4RADA

Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
213
structure length
197
Chain Sequence
PGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Aza-acyclic Nucleoside Phosphonates Containing a Second Phosphonate Group As Inhibitors of the Human, Plasmodium falciparum and vivax 6-Oxopurine Phosphoribosyltransferases and Their Prodrugs As Antimalarial Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 197
sequence length 213
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4radA00
1A3CA 4RV4A 3GEPA 1ECFA 5E38A 4F8EA 4RAOA 1FSGA 1XZNA 4RAQA 1Z7GA 1A96A 2IGBA 4MB6A 4P80A 2WNSA 5BRNA 1D6NA 5KAPA 4ZFNA 3ACBA 2JI4A 4JITA 1G2QA 1AO0A 5K51A 1VCHA 1OPRA 1HMPA 4RQBA 2JKZA 1QCDA 1DKUA 1ECCA 1UPFA 1Y0BA 3DEZA 4KN6A 2PS1A 2JKYA 4RABA 4S2UA 1OROA 4RHYA 1MZVA 5BSKA 1QCCA 4RANA 1ZN9A 1VSTA 1BZYA 1ZN7A 4LYGA 1PZMA 3M3HA 4RHXA 1G9SA 2PRYA 2EHJA 2HCRA 1IBSA 4RHUA 3NAGA 1DQNA 3OZFA 4PAWA 1YFZA 3LPNA 1DKRA 5ESXA 1O57A 1DBRA 3DAHA 1XTUA 4LYYA 1L1QA 1J7JA 1BD4A 1P19A 2H07A 4P82A 4QRIA 1I13A 1P17A 4FYMA 3EFHA 4LZNA 5JV5A 1XZ8A 4WN3A 1ECGA 1WD5A 5HIAA 4RADA 1BD3A 1G9TA 4X45A 4Z1OA 4M0PA 1O5OA 1U9YA 2H08A 3G6WA 3KB8A 2AEEA 2FXVA 1P18A 3O7MA 2JBHA 1A98A 4IJQA 1A95A 1HGXA 2YZKA 4RACA 3S5JA 1ECJA 1QK4A 4PFQA 1UPUA 3H83A 1UFRA 5IPFA 1DQPA 4P3KA 1TC1A 1XTVA 5BQOA 1I5EA 4P81A 4X44A 1LH0A 3ACCA 4OHCA 3LRTA 4LZAA 2H06A 4QYIA 3GGCA 1R3UA 2P1ZA 1ECBA 1I14A 1U9ZA 3N2LA 3OHPA 5EUCA 1V9SA 1VDMA 3HVUA 1CJBA 2DY0A 4QYIB 3QW4B 1JLSA 4RHTA 1NULA 4P84A 1I0IA 3MBIA 1GRVA 1TC2A 1I0LA 5IAOA 2GEBA 4RQAA 3OZGA 1W30A 4M0KA 5HKLA 1A97A 5KAMA 1QB7A 1XTTA 2E55A 1GPH1 1JLRA 1QK5A 1ZN8A 1QK3A 2XBUA 1QB8A 5JSQA 4TWBA 1NONA 4P86A 4JLSA 3ACDA 5BQPA 5ESWA 3GGJA 1A4XA 2VFAA 1STOA 3MJDA 1P4AA 4LZOA 4P83A 3DMPA 2PRZA 1G2PA 4WMLA 2C4KA 1OREA 1L1RA 4M0UA
chains in the Genus database with same CATH superfamily
2X3FA 1T2FA 3NWEA 4KMOA 1SOMA 4YP0A 3Q87B 4YCJA 1AGYA 2GN2A 4AS2A 2XYRA 4P5DA 4FDVA 4KQEA 2VHEA 2P4EA 3SC2A 4C0SA 2IPNA 2NIPA 4FYHA 2XKKA 3II6X 2R1TB 1BCSA 2WIJA 3JU3A 5KYKA 1C30A 1FEZA 3EXHA 5DB4A 4O63O 1MVNA 1RAIA 2F90A 1W36D 2P2ZA 1JXAA 1RM4A 4YRQA 3USCS 3L79A 3Q1LA 4FYVA 4BUCA 2GWHA 2O3RA 1K75A 4K05A 2OXTA 4D3YA 2XADA 4PLGA 5EZYB 4QTXA 2OQIA 3RVOA 4S2UA 3WRXC 1RIIA 2HK7A 3EIOA 4RHYA 4QGSA 4R1QA 1GPNA 2Q6OA 1YL7A 4TQAA 2AXQA 3EAQA 1EGVB 2AUMA 1IRXA 5BWNA 1ESZA 3HDYA 1MQSA 1H0KA 4JXJA 5E6SA 2JGLA 4P7BA 4NZMA 2L18A 2YDXA 2IHNA 3UMMA 3MMPA 3NDJA 2XMPA 3OJEA 3K5IA 5HDBB 1UODA 5TT1A 3W8FA 4NU5A 4BKRA 1W1WA 5KQLA 5D6NA 1VSVA 2EEPA 3BXXA 4GI3A 4NBNA 1E1KA 5BMVA 3FKJA 2FE4A 2FGKA 1YUNA 3UUWA 2XQVA 4GMDA 5L45A 4CEHB 4HS4A 2ADFA 3TUJC 4CUZA 1CJVC 3MTIA 3B6EA 3G2QA 5FEMA 4Z5XA 1ML4A 3UB2A 1E4OA 3D1JA 2ESRA 1VL0A 2GUWA 3KZOA 4RK0A 4Z0NA 5J4VA 2Y1GA 1MEEA 4BE9A 1GKUB 4C4ZA 1LJ8A 3I2JA 4PSCA 1OGIA 4UULA 1CFJA 5JSZB 5ICMA 2E89A 2BM9A 2FN8A 2GZ1A 2WFAA 3LT1A 3T4XA 1XB2A 1QHFA 2VT3A 2YVKA 1CIVA 1UIRA 3I73A 4B5LA 3PXXA 4X7PA 1X80B 4MTCA 4CR7A 1Q7TA 1N2HA 3R4CA 5EHQA 3T9BA 1R6VA 3K53A 1N6NA 1XCOA 2ODAA 5DJ5A 3AX6A 4AY2A 2FG6C 3RSCA 1G59A 4B4WA 1AC5A 1NLFA 2RC6A 2GAFA 1FDTA 2XOKD 2KBFA 3RBVA 4ZOQI 5TC4A 4G0WA 2EDAA 3I1YA 1N33B 2OP1A 3BXEA 3PX7A 3LT5A 5H70A 2DPHA 5FBRB 5L3QB 1SCIA 3FYDA 3JZDA 3ZVKA 3E8MA 3FCXA 3ZZUA 1FYEA 2OM2A 5ALZA 3RTBA 4MVJG 3VR3A 1D07A 2UAGA 4FYIA 5JZOA 1YA6A 4ML3A 4Z49A 2I7TA 4TRNA 4B3CA 1GT6A 3C6BA 4PY2A 4QDKA 2PGJA 3WL7A 5HK9A 4PV7A 2BAGA 2VKTA 2D5LA 1A9PA 1TAGA 4MR7A 1BROA 5HP4A 2C2ZA 5F3WB 1MAWA 4ABTA 1KAMA 2A94A 2B4QA 3V9AA 4TMTA 1SOUA 4ZVSA 1G3IA 1VKRA 4WN9B 4JXZA 1E2PA 3IT3A 4ANFA 4D46A 1WV1A 2A0YA 4BGIA 2BRUC 2UZ3A 2F00A 4MKZA 4ZCPA 4GPZA 1Z9BA 3CTPA 3GAZA 4P83A 8OHMA 4CQMA 2JCVA 3ORQA 4FYKA 3CUWA 4CLRA 2FEOA 4KQ6A 5ILQA 2PYIA 3NBXX 3WYDA 1RRMA 1AK1A 1CT9A 5EQFA 4CM3A 2BSQA 3AL0C 2WJZB 5HBRA 4F8JA 4KLZA 2Q0SA 5JALA 2D2EA 4M1SA 5J9FA 4URXR 2ZK7A 1ZCBA 4PZEA 3PUWA 3TE6A 5AHWA 1O94C 4OX9B 2Z3WA 1HDXA 1PL6A 1QBGA 1Q1EA 1XJ5A 5FV7A 4E2WA 1HXHA 1LK7A 4GVLA 3P2IA 4LS3A 4YASA 5LA6F 2DLCX 4GGPA 3HFRA 1H2XA 2WUEA 3D0KA 3PHBE 1O8CA 4GKBA 4I4NA 5D7NA 4DC0A 4KGVA 3H1TA 1CUJA 4AP9A 2P5UA 4Q1VA 4EYOA 4TRJA 1OWLA 2XXBA 1SULA 3REOA 3PRHA 4E2FA 2PX5A 1MO3A 2Y1EA 1TQ4A 2A9FA 4XX0B 1SMKA 1O5IA 1T3HA 3HS3A 4D6XA 5DSTA 3WLTA 4XD2A 4JQSA 5HCUA 5EKUA 2G8NA 4ERXA 5FULA 2C7OA 3ZHRA 4Q4HB 1NXXA 3A1UA 1BD4A 2VPQA 3C3BA 4GWLA 3WBJA 4DCGA 3AEYA 1JNYA 2WVJA 4EJ6A 5EGNA 3OEYA 1R10A 4QPPA 3OQNA 3CN7A 3IRVA 2PGNA 3N59A 4U8HA 5JXIA 3OZDA 1Y3BE 3U3KA 1DBQA 3ZCSA 3ITNA 1UBUS 1LNZA 2QN1A 4HR7A 1TF2A 3TAXA 4UCFA 1CD5A 4P7GA 3TOCA 5FPKA 2JHFA 2W6IA 4PGHA 4IFBA 3LVFO 2OV1A 3FTNA 3IA2A 2YV2A 2H8KA 1U0EA 3K09A 3T35A 5KNDA 2BBTA 4EUHA 1ZGCA 3EJ6A 3COWA 1GVNB 5GV8A 3LOUA 3KQKA 2WM2A 5DRYA 3GR6A 3O3CA 1CUYA 3A9UA 3W2TA 1BOOA 3B1FA 2P6NA 3DR3A 4L5AA 5EYPA 2XMSA 1LBTA 3HP7A 2P9CA 3HJAA 4ZVKA 3U7RA 2BFAA 1UC8A 2B20A 2BVNA 2H06A 4GC5A 5G1NA 3VDNB 4CKCB 4LVNA 5C8ZA 4ZO9A 4DVGA 5TMDA 5AQEA 1EVEA 1L5OA 1VE9A 2CHGA 1FU4A 1PBTA 2PCLA 2WLTA 5K3DA 4KQ1A 1EM8B 4CKBB 2JRCA 1F2UB 3JASA 4HAOA 3IEKA 1NLZA 3C3PA 3RV4A 1LV8A 2GYUA 5ARDA 2IZ0A 4K03A 1ND5A 3VR4A 2HLDA 4CI9A 3C8HA 4EOGA 4U7TB 3OTOB 3RSQA 4GZ3A 4YR9A 3F6PA 3EMDA 4PVDA 3L0SA 2BMVA 2GILA 1AT1A 2C2YA 3BHMA 1JA1A 3DBRB 4JX9A 2VO1A 5KUTA 3T12A 3SEAA 2GESA 1QYCA 3AFNA 2FSFA 1GARA 4AMVA 4F4IA 3JWPA 5I7FA 2X6RA 3VDQA 5IUNC 3GC6A 3ENQA 2Z4SA 1U8YA 2DE0X 3S6JA 1Z4JA 3FYSA 4UHHA 1JAYA 3PNVA 4KRGA 2XODA 1X9HA 4V0LA 4Q48A 3T94A 2D62A 3V42A 1DMRA 4OI2A 4RIHA 3CX3A 4K8RB 1L5HB 5E1DA 3OKPA 4IUBS 1M5TA 4FW8A 3LXRA 1EUCA 1NU6A 3FMIA 4M8SA 1DV2A 3LX5A 4PIMA 3WGNA 3LPLA 1MTZA 1THTA 3GFRA 1T4DA 4MTLA 4R8LA 4L6IA 4BNIA 4MW4A 4ECEA 4NVRA 1S8NA 1W85B 2V7QA 3UMFA 3WYEA 3HJGA 4XARA 1AH2A 4RHFA 4WOKA 3L0ZA 2FSUA 1V7QA 1D2MA 2WU8A 4RIEA 1I7NA 5BSUA 1Z18A 1MGPA 2KM1A 2Q8NA 1KH2A 1F6WA 3C2QA 3JR3A 3HU3A 1TTQB 3GJRA 4I36A 4KAFA 4UEKA 2LKCA 3LPCA 1IYZA 1O96B 4O1HA 5SZJA 3RRXA 3T5AA 2IYQA 3BT7A 2EJUA 3GMSA 3CCBA 3HA5A 3P9XA 4PTLA 2PWYA 3TW8B 1E1DA 1RPTA 4CI0B 1X13A 1U2GA 3COVA 4DF3A 1OX5A 3DEAA 4FE7A 2Z2YA 2AVDA 3RVPA 1YNSA 2PPVA 5KPJA 1RWPA 3BSFA 3E9EA 3TM5A 2OK8A 3GH1A 3JRXA 1XCJA 4R2MA 4YR7A 4X62B 1KZGB 2I3GA 4H7FA 2PRKA 4UKDA 2FZEA 2JLZA 3V2UA 1E32A 3JZFA 3WMRA 1FP7A 3G9TA 3KKNA 3H4TA 2J5BA 1T2EA 4E5VA 5AVUA 2XZOA 4TOIA 3AVWA 1QH1A 2Q7DA 2O54A 3N0RA 5CLQA 2EARA 2ZRKA 3NONA 2BM8A 2GA9A 2IV2X 1P29A 1JQ3A 3UUEA 1VG0B 2RKWA 1YMVA 4BQNA 4DN6A 3RVBA 3TBFA 4DRXA 5CB0A 2F4NA 4EFNA 5LXTA 5KOJA 4TZ6A 5SICE 4PFQA 1PGJA 2V7XA 2LIVA 4NMXB 1JWAB 2R6ZA 4TTRA 4TV9A 1PR3A 3UG7A 1YVPA 3T5PA 3SBEA 3ZKWB 1EHIA 4QXQA 4R16A 4YLYA 4ZIRA 5A2GA 3IPCA 4NBUA 1NUTA 4DQXA 2YXNA 3O8RA 1GRCA 4G5HA 4KUGA 1DIOB 4P3OA 1X8LA 4IEEA 4JFAA 1ZH4A 3HP4A 2V7PA 3I04A 5IRCD 3NJRA 1HSZA 4XWYA 3OAAA 5JWHA 4TMZA 3CYFA 1QYVA 1FU7A 1YVRA 1MAUA 4P3YA 5FOUA 1RQLA 1T3GA 1LKZA 3P0JA 4QUGA 4BB9A 5JYCA 4B71A 4P4NA 1YZLA 1EGAA 4LHEA 4PC6A 1EM6A 4JR1A 5YASA 1YRBA 1OTXA 4W9RA 4J8PA 2L82A 1B8UA 1X3LA 3E7WA 1ZK2A 2I4LA 1J4AA 2RK4A 2ZBEA 4CFZA 2BE7A 2ZJ3A 3LYLA 4KV7A 1QCZA 1SBIA 1DBWA 2OD9A 4TTPA 1YZGA 4QXPA 3EIXA 3L6OO 1N36B 2YFHA 4AF8A 4TKUA 3QKRA 4FONA 5B6IA 3NVMB 4HYTA 4HBZA 5JIBA 2GXSA 1O89A 5CLHA 2IH5A 2J3IA 1TEXA 3AB3A 4PVCA 5TT0A 3U4QA 1QQTA 5KVVA 3NOQA 1MZPA 1I3KA 1YC5A 4OOEA 1BDHA 3AEKA 3FPHA 4FWIB 3T0GA 4JJ7A 3WJ1A 2I33A 3DGFC 3USZA 2WWYA 3NYIA 4KJZA 1BH6A 1RRFA 1RWWA 2OXIA 2V4UA 2HBZA 1Y80A 2ZRGA 3AR2A 2HUNA 3IXLA 3PGXA 1BJTA 1UFKA 3O90A 3KO8A 3RTGA 4MV0A 2OZLA 1RM0A 2FJ0A 2COEA 3M6UA 4U3JB 2X0EA 1CUVA 2PMFA 2Q41A 4MV3A 5DWQA 5JC8A 3ZU3A 3L8EA 3TCKA 1OI4A 1QPBA 2AEMA 1B8NA 1PWYE 2GPBA 5GGXA 5JS7A 1IJKA 1EFVA 1PR5A 1QVRA 2CDBA 1E3IA 3AHEA 3F9IA 3GJYA 3MRXA 2ZLBA 3HVKA 5I9NA 1DSSG 1PGOA 4RKEA 3RUIA 3UOGA 3R8CA 1ECCA 4FDMA 1M72A 3LDGA 1DC4A 4Q93A 1MO6A 2DFTA 2AFHA 2HJGA 3L01A 4OM7A 3FLBA 4KR2A 2IYVA 1Y5LA 3IIMA 2GZ2A 2X9NA 2ZSBA 4WXYB 1OBVA 4K3VA 4P38A 4PRKA 3VPXA 3EVNA 4WBNB 1ZIXA 3C39A 2DBZA 3RSGA 4R69A 5C52B 2QRKA 1IVYA 5TQ2B 2RE8A 1QG4A 1IN6A 5BN1A 2X4DA 4FYYA 1J56A 1NMEA 2YXDA 1PVVA 3ZDDA 1Y7IA 2O3TA 1O2DA 1UZNA 2XVAA 4G4GA 3CZ5A 4I5EA 4TMKA 1T4GA 2QR2A 2POCA 3S1AB 4BNLA 4YXWD 5LLTA 2FFHA 3C85A 1E7SA 3GLUA 3Q5GA 1GZDA 1HQCA 1PR2A 1TB4A 2PMKA 4K87A 4NBVA 1HFJA 5AM0A 5EXPA 4D9IA 2B94A 2W2KA 4WZAB 3T7RA 4J3JA 4NE2A 4G0OA 3JARB 2RH4A 2DKFA 4G2TA 1KHTA 4K9OA 1PLLA 1XVIA 4BUJA 4LZZA 2IIBA 2PUJA 1OFTA 5E1BA 3SI7A 1H8HD 2Q45A 3DO6A 3O91A 2R4TA 2YVQA 2FZGA 3NKLA 1BRTA 3O73A 1MW9X 1BMDA 2WKWA 2ZT7A 1ADGA 3IIIA 3PXCX 4ND8B 1VGRA 2C7GA 1GYRA 2EG5A 2WHYA 4TVBA 4WKBA 2WHRA 4ZOLA 5HJ2A 3G2LA 7REQA 2PJUA 2ZPUA 4EATA 5ED0A 4O6VA 2A78A 1OXMA 5DT9A 3WTCA 4AK9A 2VK4A 3LXUX 2Z8ZA 1MTOA 1PJZA 5J1SB 2E21A 4FPXA 4XX1A 1KAHA 3HJNA 2ZRIA 3K92A 2A5GA 3HZOA 4DYVA 5AKEA 3WGKA 4I8IA 4EY6A 4IF4A 4L28A 1JIIA 3STUA 3O8OB 3K8ZA 4PHCA 1K27A 1RWKA 2NVUA 4B45A 1YQQA 1Q16A 2W2QA 3K6JA 1HFWA 3PJEA 4MUNA 4BVKA 1F1BA 2BPOA 1Q5PA 3VDXA 2BT4A 4GZ6A 2HA3A 2FEKA 2X4GA 4KVFA 3LWDA 2RGGA 2YFKA 4IOMA 1KSGA 3BG5A 2F8MA 4ISBA 2QN8A 2QBYB 2DERA 1D1SA 4U2KA 4BBZA 5KSWB 2AA3A 3CO0S 4HWOA 4KNWA 3VO2A 1F4LA 4P31A 2J45A 3EZGA 1LPBB 1Z6TA 1JEDA 1FQJA 3C70A 2J5XA 4TTSA 4UTNA 1DIGA 1Y3DE 5KQSA 2XGSA 4YP6A 4WMLA 4P53A 1IONA 3DTVB 1C1DB 5MN5A 2XDYA 2JDIA 4BLWA 3C97A 1HBJA 3FBGA 2O5VA 4JC5A 3QOWA 1ZUHA 3CV3A 3RYFA 2X15A 2I4RA 1KO4A 3UHJA 3IVXA 3ZGLA 1D4ZA 3KZ1E 4DQVA 4KQCA 1J8DA 1I10A 3PXBA 2DPYA 1JSZA 3DOFA 3SY8A 1J0CA 1GNTA 1TRKA 2J0QA 1PVDA 1N3LA 3UJPA 4UBNA 2JKZA 5FWAA 3KSDO 2VTVA 1CJSA 2ZE7A 1C8VB 2RHBA 1M0TA 1ITZA 2A0WA 1OX4A 3JD2A 2PFKA 4CT4B 1MOPA 1UPAA 2MYPA 3LRPA 3Q3VA 2DFKB 3R6GA 2B3TA 2C58A 4GPD1 1WSDA 2REOA 1I7LA 2BEJA 3ZIUA 1ZCFA 4OH7A 5CBKA 1WB5A 2L2QA 3L7DA 2BJHA 3L6BA 2IEDA 2Q3MA 3N6XA 1U99A 4HRXA 4QU9A 4PC2A 3CRZA 2XIQA 4DWOA 5L3SA 1FZTA 4HFRA 1ADJA 5JDCA 5F73A 1O58A 3WO0A 4C01A 3AR8A 4YUAA 3BRQA 1R16A 3R6LA 1AGXA 1YU9A 2JIQA 2FOLA 2W8ZA 2QPAA 3E2IA 2VDQB 2ZBDA 1R6AA 2EL7A 4PGMA 5HPYB 3UTCA 3MJFA 4RHCA 2XTJA 4HVAA 1QO9A 4DPKA 3QIVA 3PKZA 1IWOA 2ZXUA 1I6WA 2HPVA 4PR0A 3OQBA 1KKLA 1TVEA 1DELA 2CW5A 5T67A 1KK1A 1C8LA 3IP6A 4BP3A 1JKJA 3HA7A 1VBKA 2D0IA 4DUYB 1XMJA 3V4FA 4Q4AA 4EQ6A 3DLAA 5CA1B 3K30A 3AHHA 3U3RA 2O4CA 1B6TA 3DBHB 1GU7A 4FYXA 3TRHA 1CDOA 2WZQA 3V1MA 3OX3A 4ZRMA 5IPFA 3ZCUA 1NXOA 3K6SB 3TQQA 5DM70 1T0JB 3NTUA 5IW8A 5IJ9B 1ZNXA 4RHEA 1NT2A 1RI4A 4XDHA 2GXUA 4NEQA 1AV6A 2XB4A 3N74A 1YE3A 4KG7A 2C84A 5LZ4A 2GCIA 4IDEA 4TXNA 3ORYA 1C7JA 3PR2B 3QFHA 4IW3B 4MKRA 1XPRA 1M75A 1H1LA 3UB4A 2FMXA 1EH5A 1RKBA 1EE1A 1FYDA 1NVWQ 3DHEA 4U9IS 3WMFA 3O83A 1CZKA 1G8HA 3NASA 3LHIA 4NU0A 4DG5A 3K5HA 3WE7A 1QH9A 1R0ZA 3HCWA 5FPTA 3EHDA 3VUFA 1WV0A 1L5RA 3M1LA 3Q7QA 1BMFA 1XZBA 2X8LA 3KQTA 5FOXA 2A2ZA 4X85A 2RMKA 2R8OA 3VR4H 4PGGA 3VZBA 3WRWA 4KLAA 3ZE6A 1UC9A 1EWVA 4XYLA 4CUJA 1OH6A 4ETNA 2VDWA 1LEHA 1JEYB 2VYVD 3AFOA 5DM4A 4O4JB 3TFQA 2AC7A 5CXUA 3ZJ5A 2H4WA 1CUZA 3GRVA 3H9JA 3LQ1A 2JJMA 1FFEA 2FFJA 3R3XA 2EKQA 4EUEA 1E20A 2V0GA 5F9FA 1R0XA 4LF5B 2ENUA 2GBLC 1RXEA 2O7VA 2X8JB 5ESDA 2C8JA 1ODFA 3T1TA 5AOCA 1Y5NA 5IJXA 5JZSA 5JVDF 4YAUA 1C9NA 3L04A 4F6LA 4WZBE 1EU1A 1A9SA 1TZKA 2FWAA 1U5CA 1J49A 5I7RA 2EU8A 4BQOA 1DQZA 4GW3A 1NR5A 5DISB 3ODGA 3RVJA 2N1BA 4B2PA 2PPLA 2WIGA 4WV3A 3SX0A 2BEUB 2ZXFA 3HO1A 2WM8A 1E8NA 2YQ4A 1T2UA 3QP9A 4LYHA 4HTFB 2QHXA 4HNRA 2RFLA 3A25A 2O2CA 4GYYA 4IXMA 5E3JA 3GH3A 5IAGA 4AO7A 3U4IA 2HSGA 4BO1A 5JY1A 1F2TA 2VRWA 3EVGA 5FXMA 3QKTA 4TVKA 1JDTA 3PICA 4G0QA 1T5DX 4BCDA 3A0UA 5LQRA 2AMJA 3KPWA 2IXDA 3A6PC 2WJAA 2HWWA 2MIIA 3BTSA 3DE3X 1XFDA 4HZUA 5DGXA 4N7JA 5AM2A 2PMWB 1YUMA 4UZFA 3NT2A 3SP1A 5A4JA 1P2FA 1WL8A 1VJGA 2ZKLA 3EA5A 1YJ5A 5PNTA 1E5VA 1GSHA 1DIBA 2HK6A 4K6CA 5HBGA 4AZ3A 4JOBA 1F51E 3OLWA 2BGIA 1KJZA 4LYGA 4YLEA 5EMLA 4TZKA 1P31A 5CVCA 4XYBA 1KVQA 4YACA 2OMKA 3OZFA 3T3PB 3LQQA 4DWJA 1N6HA 3DDCA 2PZKA 1EJ0A 4JEMA 4EB6A 1O57A 2JHAA 1GGVA 5EJGA 2OFWA 4WK2B 3CWQA 5L3ZA 3H65A 4MP6A 5T6BA 4XEHA 1E61A 1A8QA 3HJCA 3KXLA 3VQTA 4GUDA 4NAVA 4RDIA 3UEOA 4PZAA 3N28A 2QE7A 3JQFA 4HI0E 1YK1A 3FWZA 4JV5B 1A04A 1H93A 2OE2A 1KAGA 2ZULA 1Y5IA 3ZBQA 4EHIA 2VNKA 3TEFA 3P71T 4HEA1 3D3NA 1A98A 4I2NA 5AI5A 1S7CA 4IJQA 4JGIA 1AMNA 4QYMA 2EJBA 2DTDA 2FZVA 4L07A 4P3NA 5C5EA 4ZN6A 4XR9A 1I9GA 3SM9A 2FA9A 1D2AA 1NF3A 1H2EA 1UT5A 5K2OA 4EF5A 5LOVA 2VDUE 4QRDA 3L1VA 4IVNA 3KM0A 2AC4A 4Q6WA 3N8NA 4LE1A 3ROFA 5F4BA 2D8AA 5CPFA 5FUQA 5JANA 2JI7A 3OOSA 1L0BA 3GP3A 4KMRA 4YJHA 3UBTA 4I4CA 2NPFA 2EHDA 2MSWA 1GCOA 1Q1QA 3R3HA 1KVSA 3I6BA 3I2KA 1PWHA 1BWPA 1EK1A 4EKIA 1MABA 2UXBB 5GADl 3KFVA 4KXFB 1G5TA 4NR0A 3QVUA 3C0KA 1JGTA 3GLVA 3PDCA 4M1EA 4UXHA 3VKFA 3Q9NA 3D8TA 2OAGA 4HX9A 4JN6B 2GD1O 3RWMB 4EL0A 5KTMA 1QQAA 4QUJA 2MDTA 3JVUA 3IDOA 4IKEA 1W52X 3P32A 8ATCA 2CF5A 1N2CB 2FETA 4FE4A 4PS1A 2PGIA 3AKCA 3NYQA 1HNNA 1JU3A 1U7HA 4G5OA 3VH1A 2ZUUA 5LYJB 3C5EA 3GVCA 4FDUA 1JS1X 3GLIB 1RXYA 1TM4E 2AJBA 3E7PA 2JLRA 2P90A 2PWBA 3MJEA 3ZIDA 1R50A 5L4NA 2IUEA 3FPGA 4JNKA 1IEQA 1U98A 5I7OA 1EQAA 1ZI6A 1K5HA 2PL1A 2RHJA 1Y7TA 1JSLA 3GA0A 3KEGA 2JS7A 3QIAA 3ENVA 4D43A 3KQHA 4BRUA 5KNCD 3Q9SA 4C2BA 3HGMA 2NO4A 2AWNA 4IUYA 4YH1A 5BWOA 4RD4A 4MUKA 5U1PA 5JCZA 3OZCA 1DX9A 4B3SB 1KFEB 1L8QA 1M7GA 2JJ1D 2WA2A 2WYUA 2XEXA 4FWBA 4TL6A 5DHPA 3SYRA 3LT4A 4UFPA 1OF1A 4G36A 1EXVA 4W5WA 5T3UA 2RH8A 1T2VA 3LP8A 1CYEA 2PMDA 1MO2A 1U65A 1H6CA 2LTAA 3B70A 5B30A 1T1RA 9ATCA 2C82A 1WKBA 1F12A 2Y2UA 4FFNA 2GK7A 1TK9A 1WF3A 4LY3A 2EDCA 1CCWA 4CDRA 3ILVA 2C9MA 2RAVA 4R1TA 4B44A 5AW8A 3DEHA 3M7IA 4N0QA 6REQA 4D81A 2A7QA 2QORA 2NTYC 1NE2A 4NJMB 1L5LA 3OF5A 1DS6A 2FK7A 1M33A 1S9HA 4G4SO 3P97A 5HIJA 4JR2A 4RY0A 2AG1A 4IV5A 3L9XA 3JAWB 3E9ZA 2PUVA 3LU1A 4PN7A 5M5BA 3B13B 4MI3A 1LPAB 1CR1A 1V1MA 3EN0A 3GRYA 4M55A 4RVOA 5DGTA 2XUJA 1P1CA 3N2GA 4WXPA 2J4CA 4NMMA 2YWDA 1JB1A 1X7YB 1DAFA 2XMCA 3DAGA 2FLVA 4IHKA 4D4HA 1XR3A 1YRQA 3A3YA 1IHPA 1X2BA 2BCEA 1UC4B 5EY5B 4BNHA 5GONA 2W6MA 3LT0A 3H5VA 3Q7PA 5D5PA 3IBCA 3JQBA 1QU3A 2VLIA 2YWFA 2ORVA 3F78A 1U0LA 1YC2A 3TO5A 3L6EA 2HW8A 1GPLA 3EFOA 2VPWA 5HS4A 1E9RA 5AM5A 1OTYA 2FUEA 5JATA 1V1RB 1MBZA 1W0KD 2ZJ8A 5CNJA 3R7AA 3GI1A 4HLCA 1ZXLA 4U39A 1BW9B 2C7VA 3IEMA 2EIXA 2GZDA 5FTNA 1L9KA 1NI3A 3FF1A 5IVHA 1JEAA 1LRJA 2X9LA 2YN4A 3COYA 1LK5A 2FE1A 2ZRQA 3P19A 4F7WA 5AVTA 5CEJA 4EWLA 5KX5F 1MAHA 3QYJA 3DJFA 4Z7OB 4QFCA 2M9MA 1K7FB 3KCNA 1XPUA 3OU7A 4Q4CA 3V4PB 3VBCA 5CYOA 3DPIA 1XTQA 3W5DA 1H22A 4GI1A 3GGCA 3K94A 2EKPA 4JVLA 3H5IA 3THRA 5AW2A 2QW1A 5EWJA 3RSOA 4A6EA 3L0CA 2XZDA 2ZBGA 3JQAB 3MOGA 3NWPA 1LXCA 4HF7A 4ZALA 5F51A 3FLMA 3MVEA 2C5HA 3RTCA 4EVQA 4F5ZA 4GS5A 3CUUA 3MYYA 2I2AA 2E85A 1E1CA 3D0RA 3D8RA 4OKNA 4M9RA 1SKMA 1KC1A 1T43A 1J07A 3QX9A 1H6AA 1JHPA 4HXFB 3ESRA 4OIMA 4NZZA 4QPCA 2ATCA 4XPZA 4Y9RA 1A76A 2C3YA 2OZVA 4LSGA 4DLTA 4Q3OA 2NV6A 4M1TA 5K0NA 1LPOA 2OBNA 2Q9AA 2QW0X 4MZXA 3RNOA 3UKJA 1YQUA 2NSYA 3M4JA 2V3VA 4ZTBA 4JT2A 3GF4A 3SX2A 1LA2A 2QU8A 4FGLA 5IFKA 1AZTA 1CB0A 5FADA 1QB8A 4M1YA 1QZUA 4ON9A 4QNNA 1Y9ZA 4C0HA 4LCJA 2CNOA 3TOXA 1RQXA 2GHRA 1Z2AA 2C9CA 1HPLA 1XCGB 2JAOA 2JFWA 1E2DA 2P5YA 4NDAA 2NZJA 2UVPA 2HXYA 2JCYA 4YJGA 4RMIA 5LXTF 3UH1A 1H9AA 1Y33E 1ZHHA 2FQQA 4YRCA 2C4KA 4TV9F 2SCUA 5FR2A 4A2CA 3D6TB 3ORSA 5G0TA 1JQLB 1Q74A 3G02A 1XUOA 3NHUA 3U61B 2D2XA 4YRBA 1VLZA 1ZJ5A 2JARA 3FPAA 1UBHS 1SK8A 2G17A 3ST7A 4NDZA 4HC4A 2A67A 3QE9Y 1PD1A 2Y1OA 1LSOA 1TU4A 1M8JA 5BWLA 2PUEA 1TA0A 4WUVA 2WF8A 1EZ4A 1A2KC 2ORWA 1F2DA 3JWEA 1ZGJA 1MB9A 2X4IA 4ZAGA 4JOQA 3PQ5A 1DU4A 1JFFA 5JMWA 2IBMA 5KQRA 3EOAI 1VMEA 2YJ4A 3DE4X 5TS2A 3V48A 1FP2A 1RYMA 2XOXA 2IP1A 4OHUA 3RRFA 2E5LB 2P2YA 3AIMA 4KH1A 1N25A 1S0UA 1Z0DA 4O25A 5KHLB 1KQGA 1G0NA 1QH0A 3TFWA 4UNNA 2HHLA 3M1YA 2JFPA 4OHRA 1IUPA 3H2BA 4DUPA 1DKRA 5ESXA 1MENA 4CMHA 5CA0F 3LAWA 4QC2A 3QH4A 1OIVA 1T2CA 2W4MA 3UMCA 2QOEA 5KKNB 3IC5A 5J4LA 5MN6A 4IP0A 1JA0A 4QRIA 4XZ3A 4MIKA 2VWQA 2ZAIA 1KF0A 2XAUA 4LRXA 3THYB 3FVVA 1PR9A 5FPHA 2O59A 2NXWA 2EQBA 1T6BY 4N3CA 4U4AA 4W8HA 4D92A 4Z1OA 1SXGA 2CNWD 1QCYA 2E6UX 4B3GA 1JKFA 4F5YA 1H65A 2C7PA 1L7NA 3A6EA 5ALGA 3INRA 2QRLA 3TQSA 1HYBA 1I01A 5C1PA 4P7FA 1ZSVA 1VMAA 1J21A 4HPWA 1E6KA 2HQOA 2QRMA 1U0BB 2GK6A 1EPUA 2YS6A 5BQOA 5C80A 3TF5A 2BFNA 2EQAA 5FFMA 3GD5A 1ZDMA 2D0DA 2C8VA 1XVLA 5CG1A 5DFAA 1A9ZA 1NJ2A 4CLOA 3CNNA 1MAAA 3E5NA 1E2NA 4NAUA 2GPWA 3ZZMA 4NCBA 2JLCA 4EG0A 3G88A 1HYEA 1YK0A 1ONSA 3KLMX 3LW8A 4NHOA 4LFAB 3FDIA 1XF9A 3CEPB 3BKXA 3UGKA 1CERA 1GIAA 2OQRA 1EJ6A 2NO0A 1JLSA 2VKQA 1ST3A 1YUBA 2AE2A 3AJ8A 3NG1A 1NVTA 3NT5A 2QX7A 1TQHA 3EWIA 2IYOA 3NP7A 4GI5A 1EUYA 3ICQB 2BEWB 2XWJI 1S9DA 2G09A 5LA6B 5E4TA 2BTEA 4QGFA 3B2EA 2GPTA 2BN4A 3ORHA 4L75A 1NJ5A 2YRXA 1A4IA 3CSSA 3EZ9A 5ECYA 1J39A 5U4QA 3KQVA 4CT5A 3RK4A 1FYXA 1V6SA 4CZ2A 4F9TA 4XQEA 1Z07A 4N40A 1D7AA 3WQBA 4H3VA 4D6YA 2BFFA 4JSYA 2AJLI 1UJBA 1V71A 2OECA 5AJYA 3SBXA 2JIMA 1CWUA 5GOTA 4EB8A 1MP0A 3U2QA 4LWPA 2P11A 2Z8XA 4FFOA 1SN7A 2YXPX 3ENNA 2Z98A 4IVQA 3D3WB 1PJBA 3I23A 5DYGA 1FMJA 3RAFC 3HKBA 1NUAA 4BNMA 5FNVB 2WD7B 2YR0A 5H9VA 4ZHQF 4OU4A 1FTQA 2ROQA 3BMXA 1W96A 5KYYA 2RG7A 4LRSB 4UM8B 4PX2A 2V6FA 3UJ8A 1QUEA 4PM4A 4WXEA 2WUWE 3WRYA 3J81A 1ZVQA 1KVUA 2J59A 1GZ6A 2I2FA 2CUNA 4QU5A 3VR1A 3VPDA 5DU2A 1LJLA 5J47A 4IYJA 2J0EA 2JHGA 2A33A 3A9WA 3V80A 4RLFA 3X43A 3S29A 4ZYTA 3B6IA 4HV4A 2ZITA 2Z04A 1C4KA 1T8RA 2Q5HA 3MN1A 3ETHA 4BQSA 3UO8B 4AJ2A 3WA6A 1SAYA 2JBWA 3N1UA 2ID8A 4BKPA 2TS1A 1QTQA 3RQSA 2Z6UA 1PZMA 3U7QB 4BNKA 5JROA 2AI2A 3NJ8A 4AJPA 5IVPA 1OZ0A 1SOAA 3QHQA 1NUSA 4HLNA 1ZH6A 4AP6A 4WW0A 1JQDA 3AYXB 1C9KA 3NPAA 4HAUA 5FL7D 4R2XA 3EVEA 5J2UA 3DBLA 1GR1A 1GLGA 4FZ5A 3V8NA 1IHOA 2FAXA 3KS9A 2ZJFA 2VA8A 2X2FA 4RSRA 3ELBA 2WKSA 1OY1A 2XMDA 4IQ4A 4WNIA 4AECA 1G41A 3ND6A 5K0CA 4RETA 4X60A 4QOIA 2P7IA 4M0PA 2ZYWX 2COUA 1GD1O 4KIUA 4N76A 5FUXA 3H9QA 1RI1A 3OTIA 4FGJA 4RCZA 4K9RA 3PUHA 5FOVA 4YHBA 3CEAA 3R9KA 3OICA 1WW2A 3O31A 1TQ8A 3HCNA 4OHYA 1UAGA 1R9NA 1U5BB 2Q3DA 1EP3B 4MGYR 4NECA 2P2SA 1N9GB 5KYWA 3BWDD 4HLUC 1DO0A 3K0AB 1DAMA 3V1NA 3B3FA 3OJLA 2ZU0C 1TAQA 2BEKA 3HSYA 2ET6A 1H4TA 1T9DA 4X1YB 1K7YA 2B30A 4X44A 1A9RA 2BDUA 3JYNA 4GIBA 1XTZA 4ZQGA 1C9JA 1P4HA 5EPOA 1ZP6A 2WIDA 1USUA 2H8GA 4HEHA 5FBKA 4DYDA 4HNVA 2P1ZA 1IY8A 3D4LA 3KDPA 4DW8A 5KDDA 5E7IA 3VKHA 3JQ9C 1N7HA 3S7ZA 2C88A 2VNJA 3LXMA 5ALTA 2HJRA 2YWEA 1FE8A 1JDUA 1LDNA 1W29A 2MU1A 1MFZA 2RSLA 4GUAA 1V3TA 4OQZA 4WKGA 3ZW8A 4AURA 2CBXA 3B7PA 3I37X 1UJMA 3JYQA 4HL6A 3BE4A 4IOJA 4TXJA 3UUGA 3WGQA 4B43A 2JGDB 4AS3A 4S1OA 4RSMA 5K0BA 3G8YA 2XB2A 5A4FS 3U6BA 2A7XA 4QJ5A 2YHAA 1NP3A 3E1KA 4LG1A 4FU0A 3F98A 3K1YA 4WOBA 1TI7A 5CYFA 3TPCA 2WIAA 5KI6A 3HH8A 2WWHA 4ZVMA 2IDJA 3PHJA 5HZHA 4CGZA 4HDRA 3DM5A 3WOVA 4CKZA 4RL6A 1N1GA 5EIBD 2B82A 3X3HA 4MVJH 3R0JA 3U4GA 3M81A 2PUDA 5AUOB 4HDNA 1YWGO 1X7ZB 1U80A 1CYDA 1B73A 1DRJA 2DCUA 1FNDA 3MNFA 3PJGA 4J07A 5ECWA 2CLDX 5HEKA 1XLTA 3RVMA 3UH0A 1NFRA 4AVYA 1AQNA 1W0JD 5DH9A 2XTMA 3UWSA 4GSLA 1HDGO 3O4RA 3QTLA 2DFNA 2FZWA 2GF2A 2O2XA 1EJ2A 4J0EA 1EXMA 1JHUA 1KI2A 2PAAA 2ZXEA 3VC3A 3GLGE 4J2OA 3RVRA 3FSJX 2VZ0A 2QT0A 3KQNA 3VX3A 3HN7A 2VTBA 3JQRA 1ULSA 2WZBA 4Y8VA 4BNJA 3FE2A 1HTTA 4BX8A 3T7EA 3DG9A 4I46A 4KKVA 5F9MA 3CRVA 3L92A 1VHWA 4FFLA 3PFCA 1GKKA 3BMOB 4MUEA 4NPHA 1VI6A 1S02A 5FF9A 5BSEA 1J8MF 4K1XA 4MUGA 1RQ2A 1D2HA 3GW8A 1EP9A 4DLNA 3FUUA 5JXGA 3TMAA 1V4BA 3DCIA 3RS8A 5IKOA 4AXBA 5F2KA 5HF8A 3R4VA 1DT3A 1K08A 1M1YE 3CUEF 4BNDB 1C7ZA 1YNOA 2PVCA 2XOKA 3L6DA 3N2NA 3F9CA 4L72A 4OQ4A 4YJKA 5IK2D 1ZGHA 3P5SA 3KOZA 3RE1A 1E0AA 4M7WA 3GNTA 4UTVA 4II7A 1E4EA 2CSUA 4JWKA 2QRVB 2BFOA 2JW5A 1V25A 4GVXA 3UJBA 2V8OA 1SXHA 1BFKA 2JL1A 2DBVO 4PSUA 3S8MA 5ICSA 4MIYA 1LPNA 5C4MA 2GLUA 1XDSA 1ZQ1A 3L4SO 2C9DA 2BR3A 1SIUA 4ZCLA 1GUBA 1N6IA 1XOIA 2H08A 3E3OA 3IQZA 1P73A 4DM3A 3CBQA 4KX3A 4H6XA 5GM1A 1NXSA 3VHRA 1IZZA 2B34A 1TUBA 5TX7A 4Z54A 1KZ9A 1U2DC 1JSCA 4EJMA 1JYFA 1DRKA 1T36A 2C5GA 1JRLA 4TWZA 1ADBA 2EFCB 1CE8A 2QTHA 4LMPA 3D59A 3WIDA 1XZPA 3GYBA 2FF7A 3U6KA 2WF5A 4LZWA 4PU0A 4F9FA 4V2UA 3LRTA 3LDFA 5AVKA 2PQ6A 4PZYA 2OBXA 1G66A 1CJMA 4OQNA 1G7SA 2O8VA 4C4SA 5LYYA 1YAHA 1HDIA 3ML1A 2VAMA 2VP0A 4F4UA 3BRSA 1JDVA 1FQOA 1NBWB 1A9XB 1VYTA 1XLVA 3A8TA 2UV8A 4QFBA 3PNQA 3EGDA 4H60A 4MW1A 4ZMSA 1WB6A 2AQIA 1PJAA 2V9ZA 1HOTA 2XRZA 1N2EA 3OM8A 1N77A 2WFMA 3CZAA 4C6HA 4M1KA 1YBAA 2JIOA 3M5CA 4MA5A 3SJAA 3KTAA 4PX3A 4P2BA 1XXHE 2R8PA 1N5LA 3JQGA 3PF8A 4RULA 1ZS9A 4DA4A 1S2LA 3QKSA 5H3LA 4EUKA 5C5DA 1E8DA 1NUHA 3GLGA 1GFWA 1N2ZA 1NBEA 2HLNA 3FCCA 3GY0A 2VSYA 3PCXA 4GRDA 2CJWB 4KIGA 2I6UA 3TVTA 3OU2A 3SQMA 4YREA 3ZY6A 2B4YA 4RVCA 5IM5A 1KKMA 2R8XA 2X77A 2K87A 5B7NA 1N5RA 4OHPA 1B3BA 3ZE1B 5JTUA 2Z83A 3I45A 1C7FA 2V8BA 4MPTA 4BY9E 4LCBA 1WUIS 4OAQA 2Y1XA 3WNDA 1KGDA 4W8GA 4MQFB 4DV4B 1NVUQ 2NYVA 4FTWA 4K9NA 4ARSA 4RW0A 1M1YA 2D4AA 1MG5A 3DH0A 1FP4A 4XJXA 3V8VA 4OY3A 1BDBA 1ZY2A 4IJ5A 5AK4A 1OR8A 2IHBA 3IRUA 1KZ7B 1T0IA 3JD0A 3ACBA 3L06A 3R77A 4M1MA 1GYPA 2YXBA 1QHHA 1ZD8A 1IOWA 2AOXA 2PX8A 2WF9A 4XH9B 2HU5A 1RHMA 3S44A 1HQYE 2J8ZA 2YJ3A 4OJNA 2XT9A 2YV5A 3DWGA 2Y1FA 3G9XA 4RMGA 1W59A 4WPGA 5TMBA 4ZZ2A 4O4LA 4ZYYA 3QLUC 5GGYA 5K3BA 4FFSA 2C3OA 1Y9EA 4JY7A 1F0NA 3ZHOA 3FDZA 2I3AA 1IY2A 4CIWA 1DQSA 3RAEC 1JIQA 3AVTA 1K4KA 1H2HA 1JZQA 3QF4B 3QVGA 3IPYA 2FMHA 2I22A 2ZQYA 3PFBA 4ZQIA 1XZAA 3TUZC 3L8MA 2RHOA 1QIHA 1Z83A 4K6HA 3ZY4A 1AGNA 3AIKA 2IYLD 1PR1A 3DTNA 3P4YA 3LPMA 5DO9A 1CXZA 1EINA 4WLEA 3TQOA 3X44A 3ZHQA 1YL6A 2HIAA 4JDUA 4TKVA 1CQZA 2ZB2A 3GHYA 3DXFA 3A36A 3SJZA 1SUCA 3ZCVA 4EY4A 1T1GA 3BWBA 2FP4B 3EEQA 5E1MA 2O7SA 2WHPA 1Y9DA 1O9GA 1XU7A 3BMQB 5KVQA 2Q6KA 1L5VA 3T9CA 3NGLA 2X1VA 3G5TA 2FCAA 5FYDA 3D6HA 4LHXA 3CXRA 2CLKB 3IUBA 1GPUA 4ED9A 3AM1A 1QC5B 5IASA 1KK3A 3E2PA 1FBNA 1PQWA 4O4IF 3LLVA 1SXPA 2YICA 3QLEA 4PRLA 1W8DA 1CDDA 2ZT6A 1UWKA 1QHGA 3CRW1 1EFPA 4TZTA 1X14A 2QM0A 3ZWVA 1RC8A 4UUPA 3ZZTA 1N3BA 5GVSA 2O06A 1DC6A 3DDZX 2PT5A 3V4VB 2W2LA 1OWPA 1IHDA 1WEHA 3MERA 3NWBA 3QBVA 3TLXA 3E9NA 5G0UA 1FX0B 1W4ZA 1EE9A 1YB5A 5HILA 4K0KB 1FFHA 1QUFA 4OMCA 2WWGA 1OLUA 3IAS1 4G4IA 4GH5A 4IJ6A 5C5CA 1NTOA 2PL5A 4RPCA 3KQWA 2VSQA 3IAXA 5CTJA 2DHDA 4BMZA 4TQ9A 1L5QA 4P34A 1V5FA 2XUHA 3L7MA 4O02B 4ESOA 3EXFA 4LZPA 4YAIA 1W88A 2DBRA 4WA8A 4TMYA 5T6MA 4OF4A 5HR5A 4RQAA 4YMIA 1ULTA 1PHRA 4A6PA 2E9SA 4BP8A 4YIHA 3ND7A 3PCTA 1FIUA 1U9IC 2MR5A 3PQ4A 2J1LA 5COBA 1KO1A 2C78A 2XPCA 1FCJA 1PNRA 4ES6A 2JH8A 1P9RA 4US0R 5E7MA 3E2MA 3L41A 5E6UB 3IR7A 4NZYA 3VNRA 4UOEA 3TLAA 2OYSA 4XQCA 4CT0A 3EDQA 3REQB 5IF3A 4CCWA 1DC5A 3RUDA 4KI7A 2YOHA 1MDFA 3CLUD 2YYSA 2O3UA 3NXSA 4QGHA 1KYQA 1JAZA 1GN8A 2BCJQ 1FL9A 2AHOA 4COOA 1YQXA 2IOHA 5BUSA 3U1BA 1NVDA 2DC1A 2XCTB 1RABA 1LC3A 2NUAB 1XCMA 1Y8QA 1GUYA 2BTOA 2H5JA 3DUWA 5E38A 1ZC3A 1E63A 5JD4A 4URHA 3DEYX 4A92A 2A14A 3LQKA 2XF2A 3WGIA 1QPZA 1F0YA 3L1HA 4X71A 1V5WA 3DT8A 1WS6A 1DBVO 1GPBA 1LBHA 2YZNA 4JB0A 4MAMA 2M6LA 1NJFA 3DTVD 4BASA 1PG2A 3TW4A 5ADWA 1GRRA 3LP5A 4WVFA 2BHNA 4QTZA 4R7ZA 4Y9DA 3SC2B 1ISMA 4GKVA 3ZHUA 3A4MA 1PP4A 4FOSA 3EXHB 1LB1B 5GJVC 3WBKA 1TTTA 2YJNA 3H2KA 3QFTA 1RE1A 3CNOA 2ZT8A 3DHNA 3NYWA 4MO2A 2ZJ4A 1NQAO 3QPCA 2KPOA 3QW2A 4HAWA 1ISFA 5T5QA 1V2GA 2BWJA 4IAOA 4DADA 3U19A 2O05A 1W7AA 3SQNA 4X6LA 4EYSA 5DMHA 1Z13A 2R96A 4JB2A 3ZV6A 2HJ9A 4RHUA 4MCJA 4PAWA 5DBFA 3BXHA 1KDYA 1NVVR 1GGJA 1WDLA 1IAVA 5E4FA 4MQ5A 3VC2A 3FTEA 3C5WP 1UXHA 2ORED 4JVMA 3NC1C 3OVMA 1B16A 3HXTA 5C3MA 4IO1A 3LUHA 5AI4A 4E5DA 4TWRA 2ZJAA 5A9SA 4DUZB 4DKXA 3QE2A 1WNTA 1VQ1A 4RZ3A 2WYOA 3VI4B 2ZBRA 1LWOA 2YUTA 3BL8A 4QOFA 1XZCA 2ZDHA 5BMVB 5A0TA 3R9WA 2P2DA 1NLUA 1LLCA 4JLAA 1N2SA 4EX6A 4XFDA 4AJHA 1QQBA 3NDPA 2AT1A 2YXEA 4B33A 1L6RA 3QWBA 3SHWA 1DXQA 4DMFA 1EFRD 4OL9A 1AKYA 2AZTA 4KXUA 3M5PA 3TOSA 4GLOA 4RVFA 1IVSA 5JVDB 1TMOA 4IDPA 3W77A 2Q3HA 4E4YA 1U7OA 5DGCA 4YMUA 1I7DA 4FI3F 3TZKA 4AWXA 2HMSA 3RYIA 1O9BA 2UXCB 2O9JA 2VJQA 3ZG6A 2FP3A 1I2MA 5F3RA 3ER6A 3HDHA 3M5DA 5SY9A 2DTXA 2H2HA 2VP4A 3M9LA 4ZKDA 3QVTA 3H1GA 2W8BA 4MS1A 1YV9A 1GNQA 5SYMA 2I8AA 4DLZA 2Q4OA 3K8OE 1Q1AA 2WU0A 3NEAA 2A1IA 1FFSA 3DP7A 3AUUA 3EZFA 1L3CA 3QTTA 5L4LA 2C3UA 1SVLA 2G1KA 2O2GA 4BMDA 5EMKA 3QBEA 1NMYA 1G8KA 1UK7A 1DTWA 2I4OA 4R9NA 3PQCA 2NZUG 5EERA 3PPXA 3WP1B 5F23A 3SE0A 1P75A 2JKVA 3EIFA 4UPDA 4C5BA 3LWZA 4QECA 3UXEA 4MRAA 1GFSA 2P4SA 2XE6A 4C76A 3W8EA 3O4VA 1UKCA 1SUSA 2XJ9A 4A15A 1X0VA 3RFUA 3V9PA 3CVWA 5CT9A 2NTEA 3PNOA 5THKA 1OC4A 3TQIA 2IS4A 4B4DA 2EJCA 3BJRA 2WYWA 3KL4A 5F2EA 1A77A 1NI4A 1QNLA 2WHQA 1MC4A 1Z2EA 2RHHA 3F3YA 4EA9A 2RBGA 3LSTA 3ACDA 2RGAA 2QJTA 2QUHA 3R3YA 4YXWA 3AQIA 4Z4FA 1YTUA 3G8AA 1KHHA 1ZOLA 1QFZA 1I4OA 4KVZA 4H17A 1JFRA 3OOHA 5HZMA 5EZ6B 3RABA 1NE7A 4TUYA 3ZQ6A 1H2YA 5AVOA 1RP1A 2NAPA 4REOA 1G3UA 2FKNA 3H42B 2CL7X 1TD9A 2C4HA 1YRAA 2C2HA 1ZG3A 3FPSA 4LTNA 2CD7A 1RE0A 3HADA 1H8HA 3MT0A 2QRZA 2D2VA 3N86A 3ROEA 2BCGY 3KFLA 4A2PA 1AO0A 3FSEA 1AZSC 1XEAA 5JH7B 3V34A 1IM2A 4J6FA 4G8JA 2WABA 2PUWA 4H7HA 4ZQFA 3O2JA 1G2OA 3I4LA 3IP1A 3JATB 4XVRA 4OUDA 4AKTA 2CUTA 2P2LA 3EY9A 4C0LA 2FW1A 4DSNA 1VB5A 3M9WA 2FWRA 3U7JA 4Z4CA 3BYZA 3GN2A 1M2EA 3DXYA 4QATA 3MGBA 1SUIA 2ZWOA 2GARA 1KU0A 3KJQA 3MBOA 3PB3A 4MLPA 4NX2A 3I0MA 3NAMA 4FXOA 3T1NA 4E46A 1CJKC 3GJ0A 5DGHA 5TJHA 3TX6A 2TMKA 2NTJA 4GPBA 4L7QA 3RF7A 1GVHA 3H2HA 3OJXA 2CLLB 4JI5B 2A1UA 2NQ2C 2WV9A 3C7KA 5K3AA 4WKPA 4DIMA 4U5XA 5GJCA 4JP2A 1YB6A 3DKRA 3FPLA 3GT4A 4G0XA 4JCCA 4TLMB 4YJ3A 1NAIA 3U3MA 1Q0ZA 2YMMA 1UZUA 1YHZA 1IBCA 4JYMA 1TYBE 3A7EA 2XUKA 2IHZA 3BFPA 3Q8KA 4XUDA 1HO3A 1DRWA 5ALRA 3N0VA 1V8DA 1ZMXA 1C3EA 5FB3A 3WAJA 1T4CB 1UJNA 3FPKA 1AB6A 3GGSA 3IHWA 4X45A 3DQPA 1Y3AA 5BR7A 1DB3A 1E3WB 2Q3FA 2HB6A 2XUIA 4HB0A 4J43A 4XDZA 3D3JA 5KTKA 5EIWA 1JQEA 1OBCA 2VXCA 3RAGA 3LHSA 3KUCA 1NY5A 4M1QA 4D41A 1QK4A 2E82A 2ZSAA 3JQ7A 4GPTA 4UQOA 4ENSA 3VPBA 1WUJS 1HZZC 3GVIA 4P7JA 4E2XA 2DR0A 2VQDA 2JCGA 1JLHA 4OOFA 4DE5A 3AR9A 4IEIA 1CRZA 4FHEA 3ZJVA 2XY4A 3F67A 3DWEX 4DB2A 3OH8A 1YJQA 2ODEA 1HDZA 4WJLA 4B9AA 4D6PA 5JDIC 3EGCA 4L0QA 5DE3A 3TTWA 2QLJA 2OOSA 3KPYA 3BE6A 2VS1A 1ZH0A 3AVPA 3GGPA 4QUBA 4D3ZA 1IH8A 3DEIA 3SEFA 4YO7A 1FBTA 5KB3A 2H0QA 4FZRA 4TTTS 1C4OA 2VA9A 4F3CA 4YMLA 4AJEA 1OXTA 2XWBF 3O9VA 2P30A 1P1RA 3EC7A 4V03A 3CISA 3D0QA 1L5NA 4X7MA 4RS3A 1A82A 4QT0A 5BNFA 1F0PA 1MV8A 1OFUX 3F8TA 4HRAA 1Z75A 1ZEJA 5F5NA 3J7AC 1OXKB 2TSYB 4TXMA 1SCJA 1Y6RA 1H2ZA 2LE0A 4G84A 4E1AA 1CUCA 2HHAA 3L49A 3TLGA 2WDZA 3K9HA 1GPH1 4M7OA 1EX9A 3IEIA 2QUZA 4OHKA 1Z2OX 1CW2B 3WR5A 4BWVA 3ONWA 4NYJQ 2PIDA 4U2FA 1WDTA 4PRZA 3D4IA 4LE0A 4LYDA 1E58A 4CKWA 4KQGA 1WF6A 1GPDG 3RC3A 4HO1X 4AJLA 3AHIA 4PO9A 3H5RA 1RWNA 3JSAA 2QN7A 3QY9A 4HQLA 4QXOA 3V1TC 2D54A 5GP1A 1TM1E 4DCTA 3G2HA 1JXMA 2E3JA 2QZSA 5JG7A 4P82A 3SKYA 3FOCA 4LYJA 3LCUA 1X1BA 1T8SA 2NO1A 2XHEA 3BAFA 3WLPA 2VJKA 1O95C 2JJQA 2QZZA 1WMAA 3IIEA 4PZUA 3MT9A 4N0DA 2Q2VA 4IQ8A 1C3OB 3MSXA 4ZZ3A 3T3NA 1KYTA 5B64A 4JAVC 1DJLA 2XAAA 2C2XA 1F17A 1Q0RA 4QFDA 4DCNA 3RUPA 4BLOA 3FVRA 5JE8A 1RXVA 2PZAA 4X9XA 3I9OA 4DNXA 3TW0A 4U6QA 4CHTA 1NNUA 2HZBA 3CWZA 1BDIA 2AI3A 3UTDA 1MO4A 2IS1A 3Q8WA 4FJ2A 5KX5B 4GQAA 4WLOA 2QD1A 3B51X 2PLAA 1UF9A 3BDAA 3PC4A 5CFPA 1GO2A 2PVPA 3C6QA 3RJ5A 5JI3E 1K0UA 3ONEA 3O74A 4LF4B 2LNDA 2ZUVA 3FDJA 3FUVA 5TMEA 1YO6A 2QD3A 1P5ZB 2I8CA 3DAHA 4TTVA 1Z8NA 1EFCA 3AILA 3ONFA 5CVUA 1R9GA 5JISA 4MRSA 3UKDA 1NNLA 2C5EA 3CMCO 3FPFA 3ONVA 4KOAA 5H81A 1U0TA 2BLNA 4CNQA 1BMQA 4J76A 4IYRA 5E4JA 4GOND 2VYVA 4IH4A 2Y67A 3KAQA 2DWCA 1RQGA 3Q4GA 6NULA 3K73O 8ADHA 4KFCA 1DMSA 4X91A 2AZDA 3HZRA 3GGDA 3KB6A 4W9MC 2RHGB 1FFAA 3KVYA 1NMQA 4DY4A 1BEEA 3L02A 1DEAA 3DCYA 3W04A 2IQIA 3GO4A 4I5DA 4MZDA 4G1BA 2J3QA 3NHZA 3OF2A 1QIGA 2GYWA 3HXLA 3PYLA 4DRXB 1I3OA 4BFXA 2QXYA 3MCUA 4BLQA 4DJJA 5LXTB 5KOJB 4YT2A 2X1MA 1QFYA 4PFKA 4JIMA 4TV9B 2NZ8A 3F9RA 1XE3A 2OEPA 4P8RA 4ZIRB 1ZK4A 2ONYA 2WUVA 4R9RA 2B1JA 4RDHA 2WD8A 3STHA 3W6ZA 3PI6A 4PAGA 2ZYVX 1QVWA 2Y0DA 2IF0A 3C41J 3AEUA 2AGVA 3I6ZA 3NTOA 1BRMA 4UBLA 2GTPA 2WAAA 2XKJE 4A16A 4D2IA 1PNVA 3K2IA 4TLBA 3CZPA 4R05A 5ECDA 3ZWYA 1GAJA 4IQ0A 3KWJA 4KOEC 4QG7A 1GYQA 2GFHA 4C3UA 3EXG2 3P27A 4NY1A 5HRCA 1UINA 2A3NA 1U8CB 2XQJA 3QLVA 3F6SA 5K0FA 1NUPA 2VZEA 3JQAD 3FLEA 4PG5A 1VKHA 5A4KA 4B3TB 3QTBA 4PS0A 4RK1A 1D03A 3BEDA 4C78A 1KAOA 1F8YA 4IGKA 2W70A 1IBMB 4BYGA 2OD2A 1V8ZA 3ULKA 5I7SA 2PYZA 5KWVA 1A2QA 2XH8A 4XGIA 3RD5A 3OPYA 4TKUB 4B31A 3ES9A 3TX2A 3WWEA 1CIJA 3HL0A 1NR1A 1U7DA 5M7EA 2QY9A 1N92A 1UQRA 2VFAA 4H6VA 1ONPA 2ZANA 1M2HA 2K5UA 4ER5A 2E87A 4YJ2A 3NDBB 3BILA 3BH7A 3UHAA 3EGOA 1U28A 4WESA 1BGXT 3AJEA 3AV0B 1Y4ZA 2C2KA 3G79A 4Y9TA 3L7LA 4MGKR 1SVKA 2RJOA 3WMWA 1VYVA 3Q2KA 5A04A 4CMEC 5K01A 4KLNA 4HDMA 3G5UA 2X0JA 3KLNA 4KR0A 1KS9A 1L4FA 4ZVUA 3GLFE 4FC6A 2G5GX 3QVWA 2RARA 5TF4A 3WKAA 4G3XA 3AUJB 3P2OA 2H1WA 1RJDA 2R6FA 1SXIA 1YB2A 3AWDA 4JBYA 3RIEA 3SICE 4CR6A 4CEIB 4MRMA 5CUQA 1EFVB 4L27A 3VJMA 1O97C 3WK5A 3CVVA 1H1TA 3A2KA 4DR6B 3SZLA 2X8WA 5CGQB 3GZTB 2DXIA 1J9ZA 5CU7A 1WB4A 2FX5A 2BF7A 3T15A 4LRTB 3HY3A 2XBMA 2F3PA 2WWVD 4KO4S 4FI3C 4UPVA 5JQWA 2BFWA 2GK3A 4EBFA 2IL1A 4YMVA 5CVJA 5KJ6A 1PV2A 4H6WA 2PRYA 3C3CA 1KSFX 4RESA 4RV5A 5IVKA 3L4BA 3PUKA 3EMVA 4GI2A 4OTZA 3UK2A 2GI4A 4HGPA 5JJIA 1JECA 1GZ5A 1ZW6A 2QTFA 4ER0A 3TIXB 1N0UA 1G18A 1C1YA 1U8EA 3A6FA 4FD3A 4HNUA 5LP6A 3OESA 4MIEA 4A1OA 2FFRA 1JTVA 2MSDB 2F3UA 4MR9A 1BA3A 1QOZA 1JLLB 3A2MA 2CDNA 1B8PA 1E7WA 1YBFA 2H4ZA 4IFTA 2N9UA 2CV0A 3VR6D 2IPOA 4NIMA 3D8SA 2YNMC 4WIAA 4R7GA 4CW7A 2W2KB 4D4LA 5JJCA 3LXXA 3R2JA 3CUVA 1TMGE 3RK1A 1W8IA 1L7PA 3D3QA 2G77B 4B85A 5FDFA 1YZKA 1HL7A 2ALJA 4N01A 4CF7A 3KYCB 3DD5A 1ZEMA 4WVLA 3AIIA 4YMHA 4IFEA 5KNCA 1S4MA 1WW8A 4LJYA 4QGBA 1WXIA 3WB1A 3D54D 4MICA 2XB9A 3IKTA 1FSZA 4M49A 1YDWA 2XHZA 3CVJA 1CEXA 3IP5A 3VR5D 4CM8B 4X41A 4ZHQB 2JJ1A 4CTKA 3BGSA 5TRTA 3MF4A 2HRZA 1JG2A 3MWKA 3PEEA 5IT4A 3CH6A 5BORA 3OJCA 5D3MB 3WDSA 3Q7EA 2IXEA 2MSCB 2PZ8A 2C7QA 1VLQA 1OXVA 1PK9A 3LUCA 4ZOLB 4RTNA 3LLMA 3B20A 3DMNA 7REQB 5KU7A 3QEBZ 4C07A 3VFDA 2FRDA 1Q84A 2OHOA 3FYCA 4J7AA 2O3JA 2Q0XA 4LJ4A 1SXQA 5EJ2A 5C9ZA 3ND9A 4GLBA 1RRGA 1AQUA 1AF4A 3PFGA 3U4HA 1L6IA 4A03A 1GV0A 1B7GO 1DDOA 1KR2A 1W93A 2LD4A 2IXGA 1RD4A 2OXEA 4OK5A 4OXQA 4D74A 3LK6A 1XMQB 1JAXA 1C0PA 4JKYA 1R6XA 1F3OA 4AUKA 3DSRA 2NVUB 4ESVA 1WLYA 5JNRA 1U7PA 2VCHA 1X42A 4DJFC 3V8EA 4JL8A 3OOYA 4O2BA 3HB4X 3T7DA 1T5OA 1OFGA 2OA0A 2XSZA 1EDOA 4D3XA 2FDXA 1G5FA 1RIFA 4MOWA 2QVBA 1HQKA 4Y0VA 2NN3C 2A9OA 5HKAA 1CQJB 1T8YA 4WASA 2VG8A 1X1RA 2IYUA 4HYYA 3UK0A 4O2RA 4MPJA 1DRVA 3TR6A 4INOA 2WUFA 3ZWCA 4JENA 4UNQA 1IULA 4LNUB 3NIFB 2QAJA 3AZQA 1B41A 5LR6A 2FK8A 3FW1A 3WMGA 1M5UA 4MEBA 1W0KA 5JWRA 1YOVA 3QV1A 2BZ1A 4DABA 5KKCA 4G41A 2XVXA 4RH0A 1HG0A 1MX5A 1B14A 3P0FA 2PBLA 2WI8A 4HMQA 4LW8A 1ZW1A 3Q3EA 4NEGA 1TZBA 1YH3A 4FGUA 4PC1A 4ZVOA 1HYGA 1OVGA 3RG2A 1YB7A 4NQRA 2CVOA 3FNRA 1CHDA 3BWVA 1U81A 3OMLA 2QTZA 4P7KA 5HFAA 5CLJA 4UQPA 2PKXA 3ZX4A 3K1TA 5MHTA 3THWB 4CNBA 1KOLA 2P6UA 4NC9A 4KXVA 2PX0A 2NTVA 1G6OA 1NF9A 2V0NA 1J99A 3N7UA 4PYOA 1UBEA 4DOMA 3U3XA 3ELDA 2IVZA 1WG8A 4YDRA 1Y1TA 5I8WA 1P2DA 2BZSA 4Q9JA 3WGOA 1SD1A 5DPMA 1U3FA 2DH6A 1AQJA 3PF9A 3QEKA 4CQLB 3D7MA 3PFKA 4G07A 2FN4A 1E66A 4G97A 3ZS8A 4XWOA 1AKEA 1DFGA 2R25B 4KO3S 4U7PB 3NC0C 1GL9B 2BBWA 1ZD4A 2ZIFA 3W5VA 3CFYA 4G4SP 4TKLA 4KPFC 3ZHXA 5A4AA 2P1RA 3T4UA 1II9A 1S89A 3IHLA 2OV2A 5HIAA 5H0IA 4K6MA 3L0YA 1V39A 2ODWA 4CM4A 5KPDA 10MHA 1AA9A 3ZDXB 2PUTA 1PS8A 2IC5A 3PDIA 2HT1A 4L4YA 3H04A 1QPGA 2GH1A 1G60A 2G25A 4AS1A 4J4HA 1UDXA 4JYCA 4BQIA 4YV7A 2FVYA 1H6BA 5HA5A 2I67A 5CT8A 3T1HB 3KYJB 4FNGA 3CJTA 621PA 3VZCA 3KC2A 4G1MB 3KHUA 4KWTA 4EQ6B 1MOQA 5L51A 1DX6A 2DCMA 1OV4A 1UL1X 3Q8LA 1N1DA 1XROA 1YQEA 2DJIA 3B6KA 3BVPA 4IX9A 4O0LA 1Y3CE 3PC3A 5ALOA 3SF0A 1K89A 1N57A 2Z30A 2CMGA 5TLSA 3VZSA 3MIZA 4FNMA 4KN9S 4MVJE 1ZMOA 3K8QA 3WI7A 2ERYA 1ZVVA 3A6GA 4LWOA 5DT2A 5G4LA 3LHKA 3UJ9A 1JR3D 3T95A 4D3DA 1QV9A 3BD7A 2JLAA 5ALSA 4C30A 3UGJA 1H1LB 1SBTA 2WYIA 2H7CA 2ZWMA 2QRHA 3NEYA 5EUQB 1Z0AA 3I1FA 4AY5A 5JAOA 1V0JA 1VECA 4R81A 3FYUC 1T8UA 3GMTA 2ES4A 4FJ1A 4N9WA 4BKOA 3TD2A 3SS9X 2R1TA 4GZ5A 4TKMA 4F3NA 2Z57A 4X63A 4C03A 3LL4A 4Y2GA 4EJ0A 4B48A 4GMHA 1XKXA 2H16A 3TZEA 2G8LA 3UG6A 1J1IA 2PAFA 1CR6A 1GUZA 4U00A 2VDWB 2Y6UA 4NV0A 1C3LA 5DW3A 5EZYA 1VMKA 3S2FA 1G8YA 4PANA 4QG3A 3H5LA 1Q15A 2G4LA 1VDZA 5M2QA 2PUBA 1DKNA 1XA0A 3EYWA 3NJ4A 4AFNA 4E5KA 1TZ2A 3SJ7A 4HGNA 4ZI7F 1YZFA 1WBBA 2W6QA 5A71A 4DEXA 3VPFA 4FOTA 4R1UA 3IULA 4RVDA 3C3DA 3AF5A 2IVFA 3CUYA 2C95A 2BMEA 2FW6A 2FYTA 3A04A 3CC8A 4K81B 4OHBA 2BFCB 1CR4A 2BGRA 2MOKA 4DCOA 5BY2A 4KQFA 4RAQA 4E5MA 4EGJA 4RVUA 1LBQA 2J9RA 2OT3B 1LQUA 1ZRMA 3KRTA 1QTRA 3LVQE 2CNWA 4JP3A 1ESNA 2CHUA 4N7RA 5EJ6A 1AKTA 3GRAA 2PSDA 2PSJA 3X1DA 3ZWAA 1QGAA 2IOFK 4CEHA 1UKAA 1VCHA 4BNUA 1W46A 1OPRA 1ZD3A 4J0KA 4DMUB 2A5YB 4E7PA 2RH9B 1D6SA 3A2LA 4WAUA 3MJSA 3OLCX 2DHCA 4GEGA 4ZI3A 5JNVA 4ZT2A 5K8LA 1F2TB 3AI7A 2QLTA 5FUVA 1DBIA 1LD3A 1M6EX 2QVCA 4D4GA 3PWTA 3GPIA 3OMWA 2NQTA 1X1TA 4B1FA 1CUXA 2C4VA 5IEBA 3SZOA 5JSZA 3B6JA 3HV0A 1J1UA 3I39X 2LXNA 2ECKA 4UHBA 2I66A 3BIFA 3SHOA 1E9AA 1QRRA 5KTSA 5GPBA 1K3FA 1JDZA 1MVLA 3PA6A 1I1NA 4YAEA 4AZ3B 1X80A 2BGJA 1XXLA 2ZM6B 5BSWA 2QNBA 2VWGA 3W9BA 4B73A 2YZ7A 3HCPA 1UPBA 2DFDA 4E2YA 5DHRA 1I2CA 2YL2A 4AU1A 4EB6B 1ODSA 5EXDA 4KBGA 1IHYA 3FZNA 1NNEA 2Q5IA 3TYXA 1R66A 3TKLA 3LIIA 4XYGA 4Q1CA 4NYIR 1CVIA 1ZLYA 1MVOA 4GX5A 3BIWA 5BMOA 5JYDA 2ERCA 1P1HA 2B9EA 4LK2A 5EAIA 3T7KA 3CW2A 1Y7LA 3RAJA 5AW6A 4B6GA 2IY7A 2VJMA 2PSSA 2IOFA 1SUEA 1ZXXA 4BB6A 4FYJA 1KDOA 1W4BA 1NNSA 2Y9PB 3DZ8A 1N9ZA 1WY7A 2IA5A 3RW9A 1TAHA 2CBZA 1NJ1A 1L7OA 1NRJB 3AOGA 3NAQA 4OFBA 2WTMA 3T5TA 5H1YA 3TTXA 3WKBA 1FFCA 2WQZA 2IHVA 1LX7A 3LX4A 3ZU2A 4DQLA 5F21A 4QYIA 3I64A 4RXMA 1SXJE 1R0LA 3I3OA 1USGA 3TSCA 1OGJA 2ZRAA 4O1MA 5I01A 3ERCA 4TZ0A 4MYUA 5BR4A 3KOXA 4S1PA 5EKDA 3FNBA 4KGDA 4YJHB 3O8BA 4DXAA 4MYSA 4RHTA 3JAKB 4OXYA 2HO4A 2OC9A 2V96A 3I3SR 3TLKA 2VDMB 3AONB 3CU5A 1G6KA 1MABB 1RLOA 2HBYA 3NWJA 5FJIA 3HM9A 4ZO6A 1G4UR 3EULA 3MUEA 2QP4A 4WSOA 2QX8A 1Z5ZA 3TWOA 3ZYZA 2VHZA 3ROZA 4F93B 1FRZA 2OCAA 4CCYA 1YT5A 4M88A 4W5NA 2C8KA 3I32A 1K8ZB 1OZGA 2F67A 1ISGA 4XIYA 3U0VA 3AVOA 5AVZA 1W4CA 4J03A 1V4NA 2GEFA 3BCRA 5EWMA 5EJIA 5KTTA 4EHDA 3BQ9A 1F9AA 2F48A 5FL7A 1RXIA 1TVCA 3IR5A 1VL2A 4J3FA 4JGBA 5A0FA 2B92A 1PX0A 3HVHA 1YE5A 3F7TA 1TT7A 2VJLA 2OCDA 4F5WA 5A6SA 4RVNA 4XX0A 1V6AA 2VWPA 1CU1A 3HXMA 1XZNA 1Q3TA 2HPHA 3CE9A 3IODA 2Q5OA 3HRIA 3RNLA 4ZC8A 4P0QB 3H0KA 2FUCA 4KUHA 4Q4HA 4DLYA 1BX1A 3E35A 3GRUA 3P0HA 2XRMA 3TR5A 2Q3JA 1L4HA 3ADOA 4IHJF 3CRNA 4INZA 2FHPA 2J9ZB 1D1TA 1VSQA 2W9XA 4N6NA 4QUHA 4RXUA 4ESEA 5J2TA 3VU9B 1NQOA 2FQ1A 2D59A 2GPAA 2L0XA 3OPYI 3PIIA 1FUEA 3GCXA 3EBOA 3VX4A 2XCIA 2KMLA 1XEFA 5THXA 3REGA 4FSHA 4HPJB 1CG6A 1Q12A 3S0JA 5IMSA 2ZJ1A 3M4YA 2X7XA 4CMIB 2WB4A 1MDBA 3BRCA 2C5AA 1HV8A 3LYHA 3LF2A 4KO1S 1GHTA 3HRKA 4IY1A 1PI3A 1J22A 3K05A 1B76A 1MB3A 1XEXB 3F6YA 5ITVA 3LDUA 1JAIA 1YFZA 3ENKA 1XVUA 2HK9A 1QQ7A 1KAQA 4YFYA 2F1RA 2HDWA 5KSPA 2YBDA 2I78A 3CX6A 3IBYA 1Z68A 2G5PA 3NHMA 4MI1A 5MN4A 2CXTA 1DEOA 4MROA 1K3TA 4DMRA 1TYZA 1OE0A 1SZPA 1Z74A 1QKJA 4LGCA 2ZRHA 4PYMA 4ZT7A 3PUZA 5LLDA 4OU5A 2AFRA 2IODA 4XB2A 1W2HA 4HGZA 4OHFA 3E05A 1PDVA 1SJ9A 3U9TA 4BO3A 2VJOA 2HKIA 3PTLA 3QMMA 2AN1A 4Q05A 5EQJB 4V0RA 1MJ5A 2P4UA 3KFXA 4GHWA 3W6PA 3TOVA 4KXXA 4OXIA 3M6XA 2WWWA 2Y92A 4XD7A 5CXXA 5J1TB 2AZXA 4O5OA 1VKOA 1RLIA 2W2OA 1W581 1DKPA 1IN5A 1N2IA 1XHLA 1GQRA 2FPIB 2P2GA 3CBGA 4XSHA 5INTA 1CZOA 3EPLA 1NF8A 5FPSA 4OMUA 1FJ2A 4JYAB 3NTVA 2I5PO 1B3RA 1H94A 1W0JA 3QLJA 3VZDA 1P7VA 4KDRA 4U2DA 1KFKB 3D6FA 1USIA 4Q39A 5ES3A 4A91A 5FL3A 4A6DA 5LQUA 1E0KA 3KLBA 3MSCA 5AXDA 4Z53A 2KLBA 1SHZA 1XYVA 2OCGA 4LPKA 4JT4A 4L3WA 4KN8A 3V6MA 4WY2A 1Q11A 2HM7A 5DN9A 4FEGA 3S99A 1QBKC 1PGNA 5C81A 2XZTA 3B1VA 2JLWA 1XJQA 1ZD5A 1JVSA 4E15A 3TQCA 2I6TA 1KQPA 1KJNA 4MAAA 4XEUA 1PFVA 1GRVA 2RGEA 4B87A 1QP7A 3N9IA 3TDNA 4BE4A 2R44A 3FCSB 3GAAA 3RS7A 1OYWA 1A7UA 1KETA 4M0FA 3HNOA 4BXOB 4OO3A 1II8A 3ABSB 4B79A 3WWPA 1ZZGA 1QOQB 1TUIA 4LDQA 4LXUA 4U63A 1TRHA 1AU9A 2OZKA 2B69A 1Z0KA 4OHOA 4C3ZA 1H3EA 4QUAA 1FP1D 2HEIA 4HZIA 1NXWA 5IK2A 1BDJA 1LFAA 2C4WA 3HB5X 4F2DA 3RUAA 2PRJA 4ZT4A 4C6TB 4WACA 4Z99A 3UIEA 3U4MA 3ROQA 4XDYA 3C4VA 4DCVA 4KW7A 4LIPD 3TW8A 2GZSA 1H5QA 2VPIA 3DMPA 5HS6A 1JE0A 1RLMA 1JMYA 2QMZA 3FGOA 2UVPB 3O2SB 1U0GA 1GCIA 3OIGA 4MV5A 4PC7A 4EMTA 4F8EA 1XEWY 4XGNA 4PYJA 5CDGA 1WPGA 1IE3A 1PYOA 2SCUB 4FLMA 3G17A 4O3MA 3NC4A 4KDEA 4PQEA 2O7QA 1FOEB 1S01A 3BH0A 2W2NA 3HB7A 3WNQA 2VH1A 2C42A 1KA9H 3EWNA 1Y81A 1NVKA 2M6RA 3GFQA 2QD4A 1EFAA 1OBOA 3H8JA 2OB2A 4CIYA 4ZKEA 1GWNA 5C3UA 1I30A 3WO1A 1IC6A 2EFDB 5EVCA 5FBQB 1QRAA 1SB8A 2ZT5A 1S7GA 1R27A 5C8XA 5TPWA 2E4AA 3C48A 3MGKA 3Q6MA 2CT8A 1M6VA 3PFIA 4UASA 2XOEA 3AUAA 5JNWA 4MGZR 3V2IA 1FVOA 2GZMA 3GELA 5KTYA 2LCIA 1ZI9A 3RLIA 1TA4A 2YUIA 1G9SA 1NYTA 1U8FO 2YJZA 1U2EA 2RKBA 5CDYA 2HA0A 4BIMA 4POAA 1TQ2A 4JI0B 1U2ZA 4WLNA 1H4VB 3E4DA 1Z2CA 4XIFA 3R7FA 3HCEA 4C7VA 2EFEB 1GLNA 5FLEX 1Y6JA 5E3IA 1LU9A 2I4TA 2QMHA 2P40A 4BV8A 1ZK1A 3UMBA 3CZCA 4EA7A 4KITB 2DY1A 2FSVA 4OLHA 1AMOA 2AHRA 5FIUA 1FMTA 1WSWA 3ZXYA 1GA1A 1WD5A 3UGTA 1AURA 1BO6A 1HWYA 4BQQA 4BWFB 1ZIOA 1F48A 1J09A 2G70A 3O7WA 5HUHA 3IVMA 5KYUB 1DT5A 3QX3A 2ZSKA 3ICWA 4PLYA 4CIAA 2E5WA 5EXSA 5CFQA 2XZPA 3H97A 5BOSA 3JZMA 2X58A 3ZE8A 1OAOA 3WGZA 3PSHA 4R8VA 1ZIDA 1BXKA 3EAGA 3DV0A 2ZJOA 3EEBA 3P4UA 5TS3A 5G0WA 4L16A 3A1EA 3Q6NA 1VE5A 3ETCA 1YOBA 1MRZA 1VHTA 1A4RA 1LK0A 3ZXXA 4EW1A 3CA8A 4QBIA 2A0UA 1VI5A 1YCDA 3IBFA 4GYWA 4M0MA 1VFNA 4X84A 5F9HA 2HPAA 4KYTA 1YKGA 2XDQB 4JELA 4XWAA 2HLPA 2VLBA 3WGTA 1WY5A 5D8DA 1TFUA 4YONB 2C04A 3UW3A 2XECA 3A9CA 2JK1A 1XWWA 3W8NA 4DLBA 2A5DA 4CG0A 1OU0A 3EF1A 3F0TA 3PR3A 1FZQA 1G8FA 3BWXA 2N1MA 1NYLA 2PJZA 1SUPA 4WY8A 2P0AA 2H1HA 1NVFA 2WSBA 3FCEA 3BBLA 5G02A 3TPZA 2G0TA 3S8EA 1DBSA 1U11A 3OJWA 1KFJB 3H4IA 2OBYA 1U7WA 5B6JA 3LD9A 2O8BB 1JLRA 1N2JA 3TLEA 2IEBA 5TEVA 2IYAA 3SYLA 4XJVA 4UU1A 4DZZA 3TJRA 2H63A 3G1TA 1U3VA 5K4GA 5MFZA 2BFFB 3A9RA 3R3WA 3MZ0A 4LV6A 4QAQA 3MMXA 4U7WA 2XDWA 2YRFA 4OM8A 2W42A 3L7KA 3B9PA 1PFWA 1AQ6A 5B2ZA 5IZ4A 3GFFA 1Z0ZA 4KQMA 2Y4OA 1KEPA 4OP2A 4C9BA 3NVKI 5HGXA 4YAOA 1XRPA 5BN5B 5K8JB 3AM5A 1V3QE 1K1EA 3S1AA 2VHCA 5KYYB 1OYOA 4BMCA 1K98A 2CFSA 4DR4B 1GQ2A 2LDBA 1BWSA 1RAFA 3W05A 3G5AA 3PA8A 3FFWA 5L3RA 4DM7A 1SUWA 3JARA 4K9PA 2C57A 1WOMA 3DFUA 3FFBA 3I30X 4F3KA 3H9BA 3NRBA 1A1VA 2ZPAA 3D7SA 3DKIA 5D5QA 1I2ZA 4JC4A 3FNEA 5CFZA 1PFQA 1ORIA 1EVQA 1Y0BA 1Z56C 2VF4X 4K2HA 1IN8A 1ZVMA 1EVYA 3HR4A 2R6DA 4RANA 3I9V6 4V02A 4H18A 2RGWA 4ND8A 3UATA 1UKZA 3I01M 1ZJZA 3PUJA 1FVFA 1VP9A 4RK4A 2PT6A 3UV7A 2WHEA 3CWCA 1PT7A 3DMDA 4OQYA 2IX3A 1VSUA 1JP7A 4KU4A 4B6JA 1D8TA 2QTAA 3V7WA 1L4LA 1VG1A 3S81A 5HRUA 4XOUA 2HIHA 3ABQB 3G2MA 2W71A 3KG2A 5J2UB 3FBWA 4IS2A 2W0MA 2LV8A 4BEBA 1M8PA 5BYKA 5GIOE 3C6MA 3WX0A 2QXTA 1RZUA 3QOXA 3D7NA 4K28A 2OBBA 1G9TA 3NPMA 1OILA 3O8OA 4PPGA 4ZPXA 1ACMA 3U3OA 2CXRA 1QR2A 4LHWA 3QG1A 2WSLA 4RLHA 1ZWKA 3V97A 1NOIA 3WOHA 1VBNA 2XNHA 3GN1A 4C0WA 2B6HA 3LLSA 4FMDF 2QBYA 1F20A 5GIPE 2AD5A 4RH3A 3HYTA 4ILEA 2NT4A 5LMNB 1HG1A 1K5PA 1KARA 2ECOA 3ASYA 5EQTA 4RPLA 1AUPA 4ER6A 2J0VA 1Z45A 1ZUNB 3C3YA 4LUCA 4RCVA 5L7TA 4IV8A 4J1QA 2IUSA 3LUFA 1GGHA 4N5DA 4CTNA 2X2EA 1ISPA 1KEZA 3UM9A 4YA6A 3VPCA 2I2BA 3X1YA 5IUJC 2HNKA 3L0OA 4EJFA 3K0FA 1YDMA 1JFVA 3GJSA 3N2LA 4P5PA 3PNKA 4P4UA 1IY0A 3DTVA 2O2HA 3CNHA 4AQYB 5LFAA 1FTWA 1J90A 1AZWA 2HMWA 2ZAOA 3RU3A 4XIJA 4LF7B 5KSOA 1JPNA 3H3JA 2QLBA 2V7VA 1HFEL 3DE1X 1LLQA 1JH9A 2Y0CA 1B1AA 4NCKA 4IDCA 2BGTA 4ALKA 4BX3A 1G16A 5BW5A 1GDDA 3FY4A 5EC8A 3WLKX 2UUPA 2DQKA 1KOJA 2P9HA 2I3DA 2VNHA 1K3UB 4FILA 4UDXX 2E55A 2H0AA 4X54A 4Y2QA 2Z58A 2FZLA 1RQRA 2V45A 1Y89A 2BZGA 2R1UA 4KVGA 4KC0A 1YQWA 4G0PA 4RFVA 3UN1A 1L5FA 3L43A 4IQGA 3ZTTA 1JHYA 3ISTA 1IN4A 2YWHA 1POWA 1WDKA 1Z8FA 5CAEA 1G8MA 4J49A 4L74A 2QMUA 4JYPA 2QRJA 1KIAA 4L5IA 4NOLA 2H17A 2CLSA 5JS8A 4IGAA 4FCCA 4R3NA 1E5XA 1KZ4A 3P45A 1S8FA 4V0QA 3OE7D 1P44A 3SR0A 2O8DB 5AUQA 2H48A 1WDWB 3NBAA 1OI2A 4HDNB 4MVXA 4I0WB 5J4YA 4OXKA 4YRKA 3X1ZA 3C98A 5FCDA 4F3TA 3RIXA 2P6RA 2G0NA 4D9BA 4BJ5A 5BSTA 1D6NA 1M3SA 4CKXA 2XT6A 3F1LA 3FUTA 3QI2A 3E3AA 3HHPA 1WHSA 2PZGA 4HUTA 3SFZA 4MUBA 3QHPA 3HBMA 1EFRA 4FZJA 4DLKA 4FEEA 2X9GA 3HI4A 1QYDA 2VTBB 3EG9B 1AS0A 4YWHA 4EA6A 5K05A 4RPKA 2H2DA 4UZEA 1TUGA 4UVIA 3WGVA 3V8RA 5C7LO 3T7SA 5AVVA 4OI4A 4X66B 4ZVLA 3ZE9A 4LQCA 3UAWA 3TGPA 1AJEA 3CF2A 1EE2A 3ND8A 4JBNA 3W3ZB 1SU7A 3AUTA 1ML3A 2QPTA 1E1QD 4Q7JB 2CXXA 1NM5C 4X6UA 4BMXA 5KDLA 4MJ3A 1XIVA 1Z6GA 1CKEA 2DECA 4K9DA 4JB8A 1HM5A 1FPQA 3BTUA 3MWFA 4XM2A 4L9WA 4EARA 3FOEC 3JWGA 1EK6A 2OGUA 4HGRA 4IIJF 3HA2A 4R0NA 1L7RA 3MFQA 5JHHB 4FHDA 3FETA 2OWEA 3PE6A 4GR4A 5ALWA 4Q47A 4Z4HA 4YCCA 5IYZF 2FQYA 3EF0A 3WL8A 1E4EB 1H85A 4EGFA 1AQLA 4E33A 2PRSA 3CH4B 3U3DA 5ENVA 2VH5R 3KR9A 4YP7A 1Q92A 4A9AA 3EMKA 3NIGB 4PCUA 4NENA