3IC5A

N-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
b'NAMRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRMGVATKQVDAKDEAGLAKALGGFDAVISAAPFFLTPIIAKAAKAAGAHYFDLTEDVAATNAVRALVEDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative saccharopine dehydrogenase
publication title X-ray crystal structure of N-terminal domain of putative saccharopine dehydrogenase from Ruegeria pomeroyi.
rcsb
source organism Ruegeria pomeroyi
molecule tags Structural genomics, unknown function
total genus 40
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ic5A00
1GAEO 1JVBA 5JBIA 2QX7A 3PVZA 2G5CA 4IGEA 4M54A 1UDCA 1Q7GA 4UVGA 2VUSA 2EWMA 4XWYA 3HN7A 3JD1A 3V1UA 2PZLA 1C1XA 2X6TA 3TDKA 1XHLA 2HK8A 3D4PA 5TNXA 3TL2A 4ZGWA 2FP4A 1JWBB 3QWBA 1J49A 3JD2A 5EPOA 4UUNA 5JO0A 1BTOA 3BMOA 1U4SA 4D0RA 5C3MA 1Y9AA 4K28A 5MDHA 3RROA 3GZ4A 3TQHA 4BVAA 1D4FA 2VOJA 3PXXA 5AXDA 3MJCA 3NT2A 4QECA 4FC7A 4A10A 1T4BA 2HMWA 3PHIA 4XR4A 3LC7O 4DBZA 3UFXA 3KB6A 3GRKA 1DC5A 1Y81A 2NTNA 3PYXA 1LX6A 3MWDB 4ZU3A 2A92A 4NU5A 1JW9B 3JQ8B 3INTA 1WZEA 1Z45A 4PGFA 3F1KA 4YACA 1LU9A 2G0TA 1M66A 3QVSA 4AJ1A 2QQ5A 1X7HA 4J2OA 4PLWA 4UEKA 5DDIP 3E5RA 4UVDA 1NQ5A 2J3KA 3RKRA 2O3RA 1EVJA 3K2EA 4IZIA 4EBFA 4XIYA 2NVWA 1NPDA 4YJHA 2R00A 3RUEA 3DQPA 3ROMA 4FIZA 1XWFA 5JLAA 4NR0A 1IUKA 3HQ4O 4Q3DA 1LLUA 3EDMA 4MP6A 2WMDA 3BTOA 3PRJA 1GYPA 3RKUA 3V2HA 4AJ4A 1E0DA 1T1RA 1WWKA 4QUKA 1ZK4A 4AJNA 1ENYA 2OZPA 1JAYA 3WFJA 1DIGA 3DBHA 1U4OA 1AXEA 3FNFA 3ZWWA 3E9NA 3OHSX 4R41A 3F4BA 1GYQA 1E7WA 1KS9A 3DAPA 3WYBA 4J0FA 4XQEA 2GDZA 4YTEA 5A1TA 5ITWA 2QRJA 1T2FA 4TSKA 2P5UA 1RM3A 4CL8A 4DTIA 3RFVA 4ND1A 2BFPA 2ZTVA 3JQBC 1YGYA 1Z74A 3KETA 3NDRA 4TZKA 2NQTA 1NHWA 2IXAA 4ALJA 1ZK3A 1UAGA 2ZB8A 4N5NA 3RBVA 4YCAA 4ZICA 2VRBA 3PYMA 3H8VA 4RF4A 4OOEA 1A27A 4YAKA 5BNFA 4BGIA 1GUYA 1ZKMA 3HZZA 3L6EA 4MIYA 4CM9D 1WMAA 1HE5A 4J1QA 3ICPA 4BO7A 4DPLA 1WZIA 1V3TA 1G0OA 4PLHA 1XGKA 1U7HA 3FI9A 3R6DA 4BNHA 5IFLA 3AUUA 4PLPA 1ORRA 3R3SA 3BMNB 1LUAA 1K2WA 1GDHA 2VWGA 1SCUA 5IDWA 4XDZA 4FN4A 1IULA 3RFXA 3Q11A 4WLEA 4IMRA 4J6FA 2WYVA 4KTVE 1Q0QA 2P9GA 5B1YA 1BW9A 3UCXA 1SEPA 4Z6KA 5C5IA 3VZPA 2Y67A 3F4LA 4BO4A 3PGJA 1GCUA 4Y8VA 1NTOA 3NTRA 4JROA 5AYVA 3WYEA 2NU8A 1ISGA 2HMVA 3PJDA 1A7KA 2ZATA 4A73A 2DBZA 3EY4A 4BIIA 1P0FA 1UXJA 3AM5A 3ITKA 4PLCA 1IOLA 5EJ2A 2NVUB 4A0SA 2O3SA 4BO3A 4TQGA 2RHCA 2CY0A 2JCXA 3NX4A 1YONA 1KYQA 1C1DB 4YB8A 3WMXA 3I9MA 4NK4A 2O7QA 3GGPA 3OEWA 3JD3A 1PJCA 5A9SB 2Q2WA 2D4AA 1N92A 4I5EA 2O48X 3CMMA 3GDFA 2Q4BA 2BKAA 2V6BA 2Y68A 1UXKA 3R3JA 4OKNA 3HJAA 4IDCA 5KVVA 2XAAA 4J3FA 3CEAA 1YDEA 5B4TA 1PGJA 3NJ4A 1NAHA 3TL3A 3DBRB 3L6OO 4MO2A 4CMCA 2B4QA 4E31A 5KNLA 5I7VA 4ALKA 4OXNA 4FOSA 1NQOA 3H5RA 2B69A 5I7EA 4AJEA 2EKPA 3EAGA 2AE1A 2Y1CA 1X7GA 3IKTA 1JA9A 2VZ0A 3ZV5A 4RO0A 1ADGA 3C85A 4FGWA 5DT9A 4A03A 5IG2A 3HNPA 1S6YA 3QY9A 5TS3A 2D59A 4NH4A 3ZWVA 1CRWG 2VNAA 3OIGA 1PQUA 1NHGA 5T67A 4YAIA 3P7MA 4U6QA 1OBFO 3DC2A 1M6WA 2AXQA 4CMHA 4BKPA 3H9UA 3W4KA 4NBTA 2HK7A 5JCJD 1TB4A 4JBIA 1T2CA 3I3OA 1QR6A 5AQ1A 1SB8A 1GL3A 2GF2A 2X9NA 5FEUA 5ICSA 2CVZA 4DYDA 4BNGA 4TRNA 3UUWA 3PHJA 4NJMA 4HKTA 4P22A 2DM6A 2HLPA 4UAGA 3IJRA 4IDBA 5EERA 1ADCA 2OBYA 1PEDA 5DZSA 2AEMA 4D42A 5K9ZA 1E5LA 5DN9A 3KBOA 3O4RA 3HDJA 3ZU3A 3KEOA 3MJVA 3FNHA 1I32A 3ADOA 3VPFA 3QQPA 2Q45A 1PGPA 2YY7A 2YHIA 3U5TA 3VZRA 1VM6A 4FFLA 3WG9A 4BHTA 1XA0A 4KOAA 1NP3A 1R6DA 2ZKLA 5FI3A 1V6AA 2RCYA 3FWNA 4W9NA 4TWRA 1XU9A 3H9GA 3K8ZA 2NVUA 1CETA 4NJOA 1LDBA 1PTJA 1EDZA 5G4KB 1E1NA 2NSDA 3AFNA 5G0WA 2Y0EA 1JAXA 3ZV3A 3H3FA 3H9QA 4IMPA 3K5PA 3OQ1A 3JYQA 4WEOA 2VOEA 1ZEMA 3HDQA 3LLSA 3K96A 4I08A 4PVCA 1J6UA 1RYDA 2EIHA 4XR9A 4CLHA 1B14A 3ZWOA 4RJTA 2HJSA 4LVUA 3ZWAA 4O0LA 5A9SA 1O8CA 3DZHA 2P9EA 4JJGA 4GWGA 4TMFA 3VPSA 4FS3A 1A5ZA 1V8BA 2IZ0A 3G0OA 2BMAA 4GSLA 3OICA 1DAPA 3FR7A 4RPHA 3DZFA 2DPHA 4CLXA 3ASVA 3DL2A 4Y98A 1CJCA 4WLUA 1MX3A 1ZXBA 1LTHR 3A1NA 9LDTA 4R68A 4BV9A 1HTBA 3GOHA 1R12A 8ADHA 4CMJA 2AQKA 4CM1A 5JMWA 3EMKA 1GZ3A 3LU1A 4BNFA 1CIVA 4E0BA 4UEJA 1KEWA 1ZH8A 4R1UA 3G3EA 2SCUA 2W8ZA 3DMTC 2DBVO 3ABIA 1RKXA 1T1SA 4LCEA 1VC2A 3BYZA 5DBFA 5KJ1A 3Q9NA 2W2LD 4AJKA 4D46A 1DC6A 3LF2A 1PJTA 3IL2A 2EW8A 3OA0A 2V6MA 2X22A 1U1IA 3H2ZA 4MPDA 2WTBA 4L4RA 4L74A 1XIVA 3PPIA 4G5HA 4J0EA 3LLVA 1DIBA 1B0AA 1H0KA 1I2BA 4S1VA 1GFSA 1TA4A 3HDYA 3G17A 4DC0A 3AI2A 1XU7A 2EP7A 4IBOA 2Z95A 3FNGA 3JYOA 4W6ZA 3RUFA 2JCVA 3C7AA 3JQ9C 4B4OA 3HWRA 2TMGA 4ALMA 1PGQA 3T4XA 4IJUA 5L95A 3BHMA 1E3JA 1R16A 2AMFA 1BHSA 3WNQA 4E12A 4ND5A 1U3WA 5CDUA 1DPGA 4XYEA 1YBMA 2O2YA 5I8ZA 4Z0HO 3VPXA 4CMKA 1UH5A 2VHZA 3TWOA 5K0ZA 2GN9A 1SBYA 4P4LA 3OM9A 2AE2A 3RAJA 1K6IA 3U4IA 1KVQA 2VHXA 5IN5A 1I10A 3ZN2A 1NR7A 4BQPA 3ROPA 3RC9A 5JNLA 3HB4X 4RCVA 4GKVA 3PWZA 4CUZA 3L9WA 4XA8A 5G4KA 8LDHA 1IZ9A 4YAJA 2GZ2A 1S7CA 4AJIA 3ZU2A 5KVSA 3GC6A 4DREA 3KTDA 3BMQA 1ISJA 1O6ZA 3NDJA 1X0VA 3V2GA 1Y8RA 2GR9A 3OH8A 2UAGA 1LXCA 2HMTA 1E6UA 2E49A 4XD2A 5FWNA 3PP8A 4IINA 4E6PA 3ROQA 3IP3A 1WNTA 2J3JA 3GG9A 2PKQO 3L4BC 4BS9A 5F1KA 1E7SA 3CXRA 2X9GA 1GQYA 5A05A 3GGGA 3FPCA 4QO8A 5IF3A 1YQXA 1AN9A 1QXSA 1DRWA 3KVOA 3QP9A 4JN6B 3S2GA 1EBFA 3PHGA 1M76A 1XCBA 3QWHA 1C14A 2BI7A 4ID9A 1HLPA 4NNJA 1DSSG 2QRLA 1HETA 5HBRA 1PR9A 4E5PA 4DA9A 1PL6A 1U8FO 2QIOA 4JK3A 5L7TA 2C5EA 1EQUA 3NEPX 2HQ1A 2GO1A 4YDRA 3JQDA 4WGGA 3HSKA 3L4BA 3S8MA 4O59O 5T57A 1YJ8A 3E48A 3RFTA 4HWKA 2H9IA 2PD3A 3ZV4A 3F5QA 4WKGA 2Q1TA 2BFAA 4PG4A 3GN1A 3U4DA 4CM7A 4LMPA 2ZJ1A 3KRTA 4RDHA 2BF7A 1EUZA 2H6EA 5ILGA 4CLEA 2HDHA 2JJYA 3E9MA 1UJMA 4XB1A 3WLFA 3DZIA 2DFDA 3GZNB 2PA3A 4R3NA 4GMFA 4CM9A 4BV8A 2GSDA 4CM8B 1DJQA 1YQDA 4GH5A 5KVCA 4HBGA 2CZCA 3AW9A 3JD4A 1PZEA 1LSOA 2VQ3A 4TRMA 2X0JA 3ITDA 1DC3A 1IY8A 4M49A 1XELA 3TSCA 3E1KA 3GVHA 4RF5A 1Y6JA 4MIEA 4RQUA 2I3AA 4KP7A 4CMEC 4D3DA 1DXYA 4J91A 1BXGA 3K73O 3MTJA 4DLLA 3RC2A 3VVCA 3LZ6A 5DF1A 4MKXA 2AEFA 2D5CA 3A06A 1ENPA 3LT2A 3GNSA 3ST7A 4YT2A 5L45A 1VKNA 3WTBA 1IB6A 4YR9A 3O03A 4J4TA 3N74A 3A14A 1B7GO 4J4BA 3LQFA 1OI7A 3H2SA 5FI5A 3GEDA 1FK8A 2DLDA 4GX5A 1EE2A 2LDXA 4CMEA 1A9YA 2O7SA 2O50A 1VE9A 3HDHA 2JHFA 4J1TA 3B1KA 2TMDA 2J3HA 1E7MA 2VYVA 4NBRA 3VH3A 3BMCB 3PWKA 5DCWA 2GLXA 2CUKA 3NAQA 2GN4A 4OHUA 1GEEA 1PQWA 1ARZA 4BKUA 1QP8A 4R1SA 4HV4A 2VYNA 2NQ8A 1F17A 1YXMA 3QJ5A 4R4JA 3EC7A 1I24A 1I5RA 1G6KA 1KEUA 4JIGA 3WGYA 3LSYA 1EFLA 3TFOA 3B6ZA 1OMOA 5HA5A 3UHAA 4A26A 3FN4A 1CDOA 1GV0A 2HU2A 2B35A 3N7UA 1MXFA 1PJQA 1NWHA 1KY4A 2GASA 4F3YA 1ZW1A 1LEHA 4OJNA 4YJDA 4G81A 4PLZA 2CVQA 1GCOA 2Q46A 4WLOA 4BNJA 1U5CA 1K6JA 4YRDA 5DBIA 4B7XA 2VN8A 2Z5LA 4W82A 3RUIA 1MGOA 1YQGA 4LISA 4M86A 3FTNA 3UAGA 3WNVA 4R1TA 3H4VA 4R9SA 3ASUA 4N54A 4DIFA 1Q0HA 1LSJA 3PQDA 2X0NA 4DL9A 4E30A 1H6CA 2NVBA 1LI4A 1VI2A 5TX7A 3MTGA 3GZNA 2VHYA 3COSA 1RM5A 3LF1A 5THKA 1PJLA 2X5JO 4RVUA 1HSZA 3R1IA 2YV1A 3U3XA 3X2EA 3M6IA 2C82A 2CNBA 5AXAA 4GI2A 3VAZA 3PWSA 5EIOA 4YT8A 1ZZEA 3PJFA 3WGGA 3MJSA 4OYRA 3PK0A 3GNQA 1X1EA 4CV3A 1D3AA 4W7HA 3GNTA 1IPEA 2BGKA 3I9KA 3EUWA 3I23A 3U0BA 2VTEA 4CLOB 2UYYA 3NT5A 5A5EA 2GN8A 1GZ6A 2VNSA 4Q3CA 3SLKA 3C7DB 2X5KO 4FCCA 2PD6A 3TZQA 4GVLA 1E7YA 5L4LA 3S55A 1VPDA 4PG7A 5T8KA 4BNXA 3FHLA 1P1HA 2B36A 3U49A 1NPTO 2BGMA 4L9RA 5B4UA 1VRWA 3QSGA 2ZTUA 3GH3A 3I6QA 3TOXA 1XSEA 4UUPA 1B26A 3DONA 1H6DA 2PH3A 4EUHA 1GQQA 4LSMA 2Y66A 2P68A 3DBLA 1VL6A 3C1OA 4A7PA 1W6UA 5HS6A 2RH4A 4OAQA 2Y99A 3Q1LA 1IE3A 2HMUA 4ROSA 4PRLA 4PLYA 4CQMB 1X13A 4EZBA 1GD1O 5A3VA 3WGHA 4E2YA 3A4VA 1GU7A 2CD9A 2O3TA 2B83A 2WJPA 3CZRA 4TROA 3FPLA 3GLQA 4FFMA 2B4RO 4Y67A 4BNUA 5F5NA 3SC4A 1ZEJA 3EGOA 3DMYA 5KOIA 4Y9DA 4LRTB 4ND3A 4OH1A 4MVJM 1DC4A 3WYCA 3WSVA 3VHRA 3S2EA 1HWYA 4MVJA 4R01A 3ONFA 1B16A 1HE2A 2JFGA 1ID1A 3KEQA 5JSFA 4XJSA 4CM5A 2VT3A 3WQQA 2R00C 4IGFA 3ADPA 3WTCA 1UAYA 4M87A 2PKQP 2W2KB 2FRDA 4E5KA 5HWSA 1P77A 2W2LA 3ZWXA 1VJ1A 2XXBA 4B7UA 5A06A 4XKJA 2JAHA 5DBGA 2WSBA 1F06A 3AJRA 1MB4A 1X14A 2JKVA 4UVIA 4GBJA 1LBEA 4E3ZA 1PGNA 3P2OA 1T24A 1N1EA 5CEFA 4PZEA 2VTDA 4DQXA 2FPPA 2UVDA 3AY7A 3DR3A 4H16A 1GR0A 2QZZA 1XDWA 4GWKA 4I9NA 3OIFA 4UVHA 2DQ4A 2DC1A 3CUKA 4XGNA 1W0CA 3AI1A 4DQUA 2PY6A 4TRJA 2V7PA 1XKQA 4FGSA 3K92A 3H9JA 3NUGA 3QVXA 3OJLA 1Y8QA 3RUAA 1P1FA 2GRAA 3RUCA 4CQLB 1B3RA 2RH8A 4K26A 5HM8A 1DDOA 4WJZA 3QA9A 3Q0EA 2IXBA 1TT5A 1HE3A 4S3MA 5ITVA 1C0LA 1GUFA 4HY3A 2PWZA 1PL8A 5TC4A 1DLJA 4DWVA 2A35A 4B3HA 4EGFA 3DOCA 3OJ0A 4PZDA 4C4OA 3U09A 4CV1A 2IYOA 2QRKA 3AWDA 3EZLA 3PQEA 3I52A 3L6DA 4B4UA 2QYSA 4K6FA 4YXFA 4BUCA 3KXDA 5FYDA 1O95A 4GGPA 4HFJA 3GQVA 4R54A 4RPJA 4B4WA 3AK4A 1J5PA 5HTOA 5FFFA 1P3DA 4XCVA 1U2GA 3TNLA 4DIOA 4FPXA 1GY8A 4CQMA 1LSSA 3BTVA 3G1TA 1SEVA 2CMDA 2GD1O 2CSUA 4KZPA 3WGZA 4R16A 4R1NA 5A03A 2I99A 5KVQA 4MDHA 5TRTA 3ZNOA 4QO7A 1KVTA 4ESOA 1SNYA 5DOZA 5ENDA 1CWUA 1SPXA 4QXMA 2IDZA 5JY6A 2OP1A 3VDRA 1A4UA 2DFVA 2UDPA 1H5QA 1JTVA 2BELA 4PLFA 5ER9A 4GQAA 1T4DA 3RWBA 3SBOA 4GVXA 2E82A 4M55A 2GPTA 4Z9YA 5TT0A 4DRYA 2A4KA 2CFCA 2DPGA 4IJWA 3KOUA 4ND2A 4BNIA 5CDTA 1I3NA 2NTVA 4DVJA 2W2KA 1C0PA 2PZMA 3V5NA 1HE4A 4BMNA 4YRBA 4J49A 2I3GA 3F47A 3ZI0A 4EJ0A 5A5FA 2OO5A 1DHTA 3DHNA 4R51A 4UEOA 3JQ8A 4WNIA 4E5NA 2FZEA 5BQFA 4CMAA 3GFBA 4W7IA 4IUYA 4XJTA 1HZZA 3WMWA 1FDTA 4QFCA 4J16A 1A71A 4J43A 1QG6A 3AM4A 4MVJP 4LN1A 3UW3A 2C5AA 1HDCA 1F12A 4P8RA 1HXHA 5F21A 4CM4B 1BXKA 4E5MA 2BHLA 4N7RA 3STHA 3TZ6A 1U3UA 3V8BA 4ZN6A 3Q3CA 5COBA 2UV8A 1WVGA 4E33A 1QYXA 1Z7BA 2FPGA 4Z9XA 5LCXA 1ULSA 1PZHA 1FDWA 5EINA 5ADHA 4UVEA 2X0RA 1NWCA 3AOEC 3H6KA 3RJ5A 4E5YA 2WWRA 2DBQA 2ZJ0A 2D0IA 4RLHA 4KDFA 3TRIA 2FMUA 1LC0A 1K3TA 1XYGA 1VSUA 4QQRA 4E4YA 4XYBA 1I36A 4UUOA 3KZVA 5L40A 4EUEA 1GQ2A 4HFRA 4NBWA 3ANNA 3FRJA 1H93A 2B4TO 2J5KA 1H2BA 1Z7EA 2CF6A 2O3QA 3AUAA 3KYCB 2F1KA 3O26A 3ONDA 4RV9A 1B8UA 3WGTA 1PWZA 4WLFA 2ZQYA 4E2ZA 1E77A 2P9CA 2EEZA 3WGOA 4JJIA 1KBZA 1HDOA 2AQHA 3CINA 4Z3DA 4WECA 4BB6A 3ORFA 3AOEA 3WIDA 5LDHA 1I33A 1A4IA 1E6WA 1GPJA 5JCXA 4J7CA 1P45A 2Q99A 1YOVB 4F6CA 2NADA 6ADHA 2ZQZA 1TLTA 2IEDA 4WK6A 5CAEA 4ZVVA 5JO9A 1Z82A 3FR8A 4BNVA 3OF2A 1ZXLA 4IIUA 1KC3A 3U4CA 6LDHA 2DT5A 1LDMA 4JJFA 3A28A 4NK5A 4JXKA 2I9PA 3DHYA 3BMNA 4E32A 3TZHA 3JQ7B 1Y5MA 2Y0CA 4W9NC 4FOOA 4DQVA 2W98A 5IZ4A 4J1NA 2DUUA 2V65A 5EL0A 3QWIA 1O9BA 4RGBA 2Q1WA 5KTKA 2Y93A 3JV7A 1LJ8A 4FB5A 3W8EA 1JU9A 3L77A 4RL6A 4CR7A 2AHRA 3JYPA 1WLYA 1AE1A 5HRUA 4FFRA 2YYYA 2OMEA 4ZA2A 5KJEA 2JD0A 4MVJH 4AJHA 1B8VA 2O4UX 5CDSA 2ZIZA 3NJ8A 2VRCA 4Y6RA 4GSKA 1JLLA 4YT5A 3PLRA 3ENKA 5A9RA 2HUNA 1B3BA 1WMBA 4OGWA 3H65A 3AM3A 4OSPA 4RPLA 4Y6PA 3WICA 2JD2A 1I0ZA 1ZK0A 4CM4A 2WD8A 5F1PA 1U8XX 3MOIA 4DYVA 2CVOA 3WOHA 1M67A 3B1JA 7MDHA 2X5OA 1C1DA 2D5AA 2Y1OA 4CLRB 4RVGA 3F46A 2YUTA 1R0KA 1V3UA 3PLNA 4II2A 3I9NA 2VWHA 4O63O 1PJ3A 5TIIA 4B3IA 1K89A 5T64A 1EVZA 4BO8A 1NFFA 3VH1A 1GEGA 3JQAD 4PLTA 2BRUA 1I2ZA 2HRZA 2BH9A 3ON5A 5L51A 5COQA 2O4CA 1E3SA 5TJ9A 1EE9A 3GHYA 4MVJF 1AUPA 3CPSA 2E37A 2ZK7A 3DBRA 3ZU4A 1QRRA 2PGDA 4WNCA 4DXHA 2BFOA 3KYCA 2BLLA 1LDGA 1SO8A 1PJ2A 3U4HA 1PJ4A 2PZJA 2PK3A 3PHHA 5KKAA 3PJEA 1I3MA 1NFQA 3FWZA 1ISMA 4GMGA 3RJ9A 3M1LA 3UH1A 3AU8A 4LRSB 1ZIDA 2DTEA 4EEXA 1IHYA 4EDFA 5BR7A 1OC4A 1XR3A 1MA0A 1YOVA 1ZVMA 3GG2A 1IPFA 5THQA 5IXSA 2VUUA 5L4SA 2YQ5A 4H3VA 4XEHA 3C1TA 4M8SA 4FBGA 4B3JA 4YYZA 4Q9NA 2X86A 1GZ4A 1FMCA 5JS6A 4ZD6A 1GUZA 4F6LA 3QHAA 3UN1A 1NX6A 1RM0A 3QV1A 2ZTLA 5DOVA 3DFZA 4AL4A 1I3LA 4CM3A 4D43A 3DBVO 4Q3EA 3GN2A 4CR6A 1RM4A 3PFWO 1QORA 3HN2A 1YB1A 4OMUA 3JQ7A 2IYPA 1I3KA 2X0IA 2YW9A 4QSMA 3ZV6A 4KWIA 1BGVA 1H9BA 2HCTA 3PGXA 4XX0A 3I83A 3NT4A 1UP7A 3E8XA 4I5FA 1H2HA 3KM0A 4GX0A 4WCFB 5CEJA 2PD4A 4YVFA 1DIRA 5TGDA 1JKIA 3PFFA 2HRBA 1FJHA 4AFNA 3H5AA 4XRRA 3SJUA 1PU2A 3GK3A 2FSVA 3AUTA 2G76A 1DJNA 4RVFA 2FY8A 5I9MA 4D3SA 1QYDA 4YWJA 3CKYA 1N5DA 1PQPA 2O3JA 4FR5A 4RDIA 1TVEA 3ZHXA 4IY1A 1ZK2A 4IS2A 2OOSA 3D3EA 1LDYA 3L4SO 4RF3A 5L4NA 2ZYDA 3BA1A 2G82A 2G17A 4JLWA 3VPGA 4XYGA 3T7CA 1H6BA 4BNNA 3TF5A 3RVDA 3IAHA 2R6JA 2BGLA 3G1UA 1DFHA 1BSVA 3NKLA 3ZWNA 4CUJA 5JDIC 2X7HA 1IL0A 3IKVA 1H9AA 1OZAA 3DOJA 4F46A 4MINA 1R0SA 1ZJZA 4FSHA 4YA6A 5KJ6A 1EBUA 4GPD1 5HS4A 5ES3A 3K2BA 4N5LA 4D79A 3WR5A 4E13A 3ZW9A 2D2IA 3KSZO 4U7WA 5BSEA 2EKLA 3MZ0A 3ROKA 4BO9A 1P31A 1XQ6A 2C59A 3NDIA 3VVBA 3KYDB 3ICCA 3GAFA 2YHUA 3OJFA 3MJEA 1B8PA 4NFYA 1K0UA 1NVTA 2DKNA 4Z0TA 1EDOA 1N9GB 5JDIA 1SB9A 1PS9A 4TVOA 3RCBA 3D64A 1PJSA 2UUOA 5IDYA 3NGXA 3OFSA 5CPBA 5CPFA 1Q7CA 3TN7A 1KC1A 4BO5A 2X9VA 4XYLA 1G0NA 3ZCXA 3I6IA 4XQ9A 1EK6A 3UCFA 2RHRA 3HFSA 3BHIA 1HEUA 4RVDA 1R15A 1VKOA 3PEFA 3RU9A 4PFJA 3VOSA 1L1FA 3ONEA 1Z73A 2J5RA 1E3IA 3WQSB 4DUPA 3RU7A 3SXPA 3O38A 3EHEA 5GZ3A 3ZWCA 5JFOA 1KVSA 4YEDA 1ISFA 1E3WB 2GERA 3QVOA 1W4ZA 3GVCA 2X4GA 1LQUA 2C2YA 3QWFA 4WCFA 1P33A 3BZUA 1R66A 4RZHA 3KLPX 5AVOA 2D8AA 3JD0A 3KSDO 4W4TA 5AXBA 3JQGB 4C7KA 5TQVA 5T5QA 2LDBA 1VJTA 2H1SA 4H7PA 3WFIA 1UZLA 2VZ9A 2FR0A 4MKRA 4N18A 5A02A 2ZB3A 4TKLA 3VZSA 4R9RA 3OSUA 4BMVA 2DBRA 4CODB 3NTOA 5EN4A 1HL3A 3WB9A 1KETA 5C7OO 4NBUA 3UGKA 2J6IA 1ZBQA 2FN7A 1M2WA 3FF4A 3KHUA 4FDAA 1IHXA 2GN6A 1KEPA 1VSVA 1UZMA 4OOFA 1V9LA 3O8QB 2QHXA 2IODA 2FR8A 4XB2A 4LGVA 5JXWA 1BMDA 5LC1A 4YJGB 2WYWA 1DFIA 3QIVA 4ND4A 2CDCA 1W8DA 5DP2A 5KJFA 1NM5A 2J3IA 4I5DA 2YV2A 5I9NA 4BMSA 3GF4A 4MIOA 3TFQA 4BO0A 2W90A 3MOGA 3UVEA 4YBZA 2X58A 3K6JA 3QVWA 5G2OA 1NFRA 3LC1O 3LT4A 4IDDA 4JBHA 3ZNNA 3JQAB 3KYDA 3C3XA 3OETA 1UXHA 4E2XA 4E2WA 4R69A 1GTMA 1ZO8A 2Y1GA 1N9GA 1Q2XA 2EJVA 2VT2A 3DAGA 3FCOA 3K9QO 3PQFA 1KEVA 3P19A 5DCYA 1LLQA 2WDZA 2GUGA 4CMIB 3HFGA 2Z1NA 1KVUA 3WDSA 2YV3A 3NYWA 1ONOA 4IM7A 4OIMA 2D3TA 5EQDA 3WIEA 3RBXA 1JQBA 4TKMA 4D45A 4JNKA 2PZKA 3I9LA 3LK7A 3JTMA 4EI2A 2I65A 3MEQA 1MFPA 4YAEA 4J9UE 5CDGA 3T4EA 3BAZA 2GGSA 2XPCA 2P4QA 3D7LA 5JAZA 5LDGA 5A4DA 3VTFA 4KWHA 1WDKA 3Q9UA 3W6ZA 5U1PA 3BMOB 4CM8A 1E3WA 5JCJA 1UR5A 3G79A 4L8VA 1AHIA 5JC8A 1HKUA 1ZK1A 3D5QA 2EERA 1N7HA 1WDLA 4CLDA 1E3EA 4Q3NA 5BSHA 2WD7B 5T8KC 1BWSA 1A7AA 1U28A 4DMLA 4JX8A 3JQGA 4PZCA 1BVRA 2X1HA 3RUDA 3PIDA 4CR8A 2YQ4A 4RF2A 5I7FA 2OXIA 1DEHA 3N58A 1VJ0A 1X0XA 4OL9A 2PH5A 3GUCA 5BSFA 3DZGA 1QLHA 3U9LA 3DFUA 4O6VA 3OJOA 1D1SA 1LLDA 5L7WA 2AQIA 3WLEA 3AFMA 3O9ZA 4GGOA 2IEBA 4PLVA 1PZFA 1HDXA 3H5NA 4K6CA 4F45A 4CL3A 4NBVA 4J9VA 2B5VA 4BNZA 4RLSA 4RPKA 1U9JA 4BKOA 1LRKA 1PL7A 4CUKA 2C2XA 2R2GA 3TJRA 4U6SA 1FF9A 2CF5A 3OQBA 1FDVA 4Q3BA 2GYYA 4B4VA 2PFGA 3E03A 5B12A 1ISIA 3HUDA 5IZCA 1ADFA 3ZGYA 4R5MA 4O1MA 3M1AA 4TZTA 5EESA 5G4LA 4BNTA 1O89A 3BMCA 3HHPA 3HADA 3KLMX 4IQGA 4Q39A 1EUCA 3QW2A 2GNAA 2OORA 4HFMA 2EF1A 4D7AA 1YDWA 3JQAA 4NHEA 4XYMA 5CG2A 5I9LA 3JQFC 3DBHB 1UP4A 3CTMA 4IDEA 3GMSA 5EQFA 5CHEA 4LK3A 4JQCA 5C37A 4OM8A 4RVHA 1WXDA 3E6AA 3L0DA 2BD0A 1P0CA 1ZMTA 3P5SA 4MKZA 4CV0A 4CMIA 2AG8A 3IUPA 4JP2A 1UXGA 3BTSA 2PLAA 1QSGA 4ZJUA 4CM6A 1ZSVA 4YAGA 3OIDA 1LNQA 4NFHA 3HE3A 4PG6A 4UREA 4XQCA 1QYVA 3WBFA 1DBVO 1QYCA 1AXGA 3GGOA 1HF3A 3ZW8A 3TPCA 5JDCC 3WBBA 4ZQBA 3JQFA 2E48A 4JGBA 2X23A 4HFNA 4D0SA 3C7CB 4IQ0A 5CEEA 1DLIA 1DOHA 3MJTA 3GRPA 1RPNA 4XIJA 2DAPA 3D0OA 3UKOA 2QW8A 1UZNA 3RIHA 4Q3AA 4LMRA 1ZSNA 4BKRA 1WPQA 2EP5A 4ALIA 2P2SA 3F3SA 4KUHA 1XG5A 4WASA 1LRJA 1ZCJA 2EHDA 2WD7A 1W73A 3AU9A 4B7CA 3GPIA 1ML3A 1YBVA 1FDSA 2Y05A 3EVNA 1P9LA 2OGUA 2JL1A 1BVUA 4LSWA 3RD5A 1P1JA 1YRLA 5JYDA 1EUDA 3B70A 4IS3A 1BW9B 1Q0LA 5G0VA 4ALLA 5JDCA 1U2DA 3GHHA 4CLOA 2FZWA 3F6YA 1D1TA 4X54A 4ZQEA 5L3ZA 3K31A 5DNAA 1P1IA 3DZJA 4Z9FA 2ZTMA 3I4CA 3GPDG 4L4SA 1NYTA 3BXXA 2UUPA 2W4QA 3OEYA 1Q1NA 4GLLA 1OFGA 4B79A 3W8FA 3WSWA 1EVYA 5IXYA 1NR1A 3DWFA 2P91A 2EKQA 2H63A 3WWZA 1BDBA 2E4AA 3VDQA 1RYEA 2CDAA 3QVTA 1LDNA 3LT0A 5JPIA 2NWQA 2V6GA 2B5WA 4U5QA 3OMLA 1ZUD1 1YE3A 2F00A 4AVYA 2ILTA 2AEJA 4DLBA 3BIOA 3TZKA 2EG9A 1C0IA 1Z6ZA 4AICA 1I2CA 1JWAB 3OBBA 4EEZA 4L75A 4W99A 5CG1A 3WWYA 1A9ZA 1PJBA 2NUAA 2Y1DA 3RUHA 1SC6A 2IE0A 3U62A 4BNMA 4BOYA 1ZNQO 4KQWA 1OC2A 3QLJA 2P4HX 2RAFA 4YT4A 1MUUA 2DVMA 3S1LA 1U7TA 3PJGA 1TXGA 1NQTA 4G65A 4WE3A 3GDOA 1MLDA 2E6UX 3VPHA 1U5AA 1X7DA 4QEDA 4NDNE 5IDQA 1NQAO 1EZ4A 2NU9A 4ZQGA 4ZQHA 1G1AA 3DZKA 1YL5A 2WEKA 4J90A 1L7DA 1KERA 4URFA 4ZRNA 5A04A 3UICA 2I6TA 1QYWA 4JBGA 3ZDFA 3G49A 3B20A 5BNIA 4A27A 3JQBA 3I1JA 1NPYA 2J5QA 4NIMA 4NJMB 1Y9EA 3NGLA 3ANMA 3DOOA 1F8FA 1VL0A 3IS3A 1T26A 1TI7A 1D7OA 2ZB4A 4OXYA 3IDSA 2WE8A 5G0UA 4A5OA 4MP8A 1FXSA 1SOWA 1DO8A 3PDUA 4L4XA 5JC1A 3RQSA 1LC3A 2VWQA 2BFMA 1C3VA 2NV6A 1T2DA 4IDAA 2YHIB 3HB5X 2EV9A 4WEQA 1I30A 4OQZA 1SOVA 2POQX 4QTZA 4CQLA 2FPIA 3I4FA 4FQ8A 3DDNA 3PHLA 4QT0A 2PV7A 2Q50A 3ZHZA 4Y6SA 2WYUA 1YB5A 1NASA 4PLGA 2EXXA 1QLJA 3WXBA 3VC7A 2D1YA 3IC5A 2WE7A 1NNUA 5IAAA 4DPMA 3PTZA 3ETGA 4NMHA 3KO8A 2QG4A 4AJPA 2C07A 5MGBA 3ZU5A 4N5MA 5IDXA 4CV2A 4DIBA 3RC1A 2CDBA 2VYVD 4IXWA 1UUFA 4MOWA 5JAIA 4WCDA 1Q7BA 3F9IA 4J2HA 5U4QA 4DMMA 2HMSA 1NBOA 5AOVA 1E92A 3V2UA 1P44A 1YS4A 4EJMA 1HDRA 4IJVA 2VYND 3SX2A 3IMFA 2PKRA 4ALNA 5KKCA 5COAA 3UCEA 2EW2A 1T2AA 5KWEA 1MC4A 4TRRA 3ZWYA 1PIWA 3UOGA 2OHXA 1ONPA 3SVTA 3SEFA 3NTQA 3OECA 4PG5A 1DIAA 3C1AA 2Q2VA 2X8LA 2QZ9A 4IQ8A 2NM0A 1HYHA 2BI8A 5B4VA 1GYRA 4EYEA 3T7EA 1E1KA 2JCYA 1EEHA 3K30A 3Q6IA 1CEQA 4HX5A 4XQGA 1BXZA 3C8MA 4IDFA 4J7XA 1E7RA 4PRKA 1O5IA 4HUJA 5ICMA 2HJRA 3JQEA 5KCZA 4DLAA 3WX0A 2B37A 1EFKA 2Q49A 4FFPA 2OL4A 2IZ1A 3LT1A 4P4GA 4BQRA 3LVFO 1AGNA 4MVJI 4FJ2A 3QRWA 3M2PA 1P1KA 4EUFA 1LRLA 1LSUA 3MWEB 1PGOA 4LCJA 2ZYAA 3AUSA 3MJ4A 3PZBA 2C29D 4I8XA 2A94A 2OBNA 1MFZA 4RPGA 1UXIA 2Y1FA 4O5OA 4XZ3A 1ZFNA 2ZCVA 5G0SA 3AY3A 1P74A 2NU6A 3DXFA 4ONEA 5L9AA 3HG7A 2YFHA 2GCGA 3ENNA 1QV7A 1IYZA 2HK9A 3D4NA 4D44A 4WUVA 5JAMA 4GX2A 2IZZA 1YO6A 4FJ0A 2HAEA 4WOJA 5JW6A 1Y1PA 2AA3A 3FTPA 4NU6A 5IN4A 3QE3A 1CQJA 2PGLA 3FSRA 2I67A 1WAMA 1XLTA 1LDEA 1OAAA 2IRWA 5H82A 5C7IO 3Q2IA 1UP6A 2ZB7A 4I9HA 1KIFA 1SZJG 2O3UA 3BTUA 3FNEA 3ZZNA 3INGA 1K5HA 1NVGA 3NRCA 3BMQB 2I76A 4ZQFA 4BGEA 5L53A 4INAA 4EITA 2VHVA 2ET6A 1Y8RB 2JD1A 2HO5A 2NTJA 3ZWBA 3D4OA 4BO1A 5C7LO 3S2FA 1HRDA 2O2SA 1ZJYA 5KIAA 3GFGA 3TZCA 2AQ8A 3RI3A 1YH3A 5A9TA 5GMOA 5TLSA 3ETDA 4ITUA 1VL8A 2DTDA 4RVSA 4A2CA 1MXHA 4IPTA 4E21A 1CQIA 1T2EA 1DRUA 4I5GA 5T6BA 1DRVA 5H83A 1YKFA 2GZ1A 1YL7A 3W4IA 4MVJD 4XGKA 5J23A 4KQXA 1LQTA 1ENZA 3WGIA 3E9QA 4R3WA 3NV9A 1DAOA 2FOIA 3A9WA 4KDEA 2O23A 3WQRA 4PCVA 5GZ1A 1Y5RA 3DO5A 4KMSA 9LDBA 1GADO 2HSDA 4HNGA 4I9UA 3WS7A 4B8ZA 4J4HA 2JHGA 4MJLA 1YB4A 1E1LA 1RJWA 1GV1A 2B0JA 2P5YA 3RSHA 3IQDB 1LLCA 5JMPA 2OFPA 4I1IA 2DU8A 2NACA 2PNFA 2JFHA 3D1LA 3RC7A 4BO6A 5JE8A 1YBAA 4YJFB 1KOLA 3SLGA 4NPCA 3FD8A 4DBVO 1SAYA 2FR1A 5G0TA 1R4MB 1M6HA 1Y7TA 1JDJA 2I5PO 1E7QA 3H9EO 2C7VA 4RZIA 1MG0A 3GY0A 1X1TA 3DMTA 5CDYA 3PYLA 1GPDG 4MVJE 3WGQA 4DPKA 3OP4A 3IJPA 3ANLA 4RQTA 3VZQA 1KY5A 4CPDA 2YDYA 3GMDA 1N1GA 5L7YA 1WW8A 4BNLA 3GUYA 4CLRA 3PIIA 4BNWA 3H3JA 3UXYA 5AXCA 3EZYA 4Z3KA 3W4JA 4QFDA 1BXGB 3JYLA 3GA0A 3RBZA 4WOKA 1N2SA 3I5MA 3KUXA 4OSOA 3V1TC 2DTXA 3ZHBA 4IJKA 2ZCUA 4IDGA 3M2TA 2JFFA 3JQ9A 3GEGA 3IIEA 1OOEA 2PGJA 3EVTA 4NFSA 3VKVA 3VH4A 2JAPA 2RBEA 1KVRA 1ULUA 3CSDA 3ZH2A 5K6AC 2H5LA 3PDJA 1I01A 3JQ6A 3EW7A 1NAIA 3KSUA 3CIFA 2YDXA 4UUMA 1YJQA 1E3LA 4P38A 1H94A 4UULA 4L76A 1QMGA 5JAQA 1F8GA 2NU7A 2YJZA 4EW6A 1XQ1A 2GZ3A 3UF0A 1EMDA 1R4NB 2XF8A 1HLDA 2Q4EA 4XGIA 4WLNA 4CQMD 3I9JA 1PZGA 1TT7A 4U0JA 3DAFA 3QWAA 4WCFC 3ZNQA 4ZHSA 1C0KA 3RASA 1J4AA 1CYDA 1LA2A 1DIHA 1O94A 1P1RA 4JCOA 3W6UA 3DTYA 1CERA 4HXYA 2XXJA 5K6AA 1EQ2A 3DZBA 3ULKA 4AJLA 4NZ9A 3JSAA 5TF4A 1V35A 4GAEA 5BSGA 5U9CA 1TEHA 2Q2QA 4KUGA 3JCZA 5TT1A 1WDMA 2VCYA 3I9OA 5ILOA 2FHSA 3INRA 1SMKA 2V6FA 1ZMOA 1U3VA 5FF9A 4AJOA 3VH2A 3D3WB 4G2NA 2ZYGA 1PWXA 5F1OA 1UDAA 4L0QA 2Q1UA 3OJEA 4PG8A 3E5MA 4HNHA 1K6XA 1QKIA 2J8ZA 3GEMA 4BGVA 4FW8A 1DFGA 2C20A 3GR6A 3AOGA 4II3A 5TSDA 4B8WA 4GKBA 4PIVA 4YJFA 4C7JA 3FBTA 3WJAA 3SJ7A 1R4MA 3TOZA 2Z1MA 5I8WA 3ZNPA 1NVMB 3L9XA 2YZ7A 5ENVA 5GZ6A 2Y0DA 1BRMA 2YFQA 2QYTA 2C54A 3CZMA 1I8TA 4YQYA 1R0LA 1HYEA 4BNKA 2PR2A 5A3JA 4ILKA 5IJZA 1HYGA 3CE6A 1A72A 2RIRA 1BDMA 3DB2A 1VLLA 2OUIA 1MG5A 5JY1A 1L7EA 3VKUA 1E1MA 4KUEA 2HKIA 1J0XO 4HP8A 3CH6A 4NG5A 2Y1EA 4D3FA 3H7AA 3DEYX 2OP0A 4FD3A 4BGUA 2EGGA 3SC6A 3KV3O 4DGSA 1WP4A 3GDGA 3PI7A 1UDBA 4JP3A 1U3TA 4IIVA 4M1QA 4AG3A 4CMBA 1V0JA 2C7GA 3AI3A 4K1LA 5ER6A 4TVBA 1AHHA 1R37A 4GX1A 1M75A 1N7GA 3DTTA 3GVPA 4IZHA 4R5HA 4AJJA 5B37A 1CF2O 2VZ8A 5EMHA 7ADHA 1X15A 5F5LA 4OXKA 4BO2A 3Q2KA 4FFOA 4J7UA 4EJ6A 4J1SA 3GVIA 5I7SA 4MVJG 5DP1A 4CMGA 1YVEI 4OQYA 3ZWMA 1F0YA 5CP8A 1R4NA 3AY6A 1HT0A 2AG5A 1JKFA 2A9FA 4LVCA 4ZRMA 1JN0A 4H15A 3DBLB 5F3RA 1QV6A 1YWGO 3IUSA 1JVSA 3OA2A 4XRGA 1MC5A 1ONNA 4YRAA 2NNLD 4WLVA 4BB5A 3KYBA 3R0IA 1D8AA 1ENOA 1EVIA 5GY7A 3B1FA 1C1XB 3F5SA 3MCVA 4FJ1A 4PN3A 1ADBA 2PTGA 1RWBA 4K9DA 2EJWA 1XEAA 5DCUA 3GAZA 4OO3A 3WJ7A 3S2IA 4DC1A 3V1YA 3D3WA 1F14A 3CMCO 1DHRA 4HADA 4YPOA 4AJ2A 3IP1A 4P4NA 3JQCA 2DUWA 1Z75A 3EYWA 1IZ0A 3ZHYA 4WPGA 1B2LA 4XDYA 4U0KA 1E5QA 2WM3A 4NQZA 2VRCD 4QX6A 4NI5A 3X2FA 1PSDA 3W8DA 4BL5A 3DHEA 4L73A 5IZCC 5BT9A 2VWPA 4M89A 3PZRA 3ETEA 4Z0PA 1JKJA 3LYLA 5KJCA 3BHJA 3GT0A 4D41A 3FBGA 4BNYA 2NLOA 1EK5A 4RORA 2FWMX 1PX0A 1PS8A 5DULA 3ZWPA 4FFNA 4KTTE 3W1VA 1BG6A 4OKIA 2G1UA 3O8QA 4YJHB 4BKQA 1HDYA 4GLOA 1HDGO 3F1LA 4U8GA 2I66A 5H81A 4YJGA 4IXTA 1PS0A 1ISHA 1B15A 5CFZA 3JYNA 3LC2O 4PVDA 1E6EA 1Y8QB 2VHWA 1MP0A 2VUTA 3OQ6A 1N8KA 4LW8A 3D5TA 2C0CA 4FC6A 1FDUA 5JYEA 3LDHA 1TT5B 4MP3A 1ZSYA 3IOYA 1O0SA 2XOXA 1V3VA 5TJHA 2Q1SA 1YL6A 1MV8A 3C24A 1HDZA 1HSOA 3L07A 1NXQA 1PR3A 1DB3A 3GVXA 3E18A 3P2YA 2AW5A 5BNTA 1T25A 3EK2A 2EGHA 2FSSA 1HZJA 1H6AA 2Q3EA 4CJXA 3VTZA 4GL4A 4YQZA 3E82A
chains in the Genus database with same CATH superfamily
1GAEO 4YLEA 2R1VA 1J99A 5D3KA 2Q7XA 1CEEA 3JR7A 3H19A 4GECA 4IGEA 4M54A 2QVCA 5HIMA 2HF9A 3AERA 3GYBA 4KK4A 5DYGA 2O1SA 2EWMA 3EZ9A 4YMUA 2HUPA 3GBSA 3IUJA 3CVXA 1C1XA 4OFXA 1VXOA 3TDKA 1ES9A 1U2DC 4RJLA 1I3OA 1K88A 4ICIA 2FP4A 3FZEA 2R4QA 5SZHB 1J49A 1T3TA 2F1RA 2XYVA 3H2YA 4RA6A 4CCSA 4KE7A 2OK8A 1EA5A 2Z56A 1E2IA 1GSOA 3HFRA 4MUGA 1Y89A 5EXDA 3F6CA 3BXPA 2ZVQX 2C83A 1U4SA 5BOSA 1EG2A 1UBNA 5HE9A 4JI4B 1HO3A 4BVAA 1D4FA 2G9QA 3A27A 4GR4A 2ZJ4A 1I5OA 4EPRA 3PXXA 2IS2A 3GP5A 2YIJA 2YQZA 1CZRA 4TMZA 3G89A 4G24A 1X7YB 3BIWA 4QECA 5JJ5A 1NW9B 4PE5B 3ZDRA 2HMWA 3LC7O 3DGEC 2AR9A 2NTNA 4Y2SA 1TUEA 5FNVF 2VDWA 1GNQA 2BEVA 2XIJA 3EG5A 4AJ9A 2JH3A 2D1TA 3HYTA 3OI7A 4HATA 1WY5A 4OAPA 1EWTA 4BMOB 1ID8A 1TADA 1QHEA 3CNBA 3N5KA 4C0AC 2ZRMA 2C4MA 1P4SA 1P29A 5AW3A 2C3PA 1RMQA 3FPKA 1LU9A 1QCCA 2G0TA 5CLLA 4AJ1A 4DR5B 5C53B 1AUQA 1Y3DE 1VKZA 1YUNA 1K0FA 1E9AA 4LVNA 3NOVA 2PM8A 3EQ2A 5T4EA 3T3GA 4YYEA 3ACBA 4W5OA 1EVJA 4UHEA 4DCSA 3L8ZA 1PK9A 3FI0A 1DADA 2G71A 2IVZA 1ZI9A 2WIFA 3QOYA 3X3HA 2NTYC 1US8B 3DM5A 1O1YA 2VDOB 2NYRA 3O8OB 4QGBA 4R7TA 4X93A 4EO9A 4NR0A 4URHA 1NW6A 4C0KA 4MKHA 3M3DA 4Q3DA 5D6NA 1BEUB 4LE0A 5H3CA 1EK0A 3EFOA 1FDIA 1AKQA 1QGUB 3A05A 3PRJA 3DKPA 2OHJA 3M1IA 3RSOA 3V2HA 4X0EA 1T1RA 1UQRA 1Y4UA 2BOVA 3HGMA 1MF7A 5JS1A 1RXYA 4U7PB 4XPZA 2GPAA 2CVHA 3UK1A 3ZR4B 3QEMA 1IBLB 2JZCA 1PT7A 2C88A 3DAOA 4EA6A 1RXEA 3FNFA 1NUQA 1OVGA 3FHTA 4J7AA 3OPNA 4GMKA 3OHSX 4R41A 3HUTA 5IHXA 1E7WA 1KS9A 4KR3A 4XQEA 5LQNA 4YJ2A 2GDZA 5A1TA 3W5AA 3NWJA 1G59A 1J09A 2V7VA 1WSDA 1JA0A 1T2FA 4G4SP 4PFSA 1ZD2P 1EDEA 3IQHX 4R1QA 3TW6A 1RPZA 2ZTVA 3JQBC 1DG3A 3U3ZA 1EM6A 3EZNA 3GB9A 4TZKA 1G98A 3HLKA 5CK4A 3W9SA 2ACEA 2IXAA 2VXBA 3EJWA 4R3UC 1T3HA 4YCAA 3LKBA 2FRXA 3HWWA 4OOEA 3WIOA 1BMTA 3LPDA 1NNI1 1YFZA 2IA5A 3CG4A 3LKDA 4CFYA 1QUEA 4ZVNA 5BYKA 3VDNB 2P7IA 2HBYA 4DPLA 2I29A 1MJHA 2AN4A 5D87A 4ZK2A 3E7XA 3RHZA 1XGKA 5IFLA 4INOA 1K98A 2OV6A 1OJ7A 4IUCS 4O2AF 1KRXA 1DXOA 4PC2A 1WUKS 2G4VA 4HK4A 3R3SA 4GC5A 3BMNB 1LUAA 3TX6A 2XAUA 3QE0A 5CVEA 2CFRA 1GPYA 2HWYA 4MMYB 3U39A 3VBCA 4AD8A 3NOQA 5IDWA 4NE9A 3OF3A 1IULA 3E35A 4EYQA 3RFXA 3Q11A 5JBNA 4G56A 1M33A 4IMRA 1QX4A 1YBHA 3GMTA 3QHQA 4BP8A 2WYVA 3LXRA 1PVDA 4FVTA 4KTVE 5SZJA 4BATA 1Q0QA 1WM1A 1ZH4A 4E3WA 2P9GA 2AWNA 2YVAA 3MWDA 4QQ8A 5B1YA 3ZDAA 5AKZA 4B33A 4F60A 2WM9B 3IPAA 4KGVA 3UCXA 1YJ5A 5G40A 3I28A 2ZAMA 1XRPA 1S2GA 3H1FA 4HDRA 5HCNA 3ZVLA 3OQPA 2Y67A 5LLTA 4WZBA 3ZDZB 4U1RA 3PGJA 2QN6A 4UQPA 3UA3A 4EZEA 1NTOA 2H29A 4JROA 1WKCA 4HDKB 5CM9C 2SICE 1ISGA 2WKSA 4EVSA 2F9MA 2GAFA 1A7KA 2ZATA 1T36A 1YTUA 4NJEB 1E3TA 2A67A 2XUAA 3L93A 3GLFA 3HRHA 3O0DA 1E1CB 5EFOA 2EZTA 4Y30A 3WLKX 2MMGA 4C0JA 4UEQA 3C70A 1P0FA 2NZJA 3ITKA 4PLCA 5EJ2A 1IOLA 2P2YA 2OVFA 3PQ5A 4URXR 1NG1A 2HW8A 3NWEA 2Q29A 4D6XA 3AIOA 2RHCA 4I50F 2PVPA 3SG0A 3PQ7A 3ESYA 2ZBQA 4MW4A 1NYLA 3KR1A 3RJZA 4QWWA 5TMPA 4YB8A 3NVMB 3S4YA 3PC6A 4OMFG 1N6KA 1L5KA 4RY8A 1QH9A 1Z15A 3OEWA 4NNPA 1PJCA 1PR4A 3AHIA 5NULA 3DDCA 3NTLA 5JVDB 4I5EA 2PPVA 4MKFA 1XQWA 1XXHB 3AILA 2VNJA 3CMMA 5LLDA 2WWIA 1T3LA 1UXKA 3R3JA 3HJAA 1QCDA 4NOKA 2XAAA 1VLZA 1Z5ZA 1YDEA 1GVHA 3CEAA 3GFRA 5F2OA 3F67A 1F51E 2ILVA 2HI0A 1NAHA 2WV9A 1ZOPA 3B82A 3DBRB 5KNLA 2G5TA 3JY6A 4EG0A 4Q7QA 1G7TA 3UPTA 4ALKA 5CD1A 2XJ4A 3VSAA 3S28A 3WO1A 1IJFA 3KZ1E 1D2RA 4AJEA 2O8CB 3EAGA 4HGOA 1X7GA 5HW0A 2IS1A 2VZ0A 5EJGA 4ZOBA 2HR1A 1LPBB 1QS0B 4CEHA 4XOIA 3O3CA 1NVEA 3HNPA 5IG2A 3RADC 2YBEA 4R8LA 1KPGA 2VEDA 3RC3A 5CH8A 2D59A 1PFVA 3U3DA 4GP7A 5MFZA 3OIGA 1PQUA 3DCJA 1NHGA 1Y4SA 4JD5A 1OI4A 1CUJA 3HEAA 5AH0A 1GZVA 1KBQA 2JEOA 1FRFS 1MQSA 1CB0A 1XCPA 2H8GA 1F2UB 2XGOA 1NNLA 521PA 5LYJB 2PL3A 2HK7A 1A8QA 1F9EA 1U7PA 2I3ZA 1QR6A 3FGZA 1CQXA 2YWDA 2FWIA 3MUOA 4LJLA 2X9NA 4MEAA 5AESA 5FEUA 5ICSA 2XIQA 4BNGA 4DCNA 2SECE 2Y6VA 1TEXA 2B1QA 3IXQA 3D2BA 3GLHB 3SYTA 4ER5A 2QGZA 4UXHA 4P22A 4PCAA 3DL4A 3EDYA 3QKTA 3NCTA 2C7QA 2JIZD 2FPRA 1ZLXA 2WFAA 3ZCTA 4I1RA 1H3NA 5K8UA 3QFFA 5EIAA 4HDNB 4A92A 3FDZA 3KUCA 4JR0A 3LVBA 3H99A 4BC1A 2QAIA 4HS4A 4ARAA 5ESXA 5LR6A 5JNWA 1Z6AA 2ZWPA 5C8XA 1VHQA 1I32A 4JSYA 1AXRA 2Q45A 4HCJA 5BR1A 2PPLA 2YHIA 4WJKB 4YMHA 2P9JA 4X66B 3EUAA 1V1RB 2W58A 4NLLA 2HSZA 4KOAA 4X97A 3ZGNA 3TLEA 2OA0A 4DE5A 2ENWA 2ZYRA 3A1UA 3H9GA 5EIXA 4GYJA 4LOKA 3N75A 2NSDA 1H0RA 4LDZA 2OC9A 1JAXA 2Y0EA 3AKCA 3H3FA 3H9QA 5EXTA 4AROA 4S04A 2X1MA 1YIAA 2VOEA 4PVCA 4EUFA 3OF5A 5HP4A 1XQ9A 1UK8A 1V6SA 2AYZA 2J1LA 2XWBF 3ZDCA 4LOLA 4MB6A 5K8TA 3QUTA 1O8CA 8ABPA 3IKMB 2G1KA 2P7HA 1M1NA 3BL8A 4GDFA 3V8RA 1X8XA 4AX8A 4GWGA 1D0IA 1QHSA 4Q4DA 2Z0MA 4FS3A 3G85A 1A5ZA 1C30B 1V8BA 5KQSA 2ERCA 4GSLA 1ZD3A 2KBEA 2Z5VA 2KWIA 3H11A 4ACBA 1PVOA 4ND8A 3I30X 4Q47A 4RPHA 3T3MB 3MUNA 4C78A 1E9FA 1D07A 3HZHA 4Y98A 1CJCA 4UFOA 3KS9A 1MEOA 4YAFA 4BVLA 1LTHR 3A1NA 4WN9B 5AQEA 4R68A 2NO1A 4MR8B 3R20A 5J4YA 3LHDA 1O58A 1VIVA 2JFNA 5JMWA 3RSCA 1KQFA 2F8TA 1T0UA 4MV5A 5BP7A 3KZXA 3OO0A 1Y98A 3I62A 1T8WA 4TKUA 3IKLA 5I01A 5FUMA 4UEJA 3PX2A 1ZH8A 3M34A 1JDBB 2AEEA 2C61A 4KVGA 4GDMA 2ZYWX 3X1KA 4RPCA 4DNOA 1D0VA 1S2NA 4EFKA 2IBSA 5EVCA 3SICE 3P52A 3H17A 2WJWA 3K0CA 2CEKA 2W2LD 4D46A 3OEEA 3O8NA 5CA1F 2R8ZA 1TJYA 2AOWA 1XZ8A 2REOA 2W6QA 2JGEA 3HVUA 5DYNA 4F7DA 4MPDA 2IYYA 3W5IA 2B78A 3SBXA 1XIVA 2OCYC 2R7NA 2JLCA 4HTFB 1MAHA 1SVKA 2YHSA 1H0KA 5D86A 1I2BA 4WAUA 3PPWA 2QXYA 3TQFA 4BB0A 4OU4A 1F0PA 1N3YA 2CFOA 3G17A 3AF1A 1VXRA 2AXPA 4QJ5A 1W85A 1UWLA 2HY7A 3UC9A 1XCJA 4W6ZA 3GBVA 4YCDA 1IEXA 3FTQA 4TZ0A 5FL3A 3WRVA 5DHQA 4ZT4A 2BH2A 4HDCA 3QOXA 1QIJA 1WX1A 2XA1A 4O8ZA 4L5IA 2PJRA 3L6RA 2OMKA 1E3JA 1R16A 2AMFA 3SCZA 3T1NA 2OE2A 1Z22A 4E12A 5KS2A 4ND5A 5EUCA 3I2HA 4X1YA 2BTQB 4EYGA 3AP1A 4XYEA 1DE0A 1YBMA 4Z0HO 4MCIA 4BVGA 1SVLA 3VU9B 1QTRA 3R5FA 5A7HA 3TWOA 1TQ8A 5H68A 5EJ4A 3NPMA 3N8IA 1WEHA 4P4LA 3OM9A 1RHQA 2Q49A 2Y9MB 4KFRA 1B8OA 1B2RA 4DB2A 3SIRA 1XPOA 3Q7PA 2V7EA 1ZM9A 3K35A 5IN5A 1SWVA 3G0BA 3JATA 2H5EA 1U6JA 1UKYA 3NUQA 2OCXA 2VSXA 4RCVA 3WB2A 1GN9A 4CCYA 3AVXA 2XMCA 3L9WA 4XA8A 5G4KA 3DVQX 3FJYA 2RGUA 3O9VA 4Q1CA 2QPAA 3ZCVA 2IYZA 3GC6A 3OIWA 3D6FA 3N3BC 1P2GA 1TW3A 3DV9A 4J0JA 3EVDA 1XAHA 4FE4A 2PLFA 3LXMA 3NXSA 4LQLA 4OHMA 5EE0A 1Q7TA 1WQ1R 4R6WA 2PBRA 3ANTA 2ZUUA 5EAIA 1LXCA 3QENA 3WK6A 4IVQA 1L1RA 2R751 1UMCB 2Z5FA 1TPZA 3TCNA 1XVTA 2XB8A 1GWNA 1LBIA 2PSJA 3I0NA 3IP3A 2BFFA 3LO5A 4FLFA 4FBMA 4TLMB 2PKQO 2ZSBA 3I6BA 1XAJA 3M6LA 5F1KA 4EMTA 1V11A 3L0CA 3LI2A 4RHEA 3VU3A 4HQ0A 1RU3A 3OURA 2IU0A 4UMDA 2AX3A 5IF3A 4ZMRA 4Y0VA 4M7PA 4A6XA 5K6RA 3Q8XB 1HEIA 4J0HA 1CF4A 3QU9A 4DLRA 4NNJA 3TSYA 4DIEA 3DE7X 5B57C 2GCOA 2Z98A 4JNCA 1YHZA 3F90A 2QSZA 4G0UA 5DXAA 2NXNA 3E61A 1VDZA 1PL6A 1QH0A 1V8DA 3NHZA 3R6TA 2QIOA 1NOJA 3ZY3A 2FMKA 4MA0A 3JZDA 1PFUA 3L0OA 1PT8A 4QYIA 5ABPA 1D09A 4YDRA 4WGGA 3L4BA 4N0EA 4QASA 2WAMA 4UTZA 3MJFA 4HMQA 3SDBA 1J07A 1KAMA 3R0VA 2FEMA 4HXEB 1JEOA 4MQ5A 2ZRAA 2P40A 2PD3A 1GITA 3L7DA 3BREA 1JQLB 3D8SA 3QMPA 3HK2A 4NZPA 5J2UA 1TCAA 2VPQA 3SFZA 3KRTA 4RDHA 4O2BF 5SYAA 1JBKA 4EI8A 4XB1A 1YZQA 3WLFA 2DPYA 2R6GA 2PA3A 4OK6A 2EKBA 2ODWA 5EIBC 2TS1A 4NAHA 3QTLA 4LPKA 1ULBA 2AXNA 4RTMA 2ZQ5A 3T1YB 4HBGA 4OK5A 3MOSA 1VIDA 2CZCA 4M1KA 5EHGA 1PZEA 1LSOA 2VQ3A 2P4EA 1IWOA 3N39C 4LRUA 3CH5A 1DC3A 3PKJA 5J2TB 4AI6A 5E0OA 3R9KA 5D51S 1HMPA 1BN7A 4L0CA 4RXTA 2J3LA 4JJ6A 1II0A 1U7XA 1MO5A 2XCRB 4QOSA 1T2VA 2WR8A 1Q95A 1TQ4A 3ORHA 3IUNA 2I3AA 3LCJA 3ORQA 1ECGA 3QEJA 4D3DA 2UZ4A 1IN1A 1BXGA 4EDHA 2AF4C 3K73O 5ETJA 4OF4A 3VVCA 4C6SA 3AIKA 1OB2A 3QMVA 1U2QA 1KA9H 1JZQA 1J24A 2MT9A 3LNCA 4KG7A 4CG3A 2XDYA 3A06A 4KBGA 3UT5A 1U11A 2JLVA 1JEAA 3ZJ4A 4ZI7F 2WFLA 3C45A 1KH2A 4YRLA 3ZUPA 3OQIB 3WTBA 5BXQC 1IB6A 3CISA 4GBED 1IOZA 1M8PA 4N8DA 3I8SA 4UEWA 4CTKA 2FW0A 3C8ZA 4V1CI 4J4BA 3HPQA 2I4IA 1NU8A 1GA1A 3O5AA 4I1OA 3G9TA 2MR6A 5FI5A 3BILA 3NI2A 4YP9A 1S4QA 1XCLA 2NXWA 2X0DA 5JPDA 1EE2A 1NR5A 4GF5A 3TJMA 1FNDA 2Y4OA 1LQ2A 2VDVE 3HKDB 2H17A 4I8IA 2PGNA 4I1VA 4RXUA 5ALFA 3U1BA 1SBIA 3D8BA 2YXBA 3HDHA 3VU8A 2JHFA 4J1TA 5D84A 5TGTA 2FOXA 3P1JA 1NQXA 2J3HA 3L0ZA 4B44A 4DLTA 4EL5A 3QKIA 4NBRA 1V8PA 3BMCB 2XGJA 3QVJA 4LRYA 3NAQA 4PQEA 2GN4A 1Y6ZA 2OFFA 2H4FA 5DNVA 4BKUA 2CLKB 3U5ZB 3KVNA 1FFWA 3RT1A 2QGFA 5KI6A 4G0QA 1STOA 2NQ8A 4DAEA 1YXMA 1RXSA 2C4TA 5ARCA 1T0PA 2OCDA 1GXSA 2JW5A 1KEUA 1G6KA 4KN9S 3UV3A 5BMVB 3O1IC 4NONA 4B3XA 1Y80A 1D2EA 2LD4A 5HA5A 4A26A 4AT1A 1YZGA 4M1YA 3K1JA 4XCQA 1S1MA 1UBEA 3EH2A 2W7TA 3G8DA 3NYQA 4RV5A 4DLYA 5FUYA 4YRZA 1PJQA 3QELB 2J3MA 1NF9A 1E5XA 2GAIA 1FOEB 1LEHA 1ZW1A 2M2IA 1TTQB 4LJ6A 3A4LA 2CVQA 3FAZA 2Q46A 4OJNA 4PLZA 4DEVA 5JFGA 5CYFA 4RA9A 3V32A 1GG5A 2PUCA 5DBIA 1GZSA 2Z5LA 1RAIA 5LZ5A 1C8KA 3KPUA 1Y1RA 1V5IA 4LISA 3WNVA 3BSYA 3VR0A 2AC7A 1YZFA 3KXKA 3SHTA 3ZY2A 3W5HA 2XB6A 3TMKA 1TK3A 1KJ8A 1Q0HA 5KOJB 1V5GA 1H6CA 4EY5A 2CHFA 4RTKA 3CUWA 4O2LA 5K5EA 3HXPA 2V98A 4QYWA 2OZEA 2PUJA 3VYWA 1NDUA 1JXMA 2W0SA 1CC1S 1C9DB 3HJGA 2IW1A 3O92A 4NYMQ 5FBKA 1FSGA 3R1IA 3B6JA 2YV1A 3DE4X 3M6IA 2BYTA 2EQ5A 4UATA 2UVPB 5FJIA 2BSXA 5AXAA 1ODCA 2GBPA 5CVUA 5EIOA 5B6IA 5C18A 4JI0B 1OKKD 1XTBA 1ZGGA 3COYA 2EJUA 3GT7A 3PJFA 5CLJA 3DBOB 4N47A 3PK0A 2CD7A 1X1EA 5IVKA 1D3AA 2QQFA 4M7RA 3AF4A 2QTZA 1MX5A 3NYIA 3RYFA 1T6BY 4HTAA 4CTNA 2GLTA 5KTRA 2A5DA 2FWJA 2GXUA 2UYYA 1KY2A 5B3JC 2WDPA 2ZAOA 3NT5A 4AYXA 1BMFD 4NATA 1GA4A 1NVDA 2OBBA 5ANRB 4E70A 3TRFA 5E7MA 2YMLA 2ZS9A 1OFVA 2HPHA 4LJYA 3ZZUA 4GVLA 4B2LA 4EY3A 3FTDA 3VSCA 4Q05A 4PG7A 2HIMA 2FB9A 5E1DA 3I04A 1CUYA 1I0LA 2HWUA 2ZBFA 5AHOA 4QYSA 3UY4A 3ZTWA 1F4PA 4AUKA 4L9RA 1K3UB 4EB6B 4BWFB 3TNDA 2IOFA 4J94A 1YD7A 1CE8A 4ZAXA 4FZJA 3C6KA 4UPEA 4W5QA 2JGJA 1TU3A 3ZVKA 2XTJA 3KKEA 4MGHA 2P9BA 5M3BA 2Y2UA 2B3TA 2FMFA 5KYGA 1DKQA 1ZNZA 3SQXA 1HEYA 3UWPA 4DLPA 3CVUA 2EAUA 3QNWA 3DONA 3L82B 3KSBC 4IX9A 1WCYA 4DKJA 3Q7QA 4XD7A 2DQSA 4JU8A 1MORA 1C3EA 2DKFA 2EL9A 3C1OA 4YFVA 1L3IA 2FRDC 5BQ5A 1DNPA 2Y99A 3L05A 3ERCA 3H75A 4EOGA 4YUAA 1P9RA 1SHTX 3ONVA 4Y2HA 5AIAA 3W9YA 2H65A 2ZI5A 4LJ9A 1RLUA 5GGYA 1RAAA 1YCGA 2OG1A 1VPVA 2YYAA 3CA8A 4HDOB 4HUQA 4K1XA 4OLHA 4Q66C 3LFTA 2RCNA 2B83A 1YRYE 1ZA1A 3U9TA 4YAWA 3GLQA 2IXTA 5IX8A 5LOVB 1W36C 2WHYA 3NWOA 4YV2A 1F0NA 3ORRA 1LVHA 1N5MA 1PK8A 1U2PA 3SC4A 1Z18A 4M0EA 4FNMA 1REQB 3X1YA 4EBBA 4G6ZA 3VHRA 1ELOA 4QDZA 3HP4A 4MVJA 4R01A 4X1IB 4ZGGA 3VVLA 1JPNA 3NH6A 5KTPA 1PDVA 4IAOA 4WKPA 2VT3A 4UBKA 3EVBA 2CHEA 4G4JA 2JANA 5FBWB 4UDNA 4CI0B 3OZUA 1X38A 2PKQP 3DMRA 3W6OA 2GXSA 4E5KA 4DQDA 1R74A 4C01A 5J43A 1I3CA 1E0SA 2GMWA 1FEZA 2XA2A 4NV3A 3DOHA 3VHXA 5IYZA 4OP1A 1RVDA 2QTLA 2XYGA 3A10A 5EIEA 2CYAA 3MIZA 4OI4A 3A1WA 4D9BA 2NXJA 5B1HA 4KXYA 3H42B 2GHQA 4LTDA 2LP4Y 1T24A 3RV4A 3CNLA 4MI3A 3RK1A 4DQXA 2PUEA 3PCXA 1OAOC 3N70A 2HBRA 1BCSB 3DR3A 3L1KA 1NW5A 3T7IA 1U7DA 2BFEB 1DTWB 4MS3B 5DSXA 2AZMA 3OFVA 3X1WA 2AN9A 1P80A 2WJGA 2AC2A 4FX2A 4HG2A 3OU6A 2GFHA 4GWKA 4O4JF 3M3HA 1LKZA 1EFRA 2QP9X 3BE8A 5FAXA 5LP1A 2ZROA 1UCFA 2DQ4A 1JE0A 5JSZB 3CLKA 3VYSB 5JSHA 4HL6A 3WNCA 1Q6YA 5IWAB 3E0QA 4X95A 3D2AA 4TRJA 2HGSA 3K0SA 4FGSA 3ZXYA 4YRNA 3WVNA 3K4HA 3ZLVA 1Z28A 1YDGA 4AUMA 1W5AA 1P1FA 2XMGA 3KZNA 3U7QB 2V45A 4XIIA 2QT9A 3FLMA 4LKRA 5JCOC 4GLBA 1DDOA 4B43A 4WJZA 4HDQB 2DETA 1B93A 3BQMB 2VQDA 2QD5A 2PO7A 1MJGA 2DPMA 2WVHA 4HGRA 4JB3A 3WP0A 1C0LA 5ITVA 4TM8A 3PJRA 2PWZA 1QP0A 3AEQB 5HSGA 2J0SA 2VPWA 4LHEA 1DLJA 1ULHA 2D5IA 3M6WA 4GBGA 5J4VA 2C57A 3ZKAA 1L0BA 3VYTB 3EZLA 3LKZA 4H0NA 4KPUA 3RABA 1FFXA 1QZ3A 4FYPA 3ZS8A 4B4UA 1XMSA 1O94D 2E18A 2QYSA 1PNOA 3ACDA 3PDWA 4K6FA 3M6VA 4X63A 4F4IA 4R54A 1YS9A 2QAGA 3GQVA 4IDQA 2P4UA 4N3GA 3AK4A 3TQOA 1M7GA 3JVIA 4XCVA 3WRXC 5M34A 2ZSJA 2E2WA 1AKEA 4FPXA 4BRZA 3O9MA 5CIYA 3IT3A 1GY8A 4FYMA 4B6PA 1SEVA 2CMDA 3OQNA 16PKA 1KKMA 3N0RA 3H4IA 2CXTA 3HKEB 4BRUA 1U3FA 4DDWA 4EGCB 3RYIB 1H3FA 1QGAA 3EFEA 3QX7A 4I14A 5C52B 2XKKA 1SNYA 4KU4A 1GUDA 4QREA 1E1RA 5E6SA 3W90A 2E3JA 4QXMA 2IDZA 3B1XA 5JY6A 2VTBB 2OP1A 1A4UA 2UDPA 4MZXA 1H5QA 1XYYA 5JSQA 3BBLA 2MSNA 2BELA 5DNEA 5ER9A 1M3SA 3A4IA 1XMPA 1MC1A 3SBOA 2BL4A 3COZA 2E82A 3KD3A 3SBEA 4Z9YA 4DSTA 3FZGA 2ZI6A 4MWBA 1KZ9A 2A4KA 2O8VA 4ND2A 3W0LB 4B31A 2AZXA 4DWJA 3NYRA 5CDTA 4DF3A 2W2KA 1ESZA 4YRBA 2J9RA 2G9NA 4J49A 3CZ4A 1WZNA 3EIUA 1JIQA 5KYTA 4EJ0A 1FLAA 4YUZA 1WB4A 4BFZA 4U7DA 2OO5A 1DHTA 3AUFA 3DHNA 2ZM6B 1AS0A 4UEOA 4WNIA 1SHLA 1F2DA 4E5NA 5BQFA 2JLWA 4W7IA 4XJTA 1RQ2A 4BNDB 4D96A 2V0GA 1BVYF 4QFCA 1KYWA 1T5DX 3L7OA 1CNEA 1A71A 2NYVA 1JLLB 1MVLA 1GFZA 3NIDB 1WOMA 1WA5A 2HNKA 2HCRA 1JFFB 4LN1A 3PPXA 1KEEA 1X7XB 4RIGA 1FNBA 4ZU1X 4NRDA 1R0ZA 1SCAA 3EXIA 1HXHA 1KNXA 1VJ5A 4LBVA 5I51A 3RVOA 4B75A 2GBFA 5COBA 1OZFA 2WQ7A 4WBNB 4WZ6A 3ID6C 1IZZA 5B3AA 3W05A 3ZOZA 2ZBDA 1QYXA 4MGZR 3TIIA 2Z4TA 4JLPA 1ULSA 2M6RA 3GJTA 3ILSA 1P0IA 1OTXA 4ZP1A 1IQ0A 2AB0A 4ID3A 5EINA 4KR6A 1OJLA 2WV7A 3BGVA 1EM8B 4O4HA 2DSTA 1JSRA 4I4IA 2PSSA 3RJ5A 1VZ3A 2ZJ0A 1CQJB 3SD7A 4DRZA 1EAMA 2VR1A 3ECCA 2VTKA 1AO3A 1LC0A 1CQWA 4OB7A 2PZBA 4E4YA 5I4IA 1L5SA 4CETA 1FP2A 4UUOA 3KKMA 1PSWA 4WFKA 1Z4QA 1CJMA 2O0MA 4OHOA 3WO0A 1BQ3A 5BW8A 9ABPA 2J5KA 1H2BA 2BR3A 2GAJA 1Z7EA 2WIGA 1ZCAA 4TLLB 3HC7A 3OM0A 1UMBA 3WGTA 4OBEA 1PWZA 3LGSA 3LZDA 4S1WA 4NOMA 1V4BA 3UO8B 1C3OB 1E77A 1P18A 1RHJA 2HV9A 3IMGA 3M4NA 3P97A 1KBZA 5JQGB 2AQHA 4I4CA 1U0BB 1VA5A 4WECA 3K9GA 1YZTA 3AOEA 3ORFA 2B21A 2H52A 1P6QA 1T2NA 1V2GA 3PL1A 4PZ9A 5FBQB 1YOVB 4WXHA 4O1IA 4GPEA 3CSSA 4PM4A 1ZBDA 2Q27A 2ZRGA 1FRQA 4LYYA 2NADA 3OY2A 2ZQZA 3BWBA 3UG7A 6ADHA 1EGMB 3T3DA 4P92A 5CAEA 5MGNA 4NXMB 2R6ZA 5JO9A 1SURA 1Z82A 5DTJA 3FR8A 2F90A 1RI3A 3U4CA 4A9AA 2DT5A 1VOTA 2J9FA 3QK7A 1J2YA 1MJFA 1XK6A 5L6LB 4YV1A 4DZZA 2DJ5A 3B48A 1KP3A 4AU1A 4KIUA 2I9PA 5CX4A 4A8PA 3OZIA 3TZHA 2Y3IA 4PGAA 1UBOS 4JH0A 2Y0CA 3ZCSA 2JIOA 2DJIA 4FOOA 4DCTA 1E69A 5FOUA 2NPIA 5K99A 3A1TA 2LKCA 2WPNA 4J1NA 2V65A 5EJ6A 3QWIA 1C9EA 1MJNA 1P4RA 2PRIA 4M2LA 4U8HA 4ZAFA 2Q1WA 3TNYA 1Q16A 4RIFA 1JJIA 4WVFA 4FB5A 1JU9A 3GWZA 3RREA 4RD1A 2FFBA 3LHIA 1ULAA 2JLBA 3BF7A 4FNGA 4CR7A 1T5SA 4HAOA 1ODJA 3IAFA 4G5XA 3ZBPA 4LNUB 3JYPA 1NLMA 4K7JA 1AE1A 5HRUA 1M5TA 5T7BA 3KXIA 3AB3A 4FE7A 2NPFA 4ZA2A 4AJHA 1VKRA 3BWVA 4XM1A 3LFUA 3UOAB 2JJ1D 3LT5A 3PLRA 1ZN2A 2XMRA 1YB7A 2C2KA 3TPFA 2HUNA 1ORTA 2CCGA 1IAQA 2OK7A 5FH9A 2O52A 1BWQA 3Q87B 1JLHA 3NEAA 1GTZA 4LHSA 3AM3A 3Q7EA 3WICA 1ZK0A 5JALA 4E88A 1I7LA 4L15A 4MZDA 1U8XX 5BSMA 4IIFA 3JAWA 2H7XA 4M1MA 1O96A 3B1JA 4KIGA 5F3DA 3AEYA 2X40A 4XE5A 2X5OA 1NE7A 2Q5JA 2D5AA 2Y1OA 3RS8A 1BE8A 1XTKA 3G8CA 3NBFA 3MGCA 2XYRA 2JGNA 2YUTA 1EPUA 1TCVA 1KKUA 2REXB 3NQ41 3PLNA 4H6PA 4PYQA 4WZZA 3PD0A 5KAMA 3TGWA 2VWHA 2M6LA 3UWKA 4CHGA 4O63O 4L51A 2C5BA 2X19A 1R64A 5K3FB 1K89A 3EIQA 3PBKA 4JBYA 3TD6A 1EVZA 4RK4A 3TRHA 3EJ6A 1GEGA 1A9XB 5A5VA 4BVFA 5J4LA 3G23A 3OZEA 1SIWA 4GSYA 2HRZA 3BE4A 2PUBA 2E4WA 2YYSA 5KYKA 4YALA 4HGNA 1IOWA 5TJ9A 4ARVA 4ZJPA 3G0GA 5BN5A 2PGIA 3KV1A 5IW8A 1QRRA 4WNCA 1M2NA 2P0EA 2BFOA 3K3PA 3CQ9A 3WLHA 2C7OA 1SO8A 4KIWA 4KKVA 4OLJA 4ZYLA 3K4QA 1PJ4A 2WU8A 1G60A 4YQEA 3ZD8A 3LX6A 4LY9A 3DLAA 3PHHA 3C3KA 1PT5A 3SGLA 4V0RA 3KCQA 3AG5A 1WXEA 4Q93A 2QTNA 2GCPA 3FWZA 1ISMA 3V46A 1ABBA 4BECA 3SNKA 3DP9A 4TWIA 2DTEA 2HHLA 4FOLA 1IHYA 1KOJA 2MWMA 4EDFA 1YR8A 1J9GA 5EP1A 1XR3A 2Q4TA 3OEHD 5IXSA 1DWUA 1E3DA 4M8SA 1FLDA 3RLFA 1F0KA 2X86A 5LN1A 1D2CA 2AN3A 5JS6A 1IHOA 4F6LA 2RHBA 3QV1A 1X8KA 5B64A 2ZTLA 3CZ9A 2B4KA 3DFZA 1QNLA 2WB4A 2FGKA 4WDQA 3C4JA 3WL4A 4CM3A 3KEMA 4IIJA 2BCJQ 5LMNB 1RM4A 2WA2A 4N5DA 4WXYB 3EFBA 4DBLC 2ORIA 4ETIA 5B1EA 1I13A 3RSLA 1M2VB 1QKJA 1XEWY 5FBLB 1ZD9A 3CFYA 2YFYA 4HNQA 1P2DA 4LECA 1OR8A 4PC3A 4PZAA 3KT8A 2QQEA 3H8WA 4PXYA 2NVOA 2PO5A 1I1QB 3HLTA 4RH0A 4MLPA 2J0QA 5K4GA 2P35A 1XKTA 3FFTA 4IIEA 5JD4A 3V9AA 5MFPA 1WCV1 2FSIA 2XDQA 3DQQA 3E8XA 3QY0A 4GX0A 5F1YA 5K1ZA 3W2TA 4X62B 1Z0FA 4Y0NA 3PTAA 3RPEA 1XZAA 4D97A 3PFFA 3WWPA 1H4TA 1Y4AE 2WBLC 3H5AA 4XRRA 4G0YA 5CW1A 1PR6A 3SJUA 1SIBE 1DJNA 4JVNA 2QVLA 4NS4A 4D3SA 1GTG1 3FGPA 4OHVA 1QYDA 1SD5A 4X1KA 4BAZA 4DLVA 5IABA 4CT0A 4AG5A 2F2TA 1PQPA 2O3JA 1FXUA 4FR5A 4B5KA 3I64A 1TUIA 1ZK2A 1Q74A 2HA6A 2OOSA 3D3EA 1LDYA 2V7UA 1Q0RA 1IDOA 4BASA 2G82A 2G17A 4W1PA 1Z6QA 5ELXA 2IS6A 4XM2A 3PVSA 2CNKA 2NSLA 1ZQ1A 3T7CA 2DHRA 3W7AA 4WINA 3B7WA 4XIFA 2CLMB 5AW8A 3RK4A 3L0YA 1DPFA 4FI3F 2GXAA 3NP7A 3SQLA 1P0MA 3KHKA 1CTQA 3G1UA 3NIGB 1DFHA 1R0XA 2ORED 2SKEA 3NKLA 2GQ0A 3G8YA 2RBKA 4XUGB 1AVTA 1NUSA 3LLMA 1NIJA 2HQOA 3ZZ1A 4BCBA 2CVFA 1R0SA 1OROA 3IBSA 4KDCA 4RJKA 4CKXA 2JHCA 1W49A 3BM5A 3CZPA 3FCSB 1ZD5A 5LXTB 4DZTA 5HVNA 4GPD1 2XMSA 4D3ZA 4P4SA 3DLTA 1N5RA 2A14A 4D79A 5B53A 4D5EA 5PGMA 2QSYA 3WR5A 4JA2A 2QW0X 4E1BA 2D2IA 5AJWA 2YMQA 1TO1E 5K0NA 1CY6A 3PD1A 4U7WA 3UG6A 2BKVA 2PQMA 4BZPA 4HYQA 4V24A 3G2NA 5IBQA 4BN5A 1PR2A 1P31A 2C03A 4NAUA 1EFAA 3NDIA 1SU4A 4N82A 3NBUA 2YHUA 2BGUA 1PDOA 2XWPA 1DEXA 1LNSA 1P0PA 3MJEA 5ED0A 1XDUA 4WK4B 4FQ7A 4H31A 4LQCA 4YDHB 3COJA 2D0PB 3OOSA 3T1VA 2VPTA 3KSAC 5IDYA 1EFPB 2XUFA 4RSMA 5CPBA 1Q0UA 1QM5A 2O1EA 3KYIB 4I4TA 4O25A 4OQLA 1QRSA 2BFBB 1XMVA 3CLUD 3UMGA 3WK8A 3VJKA 1WPRA 4C4XA 1A5TA 4XYLA 3CNNA 4RABA 2Z83A 4LZZA 2ID7A 4LZLA 1G0NA 3ZCXA 2H2DA 5K8LA 3ZX5A 2RHRA 1L1QA 4B3CA 3AFHA 3W04A 4RVDA 4ZYVA 3PEFA 1E2EA 2Q4RA 1I7NA 1Y8CA 4EJSA 2XI4A 4HC4A 3VR4H 4C76A 1L1FA 4FNOA 1Z73A 2A1TS 4L6CA 2G80A 3GL9A 1AURA 1SU6A 2J5RA 3AJ9A 3L8DA 4ZHQA 2L2QA 4DUPA 2GDJA 5EMJA 2H8KA 3SXPA 5I8PA 3ZWCA 3SYRA 1TZBA 2VPYA 2ZPAA 3OMWA 1XRJA 1TUGA 1P1CA 2YY6A 2AJTA 1SXJD 4Q19A 3UGTA 2ZP1A 4ND7A 3WISA 3FCYA 4DT1A 4QDXA 4EPWA 5JD5A 1UPUA 4IIDA 1KARA 2Q6IA 1XQVA 2G8NA 1ABFA 2X4GA 3QWFA 3ZZMA 3RS7A 5IXJA 1NOIA 2G0NA 5P21A 1P33A 3BZUA 5I4BA 3C5HA 4K6KA 3D7SA 2O8FA 2QUKA 5AVOA 1VB3A 3CF0A 1IBRA 2DPXA 3RB8A 3AT1A 5C5CA 4HLUC 5DGXA 2LDBA 2NUPB 2POCA 3BL5A 2J4CA 3ZDQA 1G4UR 3WFIA 2R5NA 4LCBA 3O8RA 3O1LA 3B3FA 4N18A 3BWMA 2ZB3A 3A2KA 3MTIA 3VZSA 3U4QB 2G1PA 1N5KA 2EP8A 2XRYA 1Z4NA 2HCFA 2PMKA 1HPLA 1W19A 1XP5A 2FEWB 2ZANA 4BZXA 4LFCB 1G8JA 2J6IA 1S2IA 2Z04A 3IMEA 1G2OA 2YJTD 2IEGA 3O2NA 4KFUA 4LSGA 4QPNA 3QEBZ 2FN7A 1M2WA 3FF4A 5IAEA 2RC6A 5KBYA 1O4VA 4J6EA 2G8LA 4JJ8A 2JLZA 2O8NA 2ZJ3A 1AGXA 1NRXA 4TVSA 1UODA 4LF4B 3L5OA 4BU0A 1RE1A 1NJ1A 5M29A 2W71A 2XT6A 3DV0A 3CZQA 3K7EA 2PKEA 4MSUA 3K05A 4XB2A 4EFLA 5HIAA 1ZYUA 5AMXA 4PRZA 4JB2A 1ZKDA 1N2CB 1VE6A 2R87A 2AFHA 5B7NA 2WYWA 5BUSA 1SA0B 4HWRA 2JGIA 4M21A 1N5IA 5A7FA 1WETA 1B6GA 1QVAA 3GJ5A 5KJFA 1NM5A 4QIHA 2JF0A 2OHVA 2YV2A 3TSWA 2IJGX 2E4VA 2X0KA 2HXGA 4DNQA 3A04A 5ESWA 3P9RA 5FXMA 4F3KA 2RE8A 2ZEJA 1YOBA 1M74A 2E5LB 3K6JA 2IY9A 3KZKA 1NFRA 2AW3A 3DMNA 5D5PA 5G2OA 3VDXA 3L49A 5IJ9A 1KPHA 4DCCA 3C3XA 1QYRA 5HRAA 2OXEA 3OETA 3E3AA 4R69A 1VA4A 4I6JA 1Q2XA 2EJVA 1QPBA 3BDVA 1YAJA 1XDSA 2X4IA 2YVKA 3DAGA 3LDUA 3PQ6A 5HUQA 1AZTA 4JX9A 1KFBB 4HVLA 1E2QA 2EYUA 4TT3D 4AW9A 1NF8A 2JFWA 2CXRA 2XB9A 1A4XA 5DCYA 1VHLA 5TMDA 5EE3A 4PZYA 5F9HA 2BY4A 3FYUC 3HFGA 2A1TR 3TW8B 4BFCA 4D0NA 5A4MS 1E61A 3MCUA 4H27A 1FYFA 2ZS8A 1NBIA 4HT3B 4IYJA 3L6CA 3MLEA 1PBNA 4L5AA 5EQDA 4RPIA 1U7ZA 2YIVX 1JQBA 3Q72A 4TKMA 1Z2EA 2MR5A 3N2KB 4W5WA 5IBPA 4C14A 3PGKA 2BTEA 3HO6A 2GGSA 3K6RA 2BUBA 2UVQA 5AK0A 3MELA 4M76B 2Q0HA 1C41A 1L7BA 2BCGY 2HJWA 4CM8A 5KOYA 1RPAA 5JJBA 1E3WA 5JCJA 3G79A 4KZKA 1AHIA 2CMKA 4LMBA 5JC8A 1UQUA 4TTTS 3D5QA 5K3BA 1N7HA 2YBDA 1BHQ1 4GGMX 4Q3NA 5FOQA 2C98A 2HTFA 3EQZA 3BKXA 4JKOA 5CVCA 5DKFA 5C31A 4HNUA 1R5OA 4AB1A 1UEJA 1YKGA 3JQGA 4JX8A 4KDRA 1L5HA 3ZE1B 1JFSA 1YR1A 4YWHA 2ZT5A