1DEOA

Rhamnogalacturonan acetylesterase from aspergillus aculeatus at 1.55 a resolution with so4 in the active site
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
233
structure length
233
Chain Sequence
b'TTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVLTTTSFEGTCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHAMNOGALACTURONAN ACETYLESTERASE
publication title Rhamnogalacturonan acetylesterase elucidates the structure and function of a new family of hydrolases.
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
total genus 74
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.86: Rhamnogalacturonan acetylesterase.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1deoA00
2Q0SA 1BWPA 2WAOA 4K40A 4NRDA 1J00A 5BN1A 4OAPA 3PT5A 3KVNA 2O14A 2HSJA 1PP4A 2W9XA 3C1UA 5CD9A 3U37A 1ESDA 2VPTA 3RJTA 4RW0A 1WABA 1ZMBA 4I8IA 1BWQA 4JJ4A 1FXWF 4OAOA 4HYQA 3W7VA 1DEXA 4H08A 4K9SA 1ESEA 1V2GA 3DT6A 4DEVA 1U8UA 1VYHA 1DEOA 1K7CA 3MILA 2APJA 2WAAA 3DCIA 1FXWA 5JD3A 4JJ6A 4S1PA 1IVNA 4M8KA 3HP4A 3P94A 2WABA 4TX1A 5A4AA 5B5SA 4JGGA 3SKVA 4K7JA 4K3UA 4Q9AA 3DT8A 4LHSA 1ES9A 1Z8HA 4XVHA 4Q7QA 4HF7A 4RSHA 1JRLA 4JHLA 4JKOA 3SLRA 4PPYA 5HOEA 1ESCA 2Q0QA 1YZFA 4IYJA 1BWRA 3DT9A 3DC7A 1VJGA 3BZWA
chains in the Genus database with same CATH superfamily
1NJ8A 4BN4A 4EW1A 4QDTA 1CQXA 4MEJA 5JXHA 5J4KA 5CX4A 4G09A 1KIAA 4TL6A 1ZGHA 3I01M 3MN1A 4KYIB 1VZ2A 1ZCBA 3B1VA 3GRZA 4BS9A 2V7BA 3L1HA 5CURA 1CX9B 4Y67A 3GLIA 2H92A 5HNKA 1S3FA 2GEKA 5LOVA 3OJCA 3SYMA 1QRAA 1XCGB 5D86A 3TIIA 3FKSA 4AB1A 4EHKA 2Q4EA 1UL1X 4FC7A 5CA1A 4FBMA 4BLSA 2R62A 1V3UA 9LDBA 1S2OA 1PL7A 4KQFA 3OLQA 1C7FA 3EDRA 3HJCA 5CB4F 5K3OA 2QR2A 2HU7A 1WX1A 3HVUA 1A9PA 2WD8A 1P2GA 4N5IX 3TQQA 8ATCA 2CJFA 5C46F 2MSLA 4LOAA 4DQLA 3RJ5A 2PGIA 4H17A 1EJ2A 4G1CA 3PF9A 5FXMA 1DX4A 2II6A 3GR6A 2MSCB 4PQGA 2H06A 2Q3FA 4FZVA 5C0OE 3L84A 4S3MA 1H6BA 2Q5OA 3K0BA 2DH6A 1WV0A 4TYPA 4FNMA 4DMCA 5BO5A 3ABIA 1YD7A 3AR3A 4QEKA 3R9XB 5DBEX 1KOLA 4ZJPA 5I4BA 5M3BA 1QGDA 2I4MA 3NQ41 2H1RA 2OHIA 2PA3A 1YB4A 2ACVA 2VHXA 2GVZC 4O1MA 4R6WA 5AXBA 1EUDA 4B09A 4C3ZA 3U6BA 2XYQA 1EYZA 1OXXK 3SAJA 1E0DA 2QZJA 4UBKA 4XM1A 3I4CA 4NMHA 4B6JA 3CVWA 2I7DA 1JIJA 1FTSA 1TK3A 3H04A 4IL5A 5F5NA 2CHGA 5JY6A 4RU1A 4CEHA 2ZSHA 3DG9A 1Y4DE 3G8BA 4Z4IA 1Z2OX 5CLGA 1PN3A 2PL9A 1F2UB 4TSFD 5CM2Z 1I4LD 1WUIS 1ZK0A 1ZESA 3I05A 3DNPA 4LWZA 2CHUA 1OFVA 5JSZA 4GBED 1QIEA 2E9SA 1F5SA 1VBMA 2OO5C 1V0JA 2MMCA 2QMEA 5FI5A 2ZZKA 3MXOA 2Q4DA 3KYCA 3OU6A 1AKVA 2GESA 4LTDA 1SU7A 5FF9A 5ELXA 3C5WP 2YICA 3DGFC 1YHZA 4DNPA 2EX4A 1M5RA 1JGTA 3OC6A 3CJQA 2XQGA 3WRVA 3G68A 4J4TA 4WLFA 1VSUA 1G16A 4BVEA 4F56A 3CUVA 4XLTA 4R16A 2VZ9A 1XZFA 3DTNA 4WXRA 1WUYA 3Q5GA 2CE7A 3ZHYA 1FFBA 3U7IA 1V11A 3QX9A 4BB5A 4JI4B 1KVRA 3O91A 4PLGA 2PNJA 1CY8A 4R5MA 5F3WB 1WF6A 3HVJA 4V03A 1S4MA 1KL7A 2VFAA 5FWAA 4JELA 2ZRLA 3GN1A 4JB2A 4CIDA 4QTTB 1E77A 4EGAA 1P7ZA 1FU7A 1GFIA 1SVNA 1UPAA 2J9XB 1E9SA 2V55B 1Y5RA 2I99A 3AVQA 3CUTA 3H5IA 3IIIA 1WSAA 3MAAC 4OJNA 1OYYA 2JARA 4W5JA 4CDRA 5IZCC 3HYTA 3Q3EA 4H4CA 4LXGA 5EIBD 3MERA 1RQNA 3ZHRA 1NOJA 3AOGA 3IAS1 2G25A 4WZBB 3T7KA 1TF7A 1LSSA 1NF2A 3QRWA 1DUSA 1KMNA 1L5QA 2ZB7A 2FMFA 1OFGA 3CHYA 4UNQA 1F7VA 3ZN2A 4N6NA 2P4UA 2X5OA 5HF5A 1BA2A 1LVUA 1R0RE 2P8SA 3OF2A 3PL1A 3W1VA 2QLTA 4NP6A 3FTFA 2WWHA 4Y6QA 1GQRA 1QH9A 4CCSA 4F9GA 3V6LA 2FN9A 5IFLA 4XB2A 1OI7A 4TLBA 5DSXA 1LLFA 1NULA 3VC2A 1GA1A 2JRCA 2CC2A 1GGFA 4YJHB 3WIDA 5K45A 4NE9A 2BLNA 1GR0A 1S2NA 1MH1A 1I0ZA 4B46A 3IHWA 2Z83A 2DFNA 4EKYA 1QUEA 4H1TA 3O92A 2FEPA 1V96A 2YZGA 4I99A 4UFPA 4MV8A 1MXHA 1UKBA 1XQ6A 3M5DA 2RJ3A 1M1YE 3P1JA 4DOMA 2C99A 2EZ4A 4PFSA 5H80A 1I1NA 2DFTA 3ETGA 1E8MA 1X87A 3IP8A 5DZSA 4AUKA 2NAFA 4I5FA 4RYLA 4ZCMA 1Z6YA 1ZNQO 3ZWDA 1CZRA 1Z7GA 2G83A 2LGJA 4W9NC 3VPGA 5KUTA 1UEXC 2DQSA 4FFRA 2YWXA 4IOMA 5FUYA 4TZTA 3OA2A 3ORFA 2LTAA 3TB6A 3LAWA 3MJEA 3TOVA 2YZ2A 3B20A 4IDDA 1C1XA 1E1QA 1GZUA 3TINA 1FP4A 3AY6A 1KEZA 4JQSA 4GIBA 1EXNA 4WY8A 3P0IA 5BNZA 1RLMA 4C7MA 3LK7A 2Q62A 1E9FA 1UEJA 2D8MA 2X1MA 1N32B 4TKVA 2PRJA 4YROA 5K4GA 4AULA 5ALOA 2Z2IA 1H3FA 1GCOA 3E9MA 4HDQB 5AHWA 1H42A 2VOEA 3DO8A 4DUPA 1DX9A 5FHQA 3PA8A 4OAQA 3SYKA 3OE5A 3BIOA 4RQUA 1KK0A 2R2GA 3EQZA 3PC7A 5AJWA 2B4YA 5HKLA 3S8MA 4YIHA 5MGNA 3IE1A 4RWZA 1VFNA 2PSJA 2LV8A 3IXMA 2VNSA 4RE6A 2BJWA 3H2BA 2REXB 4JC5A 3PJFA 3I4FA 1MXFA 1XUOA 3MJRA 3E5HA 4ETIA 4CTMA 1KU6A 4DBVO 3RIMA 1CDOA 3A4TA 1S0UA 2VRWA 4Q15A 2NT4A 1DKMA 1T3TA 3ZBTA 4BUZA 3STTA 5LZ5A 3I2KA 2XUJA 5AM4A 2PXCA 1WOYA 3AEYA 3N8HA 5D7BA 4L08A 4ZMSA 5DHTA 2E1RA 3VR4D 4NEQA 4UM7A 3D4OA 4FSXA 3MWDB 1E3JA 3P9IA 3H5NA 3BICA 3PEEA 4R40A 5TY0A 5JAZA 2RC6A 4Z1MD 1B2LA 3AIMA 2Q3LA 1BE6A 2XECA 3LKVA 4GKBA 4IKPA 2WI8A 5FUVA 1G3QA 3QELA 4K6GA 1V47A 3EXG2 4YFVA 5DHUA 3UH0A 4BRUA 4GLLA 3WGGA 4EA6A 4MQEB 1O54A 4ISBA 3R3UA 1KYQA 4KPGA 4WZ6A 4R3WA 4TXMA 1R9GA 1XCMA 5BN4B 2PD3A 2WYUA 2Y9PB 2Z98A 3KVOA 4L5IA 3ZGNA 5JYBA 3IO3A 2XD4A 2OOKA 2FUG1 3VO2A 3P2MA 2BDEA 4W7HA 3EFOA 1B0UA 2B6NA 4FHEA 4YR9A 3QU2A 2PGNA 2C2KA 4PCAA 1KEWA 2C88A 3BEDA 2GBLC 4ENUA 3J81A 3HH8A 3GFVA 3KT3A 3ZK8A 4QLOA 5LDHA 3CTPA 1OE0A 2FQWA 4GW3A 1XMQB 3HU1A 1HOXA 1O0SA 1T5HX 2C9CA 2HJHA 2OBFA 4M0PA 2QTHA 2JKVA 3AQ4A 1DQNA 2UXDB 3NKFA 1JWBB 1J1UA 3I2HA 3N2KB 4XQ9A 5DBHX 1TAQA 1WV1A 2FPPB 2H0RA 1X7YA 4M89A 5I7WA 4MS4B 3WLHA 4YRIA 1RYHA 1L1FA 4B1FA 2H31A 5GIPE 5F9FA 2FFRA 1E9RA 5HKKA 1H22A 5TF4A 3B6KA 3OZDA 4HQRA 2ATIA 1KY5A 2Q28A 3QV1A 1W94A 4PS1A 1JEDA 1H6DA 3B3JA 2CZCA 1OX4A 3G9QA 1GPBA 3UJ6A 4ZAZA 3ADOA 4EF4A 1U9IA 1W4CA 2P0EA 3HJFA 2J3IA 4LECA 2BSQA 3BIJA 3COPA 1Q0PA 1NNUA 2GBFA 4LGVA 3PQ7A 4E7PA 1JHQA 5JFTA 4ZDJA 3GJZA 4ZYYA 1XVIA 3EQ6A 4BIMA 1Z3CA 5B30A 1QGZA 2HIMA 2I1QA 3D4NA 4JYBA 3WZ2A 3T9DA 2B3TA 3RV4A 4QC2A 1V95A 2O6HA 4C4XA 5KWJA 2AYZA 4PFQA 3VPBA 2PQ2A 4TKUA 4LZWA 2WPDA 1XRQA 2ZYRA 1ESZA 2QEQA 3DW1X 5CG2A 1SQGA 4RTOA 3KX2A 4AY4A 5FEUA 1VMIA 1ZVJA 2CXOA 2DWCA 1VG8A 1Q0ZA 3QJGA 4ZVKA 1EZZA 2JBAA 1QAOA 3T3PB 3FVRA 3UT5A 4A6XA 3I12A 5JNLA 1O0CA 1OXMA 2FPLA 2IYNA 3SHQA 1L4GA 2HBZA 4FT2A 3BFXA 5JG7A 1JH9A 3I34X 3DMNA 2D5IA 1KYXA 2C4VA 2W2OA 3KHUA 4L4SA 2EGUA 4PRKA 2DY1A 2TS1A 2XX3A 2OHHA 4RY2A 2XLBA 5LP6F 1P1HA 5LPNA 4ONEA 1E2FA 3UCEA 2Q4RA 3DPSA 2WJIA 3JD0A 3C3EA 3FGOA 3OX3A 1YFLA 1FDSA 3GFPA 1QONA 2EJCA 2EZUA 3SJZA 3F3MA 3K2IA 3NW9A 4L3WA 4W63A 4YDSA 3OOJA 3LECA 1RRFA 1BDIA 1E96A 4KMRA 3RC3A 1M8KA 4EMTA 2XUQA 3IAM1 4BN0A 2BR3A 4MCJA 4R2HA 2E6KA 3KETA 2ECOA 2X9GA 3EWNA 4L73A 1JFLA 4BO3A 5EP4A 3CSDA 2GN2A 3PGKA 2F8SA 1XFDA 1S8FA 1O08A 5J9FA 5HP4A 2V8BA 3DTYA 1SELA 3BGIA 3ISJA 4QNNA 3K0HA 1GU1A 4L78A 3WAKA 4AKSA 1J42A 5JTTA 1YB1A 4AXBA 1TF5A 5GOTA 1KVQA 1T0IA 4R2IA 2J3HA 5FI3A 4FDAA 1DJOA 3ONNA 2O2CA 3VZQA 1QQBA 3ZJUA 1PGPA 1S8OA 4QOFA 1Z73A 2OA0A 2HQOA 1QK3A 3FSGD 3BK1A 4JWKA 5EWMA 1NXWA 1N6KA 1W44A 2RHDA 2XVZA 3CLTC 4HAZA 4XWAA 5DXJA 3SC3A 1PFVA 1FW8A 2FX2A 2ZTMA 2IHBA 2IXEA 4P1ZA 4EX6A 1RHQA 3N8GA 4H9GA 3TL2A 1Y7TA 2QJTA 1C8KA 1T2AA 2GZ3A 2XCLA 1N5JA 2ZJYA 1GUZA 1N9GB 4TTRA 2Q49A 3UG7A 3ZI0A 2EKLA 2BF7A 4ZZ1A 2IY7A 1G5HA 1QQ7A 3KE8A 3PWKA 4FS3A 4JKIA 2XBMA 3EZNA 1Q22A 3MNFA 1E7QA 4DRYA 3WC4A 2IOYA 2YL2A 3Q7PA 4MRMA 1MB4A 4XD7A 3UMRA 3U4HA 1GG8A 4Q34A 4JXXA 3O31A 4LC0A 2KHZA 3MTBA 4WCDA 2JI4A 4F8JA 3OIGA 2O7SA 2OBYA 4Z9FA 5I4CA 1OGIA 4O25A 1EX6A 1O5OA 2REBA 3TIFA 5I7UA 3QE2A 1UIMA 4KFTA 4KK3A 1E61A 3U2QA 3KSUA 2FFQA 4Y9SA 5IULC 4FYWA 1Y6GA 1G38A 1X19A 1DWOA 3EC2A 2WP0A 1DOAA 1ZD9A 4M0MA 3QE4A 3VYUB 4UZFA 1CUZA 1G98A 1ESNA 3EQ9A 4N8EA 4RPIA 4LF4B 4D45A 2EXXA 2KJQA 4BPBA 3HB7A 2JZCA 4E21A 1PNVA 4FLEA 3F5DA 2A1IA 2QGFA 4NZYA 5ELMA 2CDAA 4KEAA 1JG4A 4B7XA 1YS6A 5IC5A 2B8JA 4A0FA 5JI3E 4WFIA 3CVVA 1OBVA 2JVJA 4HX5A 5F4BA 1J2UA 4HAWA 4WDQA 4Z86A 3T1VA 1JHYA 2RIRA 2PPLA 4LQLA 1PR3A 2VPYA 2B30A 4KHZA 4KREA 3UK7A 4DQDA 2BFNA 4IO0A 3DL0A 4CF6A 2C8LA 2G06A 2IPLA 4L3OA 3ICQB 1ZUNB 2ONCA 4G0NA 3IV6A 3ZS9A 4AJPA 4MW5A 4YT5A 1ZAYA 1JA0A 1HMYA 3JYHA 3N28A 4PRYA 1A9TA 1H4VB 3CF0A 3ZH9B 5KYNA 1QGAA 2B20A 3B53X 4GAEA 1Z82A 2V6GA 4LZLA 1OFTA 4J0HA 5EMLA 3ZHCA 3FPGA 1QP4A 1W35A 1FS5A 3G49A 1CUCA 2C58A 2PZGA 3EARA 3MWGA 5H3LA 3TN7A 3GOQA 1CWUA 3SOPA 4OVKA 3UXHA 2XSZA 1NATA 1V71A 3SXUB 3PLRA 1USUA 1A04A 2E4UA 3MRXA 4P2BA 1VP3A 1FIUA 3I6MA 2E21A 2LNDA 4QGBA 1H2YA 4V0ME 1TM5E 5A06A 4HAUA 1GVNB 3M81A 5ABPA 4S05A 1P1BA 2A5DA 4L07A 2O2DA 3ANSA 4PZYA 4Q93A 2NYVA 2VWHA 1U7HA 1NE2A 4MUBA 1KI3A 1TC1A 4CW7A 1WS6A 1XZMA 3JZIA 1R0WA 3BXEA 4NU0A 4TMKA 4DR1B 1DKUA 4HJRA 1WXFA 3IOEA 4WFJA 2V97A 4LHZA 3SX0A 3HN2A 3K9FC 3M3HA 2BL4A 2CDRA 5KVQA 2BP7A 2PJUA 1FVHA 3ILSA 3JQ8B 1DAEA 5CAEA 5INTA 1WZCA 5C7YA 3L0ZA 2PGLA 4I6GA 1U2GC 2I8LA 4MGEA 1Y3AA 5GJVC 3OUZA 1IHUA 3N8KA 4E13A 3GEGA 3HWRA 4LRTB 1PWEA 1SU8A 2G82A 4F11A 4F2WA 2YC4C 4BZPA 4QGSA 4CIAA 4YREA 2PJZA 5FUXA 1X7XA 3HGTA 4PVCA 1WLYA 5AW1A 2W5UA 1UBSB 3WHLA 3IQWA 4G56A 4AZ3B 4RE5A 1Y8RB 3DVAA 1BXRB 3AHFA 4EW2A 2I4LA 3HVRA 3GUYA 3JWEA 2FEMA 3IQXA 4MIEA 2ZM6B 4B3SB 1XA4A 2C5BA 1Z28A 3LXUX 1XVLA 2J6IA 3QVTA 2G67A 3PVCA 4ZI5A 5REQB 2H2AA 4F2PA 2UZ3A 3D8RA 3R76A 3E7PA 2VDVE 3TZQA 2GZHA 5EJ6A 1KBOA 4GEKA 1CV2A 2WAYA 1QV7A 1I3LA 4ZRDA 1YS1X 2JIQA 1GGKA 5EIAA 3S5JA 4P4GA 4IQGA 2VBFA 1BFKA 2IKQA 4NCKA 2DLDA 5KTPA 1FL9A 1E1NA 3Q41A 1H9CA 1GPDG 3GJXC 4UUAA 4V0RA 2AI3A 4V0OA 4DR2B 5LBIA 2JI8A 2VPZA 3C6ZA 4FFNA 1J7JA 2XMZA 4L51A 3LYUA 2CF5A 4Y1EA 2YOGA 3NEAA 3F5QA 1SQ5A 4TZ6A 1NUTA 5D3KA 3NTXA 1WMEA 5HZKA 3NC0C 5HS6A 3Q9UA 2IYFA 1JF8A 3MQFA 4BGDA 3PPXA 3JRNA 5ARCA 1RFLA 2OQRA 3FPCA 1P1IA 2W6ID 3NETA 4LWOA 3PHIA 3Q8WA 4RIEA 3U44B 4M0EA 1PLJA 1VDMA 1QO9A 1K4KA 2NIPA 2XUDA 4MWDA 4BO1A 2X77A 2F7SA 2FMUA 1ZIXA 2H65A 1Q7CA 4L74A 3LQQA 5K0CA 1NQ5A 3GFRA 1U7DA 2PSDA 3UMGA 4HYTA 5G02A 3A4MA 3KEGA 4A2QA 2RSLA 2HRDA 5CA0A 4IX1A 1H2HA 4YFYA 5FIUA 3UOAB 4CKWA 3AVXA 1VTKA 3K70B 2GAIA 2NQTA 3EFEA 3FPBA 4RKWA 1NNI1 3SN6A 1UKEA 4JVLA 3BL6A 3VJMA 1CQWA 5TDHA 4KR9A 1NSFA 1IN4A 4NICA 4DYDA 3L8GA 1B74A 3OEHA 5C1IA 4WKGA 4CKYA 4HDNA 4J0EA 1EHIA 3G5UA 3GDOA 2P68A 2OCGA 2P5TB 3TBHA 2L42A 1J2JA 1YKFA 2V7TA 2XNJA 4G4IA 4K0RA 4XKJA 4KTTE 4Y9UA 3SM9A 3DOEA 4DDVA 2PRZA 2CFIA 4ZHQA 4DBLC 1IG3A 3SJUA 3PNYA 4UTRA 2O8BB 4NZNA 1ZRHA 4M8IA 3UENA 5BN3B 1YZLA 3IBGA 4YQYA 3M4JA 4QO8A 2BYTA 2BGKA 1KXJA 5CK5A 3GHYA 5DOVA 4D3ZA 1G5RA 3AR2A 5K0TA 2YMPA 1KZHA 3BBLA 3VTKA 2QRMA 3N2ZB 1QIHA 4D1YA 4UCXA 2NXJA 1X1SA 1Z2NX 2D0DA 2DPMA 1AV7A 2CBGA 3M6WA 4LBZA 3IAHA 1CJUC 2QRGA 3WRXA 1IY2A 1U0HC 1QOZA 2D2EA 4HBGA 5P8WA 5K7SA 2X13A 2BUBA 4EPVA 1RIIA 4HLUA 1TF2A 1XU9A 5TS2A 4POOA 3AL0C 1SUDA 1VRVA 2C0QA 1QHGA 3BL8A 2O3QA 4IIJA 4BP8A 1XDWA 1ES9A 1Z8HA 2JGFA 2WJAA 1KSHA 5JLAA 2UYOA 4XVCA 5JR3A 4EKDA 4KAFA 2PLFA 4DBZA 2C92A 1NKVA 2X19A 1OB5A 5HDBB 4OLAA 1V1MA 1CUBA 4HS4A 5IHXA 4D0GA 1E58A 5DTEA 1L5HB 4GVLA 1JYSA 2XOKA 2F3SA 2JHGA 1TO6A 5GONF 1DINA 2B0CA 3K1YA 4ZV4A 5BQFA 4QJ3A 2VH5R 5HTOA 3MUFA 3H84A 1B8VA 2Q46A 3ONEA 4Z1OA 5JT1A 1H05A 3E03A 1NU6A 4UNRA 1Q3HA 2XGOA 3REQA 3LXRA 4US2R 1AMNA 2VAVA 4MW6A 3DQQA 3G2KA 3LE8A 4D9NA 4DSNA 4LJKA 3CO0S 1QH1A 1JFRA 4G37A 3ER8A 4AMBA 1SKAA 5BQ3A 1II8A 4O1HA 2ZPUA 4IKOA 5EZ6B 4MO2A 3UUEA 4O4JA 3WL4A 3HDYA 5GV7A 1E6UA 3WSWA 4NRDA 2AG1A 5CVTA 4TYYA 2UYGA 2X58A 121PA 1VMDA 1WIWA 4KWHA 3F71A 1RPAA 4PNEA 1MO6A 5K0GA 5DNDA 2ODWA 2H1FA 3DUWA 3ETEA 2YJ3A 3RFXA 3RTGA 5EJ5A 3GPLA 2F4NA 4DV5B 3WNQA 3AX6A 5BR1A 2NO5A 1X9GA 1U28C 4OHXA 4PXSA 3NC1C 4MEAA 4X1IB 4Y2VA 1N6PA 4CQLB 2VP0A 1EK2A 2QM3A 3OM8A 1AK9A 4JB0A 4BGIA 3FR7A 5CT6A 3H13A 4OBBA 5D5QA 4US1R 5LMCA 1S7GA 3C1UA 5DIZA 2F55A 1Y9ZA 3H3FA 2I3DA 4M9XA 2QD4A 2PLWA 4WXPA 2A6PA 4LJ4A 1U5CA 4CL8A 4B2YA 2DTXA 2GVNA 3T94A 1W88B 4C05A 4XDGA 5C32A 1U4SA 3L05A 2KBFA 2JFFA 4L8LA 4AI6A 2R6GA 2VT6A 4I8IA 4FFOA 2BGIA 2DPLA 4UHEA 3LGSA 1Y42X 1N5MA 3CBGA 2JGLA 3D8SA 4JWTA 4QULA 3V8QA 3KALA 1W46A 5JAIA 4N18A 1QO0A 4LCJA 3U17A 1ZUIA 3I9NA 1VYHA 3LCCA 1YDGA 2VYFA 3Q6IA 5SICE 3VPHA 3W6NA 2XNKA 5ALFA 3TZLA 3PIDA 4PYRA 3VNRA 5DRTA 2OXRA 3G1TA 4ENQA 1KYTA 1HE8B 2ADOA 1FMLA 1W9MA 3KPJA 3NYWA 3H65A 4KLAA 1CKEA 2X4LA 4FFDA 4D3FA 4LF9B 4FR2A 3E3OA 2LCFA 4GU5A 1D2EA 1ZPDA 3CRZA 4X84A 4S1PA 4RSRA 4Z0TA 1E7WA 3PDWA 4OQ4A 4DV3B 2HCBA 4TLAA 4H7KA 4RESA 5K6AA 2CD7A 4CG3A 3KQUA 3IP1A 1Z63A 3ZQ6A 3OTOB 1PSDA 2Q1XA 4O4LB 3T8YA 1L6IA 3AMVA 4TTPA 4F3CA 2DETA 3MWFA 4KXFB 5HG0A 4OYYA 5DNUA 1XVVA 2B7BA 1PIWA 2QAIA 2OSBA 2VZ0A 1HEIA 3PCXA 3T3IA 4BNIA 2HR1A 1SVOA 5BN5B 2FSVC 3G0OA 5ICFA 5JWRA 4CQJA 3GFOA 3PRYA 4AY6A 1MNAA 4BYGA 3WRYC 1DP4A 4H4EA 1Z4JA 3ZE2B 2VHJA 2IYTA 3G8AA 4E08A 1JFVA 3CB2A 1P62B 4L3VA 5D3MA 2GSDA 3R7AA 1YQGA 2B1JA 4IVRA 4OHYA 2J3MA 5ICSA 3IFSA 5A3QA 1CF2O 4BZXA 4MMZB 2OXTA 3HYRA 4HO1X 1JA1A 1YFKA 1GAEO 4AJIA 4CUZA 4DMGA 4ZIRA 5CB8A 1S9DA 3SMVA 3I73A 3NR2A 1W36B 3AM3A 1UMKA 4N7MA 3AEUB 4XYMA 1VE1A 2ZR9A 3C14C 3BMNB 3BG5A 3D7MA 3OQIB 1XJWA 4PYMA 4Y8VA 1AS3A 5FOTA 2FMHA 2GAJA 1RXWA 2E5LB 3CLRC 3NEJA 2JJ1D 1QRDA 1R1DA 1FFYA 2WQ6A 2BONA 2OLKA 3OWXA 2JAWA 4IUDS 5K0FA 2AKYA 3E84A 1XLTA 5BSKA 4MVJA 1DAMA 2PJDA 2Q0XA 5JMPA 7REQA 4XXHA 1B2RA 1WDWB 3DZDA 3RASA 4HQOA 1MX5A 2WICA 3RSGA 2H3HA 1SRRA 3E70C 3ADCA 2VNHA 1Z36A 1W34A 4OHVA 4YUVA 1PFKA 3OESA 4CODB 3B78A 4HDMB 3ROEA 4NBVA 1Q7TA 1EDDA 3KJEA 1ZH6A 1FDUA 4ITRC 5DCWA 5HBGA 2WYVA 4GPAA 5HIJA 3EBOA 3IKMB 4GM0A 1FSZA 3RUCA 1UBEA 3LRTA 2OL4A 1EWRA 4D4MA 4EB3A 5JECA 1QHFA 2UZ4A 2QQGA 2Y6UA 4P4TA 1MLDA 3BMCA 6ABPA 2FFBA 4ZT5A 4S35A 3RT9A 4OQMA 1GLGA 3GEHA 4NECA 3R7SA 1F4VA 1ZW1A 2P78A 3IURA 5HBRA 2CFOA 3G0GA 2Y9MB 2EG5A 2ZJ3A 3UMVA 1BH6A 5CXQA 3G6WA 3VYRB 2FZ5A 1UFQA 2HXSA 4BQNA 5KC9A 2C77A 3KYJB 4LDQA 1ZSVA 3OHPA 5P21A 5JD5A 3RB8A 4Q1FA 3OQJA 5E2IA 4DABA 4YV1A 3FZEA 3I8XA 4LYJA 3VHLB 5IKEA 8OHMA 4JBIA 3E53A 2XI4A 2NOAA 3K1TA 4ER6A 3RBXA 3FKSD 4HX2A 4G0QA 4HYQA 4MULA 4Q4LA 4M0LA 3LC2O 1PYGA 1V2GA 1DCMA 2V9PA 5FA5A 3IQHX 3URMA 1XZHA 2OHVA 1FBNA 3NOQA 4CETA 1OVMA 2IYAA 4PHHA 4YMIA 5C5DA 4X6YA 4GVXA 1XZDA 3SLKA 1QNFA 3P9KA 5HS4A 4XX0A 2BHSA 3TIGA 3QLUC 5KOHB 2R6JA 4K87A 4QOSA 1T35A 4GOND 2BHRA 3RYFA 1QRRA 1UCFA 4HFMA 4XR4A 2AB0A 2IEAA 3D0RA 1U2ZA 5K2MA 2V3CC 4D4KA 1FDOA 1LNSA 4BVLA 1Z8DA 3Q10A 3TLEA 1T10A 3Q72A 4L4ZA 4OEHA 5JSFA 3DBRA 3F8WA 3PHLA 5DBGA 4IDNA 2WKWA 2W93A 3EXEA 1Z6XA 2FZ4A 4MIKA 1N78A 2IXFA 2RBGA 4P5PA 4X5OA 4CEJB 1QVZA 4BECA 1T13A 3W78A 2C8VA 3PX3A 2RG1A 4D9CA 3WLOA 3MELA 5LL6P 5KX5A 1YU9A 2AKAB 2J4CA 2VSOA 4GSLA 3LQFA 4DLUA 4MP3A 3UY4A 4CKZA 1CY1A 3TBFA 3L8HA 2GXUA 1PUJA 1NYTA 1ILEA 2FP3A 4HGZA 2R6HA 1AKQA 4HGPA 4IINA 3AF5A 2ZSJA 1IM8A 2B82A 3PDIB 4MHSA 3IVXA 1DS6A 2NUTB 4W5TA 1ZN2A 4U5QA 1V7PC 4YDRA 5ALSA 1PBTA 5E8JA 2CXRA 4YGYA 3SZRA 1DVRA 3VUFA 2F8TA 4TV8A 1NZFA 3FD8A 2CLSA 1B23P 1X1AA 1PQUA 4RTMA 3ANMA 4DIEA 3L4EA 1L4NA 2OCKA 2Q3JA 1WE2A 1UZMA 2NSDA 2WK1A 3HA7A 3LWNA 2WF7A 4PM4A 3LW8A 2F00A 3MJDA 1EDOA 2GEVA 2HXGA 1NRWA 2IXAA 3OPNA 4LJ5A 4PVDA 4X45A 1CFZA 4WKNA 3V8EA 1CD5A 3W1EA 4DIDA 5CG1A 3BE6A 3IQDB 2XXBA 3ET5A 1MD9A 1LSOA 4OGLA 5EIHA 2ISQA 5AW5A 1ZKMA 2X14A 3ADDA 2W4MA 4X3PA 1KVTA 4ZCQA 3SJBA 3D3QA 3W1WA 4KFCA 1KJNA 3HB9A 5D1NA 3AFGA 5TR9A 3DE7X 4B48A 1XRPA 4R2JA 3W6OA 3OZTA 3UAOA 2R7LA 3PTZA 1QLWA 2ASEA 1QCCA 4HAVA 3EF1A 3U3ZA 4KNYA 3CUSA 3DAFA 3BJEA 2B8EA 3CGGA 2WB4A 1Z0SA 2R7NA 2VJNA 1XJCA 5DNCA 2A88A 1GU7A 4QUDA 2QRZA 1ELOA 6REQB 3DVLA 1S9HA 1F9EA 2H4HA 1U2DA 4U6NA 1PL8A 3GROA 3K20A 2GF9A 3O82A 3W9SA 3MAJA 4AWAA 4NYMR 1P2VA 3RK4A 3RW9A 3VHRA 1LBTA 2E4ZA 2H51A 4DXAA 5HXAA 2PYIA 1NJ2A 5KVCA 4KLZA 1GIAA 1KYWA 2HX1A 2WDPA 3RVMA 4FI3C 4HWPA 3L79A 1HG0A 1POXA 4FMCB 4LMAA 1BDHA 1XRSB 4F3KA 4YAEA 2GB4A 1WNTA 1A4RA 1DBSA 4OATA 4TTSA 4CTOA 4HWGA 4C78A 5JARA 1DEXA 4LY3A 5IDWA 4RPGA 2UUPA 1ETHA 1ONPA 2C4UA 3QPDA 4TUYB 4URZR 5FTKA 2R1TA 4U0JA 1NVGA 1TMOA 3EWAA 2FWIA 3G2MA 5LVAA 3WK6A 2BMEA 2NAPA 3COYA 3MWKA 1RAAA 2AOWA 2XTNA 5IEBA 4UOZA 2AQHA 1IBMB 1YE8A 3GGPA 4BYMA 3TJRA 4YIKA 2XUKA 1UJ4A 1VCHA 2O2HA 3PXAA 4MZDA 1WZNA 2WAAA 3TMAA 5KSZA 2O8FA 2FQ1A 1E1QD 1JLKA 1OSNA 5E3JA 3KPUA 2OBLA 4B7CA 1BVYF 5KNBH 4G9BA 1DO0A 5TS3A 1R4NA 2AV6A 1A27A 3RHZA 2XXJA 4WJLA 1ZHFA 1BS2A 1J21A 2CD9A 2H1LA 5COBA 3PFNA 4Q1EA 3FDZB 4NKRA 1M67A 2Z30A 2PQ0A 1RI4A 3DMFA 2P0AA 3NBMA 4MWCA 4UVIA 2IV2X 4D98A 3C15C 2GM4A 4QJBA 5AKKA 4BTEA 1BGWA 1QP0A 3ENKA 1J4AA 5KYKA 3L01A 1N25A 3TZ6A 1CSEE 5LKAA 3NAGA 1DJNA 4EFLA 1TPYA 4UDYX 4GECA 5KOYA 2XGSA 5KSPA 1L5YA 1RXEA 3I04M 3QY9A 1P5JA 4Z5XA 2CWWA 2SKDA 3GH3A 1SWWA 1XL1A 3M9XA 4ZO4A 3TW8B 1WP4A 2X5XA 3EGDA 3MTGA 4HATA 1AQJA 4YRGA 2FRDA 3W77A 3ZE6A 5LMUB 4JCOA 3BBPA 1DLIA 1R4ZA 1XB2A 5CH5A 4B6QA 3T52A 5KAPA 4BBPA 9LDTA 1U04A 3GLGA 2PMCA 3V55A 3T4EA 4TGLA 4BOYA 4HZIA 1D0IA 1J23A 2CMKA 1G6HA 1HE2A 4LDPA 3FFWA 4C03A 5ILQA 4HPXB 2AFIA 3HKCB 3SIXA 2X0JA 1X80A 1X7DA 2RH4A 1JSRA 2Y1FA 3KHTA 4RV5A 1T25A 1BWPA 1J97A 3U56A 4TMFA 1GZ5A 1LW6E 3SR4A 2H5IA 4IEFB 2G0NA 2H16A 4AF6A 4IV5A 1YUBA 4K40A 4P98A 5THXA 6PFKA 4DAOA 1HKUA 7ADHA 4X95A 1I51A 2HJWA 1ARZA 3SEFA 5CCBA 4LXUA 1C3OB 3EZGA 5H16A 2C57A 4G1EB 2Y0BA 2XMRA 2FDXA 3VPFA 5HZGA 3SG0A 1BVRA 4WPGA 3Q12A 4XJTA 2JGIA 2BE7A 3JD3A 3KWFA 1RAHA 4HXFB 2WZDA 1HQKA 3PRKE 1YB5A 1IZ9A 4NAVA 3W3ZB 5U9CA 1HV8A 1PJLA 4XGIA 4CHGA 3WYEA 2VTKA 3WL7A 2AJ8A 3GGGA 1L4UA 2W2XA 2NUPA 4AJKA 4YVFA 4B79A 1BKYA 4E1AA 1L4YA 3PXEA 5ALYA 3DMDA 1SUAA 2A3NA 2XOXA 4W9NA 2XH8A 3QVGA 5HKKD 2MMGA 5IM4A 5CUQA 1QHNA 1D2CA 2ZIWB 4O0MA 1QU3A 3PEVA 4EL0A 4FSDA 5IASA 3KDPA 3WGNA 1NUPA 4GKAA 4WESB 5DX8A 3NI2A 5JD6A 2I54A 1NV9A 5JQWA 3SZMA 1FMTA 1YJCA 2HLPA 2X41A 4CQMB 5HJ7A 4RTKA 4RIFA 2QTVA 4AMZA 2RI6A 4QHYA 2E49A 4BRZA 1CYDA 2ZVDA 3H9UA 2GHIA 4IOKA 1XROA 1WOMA 3TLGA 3L9WA 2PMDA 3Q3GE 2P65A 2V3VA 3Q9LA 3CX3A 2B4AA 2VYCA 4DW8A 3GFBA 5BY2A 5EUBA 1PCXA 2FW6A 3AGQA 4RD4A 3NRBA 1ISIA 5CPFA 2JJMA 4CF5A 1S89A 2YHIA 5J43A 2WPDD 4FOOA 1U7XA 3H17A 4GGMX 4RQAA 5J23A 1KQOA 1SC3A 3I28A 4KWTA 4IIEA 5F35A 3VNUA 1NLUA 3KTDA 2ZCJA 3M6LA 2F9MA 3KE9A 3M6UA 3NHUA 4KN5A 3R0XA 4XIYA 4YAJA 5LBTA 1OBFO 5T6MA 5IVHA 1RXSA 4D5GA 2ZS7A 3VVLA 1SG0A 3CR8A 2Q6KA 1QWOA 2HSWA 2XWSA 3QYFA 3NJ8A 2CCJA 1NMSA 4JD5A 3LBNA 3A9SA 1RMQA 3TI7A 4AQ7A 1QC5A 2NMVA 3ZDRA 3IRUA 5EZYB 4BNYA 3D54D 1FUYB 2C4HA 1ZMOA 3L1JA 4KXYA 2BFBA 5JROA 3EQ7A 1OXTA 4YEDA 1Q91A 4ND7A 3AJDA 1XWIA 5C1OA 1G21B 1AJEA 3OTIA 1ORWA 1IDN1 3O3CA 2P9JA 2A67A 1KYZA 3R6TA 4G1FA 2IDMA 2OILA 1MO3A 3DHYA 3NG1A 5JZMA 2Q6OA 4K28A 3C3YA 4ARUA 4DUGA 4MYCA 1JKJB 1G42A 4DR4B 3CVOA 3D3WA 2B35A 2EW1A 3VTZA 2Q2NA 2ZYVX 1T9KA 1O9GA 3L4SO 4WOBA 1NJ5A 3C24A 1QQ6A 1YCFA 1F6DA 3KD2A 1T8TA 3ID6C 4R1LA 5HFJA 3ASZA 1PAUA 2ERYA 4PINA 3F9CA 3GBSA 3PLNA 5DTMA 4WINA 3HBFA 1OFHA 1ENOA 3FMIA 4IGIA 4JVMA 2VPPA 4PIMA 1VPVA 3RS0A 3RC1A 2QXTA 3HJUA 2R8RA 4P58A 1RLUA 4DSAA 3WMEA 2FZCA 3HP1A 3NATA 1TD1A 5HGJA 4B7AA 5T64A 1NQWA 2ZK7A 2H48A 4GP7A 1E6MA 5AI0A 3NYIA 1YR6A 4QYWA 2RFLA 5CYFA 2AXNA 3WYFA 3GLHB 4B2IA 1QLHA 2FZEA 4MYTA 4DLTA 2I3AA 4U9HS 4YASA 2VXBA 2P27A 5HQJA 2JGJA 4HV4A 3ML1A 4P08A 4JBYA 5HR5A 1WW3A 2XWPA 1TECE 1YMQA 3A7DA 4TLDA 4XD7D 5CDFA 1S2DA 3EIQA 4OJMX 2HFJA 2RK3A 3ZLBA 2X6RA 1ESDA 5LIPA 5ER9A 2ILVA 2C2MA 3FUUA 4I55A 2WWYA 4KDRA 2C2XA 3SQXA 2EG9A 4URFA 1SUFA 1PYOA 4I9FA 4AYTA 1F4PA 2BKEA 3QEJA 2A1TS 1H0KA 3S0JA 3T34A 4OTZA 4UUNA 1KOGA 2CLCX 4PPGA 4D97A 3BX1A 2CXUA 1TPZA 2LKCA 3RHSA 3ZHSA 4YJFA 1NQOA 3T12A 4M37A 4AKTA 3UUFA 3F96A 1I4DD 3KAKA 3L82B 4JGIA 2GKSA 3QGMA 5KYVA 1VECA 4BMPB 1UK6A 3O9MA 1ESEA 2GK6A 3OOSA 3KV1A 4I6EA 5ICEA 1TA4A 2PGXA 5CVVA 5KQSA 4OX9B 3HLYA 3D4IA 2ZPTX 2ZIFA 3I01A 3KAPA 3NVAA 4IG9A 5HJ2A 1K7CA 1Z5ZA 1ZH0A 2EJVA 3KB2A 3LO8A 4C4ZA 3E35A 4Q3AA 1W59A 5DEIA 4GG1A 3AR7A 3WGMA 2GBIA 3R77A 3SF0A 2Z6VA 4CKEB 4OFBA 5GJWC 1WU7A 3B5JA 3G59A 4PQYA 4G2TA 4BNKA 4BRSA 4MUKA 4C0LA 4JDUA 4OK6A 3H9QA 3PFKA 1BIFA 4B4VA 1N7HA 3VDMA 3RU2A 1F4LA 3NGXA 5F1PA 5EIFA 4I2NA 1YDMA 2P35A 5F78A 3A1SA 4ND3A 4DTCA 3OZUA 4ND8B 4DNOA 1YIDA 3RCBA 4Q9NA 4EYQA 5KYXB 1U0JA 2EHDA 5K0BA 3D5TA 1C50A 3DEHA 4C3OB 2B1GA 1G4AE 2XSZD 1RWKA 2FPRA 4IMPA 2FUCA 3FBGA 4LHSA 5TEVA 2PZ8A 1ZONA 2JAUA 3N3BC 4LSWA 2FZWA 4CVNA 2ORYA 3FJYA 2HHAA 3FPSA 4HWSA 3FBWA 1S3GA 5LP6C 2QTMA 2OXEA 4IR7A 2ONZA 1Z74A 4PW0A 4CLOA 1JLLA 1QYIA 1YMVA 3D3KA 3PVZA 5B3KA 5J2TB 2BD0A 2QT0A 4UAJA 1FW6A 2DSTA 1YQXA 1EPUA 1GKKA 3MRVA 2DCUA 3VOAA 3P9ZA 1CJSA 3GZJA 1ZNWA 1UDWA 3IV9A 1AU9A 4FBLA 4IYJA 3LUBA 4U0KA 5AK4A 3RK0A 3W0LB 1ZVVA 1VJTA 1YBMA 2YXPX 2QPAA 3JAWB 2I8CA 4GF5A 3PXXA 4KWEA 3RS3A 2BZ0A 1SHUX 5BQOA 1MAUA 1T3GA 3LA8A 2IY8A 3AI2A 4A6EA 4FDVA 2GYYA 2WVGA 1XEFA 4RKFA 1Y7HA 4PPQA 1ZM9A 2WKRA 3GLTA 3K5HA 5G0WA 3GEIA 4QBGB 1L7OA 1SOVA 5FL3A 1DAPA 3EZFA 4TRNA 1OZHA 5TGDA 2VHTA 3GRVA 4AWBA 1NFFA 1IN1A 1M2JA 3GRAA 1P9RA 1FNMA 3N53A 5ESWA 5EMJA 4IDQA 5K8TA 5KJFA 3OP4A 3G7UA 2R8EA 3IPXA 4MOWA 1RJWA 4E11A 3HB5X 4OJTA 5BRJA 2EEPA 4E2ZA 2CB9A 2ZS8A 3FVWA 4NQRA 5EWJB 5C81A 1DTEA 5IXSA 4FHZA 4YBZA 2PL3A 1D1PA 1MRNA 3QXGA 2SCUB 4S24A 2DUJA 2P4QA 2KMLA 4MHOA 5LM3A 3AV0B 1CU1A 1EDEA 2VPTA 3K8OE 2FE4A 1PW5A 4JLNA 4OUDA 5LA6B 2QYSA 4BFSA 3VGPA 2FR8C 2XYRA 4ZC8A 3OIYA 3WBJA 3QBJA 4HAXA 4LSGA 1GY8A 1BOOA 1RQXA 1BN7A 1DKPA 3UA4A 4Q05A 2PHZA 1LX7A 2QPOA 2YJ5A 3DLBA 4YJGA 1BXGB 1PNTA 2VDUE 1VG0B 4QJIA 2C5SA 4HTFA 1G8PA 2F8LA 2G9QA 3PC2A 3PHJA 1YBFA 3LPLA 4M8SA 3W7VA 5LSAA 2QBYB 4HDKA 2AOXA 2AZDA 3ANYB 3L40A 4AKGA 1QX4A 1RYNA 3MJTA 4PBRA 5FBWB 2XE6A 3I9KA 5CT5A 2B83A 4G8CA 3OQ6A 4LXYA 3KZVA 4L0MA 1EFVA 1EFPA 4ARZA 4INAA 2W2LA 2R0QC 4L9SA 1H65A 4C6RA 3L4KA 1FFCA 4HNHA 2QN6A 2XT0A 4FGSA 4YJKA 5I7AA 3BB1A 2VKTA 3OJEA 1UM9A 2H63A 3D6NB 4DA9A 3GXBA 4K6KA 4G2NA 2AQ8A 5B12A 4K3UA 2XUIA 1ACMA 1AGXA 4P4UA 1TK9A 3DEKA 2GFIA 3IALA 3Q6NA 4Y1RB 3DLAA 5JZOA 2O3RA 4PX3A 2G8LA 3OEHD 2KYRA 2VNAA 4CWAA 3U7HB 3QFCA 3NHPA 2HT6A 4BHTA 3N9IA 3KQNA 1G64A 2W2KB 4EJSB 1UIRA 1P33A 2H57A 2J33A 1V9CA 2JAQA 2P62A 4QICA 4IWNA 5DTJA 3ZWOA 4V1CI 1SVMA 2VDKB 3NNDA 3KSDO 1RI1A 2Q2QA 2R68A 5LQUA 5LZ9A 3U4QB 3ANNA 4JN6B 2ZBVA 1DCKA 5KQGA 2P67A 1ZC3A 3V80A 1F2TB 4ZCRA 3I58A 4PSAA 1H2EA 3NTVA 1AB5A 4Q7EA 4QXQA 3VKUA 3SXPA 5JHHB 5TQ2B 5JNRA 3RPEA 1LPBB 2R86A 1NW6A 3SVZA 3HQ4O 3TTSA 4XWTA 1G63A 3PVSA 2QMYA 5HF6A 3PL5A 1ZQ9A 2ZVQX 4X93A 1GNTA 4DMFA 3DAOA 4LX0A 4P92A 4RC9A 3V2IA 1EEHA 3BRCA 1G20A 3H3JA 4D8TA 4PCVA 2VJMB 1GPWB 5DGIA 4ZVUA 1U7WA 3CO5A 4IXNA 3UQZA 4K9OA 4ALJA 4F5ZA 2XRZA 1D9ZA 2QXYA 2R11A 3GD5A 1WXWA 2N1BA 4PPFA 4XCXA 4WN3A 4AFNA 2XB8A 4CR8A 1CQIA 1NXVA 3IH5A 4RM2A 1NR7A 4C9BA 4C08A 4LXTA 1UBKS 2XOKD 2FUEA 4U63A 3ZQJA 1IEVA 1OIVA 3BEOA 3SJ7A 5C5CA 1A1VA 1N5OX 4RF4A 5CB6A 2ZB8A 3ZIUA 3HK2A 3BWXA 3KC2A 1SC6A 2GRUA 5CDTA 5DNYB 5LR6A 2C4WA 1YQ9A 3F1LA 3CR3C 4X7MA 4K6HA 2MTBA 3JWPA 3WK5A 2HSGA 4CEIB 1NKSA 5FWXB 1K66A 3ZU5A 1FVXA 3L6BA 2OMKA 2GWRA 3N07A 5LUBA 4DQUA 4L1KA 2J08A 2HHJA 1QZUA 1JT9A 3I52A 1JAZA 1DXOA 4JBWA 3EIOA 1I94B 3TLXA 5KU7A 5KVAA 2F3QA 3W06A 3N2LA 4X0EA 4L5CA 2I2CA 4IRMA 4EGSA 4F04A 3A11A 3HP7A 5GVSA 1Z68A 3V4RA 3PR3A 1ZK3A 3JZAA 4ARIA 2N9UA 4M9RA 1XZCA 1NRXA 4LAFA 1XD8A 4QUBA 2HMVA 2FEOA 3DE1X 4H08A 2QJOA 5L3ZA 1KDYA 3NH6A 2Q6VA 2X8BA 4HH4A 2D1QA 2GEBA 4OMFG 4Q66C 2YYAA 3PYLA 3G88A 3LY5A 3ORHA 1CQJB 2H5LA 5JBIA 3QUSA 1EVEA 4PWZA 3P0HA 3HYNA 4AO7A 3Q40A 5KJ1A 4KUEA 4CGZA 4PYIA 3OT5A 1GCUA 4CL2A 4FU0A 3HTXA 5ED4A 5KB3A 3BMOA 1W30A 2FMIA 3EVTA 3ISTA 5EMKA 4EPTA 4BQRA 1JHXA 4A4DA 4X8OA 3HU2A 1MJNA 3T4PA 1USVA 2QW0X 4UXJA 1Z5NA 2Z8ZA 4D25A 1B7GO 3WAJA 3OVMA 4A0GA 3I6IA 2ZIGA 3RYCB 4ZCIA 5DM70 1U8AA 4K9LA 3K6SB 2QTZA 4QBFA 2XUZA 5DM2A 2Q4TA 3RO7A 2V5AA 4G01B 4XYBA 3ODGA 4HZUA 3B36A 4JLSA 4I66A 3HYCA 5HUJA 3EEOA 4NFHA 2MSKA 4TSRA 3GL9A 1Y9EA 1QO0D 1V8DA 2EIHA 2BFAA 2Z4TA 3IR7A 4KE7A 3S2FA 1PG2A 1AUPA 1RKBA 2CK3A 5DYTA 1YQDA 1TGVA 3UKJA 3UN1A 2J3JA 2IV3A 3V48A 4DWOA 4PG8A 4H77A 5GP1A 5TMPA 3UBTA 1SB8A 2AWNA 2FFAA 1CEYA 5JASA 2V4UA 1JPJA 2MINA 3C3KA 5HRAA 1NTOA 4ALIA 1R00A 1ESCA 4ZQFA 1OAOA 2CVFA 1FLNA 2ZRMA 2COEA 3CT4A 4WADA 5F4ZA 4ENSA 3IEUA 1FU4A 3JD4A 4UNPA 3SEQA 1C7EA 2I65A 1M6VB 1HT2E 2I4TA 2XQKA 3EC1A 3FHJA 3OJOA 2XUHA 1EM6A 3M70A 2GUWA 3IBCA 1W5EA 3ABZA 3E4DA 5CT9A 5FJJA 4MS3A 3JQ7B 3CVXA 4Q16A 1V7CA 3DXXA 3DEJA 1H2XA 2VUIB 3ANTA 3EUWA 3EUFA 2FW7A 2R1VB 3DFKA 4TS9A 1W8IA 2E0IA 5T4BA 1TDJA 3D4LA 1JQJC 2BJHA 4A82A 1LH0A 4JENA 3R6LA 4Y6GB 5JWHA 2ACWA 1KI4A 1W4ZA 2A92A 4TLEA 2ZAOA 2VLIA 1CBUA 3M1LA 4Q7JB 2SICE 3GJ0A 4C89A 1NVXQ 4INZA 3ZE1B 4D6PA 4E0BA 1LC3A 2PTHA 4REMA 3CEHA 4N5DA 3F49S 3CLKA 1UPTA 5DGXA 2VYNA 5CVUA 2FN7A 1S6YA 4IQ8A 3IVAA 2UVPB 4KE8A 3PENA 1E3EA 1CG6A 3DTVA 3FHOA 3DEYX 4YXFA 3EIHA 1RHRA 4Q0MA 5FLEX 4ZI3A 2GPYA 2CL0X 5A7FA 1E3DA 2WUDA 4Q4DA 2AYXA 5C31A 3LXMA 2AEEA 3AEQA 3DXZA 2HPHA 3B6IA 5J59A 2YFKA 4LY0A 2CVOA 5E1BA 2B8WA 1HNZB 3T99A 4MVJD 2I80A 5GTDA 2FWNA 2HMAA 3DDNA 4O33A 5FTJA 4O4IB 1PJTA 1P4GA 3Q9NA 4Z7OB 5M04A 2JA1A 3G79A 2ERCA 1K6MA 3H11B 5IKPA 2PS3A 4B74A 4AF8A 3VO9A 4X41A 1YRAA 3CA8A 4O4LF 3JQBC 4LWQA 1TE2A 3DMYA 5CD1A 2CDNA 1XRJA 1UZNA 1BMFA 2Q1UA 2RGGA 4P3KA 4DXHA 2R1UA 5FLKA 1IZ8A 1M34A 1SIBE 4MVJH 5C5IA 3IESA 1VRWA 3OM0A 3I8OA 5B1SA 1MN6A 1IPEA 5EJ4A 3N8IA 2M2IA 4ENPA 2PG3A 1F48A 2AE1A 1NOIA 2QJFA 3EY9A 4TQUS 1OLSB 2KBEA 5CH8A 3NTRA 2B1QA 2HNKA 3IIJA 3FROA 1P72A 3LXXA 4ND5A 2BTQA 3FNBA 5IJ0B 2XA2A 2H7VA 3IUBA 2ACEA 2R5FA 4J16C 2GA9A 5I9SA 3T4UA 3I64A 4V0QA 3VI4B 4JP8A 5EJFA 1QDUA 3SHOA 2GS9A 4WKPA 2LDXA 3PWSA 4L9RA 4L16A 4FEAA 1K0UA 2F8MA 4O3MA 1JQ3A 1TM7E 4JGGA 4S1WA 4QUHA 3SX4A 3TRJA 3QWIA 4AU1A 2HAEA 1RCFA 1RC0A 3A9VA 3X1YA 3TOZA 3SVTA 1YA6A 2NTJA 3D3NA 4CUKA 2ST1A 2ZSEA 3HDTA 1I4TD 4MB2A 3LG2A 3OCVA 1UXHA 4FUTA 2IZ0A 1KY4A 4ZQGA 3OMXA 4YQEA 2PKXA 4NSNA 1SQFA 4IICA 1YJ5A 4R8KA 5CX1A 1NKTA 5HOEA 4M22A 3FMFA 3UV7A 1RLOA 4PEVA 4G89A 4AP5A 1I9GA 4BAGA 4UMFA 1CEEA 5LU9A 5AKJA 3L07A 2EP7A 2G5GX 1T1SA 3MD0A 3S40A 5CFQA 2OO7A 4CM9D 1ODSA 2WR8A 3MJHA 1USKA 2C8KA 2UZ1A 2C0PA 1MTOA 1RWNA 1UBJS 3KYDA 3L6CA 4JLAA 5H3CA 3FNHA 2Z58A 5CU7A 2BUCA 4ZVQA 1KQFA 2BJVA 2H85A 2D59A 1EFHA 3AZPA 3CF4G 2P9QA 3PUYA 1ULBA 1VL2A 1BE1A 3LUHA 4WXEA 5DOZA 5EGSA 3OT1A 3GVCA 4OXYA 5LMNB 2REQB 1YQEA 1UWLA 1FYXA 1GTL1 4Q19A 3SYTA 1CW2B 3PE4A 4R01A 3QKRA 4F4UA 1N1EA 1VIYA 1XEAA 5KOJB 1WA5A 2OZVA 2PKCA 2C5EA 5AIAA 1ZW6A 5EKTA 1A2KC 1AUQA 1T5BA 3OZEA 4K6MA 1W85B 3NO4A 1KEVA 2NXWA 3HUEA 3ZCUA 4WBXC 3K30A 1KERA 5I45A 2J5XA 4MVJE 2Y71A 1ZLXA 2HK7A 2OBNA 5HJEA 4Q4AA 3NFRA 4UD2A 2A0FA 2IFTA 3V3TA 2JBWA 4YAUA 2WHPB 2KB0A 4MEBA 1FBTA 1BCSA 1ZI9A 2PT5A 4K9RA 2O5EA 1C4KA 1BW9B 2HQRA 2OD2A 1Z7EA 3GGDA 1ECCA 4V0LA 2W0MA 3INYA 3FYTA 1LTKA 3CF6R 3BORA 3MS7A 4L15A 5CM8B 1NI5A 2XQFA 2E55A 1JWAB 1Z6AA 2YZ7A 2Z1NA 3ZU2A 2IRWA 5K05A 1PD1A 5EUCA 4EJMA 1KI7A 2QL6A 5BW4A 3UV3A 4BP1A 3RFTA 3WL8A 1LDEA 3JYNA 1JJFA 3CSSA 4MWBA 4Y0NA 5FI1B 4BU0A 4LG1A 1V5FA 4BVKA 1Q95A 4JUFA 3V4LA 2IHVA 1Y5LA 3AKEA 1A8QA 3BMQA 4F3RA 2WJZB 4HL6A 3ZVRA 5HZHA 1P7WA 3LUGA 3NHFA 3COZA 4TM8A 2VK8A 2EJWA 1N1GA 3FFBA 3IP5A 4XQ0A 5CLFA 1VGVA 4H0NA 3VKVA 1YASA 3LNCA 4B82A 4BVBA 3WNCA 4KQCA 4PPNA 3K2EA 4US0R 4WNAA 3KELA 4NLLA 4TROA 4PN7A 4CKCB 1Y6QA 1PJQA 3RS2A 2VK2A 1YFJA 3VZRA 5ALIA 5I5GA 2HM7A 1ZOSA 1XWFA 3ECCA 5K5EA 1L7EA 5JU6A 4JLWA 5CRIA 5TQ0B 3F73A 3CX6A 1EWVA 4EA7A 4EYKA 3KQWA 4RCZA 1A3CA 4EB6B 5LMZA 1LZLA 1GN8A 4QQKA 3RAPR 2BC9A 3CUYA 4QXOA 1FX1A 2O0LA 2ACKA 4G3XA 4MI9A 4OSOA 4F4HA 4PLHA 4BXOA 1T5LA 3LLMA 3CRQA 521PA 3HXPA 4N76A 4CKXA 2V58A 1QR6A 1B0PA 3ADBA 4DDHA 2KX7A 2UYYA 3HN7A 3PUJA 5JZBA 3K09A 4OMUA 5HKAA 3KSRA 1U8XX 1TMKA 3SHTA 1UXKA 2C7BA 3OEYA 4QAJA 2RHHA 3SLRA 3SQMA 1VJ0A 2ZJ7A 3TL6A 3HCDA 3PWTA 4EGJA 5ENVA 5JS1A 1GRQA 1KE2A 3V2GA 4EHFA 1JTVA 5AKXA 5ADVA 2H1VA 1MIHA 1JVSA 2AR9A 1CK4A 3EVDA 4NJMA 1ZA1A 5EJAA 1FNCA 1VHJA 4OGGA 1QWSA 3WL6A 1GL6A 5FX2A 3KJNA 5CFZA 1ZIPA 3KZNA 4RX1A 4POAA 2P77A 3SS8A 3T3HA 1QPZA 1VIAA 4HH0A 2FPSA 4AF7A 3V8NA 5FBRB 4OMCA 3OLXA 2QIOA 4Q5IA 2XDWA 3DWEX 3ER6A 3HFGA 4UAUA 4ZOLB 3TPCA 3OH8A 4YCLA 2D5LA 3IP3A 5K6TA 3FLMA 3JASA 1KFJB 3COVA 5B6IA 1CYEA 5A5VA 1Q20A 4YI3A 2JA2A 2RHWA 1FLVA 1GP2A 3N3AC 4KQWA 3OO1A 4MI1A 1NWHA 1VL1A 4R8LA 4RZ2A 5AK0A 3MWYW 1DCTA 4IILA 1J00A 1QQ5A 2JFZA 4KO1S 5JSQA 3PD0A 3FG9A 2WIFA 3HFSA 5AYVA 3HRIA 2WTAA 2P3LA 3ZW7A 1I80A 2OQIA 4M0UA 1NASA 2HA7A 2OWDA 4FM9A 3Q1LA 3WSVA 2DF8A 2BISA 1E1DA 4BV2A 2Y0PA 9ABPA 2JLSA 2GCEA 2X5JO 1KJIA 1QFJA 1OW3B 2QW1A 3TLBA 1R8SA 1U3CA 4RLHA 1CP3A 2CLMB 5KNCA 2ZQ5A 2E3JA 4GX1A 4NH4A 4J9UE 1XIVA 1AK2A 4LRQA 4H1VA 4O8CA 1SBNE 1LBQA 3PDCA 3F7MA 5JO9A 3C0KA 2I33A 4MICA 4XAQA 2IX3A 2Q1WA 1EB8A 2XMBA 4K2HA 1TTPB 1UBMS 2JS7A 1ODLA 2ZYDA 3JAKB 2ZBUA 2OZLA 1F1BA 1PTKA 1XTUA 1ZJJA 2FSSA 2QUBA 4X1YB 5A0TA 4KG7A 5CJJA 4KJXA 3B7GA 2IBSA 3AYXB 4L8FA 5JMWA 1NHWA 1Q2UA 3IUQA 1JX6A 2GETA 5ADUS 1GTVA 4GQIA 4OD0A 1Q7GA 3ZCVA 4QO7A 4FNAA 2EGHA 1FDVA 2PMFA 5TPWA 4F92B 2XMSA 2F17A 1K6EA 1WNFA 3L43A 2I1WA 5A4KA 5KREA 4N0MA 5AI4A 1KH3A 5DV9A 5DBOA 3TYXA 2CL7X 4MI6A 1JXQA 1ZGBA 2W8BA 2WYWA 3DCIA 1ISMA 1GHTA 2XB6A 3LH5A 4TOIA 3NBAA 4QM7A 2XXAA 3LT2A 1J1IA 3WB0A 2CBXA 4J3JA 1BSVA 1ODCA 4UQOA 1FPQA 4EHJA 3R6GA 2IODA 4HWOA 1T3LA 4NMWA 2C2OA 1SBZA 2GBCA 2CXPA 1VI5A 1GAJA 3EA4A 3A10A 1XHLA 1FS6A 1MIOB 3KVRA 1DQRA 1N3BA 4YPVA 1FJHA 2GZ1A 1TT5A 2OB1A 2I8AA 2PD4A 4YJ3A 5F76A 5CVJA 5CEJA 5IJ9A 3KJZA 1U0FA 1SRQA 4K1LA 1C5KA 2BMAA 3B3QA 4RIIA 4EHAA 4PZCA 2PEYA 1YK0A 1A0OA 3ZV3A 3SBOA 4LCBA 3M82A 3IKVA 1XWWA 1RT9A 2XWBF 3DKPA 4RDIA 5IN5A 3EX7C 1NVEA 3INGA 5YASA 2V0CA 1WPQA 2WLSA 4KV9A 4RAOA 4HNAB 1WXGA 3EULA 4JH0A 1N7JA 4MV6A 4O4HF 1IXSB 3VOBA 2D4AA 1GITA 4FWIB 1P73A 1VA4A 3RU9A 3BPSA 3WS7A 1HNXB 3DC7A 4MGYR 1M1XB 2JLQA 4AT1A 4BC0A 2JLUA 4MPTA 4YP6A 3I6QA 2AX3A 2BFCA 1JFFB 1LJLA 1PZHA 1SK9A 3L9XA 2GQ0A 3K5IA 3WLJA 5IKXA 1TUIA 4GUAA 4OQLA 4QRHA 4EF5A 4ME6A 1Z13A 3EXHA 3UOGA 4DSZA 3GLGE 2C9ZA 1QFMA 4PYNA 3GRCA 1QHHB 1O58A 5K3FB 4COKA 1OAAA 4R9VA 3DMTC 4ZTBA 4NENA 4Z51A 3A6HA 3GIDA 2AFIE 3ZNPA 5IKMA 2VHQA 3OKAA 3H18A 4DUGD 1ORVA 4DCSA 4PX5A 1CJCA 1UOOA 4LOIA 4HNSA 3UKOA 1CRWG 4HPJB 5AICA 3ZJ5A 1LKZA 5DM60 4JI8B 3B70A 4UMEA 1H5NA 3I23A 3ZEIA 5IJ9B 2GBPA 4A6PA 4CDGA 4GM1A 5LIRA 2I2BA 1JB9A 2H4XA 2VJBA 2IVZA 3MBIA 4IIYA 2Q3CA 3W9YA 5JH7B 5IRCD 4YJ2B 4GP9A 3GMSA 4XWOA 1JKXA 1ZI6A 1VFPA 5H68A 5BV2P 1DJQA 1L4LA 3RJTA 3A9RA 3EXFB 3UWPA 1MF7A 3RK1A 3D5QA 5F9HA 1M1NA 4HDCA 4P7BA 2HA4A 1MKYA 4G0MA 5JXWA 2QENA 4NNOA 1A8HA 2XKAA 3EGCA 1EM8A 4A73A 1Y63A 3W5UA 7MDHA 1Q7EA 3P9XA 4R8VA 2QG4A 3NRCA 5I9BA 4F8EA 3DL2A 3JYQA 4CN8A 1THTA 4ZVNA 1GL7A 1N8TA 1MO4A 2C2BA 3NOVA 4DG5A 3FUWA 4CM8B 4NBUA 3WL5A 1WUTA 4NS4A 3AERA 2G72A 1KMMA 2QE7A 2YFHA 5KYYA 4OCZA 1Z7YA 4P4SA 4GE0A 5FTMA 2ZAGA 4KQ2A 4BP9A 4DLSA 2CXXA 1Q1QA 3VC7A 3OICA 1VL8A 2RHJA 2X23A 3SJCA 4DR7B 2GM9A 5CW1A 2MR5A 4CG2A 5AUPB 4M7RA 2NO9A 4U2GA 5A5DA 5K20A 4RHXA 2ZUFA 2OCBA 1SKBA 3H9BA 1O94A 3GDGA 4TKMA 3OPYB 5DFAA 1R3UA 1F6WA 2GEUA 4FNGA 3ZIAA 4N01A 2F9LA 4QX6A 4YR7A 3T41A 1PZEA 4NULA 4DIBA 4NR0A 5CT4A 4GI7A 2PJRA 3GRPA 5A4IS 3C74A 4OHBA 2EYQA 1DIHA 1XTIA 2YV5A 3DTTA 4HGNA 4IFTA 4KLCA 2Q3EA 2XCTB 1X7WB 4GZ3A 3WZLA 4DLNA 1D4AA 5J4VA 4V2UA 2OGUA 1EVLA 1ZDMA 3GXOA 2RHGB 3EZ7A 4KFUA 4RZQA 3RDPA 3S2ZA 3V8PA 4FGWA 2RKWA 3VV2A 4UZEA 1H5QA 4R0NA 3FN4A 3C3CA 5HVNA 2NX2A 2FDCA 2WFLB 2VSFA 1E6CA 3UG6A 2P69A 3VR6D 1BMQA 1UM8A 3K3PA 3DAPA 4QNMA 4PR0A 2ZI7A 5EJ9A 3EPPA 3FDXA 5BWNA 2FETA 3NASA 3VYTB 1R6VA 2GLTA 3LSYA 4M1KA 4BASA 2FDRA 5JJ5A 2IYSA 1P9NA 1O9BA 1W87A 3SZGA 1QJCA 4WVFA 5A0VA 5DO9A 1XELA 2PKQO 4NNJA 2HPAA 1RXUA 2O1WA 4ID9A 4J1TA 4MUJA 3VR6H 1O97C 2Y0CA 2ZYSA 1EBUA 4EATA 4G36A 4PSKA 2FHSA 5AESA 2HY7A 3OLWA 3N1UA 2ZRGA 1ZN7A 3LM8A 4JIGA 3F98A 4NBRA 4P33A 3WYBA 1NW4A 1UKYA 1UKVY 2NXNA 2PKWA 3A6DA 4O0LA 5K6RA 3GLIB 3ZI4A 1K2WA 4IRXA 3ZDCA 2HSJA 4XTRA 5LOVB 1TLLA 2IKSA 1K3UB 2BBSA 2DE0X 4NDAA 3ECSA 3WLAA 3OSUA 4PO3X 1OXSC 3DFFA 4ZRMA 5F73A 3FSJX 3JPYA 4E94A 5CA1B 1FY2A 1KDRA 4DDWA 1NV8A 1W2WB 5JMOA 4LJ7A 5LYYA 5LD2B 5H9WA 2I7CA 3I09A 4H1HA 3FLBA 4N7RA 4EQ6A 3PITA 4GRDA 2WU4A 2X2EA 2DC1A 2VWPA 3GH1A 1QAMA 4RPKA 4BNNA 2XZLA 3T0GA 3BDIA 2W6QA 1M74A 3GV0A 4RQBA 5CDFE 4IGFA 5AVTA 1E6LA 5EHQA 4YRPA 3T7RA 2C9BA 3AVWA 2QZ9A 3PGMA 1GQSA 1WCV1 4ZN6A 1E2MA 4EP1A 1OREA 4BQIA 1G7CA 4KIFA 1E66A 3TBKA 3TUJC 2K4MA 1QZXA 2CXSA 4OHMA 3KU4A 4EYSA 1KJJA 1XNGA 1EUDB 3K1AA 4RA9A 3THWA 1JVNA 3TTXA 1YL6A 4P7JA 2XHEA 1L8QA 1I10A 1NVVQ 4HB3A 1JAIA 1TQHA 1IEXA 2DKOA 4W8GA 4CEHB 3DDHA 1T2VA 2OK7A 5HE9A 4KPFC 4I7EA 3PSHA 1TYEB 5J2TF 4B6GA 5KKAA 3LYAA 3DKVA 3N74A 4FGKA 2WHRA 5BYKA 2B5VA 4DDMA 4RL6A 2DHDA 5GGXA 2ECFA 3H1AA 3QLJA 2LRHA 4TXNA 4F3NA 5A4AA 2ZRHA 1RPJA 1YB2A 4MROA 1C9DB 5JSZB 4P0PB 1SUWA 3KSMA 3MTIA 4YQZA 3IT3A 3KYCB 3LHFA 5IVPA 4DR5B 4HQKA 1S2LA 4EPRA 3DB1A 4OK3A 3FVQA 1KZ6A 2CY0A 3E1SA 4ILEA 1AKTA 2PUBA 3ZEAA 4X00A 4LMPA 1KSJA 5DLDA 3VO8A 3MOIA 3NVKI 1T5TA 4MGZR 3BRQA 4NWIA 1AKNA 2FSHA 2GCOA 2UXCB 2BI8A 1H2ZA 3G7SA 1ULTA 4C2UA 1ZJWA 1V11B 1EVYA 4EHBA 3WGOA 5IVDA 5A02A 1TLFA 2W2LD 1NAIA 4J1SA 1ZD1A 2BZSA 1JV2B 2MSWA 2PWYA 1J90A 1E1YA 2Q0QA 1K98A 2IT1A 3HM2A 3MWLA 3PI6A 1U1EA 4K6CA 1ULSA 1NFQA 2ZRDA 1A72A 3DE0X 1H8EA 3N5CA 4HDOB 4X85A 4AUMA 4GXRA 1R7RA 4WDRA 3VZCA 2ZYUX 1TYDE 1GKYA 3OKFA 3WAGA 1RFGE 3CRNA 4RAQA 4ZWNA 1Z39A 1NIPA 4R3UC 5LA6F 3IT0A 2A86A 4HP8A 4R9NA 4AECA 1GFWA 2C7RA 1Q0QA 1DMSA 1LWOA 3W8DA 5FFFA 1VSTA 3HBNA 4E2WA 4MGKR 2UUBB 2LBPA 1XFAA 2OP0A 2XEXA 3QENA 1UMBA 5FNVA 2D7DA 3D64A 1PQ4A 3DVSX 4OHUA 1M2GA 3IOYA 4KDFA 3NWJA 4IDAA 5LYJA 4F1WA 2VQFB 1RW4A 3BULA 2H2HA 4FLFA 5KHAA 3D43A 2IHKA 3WKDA 1QB8A 2JIPA 4H2DA 5JYEA 4WW0A 2BZGA 1DKQA 3ABSB 4DB4A 3ZGZA 3KTOA 4PGGA 4YPFA 1H5UA 2PH5A 4NZ9A 1ADYA 5JCZA 3KQKA 1RWXA 5BW6B 5K09A 1I33A 4F3TA 3I04A 4JSRA 3L7NA 5DCYA 4RO0A 5C2JB 4XRRA 2VCYA 2VQSA 3TM5A 1CIJA 5IXJA 4JP5A 4QPNA 2EKPA 3OZBA 1FVOA 5TPZD 1ABEA 5EVCA 5MN6A 1SN7A 5C1DA 4BKMA 4QPPA 3E0XA 3UHOA 1IUNA 1E4EA 4I08A 3D6VA 1KQPA 1SHKA 2PS0A 2V7UA 1I7PA 2CLEB 2HF7A 1PT7A 3I2FA 1KI9A 1C1XB 4PFKA 2O7QA 5DBFA 1FP4B 3RTDA 4ALKA 4A26A 1PX2A 2AN5A 1FCJA 4EUFA 5TRTA 2YWBA 3ROGA 1L8OA 1EP1B 1Q21A 2WSSA 3QPBA 1XZIA 2HD4A 4TKVB 4D44A 5LB2A 3HA3A 4KK4A 1NT4A 1PTJC 2FF5A 2W2VA 4Q3EA 1ZK2A 2X9NA 4AUNA 2Q50A 4XWKA 5IFKA 4DGQA 1V48A 4MQUA 4QE3A 3WFZA 3NCHA 1TU0A 3WP1B 3PF8A 1H2RS 1RNLA 2EKDA 5TLSA 2TECE 2WYIA 4MUGA 2QTAA 1GUAA 2PX5A 1RM5A 4P83A 2WJVA 3W6UA 1KAHA 2WJYA 4TMTA 2P4SA 1HURA 2O0JA 4BATA 2OKCA 2FMTA 4EJFA 4MDEA 1MJGM 5BOSA 1FNSA 4L22A 1LDYA 3EIFA 4AJ2A 2PU7A 2AZ4A 2BHTA 2HHLA 2OFPA 2V7QA 4MV9A 4AJOA 2RIPA 3VVMA 1ND5A 5BT8A 4GR5A 8MHTA 3LWDA 4FJ2A 4B3HA 2Y1DA 1QIDA 4TL9A 1XNQB 2FGJA 5AI5A 2BI7A 3VAAA 2IBMA 3IJ5A 3HO6A 3P5SA 1CJMA 3GJQA 2PX3A 1YA8A 2ZWPA 5CMLA 3P7MA 1RYZA 5BMVA 10MHA 4AS1A 1JRLA 4QODA 2CHVA 1HQCA 2M1ZA 4KRGA 3QELB 4GLFA 4BFZA 3M6XA 1V35A 3NDIA 1HZZC 1TGYA 4QGAA 3THXA 4BO2A 3UO8B 1M0EA 1Z2CA 3CNQS 1H85A 4CR6A 3U1BA 4F5WA 1CETA 3F46A 2WHYA 4CT4B 1D03A 2AC7A 1NP7A 1SHJA 1VKHA 4PFJA 2G5TA 4KQGA 3DL4A 3EFOB 5DXFA 1EGAA 1YH3A 1Q77A 1ZIYA 3BE8A 2I4IA 4B0OA 1AV6A 5AXDA 3WWYA 2GJAA 3O84A 4C88A 3DMHA 2CLDX 4ZT4A 2AUNA 6GPBA 1NNEA 4OQPA 1KZ4A 2ZYTX 4XIFA 4WUVA 3UF0A 4DSUA 2CK3D 4EM6A 5D85A 3ROXA 5HTKA 3NCTA 2NV0A 3CF4A 3VKWA 2RHCA 1OMOA 5J4YA 2ZUCA 3O8LA 4HQ6A 4MVWA 1X7YB 5NLLA 3SHWA 1P1KA 4ZRNA 721PA 5DP2A 4RK1A 2B3DA 4EY6A 1L9XA 1LRKA 4C22A 1HSZA 4XPZA 1U80A 3OJXA 1VCMA 1G20E 5CFMA 1XLVA 2OAEA 3INTA 3EEYA 1CY6A 1N2OA 1OX4B 1TA9A 3KTFA 4JT8A 2WJJA 1BAPA 1JXMA 3DKRA 1DBRA 3G13A 4ZEOA 3K0CA 2YN0A 5B2FA 2O5VA 3CW8X 1NZJA 3MFQA 3C6YA 4OF4A 2YXDA 3FX2A 1DO2A 5K8VA 2GPJA 4LHEA 1GTJ1 5IT9A 2OBBA 2GRAA 3I4LA 3KCNA 3L02A 5MN4A 1CP2A 4QXAA 1FP6A 3ST7A 3U60B 3GUHA 3GN2A 3U16A 2PZMA 1C4WA 2G40A 4UEWA 4D9GA 4Q37A 2PL1A 4TKUB 2R6AA 3U26A 4GZMA 1TTHA 3V3KA 3D4BA 4RFLA 3ILYA 2P9CA 4MWGA 2VYND 3L1VA 4R7TA 4F1KA 2WDZA 1ZJ6A 3BYZA 3L7CA 4TT3A 3QM1A 3L7AA 2Z6UA 3UT5B 1WXQA 1G4HA 5KCMA 3K70C 1PHPA 1ZICA 3DTVD 2NU8A 3CNBA 3CWZA 1M76A 1N33B 1CUEA 1N2XA 3FB1A 3W3AA 1JZQA 4LJRA 3BTUA 3HUFA 5H7XA 3SNKA 2P8JA 3R41A 2OORC 1C7RA 2EAUA 5I4IA 5LQKA 2A33A 1OY1A 4ER0A 2XCQA 5DBIA 2YR0A 2Z08A 3SQOA 4UHCA 5L4LA 2DAPA 2WWTA 3B82A 4M8KA 1MCZA 3X0DA 2FLWA 3RVOA 1BD4A 4BO8A 3WHKA 3MPUA 1KI8A 4EF6A 1NX9A 1TVCA 1M7GA 3WBBA 1UXJA 2DBZA 2B9VA 4IUBS 3VU1A 1DIGA 1IHDA 1BMFD 1MVNA 4BO9A 4Y2XA 1A88A 5AW3A 3WFJA 5H59A 3MCUA 3U31A 1TADA 2NQ8A 4RZHA 4Z0HO 2D7CA 2QD1A 4INJA 3TOCA 1EFKA 5KHLB 3KOMA 4ZKDA 4M0KA 4JOQA 1MBZA 1YU6A 3K2BA 3UK1A 1Q7RA 3A0RB 4ZJYA 4KI0A 2C03A 3HCWA 1TRKA 3Q3HA 5SY4A 3A3PA 4JEUA 1IHXA 1JAXA 4P3NA 5DT9A 5BSHA 1U3WA 2VG8A 2LWIA 5EWMB 2BBWA 2FG6C 5IDYA 3VAZA 3BD7A 4NMLA 2MWMA 1O7JA 1L3IA 1ZN9A 2D1YA 2JI6A 2X22A 3NV7A 4MV3A 4L95C 1PI3A 3DT9A 4A23A 3ZW9A 4OGFA 1U8YA 4IHKA 4P5EA 5G1PA 5HW0A 4HRYA 1Z4QA 2G09A 3KZXA 1W7AA 4FWTA 3L0BA 3PRJA 1YOVA 3ITDA 2I6TA 3F78A 2YWEA 1PNOA 3BH0A 4CXMA 5HRUA 2ERXA 4H3SA 4PANA 3QVXA 4MRMB 1M7HA 1LW7A 3E5NA 1RCUA 3A1DA 4B9EA 3G2IA 4XGQA 3QTTA 3O4FA 4JA0A 1BXZA 4O4IF 1Z29A 2AMLA 3ZX5A 2UYHA 4Q7LA 1RCTE 2Y92A 5C8ZA 5L8VA 2HLNA 4JC4A 1QV6A 4Y2JA 4A16A 3K05A 3O90A 4Z99A 2CWDA 2OAGA 1CVIA 3ITEA 1T6BY 1LVGA 4JSYA 4N49A 4Y30A 5GGYA 5TT1A 1YZNA 3EGOA 3L8MA 4ZTUB 1U63A 1NSYA 1M6HA 4LXIA 5BV1A 5KSOA 1FUKA 4LHWA 1UK9A 5G3YA 3KAQA 4BNJA 1E94E 1AHIA 2ZYWX 4AW9A 3BIXA 4JJZA 1SXJA 1ZD3A 4KW7A 3WV4A 4U9IS 1GZ6A 1DAGA 3RRFA 4JCCA 3IBYA 3A6LA 1QPGA 5HRCA 3DM5A 5ALLA 3DJYA 4DDUA 1C9YA 2JVKA 2I62A 5GV8A 4BBZA 4DQVA 4TMVA 2XDYA 1EHYA 4L6AA 2LIVA 3NTQA 4R9SA 1FXWF 3NWBA 4EVSA 3EE6A 5EGNA 3DZJA 4D9FA 1P1CA 5AHXA 3WB9A 4UEOA 3CV3A 3CJTA 1R88A 1PU2A 2JCBA 1UC8A 3BZBA 3C7TA 2JFOA 2G36A 3IE0A 4FE3A 3ELBA 4FYKA 2ECQA 4AJLA 3PEFA 5E2BA 1E1RA 3QU7A 4C04A 1WCYA 1X7ZA 2DECA 2ZR7A 3EBPA 4IEIA 1BNCA 3ZY5A 1GAWA 1UBTS 5FTWA 2JCXA 1WDMA 3DFZA 2P4EA 5HIMA 2XF2A 5BVGA 5KCZA 2X3FA 2PKQP 1RWBA 3JSAA 4PO9A 3P4YA 1S02A 2XW6A 1M34E 4LJAA 1YHNA 3JRWA 3RVLA 2VP6A 5G4LA 3QHQA 1C81A 1KARA 1UBHS 3IO5A 3PNBA 4GMKA 1DAKA 3FNFA 2Z09A 2W6JA 2BT4A 2HXYA 3MM4A 2P40A 2GR9A 4YH1A 3PC4A 4R8RA 1HE5A 2PRIA 3GYGA 1DIBA 1CQZA 1R16A 2PCLA 2SHKA 3EHDA 3QQPA 3QWBA 4Q9AA 1MV5A 3FHTA 4PYLA 3CMMA 4ITVA 1RWVA 2ZFUA 4L2IA 2A0WA 3LV8A 4LVUA 1P6XA 2B6HA 4JLVA 1T3ZA 4OHKA 2OB2A 2BP7B 2TRSB 1J9EA 5CAEB 1PT8A 1AF4A 1YRYE 1OPRA 2CHEA 2OCPA 2PBFA 4RSHA 2AR0A 2JAOA 2SNIE 4JU8A 3CLSD 2OGTA 4IDBA 5FDFA 1ZYUA 5E1MA 5ARBA 1Z4MA 2WD9A 3WDLA 4RD3A 1G5PA 4M4SA 4UCQA 4B40A 4EG5A 2EV9A 3D7NA 3TX2A 3LVFO 2DR2A 1TI7A 1SFRA 3W5VA 2VQ3A 1X7XB 3JYPA 4BFWA 2R60A 2R6FA 3D2AA 3IMCA 4JUDX 4Y9DA 3USZA 1QDLB 2WSYB 4LIPD 4YECA 1P74A 3W90A 5IX8A 2ZB2A 4BNDA 1MEJA 1U1FA 3DVAB 3INRA 4HMQA 1PGNA 4L5YA 4LOKA 4N39A 1BRTA 4JLOA 4FC6A 4LDRA 1CZUA 5SYAA 1W36C 3B1FA 2PWPA 3NHZA 5JCOC 2QV0A 3E81A 1XF9A 4IIGA 3OM1A 4FOTA 4BIIA 1V6CA 1E2KA 2C4MA 2V9ZA 2WIKA 5LZ2A 1DBIA 1H9AA 1Z2AA 3UTDA 3KKPA 2A4MA 5A7HA 4LDAA 3H83A 1GR1A 1RRVA 2IDJA 3I6ZA 2CEAA 1W19A 3KAJA 4QOIA 1JYFA 2WF5A 2V3WA 1DT5A 3M2PA 4BNFA 5CW2A 4DQKA 5KQMA 4GT1A 1B26A 2WHEA 1SKMA 4OHZA 3WLFA 2PFGA 1NVWQ 1X15A 2GN0A 3JD2A 3KOUA 2ZIXB 2WINI 5BURA 1X42A 5A62A 3AHDA 1L5SA 1H23A 2IP1A 4JYZA 1NWCA 1NLZA 4DCCA 2YIVX 4HFRA 2XPCA 3DMRA 3UMSA 1JQ5A 5EI5A 2JD0A 4NAHA 4D43A 1JKFA 3BTVA 4C4YA 5K8JB 3MS4A 3T3EA 4B4OA 4RM3A 4BBJA 3G02A 3TO5A 2WA1A 3MJVA 1Y4AE 2J30A 4HGQA 1O1YA 1HRDA 4NPAA 4PGFA 4QBTA 1HDCA 4GI2A 4BNMA 2PBRA 4N9QA 3B8HA 3O4HA 3ZR4B 2OUIA 2OV2A 3QLVC 4U7FA 2H8GA 4TM7A 1RHMA 5H1YA 4FR5A 3UWKA 4QUIA 2XJ9A 4MUAA 3AP1A 1HLFA 4KWCA 4EITA 3TNFA 3VR1A 3W8EA 2D6FA 1KC1A 3ENQA 3VBCA 3Q8MA 3E9CA 1PJCA 1TKAA 1U0NA 4GI1A 1R0XA 2HCJB 5JD4A 1Z3IX 2J09A 3R44A 3WGUA 1AA6A 2AFVA 4CKWB 5CA0B 1KC3A 2HSZA 1LCIA 2D5AA 3KUKA 3KZCA 2YWGA 2LR0A 3OU2A 2XT9A 2EP5A 4GRAA 4HGYA 3SC6A 4W5WA 5KNCD 3IQEA 1GL9B 1PK8A 2RHBA 5FI0B 4ETMA 2QA5A 2BAGA 3M9WA 4TTVA 4B73A 1JPUA 1W4BA 2YYYA 4HDNB 1UMCA 4LZAA 2A7XA 3SWWA 3GY0A 3ESZA 4NH0A 2BM1A 4ZCSA 2PMEA 4EJ2A 1MHTA 3GCXA 1GT6A 2IZ7A 1V2HE 2LPMA 4QASA 5KDLA 2IXGA 2O23A 2YOHA 4ZHQB 3GEMA 2POCA 2CCKA 4YGXB 2UUAB 2WQZA 2E4AA 5DPMA 3BSFA 3ROPA 5KNCH 3ZPXA 3D4PA 1JN0A 3DFMA 3NXKA 1Z5VA 1R0CA 4LRYA 2IBTA 2AMJA 2SECE 4PZ9A 1CCWA 2WTBA 3FH0A 3K9CA 1K8RA 3M33A 3V7WA 2FTKE 3D8HA 1X2EA 4ZOLF 5BPFA 1O2DA 4A10A 1M1YA 1I2CA 3GP3A 3WDSA 2F1OA 1CZOA 4R51A 4Y18A 3P0RA 4TV9A 1UAYA 1Y3FE 4CCYA 1B4DA 2VAWA 4JKOA 2RD2A 2E37A 3RKSA 4AY5A 5C18A 1L4EA 4MV7A 3ACCA 4NL4H 4IIJB 3WR5A 4EG4A 1Z26A 2YMQA 4ZZ2A 2MCFA 4OH1A 1VC2A 1Z6QA 1M75A 1UANA 1P9OA 3OQPA 4RJ2A 3SFTA 2Z0MA 1IAQA 3KL4A 3CUKA 3OZWA 1DDGA 2Q7OE 4GQAA 2AN9A 3ICVA 5ICCA 2F1HA 4QLAA 1V1MB 1X1DA 5BT9A 3VHQA 4UFOA 2N47A 4NF2A 5L95A 2BGRA 2WU1A 1YS2X 2J0UA 3DOOA 3OT4A 4JBLA 4WI1A 4MSUA 3F9IA 5KPDA 3O4IA 5K51A 1LS1A 4RA6B 2GPBA 3IJRA 3QBEA 2OPBA 4KZKA 3ZW8A 2PE5A 4ZVTA 3X44A 3CNLA 1ONBA 2A14A 4ECAA 4MDYA 3DE5X 1LVHA 4Q4JA 2C7GA 4QUEA 5DYGA 1C3VA 3REQB 5LQMA 4W5RA 4NZZA 4IDOA 3BWVA 2GNOA 1K1EA 4CF3A 4MQMA 3HYSA 3B5EA 1N4AA 1QH1B 2IYVA 1WBJB 2WAXA 1ENYA 2C4KA 2WC1A 4TKLA 1II8B 4PC1A 4ASUA 4BE9A 2B92A 3F3SA 4M83A 2R96A 3BMXA 4O4JB 2YN2A 3RIXA 2O2ZA 3HSYA 3NJ4A 4EX7A 3S68A 4LWPA 2IUSA 5CNKA 3PD1A 3D6JA 3KT8A 5EPUA 1PEYA 2VLBA 4ZVLA 2BN4A 1U0BB 1N6IA 2PS1A 5HQ3B 3NX4A 1WO8A 1E4YA 1KOJA 1IM5A 1E2UA 1Y81A 1Z2PX