3IC5A

N-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
NAMRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRMGVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of N-terminal domain of putative saccharopine dehydrogenase from Ruegeria pomeroyi.
rcsb
source organism Ruegeria pomeroyi
molecule tags Structural genomics, unknown function
molecule keywords putative saccharopine dehydrogenase
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ic5A00
1F12A 2EG9A 3UXYA 1U5AA 4TRNA 4EW6A 3QRWA 4J2OA 3HQ4O 3W4KA 2BI8A 4J7UA 5GZ6A 2D5AA 4ZRNA 4E31A 3GY0A 4K28A 1E3EA 1I2ZA 5JDIA 3NDRA 1BG6A 4YQZA 5T64A 4LRSB 3NKLA 1XELA 3ZHYA 1E7YA 4NFYA 5LC1A 3GR6A 4TROA 4TZKA 4RLSA 4BNZA 4YRDA 1KY4A 1UP7A 2YHIB 1E3SA 1P9LA 5JSFA 3T4XA 5EPOA 4CMEC 3TNLA 3NTOA 2RHRA 4OXNA 4HNGA 4CLHA 4WLFA 3Q0EA 2CY0A 4WLVA 3MCVA 3LSYA 5L53A 1IY8A 3E18A 3WDSA 5KKCA 3GMDA 1I2CA 1X1EA 4MJLA 1GZ3A 4DWVA 3MJEA 2C5EA 4W9NA 4BHTA 3BYZA 3VVCA 1V8BA 1ZKMA 2C59A 4NG5A 5I8ZA 1EDOA 3TZKA 5CDSA 4P22A 4RPGA 4JNKA 4YAJA 5KNLA 1BW9A 4ZVVA 4FJ0A 3FWNA 1YOVB 3BMOA 1F0YA 4P4LA 2VWHA 5IAAA 3K92A 4JX8A 4IJUA 2OMEA 4G5HA 1N2SA 1PZGA 1CDOA 3UF0A 2WSBA 1H0KA 4YR9A 3S2FA 3ITDA 3KYDA 3CZRA 3PRJA 3V1UA 3W8EA 3OIDA 2Q2VA 3GOHA 1BVRA 3UOGA 3HN2A 3LVFO 2VTDA 2O3JA 3I52A 5DT9A 1KC1A 1HE5A 4L8VA 3GG2A 4FFPA 1HF3A 4JK3A 2CSUA 4B3IA 1BVUA 2PTGA 3WOHA 1LBEA 4L4RA 4NBVA 3MJCA 4YACA 1CERA 3GHYA 1ML3A 3E48A 2GASA 1LSJA 3AY7A 1BSVA 4AJ4A 1ZK0A 3VZQA 4E13A 1EUDA 3ONFA 4J16A 2JAHA 4RPHA 1EVIA 3UICA 4E32A 3UVEA 3I9KA 4HFMA 4D44A 1Y81A 3PPIA 4Q9NA 5THKA 3GGOA 2BGLA 4N5MA 4NBRA 4LGVA 5DCUA 5A9RA 1PS8A 4LVUA 3QW2A 4NK5A 4AJJA 2Y99A 1MC4A 4D41A 1H5QA 4BB5A 4TRJA 1Q7CA 2FR0A 4CV1A 3A28A 4F3YA 3V8BA 1Z82A 1HYEA 2HSDA 1CETA 1PJQA 3K5PA 3PYMA 3DXFA 4JGBA 1IZ9A 1WVGA 1U9JA 3RBXA 4U0JA 1X14A 2NVBA 2DU8A 5G0SA 1GQYA 1EFKA 4I5GA 4J90A 1R6DA 5K9ZA 1O89A 3PYLA 3GPIA 3T7CA 1B2LA 2A4KA 3RU7A 4FOOA 4BMVA 4RVDA 4IDBA 1LEHA 1N92A 3GDGA 1O0SA 3H3FA 4F46A 2E4AA 3DBRA 4IDAA 2VOEA 2Z95A 3OP4A 1PR9A 2NACA 1LQTA 5L4NA 4CL3A 4NHEA 1ISGA 3LT0A 4R5MA 1CRWG 2J3JA 2JKVA 4EGFA 4IDEA 1P3DA 2PH5A 4WCFC 5AXBA 1J5PA 1HLDA 3UCXA 2EWMA 4IGEA 2JFHA 3PWSA 3BMQA 3KLMX 2O3TA 1PJSA 3PHLA 1P1JA 4GMFA 4QXMA 3QY9A 3SC4A 1R66A 4YTEA 2DFVA 3OIFA 4EEXA 1OFGA 4IZIA 3VH1A 1T26A 5K6AC 4WLEA 3O03A 4YRAA 3EGOA 2WE7A 3ULKA 3AY3A 3MEQA 2PGDA 2J6IA 1PL8A 1YVEI 2JHFA 3LT2A 3UCEA 4CQLB 5C5IA 1DC3A 1PGOA 6ADHA 1ZJZA 1X15A 4J43A 4LCEA 4UEKA 2EKPA 1BXGB 3BHMA 5EQFA 4H7PA 1YQGA 5A04A 2NU7A 4XJSA 5IG2A 1U28A 3HDHA 1LTHR 3VPSA 4OGWA 4ALNA 4MP3A 3K96A 2GN8A 1R4NB 1ZXBA 1NM5A 4YT8A 4MO2A 4I1IA 4K6CA 4XDYA 3VPXA 5JYDA 3QVTA 2EF1A 3C3XA 3ENKA 1KS9A 2FSSA 3L6EA 3FPLA 4XGIA 4XCVA 3T4EA 3LDHA 4PVCA 4CMAA 1N9GB 1YDWA 3KZVA 4MVJI 4PLTA 5HTOA 3B1FA 1LXCA 4YQYA 3TZ6A 4XRRA 3MWDB 3PZBA 4Y8VA 5JDCC 1LU9A 3RFTA 2YFQA 3VZPA 4M55A 1JWBB 5G4KA 3RBZA 5T5QA 2C0CA 1U7HA 1UDAA 2AEMA 2B83A 4GH5A 3UUWA 1AN9A 2TMDA 4N5LA 1PL7A 1Z75A 3M1LA 4CLRA 5C7LO 1WXDA 2P91A 3DBVO 4E4YA 5F1PA 3U5TA 6LDHA 1FDTA 3CXRA 1NPTO 2WEKA 1A27A 4MDHA 4NH4A 1ZXLA 2PZLA 1HXHA 1TI7A 2E82A 4II2A 2B4TO 2ZB7A 4PLWA 1T1SA 2ZB3A 4N5NA 3R0IA 5TC4A 5TRTA 5L3ZA 3SEFA 5ER6A 1T2EA 2OHXA 3DZHA 4U7WA 3OA2A 1VSVA 1WW8A 2VNAA 5EESA 5B37A 3V5NA 2W90A 3GK3A 2EJWA 4YRBA 4BNMA 3OQ6A 3I3OA 1PGPA 2EERA 2JFFA 5EIOA 1P77A 4YT2A 3EK2A 5F5NA 4JP2A 5CDGA 1UXHA 2O3SA 2PZJA 2RH4A 3HSKA 3W4JA 2BKAA 4F6LA 1D8AA 3NT5A 2YV3A 1YGYA 2PR2A 4DBVO 2G17A 5G4LA 4K26A 4L74A 2V6MA 4XB2A 3F1LA 1ZCJA 3WGHA 4PRLA 2QHXA 2HK9A 1FXSA 2EV9A 3VPHA 3ZWOA 4EJ6A 1IPEA 2AE2A 5ENDA 3CE6A 4A5OA 3WGTA 2PKQO 5F1OA 2P5YA 2Y1FA 1U4OA 3TJRA 5L45A 1NTOA 2D59A 2Q4EA 3RC7A 3IUPA 3FNHA 1R4MB 5ITWA 1XEAA 1A72A 2Q1UA 1A7KA 1CYDA 4FCCA 3DTYA 5A05A 1YONA 2AEJA 3BMCA 3ETEA 1XLTA 3ZWWA 2IXAA 4A26A 1YL5A 3ZI0A 4W7HA 3FI9A 1NVGA 2EKLA 5EN4A 5CPBA 2I67A 3ANMA 1A71A 2OL4A 4CLOB 2CZCA 2X4GA 2BMAA 2EEZA 2VHXA 4M86A 4BL5A 2A9FA 4YT4A 2B69A 3RUIA 1T4DA 2BLLA 5L7WA 4WCFA 2X1HA 3CINA 3ZWVA 3S2EA 3WIDA 4NQZA 2VHZA 1Q7GA 2DQ4A 4MIYA 2AXQA 2OO5A 1ZFNA 1NASA 2GUGA 4XD2A 1DIRA 1I33A 4NU6A 1UDCA 2OOSA 3IP1A 4OIMA 5AOVA 1X13A 4L75A 1PGNA 1GEEA 1GCUA 2NTJA 3RC9A 3D3WA 4BS9A 3KUXA 4DMMA 1M76A 3KTDA 3CUKA 2ZQYA 5A9SA 2HCTA 2HJSA 4NBTA 4ITUA 2SCUA 4RV9A 1NX6A 3QWHA 5A9TA 1X7DA 4L9RA 3I1JA 1BXKA 4JJFA 3GN1A 5CG2A 2CF6A 2X0IA 1PS0A 4R16A 4ZQGA 3H5AA 3H2ZA 5KVCA 2IEBA 3LZ6A 1RYEA 2DLDA 2Q1TA 1K6XA 4C7KA 3I5MA 4C4OA 9LDBA 1UP4A 3EY4A 1ORRA 4FIZA 3VTFA 3QJ5A 1GUYA 1FDUA 4GQAA 1PIWA 1R0SA 1JW9B 1T1RA 4INAA 1H9AA 1SNYA 2BFPA 3JD3A 3KVOA 2Y0EA 3WGGA 2UVDA 3UHAA 1E1LA 2B35A 2QRJA 4XYGA 4AJLA 4B8ZA 4CM5A 4KTTE 3ZWNA 2GN6A 4URFA 4Y6PA 1KOLA 4D0SA 4DIOA 1UZNA 1BXGA 1YKFA 1GEGA 1LSSA 4IIUA 1DRUA 1L7DA 1XGKA 2FRDA 4GX2A 3OJ0A 4J4BA 2C54A 4OKIA 4GVLA 3MWEB 1NBOA 3ONEA 4OJNA 2HK8A 1E7MA 1ZEMA 3K6JA 5AXCA 1OC2A 3MJVA 2PZKA 2CUKA 2Y1EA 3D0OA 3GAZA 3U0BA 4KDEA 1D1TA 1YQXA 4AJ2A 1FJHA 1NR1A 1JU9A 2CVQA 3AUUA 5KJEA 3ZZNA 4BO2A 5ITVA 1P1FA 4XJTA 4E3ZA 4IXTA 3EVNA 3TPCA 3MTJA 3OICA 2VTEA 1Z45A 4KUHA 1DIGA 3IJRA 2G0TA 4P4GA 3TZQA 1X0VA 4YJFB 5G4KB 1ISMA 3I9OA 4I9UA 3ZU2A 2FZWA 1I36A 1NVMB 2IXBA 4P4NA 4E2ZA 3QHAA 1DRVA 4DA9A 2IZZA 1ISIA 4DMLA 4H15A 3GVHA 1AUPA 3GLQA 1BHSA 5KKAA 5IZCA 1FF9A 2FP4A 3OMLA 4A27A 2J3HA 2DVMA 1BW9B 3KHUA 2EKQA 3NUGA 2O3QA 3ZV5A 2RH8A 4K9DA 3IS3A 5G0TA 1OC4A 4GVXA 2VZ8A 1DHRA 1QLJA 3DR3A 1DJQA 2ET6A 4BNXA 2AA3A 1QR6A 2BFAA 1NFFA 4MPDA 1PJLA 4FC7A 1PX0A 1YRLA 4E12A 3QE3A 2ZTUA 3I6QA 5BNFA 2Q4BA 3ZNQA 1HE2A 4U6QA 4MVJD 3CZMA 2PZMA 3PGJA 4TKMA 5TJHA 1D7OA 1MLDA 4R4JA 3ETDA 1I30A 2X9GA 1DLJA 4D3DA 3GFBA 4Z3KA 4PN3A 4CPDA 1M6HA 3U09A 1VM6A 1UAGA 4UVEA 1LDEA 2IYOA 4U0KA 3SC6A 2GGSA 1KIFA 2EHDA 1B7GO 3ZWXA 3VOSA 2XXBA 1YH3A 3BMCB 4ND2A 1I24A 2Y1DA 1U3TA 4DTIA 2VHVA 3B1JA 3UH1A 3H9GA 3VPFA 3GQVA 3WGYA 1H93A 4BO6A 1F14A 5CEJA 3ROKA 4FFLA 4YAGA 4J1QA 4OL9A 3CSDA 5EERA 2JL1A 4LISA 3DBRB 5DP1A 4XRGA 4YA6A 1QLHA 4LN1A 3IUSA 3DMTC 4UAGA 1Y7TA 1W73A 1ULSA 3GA0A 3SLGA 1GR0A 3D4NA 4PG5A 4BNIA 3OIGA 3U49A 3GVIA 4ZGWA 1F06A 4HUJA 4XZ3A 3VH4A 5HS4A 4AJHA 5JDCA 1EE9A 3H9JA 4GSLA 1HEUA 4AICA 1EZ4A 7MDHA 1KVQA 4R5HA 4E33A 3WGIA 2E6UX 3IP3A 1L7EA 4IINA 2EW2A 3L4BC 4UVGA 2Z1MA 3SVTA 5JNLA 2Q45A 1IE3A 2NQ8A 1DXYA 4N18A 3BMQB 1C14A 1KEPA 1PWXA 1YL6A 2CD9A 3PJGA 3ZNNA 4DREA 4W6ZA 1NQAO 4QFCA 3JQ6A 1GAEO 3SJ7A 3SXPA 4ND3A 1LRLA 1LRJA 3RI3A 2Q50A 4A7PA 4LW8A 2AMFA 1ZNQO 2HMSA 4CL8A 3DQPA 4RZHA 1Q2XA 4O59O 4XYMA 2FMUA 1AHIA 3RKRA 2BI7A 4ALKA 1E6WA 1K3TA 4ALMA 3NX4A 3PEFA 3TSCA 5TIIA 1FMCA 3DZKA 5T8KC 2LDBA 3ZNOA 3ZWPA 3RFXA 1E7SA 3LF2A 1MXFA 3FWZA 2O50A 3PYXA 2X0JA 3AUAA 3HFGA 1IHXA 3DHYA 5CP8A 1GZ6A 1FDVA 3E1KA 3MZ0A 1DIAA 3L4BA 2I3GA 1LX6A 2VWQA 4OO3A 5B4UA 5BSGA 1NVTA 4Y9DA 8ADHA 2HRZA 1UH5A 1RM5A 1UUFA 2DUWA 3ICCA 1R37A 1ONNA 2JJYA 3Q9NA 1I8TA 1V35A 5TNXA 2HO5A 3BZUA 4YJHA 1PWZA 2XOXA 4IS3A 3UKOA 2GPTA 4CODB 3ASVA 1XWFA 4EJ0A 1LNQA 1AHHA 1EQ2A 3MTGA 4KWIA 3WS7A 4DLBA 1EUCA 1I0ZA 5AXDA 4DPLA 2JFGA 1LRKA 1T2AA 3CKYA 3IJPA 4R41A 5T57A 3GN2A 1ZUD1 4EEZA 5IF3A 3H9EO 2JCXA 3ZDFA 1HYGA 1XCBA 3A1NA 4BGUA 4ESOA 3CH6A 1A7AA 1G0OA 5I9LA 4GSKA 2GD1O 4BNTA 5KJ6A 1B16A 3LLSA 3G17A 2RAFA 4PZEA 4L76A 4ND5A 2C20A 2JD2A 4E0BA 4TRMA 1OMOA 3JQ9A 2NTNA 4TVBA 3IKTA 1M6WA 3VH3A 3C85A 2VWGA 3GHHA 4Q3DA 3SJUA 3KB6A 1WDLA 2P5UA 3NEPX 2W4QA 3IIEA 3KYCB 2QYSA 4YJDA 4DBZA 1QYWA 4BO8A 3DC2A 4E5KA 3GGPA 3INRA 3OEYA 2D2IA 1YB4A 1B8VA 4UVIA 3D3EA 2GN9A 3OSUA 4CR7A 4BMNA 4OQZA 3WSWA 5A02A 2W2KB 2VT3A 1B8UA 4ILKA 2B36A 3GMSA 3GGGA 3A06A 1KEUA 3L9WA 5JO9A 1XIVA 2G76A 4YAKA 4GX1A 4GWKA 4IS2A 1I3LA 2VRBA 4IZHA 4LVCA 3EC7A 5EINA 4E2YA 1B8PA 1W4ZA 5DCWA 1LJ8A 3E9NA 1GL3A 4CLOA 5C37A 2HJRA 3HFSA 1V3TA 1QYCA 1HDZA 1M67A 1SC6A 4QEDA 4AJKA 1GUZA 1ZK4A 5TJ9A 4DLAA 4AJIA 4M1QA 2JCVA 4BNNA 1DC6A 1I3MA 2I66A 3QQPA 4MP6A 3JQFA 3AFNA 1XA0A 4HWKA 2YZ7A 2YV2A 2YDYA 4QT0A 1I5RA 5FYDA 1BRMA 3PDJA 4DQUA 3QSGA 1MFZA 3U62A 2Q49A 1ISFA 1V6AA 5FFFA 1XSEA 2GYYA 2XAAA 3AM3A 3EUWA 4D43A 4BUCA 2NVUB 1EE2A 4ALJA 4WCFB 2X0NA 1V3UA 4HV4A 4D0RA 1GTMA 3V1YA 1NWHA 1N1EA 4K6FA 4IQGA 1RM3A 1GYPA 1TT7A 4Y98A 1UXGA 3IC5A 1G0NA 3WNQA 3P5SA 1DC4A 4XB1A 4NFHA 3RWBA 4QX6A 2OP1A 4GLOA 2Q3EA 1R16A 5JMPA 3TZCA 5CHEA 5EJ2A 4WE3A 4DYDA 4RVUA 4ZQHA 5FI3A 1A9YA 4B7CA 5IXSA 3NT2A 3D1LA 2CF5A 3P7MA 3W6ZA 1YB1A 4JLWA 3B6ZA 3N58A 5CDUA 5LDGA 4AG3A 3WNVA 1PZEA 1DFGA 5AYVA 3AU9A 1TT5B 3S2IA 3JD4A 3FF4A 3CMMA 4CR6A 3WIEA 3F1KA 3BTSA 1ONOA 2X8LA 1U2DA 1L1FA 4XYBA 3NT4A 1WWKA 1VC2A 1YB5A 1U3UA 3BMOB 3V1TC 5JFOA 3E9QA 1PQUA 2Y1GA 3RASA 1ENZA 3ZW8A 1Q1NA 3VZSA 2X9NA 2XPCA 2FN7A 4TZTA 3ZH2A 2PWZA 4BNWA 3PWZA 4EZBA 5JE8A 1R0KA 4BO1A 4JBIA 3QVWA 1R0LA 4JN6B 4S3MA 1N1GA 4MIEA 2VHWA 4Z0PA 5JAMA 4Q3EA 3STHA 5J23A 3C1AA 2YFHA 3RD5A 4MVJF 3KSUA 4QO8A 2PFGA 4YJGB 5BNTA 5ADHA 3VPGA 4HP8A 2FWMX 3ADOA 3NDJA 2G82A 4IDFA 3N74A 3PIDA 3BXXA 2I6TA 5MGBA 3HJAA 4XGNA 1A5ZA 4BV9A 1E7QA 2IYPA 3VTZA 5JPIA 1H6DA 1VLLA 4B4VA 2J5RA 2HUNA 2RIRA 5H83A 3QIVA 4IJVA 4R1UA 1DC5A 1GD1O 3RJ9A 3UGKA 3MJSA 5CDYA 2GR9A 3OBBA 3FNEA 4YXFA 1TT5A 1M2WA 3U4CA 3I9JA 2DPHA 2XXJA 1SAYA 3FR7A 3EDMA 1PQWA 2UV8A 2Y0CA 4P8RA 2OUIA 2PKQP 3DOOA 3WYCA 3OQBA 4RPKA 4LMRA 4DC0A 4DYVA 3PDUA 1H6CA 1N5DA 3UW3A 2X7HA 1VL6A 3PHJA 4AFNA 4HY3A 2VN8A 1PZHA 4BV8A 3BHIA 1E3JA 5A4DA 4B79A 4CMCA 4BNHA 2A92A 1EEHA 2UUOA 1PJ2A 4CJXA 2WE8A 1KYQA 2IEDA 4JP3A 2NADA 4PG8A 4PLVA 2E48A 2G1UA 3R1IA 4OQYA 5CFZA 4RCVA 5L7TA 1C1DA 5DDIP 4BO4A 4I5FA 4G2NA 4UEJA 1J49A 2NVWA 5FI5A 4BKUA 5JDIC 3ZU4A 4Y67A 5KIAA 4CMIB 4B7UA 3OQ1A 4J6FA 3W4IA 1P1RA 3GZ4A 3DMYA 4U8GA 3WG9A 4CQMA 1LDMA 4PG7A 3Q1LA 3UAGA 4OSOA 3ZWYA 3MOGA 4FQ8A 3H9QA 3KRTA 3C7CB 3KETA 3KOUA 3PK0A 4W99A 5DF1A 4DQVA 3GRKA 2A35A 2V6FA 2WTBA 2P9CA 3EVTA 3E5RA 5HS6A 5FEUA 3FCOA 1KBZA 3OHSX 4BNJA 3H4VA 4CMEA 3DBHB 1BTOA 1AGNA 2V65A 3M2PA 3ONDA 3MJTA 5KOIA 4PRKA 4ID9A 4E21A 3I83A 1YJ8A 3L6OO 1VRWA 1I32A 1YE3A 2O3UA 2Q1SA 4H3VA 4KOAA 2NU8A 1O8CA 2QIOA 3TFQA 1N9GA 1XG5A 1J4AA 3QWBA 3WYEA 4GWGA 3H3JA 4BKRA 4Z0HO 1EVZA 1K0UA 5G0UA 4WLOA 2QRLA 3U4DA 3JD0A 2WD8A 3K8ZA 4PIVA 1NPYA 3EHEA 5BSEA 3HWRA 3FNGA 3RU9A 2EP5A 3VVBA 5EQDA 3PJDA 2DBRA 4CLRB 1EVJA 4DGSA 4IDGA 2YV1A 1Y9EA 1LUAA 3LC1O 5U4QA 4WASA 4BNLA 3CPSA 4C7JA 3Q2IA 4J0EA 4J4TA 1XQ1A 3GDOA 4WOJA 1KVRA 3JQEA 4CQMB 2W2LD 5IN4A 5C7OO 1DIBA 3JQGA 3RSHA 5U1PA 1GU7A 4CV3A 3EW7A 2UAGA 1KVUA 2OXIA 4J9UE 1QG6A 1PU2A 4J2HA 4BOYA 1RM4A 3AOGA 2FZEA 3JYOA 4J1SA 2UYYA 1P31A 3AY6A 4E6PA 1X1TA 3QWIA 1EBUA 3P19A 1E7WA 3M6IA 2WMDA 4NZ9A 1ZIDA 3JQAB 3DZBA 4FB5A 2BFMA 4YEDA 1CWUA 3WGZA 1T2FA 4GKVA 1RKXA 4YYZA 4WKGA 3G1UA 1HZZA 2WYVA 4OM8A 3GPDG 4Q3CA 3QA9A 3R3SA 4I9HA 1P0FA 2VYVD 3GF4A 4HFRA 3WGQA 3W1VA 1SCUA 1W0CA 1XHLA 1C0PA 3ZU5A 1E92A 4ONEA 3G1TA 5JAQA 3CEAA 5JYEA 2ZTLA 3DAFA 3WYBA 1JVBA 1Z7BA 2VZ0A 3OF2A 1P44A 4PLFA 3IMFA 4RVHA 4CUZA 3JQAD 3HE3A 4E5MA 4ZICA 3PWKA 1HDGO 4QQRA 2B37A 4FFOA 3PFFA 1NXQA 3P2YA 4D46A 4O1MA 5H82A 2X86A 1D4FA 2Y68A 2NSDA 4FS3A 4XWYA 4XX0A 4AVYA 4M54A 4OAQA 5JAZA 3K9QO 1NP3A 1S6YA 3AI3A 4HKTA 5A3JA 2ZATA 4BNFA 1HKUA 2J5QA 2NLOA 3HDYA 2VUSA 3DAPA 2X22A 1UAYA 3PHGA 4H16A 4RQUA 2C2XA 4XYEA 3JYNA 3QWAA 4CM6A 3QP9A 4OSPA 4NIMA 2EGGA 1TLTA 4DLLA 2JAPA 5BR7A 2YHIA 1HTBA 2I76A 5BNIA 3TF5A 1QV7A 1JKIA 3HB5X 3JTMA 2W2LA 4WNIA 1YL7A 3KYCA 1J6UA 2I99A 1HSZA 3QV1A 1GCOA 1UDBA 2BD0A 4YT5A 1DSSG 2HMVA 4PFJA 4YB8A 1E77A 3A14A 2C82A 4E5PA 1RJWA 1W8DA 3EMKA 3GNTA 5HM8A 1MG5A 1RM0A 1HRDA 3D3WB 4CMHA 1HDRA 3H6KA 2X5OA 4IPTA 5ICMA 1DIHA 3OJEA 3C8MA 2VWPA 2HAEA 3OH8A 4D79A 5KTKA 2CDCA 4ZRMA 3WWZA 4D42A 5B4VA 4FPXA 4LRTB 2JCYA 4D45A 1B3BA 1XYGA 3NRCA 4GX0A 4CM8B 4TWRA 1ADBA 1NFRA 1Z73A 3JQFC 3L77A 5IZ4A 3WJ7A 2GZ2A 4MKXA 2IZ1A 3C7DB 4R1TA 3GZNA 5I7VA 3AUSA 4DIBA 1QMGA 4FFNA 3WFIA 2IZ0A 3AI2A 4A03A 4D3FA 1KVSA 3OETA 3HHPA 2PV7A 4NR0A 1MC5A 1I2BA 2BHLA 3KSZO 5COAA 4IIVA 1GUFA 4O63O 1T2DA 3DZFA 4CM9A 2B4RO 3ZWCA 2F00A 2P68A 3TL3A 2NWQA 3PGXA 4G65A 3JQBC 1Y8QB 4W7IA 3RQSA 5FWNA 5A3VA 1ZSYA 2TMGA 5CG1A 3BMNB 1Q0LA 2BF7A 3GUYA 1VI2A 4BQRA 2I5PO 1PJ3A 5JY6A 2B5VA 4GPD1 4GL4A 5AVOA 4BQPA 2YYYA 4ZN6A 3ZU3A 3ZCXA 4ZHSA 4LSMA 1VL0A 4BMSA 4PLHA 1TEHA 4JJGA 1SZJG 3FTPA 2CVZA 3ZV3A 1HLPA 1ZEJA 3Q2KA 4TQGA 5F21A 3HDQA 1TB4A 1LI4A 2LDXA 1H6AA 2X0RA 3SX2A 3OM9A 4R1NA 2O2YA 1SEPA 1HDCA 5I8WA 1Q0QA 2AE1A 4ZD6A 4UVDA 3COSA 4OH1A 4KUGA 4BNYA 2IODA 5IJZA 3D4PA 3JQGB 3TFOA 1CQJA 3L4SO 1PSDA 5TX7A 1ZMTA 1U8FO 4CQLA 3ZN2A 1E3IA 4GAEA 3GVPA 4NJOA 4BNKA 2GCGA 3PQDA 4IMRA 1YDEA 5IN5A 1IUKA 3F6YA 3GRPA 2O23A 5DN9A 3FHLA 5DZSA 1LLCA 1SBYA 1VPDA 4F6CA 3DO5A 3GH3A 3PQFA 4RO0A 2EP7A 2ZQZA 1HYHA 3GUCA 2GNAA 1P0CA 3H5RA 4QUKA 3AFMA 1MFPA 1GY8A 1YXMA 2GLXA 2OP0A 4II3A 4NMHA 3RAJA 3IL2A 5IXYA 1B14A 1IHYA 1UZMA 5A5FA 2R00A 1PZFA 5ENVA 1BWSA 5IZCC 3AM5A 5I7SA 1E3WB 2VQ3A 5IDXA 1LSOA 4GX5A 4YAEA 4R1SA 3PJEA 3JQ7B 2CDBA 4WEQA 3IAHA 1ZK1A 5COBA 2WWRA 3PLNA 3BTVA 4DQXA 3JCZA 2JD0A 5GZ3A 1QYVA 2Y93A 3PLRA 1WMBA 3WGOA 1LDBA 1UXIA 2X6TA 4LCJA 2FY8A 3T7EA 1EFLA 1SEVA 2AQ8A 3HADA 4U6SA 2PH3A 4PCVA 2BELA 2CFCA 1V9LA 2HDHA 4UULA 4BNUA 3PI7A 2O4CA 2PNFA 1HT0A 3WMWA 3GAFA 1PS9A 1E1MA 2NVUA 3ZNPA 2VNSA 2P4QA 5LDHA 4KDFA 4R54A 3WQRA 3TQHA 4J49A 2EIHA 3G0OA 4HBGA 4IXWA 1PJBA 1MG0A 4MVJG 3GNSA 3RUAA 4L0QA 2POQX 4R51A 4GGPA 2RHCA 2Q2WA 1YO6A 1BDBA 1ID1A 1K5HA 3L0DA 2BH9A 1LDGA 4E5YA 1HETA 4WLNA 2AQKA 4CMIA 4CM7A 4MVJM 1CEQA 1RYDA 1MB4A 3HN7A 1E1NA 2FPGA 2VYNA 1GDHA 1G1AA 1U5CA 4GKBA 2NTVA 4X54A 5KVQA 4CV0A 4E30A 4RDIA 3FD8A 3W8DA 3RCBA 1HL3A 3B1KA 4XIJA 3S55A 3PZRA 4N7RA 3JQ7A 1C1DB 2E49A 3UFXA 3AJRA 7ADHA 3SBOA 1XR3A 3HNPA 3FRJA 1FK8A 2ZCUA 3PHIA 5GZ1A 3O8QB 1EUZA 5DOZA 5IDYA 3Q11A 3S8MA 1T24A 3FBGA 2ZJ1A 4XIYA 5ES3A 1E1KA 5BT9A 4QTZA 3F3SA 1JTVA 1UJMA 1U3VA 3DTTA 4DVJA 2WD7B 2QW8A 3D4OA 1VL8A 3JSAA 2ZIZA 1YJQA 3V2HA 2WM3A 1Y8RA 2NU6A 3ZWAA 5ER9A 2O7SA 4A73A 5TLSA 3H2SA 1UP6A 3F47A 5L9AA 4EDFA 4B4WA 2NUAA 3E82A 4EYEA 4BO5A 4YVFA 3DZJA 1E3LA 3KO8A 5THQA 4FC6A 3F4BA 2ZYDA 3OJLA 4RVSA 3NGLA 4QO7A 5HRUA 2DBVO 1BGVA 1WLYA 1Y8QA 1P1KA 2YUTA 2H6EA 4N54A 1BMDA 2I3AA 4IY1A 2VYND 2WYUA 4K1LA 4KZPA 1NQTA 4WK6A 4OYRA 1QSGA 2PY6A 3NYWA 1P1HA 4BGEA 3PIIA 5JC8A 2NM0A 1ULUA 1B0AA 1B26A 1DHTA 4PZCA 4CUJA 1SOVA 3QVSA 1OOEA 1WNTA 2FPPA 4KWHA 1YOVA 4NNJA 4DRYA 1DDOA 4XQ9A 2EXXA 2OZPA 2W8ZA 4B3JA 1M66A 1YWGO 1PJCA 2R2GA 1HDYA 3IOYA 5TT0A 3RBVA 5C3MA 3EYWA 3WMXA 4BO7A 2D5CA 3V2UA 4O5OA 3ZV6A 1XQ6A 3A4VA 2CMDA 1HE4A 4Y6RA 1H2HA 4Z9XA 4WJZA 3TL2A 1HE3A 2X9VA 4Q39A 3ABIA 3K2EA 3I23A 3WLFA 1Z7EA 1HWYA 5L51A 2B0JA 4EI2A 4RF2A 1JLLA 1A4UA 1JKJA 1ZO8A 1R12A 3WICA 3ZHXA 1TXGA 2PKRA 1NYTA 2HMUA 3PVZA 4CM3A 1O6ZA 2H9IA 3WB9A 2YJZA 5CEFA 4CMBA 3JQAA 4R3WA 1IPFA 3ST7A 4RF5A 1IYZA 5JLAA 4JBHA 1F17A 9LDTA 3LC7O 1OBFO 2QX7A 4A0SA 1B3RA 1I10A 4JXKA 4BO9A 4CLDA 3QVXA 3B70A 2FR1A 3HG7A 5DNAA 2W2KA 4IM7A 1I3NA 2VYVA 2PD6A 4QSMA 1ZZEA 3RUHA 3X2EA 1LLDA 2Z5LA 3KEOA 4XR9A 3E8XA 1D1SA 1Y5MA 4YJFA 4YWJA 5FF9A 4L73A 2VOJA 4NJMB 4WCDA 3NJ4A 3E9MA 5G0WA 3CMCO 1Y9AA 3WTBA 1Y5RA 2E37A 3WQSB 2C2YA 2ZK7A 1V3VA 2DTXA 1H2BA 4PZDA 1Y1PA 3NDIA 4RORA 5T67A 4PLZA 4UUMA 4WLUA 1T2CA 4QFDA 1KETA 2F1KA 4TRRA 3WFJA 2NQTA 3KM0A 2UDPA 4HX5A 1EVYA 2OBYA 3K73O 3ANNA 3PQEA 4RZIA 4U5QA 4R9RA 1ZVMA 5F5LA 1LDNA 1VSUA 4IQ0A 1UXKA 3E03A 1N8KA 1QXSA 3JQBA 4UUNA 1KERA 4NBUA 3LT1A 5KJ1A 1O95A 4W4TA 1Q7BA 3GEDA 5EMHA 1KEVA 4RF4A 1FDWA 1GZ4A 1ONPA 2O2SA 3U4HA 4CMGA 1M75A 2DTDA 1DB3A 4GGOA 5BSHA 1BDMA 5I9MA 3H65A 2H63A 3AK4A 4FGWA 4UUPA 4OXYA 2ILTA 3OECA 1LC3A 4JIGA 4MP8A 5GMOA 2QRKA 3LC2O 1WAMA 4MVJE 4PLPA 3WBFA 4BVAA 4J9VA 2AQHA 3D7LA 4OMUA 3VAZA 5JAIA 1QP8A 3NV9A 1RPNA 1ZBQA 3PJFA 3L6DA 2C29D 2Y0DA 1PR3A 3MOIA 1HDOA 3O9ZA 1DBVO 1Y6JA 3EZYA 3RUEA 2GO1A 5JS6A 4CM9D 5K0ZA 1VJ0A 2ZTMA 4NJMA 1QYDA 1V0JA 2AW5A 1Q0HA 4CMKA 3PTZA 4FDAA 2J8ZA 1E6UA 2J3KA 1VJ1A 2VHYA 4XEHA 5JW6A 2WYWA 4BKQA 1WPQA 2YY7A 1UXJA 1SMKA 1GPJA 2QZZA 1U8XX 3BMNA 1LC0A 2X5JO 4KMSA 4UREA 4CQMD 2Y1CA 1ZK3A 1UZLA 3LU1A 5EL0A 5KVVA 3U4IA 4JQCA 5DP2A 2Q46A 1ZSNA 3RUCA 2IRWA 2AEFA 2ZYGA 4PVDA 4RVFA 3WLEA 3DFUA 5HBRA 2OFPA 4YJGA 4Z9YA 1C3VA 2DFDA 3E6AA 3AOEC 1KVTA 2B4QA 3KV3O 5TQVA 4CM4A 1ZH8A 3F9IA 3QLJA 3RUFA 1Z6ZA 2EW8A 4IGFA 5TT1A 3NTRA 5A03A 2EJVA 1HSOA 1NQOA 2B5WA 3VC7A 2UUPA 4HNHA 1NHGA 3F4LA 2IE0A 2Q2QA 4BKOA 3IDSA 3NTQA 5MDHA 4M87A 2YDXA 5TGDA 1JWAB 1W6UA 5L7YA 2Q99A 3BHJA 4RGBA 4J1TA 1CQIA 1O9BA 3TDKA 4D7AA 4MKZA 2QQ5A 1CIVA 1EMDA 1YBAA 1I3KA 1WZIA 1JAYA 2GF2A 2PK3A 1ZSVA 1P74A 3ETGA 5I7FA 2P9GA 4Q3AA 3M1AA 4YAIA 1DFIA 3FBTA 4NU5A 4RJTA 3WXBA 4Z6KA 1G6KA 1N7HA 2BGMA 4S1VA 4R3NA 2GERA 2C7VA 3S1LA 4DPKA 5ILGA 3D5QA 3WQQA 1K6IA 3VHRA 1CF2O 2I65A 1QRRA 4W9NC 1P1IA 1T4BA 5COQA 1U4SA 4GBJA 4CLXA 3ORFA 3LT4A 5T6BA 4CUKA 3I4CA 4XA8A 2PA3A 3BIOA 1X7HA 3AI1A 4IQ8A 3JQ8A 4E5NA 4XQCA 4KQXA 3GT0A 2QYTA 4MVJA 4I5DA 1DPGA 2ZYAA 4OOFA 3IQDB 3K31A 1K6JA 1PGQA 1AXEA 4XKJA 2CVOA 2C5AA 3M2TA 2Y1OA 1NQ5A 4ZU3A 3LLVA 5A5EA 3QVOA 1KC3A 2CNBA 5B1YA 1IZ0A 1OI7A 3DHNA 3Q9UA 4ND1A 4UUOA 1JN0A 3DFZA 5JBIA 1GQQA 3CTMA 5KCZA 1GQ2A 1PQPA 1O94A 2RBEA 3DONA 5B12A 4IMPA 4RL6A 3DL2A 1X0XA 5TF4A 2C07A 3AW9A 2O48X 4XQEA 1SB9A 2JD1A 2DKNA 2FSVA 2DUUA 3GEGA 1C1XA 3GZNB 4UVHA 2WJPA 5AQ1A 4WEOA 4GI2A 1NPDA 4AJPA 3ZWBA 4CLEA 3FTNA 1SOWA 1T25A 3I9NA 3GG9A 3Q3CA 2ZTVA 1X7GA 4E2XA 5LCXA 2R6JA 1F8FA 5KJCA 3AWDA 5JY1A 3KEQA 2IDZA 1JA9A 2GZ3A 4HFJA 2GDZA 3EZLA 4DL9A 1C0IA 1WP4A 2D1YA 4NI5A 1WDMA 3PP8A 4LSWA 1MGOA 1IULA 4PGFA 1ADFA 4AJNA 1A9ZA 4RF3A 4GMGA 2C7GA 4Q3BA 2EGHA 2O7QA 1VJTA 1KEWA 3RROA 1EDZA 2PD3A 4B8WA 4EJMA 3C7AA 2D4AA 1GFSA 1Z74A 1NR7A 2HK7A 2V6BA 4YCAA 3ZHBA 3ZWMA 3HDJA 1NAHA 3PHHA 2DBQA 5GY7A 1XKQA 4NBWA 2P4HX 5KVSA 4WPGA 2V7PA 3NAQA 3I9LA 3E5MA 4B7XA 2D3TA 1ZJYA 4ALIA 1E6EA 2AHRA 4FR5A 4YJHB 5L4LA 4Z9FA 4XR4A 1ENOA 1O5IA 4FFRA 4IJWA 3NJ8A 1S7CA 3GC6A 1HZJA 2PGLA 1H9BA 2YW9A 4KTVE 4RDHA 1NNUA 2NNLD 4BIIA 5CEEA 4O0LA 5JMWA 5DOVA 4Z3DA 1P45A 3ASUA 3X2FA 1DAOA 1LSUA 1QKIA 2X23A 4GLLA 3VH2A 3ROMA 1ARZA 3ROQA 1OZAA 1C1XB 4CMJA 4MIOA 1RWBA 2DC1A 8LDHA 5U9CA 1Y8RB 2HKIA 5JC1A 3JD2A 3UCFA 1GYQA 4MINA 1H94A 3H7AA 3ON5A 3O8QA 2GSDA 2ZKLA 3C24A 1XU9A 3RC1A 4KQWA 4YPOA 2J5KA 3CIFA 4CV2A 4M8SA 4P38A 2WDZA 1TA4A 3AU8A 2OGUA 3KSDO 3WTCA 4ZA2A 1ENPA 4B4UA 4M49A 1R4NA 3C1OA 1DO8A 1VKOA 1E5QA 3L07A 4MKRA 3RJ5A 3KYDB 2VRCD 3DWFA 5HA5A 3WX0A 2AG8A 4A10A 1ZMOA 4KUEA 1YBMA 4OKNA 4DXHA 1DOHA 2X5KO 2QG4A 2A94A 4OOEA 3HB4X 2QZ9A 1ADCA 3IKVA 2H1SA 1MUUA 3LF1A 3R3JA 4CM1A 5JCXA 1TVEA 3OJFA 2BGKA 3I6IA 3PXXA 5ICSA 3DZIA 3OFSA 4DPMA 1JVSA 5BQFA 2O3RA 1QORA 4A2CA 4DIFA 4JROA 5H81A 1QYXA 1K2WA 3HZZA 4WNCA 2I9PA 3DAGA 4F45A 2AQIA 3ENNA 4ND4A 4OXKA 4B3HA 4BO3A 1A4IA 1IL0A 2PGJA 5K6AA 4Y6SA 2ZB4A 2Y66A 3B20A 2GRAA 3RFVA 5JCJD 3UN1A 1LLQA 1D3AA 4MVJH 2HRBA 1YS4A 4TMFA 4JBGA 1E0DA 3FPCA 3KLPX 3S2GA 2VCYA 3DB2A 3GEMA 1YBVA 2Z1NA 3C1TA 1ZW1A 3VZRA 3RUDA 4AJOA 4BB6A 1GV0A 4JJIA 3ROPA 4J91A 2VZ9A 2AG5A 1PGJA 1SO8A 3LQFA 1MA0A 2BRUA 3FN4A 1DJNA 4FJ1A 3P2OA 4FFMA 3A9WA 3JQ8B 1JQBA 3JYPA 3TWOA 1GYRA 3G49A 3JQ9C 5DBFA 4TVOA 3DHEA 3U3XA 1VKNA 2JHGA 5HWSA 4OHUA 1LLUA 2HMTA 4TSKA 3GVCA 1F8GA 2RCYA 4FSHA 4I9NA 1WMAA 3K30A 3RVDA 5CDTA 3F46A 1CJCA 4PLYA 4UEOA 5IDQA 4BNGA 1VE9A 2FHSA 3R6DA 4WECA 3VKVA 1I01A 4J7XA 2CDAA 5F1KA 4DC1A 4J0FA 1ISHA 1JKFA 4QECA 1JDJA 1MX3A 4D3SA 4R68A 4RPJA 3MJ4A 5DCYA 4Q3NA 3GNQA 4BKPA 2FPIA 4RVGA 2DT5A 4XGKA 4IJKA 1SPXA 4FD3A 4WGGA 2OORA 4LK3A 1HDXA 4E2WA 4CM8A 2HQ1A 4Z0TA 3O4RA 2ZCVA 4XDZA 1PJ4A 2WD7A 5DULA 4BNVA 5B4TA 5ILOA 4NPCA 1N7GA 5I9NA 4FJ2A 4YDRA 2X58A 1DAPA 2H5LA 4IDDA 4PLGA 4XQGA 4ZQEA 3ZHZA 1PJTA 1U7TA 3LYLA 5CAEA 3INTA 1MP0A 2FR8A 4ZJUA 2BFOA 4FN4A 3DOJA 4J3FA 5A06A 5JXWA 4WUVA 2D0IA 3JYLA 3L9XA 3ZW9A 1PL6A 5DBIA 3DBLB 3JD1A 3INGA 3H9UA 5BSFA 3KXDA 2XF8A 3DMTA 4RLHA 1OAAA 1DFHA 1PEDA 4ZQBA 3I9MA 4YBZA 1PTJA 3O38A 4DUPA 3AOEA 4NDNE 4I8XA 3AM4A 3N7UA 1J0XO 3EAGA 2HLPA 1EK6A 1BXZA 4IUYA 3KYBA 1B15A 1EK5A 1GPDG 5A9SB 3BA1A 4EITA 1ENYA 5AXAA 3BAZA 3OJOA 4AJEA 3GVXA 4EUFA 3K2BA 1EBFA 1E7RA 2J3IA 1NFQA 3ZV4A 4J1NA 4W82A 4EBFA 4NFSA 1IB6A 3JV7A 3V2GA 2YQ4A 3G3EA 1NWCA 1ZK2A 5DBGA 4FGSA 1AE1A 1LDYA 1U1IA 2O4UX 4J7CA 4G81A 1U3WA 4LMPA 3D5TA 1JAXA 3RIHA 3D64A 3GFGA 4IDCA 3QWFA 3JQCA 2FOIA 4JCOA 4NK4A 5IDWA 2YHUA 2P9EA 1H6BA 4R9SA 3TOXA 5KJFA 1IOLA 3OA0A 1FDSA 3DBLA 5KWEA 2DM6A 1DRWA 3PFWO 4ZQFA 5L4SA 3ITKA 1NAIA 4MVJP 3JYQA 3G79A 4I08A 4O6VA 2R00C 4WOKA 4BO0A 1ISJA 5A1TA 3TN7A 2ZJ0A 1GADO 5I7EA 1R15A 3WR5A 2NU9A 5CPFA 1KY5A 1R4MA 4XYLA 3KBOA 1AXGA 1E5LA 1UR5A 3DZGA 3F5QA 3DEYX 3DDNA 3TZHA 4IBOA 3VKUA 1XDWA 4CM4B 4MOWA 1E3WA 4EUEA 3W8FA 4R69A 2OBNA 5T8KA 2Y67A 4L4XA 1DEHA 3ADPA 4PG6A 2VT2A 3WBBA 4R01A 4ROSA 5JO0A 3NGXA 3DBHA 1P33A 4L4SA 4PG4A 4RPLA 2GZ1A 3Q6IA 4I5EA 4FOSA 2ZB8A 2VUUA 4HFNA 1DLIA 2DAPA 1WDKA 1C0KA 5C7IO 3WJAA 2P2SA 1MV8A 1LQUA 4AL4A 3RKUA 2HMWA 1ADGA 4PLCA 4CR8A 3I4FA 3TRIA 3ICPA 4AJ1A 4RQTA 3VDRA 1QV6A 3ANLA 3TOZA 2DPGA 3JQDA 1GV1A 5G2OA 4FW8A 4KP7A 3LK7A 3FSRA 4B4OA 5G0VA 1YQDA 4EUHA 5IFLA 2Y05A 3GDFA 1MXHA 3BTUA 4ALLA 1EQUA 3VDQA 2V6GA 5TS3A 2DBZA 3WSVA 2W98A 5JCJA 1NHWA 3DOCA 2PLAA 3H5NA 3FR8A 5L95A 3SLKA 1LA2A 2GN4A 3HUDA 2VRCA 5TSDA 2YQ5A 5L40A 4BGIA 1K89A 4J4HA 3BTOA 3OEWA 1XU7A 2PD4A 4FBGA 3ZGYA 2VUTA 3F5SA 2NV6A 5F3RA 2HU2A 3RC2A 2Q1WA 1U2GA 2D8AA 4TKLA 3W6UA 1SB8A 3AUTA 2DTEA 3FNFA 3O26A 3H8VA 4M89A 2G5CA 3WWYA 4BGVA 4HXYA 4HADA 1C0LA 1WZEA 3U9LA
chains in the Genus database with same CATH superfamily
3KTAA 4NENA 2FPXA 5BQXA 2EG9A 4FX2A 4A2WA 4TYYA 3KG2A 4J2OA 4N8SA 4F3CA 1KA9H 4J7UA 1TIBA 4PICA 5B58T 2H5JA 1GILA 4E31A 4L8LA 3KX2A 1JSLA 1W35A 1FMFA 5DMXA 1TQHA 4LRSB 3S1AB 5LC1A 4RKRA 2J08A 3GR6A 4JUAA 2AR9A 3K0AA 2VG8A 4UM9B 2QRQA 3KPJA 2NSLA 4YRDA 3OLYA 2YHIB 3DUFA 5LZ8A 3SJZA 1E3SA 1FDOA 3UHOA 1MABB 1G21A 3O8OA 5EPOA 1A8SA 3C8ZA 4I4CA 5AICA 4YI3A 1P73A 5A7FA 4OB6A 2FEPA 5LQCA 3LPCA 3ZLTA 4ASUA 3CPEA 2DCUA 4FMDF 3Q0EA 5HUQA 2CY0A 4BNDA 1VECA 1TLLA 3KT8A 3ME5A 4WLVA 1O03A 3MCVA 2CBXA 4RLSA 4FMBB 3ZV7A 1NW4A 2MSCB 3E18A 1FSGA 2QPOA 5FPQA 3W7AA 5KKCA 1BMFD 3MLAA 1Z2EA 2JZNA 2WHPA 4KQ1A 1NBMD 1VYVA 1O8BA 2C5EA 1L8LA 2VQSA 3AETA 4Z1MA 4BHTA 4V2IA 1DQYA 2OXRA 4JB0A 4RSGA 4UMEA 1ZH4A 2RKWA 2UYQA 2YN4A 1IWBB 3M8KA 3M83A 4NG5A 4P22A 4UNIA 5LMCA 2AX4A 2BMEA 1HDIA 2HQRA 1H0HA 3DYBA 3INNA 4XVQA 4FJ0A 4ZVVA 1FUIA 1XP5A 3RS5A 5JZVA 4P4LA 1Z0AA 2WJYA 4BRSA 3K92A 3MCZA 1KGSA 4TS3A 1WIWA 3IUEA 2VFAA 1CDOA 2IGBA 4YP1A 4YR9A 1H8ED 3S2FA 4TX1A 2QP4A 3BULA 3AESB 3CZRA 2QUAA 3OKPA 3OIDA 1JA0A 1LBQA 1V5FA 4HQ6A 2XTMA 4R8RA 1BHJA 2H2HA 2O5VA 1F9AA 3GQBB 1NF8A 1L3IA 1D6MA 4UE3S 1GKLA 3UK7A 1HE5A 5A62A 1AT1A 1JLLB 2RGGA 4FZRA 1Q44A 3RUPA 2YMQA 1KI2A 4FFPA 4X8MA 5CM2Z 3Q9SA 1ZLYA 5KQGA 2KPOA 1FMLA 1W93A 2QRGA 4HBZA 2PTGA 3B9RA 3WOHA 3AX6A 4DCCA 5ELMA 3ESDA 5IJ0A 3FF1A 4DIOA 4L4RA 4NBVA 4WHMA 4F93B 2J6CA 1U1CA 3GHYA 5JLJA 1W46A 1ML3A 2GPYA 4P2BA 3E48A 1D4AA 2GASA 1ICIA 3L43A 1ZK0A 3MMSA 3GO4A 1Z8HA 5EUCA 3VZQA 2CUTA 3G89A 2PJUA 5HKLA 1J8QA 1EVIA 4PBRA 2NU9B 2AXPA 3LLMA 4D25A 5CFPA 1KP3A 1EZ1A 3GJRA 4EOGA 3KQTA 4HLNA 5TV2A 4Q9NA 3O9MA 5THKA 1ETUA 4Q4CA 5ETJA 1SQ5A 1U1GA 3L84A 1J9GA 5A9RA 1PS8A 5EI5A 4QYIB 1T3ZA 3AG5A 3A8TA 3QVVA 4G5GA 4NK5A 4FR2A 4MTCA 2EYUA 4KITB 2KQUA 2NO5A 1FRVA 1H5QA 1EJ6A 2BFNA 2BTOA 2JHPA 4HH4A 1KEEA 1O96A 3VKGA 4YLEA 3MD0A 5D7BA 5TVGA 1V4VA 1F0PA 1X1RA 4Z2YA 3U3RA 1SA0B 4OEHA 3V8BA 1YHYA 3SDSA 3VGJA 3ITEA 2GM4A 1PQ4A 4PX3A 5DEOA 5GIPE 1IZ9A 3PKIA 3HUTA 4UATA 1VYTA 1KYTA 1N2BA 1P9WA 2O07A 3H8SA 2D2EA 2Y27A 2QV7A 3IR7A 2CLOB 2IIPA 4WWHA 4CL2A 1R6DA 1XZGA 5B58C 2MMCA 5JNTA 4BEJA 2JAOA 5F1PA 1B2LA 4HNQA 4FOOA 5A4JA 1YA4A 4D74A 1O0SA 3EGXB 1EGAA 3PWTA 2ATIA 4Q00A 5E0KB 4QWMA 2D13A 2QUKA 3DBRA 3OWOA 1QQBA 1PR9A 2XZDA 5JXGA 2NACA 1LQTA 4QATA 2H2IA 1F20A 2BFBA 2K5UA 3C98A 1XWWA 4DCOA 1MOPA 4M6WA 3QFHA 1HLDA 4QGGA 4KN9S 1PN3A 2PFKA 4QC2A 1ZQ1A 5CA1B 1F2TB 4PFSA 1XD2A 2O3TA 1PJSA 5AKJA 5HIJA 3A2LA 1JRLA 2ZRAA 3UJ3X 1HDEA 1RHKA 1JI0A 3KWJA 5DRTA 4AUEA 2AHOA 2PXXA 3SC4A 4NVRA 1Z6PA 2C4WA 5IM4F 1ZC4A 5I5GA 1YA6A 4IX9A 1OFGA 2G9NA 5I45A 4YRJA 4P0QB 5G40A 1HT2E 1T26A 1CJKC 4TL6A 2ZUFA 4WLEA 3O03A 2ZRDA 4U9IS 1KO7A 3CLKA 5HZHA 1RI2A 2WE7A 2XYHA 5DBHX 4BFYA 1JE0A 4IMJB 1ZUNB 4TV8B 5CFQA 2PGDA 4NATA 4MLCA 4QYWA 3ZE6A 2J6IA 1ILWA 1N1MA 1QC5B 1QCCA 1TKAA 3OPMA 4L78A 4CQLB 1ZWKA 1PGOA 2JFNA 1Q74A 1D2EA 4LCEA 1GGJA 2GF0A 5FNVA 3TLJA 3AJAA 3HK2A 1VRVA 4TMVA 1KBQA 1MQ9A 3EBOA 4XJSA 3V9PA 2QZSA 5IG2A 1VZ3A 3HDHA 4IF4A 4Q3KA 1A7UA 1KMCA 3IGFA 4KIWA 3KHTA 3ICEA 4IQFA 5C8DA 3SN6A 1ZOSA 2MSKA 1WZNA 4NS4A 1NM5A 4TV8F 4MO2A 4I1IA 4XDYA 3RS0A 4DUGA 5FLXA 1WZ2A 2C2GA 5JAHA 2W2MA 2HF8A 5I4KA 3HBMA 1UBLS 2E55A 3ZHRA 2EF1A 1IQPA 3C3XA 1KEKA 1KS9A 4XGIA 4PVCA 1N9GB 4RK7A 3VNAA 1QDEA 3M4JA 3JARA 4CEJA 4PLTA 5BSWA 2H07A 4YQYA 1UDRA 2B5OA 4XRRA 5JDCC 1NVVQ 3EH1A 5EWLB 3K0AB 1LU9A 3VZPA 2ZJ7A 1NJ8A 1G42A 2JJ2D 4FXOA 4KU4A 3H8WA 4FD2A 1PEKE 1FFEA 5G1NA 3GEIA 5LOVF 1GA4A 5ARCA 2AEMA 2GCPA 5DBEX 3EAQA 1EESA 4D4KA 1YIOA 3GFFA 3STYA 3ABZA 4TKVB 1WXDA 4HX2A 5CB4B 3OESA 2FWNA 4I50F 2BFEA 8OHMA 1NSYA 1VI6A 4EGSA 1A27A 1T3TA 4BAUA 5A2QA 1HXHA 4II2A 4BJ5A 2PMDA 4N76A 4PLWA 3QE2A 2IEZA 2ZB3A 4JX9A 3W05A 4L8YA 1VIVA 4N5NA 3GI1A 1MW9X 5TC4A 3NAMA 5TRTA 3SICE 5KOJA 4P3KA 5TMPA 3LBNA 5AIAA 1S9DA 3DZHA 4RD4A 4E2FA 1WW8A 3PXGA 3WRXC 2PKXA 2WWYA 4C05A 5LQMA 4JXXA 1ID8A 2EJWA 1BU5A 3OQ6A 3I3OA 1S02A 2EERA 3A04A 4XX1A 2ACVA 1UKCA 3EK2A 2ZYSA 4HB0A 4QWWA 2RH4A 5TXGA 5DNVA 2ASVA 2V6IA 5SZKB 1D8AA 4R1QA 1WUIS 2VXCA 2YV3A 1XN1A 3MGAA 4OQLA 5CGZA 5LA6A 1YGYA 2PR2A 5G4LA 5HKAA 2V6MA 3EG9B 3UAOA 1I4EB 2XRYA 2JI9A 5PNTA 5MN6A 2QORA 2J46A 4RULA 1RZVA 2P35A 4C76A 3CRQA 2QYHA 2YXBA 2ZI6A 1RHQA 5DHUA 2QHXA 2X0DA 1Q0TA 3LUFA 2GCOA 5NLLA 2C2BA 2QVZX 1BU8A 3KT6A 1NNSA 3TKAA 2EV9A 4WZZA 2AR7A 3GJ5A 4AX4A 4EJ6A 1Y3AA 2AE2A 3B7PA 3SZOA 2FMFA 2NAFA 1ULZA 2P5YA 3LPAA 3QU5A 3AVXA 1Y1KE 3K0FA 1NTOA 2D59A 4BBAA 1IG0A 2PKCA 1F4VA 1PF7E 2Q4RA 5ITWA 3EASA 1XEAA 5LL6P 4GXRA 3RLFA 2YIDA 3DTYA 2L69A 3PUXA 2I1LA 3ETEA 3ZWWA 1XLTA 1YQTA 1E4EA 3IQZA 4G9BA 3CT6A 4A26A 1NQUA 4M9SA 1IBLB 1MX5A 3FI9A 4C3OB 1NVGA 2B25A 3D8UA 3S2YA 3ANMA 2D0DA 2K6GA 5AVTA 8GPBA 2PS0A 1G21E 1NI3A 1G8KA 3PNQA 4B2PA 3SQXA 4IGAA 1BYIA 1JR3A 3GLKA 4YRMA 3K9FC 2HJWA 2FEOA 2BKUA 2VHXA 4FVTA 4UQPA 3I30X 4YT4A 2UU9B 4GDFA 5KVAA 3VR5H 1X87A 2GBCA 3O4IA 4YRFA 2FX2A 2C9MA 2HPZA 4XGRA 2H65A 1VQ1A 4IHJB 2GCIA 3S2EA 3WIDA 2ZUTA 4AZWA 3CNOA 4MIYA 2ZE7A 5LD2C 1A8HA 4XD2A 4F9EA 4M0UA 1IVYA 1JAZA 1Z6GA 3G59A 3MERA 5E2IA 5A3QA 2IH5A 3B3GA 1AKYA 1VLMA 1EFVB 1M10A 3I61A 1DJMA 1TZKA 5AOVA 2ONZA 3I3SR 1X13A 4IDOA 3Q3GE 4MW1A 1D2HA 2Q9BA 4NTZA 4L75A 4OK6A 4UOZA 2P6NA 3RARA 2AFRA 3IVXA 3OHMA 3T7KA 1GCIA 2QLFA 3SZ3A 5HJEA 1DUVG 1RD4A 3KUXA 3BIJA 4HWGA 4WZAE 3TSOA 4WBSA 4NCNA 2XTZA 4N0QA 4PBSA 2H52A 2PWPA 5CFOA 3JRNA 1KRWA 2ZRJA 1KI7A 4M9XA 3VR2A 1UDWA 1CUIA 1Z34A 5EJIA 3QWHA 1Y6GA 1X7DA 4MVYA 1UAAA 1VGVA 3IEUA 5H7XA 5E6UA 3QX7A 2X0IA 4ZQGA 3MJHA 1U8ZA 3H2ZA 4U2CA 5A4IS 4PFQA 1XDSA 5T7BA 3EXG1 5LR6A 1RYEA 2DLDA 1VHDA 2JAXA 3ID6C 4C4OA 1M2KA 4JT2A 5DYGA 1KSGA 5AW4A 4PQYA 4EPWA 5IM4A 3N05A 4GNRA 2WHYA 2IIQA 3DW1X 5HCNA 4GQAA 4INAA 1R0SA 1HFKA 5JR3A 2VJMA 2X42A 4F3RA 5EXEA 2F8LA 3LQRA 2F48A 3FB4A 3AR8A 4RKYA 3UGTA 2VHTA 5F23A 3I12A 1EAYA 1RE0A 5JU6A 2BGNA 5FWXA 4ZP1A 4EB0A 1G3UA 1T3GA 5KHLB 2FWAA 2VK8A 1L7PA 1Z0ZA 5EJ6A 1U8YA 2QRJA 2UUCB 4KTTE 3NHZA 1W2GA 1X9GA 3ZWNA 2YJTD 1YTLA 3ZX4A 3ZD6A 5FNVB 1YKFA 1QPZA 2AKAB 1U1EA 4LJYA 4QRIA 1T8YA 4QASA 2OM2A 2VSOA 3GELA 5DH9A 2SICE 3TW8B 4S1OA 1N34B 4JQZA 5JJIA 3F90A 1GLGA 4E7OA 3GDWA 2ZS7A 4X90A 1JHUA 1UK9A 1KH1A 1RSZA 1F48A 4AIIA 1DJLA 1E7MA 1KU0A 4AWAA 2A57A 4BNDB 4FGJA 4KVAA 3K6JA 5FH9A 3ZCSA 2B82A 2Q6VA 1JU3A 4JC8A 1C80A 5KWVA 3CLTC 1ZH6A 2CUKA 1M2HA 2Y1EA 4MWEA 4OFBA 4KDEA 1TCAA 3AUFA 3SJAA 1FJHA 5ITVA 2L17A 4DR6B 4BO2A 2Q3BA 3V9AA 4QIHA 3T9EA 4DS3A 3RSSA 2XD4A 3EVNA 1L4GA 3MTJA 1ZVKA 1R8YA 2GNPA 5DFAA 2IBSA 3FCEA 3HKBA 1TLFA 3D0KA 3IJRA 5IBPA 1EUYA 5ESWA 1H3EA 3C14C 3ES9A 4YJFB 5AKLA 2R7LA 3ZGXA 1ISMA 4HAXA 3B3QA 1I36A 5DNUA 1N6OA 1NVMB 4P4NA 1H4VB 5CX1A 1J07A 1Z7YA 2P6RA 1RWNA 1L5SA 1ISIA 3HVHA 3P9YA 2X2FA 4E1BA 1FP7A 1AUPA 1MC1A 2R60A 5DM4A 3JQQA 4PPYA 2DEUA 5IZCA 4H0FA 3EXFB 2V4ZA 3F6RA 3IKJA 4L0MA 2X14A 4G4SP 4MI3A 3DE5X 1ZONA 1NVFA 5IAJA 1BW9B 3KHUA 3NUGA 1B6SA 2O3QA 3R6TA 2ZTSA 3NIGB 3PNBA 4HN4B 4GLBA 3RF6A 1BQ4A 3ZV5A 4D4JA 5C51B 1HFJA 3RU3A 1OC4A 3C4VA 2AUNA 4AWBA 3KOYA 2G8NA 2Z5GA 1U80A 1DHRA 2BHNA 2CVFA 3UJDA 4F9FA 2EFEB 4RD1A 3K09C 4BNXA 2RGDA 1I2AA 4ZT2A 4WBNA 5B5SA 2BFAA 1X7XA 2R85A 1OXUA 2C8LA 4X44A 2OESA 4FC7A 3GROA 1RI3A 1I4TD 3FVRA 4RS4A 1F38A 2E4UA 5ALVA 1YRLA 2CMGA 3Q85A 2JJMA 4DLVA 1YB6A 3I6QA 3KHKA 4MKHA 4KQKA 3RVSA 3HXMA 1EX7A 2IYFA 1ECJA 2NZ2A 3PA6A 1T9ZA 3FJOA 5HF9A 1P61B 1L5GB 2FW8A 5LMUB 3CZMA 3O1IC 4ICIA 3O4HA 3R5FA 5AVXA 4BJ6A 4AY3A 5GQSA 1G3RA 2CCKA 3QK7A 4ML3A 3GLGA 1MLDA 2I6SA 3FSEA 1I30A 4X3PA 4EECA 1OI2A 1WXEA 1D09A 4RQBA 4ZYYA 1A8QA 1CQPA 1Z3IX 2WTEA 3GFBA 4NCIA 1BGXT 2DP4E 3KT3A 1BQEA 1T0BA 1B4DA 1TK9A 3DCNA 2XCOA 5HF6A 4CPDA 2A3RA 5JCZA 1IH8A 1UAGA 1VM6A 2R1VA 4UVEA 2IYOA 3SC6A 3CF4G 4RD3A 4GECA 1UJ4A 3WGKA 1F6DA 1KIFA 5IK2D 1YTUA 1E3MA 3ZWXA 1U3CA 4EBBA 2PUVA 2A88A 1M2OB 3KE9A 3PF9A 2Y1DA 1R0CA 2W6ZA 4KMOA 4O2BB 1GT91 5BSVA 1MH9A 3BZBA 3B1JA 4FGUA 3VPFA 1Q1BA 2A5DA 4W9MC 3LE8A 2B8WA 1F14A 1BFKA 2QRHA 1Q17A 3CYFA 4XDHA 5FBQB 3ROKA 3T1VA 3NP9A 2BM8A 3LDFA 4OI2A 4YAGA 5B30A 4P4SB 1FVOA 3P32A 3SYRA 2GX6A 5IC5A 3HBAA 2PSFA 3HLYA 1KARA 1UJ2A 3LRPA 4QE3A 5DP1A 1QGDA 3A1FA 1P8JA 2FPUA 4OMDA 3FFXA 4TLMB 1FOEB 4LN1A 1EUQA 2E87A 1NVUQ 3Q3JB 1Y7TA 5BW8A 1W5SA 1JB1A 3J81k 1ULSA 3GA0A 3SLGA 5HQ3A 1ZGAA 3K9HA 5HIIA 1NONA 1V6SA 2GVDC 4FFWA 5KYYA 3OIGA 4RZQA 3O4GA 4WV3A 2OFOA 3GVIA 2BOVA 4JC5A 5HFAA 3VNSA 4XZ3A 5AJHA 3VZBA 2GLUA 1NNEA 4LYGA 3ZPXA 3BGDA 5BUCA 4MW2A 5LYJF 1QGAA 2JFZA 3G8CA 1RKBA 3M4XA 1JYSA 1HEUA 4GSLA 4PC2A 3TJMA 2WKRA 2M32A 1TU4A 1KVQA 2IUEA 3PDIA 1CB0A 1ZITA 5ENZA 3B8HA 3TKYA 4RM3A 3UMSA 3WGIA 1I94B 4IINA 4P84A 3VC2A 3L4BC 5CLIA 1C8BA 4UVGA 3R8XA 1HFWA 2A5YB 2Z1MA 4TVKA 3QUTA 2BCJQ 2Q45A 4WFJA 5SY6A 4UTOA 1MNQA 1UMKA 1VTKA 1QS0B 1LY1A 1JQEA 3GCGA 4O2AF 1XP8A 3PC8A 3BWDD 4PZLA 5BURA 5E3IA 1KEPA 1WSWA 4HS9A 4I1OA 4JB8A 5EZYB 3F5MA 1IG3A 3AYZB 3KYJB 4KYIB 1GLNA 2E1PA 3A3PA 2CFSA 4QG7A 3MIZA 5DMHA 2G77B 4ND3A 1JFVA 1LRLA 3U7FB 2WUWE 3EDQA 1BEUB 4LW8A 1ZNQO 2HMSA 1KPHA 3DQPA 4MUKA 4G5RA 4WXHA 1M5RA 1PI3A 1UF9A 2FMUA 4JKYA 3O31A 3VYTB 4ALKA 3DGEC 3SVLA 3PEFA 2QBYA 4LMAA 2ZJYA 4ZT7A 1QDUA 3TEJA 5TIIA 2LDBA 3U4AA 2APJA 2HPAA 3K15A 3ZWPA 5AK3A 3QXCA 4AO8A 1QFXA 3KQYA 1E7SA 1V5WA 2FRVA 3L1JA 4D56A 3SVTA 2EZUA 2OXEA 1CNMA 2ZRIA 1KI6A 2X0JA 5CLHA 4QGFA 4MQ6A 3MTAA 1IHXA 5ALRA 5IEJA 1FJ2A 1HM5A 4YRTA 2WSSA 2H8GA 5EHIA 5JXIA 3L4BA 4GXTA 1LX6A 3EODA 4OO3A 4ENTA 2WI8A 3FMIA 4WK2B 4F06A 4F38A 4WJLA 5CVTA 1BC5A 1NW5A 1A2BA 1T9HA 2CUNA 2HRZA 4KIJA 5IWCA 1H0SA 2BH2A 1I14A 1I6WA 5HUJA 1W36B 3BIFA 4C21A 1R37A 1V35A 1R0RE 1YA8A 2IYSA 3GJ6A 4MV3A 2VP9A 3GUUA 2P9JA 2WJJA 2GPTA 4CG0A 2JH8A 4DY4A 4TLDA 2X0EA 3TNYA 3KP1A 3WS7A 1AHHA 3MTGA 3AVQA 3D43A 1KQFA 3VYVA 5JH7B 4QJ5A 1XEXB 1WMDA 2FN9A 2Q5QA 4DJFC 1Z5UA 3QFSA 1H23A 2AG1A 1OPRA 5IF3A 2I6UA 4I4NA 4TS1A 4RCYA 1UBSB 2R8OA 3O83A 1XCBA 3DB1A 4IJ6A 3JXEA 1EFPB 3CH6A 1A7AA 1G0OA 2OKCA 4EYQA 3IDZA 4LC1A 4JMLA 1AZLA 3T3PB 1B16A 1X92A 3G17A 5FR1A 2DWUA 4MRVA 3VKWA 3UJPA 2JD2A 4E0BA 1OMOA 3VGPA 2DHRA 1KH2A 1RHUA 2R97A 3VU3A 1I9CA 2R66A 3JPYA 4OP3A 3KB6A 5F7XA 5K8VA 4M88A 3EDYA 4XVRA 4JKOA 3NEPX 2GBLC 2G36A 3AVWA 4MYRA 3K9GA 3DULA 4YJDA 2ZRLA 4PGAA 5JANA 1E6LA 4FKZA 4IDNA 1LFDB 4DBZA 4R84A 2PJZA 4MDEA 4GM4A 1T5HX 4U3JA 2WJ4A 2WWIA 2ZSEA 1CRPA 3OEYA 4UM9D 1FTNA 1B8VA 4PTLA 1PZMA 2ZANA 4WBNB 3D3EA 3DFFA 1XCPA 4EHIA 2ZJAA 4QG3A 3OC0A 4YRPA 3MWKA 4BV2A 1RXWA 2ZU0C 4MKIA 3UJ8A 4JL5A 5L3QB 1CRQA 2VPIA 1M6NA 2VT3A 2ZUVA 4E46A 1EWQA 5ICGA 1JIUA 1YFZA 3GGGA 1KEUA 5INTA 4G4IA 2DZDA 4FEYA 1GPNA 5EOVA 4QUDA 4IS2A 2UZ1B 2VRBA 4LYHA 4LVCA 3EC7A 1ETHA 1OF1A 5CCBA 3ILHA 1B8PA 1UK7A 3V1NA 3WYDA 2PMEA 4EW3A 1REQA 4LY6A 4MUXA 4GKJB 1QLWA 3TQRA 5B3LA 1GL3A 3MGKA 1KYWA 2DF8A 1NJ1A 5KYWB 1IBMB 4EJFA 1SKAA 3WAJA 3SHFA 1ZVVA 3AV3A 1ZRHA 1HDZA 3U40A 3AKEA 3C41J 2BEKA 1KHHA 1NRWA 2QAIA 4EHKA 3OHPA 5CDFA 4DLAA 4UDYX 2YUIA 2AG0A 5AI4A 1Z0KA 3CX4A 5CMLA 1LTQA 2REQA 3DM5A 1DC6A 1KO8A 2I66A 1HPLA 3QQPA 2BDEA 4BNNA 1QIGA 4J76A 1EB9A 4OFXA 5JD5A 4HWKA 5JYCA 2YV2A 2O8VA 2YDYA 3N2YA 3EXG2 4QT0A 5FYDA 2PU5A 1NU6A 4PQRA 1DX4A 2EZ8A 4RETA 2WIBA 2ZRQA 1B8OA 4ZEWA 1O58A 4Q21A 4RTMA 1LPBB 2BGJA 4Y2SA 2GYYA 4QSHA 3M9WA 3CZCA 3EUWA 4EFDA 1QZTA 4F5ZA 4LXYA 5PGMA 1AA6A 3BQMB 3P4UA 3PD7A 1OXKB 3OFND 2JJ2A 1VPVA 4D0RA 3G5MA 3QI7A 1CNFA 2F3PA 1GTL1 4ROTA 3SPXA 1GTMA 5CVEA 4EVRA 1N1EA 3DE3X 4GRAA 1RM3A 3I0NA 2BAGA 5D00A 3EDCA 1GYPA 2GZMA 1T1JA 4MTLA 3MILA 3IC5A 1A8PA 4LNUB 2RJNA 4LOJA 4N0PA 4OYLA 4XLZA 5AM1A 3UKJA 5LYJB 2NZWA 3T7AA 4ARCA 3G02A 3D1VA 3P5SA 2W5UA 1T4GA 4XB1A 5H1YA 3R75A 2C4NA 1EGVB 1FSZA 3DOIA 2Q3EA 4N1AA 1ISSA 5AKZA 3EPHA 1N2EA 5CHEA 2E9SA 5EJ2A 4DYDA 4RVUA 3OQOA 3SHOA 3L8FA 5AP9A 1YMQA 3TD2A 3T3IA 3NT2A 3TQIA 1NU8A 2X9QA 4ZK6A 3D3JA 4DJ5X 4XASA 3G9QA 2JLXA 1IQRA 3N58A 5CDUA 1N2CB 1P3JA 3CKKA 2PKWA 3BF8A 1PZEA 2WIFA 3NYIA 4NRDA 2J3DA 4AG3A 1W36C 4JYAB 1IN5A 1GNTA 3GWGA 4V1CA 5KTYA 3OVMA 4H6XA 1GIAA 1I4WA 3CMMA 2GESA 2Q07A 4OMFG 3QIAA 4ZCPA 3WMEA 2YVKA 4O2BF 2Y9MB 1L1FA 1U2DA 2WFLB 2WUDA 3CV3A 4P0TA 2F1JA 5E6RB 1WWKA 1KMIY 3E4CA 3UQYS 5JFOA 3DE4X 1GZSA 4UE6A 4DM3A 4E08A 4ETWA 2IOQA 4K6KA 1Z7GA 4TTJA 4I1PA 5IYZA 2WWVD 2CMFA 2B98A 1E2GA 1Q1NA 3BAFA 4BMZA 4BKMA 1N0IA 1D0SA 4TZTA 5DYYA 5EE3A 2PWZA 5IU6A 3O5AA 1L5HA 1D0VA 1Z29A 2W0SA 3LYAA 4MARA 1R0KA 3VPAA 1AK2A 1E66A 1QPGA 1FX0B 1C5KA 5DX0A 1JSCA 1E69A 2XB8A 5IJ0B 4Z0PA 3LIPA 3W5SA 5A4AA 5J23A 3FFBA 2VJQA 3FFTA 2NZUG 1K98A 3M3PA 4IJMA 1R6BX 3DZDA 4MVJF 3FAKA 3WHLA 4YJGB 5ADHA 5KB3A 2A9RA 2YZMA 2YY5A 1NOKA 1N5IA 1FFXB 2OBXA 3BXPA 3UMVA 4V3BA 3PFHA 3ADOA 1SIBE 4KODA 2G82A 3L1KA 1O2DA 1E6KA 2HNBA 4IJQA 5AJZA 4U6NA 4D6XA 4Z51A 1VPEA 1R8XA 4BX3A 2OECA 5EE9A 4XGNA 5HRAA 4JITA 5DSZA 1NATA 4BV9A 5ECWA 3K6KA 4IWNA 2JFPA 1GAJA 4Z8YA 3TSAA 1TCUA 4M1ZA 1ESEA 3ZHUA 5H83A 4BMOB 4W5WA 4LOLA 3QNMA 3WP0A 4LE0A 4PZ0A 4ZK2A 3BEDA 5CDYA 4BQNA 2PFSA 2GR9A 3TM4A 5B3KA 1TZ2A 2WHEA 4FGZA 2HRCA 4MB2A 3TLGB 1PQWA 2C31A 1MIOB 3FTFA 4GHWA 4IRMA 5IKEA 3CCCA 3LCUA 4MB0A 4C4PA 2ZYHA 2H11A 2YASA 4LMRA 2PT7A 1QIEA 3BWMA 4NYIR 3HY4A 1H6CA 1N5DA 1DEXA 3P2EA 1J33A 1VL6A 4YONB 1QYRA 2VDUE 1JR3E 3ZY5A 4HY3A 2WIAA 5K2MA 1QOQB 4RADA 5EJ4A 2VBIA 3OJXA 2W6CX 4ARBA 1PAUA 2CV0A 4H0NA 3BHIA 3WWPA 3BCRA 1ODTC 4L3VA 1SD5A 1M6YA 2FMHA 1CVRA 5E7JA 3HWSA 4BDTA 2A92A 4LQDA 2PH1A 721PA 3WK7A 2IEDA 2WWFA 1U04A 1UM9A 2XUIA 3ONVA 4LJKA 4PLVA 4BZQA 2VNIA 2BSXA 1K75A 4ZYVA 3PEYA 3R1IA 5EJ8A 3BIWA 2R9VA 5LP6A 5EC8A 2OOKA 4I5FA 4ITVA 4ITRC 4M1KA 1J49A 3OJCA 1IEWA 4WADA 5FI5A 4BKUA 2ZWMA 4Y67A 5KIAA 2GN0A 3I6YA 3OQ1A 4CMIB 3C3BA 4LRQA 1P1RA 4U8GA 3DMYA 2AMYA 1LDMA 1TKRA 2C5LA 4K0RA 3EVGA 4K88A 2YZ2A 4R7TA 4CZ2A 1OFIA 3HZRA 3QELA 4OSOA 3ZWYA 2Q1XA 2BBOA 5JI2E 3KETA 1YC2A 4ZVQA 4H7DA 4W99A 1W2HA 2A35A 1MDFA 2V6FA 3TK1A 4CG3A 1TOAA 4X66B 3W79A 3CLRC 3OZCA 3FCOA 5LU8A 3GGDA 4DZRA 4GVPA 2NXCA 3H4VA 1G19A 4MPJA 4ZDJA 5J5VA 3L8EA 2NUAB 1P6XA 1T4CB 1UT8A 1UQUA 2QX6A 3CF0A 3IUNA 4MQEB 4N6NA 4OHFA 3ROTA 3ZK8A 4MEBA 3COPA 3CRNA 2Q21A 3L6OO 1YJ8A 1GVNB 2HZ7A 2Q1SA 4MWOA 4H3VA 1GPKA 1UMCA 2Q5HA 4KOAA 5BYJA 2NU8A 4CDNA 4HZUB 1OXVA 3QYFA 2G25A 1N9GA 3ESYA 6REQA 4CEJB 3GJ4A 2BYTA 3T5MA 2RKOA 2BMWA 2WNHA 3QWBA 3FY4A 4H59A 4RFSA 3WYEA 5IAKA 1VB5A 3H1GA 4UTVA 3SZUA 2O0JA 5ALNA 3T0IA 3SAJA 3U4DA 1XO1A 3FHCB 1A5TA 1F7UA 5ISMA 1M2JA 1SBQA 1RWXA 2ETXA 4QTUB 4OK5A 3FNGA 4KDCA 4WVFA 1X1SA 2VBGA 2DBRA 2OC9A 3G9TA 2VHEA 2QGNA 3P9RA 2IHKA 4I1VA 1ZN7A 3SR4A 4DGSA 2F4VB 3DQZA 3B5JA 2YV1A 1Y9EA 2GKGA 3NUZA 2AXEA 3CB4A 4WASA 5U4QA 4AUKA 4N8DA 4C7JA 5AW8A 4IIJA 4J0EA 4LPSA 4J4TA 1M8GA 4IKOA 5I48A 4Z9BA 2J1LA 3M0EA 1GUBA 2BFDB 1DU4A 2GMWA 2XDAA 2P3QA 1EG7A 1SXJD 2W2LD 3IP6A 4TT8A 4XCQA 5FUVA 4C4AA 9ATCA 4RHEA 3LGSA 3R5TA 4PZUA 1K66A 4KC0A 4TKVA 2ZM5A 3UJ9A 4CEHB 1ORDA 2VS1A 3ZOZA 4EY3A 2AOXA 1UEXC 3ZKWA 2OGZA 4I36A 4IL5A 4J2HA 4MITA 4MS1A 4BOYA 3AOGA 2FZEA 3ET4A 4BFZA 1W49A 1FP2A 2OEPA 4QYTA 4ACBA 1FU4A 4MW7A 1E7WA 4HEA1 1NQWA 1ZIDA 3DZBA 1P4AA 4G3XA 3P9XA 1WY7A 1YNSA 3JAWA 3DPUA 5EA2A 1MEOA 2JK1A 4W8GA 2WU1A 1GGHA 3RYIB 3SBXA 1Z07A 4DYHA 1WETA 5IYZF 4YYZA 1WCWA 4WKGA 1U7ZA 1SQFA 3AIOA 4Q3CA 4M9QA 1ICEA 1PNVA 3QA9A 1HI9A 3FOBA 3R3SA 4I9HA 4KRXA 4TQ9A 1L4HA 4KNYA 2IV2X 1W0CA 4I6JA 3T38A 1I1NA 2C0QA 3ADKA 4LZJA 4QDTA 1GM5A 4WOPA 1WXFA 3SWWA 2DWPA 1E92A 4QDUA 1V5IA 2JKYA 3G1TA 1RYYA 3H2BA 3KSAC 2WNIA 3TXXA 1CIPA 2R47A 2ZTLA 2GJ9A 3NH6A 1JVBA 4DR5B 1MRSA 3NHBA 1I3CA 3D7NA 1CF4A 1USUA 1FYDA 4NYIQ 3SHQA 3BRSA 1G20E 1ODSA 4CUZA 4RVHA 5DI3B 3OE7A 4MZDA 3QH4A 1U2QA 3JQAD 1B41A 4HDCA 1A9XA 2FWIA 4Q9IA 2OXCA 3PWKA 4ZAXA 1HDGO 4PYRA 1AV7A 4FFOA 2VSXA 3BFKA 2X4IA 5KAPA 1NXQA 4D46A 4O1MA 4RZSA 1H2YA 1BOFA 4DQ0A 1KQGA 2VH2A 2X86A 2PS3A 2VP4A 3NVMB 2XVZA 4XVUA 1YDHA 4U39A 1MH1A 1NW9B 4OAQA 5JAZA 1ZCFA 4KFUA 5B3JC 4AN4A 1NP3A 2JEYA 1LWOA 4IDQA 2Q0HA 4RE6A 3W3AA 4JJKA 4OQFA 1HKUA 2J5QA 3GEEA 4HDMA 4L4ZA 4QQNA 4YREA 4ER7A 4DR2B 2G7MC 4ZVMA 3UFBA 4B0OA 4EP1A 3DAPA 1SKYE 1WA5A 4D9CA 4U5XA 2X22A 1NKTA 1Z56C 1G18A 3OAAD 4JUIA 5GTDA 4XYEA 1RDFA 1W2WB 4TVSA 4PNPA 5IVIA 4OSPA 4P5PA 3G68A 3IBTA 3OP1A 4R7ZA 3QPDA 4TXHA 4DIUA 1RMYA 2QX9A 3CRW1 5AI0A 5KU7A 3EWNA 4KQHA 1DS6A 2HU5A 3ZYZA 4YS6A 2VK4A 5JTUA 2HA0A 2CLLB 3CW8X 4LXGA 3USZA 4JBYA 1QGZA 4NOLA 4NU8X 3TF5A 4QNNA 3GJZA 3HB5X 3BH6A 4R05A 1SXJA 2W2LA 3BSSA 1YL7A 2WNSA 3QV1A 4ZT3A 4PZYA 4ARZA 1FY2A 2P2GA 1KJ9A 1PW5A 4PFJA 1NVAA 1E77A 1S2OA 1ZD9A 5C8VA 1W8DA 1AS2A 1EXDA 3GNTA 2HWWA 1C7JA 1RM0A 2IL1A 3IURA 1N5OX 1DZ3A 3O73A 5BW6B 5KYWA 4IPTA 4V2UA 4B6FA 1DIHA 5KQMA 1KY2A 2HGSA 1Z6AA 2ZJ8A 3PNMA 2G1AA 3MCTA 2H8KA 1BHO1 3LX4A 4J8PA 1W4RA 3RVOA 4FYHA 2E89A 8ABPA 2P77A 1B3BA 3NWOA 3OOJA 1TPZA 3ELUA 3EA4A 3NRCA 3Q3EA 4LG1A 2L0XA 4NL4H 2FUG6 1V2GA 4DDTA 3BXFA 3EE6A 3IHLA 3L77A 5D3QA 3U3OA 4LDAA 5FWXB 3ZJUA 2VNJA 4FS8A 1TJ4A 3UYKA 2GDJA 1A8IA 3C7DB 4R1TA 1B76A 3DMHA 3FFAA 4GP9A 2P2NA 1AY0A 2VHQA 3AUSA 4Y6LA 1HYQA 4FFNA 1JLHA 4MYDA 3C70A 4MR7A 4D3FA 2TECE 2R5FA 4J7AA 3OE5A 4ZODA 3I1YA 4Q4AA 4MUNA 2Y1LA 2QROA 4CIVA 4POOA 2W6MA 3LZCA 2O05A 5FB3A 5COAA 4G0VA 4BVKA 2IQIA 4TLBA 4GPIB 5H59A 5J2TA 1RC8A 1JLRA 2NV2B 1RZRA 5LZ9A 2QMQA 1TFRA 2ZT8A 1PWEA 1W47A 1NXXA 4Q3OA 1UANA 4KACA 3X1MA 4CFSA 4QGSA 1AHNA 2D0OB 3JQBC 5JAUA 3RQSA 4W5RA 3N0WA 4KAXA 2PUAA 2TMGA 2IZ6A 4HZUA 5HJ7A 2X8BA 2WFMA 2BF7A 4LHEA 1VI2A 2UZAA 4BQRA 1W1IA 1PJ3A 3T3HA 5JY6A 3TGPA 4GPD1 4GKAA 2LKDA 3GP8A 1KMHA 2AZ4A 3G0DA 2XE6A 4EHLA 2R6R1 5EMLA 4ZHSA 4HC4A 1KWKA 2D74A 3MFYA 3HKBB 4M46A 3EPRA 4R9VA 5FL7D 5A4KA 1L4MA 1TEHA 3LPDA 4TS9A 4HGYA 4MR8A 1SZJG 1HNZB 2XSZD 2JLSA 4XI9A 1SUCA 4TQGA 2P9QA 3C45A 1H1LA 3HKEB 4N0DA 2B4KA 5SZIA 1UQRA 4YRQA 5EFZA 1LI4A 3D2CA 3V3TA 1VKRA 5E9WA 4B2IA 4F91B 1M34B 5HQJA 2WFLA 2BBSA 2P5TB 5K0FA 4JHLA 3COSA 3FUCA 1V37A 3L5OA 4KUGA 4Y0NA 1BROA 2G71A 1YHZA 3FUVA 5H3CA 5HMMA 4EG4A 3OCCA 4ZAGA 4BLUA 5IULC 2ZI7A 4JLNA 3JR7A 5SYAA 1FS4A 2BVNA 2C2KA 1YZ3A 1P5HA 1UZAA 2D0PB 2EZTA 2CB0A 2GCGA 3C5CA 4IMRA 4MHSA 4P3PA 1YDEA 4CF3A 3GLFE 1BZYA 3BZWA 3L1IA 2FJUA 3W5DA 1BAPA 3A4IA 1A82A 1S4QA 2YL2A 3LMKA 3K4QA 1SBYA 4IH9A 5BV8A 1RADA 1JNXX 2D00A 4NLLA 1SVLA 1HYHA 3PCXA 3NEAA 3TSZA 3V42A 2OCIA 3ZCRA 1K08A 3H5RA 4J3NA 3UUEA 3AFMA 3CLVA 2OCKA 3OX1A 1GY8A 4JDPA 5FBRB 2VJBA 3IL2A 3SC3A 5HOQA 2QPAA 5DM1A 3WIBA 2QVGA 5K45A 1ZR4A 1U6JA 1JG2A 1FU7A 2YVLA 3BRWA 2OAGA 4QFBA 1G7CA 1QIHA 3UPDA 5A5FA 1P80A 1PW7A 1Z22A 4ZVUA 3WL4A 3D2AA 2QL6A 2CL5A 2PKEA 4K7JA 5I7SA 4RHUA 2WTNA 1XCMA 4GX5A 4YAEA 1ITZA 4LMBA 2C3UA 1E59A 2OBFA 3S2UA 3AVYA 2ACKA 3W06A 4MQUA 2YZGA 4J1TC 4MV7A 4YCLA 1MKYA 1XNJA 3IAHA 2R1VB 5COBA 2RGUA 3BTVA 3TR0A 4DQXA 1ELOA 4G23A 1Q1QA 1QC5A 3PSAA 4H27A 4ND6A 4R6XA 1WXHA 3SOPA 1M54A 4EAAA 1U11A 2HJ9A 3D6MA 3IA7A 2ZIXB 4KAJA 3W9YA 4OGGA 1JHXA 1P7WA 3RHTA 2P2ZA 1G6HA 2CHFA 1RBMA 4U6SA 1CR6A 2PH3A 4JEHA 2BELA 2PUTA 4OXIA 1G55A 2JVIA 4WNAB 2KBFA 3I92A 1V9LA 3ENZA 2QSUA 2ZIWB 2HDHA 2YS7A 4UULA 5EJFA 5KS2A 3S8YA 1TQDA 1VLVA 4O4HA 2DERA 1CZUA 3BILA 3OEHA 3GAFA 3AIIA 2NUTA 2B2CA 2VNSA 2P4QA 1ZICA 2QTZA 4J49A 1LS1A 2EIHA 1YJAA 1JH8A 2IU3A 1NLMA 1ULAA 2W83A 1IDN1 3AUYA 4HBGA 3RIYA 4C6RA 3A1DA 4LHXA 4MVJG 1QH8A 4N3CA 4ZHQB 2QUJA 4X65B 1WP9A 3HCWA 4JYPA 4HPWA 4L1KA 5DGIA 2G0NA 4Y2GA 1LPMA 4HMPA 4GDMA 2RHCA 4KMRA 1XAJA 4N7JA 5BRJA 1BDBA 3E9YA 3L0DA 3QKSB 3UW1A 3L8CA 1N0WA 2FX5A 3GNLA 3NHRA 1DRJA 2C2MA 2YJ4A 2FPGA 4D4GA 1G8SA 1T5SA 3ZDFA 4K9LA 2CJFA 1OLXB 2IEYA 2HIGA 3GRVA 1XTQA 2VNKA 3NB0A