3IC5A

N-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
NAMRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRMGVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative saccharopine dehydrogenase
publication title X-ray crystal structure of N-terminal domain of putative saccharopine dehydrogenase from Ruegeria pomeroyi.
rcsb
source organism Ruegeria pomeroyi
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ic5A00
2JD0A 1O5IA 5ILOA 3G1UA 1PJ4A 3IJRA 4JJFA 3CMMA 3PIDA 2AQKA 3RUIA 5L45A 2PZJA 3MZ0A 4ND2A 1E92A 2Q99A 3OSUA 4YVFA 4BO3A 4QUKA 5CEJA 1CQIA 4P8RA 3L9WA 1LLDA 3C7CB 5T8KC 3ULKA 2I66A 3DQPA 3DHYA 3E8XA 5EJ2A 3FNEA 3NJ8A 4OQZA 2E48A 1ZXLA 4CMKA 4B3IA 3U4DA 3LF1A 3IUPA 5B37A 1UXKA 1PIWA 3AI1A 5B1YA 2IODA 4YAGA 4WEOA 3AY7A 3ICCA 4UEOA 4BO6A 3GC6A 1MB4A 5ER9A 5CPBA 3PZRA 3HN2A 1ZZEA 4DQVA 4DPMA 4RGBA 3D5TA 5JY1A 4NFHA 4Y8VA 3OECA 5TS3A 3ZNOA 5A4DA 1ZK4A 1AXEA 3GZ4A 4D43A 1XYGA 4L73A 2D3TA 2CY0A 5IDWA 2DAPA 3EUWA 3OQ6A 5JAQA 2VYND 4BKPA 3KYBA 4PLCA 1UZMA 3KSDO 3K6JA 1C14A 1PJBA 4YT2A 3VH3A 4DIOA 3P7MA 4YCAA 3U4HA 1QORA 2O3SA 1N7HA 4E4YA 5DDIP 1PGJA 5IZCC 3MCVA 3TWOA 1NAIA 2AG8A 4OO3A 2C59A 1P1JA 2ZTLA 4IZHA 2ZQYA 2UUPA 4E5KA 4CMEC 1TI7A 3DHNA 4S3MA 3TL2A 1EE9A 1Q7BA 1WMBA 3PJGA 4ROSA 4RLSA 3JD3A 1EBFA 4CM8B 1U2DA 4W9NC 2P91A 3JQFC 5THKA 4RJTA 4YWJA 3JD2A 1W73A 1PGPA 1WDMA 1TVEA 3NT2A 2YJZA 2ZATA 2X4GA 2IE0A 3FWNA 1RKXA 3GQVA 4Q3DA 3VOSA 3P2YA 4BO2A 3MJ4A 4NJMA 1MP0A 5LCXA 2GCGA 2X5JO 3OFSA 3ZZNA 2RH4A 3ST7A 4F6LA 2PKQP 1UZNA 3W4IA 5A9SB 2O2YA 3UOGA 1P44A 2WD7B 2P2SA 3BMQB 3KETA 2C20A 2IZZA 4XEHA 4D3FA 5A9SA 5DP2A 2WD7A 4U5QA 1KEWA 3ZHXA 2IZ0A 3BMQA 4UAGA 4CM3A 4RF4A 2CUKA 1BTOA 3H2ZA 1Q0LA 5EIOA 2WEKA 2VHXA 3HB5X 3QWIA 5JY6A 1FDSA 1F06A 2JCYA 5ILGA 3R3SA 4MPDA 4AJLA 1VM6A 4O59O 1HDRA 1ZK1A 2G17A 1ZXBA 4KUHA 1WAMA 2FHSA 3RBZA 4CR6A 4NH4A 4IGFA 3GDGA 3VZQA 3GAFA 1VSVA 2P4HX 1BXGB 3CSDA 4BNTA 3GGGA 3F1KA 5IJZA 3X2FA 1IPFA 2H63A 3PYXA 5DN9A 1MGOA 1GUYA 3ROKA 2JAHA 2GGSA 4E5PA 1G1AA 1YDEA 5JC1A 4LMPA 3H9GA 4IDEA 4MVJH 4EI2A 3RC9A 3AM5A 2PZMA 4MKXA 1JW9B 3JQAD 2GN6A 4J2OA 3U0BA 1O0SA 1VRWA 1HSOA 1IL0A 3GZNB 2IDZA 3G1TA 5JO9A 1CWUA 2C29D 1PGNA 3GZNA 2YHUA 3RU7A 1F14A 4ONEA 4CMIB 3SJ7A 4IQ0A 4RVSA 1XEAA 3OP4A 2PGJA 3GNSA 4CMIA 1HSZA 1I3LA 2BLLA 3PHIA 4K6FA 4BMVA 1BRMA 4UVIA 2XOXA 4TSKA 4OH1A 2H5LA 4XDYA 2EF1A 3BHIA 4FD3A 2GZ2A 2VT3A 3PQDA 4RVUA 3ETDA 5LC1A 3DONA 2GD1O 2WMDA 1KY4A 1YB5A 4M55A 4RPGA 1DC3A 3WR5A 5IFLA 3AUTA 2W90A 3B1FA 5AXDA 1VKNA 1U3TA 1MV8A 5EESA 1HRDA 4LGVA 1QYVA 1Z45A 5F1PA 4CQMA 4E12A 1WZIA 5HWSA 3L4BC 1JN0A 2EW8A 4GSLA 2VZ9A 2HMTA 3LYLA 5CPFA 3PTZA 4R54A 3IOYA 3ZNPA 4RPJA 5IN4A 2OFPA 3QWHA 4PFJA 3QA9A 3N7UA 1PZEA 2WYWA 4BKRA 3BMCB 1ADGA 1TA4A 1Y7TA 2CVQA 1JQBA 4DYDA 2Y0CA 1RWBA 3BMCA 3ZU3A 1UXHA 2G5CA 2X5OA 1B0AA 3AK4A 4XQGA 3P19A 3TN7A 5BSGA 2FPPA 2WWRA 2ZTUA 4CV0A 1M67A 4TQGA 4M8SA 2IYPA 3M2TA 3A06A 3ZV5A 1PGQA 4J6FA 1C1DB 1E3WB 2HLPA 1RJWA 1JKJA 1LC3A 5COQA 1C1DA 1UAGA 4I5GA 3ZW9A 4PVDA 2Z1NA 3UF0A 3BIOA 3PIIA 5DZSA 5TF4A 4C4OA 1J6UA 3DAPA 1I32A 4CQLB 1I2BA 3AUAA 2VZ8A 2DBZA 2X8LA 1TEHA 4ILKA 4CQLA 1LBEA 4J16A 2C2YA 4JBGA 3ZW8A 2PZKA 3GVIA 1YBVA 4MOWA 4WOKA 4CM5A 3PGJA 4OXYA 3K92A 1ISFA 5A05A 2PGDA 1KOLA 4UUPA 2B69A 4BMNA 4O6VA 1RPNA 4BNFA 3QWAA 3INTA 1L1FA 4J9UE 5B4TA 1OBFO 4TROA 4Z9YA 4DWVA 4Y9DA 2HJSA 2VNAA 4PG6A 1X7DA 2QZ9A 2RBEA 4KQXA 3ZWYA 4H16A 1P31A 3F6YA 3DZFA 2GSDA 3EYWA 3S2FA 1CETA 3WYCA 3ZWVA 2EXXA 4YT5A 4UREA 4BNWA 2ZB4A 1ULUA 4TVBA 4BB6A 5I7EA 1BSVA 3WJ7A 4J1TA 1ZMTA 3ZDFA 1H6AA 3ETGA 4BNLA 4OKIA 2PD6A 3E9QA 7MDHA 4HWKA 3OETA 4DIBA 5IDYA 2VWQA 3I4FA 4FJ0A 1DOHA 1BDMA 3Q9UA 4RPLA 3FPCA 2BELA 2AQIA 3DTTA 2GASA 1EFKA 4XYEA 4B4WA 5FFFA 3DMTC 1C0IA 2X0IA 1BXZA 2UV8A 2H9IA 1Y8QB 4YB8A 4NFYA 1QV6A 5KWEA 2VWHA 1Y8QA 1Z74A 4XYGA 1QLJA 1IB6A 4BNHA 3D4OA 4DYVA 4DLBA 3PK0A 4ZA2A 2AHRA 2Q4BA 4BKOA 1Q7GA 1GZ6A 1XDWA 1ZJZA 4FFPA 3LSYA 2V6MA 3GEDA 4TKMA 3AUUA 1A4UA 1CDOA 2E49A 1LQTA 5F1KA 2BFAA 2Z1MA 4K26A 3D4PA 5EINA 1JLLA 1QYXA 1X15A 2VN8A 1LJ8A 4XDZA 5AXBA 3TZQA 4LK3A 4OOEA 4Z0TA 4JBHA 1U5CA 4JGBA 2NV6A 1H6BA 3OIDA 2X0JA 3ZV6A 2VCYA 1FDVA 4CV3A 4A5OA 3DOJA 3M6IA 4MINA 4PLPA 4FN4A 3RAJA 4FBGA 3UH1A 3WQRA 1E3LA 1MG0A 1UXJA 3ORFA 3QY9A 3G17A 3NX4A 3S2IA 3VDRA 2EKLA 2X0NA 1FJHA 4NI5A 1ZK2A 2HAEA 2GLXA 4DTIA 1WNTA 5JCJD 2AE2A 1A7AA 2I76A 2A9FA 3DXFA 3B20A 1AHHA 4KDFA 1LDGA 2IXBA 1HDOA 1B3RA 4R1SA 2I65A 3EDMA 4E5YA 1T2DA 2A94A 3DR3A 4BO9A 1V3TA 3U5TA 4EBFA 3DBLB 5DP1A 4QSMA 4BNYA 3PWZA 2QYSA 4YJFB 3RIHA 1MG5A 3DBLA 5KKCA 4YJFA 4GKBA 1SOVA 4MO2A 2GYYA 4IM7A 5JPIA 1R37A 1DIAA 1XKQA 4G81A 5COBA 3JD4A 2PD3A 3DAFA 3UCXA 3RBVA 4E13A 3JQGB 4WEQA 4RVDA 4XYBA 2A4KA 4E0BA 1SNYA 4HXYA 3F4BA 4Y6RA 1ARZA 1EUZA 1SAYA 1DAPA 2QRJA 1W8DA 3VHRA 1LDEA 1ZH8A 1PJTA 3EZLA 4N5MA 3WYEA 4ZICA 4BGUA 3ADOA 2BRUA 3NTQA 2Q50A 4GKVA 5I9MA 4AJ4A 3WLFA 4HV4A 3IUSA 4WJZA 4E31A 4DQXA 2GR9A 2NVUA 3O38A 1JU9A 2Y0DA 5BSFA 2YQ5A 5A04A 4YT8A 4CQMD 4W7HA 3WSWA 4WCFB 1NFFA 5JAZA 5L4NA 1PWZA 5HS4A 3C1OA 3PHJA 4WCFA 3FCOA 5ADHA 1B16A 2WSBA 3NTRA 4R3NA 4NPCA 5CDYA 1U1IA 5ER6A 1IYZA 1X13A 2I5PO 3QVTA 3ZWPA 4YRBA 2BH9A 1I5RA 2I6TA 2RHRA 4IJKA 3VAZA 4P38A 2H1SA 4ZQHA 3WOHA 2VYNA 5JE8A 1LEHA 1KEUA 3ITDA 2D8AA 3PJEA 2B35A 1FXSA 2DFDA 3VH2A 5DBIA 4BS9A 2I99A 4I9NA 4K28A 2X23A 2UVDA 3RUHA 2V65A 4RF2A 2DM6A 5L9AA 2AA3A 2B4TO 4XRGA 1YL7A 4DREA 2PLAA 3RROA 3V2GA 2X1HA 5IG2A 2NTVA 4JJGA 1UDCA 2QHXA 3ZNQA 5CAEA 4Z0PA 3DZIA 3RQSA 2G0TA 4CLHA 1PZFA 5HS6A 2BKAA 2I3AA 4ZHSA 3ANLA 4JBIA 2Y1OA 3DBVO 4QFCA 1PGOA 4MJLA 5I7VA 2UYYA 4AJEA 1U2GA 5LDGA 2VRCA 3UN1A 5TRTA 3Q6IA 2OGUA 4KTVE 3LT4A 2FOIA 4J3FA 4HP8A 4IZIA 1H93A 1R0KA 4OXNA 4RV9A 2WYVA 4DMMA 4PLVA 4U6SA 3ZWNA 2C5EA 3ICPA 3WS7A 4MIOA 3JQBA 1D1TA 1HTBA 1NM5A 2G1UA 9LDBA 4UULA 5CHEA 1P0FA 3JQ7B 2R2GA 3D0OA 4NJOA 3OEWA 2D1YA 1E7YA 3F47A 3V5NA 3JQ7A 4BNVA 2Q49A 3LT2A 4IUYA 5JXWA 1C0PA 1ZNQO 2P9EA 4DBZA 4ZJUA 1SPXA 3UCFA 1PQWA 3KB6A 4N7RA 1NVTA 2JD1A 2FP4A 2C82A 5COAA 4JP3A 3QSGA 3JYOA 4D45A 1LSSA 4J91A 1OC4A 2DBQA 1F12A 4KZPA 4OOFA 2BMAA 1VJTA 4OSOA 1F8FA 3VTZA 4R68A 5IXSA 4CL8A 4J1NA 1ZK0A 4DL9A 2GPTA 3AJRA 4CUKA 5GZ3A 4FDAA 5A03A 4EUHA 4GWGA 4NU5A 3WBFA 3SEFA 1GQYA 3NT4A 3WGZA 2JD2A 4Z3DA 3L9XA 5K6AC 3MWEB 4Y67A 4QO7A 2HCTA 3QE3A 1HEUA 1DAOA 4EDFA 4RQTA 4WCDA 1E1KA 2VWPA 1MLDA 2EJWA 3JQAB 3H2SA 4GPD1 5B12A 1ZJYA 3JQAA 3N58A 1NR1A 1C1XB 4CLRB 2E6UX 1P1FA 4WUVA 1C1XA 2CSUA 3NJ4A 3DWFA 4LN1A 4RDHA 1UDBA 1JWBB 1ZFNA 1GZ4A 4OGWA 4II3A 4BNZA 4WLNA 1NX6A 5IF3A 4LMRA 4DLLA 1GV0A 3CKYA 1VSUA 2Y66A 1DLIA 3KSUA 3CPSA 5U9CA 3VVBA 1L7DA 4I9HA 2GDZA 4BHTA 3V1YA 4DLAA 3KEQA 4YEDA 3LZ6A 1HZZA 5HTOA 5CDGA 1NAHA 5KVCA 2H6EA 3G79A 2WE8A 4C7KA 2PNFA 3JQEA 1HT0A 5FWNA 4MKZA 1U7TA 1IPEA 4IJUA 3MEQA 1ZSYA 4HX5A 3QW2A 4I5EA 2O7SA 2I3GA 3I9LA 4ZQBA 1UDAA 2Q2WA 4YACA 2AMFA 1T4BA 4H7PA 4LVCA 5BSEA 1QYWA 3RD5A 4A10A 2NADA 3O26A 3OM9A 3TZCA 1DJNA 1H6DA 4CMGA 4BB5A 3DOOA 4ID9A 1C3VA 1KS9A 3R6DA 1QSGA 1AHIA 4K9DA 2YFHA 1GCOA 1HDZA 3AUSA 4W82A 4ZGWA 3RBXA 4A03A 4WK6A 1GEGA 5IDQA 2DBVO 3CUKA 3OHSX 3GUYA 1JAYA 3HDJA 4CMJA 3RC1A 3VPHA 4MVJM 1NYTA 4YJHB 3GEMA 3E18A 3HN7A 4JJIA 1CERA 1BVRA 4S1VA 4CMHA 4YJHA 2AEFA 5MDHA 1I01A 4UUOA 2X9VA 2Y68A 3IS3A 1EQUA 3RUEA 1NQAO 1T1RA 1UXGA 3KSZO 4J0FA 4R1NA 5JW6A 1WXDA 3X2EA 2ZYAA 1T4DA 3TQHA 3PQFA 3JQDA 4AJNA 2Z5LA 3QVWA 4TZTA 4NBTA 3D1LA 5G0VA 2CF5A 3UKOA 4HUJA 2EWMA 2B4RO 2DKNA 1X0VA 4A73A 1V6AA 1GPJA 1NPTO 1MFPA 1VL0A 5A02A 4ND3A 1Z7EA 1EK6A 4XJTA 5KIAA 3FI9A 3QV1A 4PG5A 2OBNA 1WP4A 4R3WA 1I3MA 3GY0A 3NUGA 4PZDA 2HDHA 4HADA 1GYRA 4JXKA 5EERA 4DPKA 5KVVA 4J0EA 1D4FA 1E3JA 2Q1UA 4NBVA 3ZCXA 3JQ9A 3SJUA 3VDQA 3WMXA 5G0UA 2Z95A 1N5DA 3K96A 4RVFA 3GLQA 3TFQA 3AOEA 1VI2A 3HDQA 3FR8A 2FMUA 1PJLA 3BHJA 4J7XA 1P1IA 2BF7A 3JQCA 4KP7A 4IXWA 3ONDA 1I3KA 3D64A 2Y1EA 3EW7A 4ND5A 1OOEA 2X58A 4EYEA 1YXMA 2O48X 3I9MA 3RSHA 2C7VA 3Q2KA 5IXYA 1SB8A 1UXIA 1I36A 4CM6A 5TSDA 1MX3A 3B6ZA 2WTBA 3MOIA 1K6XA 1D1SA 4J2HA 4CLEA 3R0IA 1NHWA 1DEHA 1SO8A 3MTJA 4UUNA 2QQ5A 1U8FO 2J3KA 2E82A 2W2KA 4WECA 2EP7A 3FWZA 3Q2IA 2J3JA 3DAGA 4CL3A 1DB3A 3L6OO 1HKUA 3PI7A 3UW3A 3WIEA 3CMCO 1O9BA 3PHGA 5H82A 5T57A 4E21A 5DNAA 3MWDB 4JCOA 1UUFA 2POQX 5BNTA 2GNAA 1XIVA 3H7AA 3QRWA 4GX2A 4NJMB 3RFTA 1Q0HA 3BTVA 1M75A 1GD1O 2VRCD 4FFMA 4DXHA 4F3YA 3WXBA 4ZU3A 3I9OA 2P9GA 1RM3A 3UICA 2Q45A 1LX6A 4L75A 4ALJA 2D5CA 2B5WA 1LQUA 1U7HA 2IXAA 3GDOA 3L6DA 3OA0A 3WGHA 3GOHA 4G5HA 3LC7O 1XU7A 2JFHA 3DZBA 3AFNA 3NDIA 3KUXA 3L77A 4J7UA 5L40A 4TRMA 1V9LA 2Y0EA 1FF9A 4CMAA 4RCVA 1YJ8A 2HSDA 2Q2QA 3N74A 2O3RA 4NU6A 4BNJA 4GSKA 2PY6A 3HZZA 1K2WA 3C1TA 5B4VA 1PJCA 1WLYA 3GHHA 5JCJA 3H4VA 4EEXA 4YYZA 1P1HA 3IP3A 1I2CA 4ALKA 1PQPA 1QKIA 2ZCVA 4C7JA 1T25A 1Q1NA 3DFZA 1PX0A 3P5SA 3CZRA 3DDNA 1YE3A 4R5HA 2WJPA 4PIVA 4ZN6A 4DIFA 1H0KA 4W4TA 3G3EA 3QVSA 2XPCA 2GZ3A 3RUCA 2V6BA 1GYQA 2OP0A 2FRDA 4N54A 2NWQA 5T64A 4BGEA 2YDYA 3C24A 4BOYA 2NM0A 5TC4A 1TT7A 3K8ZA 3A9WA 4I08A 4XYMA 3E9MA 1I10A 1SC6A 4PG4A 5DCYA 1N9GA 4YAKA 5JDIC 4M86A 4KOAA 5AVOA 3LT0A 1EVIA 4D0SA 3AM3A 3QIVA 5BR7A 4B4OA 1LA2A 3H5AA 1WMAA 5CP8A 3W6UA 1H9BA 1XELA 3GRPA 3ROMA 4DRYA 4HFRA 3WNVA 3BTSA 3JCZA 4PZCA 4QTZA 4QFDA 1P74A 5EL0A 3SLGA 1YB1A 1LDMA 5EQDA 4EJ0A 1IULA 1PL7A 4WASA 3HSKA 1P9LA 1UP6A 3LC2O 1NBOA 1XQ6A 3E1KA 4BNUA 4BO0A 2NTJA 1YOVA 1ISHA 4FFNA 3JSAA 4ND1A 2WE7A 1PU2A 5ICMA 3M1LA 2JL1A 4XZ3A 3GMDA 4JQCA 1YONA 4CQMB 1NVMB 2X22A 3LC1O 4AG3A 4E30A 1U3WA 2O50A 4YAJA 5H83A 2AEMA 4X54A 3DHEA 4CR7A 1PSDA 2X9GA 4JK3A 1ENPA 4TRRA 4MIYA 4NIMA 4FPXA 3T7EA 3RI3A 4E5NA 5GMOA 3SLKA 3I9JA 2NTNA 3U62A 3NGXA 1B8PA 3W1VA 3PDJA 1GADO 1DRVA 4M89A 2EKQA 2Q46A 1EQ2A 4I8XA 4XB2A 2BHLA 1O6ZA 9LDTA 1GAEO 1XG5A 3HFGA 2O4UX 5EQFA 4WLUA 5EPOA 1K0UA 2VYVD 4Z6KA 5GZ6A 1N8KA 4DC0A 3KM0A 5ENDA 3AU9A 1EDZA 2Y05A 1KERA 2IRWA 3Q9NA 2IEDA 4IJVA 2VHZA 1M66A 1W6UA 2B36A 2B5VA 3WNQA 4E2YA 4DQUA 3SVTA 4W7IA 3TSCA 2OOSA 3WMWA 4R9RA 1ZEJA 1R66A 4D44A 2CDCA 4FQ8A 4BGVA 4EUEA 3W4KA 4BV8A 2NLOA 2OXIA 3WFJA 4A2CA 4IXTA 4R1UA 4DPLA 1VJ0A 5JS6A 3I6IA 3NT5A 3E48A 4NBWA 3V1UA 3PRJA 3F1LA 5L4SA 2IYOA 1NFQA 3CE6A 4L9RA 1YL6A 1EVZA 4MP6A 4W99A 3TOXA 3TZKA 1O89A 3C85A 5FEUA 2ZJ0A 4FJ1A 3A14A 3F3SA 3OH8A 5JC8A 3S2EA 5MGBA 3FBGA 4XQ9A 2YW9A 3GVCA 4GWKA 3ASVA 1NR7A 1T2AA 3VZSA 3B1JA 3GFGA 4JIGA 1LUAA 1Q0QA 2XAAA 3BAZA 4AL4A 3GG2A 1QV7A 1HXHA 1YGYA 3K2EA 1KBZA 4I9UA 3AY3A 4XR4A 5THQA 1HL3A 2WYUA 4P4GA 2HMSA 2Q4EA 5C37A 1W0CA 3VPSA 1YS4A 3WQQA 1R4MB 2ZJ1A 2NQ8A 1K3TA 4E32A 5L4LA 4IDFA 4KDEA 4QQRA 1R4MA 3O03A 4FFLA 1GUZA 2PR2A 2HK8A 2QG4A 3DZJA 4D3DA 2IEBA 3E03A 1VPDA 1M6HA 4D46A 3DMYA 4XWYA 1N1GA 4FJ2A 4BVAA 2PKRA 1A9ZA 1CRWG 2VOEA 1K5HA 2ZTMA 4ZRNA 4IMRA 1PJSA 5L3ZA 5KNLA 4BQRA 4Q3CA 1OC2A 1E3IA 4Z3KA 2DT5A 1ZBQA 5T67A 5KJ1A 1Z82A 3ZH2A 1EK5A 3O8QA 3GVPA 1JKIA 2TMGA 1LNQA 4LISA 4J7CA 1KVRA 1E5QA 4IY1A 3WBBA 1F8GA 4BO8A 3RUDA 4GLLA 2JKVA 1HE2A 3BYZA 5A06A 1PTJA 4RVGA 1JVBA 2UUOA 4NR0A 1V3UA 4RF5A 1BDBA 1KY5A 4TMFA 3LQFA 4B8WA 1IE3A 4GL4A 4R5MA 4D3SA 1MXHA 5G0SA 4B4VA 4QT0A 1EVYA 1DSSG 4J4TA 4CLXA 4OHUA 3UGKA 1DO8A 1ISGA 4G2NA 3V2HA 4E2ZA 3ASUA 2PD4A 2RAFA 2DUUA 1EFLA 1ADBA 4CJXA 2O3QA 1B8VA 2ZB7A 3ZU4A 2EERA 3S2GA 4WLFA 3DBHB 3DZHA 1VE9A 3ANMA 1WWKA 4YAEA 1E7SA 3G0OA 3DBHA 4HNGA 2DUWA 3Q1LA 3KLPX 3MJSA 4OAQA 4QX6A 4CODB 5ITVA 2R00A 1BHSA 3WGYA 3INGA 4U0KA 4YBZA 5KTKA 1IOLA 3HDYA 1LSOA 5DULA 4Z9FA 4RQUA 1E1NA 4YRDA 2ZB8A 4BUCA 1NNUA 3CEAA 3PGXA 1PZGA 2VZ0A 4RPKA 3ZI0A 3ZWXA 3S8MA 3GGOA 3CH6A 1SBYA 1Z75A 3EZYA 5TGDA 1P77A 4IINA 2OL4A 1DFIA 1HYGA 5DF1A 1EUDA 3TDKA 1A72A 4CM4B 3PQEA 5JDCA 3GRKA 3WICA 3E5RA 5B4UA 3RUAA 4CM4A 3DTYA 3IDSA 1MC4A 2NVUB 1ENZA 5KKAA 1ZCJA 3CINA 3OIFA 1E1MA 3VVCA 2Q1TA 3WWYA 1KYQA 2QZZA 1PZHA 2R6JA 4BNKA 1HE4A 1P1RA 2B4QA 4PZEA 1IHYA 3TPCA 3V2UA 3MJCA 3WGOA 3V8BA 5G0TA 3ZWWA 1ZKMA 1J5PA 1D8AA 3DZGA 3QHAA 1T2EA 3F5QA 3ZWMA 2SCUA 3QQPA 5TT0A 4EUFA 2O7QA 3QP9A 4I5DA 5GY7A 3W6ZA 4YR9A 5AYVA 1A27A 7ADHA 2W98A 5IZ4A 1JKFA 1GQ2A 4Q3BA 1GYPA 3ZHZA 2C54A 5TNXA 4OIMA 2B0JA 5BQFA 4EW6A 2QYTA 3NTOA 4WPGA 4JN6B 2EKPA 2ZTVA 1YQXA 4IGEA 2EG9A 4D79A 4J49A 1PJ2A 3UXYA 2PFGA 1ONOA 4WNCA 3WSVA 3GNQA 3WWZA 4PRKA 2GRAA 2J3IA 1DDOA 1LTHR 1GDHA 4IJWA 5F5NA 4CM9A 1LI4A 1AN9A 3GVXA 3ON5A 3U4CA 1AXGA 1P0CA 1OZAA 2HQ1A 3NRCA 1YB4A 1B26A 4RPHA 3STHA 2PWZA 1UP7A 1XQ1A 4GH5A 4TWRA 1YO6A 2DBRA 1I0ZA 1IUKA 2A35A 2D5AA 2FR8A 3UUWA 5AXAA 4XYLA 2BD0A 3BTOA 2HRZA 1SEPA 4E3ZA 3TZ6A 1R6DA 4K6CA 4DMLA 3PFFA 2WM3A 5TLSA 5G4LA 3K2BA 4B79A 1U3VA 2D59A 4DA9A 3DEYX 1S6YA 4AJ1A 1E6EA 1V8BA 1E7QA 4XRRA 3BMOA 1Y9EA 2NUAA 1X14A 2QRLA 4FB5A 1HDYA 2X0RA 2YY7A 4J4HA 4A26A 4BO4A 4IDCA 2VWGA 1D7OA 4XA8A 4DVJA 2HO5A 3PEFA 2I9PA 2X6TA 3KTDA 3L6EA 4R51A 3VZPA 1ZO8A 4ZVVA 1ENOA 2CD9A 5T8KA 3K31A 1BW9A 2J5QA 4JX8A 3G49A 3PLRA 2HMVA 3FNGA 4EZBA 1EVJA 5EMHA 4D7AA 5JO0A 3H6KA 4NBUA 3RKRA 2UAGA 3C7DB 1B2LA 1YDWA 2Q1WA 5TJ9A 1O95A 4CLDA 2BFPA 2O3TA 3RCBA 2I67A 3I9NA 4JNKA 4R41A 3JV7A 5HM8A 1BWSA 3I52A 3FF4A 3TNLA 1DXYA 1HE3A 1HZJA 4GVLA 4OXKA 4U7WA 5K9ZA 4A7PA 4UVHA 2XXJA 5FI5A 4M54A 4MVJF 1XLTA 4AFNA 4YT4A 1WDLA 4FCCA 4IS3A 3QVOA 3OMLA 1JDJA 4YQZA 2FPIA 2YV3A 3KBOA 4GQAA 3PWKA 5BSHA 4B3HA 2QX7A 5IZCA 5KJFA 2C07A 2AQ8A 2B83A 4OMUA 1LSJA 1U3UA 2ZIZA 3GVHA 3SC4A 1X7HA 4GX1A 1XCBA 4MKRA 1V3VA 3W8EA 1U9JA 4G65A 2D2IA 4CMEA 4LRTB 1IZ9A 1DBVO 4O0LA 1BG6A 1K6JA 3MOGA 3AM4A 5JSFA 4FSHA 2FPGA 3L4SO 4W9NA 2FSVA 4GI2A 4CLOB 3JQFA 4KUEA 3ZV3A 3AOGA 5EN4A 4F6CA 3WFIA 1X7GA 4UVEA 3FPLA 4CLOA 4YPOA 3HDHA 2GN9A 1OMOA 4AJPA 4WCFC 3AFMA 1YH3A 1NPDA 3WX0A 4D0RA 5T5QA 3RUFA 8LDHA 4GVXA 3EC7A 4MVJG 4NZ9A 4FOSA 1WPQA 3LF2A 1DC4A 4UVGA 3NKLA 3PZBA 1E7MA 1QR6A 1ORRA 1CJCA 1O94A 4PCVA 1OI7A 4J1SA 1NXQA 1H2BA 1WW8A 1J49A 2GN8A 1LRLA 5F3RA 3H9QA 3JYLA 4NDNE 5A5FA 4O1MA 3BZUA 4XR9A 3RJ5A 1NP3A 3VH4A 3A4VA 2Q2VA 2VYVA 1M76A 3GHYA 3CZMA 3UCEA 2ZYGA 3DL2A 4IIVA 1QRRA 1Y8RB 2ZCUA 4GX5A 3I23A 1YKFA 1ZUD1 5TIIA 3RC2A 1ENYA 3WJAA 1EZ4A 4TKLA 1Y8RA 2FZWA 5A9RA 1BGVA 5A3VA 3GN2A 4IQ8A 5DBFA 1E7WA 2JCXA 1LDNA 2YHIB 3DC2A 2GO1A 3I3OA 3L0DA 3ZWCA 4B3JA 5A3JA 2Y1DA 1SOWA 3I83A 1A71A 5C7LO 5JCXA 4FGSA 3WGGA 2YHIA 3K73O 3OJ0A 2W2LD 2OBYA 1ONPA 2YYYA 4ZRMA 1BVUA 1SMKA 1Z7BA 3HNPA 3C7AA 1T1SA 3TJRA 2FY8A 3TF5A 1UH5A 3KYDB 3HHPA 4EGFA 2P9CA 3ANNA 1KEVA 1E6UA 5JAIA 1KVQA 1SEVA 3LT1A 3KYDA 2NSDA 4XQCA 1MFZA 3HG7A 3JQBC 2XXBA 2CVZA 3VKUA 3NEPX 4HFMA 5JNLA 4E2WA 2VHWA 4ZQEA 4J4BA 3RVDA 5U4QA 4F46A 1DRUA 1P45A 2RCYA 3OJFA 3ZU2A 3BHMA 1PR3A 3JQ6A 1X1EA 5DBGA 1LRJA 5ENVA 3S1LA 2CDBA 1DC5A 3OICA 5BNFA 3PP8A 3H3JA 1N7GA 3UAGA 2VUUA 1GCUA 2V7PA 2FN7A 2P4QA 4BO7A 1EE2A 3DOCA 3PYLA 3UVEA 5AQ1A 4EITA 5KOIA 1QYDA 4RO0A 4RL6A 4JP2A 5KCZA 2E37A 2EGGA 3D5QA 5KJCA 3BA1A 5I7SA 3EAGA 1PJQA 3FR7A 2AG5A 5ES3A 1K89A 1E7RA 3KLMX 1GTMA 4LSWA 3L4BA 1SCUA 4QO8A 4PN3A 2W2KB 3DZKA 4CM9D 4XGIA 1LRKA 1MC5A 4R1TA 1VKOA 3GPIA 4NK4A 3DFUA 1UJMA 3JTMA 1TLTA 2BFOA 1E0DA 3D3EA 3VPXA 4GMGA 4A0SA 1GU7A 2JHFA 1KEPA 2FSSA 4N5NA 3H9EO 1Y5RA 3C3XA 4AICA 2DQ4A 1DFHA 2UDPA 2DPHA 3LLVA 4LW8A 4PLHA 2P5YA 1LDYA 3NYWA 4MDHA 2WD8A 3IQDB 2C2XA 3K9QO 4NHEA 5F21A 4GMFA 1J4AA 1YBAA 4RDIA 3SC6A 3BTUA 2EV9A 1AE1A 1WVGA 4TVOA 5A9TA 2BI8A 1ADCA 5A5EA 2HK7A 4D41A 1ZEMA 4NFSA 3T4EA 4CM7A 1IY8A 4CM8A 5DCUA 3ONFA 4DBVO 3GA0A 3KZVA 4NG5A 5G2OA 3O4RA 3JD1A 1MXFA 1PL6A 3GUCA 4I5FA 5HA5A 1GV1A 3WG9A 4EJMA 3PWSA 2EW2A 4R16A 3D7LA 3W8DA 5L51A 5CDUA 5DCWA 3KV3O 3O9ZA 4CMCA 5I9LA 2JFGA 4E5MA 2F1KA 1U4SA 2DVMA 3ROQA 2AE1A 2HK9A 4UEKA 1Y9AA 5I8ZA 4EEZA 1B15A 2YFQA 4GGPA 3ZWAA 4PLTA 3KO8A 4LCJA 2NU8A 1S7CA 5GZ1A 3FSRA 1QP8A 3U49A 4ZQGA 3DBRB 1N9GB 2DC1A 4Y98A 4CUZA 4OSPA 4XGNA 5CDTA 3DBRA 1R0LA 3U09A 1DHRA 3SX2A 2IZ1A 4RLHA 1ZSVA 3OJEA 1NHGA 1PS9A 1C0KA 4QECA 1BXKA 1GEEA 1RM4A 2VHYA 3QLJA 1BXGA 3UHAA 2RH8A 3W8FA 1ZMOA 1GQQA 1B8UA 2HJRA 3AI3A 1U8XX 4O5OA 3V1TC 4BKQA 4UUMA 1KIFA 2J6IA 5ICSA 3DMTA 4WKGA 2X86A 2B37A 1YOVB 3GDFA 4BV9A 1E1LA 3MJVA 3HADA 3PDUA 3NDRA 5LDHA 3AY6A 1NTOA 3T7CA 4ZD6A 2DPGA 2OHXA 2Y93A 4KWIA 1T2FA 3WDSA 2PTGA 2DTDA 2Y1GA 1FK8A 2HUNA 1R12A 4ALNA 1GFSA 3JQ9C 1H5QA 3EVTA 5CG2A 2OZPA 3I5MA 3AOEC 3W4JA 3WGIA 4IPTA 1CF2O 1A7KA 2ZKLA 1TXGA 3SBOA 2E4AA 2TMDA 5IAAA 2VTDA 4IDDA 1QG6A 4AJOA 4FFRA 3PJDA 4WOJA 1ZVMA 3NAQA 4OJNA 2J5RA 4MVJD 1B14A 5U1PA 2ZK7A 3HQ4O 2CF6A 4XIYA 4L8VA 3GPDG 1WZEA 4CMBA 3PFWO 5ITWA 4R69A 5I8WA 1JA9A 2GN4A 2ZQZA 2W4QA 1O8CA 2LDXA 3EVNA 6LDHA 4DGSA 1U4OA 2PKQO 4MP3A 3PPIA 2NVWA 2Y99A 1E3SA 1GZ3A 3HWRA 1Y5MA 4WLOA 3IKTA 5TQVA 5HBRA 1HETA 4BNNA 1Z6ZA 2RHCA 1E6WA 3HUDA 4WGGA 1DLJA 2J5KA 1A9YA 5JFOA 4GLOA 5F5LA 3IL2A 1HLDA 2PA3A 1TB4A 2ET6A 4PLGA 4BL5A 2W8ZA 4CM1A 3ONEA 5JYDA 3AI2A 1XA0A 1D3AA 1NQTA 1R15A 3F5SA 3FN4A 3QWBA 4J90A 4L4SA 4OL9A 1WDKA 3TZHA 3K30A 1KC1A 2VT2A 4XQEA 5L7YA 2OP1A 1LC0A 4AJIA 1JVSA 1W4ZA 2VHVA 2X7HA 3QJ5A 1E3WA 1HDCA 4BNXA 4YXFA 3C1AA 4WLEA 2CNBA 1XGKA 1CEQA 5CFZA 4N5LA 4U6QA 1V0JA 1DJQA 2DTXA 3PXXA 4YQYA 3WGTA 5BNIA 4XGKA 4BIIA 4NMHA 3ZHYA 5IDXA 1YVEI 2BGKA 2HMUA 1ZW1A 3GK3A 3U4IA 3KYCB 4HFNA 1NQOA 1RYDA 2CDAA 3KHUA 3KYCA 4TZKA 1LLCA 5J23A 4GX0A 3FRJA 2O4CA 4FOOA 3RJ9A 3L07A 4Q3AA 1RYEA 1UP4A 3BXXA 5T6BA 1UZLA 1NWCA 4BMSA 3GAZA 5CEFA 4Z0HO 1T26A 1EUCA 1A5ZA 2AXQA 1H9AA 3VPFA 2HU2A 5TJHA 5KVQA 1KC3A 1XWFA 4MVJP 5L7TA 4XX0A 4MP8A 2RIRA 1QYCA 3DO5A 2PV7A 4E6PA 1EDOA 1ZK3A 1GL3A 3O8QB 2CMDA 1HLPA 2ILTA 4FC7A 2PH3A 4L4XA 4P4NA 4ITUA 5L7WA 1G0OA 3A28A 2JCVA 1GUFA 3MTGA 4TRNA 5I9NA 3R3JA 4NBRA 1R16A 1LU9A 1YRLA 2VRBA 1VC2A 3GFBA 4FIZA 4AJJA 4XKJA 5C7IO 3ENNA 4K1LA 2Q1SA 3TFOA 3ROPA 1I24A 4DUPA 1R4NB 2GUGA 4RORA 2NU6A 1U28A 4BO1A 5A1TA 3PHLA 1QLHA 1R4NA 4ZQFA 4BNMA 1P1KA 1YBMA 3C8MA 1NASA 4B4UA 5C5IA 3I1JA 4PLZA 2PZLA 4FS3A 1LXCA 5BT9A 4B8ZA 4M1QA 4Y6SA 2BFMA 1BMDA 2Y1CA 4ALIA 4YDRA 4J1QA 1DRWA 4WE3A 1VLLA 1T24A 1JWAB 3U9LA 1N2SA 4KMSA 1KVTA 1HYHA 4A27A 2FR1A 2F00A 4L76A 3IKVA 5FI3A 4Q3NA 4R4JA 3VC7A 2G82A 2VTEA 4HBGA 4WLVA 5JAMA 3RU9A 1T2CA 1OAAA 4OM8A 3OQ1A 4YTEA 1X1TA 2NU7A 2WDZA 1P3DA 3LK7A 3E82A 3RASA 3RKUA 2YV2A 3GNTA 1Z73A 3JQ8B 3OA2A 1E5LA 3H65A 3GG9A 2DFVA 1ADFA 1PQUA 3JQ8A 5AXCA 1FDUA 4Z9XA 4HNHA 4J43A 2Q3EA 1XU9A 2CFCA 2DLDA 2AEJA 2YUTA 4O63O 3CIFA 4H3VA 2BGMA 1LLQA 5DOVA 3WTCA 1N1EA 4GGOA 1M6WA 3OBBA 3TRIA 2JHGA 4LSMA 4MVJI 1KVUA 2LDBA 4DC1A 3VPGA 3GMSA 2JFFA 3IC5A 3KXDA 4KWHA 5AOVA 3WTBA 2EGHA 4WNIA 2YQ4A 2XF8A 4M49A 4GAEA 5H81A 4PG8A 1VJ1A 1CIVA 1EBUA 1Y81A 1YWGO 3EK2A 3KEOA 3M1AA 4H15A 4U8GA 5HRUA 3ZWBA 1PS0A 4YJGB 2FZEA 4HY3A 2J8ZA 1XR3A 4YAIA 2OUIA 2CZCA 4YJGA 2PK3A 4CUJA 1YQDA 4Y6PA 4YJDA 3RFVA 5F1OA 2GZ1A 3H8VA 1HYEA 4FR5A 2W2LA 3SXPA 4NNJA 1YL5A 5K6AA 5L95A 1XSEA 3DB2A 3VKVA 4XJSA 2O3JA 4L74A 3H3FA 3JQGA 2YDXA 1E3EA 4IBOA 3FD8A 5I7FA 2OORA 1PJ3A 2C7GA 2O3UA 3HB4X 4FGWA 1QXSA 3F9IA 3NV9A 4I1IA 2A92A 2O2SA 3EY4A 2HRBA 4CR8A 1ZSNA 4E33A 4XB1A 2ZB3A 3P2OA 1NQ5A 2OO5A 3IP1A 5KJEA 1CYDA 3RWBA 8ADHA 4MIEA 3WQSB 1NWHA 1NVGA 5JMWA 3S55A 3IAHA 4IMPA 4BO5A 1LDBA 2NQTA 3M2PA 3K5PA 1SZJG 3GGPA 1C0LA 1DIHA 3GT0A 2AW5A 4FW8A 4LRSB 2JAPA 1Q7CA 4OKNA 1NFRA 2CVOA 2VNSA 1CQJA 4B7CA 3ZU5A 3OEYA 3FBTA 3CTMA 3MJEA 4MVJE 3MJTA 4N18A 1H6CA 1ID1A 3PLNA 1K6IA 1ISIA 2X9NA 3NDJA 1AGNA 4PVCA 5L53A 4B7XA 1ULSA 1EMDA 4XIJA 4IDBA 3IJPA 3CXRA 3JD0A 3FTNA 3I6QA 1EEHA 1PR9A 3Q11A 1I30A 1UAYA 3IMFA 3AU8A 4PGFA 1Y1PA 3QVXA 4AVYA 2EIHA 1KETA 3PHHA 1M2WA 1XHLA 1DIBA 5KJ6A 4M87A 4W6ZA 4D42A 1JAXA 2HKIA 1ISJA 2YZ7A 1G0NA 3F46A 3OQBA 4HKTA 4ND4A 2JJYA 4BQPA 4L4RA 5CDSA 1H2HA 4IDGA 1MUUA 3EHEA 3VZRA 2Y67A 2DU8A 1E77A 2OMEA 4UVDA 3INRA 4AJHA 3H5RA 4TRJA 3BMOB 4Q9NA 4IIUA 1YQGA 4YRAA 3B70A 3BMNB 1FDTA 3A1NA 5JBIA 4RZIA 1R0SA 3E6AA 4PLWA 3TL3A 2NU9A 1Q2XA 1DC6A 5C3MA 3BMNA 6ADHA 4FC6A 3OIGA 4UEJA 4URFA 3NGLA 2HMWA 3FHLA 4JLWA 4IDAA 2FWMX 3WB9A 3LDHA 4KUGA 1BW9B 5TX7A 1IZ0A 3OF2A 5IN5A 2EEZA 3Q3CA 2GF2A 1SB9A 3I9KA 1V35A 1RM0A 3ZV4A 5DT9A 5CEEA 3ENKA 1PWXA 4J9VA 2VUTA 3FTPA 1RM5A 5TT1A 4PLYA 1UR5A 4Q39A 1TT5B 1B7GO 3HJAA 1F17A 2R00C 3E5MA 2PGLA 3PYMA 2YV1A 1GPDG 1TT5A 1HE5A 3ITKA 4INAA 3H9UA 4XD2A 1QMGA 3ZGYA 3WLEA 3KVOA 3FNHA 1YJQA 4E2XA 3ZNNA 4ESOA 4PRLA 4OQYA 1DHTA 4NQZA 4BGIA 3D3WB 3OJLA 5JLAA 1I2ZA 2D0IA 2PH5A 5FF9A 2NVBA 4RF3A 2V6GA 3D3WA 3WYBA 1ONNA 3ZHBA 2GERA 2VOJA 5FYDA 3ADPA 4II2A 3GR6A 3H9JA 4U0JA 4EJ6A 3KOUA 1PEDA 1DFGA 2EP5A 3LLSA 3Q0EA 4R9SA 4OYRA 1JTVA 3WGQA 2J3HA 4CPDA 4R01A 2V6FA 3GEGA 4HFJA 4L0QA 4BKUA 4ALLA 5JDCC 2VUSA 1Y6JA 1HF3A 2FR0A 1F0YA 4PLFA 5CG1A 3EGOA 3GH3A 3B1KA 3JYQA 4KTTE 4QEDA 1HWYA 1ISMA 3GF4A 1L7EA 3I4CA 3OJOA 4YA6A 1FMCA 3IIEA 4AJKA 4CV2A 3UFXA 4CV1A 3RC7A 3ABIA 3GN1A 3T4XA 1G6KA 1MA0A 1ZIDA 4P4LA 3JYPA 2QIOA 2QRKA 4PG7A 3PJFA 1FDWA 2D4AA 1NPYA 1I8TA 2BGLA 3R1IA 4CLRA 5DOZA 3F4LA 3LU1A 1X0XA 2EJVA 5JMPA 4JROA 1U5AA 5C7OO 1AUPA 3COSA 5G0WA 4GBJA 1B3BA 4LVUA 4KQWA 4Q3EA 4B7UA 3JYNA 2P68A 1I33A 1LLUA 1LSUA 3H5NA 1HDGO 4MVJA 4RVHA 3AWDA 4QXMA 1H94A 1IHXA 3E9NA 1PS8A 3KRTA 2NNLD 4AJ2A 1A4IA 4IQGA 3HFSA 2BI7A 3ZWOA 2EHDA 3QWFA 3RFXA 4NK5A 4IS2A 4P22A 1KVSA 2O23A 1ML3A 3EMKA 1GY8A 3D4NA 1HDXA 1DIGA 1VL8A 2C5AA 2X5KO 1PL8A 2ZYDA 3PVZA 3TOZA 3VTFA 1OFGA 3FNFA 3AW9A 3ETEA 1J0XO 2AQHA 2NACA 3HE3A 4ALMA 2Y1FA 1VL6A 2G76A 2VQ3A 3WIDA 2QW8A 4BNGA 2DTEA 3U3XA 4LCEA 4XCVA 1I3NA 1P33A 3ZN2A 1GR0A 3LVFO 5KVSA 1DPGA 1N92A 5G4KB 1DIRA 4RZHA 3VH1A 4FFOA 4BNIA 4F45A 2P5UA 5K0ZA 2C0CA 5JDIA 5JYEA 5G4KA
chains in the Genus database with same CATH superfamily
1X77A 1O5IA 3PXEA 5KX5F 3OAAD 5EHQA 4NAUA 3G1UA 3BOSA 2ZE5A 1IOZA 3X44A 2ZJ2A 4OBWA 5EKSA 1TAUA 2PZJA 5KNDH 3HU5A 3MZ0A 4ND2A 5FO1A 3BJMA 4XM1A 4QJIA 3OSUA 1PDOA 1RABA 1CQIB 5EJ4A 2BGTA 2C4WA 2PWYA 4CTKA 2Z58A 3L7IA 4FU0A 5EUBA 3JRNA 3SE7A 2GBPA 6REQB 3ULKA 2Q2NA 4RM2A 1JU3A 4JT8A 3T1VA 3DHYA 2FX2A 3FNEA 3OZ7A 4G0NA 4WOPA 4CMKA 1O6FA 4Q5IA 4X6XA 4RFSB 1AKVA 1LY1A 1ZC4A 3IUPA 3KU4A 3R4CA 1UXKA 4DNOA 4ZHQB 3AI1A 3D31A 1CLEA 1U11A 1CS4C 5CH8A 5HE9A 4JLDA 5LD2B 3PICA 1KQFA 3ICCA 2J41A 4DILA 2EBHX 1SKYE 1U8AA 3ROEA 4PYJA 3OJCA 4TXHA 3F49S 3PQ7A 1O95C 1F3LA 2YXBA 3E22B 3OTHA 3VR5D 5KYWA 4N7JA 3URMA 5A4DA 4MUHA 1G20E 5F4BA 4NWIA 1D04A 4NZZA 1XYGA 1XYYA 4QFMA 1U8TA 2FMTA 3CO5A 4LE0A 4YMVA 1JL3A 1HEIA 1UZMA 3OCYA 3U40A 4C1BA 5IAJA 3P7MA 4UU7A 4AC9A 2ORWA 2PWPA 3P0HA 5MN4A 2P9BA 3NOOA 4TTTS 3B89A 3MCVA 2EFDB 2R7AA 5DLPA 3CEMA 2H1LA 4P35A 4X3PA 3MRTA 1VE5A 2UXDB 4UU1A 2FLKA 1E1QD 2ZTLA 5AH0A 4IZHA 3ESCA 2X4LA 3PNQA 2GBCA 4V0NA 1V4NA 2P1RA 4QHSA 2P2CA 5KQRA 3K7EA 4S3MA 1EFAA 4AKHA 2Z98A 3WL5A 1DV2A 4UTOA 1EBFA 3C3YA 3TMAA 2A1UB 4YS6A 2V7EA 2JIDA 3OM1A 1NW7A 1UOQA 2ENWA 2W6JD 3DMFA 3X2SA 4EHFA 5TR9A 3ZDDA 4YWJA 4KMOA 2JI6A 2K4MA 4LY6A 1WDMA 1YU6A 2R8BA 2ACEA 3PFGA 3OZRA 1Y37A 4G36A 4DJAA 4PFKA 3MWDA 3FWNA 1T15A 2ZJOA 1E0KA 3GQVA 4QARA 3NB0A 4BO2A 2XA1A 5LCXA 3D8NA 3MGBA 1W0JD 2P6RA 4PC7A 1W5SA 1ILEA 2QAGB 1U0JA 3RO7A 2XB9A 1VL1A 4INZA 5BV2P 2VHQA 5K20A 1MQ9A 4MUYA 4Y2JA 2O2YA 4B2LA 2PZAA 2QL7A 2MCFA 2P2SA 4GBED 4GR5A 5B58T 2NG1A 1IK6A 3BMQB 3G2LA 4JL6A 4D3FA 5A9SA 4BQOA 2DPYA 2WD7A 3FYUB 1KEWA 4U5QA 5IJ9A 3NDBB 3EFEA 2IZ0A 4Z86A 1LPPA 3Q7PA 2ACWA 2CUKA 3P0EA 4BRWA 1UBKS 3I32A 1QO0D 3DPIA 4FMDB 4NZNA 1G8SA 3SQLA 1DRKA 3RYFB 1C3OA 3L6UA 3CFYA 3LBYA 2H54A 2BT4A 2WPDD 3MK31 4HBZA 4NU8X 1JPVA 3R3SA 4MPDA 5EZYF 3TVTA 3RAFC 2ZPAA 2XUGA 3K0HA 5KB3A 1KU0A 3CF4A 2HT1A 2G17A 4J0JA 4V3CA 4CR6A 3BM5A 1QVRA 1OFUX 2Q9UA 2W2OA 2ZAIA 2F9FA 3G2OA 4RHCA 4IGFA 3ZUGA 3K9WA 5CB4B 2P4HX 3PPYA 2B99A 3L8MA 2LGJA 1IH8A 3LWZA 2GT1A 3CSDA 2PUAA 3E23A 2XYHA 5G3ZA 3W34A 4BNTA 4WN3A 1TJYA 3X2FA 5HP4A 2B3DA 1Q7TA 5EXPA 3PYXA 3C6XA 5JQWA 2R6FA 2ZE7A 3HSYA 1J1ZA 1U02A 4KB5A 3F97A 4OBEA 5JC1A 3T54A 2CJYA 3MJDA 2AN1A 2XRFA 4PHTA 3E0XA 4IDEA 2YVQA 4MVJH 4V03A 3W2EA 4ZJZA 4IXMA 2PZMA 5LIRA 3N9IA 2AJCA 2GN6A 13PKA 1V5GA 3DXZA 4J2OA 3U0BA 3SXUA 3WRVA 5K0SA 1Z8NA 2RHLA 3GZNB 2YXDA 3IKJA 4W5NA 3EIEA 3OWOA 5FO0A 4QPJC 1Q0PA 3PEVA 4IVNA 1J0EA 5JO9A 3R7WB 1CWUA 3TE6A 1PGNA 2PJUA 4L6IA 1KAQA 4EFNA 3QKUA 5JU6A 1PRYA 1XCMA 3SJ7A 4AURA 3A6HA 1IXZA 4IQ0A 1Y4UA 4ER0A 3SBDA 4YCMA 4KXUA 2H1OA 3LKBA 1HSZA 2BLLA 2HEIA 4Q1BA 4BMVA 3ZS9A 1BRMA 1T5LA 3P8ZA 4OH1A 4ZAZA 2PRYA 4OB6A 1GRCA 4FD3A 2WU3A 2VT3A 3PQDA 5AM1A 4ER7A 5IT9A 4KO2S 1ZI9A 1NW8A 2H08A 2GD1O 3AYZB 1NW6A 4OP1A 1SKYB 2IPLA 1KY4A 4Z8XA 3KSAC 5IFLA 3AUTA 4IILA 4UW9A 2W90A 5HIKA 1U3TA 721PA 1RXCA 2H3EA 3EXEB 4U8HA 1QIHA 1Z45A 5JVDB 3RGWS 1QH8A 4CQMA 4OSEA 4E12A 1OLSB 2F90A 4D3ZA 4B33A 4JC5A 1JN0A 2EW8A 2VK2A 3EDYA 4YJ2F 5CYFA 3T5PA 1IZ8A 4ARUA 5JXGA 4QXPA 1BDHA 4DV6B 2ZT5A 5B3LA 3PTZA 5KHOC 4R54A 4YLGA 3OFND 3O2JA 2ZSIA 2OFPA 4AN0A 5DNUA 2PSEA 1E6CA 3QA9A 1CY7A 5ALVA 1EBBA 1PZEA 2B30A 2J30A 4IR7A 3C43A 1ZCBA 4JVNA 2WYWA 3AUYA 3O1LA 1UCFA 3BMCB 4YGXB 3LP6A 2W2TA 5EXXA 1MOSA 2V0GA 1TYEB 1T9GR 3V9AA 1NN3A 1UXHA 2G5CA 4AULA 2IP4A 4JYZA 3QU4A 3JZIA 4KXWA 4GBMA 3F6SA 4PTYA 3RABA 1SGWA 5BSGA 2FPPA 1W46A 1JTEA 1ORVA 1RBYA 3P9KA 3TPZA 4CKEA 4L85A 5IBQA 2IYPA 3Q7QA 3A06A 1ZOSA 3TAXA 2B8WA 1KO1A 1E3WB 1TYCA 2QW0X 3ILYA 4UM7A 2P4EA 5COQA 1C1DA 4YUZA 1SCQA 1UAGA 4KJZA 4ODIA 3JAWA 4KXVA 3V4FA 3PWTA 1R8JA 2QQFA 3OQVA 5IHXA 5DZSA 2XCLA 3CRW1 4PO3X 1T0IA 2D2XA 1DO2A 3V8VA 4CQLB 3OE7A 3ACCA 5EG5A 2SKDA 2C3PA 5KYYB 1MJHA 1ZLXA 2X8LA 4ILKA 5DWDA 1E8MA 1WKBA 1QGOA 3ZW8A 2PZKA 4CM5A 1OW3B 1YBVA 4N65A 4G0YA 1B41A 3PGJA 4DIUA 4OLJA 1KKLA 3K92A 3SZ3A 1AQNA 3MGAA 5GP1A 1SKQA 2VP9A 3O5AA 1F6BA 3HB0A 4PNZA 4R2IA 1Z15A 3IILA 4WSOA 1BCSB 1JG6A 2VDRB 4PXAA 1VCNA 2WHPB 3VR2D 4EKEA 2NSYA 4GFDA 3RVRA 2A0FA 3A32A 5E6UA 1LTKA 3IE1A 2QZ9A 1GNSA 1JDBC 3SSOA 2WUWE 1IN8A 3F6YA 2ZS9A 3SMQA 4JBNA 4RHEA 1PR4A 2OY0A 2GSDA 3EYWA 4ENQA 3BWCA 2Z9BA 2OFFA 3WYCA 3UXEA 5KSYA 1NONA 3IAAA 2Q5QA 3B7PA 4B3DA 3QKWA 3QUBA 4BNWA 5GOZA 2ZB4A 5IVPA 5ALPA 4BB6A 1K7SN 3NHRA 4YUXA 1YFJA 4NG4A 4KVZA 4COKA 4OKIA 1CZOA 2ZUSA 1N7IA 3OETA 4BDTA 4YLEA 1XNQB 3K35A 1HYBA 3GEHA 4MKGA 2VWQA 3I4FA 4DIBA 4FJ0A 2HF9A 1DOHA 3WWDA 1SXQA 1PNRA 4NVRA 3DTTA 3FVVA 4IKPA 4HNSA 2XBMA 4M1EA 1SG0A 1UMDB 4PCLA 4TXMA 1D2MA 2IU4A 2NV2B 5FFFA 5LB2A 4B4WA 3IEUA 3UGTA 5JATA 3EHDA 3RLIA 3JALA 3BB1A 2UV8A 1N2CE 4HH4A 2DPMA 1UMCB 1W76A 1Y8QB 4NFYA 4XJXA 1U9CA 3F0TA 5BOVA 1VFNA 4BFUA 1UKBA 3DLAA 3EBLA 4BNHA 1UKEA 1VSTA 1XLUA 4DLBA 4E4TA 3RQIA 1XZNA 1LBSA 1KFKB 2ZVDA 1FNBA 1YB2A 1ZJZA 3CRQA 4KR9A 5C8DA 1Y5IA 4OQNA 4QOHA 3HO8A 6YASA 1CRLA 1Y3BE 2B61A 3GEDA 4DT1B 4EL0A 1K6EA 2XAUA 3QU7A 4FFBB 1P2DA 5ALQA 1WTCA 1P0MA 3AUUA 4Y1EA 3TSZA 1MTZA 2ONKA 4ZGBA 1CDOA 1JLLB 2PH1A 3LY8A 4ASUA 3SBXA 2H7XA 1CFZA 4IOMA 1KMMA 2UUAB 1N2XA 1OJLA 1VL2A 5DIFA 2C3MA 4V1CI 4JI6B 2VN8A 4XDZA 5AXBA 3TZQA 1VG0B 4PZ9A 4TWAA 4OOEA 2CL0X 3U1TA 1U5CA 2A78A 3V3KA 1XMOB 5KSWB 3OIDA 2X0JA 1IU9A 4GLFA 4MQBA 3FUTA 1FDVA 1GILA 3JAKA 4Q4JA 2O8EB 3NAZA 3SMVA 1AF4A 1O77A 4FKMA 5ARBA 5IH7A 3S40A 3WQRA 3K9NA 4L28A 4LXGA 4V0OA 3K0EA 3BORA 4OHZA 4I55A 4BN0A 5A5VA 1YDGA 2XA2A 1REQA 2OB1A 3N87A 3NX4A 1XMIA 3U48A 1YT5A 5LZ2A 3PD7A 5I3CA 1M8JA 3COJA 2Q0SA 4NI5A 1ZK2A 3DE4X 2GLXA 1WNTA 1J06A 4JGGA 4DCPA 1A7AA 4MR7B 3H4IA 3DNMA 3NHPA 2A9FA 2GVNA 1AHHA 2VT7A 4OFBA 5AI4A 4ZVTA 3PX7A 2IXBA 2J3MA 5FT9A 4TMKA 2ZRQA 4OBBA 5YASA 1ZM4A 1DKMA 1T1IA 4UTXA 4R1SA 3IT2A 3EASA 4EJSB 1T2DA 1AMUA 1MT0A 4ZO6A 4Q05A 4EBFA 3TW8A 5DP1A 1XMXA 1GGJA 1NX9A 4DBLC 3PQ6A 5AOCA 3RIHA 4OXXA 1GRQA 4BNYA 3FTDA 3A1FA 1AQLA 3DCIA 3DBLA 3NETA 3LOUA 3IO5A 2AOVA 3CV3A 4YJFA 4V0QA 1BKDR 2HT6A 4GKBA 5LJIA 1K7XB 3K4PA 2NP6A 1WB6A 3C1UA 2PKWA 1R37A 1DIAA 4G81A 3I76A 5L3SB 4NJEA 4DRXB 1YIOA 3AY0A 2CFTA 1G6OA 5JR3A 3HBAA 1ZOOA 3FI0A 4IJ5A 3O3MB 2D5LA 3QHQA 4HGPA 1RLJA 4LS3A 4WEQA 1Q92A 1SNYA 3B7GA 3GP5A 1VPTA 1J0BA 2ZE6A 4C9BA 4DSTA 3ZE1B 2R6DA 2AUMA 1QNFA 4FI3C 2EX4A 2V97A 3NOXA 3OAAA 1DAPA 2QRJA 4QREA 5B7GA 1SY7A 3ZWQA 1JQJC 3N7TA 1W8DA 4OG2A 1OROA 1JNXX 5GIPE 3HYNA 4QT4A 1U9ZA 1E5XA 3TTXA 1PJTA 5H3CA 1OX6A 3EZLA 4N5MA 3OEED 2G3YA 1SOAA 5DTIA 1YA6A 2B92A 3ZGNA 4N41A 3MBOA 2YJ4A 3N1UA 4YALA 2CCGA 3E9ZA 4HV4A 1JHMA 3IUSA 4WJZA 4US2R 2NZYA 4EUNA 3B5JA 3NBZC 5LP1A 4PNPA 2GR9A 4RC9A 1TTPB 3KCNA 4P4TA 5FAKA 2MYPA 2NVUA 3CGGA 3IIIA 4X9XA 5H7XA 4PX5A 3I5XA 1E9BA 1EIZA 1KQOA 2PXCA 4G0XA 4IIEA 2FQYA 5BSFA 4WRRA 1NBME 3RRMA 3GLHE 4P32A 3DAYA 3KQTA 4RNCA 4RTRA 1R10A 3AV3A 5FPSA 5HS4A 4DARA 5I7HA 4JA0A 2GAIA 1YR8A 2LKDA 5ADHA 2C9OA 1FJ2A 2IP1A 1TPZA 2AKYA 3NTRA 4R3NA 3C8HA 5ER6A 2AFVA 2D2EA 3QVTA 1GKIA 1P4SA 3CLTC 4H27A 3ZHRA 4BX3A 1KZ6A 1YKSA 4I50A 3W5DA 1GTRA 4URHA 1S2DA 1V1RB 2IDKA 3K0KA 4U3JA 3HO1A 3AIMA 2I29A 2LWIA 3QE4A 3BHNA 2TMKA 3BREA 2OPHA 3S4YA 2IXGA 1EJ2A 1EEXB 5AVXA 4F1WA 4CIYA 4F2GA 5CK5A 4RGQA 1FXSA 3VH2A 2Q8PA 1BXRA 2I99A 2SBTA 3NKFA 1N2CB 3N39C 2Z8YM 2P7IA 4NV3A 2ZVQX 2UVPA 1CS0B 2X23A 4L8WB 3U4QA 4G37A 5HTKA 4UHJA 4KRFA 2OILA 2V65A 2DM6A 3H6GA 2B0CA 5EWMB 4ZT6A 2HCJB 5C3UA 2CUZA 4UNQA 1DUSA 4RA9B 3ICOA 2WKSA 2PUVA 1YL7A 2WKRA 3H0EA 4RJIA 2PLAA 4DREA 3V2GA 1OBCA 2R8PA 4MROA 1UDCA 3UXMA 1IY2A 2NXWA 2WSMA 3FMGA 3UYLA 4F96A 1W88A 2TYSB 4KAAA 4LA4A 5E0OA 3HXKA 4YRMA 2OHIA 1N5KA 2I3AA 2Z2YA 1TF2A 2W6JA 4REQA 4Z4HA 4FGLA 1B8OA 1H1LB 2H0QA 1C7FA 4JBIA 3EEIA 2IEGA 4NCIA 3H5LA 3KOYA 3L4JA 1PGOA 4MJLA 3IPAA 4LDQA 1DQZA 2GKOA 5DT2A 2MSLA 3L92A 1YJCA 4OAOA 4JLNA 2OGUA 4KTVE 5TRTA 3UN1A 3TK1A 3R9WA 2XJ9A 1XVAA 2NAFA 4J3FA 1W0JA 2JPDA 2JC3A 4HP8A 4PGMA 4A4DA 1R0KA 5A6SB 4NNPA 3FCCA 2XRZA 4L15A 5F2NA 3WS7A 3GD7A 9LDBA 2G1UA 1DBRA 1RT9A 4IVQA 5K0CA 1P0FA 1QCCA 3HLTA 1N4DA 3FW1A 3JQ7B 4GC9A 421PA 2QX9A 1GAXA 3NCHA 4NJOA 4EA8A 1E7YA 3F47A 3R7LA 3KJGA 3V5NA 4BX0A 3LT2A 1QP0A 5JXWA 2P9EA 3L7DA 1KF0A 3OX3A 3WHKA 1ZQ1A 4ZJUA 5JPDA 1SPXA 2FWRA 3UCFA 2GEVA 4D8WA 4JELA 1M1NA 2JD1A 4QGGA 1T4CA 5COAA 4BFXA 4TMTA 1HNWB 3QE2A 1SD2A 3JYOA 4J91A 1DKLA 3PXDA 4HAXA 2H52A 1UC5B 4OOFA 5JPCA 1Y1RA 2C3OA 4FN5A 1NNSA 2HCRA 1F8FA 3LMKA 4R68A 1C7ZA 2MIIA 1IHPA 4CL8A 4TV9A 3AVTA 1ZK0A 4M1ZA 1C3LA 4E46A 1D07A 1PD0A 4CUKA 4FYHA 1DPFA 1NLMA 4FDAA 3MRSA 4GWGA 5B3JC 1XWWA 2NO9A 3SEFA 5AM5A 3WGZA 3T9DA 2JD2A 4PX2A 2XWPA 5EP3A 5F4ZA 2IIVA 1U80A 2HXGA 1ZY2A 4Y67A 2VQEB 4U9HS 4ZEMA 2HCTA 3QE3A 1CVIA 1Z08A 1DAOA 2D4HA 1NW4A 4U2KA 4WCDA 1T9AA 5BT8A 4ZVPA 3PL5A 4ZDJA 1UADA 2OV2A 2V74B 5LPNA 1NR1A 4ZGGA 4P34A 1Y48E 3H2YA 1NNEA 1FP7A 4MKIA 4WDRA 2OO5C 1R9GA 3W5SA 4DLPA 1SVUA 3OOYA 4O4LB 1AKQA 1AB5A 3NJ4A 5H9VA 4HB2A 4EPTA 3VPDA 5FH9A 1JWBB 1OIVA 2V9ZA 5ELMA 1GZ4A 4OGWA 4RVOA 3LJKA 5EKXA 4BNZA 1MZPA 5IF3A 1RBZA 1UMKA 1YASA 1GFIA 3EIWA 1KE1A 1J23A 3CPSA 5LYJB 2RAVA 2DQZA 3VVBA 1N8NA 4I9HA 5U9CA 2GD2A 4D3YA 5DBEX 3GLHB 3Q40A 4DLAA 1RJFA 1GPYA 2R62A 4YEDA 5JTTA 4KR2A 1HZZA 2LE0A 2JGDA 5CNJA 1NAHA 3AEYA 1GP2A 1EXDA 3AP3A 3JQEA 4DR4B 2IS2A 1FUUA 3IMKA 3UMVA 1Z9BA 3UGJA 1JG1A 2VK4A 1ZAKA 4MKZA 1IPEA 2VF8A 3MEQA 2WVAA 2F62A 3OLXA 1F2DA 3GV0A 2WUDA 4WACA 3IVCA 4YO7A 3WLIA 1LPSA 4NV1A 1OXTA 1UDAA 1NW9B 4U9IS 4ARIA 4C6RA 3Q9SA 3WI7A 4OXQA 4CIVA 5BSEA 2UUCB 1DL5A 2N3ZA 2BFDB 2NADA 5DKFA 3TZCA 5JV5A 4KSYA 2N9UA 3C3KA 2FUG6 3AQIA 2A8YA 3DOOA 3KVYA 2RJ3A 3O4JA 4I14A 4ID9A 2FUG1 3OFNA 5HFAA 5GM2A 3DZCA 1K8QA 4Y6QA 3ZEIA 1GCOA 2I0FA 4F5ZA 2X2OA 2VP5A 5B7PA 1KDVA 1MORA 4B84A 4ZK6A 1GEGA 2XTNA 3AR4A 2AH5A 3CUKA 4RELA 4QYIB 3GUYA 4JI3B 1FW8A 2DE0X 1FDIA 3JSXA 4M36A 1XCLA 4CMJA 1W48A 4MVJM 4WOCA 1SA0A 4N48A 4YJHB 3FYTA 3QXJA 4NS1A 5CYOA 3T0IA 3I0NA 2ZBDA 4JJIA 4S1VA 1Y4DE 3VO2A 5LVAA 3ROFA 1N6KA 1P3JA 1PV2A 1Y6ZA 4M3NA 5D1HA 2B1IA 4DV7B 4BCDA 1EJ6A 3WMEA 3C0KA 3KSZO 4US1R 4O2AB 1UMBB 5FCDA 1U7WA 1Y34E 2WTUA 5J4VA 3PGVA 2ZYAA 4XD7A 1TZCA 1Q0RA 3PQFA 4GLBA 4HDOB 2ZDHA 4EAQA 3QVWA 4ESEA 1XB2A 2R5NA 1GKUB 4NBTA 5K4AA 2V54A 1Z0AA 4IX1A 4HQLA 4OK3A 3ECCA 4MEAA 3FFAA 2B4RO 2DKNA 3UPUA 3L43A 2QZJA 1V6AA 3R7NA 1GPJA 1NPTO 2V4UA 4GP6A 2XGJA 1OSNA 5A02A 3B60A 4ND3A 4B83A 1G42A 3E58A 3LECA 4QUGA 4X95A 1IXSB 4XJTA 3RHTA 3ZXYA 4PG5A 3E9DA 4OX9B 3EVFA 3R3UA 1MAAA 3G8AA 1QO9A 2FWAA 2JGNA 5BV7A 3COPA 4R3WA 2HIGA 1I3MA 4BX9A 3VYVA 1YVUA 4N9WA 2RB4A 3CBGA 1M10A 4HADA 4AS1A 5KVVA 5EERA 1XHFA 3RRFA 4DPKA 4PINA 1W1IA 3FCAA 3OHMA 4L0CA 3UAXA 2VQFB 5HCIA 3VDQA 2CNWA 2C0QA 3AESA 4HGNA 3C6ZA 3WMXA 3PSHA 1COWA 3KB8A 4R84A 1DJMA 3AOEA 3AT1A 3FKSD 3GDHA 3HDQA 1G21E 4PONA 3B3AA 4RA6A 1PJLA 1GLNA 5BRJA 2GN0A 3BFXA 2O05A 3ETHA 3FUCA 2PYZA 4IVPA 4IXWA 1GUDA 2GEKA 2Y8EA 5D7BA 4C4TA 5MF6A 5CLQA 3EW7A 4ZKDA 5K51A 1BO6A 2XBLA 2X58A 1NRWA 3AFIA 1YXMA 3IE2A 1FFBA 1RRGA 2XTAA 1XTRA 4GC5A 3HXPA 4UEWA 4EG7A 3BXHA 3FCUB 5ICGA 4C07A 1CUEA 4LRXA 3Q7IA 3PGKA 1KQNA 1MX3A 2W8BA 2OENG 2I4LA 1E18A 1G5PA 4B43A 4LDRA 2FW9A 4KWTA 3UJ6A 5JAUA 3ODGA 4KOEC 3QEMA 2Y0PA 1M34E 1GFZA 1UODA 1ZDMA 2QD1A 2VFAA 1NHWA 1DEHA 1SO8A 3GFVA 1EDBA 5F2OA 5BSRA 4DJDC 3MTJA 3OX4A 4EG3A 3ED5A 3MOSA 1JAHA 3ZKAA 2E82A 2YXNA 4LOLA 2EP7A 2WJJA 5I47A 4CXMA 2J3JA 1WG8A 1YA8A 1RYBA 4RV5A 1DB3A 2CVPA 1FY2A 3HGTA 2C31A 3AILA 2C2ZA 3CMCO 2XT0A 3ZBPA 1O9BA 3B5EA 3DMPA 3PHGA 3K0CC 4MVYA 3BEOA 3UJ3X 4E21A 4C76A 5A6VA 2BUBA 3TLJA 3AKZA 4UHKA 3OLWA 1JF8A 1G8MA 1V7ZA 2POQX 3E84A 5BNTA 3F78A 1VFPA 3PIRA 2R86A 4GX2A 4NJMB 3V32A 2P2LA 3BTVA 2H2DA 2VRCD 3WB1A 1A5TA 3K32A 1NW5A 2J9RA 4G4GA 3WXBA 4DXHA 4F3YA 2AJDA 1EXMA 1K86A 3C14C 4HNUA 1FQOA 1E8DA 2C9ZA 4MUBA 1JZSA 2D1FA 3HRKA 2P65A 3L6DA 2IXAA 3SAJA 2CLFB 4LFBB 3ZHOA 3RVBA 3IAEA 1KIMA 1O94C 2JFHA 3AFNA 4ZVNA 2EZUA 1XUOA 3BSWA 1U2PA 1QZXA 2ZRIA 1U8ZA 4RCVA 4W8HA 2HSDA 3N74A 4NU6A 4TYMA 4GSKA 4W8GA 1DKOA 4NCBA 1Z29A 4HQNA 1F2TB 1K2WA 5SZKB 2REBA 3HYSA 3JZAA 5E9JA 2AVNA 4NL4H 4GU5A 4IF6A 4GE3A 5D87A 1CSEE 1GARA 1WW3A 2WIAA 5K3SA 3GHHA 3T06B 2QR5A 1C8VB 1NQXA 3BQNB 1AUQA 3AB3A 3IP3A 3ZLJA 1Z7YA 1A2BA 1I2CA 3K70D 1TJPB 3VR6H 2WA2A 2WG1A 5D2CA 4ZC1A 1ZD8A 2BONA 2PBRA 2ZG6A 4PNHA 4DNQA 5BMVA 5REQA 1FTSA 1ZX1A 1UPTA 3DFZA 1PX0A 2WF7A 1J7JA 2JFNA 3DDNA 4LC1A 1U1EA 1G8KA 3ABSB 4OGFA 4R5HA 4ZN6A 2ZUFA 2FFQA 1C9MA 4KQ6A 3I2HA 3PU6A 3DM5A 2GPYA 4YYEA 1F2VA 1QB7A 1VJRA 3G3EA 3FRHA 3P97A 3PNBA 4MS3B 4E94A 2EFHB 3QIAA 4C08A 1XEXA 3LFHA 4L16A 2YDYA 1GDTA 4R2XA 5HUQA 4WX2B 4BY9E 2A59A 3K8ZA 5ERGB 1ZM7A 3MUFA 4MQEB 4PG4A 1SC6A 1L7NA 1TFUA 2HRCA 3RAEC 1R27A 1XNJA 3SHVA 1ZRHA 2OZVA 1NVVR 3CTPA 4DMRA 1QIEA 2QW1A 3TRFA 1Z2NX 3CH5A 2F8SA 3O4HA 1VP3A 3ICVA 1B23P 2FF5A 4B09A 3HCAA 1M0TA 4XPZA 4UOEA 5J4HA 4QFDA 5EL0A 3MT9A 2XR1A 3TUJC 4EGCB 2MMGA 2BCGY 1D1PA 4DM3A 5ED0A 5BURA 1NBOA 2AXNA 5CA0F 3OEEA 1XQ6A 5JNSA 1NMSA 4TL6A 4KFCA 4BNUA 4BTEA 1FFEA 4GGMX 2X77A 4BO0A 1GZ7A 4QXQA 3OQOA 1G6HA 4FFNA 4ARVA 2VDPB 5IUKC 1X7YB 1Z2CA 2Q3BA 3L5OA 4ND1A 2R47A 4PC1A 2FG5A 2MSDB 4R0VA 1I4LD 2WE7A 4BFWA 2FOXA 4HXGA 3UAVA 4WN9B 3N0VA 4QSHA 3WLNA 3GMDA 3MRVA 2H8GA 4K0RA 1PJ8A 2WF8A 1G21B 4AG3A 1OYOA 4A0GA 4E30A 4C2TA 1U3WA 1TW3A 2AEMA 5H83A 1BX0A 4CR7A 1PSDA 2X9GA 3M6FA 4JK3A 2IBSA 3A3YA 5ETJA 4TRRA 2G1AA 3WOVA 2WU8A 3NANA 1MVOA 4FPXA 4OA5A 5EYPA 3T7EA 2CBZA 3U62A 1XTTA 1Z2EA 2K6GA 1T0UA 3HR7A 1ZIPA 3L79A 3OLZA 4LOJA 5K09A 2R8ZA 2P78A 2PGOA 3AB8A 2WFMA 2CT8A 4FI3F 3PDJA 5AM3A 2YS7A 4QZVA 2EKQA 4TS3A 2VI5A 1VIYA 3IMGA 3FA2A 3KQQA 2PPVA 9LDTA 2FFRA 3E3AA 4ZT4A 3WL4A 4E6EA 1GAEO 4IEEA 2WAAA 1M7HA 3A4MA 5LQJA 2NTYC 3ET4A 2DEUA 1PJRA 1K0UA 4OFZA 2OQVA 1N8KA 1QCDA 3KM0A 3MMNA 5ENDA 4FXPA 4MI9A 4YP9A 1B93A 5T4BA 5AJWA 2Y05A 2IC5A 1FSFA 2PMKA 4CKWB 5JYCA 5ISMA 2H5JA 2YWHA 4UCXA 2IEDA 2RHGB 3CLUC 2G08A 1M66A 2B5VA 3K72B 4XTRA 1M54A 2OOSA 4WESA 2XB4A 1QZZA 2EATA 3WMWA 4N4AA 3O3CA 3IXQA 1M2JA 2HA4A 4OQEA 5HZKA 3L1KA 2GETA 1D2GA 3UV3A 3VOTA 2A9QA 5A1JA 4MW4A 5T3YA 3K1YA 4TLDA 4HWTA 1OZ0A 3Q7RA 1MX9A 1FNCA 3RTGA 1G59A 5J5AA 5LB4A 1P6XA 3HVHA 1SHZA 2BFBA 4IXTA 1EWVA 1JQAA 1DC8A 1MIOB 1N2JA 2HPAA 2C99A 3AJ8A 3NT5A 2OBXA 3J7TA 2AR0A 1TIPA 5L4SA 3NUZA 4DLUA 3OX1A 3WB2A 1NFQA 2ZIXB 2ZBFA 3F74A 5LKAA 3RNLA 1YL6A 3T0FA 1FLDA 1M33A 2I3ZA 4M1YA 3AHDA 5D6OA 3TOXA 1FW6A 3VNVA 3N75A 3S99A 4PZAA 3AP1A 3A14A 2F3PA 1NY5A 1X7XB 3FBGA 2YW9A 3GVCA 4LKOA 3O9VA 2ZW9A 4JYBA 1L8LA 5JS8A 1CY0A 2WJWA 3FPEA 1H66A 4ZOLA 3ASVA 3C4JA 3T8YA 3EVGA 4JIGA 2I7DA 1NSTA 3M6MD 4EW2A 4AL4A 1BMFA 3IUBA 3AHIA 5HQTA 2IYFA 3TZHA 2GXSA 4XR4A 3V97A 4X44A 1Q50A 1Z8DA 2WYUA 1SQFA 4HCJA 4DC9A 1H65A 4JITA 4P3PA 1FX0A 3B1XA 3FNRA 4Q4HB 2F55A 4KXXA 4DDKA 1X42A 4HMOA 1I4EB 1IXKA 1HYQA 2HRQA 2XITA 3CRVA 3MWJA 5HE8A 4M9RA 3B3FA 1VPWA 4KXQA 2XCIA 3I9FA 4FFLA 4RDCA 4HWSA 3E03A 2NGRA 2D06A 5HM6A 4DY6A 3QUCA 3VR4D 4IJ6A 1LBTA 1E2DA 2XADA 3IH5A 3Q3GE 2GZMA 2ODNA 1UPBA 4YR7A 2OHGA 2PKRA 1MNAA 4PQRA 2VOEA 3FPKA 4X1YA 2BM8A 5CR9A 4JLSA 4IMRA 4EKNB 1RQXA 1RQLA 5L3ZA 2HREA 1E3IA 2J9ZB 4P54A 4KRXA 1EK5A 2QVCA 4N3GA 1VE3A 1SHLA 1CUVA 1X19A 1MRZA 4ZAWA 3WL6A 4A5SA 2Q0QA 2YRWA 5BPHA 5CFOA 4LISA 1A97A 2H5EA 1JJFA 4P6VF 2VJAA 1DE0A 2D0PB 4GLLA 2OYRA 3A37A 1QRSA 3WV4A 1IWBB 3IP6A 2WIGA 3JASB 2MSKA 5G1NA 1MAVA 1IQ0A 1JAZA 2J07A 2UUOA 3FCSB 3S8EA 1MX5A 1TK3A 2IKSA 2JJMA 3LXRA 5EJFA 1G66A 1LFAA 4RXMA 3S3TA 2XODA 4EOGA 4GL4A 2QTRA 4RKEA 4F91B 3KD3A 1MAWA 2ODEA 1CB0A 1IBMB 3VZDA 3L1IA 5HKBA 2R3SA 1Z4JA 3NKVA 1MXHA 2RGBA 2AWOA 4BWYA 4H4CA 1ETHA 3OG9A 5FUWA 4GOJA 3HMQA 4CLXA 4OHUA 3MG9A 1N2BA 3UGKA 2I7VA 5TARA 2RC5A 4X8LA 1ISGA 4Y2TA 3GJ8A 3ASUA 3MINA 1G8GA 2QVGA 4OP2A 3ZZUA 1KRXA 4YBRA 5ADVA 1L5MA 2WYIA 3ROZA 2GF0A 2QG9A 3ZV7A 4E5VA 1IBKB 3NIWA 2PM8A 1YHYA 3ZU4A 1OX5A 1AN0A 1Y1QA 2A84A 2ZR0A 5EUCA 5IC6A 3AO0B 3L01A 4RMJA 4CDNA 4US0R 2CBXA 4TKVB 4IHJF 3EPPA 1VE9A 5AKKA 3BRWD 4XWOA 3ANMA 1QE0A 2H3HA 4QYMA 1MHPA 3FWKA 5F78A 3REQA 4HEA6 4WKNA 4RQAA 2DUWA 2BCEA 1VMEA 3Q1LA 4HEA1 4W5TA 1TKRA 1TCCA 3KQPA 1BHSA 1HG0A 1VYUA 2OVFA 5J2UA 2QN3A 3HRHA 2GSWA 3QX8A 1GZUA 1T1GA 3DMDA 5H0IA 1G3QA 2GB4A 1HQYE 1LJLA 1W2WB 3QVGB 1GPH1 1C50A 1IHOA 2VC2B 4LHXA 1IUOA 4WH0A 3CEAA 4FD2A 2Q5IA 3K1AB 4RHYA 4KODA 2O8BA 1PW5A 3N8HA 5EMLA 4XOUA 2WINI 5AW1A 1XN4A 3N2LA 1SBYA 1J5XA 5E3HA 3QF4A 3VBEA 2HFKA 4GYWA 4IINA 1DFIA 4XAQA 3K4QA 2Q6OA 1FQKA 5IU6A 3FDIA 5DB4A 5B4UA 2W9XA 5EA2A 4EFDA 2XGMA 4RSMA 3AEKA 2BL4A 5KKAA 4M9QA 3W9YA 2J9YB 4LDPA 3VOBA 3TW0A 3PQ8A 4D9KA 5CNKA 1PZHA 3HBMA 3BK2A 4LBWA 3IMCA 4Q3LA 1ZJWA 3VC2A 4QBIA 3WWPA 5CB6A 1SCDA 1NXXA 1QGZA 2AGVA 3MJCA 2F8TA 3KUDA 2VP4A 4XW2A 2AOWA 1XJCA 2HNAA 3KPUA 2QPAA 2GS9A 3D7SA 3EW9A 2C77A 3H4TA 2CK3D 1EGAA 2SCUA 3HJGA 2BH2A 4BRSA 1Z0IA 4XUEA 3LT5A 4I1UA 3C87A 3FKSA 4EUFA 4UDOA 1WZNA 4PYIA 3QP9A 4HF7A 4I5DA 4IX9A 5GY7A 4H08A 3U9SA 2RHMA 3NGMA 4YR9A 1X1CA 2EWVA 3PUVA 1YDHA 1TU4A 2LCIA 3QUQA 1Q19A 1FFCA 2ZANA 1P7CA 2H4XA 2W98A 3K0FA 5IZ4A 4UMEA 1JKFA 1GQ2A 2ABWA 4D02A 3EVCA 4F85A 5CD9A 1DWUA 2Z3WA 3GCXA 2B0JA 4ID3A 5BQFA 4EW6A 5KQLA 3KAJA 1MQAA 1MDBA 4WPGA 4ARCA 1MH9A 1G18A 4TWIA 2XCRB 2ZTVA 1Z0UA 2R8XA 5JAHA 1J97A 4IGEA 4YRSA 4DR5B 1XTBA 4HWGA 4J49A 2F8MA 4K03A 4C06A 1RIFA 4ZI7A 3U81A 3ZJ4A 3WSVA 2G80A 2ZULA 4D92A 1AJEA 1B00A 5I7WA 1CBUA 1DO0A 5A0TA 4CM9A 1W5FA 1LTHR 4G56A 3VNBA 5FUBA 3STYA 1AN9A 1MO3A 4ZALA 1T0HB 3OURA 4E70A 1G55A 3K6SA 1AXGA 3H19A 1E2IA 4ENTA 1YB4A 3UJNA 1E2NA 3BE8A 3TW4A 3U3RA 1F0PA 5AW6A 3GBPA 2I2FA 2NUBA 2GTHA 2F2TA 1BH2A 3PQ2A 3DP9A 2P79A 2OTCA 3STHA 2P1ZA 5C4IA 1YO6A 2G04A 1KQPA 3FCEA 1WQ4A 2D5AA 1NF2A 4JXJA 1CIPA 3T9FA 4TPKA 4JT9A 2QUKA 4XYLA 1JG4A 2XMPA 4AX4A 1SEPA 2V1UA 2E87A 4KXLA 3ZZ0A 3TJMA 4EY6A 2IYSA 3ISJA 1TJ5A 4DMLA 3RYCB 2JCBA 2QD4A 4LFAB 1JI0A 2NZWA 3FGOA 3R0JA 4GZMA 1S6YA 2OXEA 5AVQA 1VG1A 1QQ6A 2J0VA 1HC7A 3FHJA 4XRRA 1DAEA 1PD1A 3LZDA 3T5TA 2NUAA 2XZTA 1M5UA 1PAUA 1O5OA 2BZSA 2O8NA 3PR2B 4XH9B 2AOUB 1ZUHA 4J4HA 4BO4A 5ENZA 5SZJA 2X3YA 4J0KA 4LHSA 3GLGB 2X6TA 4WZBE 1V96A 3KTDA 4WXPA 4JI4B 3VZPA 5BWNA 4C0LA 3T3NA 3BWBA 1YVPA 2OCGA 3NYRA 4Q16A 2R96A 2XRMA 4HNVA 1JJVA 5HPYB 3HA7A 3K31A 1IVNA 3L4EA 4UQPA 1FFXA 4OI4A 4MXDA 4A2PA 1EJBA 3HDVA 1A7UA 3BWEA 3C3CA 5CLLA 4P92A 4XFDA 3M6WA 3G49A 2KS6A 2GNOA 4K8RB 3NXSA 3CCFA 4LYYA 1EVJA 1I6MA 3CURA 1WCV1 2ZSJA 3K2IA 3L7KA 1YS2X 4H7DA 4BXOB 4UHHA 5FUYA 5DHRA 3RKRA 1I7PA 3IGFA 3USES 1F6DA 4G09A 2X7JA 3C7DB 1D6JA 5TQJA 5LL6P 1QHNA 2HNKA 4MAAA 3TLEA 4KAXA 4WTOA 2Q1WA 2BGRA 1TCVA 5TPWA 2G7MC 4NECA 2BFPA 2O3TA 3LQQA 3HK2A 3I9NA 2PLWA 4OK6A 1VCMA 2BBTA 5DYNA 2X3UA 1HZJA 4OXKA 2DFTA 4U9UA 5K9ZA 4P83A 1E5TA 4UVHA 5FI5A 1E0SA 1RHQA 1XLTA 1G60A 2QVXX 3C5VA 1V71A 4G85A 4Q15A 2XKBA 4IQ4A 2EOAA 3HKEA 2FPIA 2YV3A 4GQAA 5GOTA 5KJFA 2QX7A 4URVR 1N2HA 1T4MA 1YS7A 2ZUCA 3HJUA 4PHGA 1BN7A 1S8AA 4OMUA 1QDUA 4NBKA 3E4DA 5DSTA 1U3UA 1Y8ZA 2HF2A 2B78A 2ZIZA 1OTHA 1H8HA 2DWPA 2B4YA 3GVHA 4GX1A 4F2WA 1YF3A 4HNRA 2AJBA 5DI3A 3HCEA 4Q12A 1B0ZA 4LRTB 2VDJA 4QUEA 4JLVA 4O0LA 1BG6A 4Q6WA 1K6JA 3DVRX 3MOGA 3UFBA 2QXTA 3B1ZA 1PT6A 1Q91A 2FPGA 2GJ8A 4W9NA 2MDTA 2DHQA 3FOCA 4N3NA 3TM4A 5I51A 1XTUA 3WYGA 3JQFA 4KUEA 3U7QB 3AOGA 3ZV3A 1Z5PA 1QG0A 3AVWA 4UVEA 5JXHA 4RD0A 1IAVA 4CLOA 4R8RA 3T41A 1QPZA 1XCPA 2YVUA 2R6ZA 1F2UA 1DAIA 3LFUA 1KYIA 5FWDA 3RYHA 1KEZA 4WFKA 3N07A 4V0SA 3RUFA 1XMJA 1E4YA 2BKXA 8LDHA 3WLLA 2FE4A 4G1MB 4HGRA 4MUKA 4IMIB 4MVJG 4NZ9A 1NVFA 1MB0A 3VSDA 1NN1A 3IRUA 4JLUA 8ABPA 1CT9A 2VJMB 4Z2YA