1EA5A 5AUQA 4BV8A 4KXUA 3CSDA 1BWQA 1TKBA 1XZEA 1T5SA 1WQ1R 3A32A 2B2XA 3L1JA 4H77A 4WCFC 3L01A 5K20A 2WAOA 1HYHA 2OPBA 1AB6A 2J3MA 1SZJG 1VHQA 4DB2A 2G9RA 1CUWA 4HQOA 1KKLA 2P8SA 2IXAA 1ULHA 3UT0A 1RQXA 3M34A 4JLAA 1NXVA 4QDKA 2YKGA 1U1DA 3IVMA 2IOHA 4PS1A 4PFJA 5E1DA 2PS0A 4IICA 3I5YA 3BE4A 4RDXA 3HL0A 3G5AA 4K2AA 1NQXA 3MIIA 1VPVA 1LQUA 2X0KA 3OQIA 4YP1A 5J47A 3PPVA 5GJVC 1QGED 3ZQKA 2I3GA 4TUYB 3UMBA 1JDBC 3R6TA 2MCFA 4W82A 3UXHA 3MVEA 4A91A 5AH0A 5KHOC 5K3CA 5IVHA 1IVSA 4EHBA 1XYYA 3W2FA 3MJTA 4UBLA 3HUDA 5EQTA 1NOJA 1P7CA 3PE3A 1V3VA 4M89A 3UJ8A 3P9ZA 5ALUA 2ZI4A 2PXCA 3TLEA 3DHNA 1FVFA 3BBPA 4Q0MA 5HKOA 4LG1A 4PCVA 3I9V1 3WP1B 2YWEA 4AM8A 3H6HA 2AKAB 1IHYA 1A8UA 1WPRA 1Z0SA 3ONNA 4PANA 2XDYA 3OZFA 5I9NA 2ZIGA 4LOLA 1G2IA 2AG5A 3C43A 5EP1A 4Z2YA 3QJGA 5D1HA 3HMQA 3QPUA 3CLRD 1VIYA 4QU9A 3N2GB 5EHIA 3ZU3A 4OPMA 4X44A 3T34A 2ZTSA 5HZHA 4CDNA 2WSLA 3JYPA 1XJ5A 1G55A 2OYRA 4EYOA 3SDBA 3VR2D 3MRVA 4XVCA 5CAEB 4ZCPA 1PBNA 4G1CA 1D1TA 1D2CA 3FJOA 4LEIA 4M7WA 1RLUA 1JT9A 3K2EA 3IO5A 4FDTA 3HM9A 1TYBE 1OH8A 3A6PC 1VSQA 1Y1TA 3Q8XB 3ZGOA 1ODKA 3MWFA 2GTHA 2QG4A 4RFVA 3WL4A 4HNUA 3GBSA 2WIAA 2JC3A 4K88A 3I9NA 2DEUA 2BT4A 1JSCA 2BFNA 4ES6A 4N0EA 1K4YA 4LSGA 4X54A 3UGJA 4MWOA 1C7QA 3OLZA 1GTG1 3R1IA 3H9CA 3U9SA 5FUQA 2YIVX 4C2BA 2HIHA 1G9SA 1YZ3A 4NXMB 1Y80A 1KAHA 4MUNA 4EFNA 2GAIA 1Z2EA 3PFGA 4YRPA 3RUIA 4KYUA 1USIA 1X7GA 1RPZA 3W8DA 1OWNA 1J33A 1GZDA 2CF5A 1ATIA 2IYFA 3MTGA 3B51X 4O4IA 4TMVA 5E2IA 1ZHOA 3QLTA 2CZCA 2GN0A 2RGBA 5CJJA 2HJ9A 3TO5A 1RZUA 6ADHA 3AVOA 3C2QA 4ANFA 3CCBA 1V5WA 2MTBA 4D9EA 3W3AA 3W7BA 2R6JA 4AQYB 3PA6A 1MAWA 4LXQA 3DKPA 5DHPA 4KXWA 1Y4SA 3JWIA 1YVDA 2WSIA 3L02A 3A37A 1YK0A 1WRBA 3IAM1 4P53A 3DAOA 1XDZA 1QFSA 3T7SA 3BIXA 2IH4A 1O03A 3LC2O 3AUSA 4PZDA 2I78A 4M0PA 2HSEA 3WQSB 4LXYA 4DCMA 3JZAA 4UBIA 3ADKA 2X9VA 2A1TS 3H8WA 1W94A 3VHRA 2ZYGA 1K2VN 4GBED 1YMVA 2PH3A 3OY7A 4I4TF 3CUTA 4G0ZA 2ZWPA 5F2OA 4ZV7A 1B3RA 2NU6B 1P0QA 1XVIA 5GWXA 4HRXA 4HAZA 3SP1A 4YAKA 2R86A 2WF9A 3GT3A 2EFHB 3LQRA 4CDRA 2HU5A 2Q8PA 3CJQA 3F6CA 4CL2A 2RBGA 3S2ZA 1QCZA 4C7BA 5BPFA 2NUTB 2GZ1A 4OQZA 4DRYA 1EX6A 1XKLA 2C8LA 4Y6SA 1DOZA 3MJFA 3P20A 4E2ZA 1I14A 2G83A 1UBKS 2O3JA 5IBPA 1FJ2A 4HL6A 4QASA 4C0HA 2VXCA 4C43A 3AY6A 5LMNB 4FCCA 3OQPA 2NSJA 3MGGA 4J1TA 3CUWA 4DRZA 4XDGA 3R8CA 2QD5A 3SXUA 4LZWA 3EBOA 1J2TA 3CONA 5FOSA 4CM7A 3AGQA 1M6VB 2JI6A 4B2IA 4ASUA 3HMKA 4EX6A 3QVSA 1DP4A 4MV4A 2XXAB 4TL8A 1DXHA 3UT5B 3WRYA 4WFKA 2QGNA 3RWMB 2CLLB 2CYBA 1E7YA 1GR1A 1UXOA 2LUOA 4M1EA 4OHUA 3THYB 3QFHA 1Q7TA 1UODA 4H3KB 4WEOA 2CFOA 3U81A 4A10A 4KOAA 2FSVA 1ZC4A 4Q5IA 4DXDA 4AMYA 2ICAA 1KEKA 4DA9A 1Y9DA 1FB5A 4DUGD 1XTVA 4ZC8A 5EN4A 1PT8A 3R0IA 4V0LA 3OIFA 1M8GA 2C42A 3WI7A 1C0PA 1SJ9A 4IJKA 1W4BA 4YUYA 4TZ6A 1E64A 1DELA 3SQXA 4KXYA 5IKEA 4N4AA 2PA3A 1E6WA 4CLRB 1RI5A 3GR6A 1PDOA 4E6PA 2CKMA 3K1AA 4WZAE 3NBFA 4QUAA 4RCZA 1NZFA 4RV9A 2V7BA 4XWYA 3GWGA 1BFUA 3V9PA 2I2DA 5CTAA 2QPOA 2KJQA 4G0XA 4QPZA 4KR9A 1SC3A 2YJ4A 2VHTA 1OTXA 3DV9A 4ZANA 5KJ6A 1KIMA 1L6RA 1R4ZA 4DADA 1Y8CA 4CTJA 3IT2A 3UAYA 3UJCA 4NRDA 4AL4A 1E3EA 2AE2A 3HGQA 1TL7C 3KHTA 2CCKA 1XWWA 1LY1A 1V9CA 1Y37A 2XMRA 1W49A 2G07A 3BGVA 4XSVA 3UATA 2SBTA 4NV3A 3LA8A 1VHWA 4EJSA 5DTEA 3NHYA 4HO1X 4OLBA 3BWYA 4WGFA 3FGNA 5HIJA 3WIUA 4UMDA 3AL0C 1QH1B 3RQIA 1F0KA 4PCUA 1W4CA 2F3UA 1TMOA 4ZQIA 4AMBA 4Z6KA 4DCCA 5C46F 4UNNA 1KDRA 2J09A 2JHAA 1HNWB 3PNQA 1NI4A 1O6ZA 2ZSHA 4YJ2F 2W6MA 4QTTB 2F62A 4E51A 4JUBA 5TSDA 1C3VA 2CMDA 2WTAA 1BROA 3O94A 3IDFA 3E61A 3F4KA 3RYIB 4F2GA 5AESA 5FJJA 3OIDA 4NU0A 1XMSA 3BK7A 4XD2A 5CA0F 3CURA 1XXHA 1DEAA 4J0CA 3E70C 1D9ZA 5CEFA 4BMXA 4W9NA 2I9PA 2ZVPX 3AKCA 4D9GA 4HUQA 4EGJA 721PA 1Q7CA 5AW2A 3A2KA 2QW0X 1KMQA 3KDSE 4PO1A 1W6UA 1J97A 3RAPR 3VAZA 3QE9Y 1LXCA 1PNOA 2CFTA 4ZU3A 4BTEA 3FYUB 4OSPA 3H3FA 3L7LA 3IHLA 3HJUA 1XCGB 5EFOA 2OV8A 3URMA 5FI0B 1GGNA 4J2TA 4WLNA 1NXXA 3LOUA 4LRSB 1J00A 5H7XA 4QVIA 2FUG6 2W2VA 3LZDA 4K05A 4EGSA 2GPNA 4LYFA 1X74A 4V2IA 3JYLA 3K1YA 2GA9A 3L07A 5J2TF 3SG0A 1MO6A 1DKMA 1G8YA 5TRTA 2GNAA 4C04A 4JJ8A 5LR6A 2XCRB 2VCHA 3A6GA 5G1PA 3WLQA 4D9CA 1KRXA 3D3WA 4BZQA 1ZOSA 1YZHA 4BV3A 1MT3A 5J2UA 5BMOA 4HCJA 5DI3A 1UWVA 5A02A 4XGQA 3DBRA 3QBJA 1IXYA 1TJ4A 4ZAXA 4D8TA 4G4GA 1A9TA 1ZMOA 2FQ1A 3CLKA 4KZKA 4S24A 4K86A 3I8SA 4QC2A 4GSYA 2GLXA 4QJIA 3R9KA 3AI3A 4EG7A 1QYIA 4HI0E 1KQNA 3IAS1 3HP4A 4FNMA 3D0QA 3MOSA 4WXHA 4U6NA 1U8TA 1O6FA 3IJPA 5I7SA 4PG4A 4LWPA 1YS6A 3V8NA 1Y7PA 3EGVA 3VX4A 3NTLA 4NHEA 3COVA 1AKQA 5DM4A 2UKDA 1PFUA 4JLNA 2I9KA 5C4IA 1U8YA 1HDXA 4BV9A 3UGTA 4BLTA 4Q16A 3I04A 1ATZA 2I7VA 2IEDA 3AG6A 3NHFA 2H3HA 3KZKA 1D9XA 4DG8A 4WLVA 1AKVA 4M3NA 3DMYA 2UUBB 4MB2A 2QVCA 4O8ZA 2BGWA 1JIQA 4TS3A 3F1KA 3HQ4O 2P2NA 1JHZA 1OJLA 3Q0IA 2EP5A 2IE8A 3BKXA 2IHTA 1GFWA 4UU1A 1EXMA 4RPKA 1G21B 1R12A 3D7KA 2A9PA 2EW8A 2P9GA 2WUDA 2WWWA 3CR3C 3FPCA 3PHHA 4LZLA 4OHVA 3VTAA 4BN0A 1NVBA 4IPTA 5DWDA 4ZJUA 3UCFA 3DS8A 3EY4A 3KIPA 3COWA 4R68A 1E58A 2EW2A 1HOTA 2I4NA 2YC4C 4R54A 2ZG6A 4I14A 3RSQA 1QP7A 1WU8A 2HM7A 3F67A 3NYQA 1EVYA 1P5FA 5B2ZA 2RBKA 1D7AA 1ISPA 4I5GA 1N0VC 4DM3A 3N74A 1KYZA 5HE9A 3KAJA 3IP3A 3JAKB 1F20A 3LDUA 4BU1A 2I67A 1INLA 1NXWA 1ZD4A 1ZZGA 2V9PA 4EATA 1F14A 2O2ZA 2GM9A 3BN3A 4TKMA 4BB5A 5L3VA 2NYAA 4NDAA 1H2YA 4IWXA 5A71A 3W2IA 2VF4X 1W30A 3BMQB 3M89A 4HR7A 3ZDXB 4BMZA 1LNQA 4XIJA 1DTWA 3K9BA 1G1MA 2VQDA 5ENZA 4TKUB 1SXGA 5KYWA 2Q1TA 3NATA 4S12A 1NDHA 1PHPA 3O7WA 2NT3A 1BWSA 4LUCA 4OHFA 3AK4A 1KYYA 1ZW1A 1ONOA 2NVOA 4BZWA 1L4YA 1A1SA 4BO8A 2YDYA 2YICA 4HLUA 4M0UA 3F6SA 5KINB 5GIOE 2O8CB 2BDTA 1JKJB 2QKYA 3KYDA 1GGVA 3ML1A 4LJKA 4CQMA 1N5RA 4E14A 5C51B 2FN4A 2A5YB 3T61A 4G07A 2ISCA 2QUHA 1REQB 1NFFA 4DLRA 1P1BA 1KPIA 1XRSB 1JIJA 4UD2A 4IJQA 4MYCA 2PZ8A 4W6ZA 3ESBA 1O0SA 1QK3A 2XDQA 3ZDYB 4M9ZA 1HDCA 2FPUA 2JGNA 3O82A 2JAQA 3VNUA 3DWIA 4RMNA 3DE5X 2O2DA 3HM2A 4B9EA 5HYVA 3CEJA 4XXHA 5JAMA 2R0QC 3H9EO 2EDAA 4MYUA 4ILKA 4BN5A 2C0QA 3BJIC 1CQZA 4HZUB 4X64B 1M8PA 2QX4A 3OA2A 2EJCA 2J9ZB 1SCDA 3A0RB 4PGGA 3W5BA 2W4MA 2OBFA 4FMDF 5IJZA 4FB5A 1TJ3A 3TOSA 3VTFA 4C14A 1Z0KA 3NR2A 1HM5A 3U3JA 2X0IA 2C4UA 3HO1A 2ZE5A 2Y68A 3GFPA 1GUDA 3AERA 3GPLA 3B60A 2C3MA 1WHTB 2M98A 2XX3A 2QY6A 4YHHB 4JBGA 1JMKC 1T5DX 3KQQA 1TM5E 3TQTA 4MTCA 4IR7A 3BWVA 1JAHA 1RWNA 3C5EA 1E9BA 1WP9A 3LG2A 1QF6A 2E6KA 1F6DA 2BW0A 4NYIR 3HEBA 4WT7A 1JNXX 2NO4A 3FMOB 2I6FA 4JVSB 2B37A 3GT0A 3QWAA 3D2LA 4NDZA 1Y8RB 2QG9A 2XXJA 2EHDA 1LI7A 3ZOKA 2Q62A 1HNXB 1YS9A 4TQAA 1RRVA 1XEWX 4JOSA 2PSFA 4GYYA 3UA3A 3UHJA 5ADWA 3NNNA 4KFUA 4TMWA 4UDNA 1E1NA 1URPA 4GVLA 4G0QA 3HFJA 3OQVA 4W9MC 1F7UA 5FYDA 4DMLA 4EHHA 2QX8A 3BF8A 4UCFA 1TAGA 1GA6A 3CW8X 1PR6A 1IDN1 2R4TA 3CFYA 5K3EA 1YVUA 3BXFA 3AU8A 3LY5A 3OI7A 2OV3A 4Y2VA 4MEBA 1A4RA 3RYFA 3RYHB 4LF6B 3V1MA 2X8JB 5DI9A 3ESZA 2A5JA 1K08A 2AWNA 1C2TA 4GYJA 5IARA 5TPWB 1PHRA 4BB0A 5CXQA 2YV3A 2BR3A 2VAXA 4KXMA 3DLPX 3P5SA 4R1NA 1OASA 5C34B 1ZN2A 3M49A 4E5YA 3MS7A 1ITZA 1M54A 2OT3B 3NASA 1JG4A 1M2FA 3JZIA 3K9WA 4RV4A 4WXEA 4B4DA 2P67A 4GWLA 5AHOA 1PNVA 1HRDA 4KTTE 4XDZA 3WJ7A 1PD1A 2FSGA 2OMEA 2WF5A 2VWQA 1NF3A 4WK2B 2ZRHA 3ZY2A 5FLXA 1FNMA 3DPIA 2R1ZA 4UTXA 3ENNA 3ILVA 2EYQA 3F6PA 4B3CA 1NJFA 4G1MB 1IN5A 4PFQA 1H9AA 1QUEA 2VYNA 1TEXA 2G1AA 3G2PA 4OHXA 4QQNA 1H8ED 2H4WA 5LBUA 4NICA 1XAIA 3UHOA 1KI3A 1P29A 4DQLA 3HJTA 4RGQA 4M7PA 3Q41A 3NJRA 1KYWA 2RGGA 4OKIA 2QMHA 4DJDC 2NXJA 3SJUA 4MPTA 1ZK4A 4AICA 3LUJA 3WGJA 3GZ4A 2QRVB 1H2EA 1QWSA 1LDMA 2J5XA 2EARA 2XD9A 3C8MA 3NM5A 4W5HA 5E6SB 5JVDB 1V43A 4N48A 4U6QA 4LGVA 1WNTA 2B69A 1JJBA 2GD1O 2YVUA 3LNTA 3K9NA 5JS2A 4OEHA 2JKZA 1UBNA 2X23A 4V0KA 3EF0A 3LF1A 1N2XA 4U0KA 4LJ8A 5TQ2B 4MUAA 1H0SA 2Q7DA 4MH0R 4KXXA 2O7NA 4IHKA 2AOWA 1N3YA 1SIUA 2H2GA 4MQEB 1IY8A 3ZHXA 3SEZA 1VSVA 4DCSA 1U9IC 1R9JA 1XTIA 2GF0A 3DFKA 2Q6IA 4J29A 1BMFD 4AKSA 4GMDA 3CVYA 3FLAA 3LGSA 3ILXA 4HQLA 1UC4B 5PGMA 3ZK9A 4B6JA 1HLPA 1SCAA 4DJJA 4F4JA 4P38A 5LP1A 2P40A 1NMSA 1NLZA 2XE8A 2NTEA 1HMYA 2AFRA 2JFZA 2PSEA 2D4AA 1NR5A 4FX2A 4G6ZA 4LV5B 4MQFB 1YAJA 4ND1A 4Q6BA 4R2WA 3HB1A 2EYUA 3IQFA 4K6HA 5CT6A 5EYPB 3OTHA 1IOZA 1SUDA 2DU8A 5LUAA 3RS2A 2BLNA 4ZQHA 2VSYA 3TLBA 1JDSA 4YQFA 4O3MA 1TKRA 4B2LA 1JAXA 1O6CA 4KQWA 4JBHA 3ACCA 1K7SN 4RQTA 2RK3A 2YW2A 5ALDA 1NNI1 2VDWB 3B48A 1O57A 4IHAA 2HU8A 4LHVA 1BD4A 4C2UA 1AG9A 5IDWA 2JFUA 5GIPE 4YAEA 4M0CA 4G97A 1PE0A 1S2IA 1A9QA 1V8ZA 3U2QA 1CJUC 5IANA 1AUXA 1Q0SA 2BBWA 2FYTA 2PRJA 3T7AA 2XNCA 3IVAA 3R3UA 1YDGA 1TQ8A 2ETVA 2AZXA 1E69A 1XLWA 5DEOA 1OOEA 4F4HA 1PVVA 2DFDA 2YN0A 2ZB4A 3HCPA 2UVQA 3TIGA 3ND8A 5L7WA 3IKTA 3FDZB 1NG1A 2NZUG 5CDYA 2ANBA 2R6GA 1A7JA 2AXEA 2OZPA 2ZI3A 2WP0A 4MKHA 3UH1A 3ZEAA 5JTTA 5EESA 4MGKR 1A8HA 3HJGA 2AMYA 4X8HA 4Y0VA 4M7RA 5LQDA 1FDOA 2QRGA 1OFVA 3LW7A 1EDOA 5F7ZA 4MI3A 1ZCBA 4DLKA 1M7GA 2BMFA 5JDCC 2G82A 7AT1A 4US0R 3LT0A 5THXA 4ZHQA 1KY4A 2BZGA 4X3CA 3O2SB 2Y1KA 4LCJA 4RD2A 3JQGB 2JFYA 2ISSD 3SMVA 1P19A 1PG5A 3HHEA 5BP7A 4ZP1A 5KJFA 2QZ9A 4UU7A 4PSUA 3LHFA 4YJ3F 2YINC 1NNSA 2Y4NA 2VXYA 1Z07A 4ZI2A 2JL1A 1W88B 2HYIC 2GJ4A 1P7ZA 1OWOA 5JQGB 1G4UR 4NAHA 3NTRA 5IAKA 1C4KA 2QRQA 1GUZA 1MLDA 3UAXA 2YXBA 5EQDA 4KR6A 2DFTA 2SCUA 3LJKA 5FTNA 3RB8A 3V4PB 1FNBA 1YFZA 1HY3A 1XG5A 5EUCA 5AVOA 1LNZA 3T7DA 1IY2A 2XCUA 4ABYA 3QZUA 4JEIA 1QG4A 1PK9A 3GRRA 1R5JA 2JFGA 3C3AA 5AWFC 4REQA 5IN5A 1HQKA 4G09A 1H4SA 4J0IA 5AM0A 2DBVO 2YZMA 1H3NA 4HFRA 3VVLA 4Q4JA 1KEWA 1E9EA 1VJDA 2D2FA 4B6GA 5JROA 2GLUA 2C00A 2I6TA 3F8SA 2I4RA 2E48A 3EUEA 4HAOA 5EAIA 5IT4A 3LFHA 4BQNA 5AVUA 5IMSA 2EZTA 1CY4A 2IGBA 1TZCA 2JJ2D 3ETHA 4JFRA 1LNSA 1T6NA 1RM5A 4Q15A 1K66A 1CQJB 1V7PC 4HTFB 3ZOZA 1ZUHA 1YKFA 2B1RA 3O8OB 3WLJA 4DPLA 5KC9A 2N47A 1X13A 2GVDC 4ABTA 3EVFA 2RFLA 2NU7A 2VDOB 3BULA 2FFJA 4J2OA 4B81A 4H3SA 2BFCB 5D5PA 5ULLA 3FYHA 5KZMB 2JHFA 1YXMA 3KT3A 4LWZA 5HJ7A 4NULA 3O1LA 4I4TB 4BC1A 1UWLA 1UBTS 1P74A 3FIJA 3KTAA 3ROFA 1ODCA 1Q19A 3WBJA 3V6LA 4ND2A 2G8LA 2HHAA 3P27A 2ONCA 2R8OA 3JTEA 1TVKB 4JNCA 4FP9A 3VDRA 3W4KA 5KWJA 1AV7A 1G63A 3C3EA 3AUKA 4GSKA 3RC7A 1PDWA 3IXQA 3SHFA 1A9XB 4DY4A 2XEDA 3HG7A 5K4HA 3ER9A 3TJMA 3IEPA 3TQFA 2GVZC 2PU7A 5D86A 5K3AA 3D0RA 5JNLA 5JV5A 4MS4B 2IPMA 3X1MA 1VKHA 5AIAA 1L5MA 1X77A 3A4TA 2GO1A 4AY2A 1U0TA 4F5YA 1TU3A 4DIFA 1L5HA 3A4NA 3ZHSA 1VKRA 2E21A 4EUHA 4DHWA 1HTBA 1X94A 3A9VA 4II7A 1A7UA 5ERGB 3GNQA 1S2DA 3G3EA 2ZRBA 1BO6A 1RABA 2I1QA 2R8XA 1Z68A 1YR8A 3CN9A 3MFYA 1WTCA 2GYVA 4XX1A 2QOEA 3QEMA 2O2XA 4DLVA 5A4AA 3TXYA 1QK4A 5ISMA 5F98A 2W6ZA 3CLVA 3R0ZA 3ZWXA 1XVLA 3GCDA 1I0LA 4RHEA 5HCUA 2J7PA 4DF3A 4GI1A 5DM2A 1ULAA 1FUEA 1X9GA 1IY0A 4OHZA 2V3CC 4XX0A 2QS9A 2PKWA 5E2AA 4JP3A 3PI6A 4BPBA 3NHSA 1OLUA 1GPMA 5LZ2A 4AB1A 5EZYF 2AR0A 4RAOA 1JR4A 1NSFA 3HKCB 4LOIA 1SCNE 3GGPA 5D3MB 5IH7A 1VMEA 3HDHA 1T0IA 1YR3A 4H18A 4KO3S 4QO8A 3NAQA 5ALJA 1DIGA 1WUTA 1Y1RA 1SZCA 3D5TA 3PBKA 1NONA 1DKLA 4DR2B 5DX1A 5BMVF 1EK6A 3PFIA 3LTNC 5C32A 2OCGA 1A2KC 3QKIA 4LC1A 5BPHA 1E1QA 1N0IA 5JMWA 2A6PA 1TK2A 3VR6A 2AK2A 1S1MA 2NQ8A 3DO5A 3UPTA 1FXWF 3SYTA 3WMEA 4MWDA 4KQCA 3WADA 1MOPA 4OYHA 1TC1A 4IFTA 3K6KA 3AR3A 1YRAA 1ZGHA 1RHRA 1V8DA 1VCIA 4IMRA 4DAEA 1AHHA 3ZK8A 3DMRA 2OWDA 2D7JA 2WC1A 3GRVA 3GUUA 4HWTA 3WLNA 4QTXA 5CM2Z 4EHDA 4UUNA 1UMDB 3FVRA 6REQB 3IAHA 3TG8A 4CEHA 4DBZA 4FMBB 4PLWA 5LQKA 4JLWA 3C87A 3LKBA 2XTNA 4PAMA 3W2GA 2PX8A 1J4AA 3ZGLA 4N6NA 5TF4A 1ZXBA 1WMFA 2GD2A 2YYYA 4CETA 2OAGA 5BOSB 1CUGA 4O2AB 4YJ2B 1ZC3A 2BHLA 4JUAA 2NO6A 3JCZA 1RLJA 4EARA 3VZQA 5MF6A 2VNHA 1CXZA 2CVHA 2GVNA 3AT1A 4L0QA 3RSHA 3IESA 3HI4A 4U7GA 4DMGA 3UK0A 4CKCB 3U44A 1OV6A 4MRSA 4WVFA 2QUIA 1KP3A 3DCJA 1GV1A 5CA0B 1S89A 1W85B 3BDAA 2WIDA 5A2QA 1SPXA 2JGRA 2QL7A 3HWSA 3IEUA 3KVYA 4XWKA 1AHIA 2QA5A 4OUDA 4DBLE 5JXHA 4GR4A 3IR5A 4N41A 1KK2A 5AVYA 2O6HA 3KYCB 3V8RA 5E6UB 5TXGA 1QWOA 5CNJA 3CEMA 2I66A 2O19A 4D56A 2OM2A 1W0KA 3CQ9A 1EGMB 4I3HA 1RHKA 3ZDEA 4O59O 3UAWA 2EWMA 1NC1A 4B4VA 1A95A 3PUWA 4JI4B 5T4HA 3FWPA 1P2VA 4NJOA 1BMQA 3LUAA 2QMOA 8ADHA 4AZ0A 1VG8A 4FFNA 4UXIA 4FOOA 3GLUA 1NQWA 5TDHA 1WOMA 5JBNA 4P7KA 1Z0ZA 4FKZA 5J2TB 4Z51A 1GV0A 1CCWA 4G3XA 4QBIA 1K9SA 3W3AD 4PG8A 4IOKA 5EPEA 5FFMA 4KIGA 3TKYA 3FNQA 4PLHA 4YP6A 4RPLA 3O31A 1ZUNA 5DNEA 1HKUA 2C31A 1I9CA 1ZOIA 1GLVA 1UP4A 3D5QA 3OOEA 4IYRA 4PHCA 3HACA 4YT5A 2VP4A 4RULA 4BKUA 2XV1A 1USUA 5IJXA 3FPJA 4ZXPA 3WBFA 1SXPA 3IKLA 1UJCA 2PMEA 4O2BA 4RVHA 4R5HA 1ZJ5A 1YOVB 2P2CA 5EKDA 6PFKA 2V1UA 2HXSA 2OVBA 2WM3A 4LW8A 5AVWA 1CE8A 1PEYA 1BFKA 5DGTA 4XA8A 1VJ5A 3L7JA 1SBZA 5CT5A 1V0JA 1FTWA 4IUYA 4F12A 4Y0AA 3KUCA 4ENVA 1SQGA 5E9QA 3C3XA 2EWVA 2UYYA 3STWA 1V1MB 1ZM9A 4CM4B 1KRWA 2Q2NA 1UZUA 1L5WA 3SC4A 5B64A 3S55A 2B30A 1VIVA 4Z9YA 1BKSB 1E2QA 2OAQ1 4RJTA 3ZKWA 1ZIOA 3DM9B 2E4AA 3EHDA 4LIPD 4N3NA 4P83A 4BNVA 5KQGA 3GZJA 1DL5A 5TGDA 2Z2JA 4W9RA 2Q6TA 1W25A 4C78A 1X7ZA 4FJ0A 1C3LA 4BVBA 4X7BA 2C5SA 4OYYA 5K0TA 5D7BA 5LU8A 3VSEA 1LTQA 3ETLA 5JH7A 2ZUDA 1BDIA 1EDDA 2YWRA 2VEOA 3GJ3A 1XQ9A 3GZNB 4DM4A 4KGVA 1BDBA 1PT9A 4MIKA 1WUHS 4HWRA 4OAQA 1DFIA 1G8KA 1RXIA 4KVAA 4LKOA 1DIRA 2GEUA 3I09A 3ZH9B 2XYHA 1KZHA 1GPAA 2FP4B 5EXSA 1M72A 4WJLA 4UZFA 2BEVB 3VYTB 1L7BA 3OZXA 4WL0A 5LB4A 1GPBA 3TI9A 1R10A 2ZPAA 1MJFA 5C8XA 1PZNA 5JO9A 3TQSA 1QGYA 1V6SA 1JECA 2FN8A 4Q7JB 3VMFA 2FUCA 1D4ZA 1AKWA 1PJ4A 1OI3A 4BVKA 2WU8A 4YDRA 1T9ZA 1M2JA 1WW3A 2A9VA 2Z83A 4A2PA 1ZDMA 3TAHA 4FGLA 4NBKA 2E1RA 5TQ0A 4PBRA 2H4JA 1SUIA 1YL7A 1XMXA 1I0ZA 3SSOA 5E3HA 2F1KA 3DZIA 5CBKA 3JR7A 2RGAA 2H07A 3RAEC 5ALNA 3LCRA 2HIGA 2Y93A 3LUHA 3PHJA 4L57A 2ZK7A 5IF3A 5LIRA 2Q6VA 1YCGA 4TWAA 2PR7A 3PXAA 1KXJA 1UADA 5TX7A 3ZWYA 3GLHB 2JFFA 2I3AA 1TM4E 3B1WA 3O8NA 4D0SA 4TYWA 2FJUA 2HJHA 3V9AA 1TU0A 4WNIA 3VR4A 3CVUA 3KCQA 5KTMA 1FSFA 2GFIA 3ZU5A 4EEZA 1CS0B 1L9KA 1T13A 2GXUA 1EPUA 1EDBA 2PLFA 4L5JA 4EPVA 4EZBA 1BNCA 5C8ZA 4PNEA 3F97A 1D4AA 1U94A 1LWNA 1V16A 4C4YA 1IDOA 1JE1A 4K9KA 1PT5A 4MUHA 5LDDC 4X1KA 3U7RA 3V3TA 3UJAA 4K6KA 3VGPA 4Z86A 2GDJA 2QDXA 5IJ0B 3FZEA 1L1QA 3G8YA 3T35A 4OJKA 1E77A 4NYMR 1LPBB 2NUPB 1B1CA 2ZRMA 4YIHA 2NAFA 4ENPA 2FV8A 4GLBA 4B32A 1TOAA 3QEKA 4X66B 1NVFA 4I0WB 1BCRA 3K0BA 3PXBA 5E95A 2Z56A 4N47A 4KR2A 2XVMA 4H4EA 1NXQA 4U9HS 2HHHB 5KSOA 1GN9A 3DT9A 4ALMA 2I71A 4ME6A 1RWWA 1UMKA 1WWKA 1QBKC 2B6HA 2Z8ZA 3ANNA 3R3XA 4FHCA 4HXGA 1WUYA 2NZJA 2CNDA 1XDGA 3BEDA 2JI8A 3C98A 4E7PA 5AW0A 3H13A 3PR2B 2F43A 4K5QA 4NZPA 4EVRA 2A30A 4MR8A 2AVDA 4LYYA 3EEOA 1T4BA 3KKKA 5GVSA 1ODLA 1KY3A 3O9ZA 4MWTA 1WW2A 1JX6A 2C4VA 5B6IA 1NIJA 4S04A 3EC2A 4A6DA 3ORHA 2R65A 4TYQA 3H2KA 1ISGA 4TXMA 4ADSG 4CL0A 4Y1GA 4EI2A 4CW7A 2QPLA 3I9LA 1A5SB 4DSAA 1U9CA 1HL3A 3IE1A 1NVKA 2GK6A 1VL0A 5EHNA 1UBCA 2YS7A 2GZHA 1XJWA 2QLTA 4IJMA 4RJLA 4UBMA 4XB1A 4YJHB 4YRQA 4BDTA 1N1DA 3O8LA 1YZVA 3EEYA 4Q1EA 5LJLA 4DR4B 5K6TA 3WQQA 5JAQA 1W5BA 3CU5A 2Y2VA 3EUAA 5JFGA 2WK1A 3WGYA 3G1TA 3RFXA 1ZLXA 3TXAA 1ZJZA 4TLLB 2PY6A 2AZMA 3U7IA 1MOSA 3V1TC 3KYBA 5CMLA 5B1SA 1NA5A 3PJFA 1E79A 1MAHA 4JVOA 3LOPA 4M2LA 2OZKA 3PWZA 1E9VA 3TI7A 4CM8B 4F8YA 3G7SA 1P8AA 2G8NA 4KHZA 4PIPA 5JY1A 2G7ZA 4OQYA 4P98A 3IIMA 5EWLA 4ZOLA 4BJ1A 3KVRA 4Q66C 1ADBA 2HN9A 5EA2A 4S1OA 3EGCA 3TGLA 5HOQA 2EQAA 2XPCA 3MLAA 5IU6A 3T3NA 2PKXA 1N25A 4ND8A 3QU4A 2WG0A 1OYVA 2PXHA 1I4LD 4U8HA 4NZNA 5DKFA 5FWNA 3GLIE 3A1VA 4P80A 1QTIA 4FMCF 3Q40A 5HKLA 1VYHA 5U4QA 4U8GA 1JS1X 1KI1A 5JZ9A 2ODNA 4QYSA 4L0DA 3EULA 5JXGA 2VH2A 4BV2A 1F0NA 1GSOA 1T2EA 2D1TA 2I2WA 2VT7A 3NOVA 3JWPA 4UATA 1LW7A 4IQ4A 4WNCA 1R0XA 1N8SA 1V2GA 3L4EA 4HNAA 1LQ2A 5AVQA 1T34A 4A26A 1OI7A 2UXDB 1IUKA 4L8GA 4NZMA 1KH3A 2YDXA 2V7PA 2VP3A 1OYWA 2G88A 1DT5A 4Q3AA 3SKVA 4D5GA 1LDGA 1RAFA 1X1BA 2A2ZA 1LI5A 1O8CA 2CZGA 2YZ2A 3NHWA 4LDNA 1BWRA 1DJMA 2O14A 1WXWA 5ECGC 1NX6A 3AC0A 3TD2A 2QN1A 4N6GA 3IP9A 3DTYA 1IN7A 4Q9DA 2B35A 2EKQA 2OWEA 1DJPA 3FZNA 4XJSA 5A4FS 4HNSA 1W93A 4ISBA 2A7XA 3O4RA 4B71A 2FMKA 1KDPA 1LS6A 3CRRA 2H2IA 2I4IA 3QU9A 5ESWA 3WRVA 4JLDA 3W8RA 5JYBA 1OYOA 1DCFA 4AX8A 2HSGA 4N18A