1DEOA

Rhamnogalacturonan acetylesterase from aspergillus aculeatus at 1.55 a resolution with so4 in the active site
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
233
structure length
233
Chain Sequence
TTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVLTTTSFEGTCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RHAMNOGALACTURONAN ACETYLESTERASE
publication title Rhamnogalacturonan acetylesterase elucidates the structure and function of a new family of hydrolases.
pubmed doi rcsb
source organism Aspergillus aculeatus
total genus 74
structure length 233
sequence length 233
ec nomenclature ec 3.1.1.86: Rhamnogalacturonan acetylesterase.
pdb deposition date 1999-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1deoA00
4M8KA 4JGGA 5A4AA 1ES9A 3W7VA 4Q9AA 4OAOA 2Q0QA 3U37A 4OAPA 3MILA 1Z8HA 3DT6A 4XVHA 4S1PA 1J00A 2APJA 4K7JA 1JRLA 4IYJA 4JHLA 1PP4A 1V2GA 3DT9A 5HOEA 1FXWF 5BN1A 4H08A 1VYHA 3RJTA 4K9SA 3C1UA 4TX1A 2WABA 3DT8A 4LHSA 2VPTA 4HYQA 5CD9A 1WABA 4HF7A 1DEOA 3P94A 3DCIA 4DEVA 5B5SA 1ZMBA 2WAOA 1ESCA 1ESDA 1DEXA 2HSJA 2WAAA 3BZWA 1BWRA 2Q0SA 4JJ4A 4JJ6A 1FXWA 3PT5A 3SLRA 4RW0A 2O14A 1BWPA 3KVNA 3DC7A 4JKOA 1VJGA 4PPYA 4I8IA 3HP4A 1IVNA 4K3UA 1ESEA 1BWQA 5JD3A 4NRDA 4K40A 2W9XA 1YZFA 3SKVA 4Q7QA 4RSHA 1K7CA 1U8UA
chains in the Genus database with same CATH superfamily
4ZOQI 3UAVA 3I9MA 1G4AE 4M6WA 1FB5A 2OE2A 1BMQA 2IYVA 2FJUA 3DBRA 1JJ7A 4HGYA 4O2AB 3DOFA 3HSSA 5CTAA 3T4UA 4G23A 4INJA 3I09A 3OIFA 3V4PB 4U9HS 5BSGA 2JCSA 3TQOA 4WOBA 1RSZA 2YIDA 4MR9B 1J06A 3HM9A 2H59A 7ABPA 1GAEO 1B15A 2LWIA 3B1VA 5JYCA 3H7AA 2C3UA 3O26A 4G2NA 1LV7A 5KNDD 1O95D 3KPJA 2HXSA 2R48A 3AETA 4C5CA 1SC4A 4BLWA 2BZSA 2QD5A 3DBOB 1SBNE 4TYWA 4JT8A 5BORA 2CL7X 3PFKA 4LOLA 1ZINA 4OHYA 3CGWA 2XMGA 1W8IA 1VBKA 2WYVA 3HB7A 3I3SR 3LFUA 3BWMA 2BFEA 3E18A 4Y67A 3AJDA 2P7IA 1QLJA 2Q4TA 5IZ4A 1K27A 3VOBA 2QL5A 3JXEA 3WLAA 3CN7A 4GNRA 5BP7A 1MV8A 2V7VA 2FP4B 1H0HA 4IGFA 4X66B 1HDZA 1XR3A 1P7VA 3ZZMA 5DHSA 4DCMA 1ZM4A 2G5PA 3H11B 2YQZA 3WV5A 4LOJA 4M9QA 1UJNA 1AZWA 3DVAB 4HX5A 1B41A 1W4LA 1CIJA 1MRZA 1YR3A 2NQ8A 2OPBA 1VRVA 2IZ0A 2IUFA 3CM0A 4E5YA 2GEVA 5KQGA 4D46A 2AF4C 1S7CA 2YYYA 3WHIA 2JIZA 4MAAA 3ZY6A 5AVTA 5BQXA 2AFVA 2XADA 4KYUA 4KRFA 1N3IA 4MB6A 2JJ2D 5CXSA 4XRGA 5F77A 1ZN2A 3FPBA 2O50A 5AM5A 2P3SA 3IQFA 1NMQA 3WL5A 4ZO4A 5ALTA 1B43A 3PD0A 4ZGBA 5H82A 3IQEA 1CCWA 5A9RA 1E9CA 4BMPB 4N5IX 4DLXA 4JX9A 4OEHA 1O08A 2V1UA 4LN1A 3QU2A 1Y1SA 4Z2YA 1UBCA 4WKBA 2EU8A 2ZWOA 2AFIE 4Q82A 1QIMA 3LPMA 3LF2A 2Q0XA 3M4XA 3MD0A 5G4KA 1IHDA 1KK0A 1TM7E 2LZ0A 3LIIA 4H7FA 4EFDA 3QPDA 1K7SN 3L7MA 3C6QA 4ON9A 5JSHA 5I7SA 1ZUNA 4A2CA 4EB6A 1XZMA 3O3MB 2AYXA 4WK2B 4N65A 5FOWA 3SC4A 4IWNA 1XJ0A 2XNSA 2HK6A 1VE5A 2DJ5A 4KSBA 4NJEA 5JJLA 2DCMA 5FHRA 1F5NA 1YACA 5AYVA 3NP9A 5EVJA 2L17A 3ND8A 2R3SA 1WP4A 2F8LA 2VBIA 4Y2QA 4DMMA 4F3KA 5J2TA 5ECDA 1LLUA 3MA0A 4PYNA 4YMWA 2GUWA 2D2IA 4P38A 3ITDA 2G9UA 2ZBPA 4PQFA 4WLEA 3RUFA 3OE5A 3FF4A 3UICA 4EUSA 2IT1A 5EKSA 4RK6A 3S55A 3QX3A 4K6KA 3SZRA 1U11A 1H6AA 4CT4B 3GRVA 5HFJA 4F12A 3RRZA 4CKYA 5KMGA 3E3AA 3BVPA 4DOMA 2H2FA 3TVYA 5A3RA 4N12A 3HDVA 3CCCA 4HH3C 1EVKA 1WZNA 2Y1CA 2RH5A 5LP1A 4OHVA 1UBGA 1FFDA 3PX7A 1AVTA 1FL9A 1Z0KA 4QGHA 1RJWA 3RBZA 1HL3A 3EASA 2Q1UA 1RLMA 4ZI7A 5JCOC 4TMZA 5CT6A 3IR5A 4YDQA 5TS3A 1T5OA 2IY8A 3A3KA 1K6XA 3NVAA 4NH0A 4E88A 2BELA 2N46A 3JQFC 5CYFA 1B1CA 3EMBA 3TH5A 1ZI8A 2KI5A 1U0EA 4LNUB 1YAJA 4X3PA 3SP1A 3GT3A 1XN4A 4EKDA 2CUKA 2OOKA 2CD9A 4KZKA 2X0DA 3UFXA 5I7UA 2ODWA 2YWDA 2CZQA 1LC0A 2NZVG 5JVDB 3U31A 1MIHA 3VR0A 4TKMA 2VDQB 1AQJA 5BRJA 3KQWA 5IJXA 1IN4A 2C2GA 1PZMA 4O8ZA 2WWWA 1Z7EA 2FFAA 2XR1A 5K0CA 4YMUA 5JADA 1HR0B 4MPDA 4O5AA 1EFCA 1Y5LA 3C16C 2CZGA 1KAQA 3O4FA 2ZSUA 4KVAA 4L28A 4LXQA 4QO8A 4IDAA 2H8KA 3K1ZA 3BCSA 3QVWA 4X8MA 5LSAA 2RHRA 3ZUGA 3LKDA 1P9WA 3LP6A 4W5HA 1LJUA 3EAFA 3EDRA 4JXJA 3TG2A 1DHTA 1BDBA 5EHXA 1WUHS 4MLPA 2NWQA 3VR3D 2VIIA 3WTBA 3WRVA 2C3YA 4CMBA 4JLNA 3DHVA 3FNHA 3TD2A 1N2HA 1D4OA 4JBLA 3BWDD 4EECA 5K8VA 2QN8A 3GLIB 5JDCA 2HIHA 4O4HF 2VHZA 4MYTA 4IOJA 1E9BA 1W5AA 3PLRA 1KRXA 3GY0A 4K05A 1IM8A 3OLCX 2DFLA 4EITA 2HRRA 1F7VA 2FHSA 4CE6A 5B1DA 4DMFA 1SD2A 1FYEA 1WUTA 3DV9A 4YCJA 1BD3A 1J1ZA 1LW6E 3DEIA 4X1YB 1DIAA 2J9ZB 4H4DA 3ESQA 2D5LA 3BKXA 4L76A 3AILA 3GIDA 2XNHA 4XYMA 2H2WA 3RJ5A 1SRRA 1UT8A 4ZHQA 2YY7A 2W2MA 3DDUA 3U1VA 4W8OA 4R41A 2WKSA 5EPOA 3P94A 5K3SA 4YR9A 1KBQA 2BZGA 4PLZA 2F3PA 4NQRA 3LC2O 1IY8A 1ESCA 4BECA 1M1ZA 2QUJA 1NMEA 2H18A 4E6EA 3G0OA 1VZ2A 2R5WA 2HRZA 3ASVA 1GKUB 4A8JC 3OF5A 3FNQA 4A1FA 2VXBA 2ZR0A 3ORSA 4C4OA 4B47A 1JSXA 2C88A 2GA9A 4MW6A 3TIGA 3L8EA 1D6NA 1OI3A 3TZQA 2O0HA 2YIMA 1E2DA 5FBRB 3E03A 4DBZA 4PYRA 2WSLA 2WA1A 1NQ5A 5B3JC 1XKQA 2J4CA 3NEYA 3OA0A 3II6X 3MWDB 2BM8A 3X2FA 1NVXQ 1R0RE 2A5YB 3M2TA 4YGYA 5IDVA 5AW1A 4F21A 5IS2A 2FLWA 2I6XA 2BHRA 2EWVA 3ED5A 4PCAA 3VU8A 5C46F 2MSCB 4WOKA 2OK7A 4P4UA 2DPMA 3Q87B 3SYKA 3OFND 3KJXA 1A9PA 1O5OA 4QIHA 3HGMA 5AVKA 5AOVA 3MGKA 1ZBQA 4PC6A 3NB0A 2X0FA 4LYYA 3HBAA 3IAFA 1QRUA 1H93A 4Q1FA 1B4DA 3SZLA 1J24A 3ET5A 2I7XA 3L7OA 3H1AA 2OXFA 2ZRPA 1WCIB 2BKAA 3Q8WA 4XCQA 1JQJC 5JJIA 2Q1TA 3LSTA 4UATA 4AAYA 5CCBA 2FQWA 4WCFA 5ES3A 1ADJA 4EGAA 3E9DA 1T9KA 4ZT2A 4L9RA 3JTEA 3LRPA 4AK9A 1UBKS 2OZLB 2CXOA 5F9FA 4F2DA 2VK8A 3S8EA 1MX9A 4P4TA 2Q1SA 4KB5A 4M0MA 5KNDH 1OSNA 1PJBA 1UAGA 2ZIVB 3CCBA 3MOGA 4NMWA 4P34A 3TTWA 5JSYA 1OLOA 4TPKA 3TL6A 4LW8A 2LV8A 2VPYA 3LZ6A 5T6MA 1RJ9A 1OAOC 2LKCA 3ANYB 2MTBA 2NUBA 4H3KB 2YRFA 2Z95A 2XNKA 4RSMA 3L5OA 5HKKD 2R7AA 3KT6A 2CLCX 2P9FA 3HR7A 4L0CA 3U4IA 4BV2A 2VUSA 3I4FA 1Z18A 4KODA 5ANRB 3L18A 2QN6A 2W11A 3TZBA 1E1QA 5AW6A 2FETA 3EQ6A 2HCRA 2B5WA 4LJ9A 2JIBA 4X7RA 5DISB 1LU9A 2C0QA 3OZFA 3AR2A 1XCPA 3KZOA 3P4XA 5ITZA 3FSGD 1SVOA 4BBZA 3V5NA 3VMMA 3L6CA 2Y4NA 4AZTA 1FJXA 1ZN7A 4KE7A 4RVSA 2J87A 3A6DA 3KYCA 3GJXC 3LS2A 2X76A 4R7ZA 3IBTA 5EXDA 4D6PA 3D1JA 1KIFA 2R4TA 4DA0A 3V1LA 4MIKA 3OT1B 5GPBA 1WX1A 3NHUA 1TEHA 3U7RA 1TU0A 5IDYA 1YUBA 2WJWA 1U98A 3NHSA 4UXIA 1KYTA 5TMBA 5EPEA 3LQ4A 1UWCA 2VPTA 4NV3A 2KW5A 3PF9A 1TKBA 3HEAA 2H7XA 3L02A 3NHWA 2VJKA 5G0VA 3RRYA 4CXMA 3GV0A 2VJYA 1U9IC 3QU9A 2FPGB 1PWEA 3I2HA 5DI9A 1R50A 5ELMA 2YXPX 4NABA 2P2DA 1FNMA 1WAMA 1D07A 2JAUA 3WLTA 5B1EA 1JR3E 3QWAA 3NT5A 2A59A 3MUEA 4OQEA 3H8SA 3BGWA 4XDGA 5AUPB 4B6JA 1EIWA 5GZ6A 4Z1MD 2XE7A 2IH5A 5TSDA 4XEUA 3I2JA 4MZXA 3GQVA 3NANA 1C7IA 4EDHA 2NT3A 2CXNA 4FNOA 3ZJYA 4R05A 2YVAA 3NNSA 1C9EA 2OD2A 3U3DA 5CPBA 5IEBA 4CLHA 2VQ6A 5KYXB 4PHHA 1GAWA 1RAAA 1PS8A 2JFXA 2OFFA 5C52B 3BHIA 4DSAA 3IO5A 4RPKA 5FUQA 3TQSA 1MW9X 4PNPA 1WXHA 2XNDA 2YN0A 3ZGXA 3GVHA 4R2KA 2VP0A 2QK4A 2Q50A 4ZT4A 1PL0A 2MSDB 1OZ0A 2E4WA 2GH1A 2VTVA 3BTUA 3G88A 3HY6A 2JA1A 3DB2A 3CNQS 4GR9A 4L0MA 2B1GA 1WDWB 4G8BA 1DX9A 4CUKA 4DGSA 4RTMA 3AFHA 1U0NA 2DUWA 4PC3A 4C0WA 2WIJA 3IOCA 4IDNA 4LHXA 8ABPA 4EG5A 2B8JA 3ROTA 4B6QA 1Y9DA 1XDUA 4BZWA 2XWSA 3HO8A 4GXTA 5C4MA 3OO0A 1T5DX 3KXDA 1SHLA 1A4UA 3OKPA 4HSEA 2F1JA 4IIBA 4CQJA 2ZLBA 4PRYA 4BUCA 5JXJA 5A4AA 4EG1A 4B71A 4J43A 5CP8A 5GADl 5BMVA 1EQAA 1VGQA 1LQTA 2RJOA 2UVPB 1EG7A 3AW8A 1FW6A 2FJPA 2GD1O 3ELUA 3HJBA 4MUNA 2REBA 3WAJA 3EIEA 3PRHA 4LZWA 1UQRA 1UIRA 3T5AA 5FA8A 2ZSIA 5G40A 1M5UA 2IC5A 3NHBA 4LDZA 3ZDQA 4KNWA 2YOGA 3S2GA 2BGKA 3M70A 4FFBA 2DETA 1NC3A 2C3OA 3LOPA 5BN4B 3LGXA 1YVPA 3EW9A 3KAPA 1UMBA 5IPFA 3UC9A 4JITA 4O4LA 3RVOA 3K9WA 4RMIA 5JLAA 1P7CA 1CUVA 4I4TF 1SXJB 1VL2A 1QSGA 4MW2A 3NCHA 3H7IA 3I1YA 1HPLA 1JW9B 5DYWA 3ZHTA 4CTOA 2QYTA 1UBTS 1U65A 2QXTA 5CX1B 5L7YA 2P69A 1OGIA 3AP2A 3C3KA 4F4IA 2IEDA 4RJIA 5CK5A 1U3VA 2DLNA 3HMKA 4N7JA 4WFQA 1PCXA 2C0PA 3FPCA 2QW1A 2P41A 4TUYF 1WHTB 3NIDB 1CZKA 1J7JA 3BD6A 4X0EA 4C30A 5JALA 1DSSG 5EKXA 2XHEA 1JT2A 1IAVA 3CH7A 4GIBA 1P5HA 3E8SA 2XGOA 3VH1A 4B3MB 4C4AA 3WR5A 1E4VA 1M10A 3SSOA 3WRYC 3AEQB 1JHVA 4JOSA 2WG1A 4ETIA 1RHMA 3EW7A 2P9GA 4DQUA 5KSPA 1LNZA 3O31A 5A7GA 2Y66A 5T4EA 2BGWA 3KHTA 1C8VB 1FTQA 1EGMB 1GZ5A 3JVDA 3PFIA 4KQEA 3U7JA 2E4UA 2OTCA 1X15A 1ZHHA 4OB7A 2PVSA 3C7KA 1RZUA 2EFJA 4O02B 5DNDA 3RFFA 1ZXXA 2DFNA 3P2MA 5T4HA 4D96A 2I7CA 3DBVO 1U0RA 2C2MA 3EG5A 1Z22A 3GBPA 3L0IB 3W2GA 1P7PA 4RKWA 3L7CA 2DH5A 3OP4A 3PUYA 3ACCA 1PBNA 5DV9A 3A05A 1E9VA 5DBEX 4BPRA 2CZCA 1J39A 3O4HA 1CNEA 2HT6A 4PM4A 1AQNA 1IJKA 4YCDA 1I33A 3V1TC 1S8FA 1NQTA 2PSHA 2P9YA 3RROA 3W7AA 3BE8A 1LPMA 1ICEA 3LPAA 5DM70 1XZHA 3VAAA 2GYYA 2YVLA 4QBKA 3PV0A 3TLGA 1NR1A 4GPAA 3RSOA 1UKEA 4KOAA 1RBYA 5J4VA 3IVGA 2XUDA 2GK3A 4K9RA 3FPLA 2HQ1A 3GRCA 3WFZA 2XY4A 2J6HA 2D7DA 3GWGA 3LLVA 4HLCA 2DBVO 2VHQA 1UXIA 2IHBA 1KWGA 1PJTA 1M67A 3AF1A 5EWJA 4F97A 4DUGA 2ZJOA 1E1YA 2NTYC 1C3XA 4MGKR 1T8PA 4LUCA 4B6OA 2X77A 4B34A 3ZQ4A 1E1MA 2YV4A 5C18A 4MQFB 4FR2A 5LYYA 4UPEA 4JI4B 3C3MA 4G9EA 4L4RA 221PA 4FN4A 1ZD5A 4I19A 1C0PA 1I6MA 2GZHA 1LDGA 4F9GA 1G2QA 1O6ZA 4MKGA 3ICVA 5E8RA 1BJRE 5BSKA 1TVCA 4F4HA 4UDNA 1T9HA 3FMFA 5LMZA 1QVZA 5GY7A 4LI0A 5JDIC 2I6SA 2QE7A 2FEPA 3VU9B 1NW8A 1XMVA 2PLRA 4F60A 1YL5A 2IOYA 1CE8A 3AUSA 3H99A 1T34A 3FMIA 3NT4A 5EGSA 5FBZA 1RM5A 4DREA 4FNMA 3RI3A 1CQXA 2WBLC 4GOND 2BOVA 1ZVMA 3A9TA 1NI4A 4Q4HA 4I9NA 5EMJA 1W5SA 1PD0A 1S9DA 4OKNA 2ZB7A 5HF8A 5C80A 2ILTA 3CYFA 3K9QO 4X8HA 4FKZA 1GL7A 4MWEA 2JATA 2YINC 2A5LA 3Q3EA 1PYGA 3VU0A 5A3QA 4ALJA 4GMDA 3DE1X 3DTYA 3LPCA 1IJEA 2CT8A 3PUZA 3DAYA 4CCWA 2LR0A 1UPXA 3NBQA 4GGMX 3RUHA 2KBFA 4QRDA 5DMHA 2VOEA 5AUQA 5HRCA 1H2FA 2XZDA 3HWX1 2WU4A 4QELA 1ZL2A 5JG7A 3CTPA 1FFSA 3B5JA 3WK8A 5KTPA 2G09A 4DJAA 1T4MA 1WBJB 3H0EA 1M75A 2CEKA 4QDJA 1VYTA 2ZITA 4B6PA 4CM4B 2I3GA 1RRVA 1FC0A 1RYNA 2PY6A 4X1KB 4QYTA 3EN0A 4YUWA 4S24A 2FFQA 1WQ1R 2ATCA 3F1KA 1VJ1A 1DS6A 2R00C 2SBTA 4YXWA 4AO6A 4EA6A 1F8YA 4MK4A 2XNJA 4GGPA 4XPIA 3T7IA 3UKDA 4MWOA 3HZOA 5BV2P 1KRWA 3MTAA 2HCTA 2NZXA 1SXJE 4DNOA 2EGGA 2JI9A 3QJGA 1LTQA 4UEJA 5IKXA 4DWJA 1U8CB 1MRSA 4C1NA 2ZM6B 1RRFA 1K4KA 1R0SA 1WXEA 3ZWDA 1N9GB 1YSCA 5D5PA 4QT4A 4DDTA 4ZIRB 3IXQA 3D54D 2CDAA 5K3BA 3GHHA 1FDSA 2H4HA 4GKAA 3NORA 1L1FA 3GROA 4L7QA 1XFDA 2A0KA 3KV1A 5JOQA 4YQEA 3BN3A 4KQ2A 2B94A 2FVXA 4I1SA 1ZD1A 4V0ME 4F4DA 1E0KA 4IGKA 3RTBA 3KJGA 3HKDB 1GSOA 3M6IA 3NO4A 3VZPA 3FRJA 2PMEA 3GUUA 5KWJA 1E1KA 1QK4A 2JLCA 3E7FA 3PJEA 3Q9NA 2UZIR 3SYMA 3U4QA 2JAXA 4L02A 1PF7E 3B6KA 4IQ0A 4HUQB 1ZBDA 1R10A 4OSOA 2QUZA 4V1CB 2ATEA 2GHTA 4KHZA 5IMBA 3DLHA 4Z3KA 4DIBA 3PNPA 1NQVA 1L4BA 2FZVA 2LP4Y 3F9CA 4TSFD 4E46A 4N76A 3FPSA 1TRHA 2H2IA 5FF9A 4JLUA 1YBMA 3F9RA 2W70A 4FJ0A 4BCCA 3AKYA 1P4HA 1IEQA 3DM9B 5BXQC 1SRQA 2CMFA 3WGOA 1ZRHA 5F3WB 2X3FA 1TIBA 1XF1A 4RFSA 2ZSHA 1VHWA 1OGYA 1Z7YA 4JP1A 5K3AA 3X44A 4DHWA 5CA1A 2B4AA 1L4MA 1H2RS 1DOAA 1IQUA 1V5IA 3A9VA 3QVLA 4YCMA 2WWXA 2XB9A 1BW9A 4Y6PA 2ISQA 3VR2D 3MIZA 4EA8A 2JAQA 2D6FA 2X8JB 4L7VA 4NOMA 1Z8NA 2BEUB 4MUJA 3GVPA 4B3FX 1CJBA 1DARA 4KWTA 2ZPUA 2OC4A 3SR3A 1XUOA 3U81A 2QIPA 3LT1A 2RKWA 4Q02A 2QRHA 4UUBA 3H9BA 1M2OA 5T64A 3BMQA 3CUKA 2FFHA 1KZ1A 1N7GA 2JASA 4DLNA 3TI7A 4EG4A 5KTYA 3B6EA 2QR5A 4BC0A 4G4JA 4MGYR 3U4DA 2BYTA 2DP4E 5K3FA 2OKGA 3HXTA 3MRVA 4L07A 1FP4B 4MW4A 4OMUA 3DD1A 4QD3A 3VNRA 4A10A 2IUYA 2X0NA 4ZVRA 1QG4A 1ZNQO 3QFTA 3MUNA 5ETJA 3R6WA 1PJLA 4S1PA 5DLEA 5E38A 1CVIA 4C4YA 2BHTA 3H2JA 4C6TB 2AQ8A 1D0VA 5FV4A 1CRWG 2HDHA 3LGSA 3SU8A 1T1IA 5C7OO 3NBUA 1AH2A 5EERA 1FFXA 13PKA 1L3IA 1WB5A 2FPSA 3REQB 2Q2NA 1NQAO 4UFPA 2E5LB 5LFAA 1S0UA 4RLHA 5J4YA 5DHFA 4ZAGA 2UUCB 4U7TB 5LKAA 3CRZA 2EZ4A 2RHBA 4HDRA 2NU7A 3L6RA 2OGUA 5EZYF 1TK2A 1ZC3A 3E81A 4YMTA 3PTLA 1CETA 1Y4AE 3TOSA 1RTKA 2DFTA 2GDZA 2JZOA 3FNEA 1YCFA 5KWSA 3HS3A 2QY6A 1DG9A 1Y80A 2BFCB 2JJ8A 1UT6A 3DYBA 3R8CA 3SIXA 1YRWA 2WM3A 2ETXA 3ZE9A 5I45A 2DB3A 1AS3A 3OEED 4IOKA 1QLHA 3K6SA 3RSHA 4UVDA 1BVYF 1LQ2A 4G8DA 1ZZGA 3ETGA 5K6AA 4LZZA 2YFKA 1L7VC 3KXPA 3U44B 1Y9JA 3UO8B 3V8NA 4HH1A 1WABA 2QIOA 3LGAA 4HDMA 4S05A 5B4UA 2UYYA 2JIQA 2QU7A 4JI0B 2XNCA 4FKBA 4P33A 2J08A 2IITA 3QKTA 4K86A 1V7ZA 3CPJB 2MCFA 3H5TA 4LC1A 2DHEA 4D5EA 5ENZA 4GFDA 4F11A 3LWNA 1RBZA 3ORHA 3KUXA 3PGJA 5TARA 2A0UA 4UMFA 4XJXA 1O9BA 5FFNA 5KTSA 1A3CA 1T5IA 2GN8A 3SXUB 5AVUA 5DM4A 3ICQB 5EIBD 4KK4A 1FBNA 3PIDA 1G291 1Q16A 4EGQA 4NY1A 3WNZA 4DQ0A 3L7IA 5KDOA 2GF9A 2I4IA 2ODEA 3PE6A 4URFA 5D3KA 1NF9A 1AHHA 4HL6A 3DW1X 4UDXX 4C04A 5C5DA 1ZK4A 1USWA 4WSOA 4JI5B 3T06B 6ABPA 1ODFA 2B8WA 3T0GA 2GZRA 4AJLA 4L5JA 3OF2A 3FAKA 2WUWE 2A0YA 3B2EA 1J21A 4R4JA 1FSGA 2X8BA 3U7QB 3UHFA 5IKOA 4BMOB 4LCEA 2BZ0A 3QPAA 1A8SA 1YQUA 1CX9B 3I53A 4DDHA 2CXTA 2R6AA 1FTNA 1KZYC 1UC4B 2IJGX 2VWGA 4EJMA 4QU8A 5A4FS 4RIEA 4OQ4A 2PJZA 5LQRA 2MYNA 4MLDA 1RC8A 2Q5LA 3OZEA 1SUIA 5IJ9A 3CRNA 2DY1A 1XVTA 2PL1A 1RJDA 1ZR4A 2Z5FA 4AWAA 4W6ZA 4EM6A 1DAMA 16PKA 1XAHA 3OCWA 1L1RA 4J0CA 3HA5A 4W5WA 3I58A 1DMRA 5FUMA 1J09A 2PWBA 2J9RA 1JQDA 2H9YA 3C7TA 3N28A 4INOA 4GPTA 4MVJA 4WBNF 1P8AA 1Z4JA 4YLYA 2A5FA 5E2AA 4TRRA 4HKTA 1N78A 2H5JA 1RPAA 4XIFA 3N76A 3GPCA 4JBYA 3GJTA 4HNAB 5F21A 3ZI7A 4CQMD 4MR7B 4PZYA 1IXYA 2BEWB 1NJSA 4YREA 3LG2A 2PX4A 3EZ7A 2YKGA 2GESA 4Y2GA 5EXPA 3O9ZA 3ZY5A 2Q9BA 1U9ZA 3IUQA 4LSZA 2CY0A 1XJCA 1XMXA 3IBCA 3LL4A 3NAZA 3PEFA 5ILGA 3BT7A 4EY4A 3E5HA 1O77A 3FSJX 1S4QA 4Z4FA 2VHCA 1GSHA 4DBLE 2FSVA 3Q2IA 2YWXA 2J6IA 4RAOA 3D7SA 1Z75A 2DYKA 4LCBA 5KNCD 5K0TA 1R0ZA 3WZMA 5IVDA 3FN4A 4TSKA 4WN9B 1PJQA 3RFCA 4H0FA 3SJ7A 3HCNA 1S8OA 1XFAA 2RGDA 4CMAA 3LYUA 2AZMA 2V98A 1SN7A 4RF5A 4RENA 3UJDA 2HOQA 3RYFA 2G67A 1E3DA 1GU0A 2XTAA 3OQIA 1JYSA 4QDTA 3BZUA 2QQ5A 5BN1A 2IXTA 1QQ7A 3CWZA 4RZIA 3I2FA 5JSFA 5HE8A 3PUHA 3NS7A 1EKXA 3IAHA 1VI6A 3GF4A 2PUHA 4OK5A 4CKBA 2QE6A 1QIGA 1QF9A 3HKBB 4YECA 1O89A 1T3GA 3AR3A 2VSOA 1OTHA 1Y6RA 4XIJA 4B6GA 3NIGB 2GFHA 3KLPX 3NYWA 5EQFA 1HQKA 2C59A 3RSLA 4IEIA 1LGYA 4P3KA 3AVYA 4F72A 3QP9A 5JAOA 3W0LB 1ZJ5A 5TQ2B 3GHYA 3AEUB 3SHFA 3P71T 5BV8A 1L5OA 1C4KA 4M9ZA 3PYMA 1XTZA 3PQCA 2NZWA 4BZQA 4PYQA 5ALQA 1JG1A 1V39A 3JY6A 4PZPA 1MQSA 3B7GA 1RI2A 2HIAA 3E7PA 3H42B 3CPSA 3ILVA 4BC1A 1WUJS 1W85B 3H2KA 4EIWA 1ND5A 1BMFA 2IV2X 3SBXA 1VG8A 2WWFA 4RZ2A 3CCFA 4BMZA 3IQXA 4XOIA 4BO6A 2C31A 4XIGS 4YP7A 4WXMA 3HI6A 3LAWA 4B3JA 4ZDKA 5LNK1 1X19A 1TI7A 4PQYA 2R84A 2X41A 3R7FA 3R24A 1W75A 1Z13A 2AEMA 2HEIA 5ALUA 2ASVA 5D2CA 3U6KA 1BU8A 3P97A 2CXQA 3ZE7A 1Y0BA 3GZNA 3P0FA 3GWZA 3IMGA 1DCTA 2YQ5A 1B3RA 2VNAA 4TS4A 3VGJA 4AY2A 2CK3D 1RM4A 3PEVA 1UODA 3LUFA 3Q0IA 4HQNA 2GGSA 4P7GA 1UBHS 4QJ5A 3HKEB 3RUPA 2MHCA 1UZAA 2ECPA 1C3LA 2FCAA 2RIPA 3PPYA 4IIXA 2V3CC 4RKEA 4QICA 1LWNA 3NPMA 4DTIA 5H4GA 4P32A 1IOLA 4N5NA 3GUVA 3ZPXA 3E4DA 2GEFA 5BSEA 3A6PC 1FUKA 2DSTA 4KFRA 3LDAA 2UUBB 3OO1A 2JH9A 5GGYA 5GOZA 2FHPA 3AF5A 1PNRA 1F9AA 4URZR 2PKYX 1UF9A 3RVQA 3Q3JB 1G3QA 1ZUWA 1K1EA 1UC9A 4BE4A 1M1XB 4GL4A 4HVTA 4M21A 1YJXA 5GMOA 3IHTA 2NV6A 3LQ2A 1U5CA 4RHCA 1RTTA 1XJ5A 3JQ9A 4MS1A 3DP9A 4P82A 5IFKA 4W7SA 2AL7A 1YDHA 3UAWA 1P0PA 3CX7A 4F3RA 2GZAA 2IW1A 5AKZA 4AT1A 1ES9A 1AKWA 4B0OA 3WYNA 4EKGA 3AHGA 3CUUA 3ZKWB 621PA 1SBQA 4EGFA 4OJNA 1VCHA 3AJAA 4YROA 5BWOA 4JC0A 1M6EX 3WIUA 2ZJ3A 4MV9A 1JJIA 1XOIA 2H5LA 3G68A 2H11A 4PXAA 1JALA 2AOUA 4QYWA 4X71A 3E8MA 3MWGA 4H60A 1PKEA 3C5HA 3R5FA 3CHYA 2X8LA 4K9LA 5EKTA 5C8YF 4WHMA 3V4RA 4IV5A 1C29B 2GJAA 1I4OA 2MMCA 3MBIA 5H80A 2Z8YA 5BNIA 1F06A 1UJCA 1DJNA 4OXXA 3LUHA 5B7PA 1JEQB 1FPQA 2QI9F 2ZBVA 4WLNA 2WJ3A 4G07A 4TRJA 5F52A 3NTQA 1IK4A 4F06A 2FZWA 3ANLA 1KRHA 3Q4GA 4BE9A 1KAGA 3W79A 3KB6A 3WYGA 2GHQA 3JAWB 5LP6A 1ZVQA 4Z0PA 5ECGC 1DKQA 1NV8A 1LPOA 1XVUA 2VSFA 3QTTA 5TDHA 1RRGA 4ZREA 4LEIA 3UJHA 2FX2A 3E9MA 1AK9A 4G37A 2BLLA 3OIVA 1YGYA 3D3NA 2CL5A 3SJUA 3D6UA 3WS7A 1IWBB 4LYFA 2XXJA 1S2OA 4KXWA 2A9OA 2QL6A 2R7KA 3HDHA 2QUHA 4WLFA 4Z54A 4Z4CA 2ZJ0A 1JBEA 2V5VA 5HTOA 2KYRA 2Y9PB 1O95C 1JAXA 4ZEOA 2QAGB 4EY8A 2BP7B 3GU3A 4ND1A 2WZBA 3IO3A 1Z5WA 4PGGA 4BNNA 5KJCA 4QUAA 3M9XA 1ZCAA 1S3IA 3UG6A 2J3DA 2QG9A 1BGVA 1FUYB 1R27A 2Q2QA 2ZRAA 4I6EA 3KKPA 1EMDA 1A4XA 1KAMA 1Z07A 4LJYA 4LY0A 3KEMA 2OA0A 3VNQA 3W6UA 5IAAA 1VMDA 3PUVA 1L7AA 4K9QA 3OJCA 4PO8A 5B5SA 2H29A 4UU7A 1ZM9A 3DBLB 2ZK7A 4QOHA 4GX2A 2JLAA 3AGQA 1G0NA 3EPRA 4UBJA 1W36D 3NIWA 2GAOA 3H87A 2JFFA 4EGCB 1SVMA 3H5LA 1KJWA 1JQAA 1XRRA 3DZCA 4DDKA 1GPAA 4L1KA 5FEMA 1YCHA 3A1EA 3KKZA 4YJDA 2JC3A 2J7KA 2ZBQA 4HJRA 1U5AA 2FR8C 4Y2YA 4BNXA 3DPSA 4B4KA 5FH9A 1R8JA 2NSYA 2F3QA 3AZOA 1U4OA 2OHFA 1EPUA 5NLLA 2PQ2A 4GDMA 3B52X 4WXHA 1U7XA 2X2FA 1L5RA 3DDHA 4IQGA 5EYPB 1EM8B 5BW5A 3VYSB 4PFKA 2ADFA 2HHAA 3C98A 1YZKA 2XCSB 4XWGA 5C34B 2G8LA 2WPDD 2ZRMA 4GEGA 4Y1EA 5BV1A 5FV7A 1DQYA 2BC9A 1EG2A 4N7RA 2XKKA 4BB6A 2Q6LA 4K0RA 5AI8A 3WB2A 4Z7NB 1O9GA 1TM3E 5TLSA 2ZB8A 4Q66C 2QY9A 1E2GA 3GW8A 1TJYA 3BOSA 4J8PA 5BSFA 1SD5A 4RPGA 3ONWA 4H4EA 1E7YA 4A5SA 1G21A 3FVVA 1FDIA 3ROFA 3TZLA 3QJYA 3NBZC 4K03A 5MGNA 2C9ZA 3U7FB 2QJRA 4CLRA 1LB1B 3IQGX 1KC1A 1B8OA 2ZYHA 2RKOA 2GJ4A 1G8KA 3BIJA 3QVMA 1GNTA 1TKAA 5LWHA 2FCRA 2GD0A 3IDAA 4H6WA 2FR0A 1XALA 2ZIZA 4MV0A 1E9EA 2ZAIA 3LBAA 1GL9B 3LO5A 4P84A 5K8JB 4UNSA 2ECOA 3W06A 3NOVA 3R0VA 1CTQA 1QP4A 5KNCH 3IB3A 1J2JA 1L4UA 3L49A 4OGLA 1FRVA 1T1JA 2PSFA 3BXPA 1PGQA 4MWDA 2FW9A 3E1GA 1N2XA 2FVYA 4DNXA 3C5WP 4LV8B 1T36A 4BV8A 4BNIA 3JAMA 2EARA 3D6FA 1YR9A 3RV3A 2XI4A 4Y98A 3WQHA 3LIPA 5LYJB 3NCTA 2PU5A 2KWIA 3H2GA 2DCUA 1JAZA 1N6NA 2EZUA 2IZ1A 3OPYA 5CBPA 4ER0A 4CKZA 2JIZD 3DUWA 2GNOA 2VDJA 4XVRA 4HLUC 2IH2A 421PA 3FNFA 4Z4HA 3T5CA 3NGLA 5CA0B 3DT9A 4NX2A 4ZXPA 3IMFA 1Z7WA 3ER8A 4RHTA 4AQYB 3F8TA 4KCGA 3EVNA 4EVIA 2XRZA 2C4WA 1QNLA 2V0CA 1SOAA 1LSSA 5FQNA 1C1DB 1Q0HA 4JLWA 1SKBA 1SQFA 4ZPJA 1BE6A 4E22A 4V0LA 3B38A 3T1VA 3Q41A 3DYVA 3TVTA 4XKJA 4FHEA 2TMYA 3E0QA 4HAYA 3ANXA 1U6IA 2F55A 3U4AA 1U63A 1RXIA 2OCAA 2BGJA 4GBJA 3LJKA 2GTPA 2NYVA 1QH8A 3BFVA 3O1JC 5EJAA 2PG3A 2AX3A 4H7PA 1KC3A 1ZSYA 2CEAA 4NNPA 3WWDA 3STVA 4FCVA 1UBFA 3ELBA 4HK4A 1GILA 4RMJA 2WSYB 3FMGA 4F2GA 4L08A 1W5FA 1ICIA 3IESA 1LS6A 1R5BA 4LTNA 3L0DA 4CG2A 4E5KA 2RHDA 3TBHA 3AB7A 2J0VA 4NBNA 3VHLB 1IOVA 3VHXB 4GBED 1SMKA 3LPDA 3HR4A 5DI3A 2O0KA 3D8NA 4LF9B 3TNLA 3GR6A 2D59A 3MAAC 3TDKA 3PRYA 2MR6A 2F64A 5FUVA 5IMSA 1F8XA 1JG6A 1K6JA 2EEZA 4QDKA 2R1UA 2HMUA 2M1ZA 2RHCA 2FPIA 3UT5B 1HE8B 4HTFA 5AQEA 4BGDA 1EDEA 3IOBA 4C0LA 1LVHA 2FUG1 3X1DA 1T2UA 3IEUA 3NYRA 4BMDA 3QYFA 2KLBA 3EBLA 3GFOA 3T54A 1VL8A 4XWOA 1UPFA 2WJZB 5KYUA 3HKCA 1DTWB 2XYQA 4QOFA 1J0AA 1U3DA 3Q3IA 2H6EA 4ESVA 2BGMA 4Z4IA 2FYTA 3T3OA 1II0A 1ZGJA 4ARZB 3EZXA 4KXUA 3FWKA 4RDCA 4CF5A 4QGGA 3ZLVA 1LBEA 1FVOA 2EJWA 2M9MA 5LD2C 3I1FA 1CC1S 3COWA 4FCCA 3B1JA 4P3PA 5CM2Z 4BB9A 4WN3A 4ZJPA 1QV6A 3EX7C 4EJSB 3OM9A 3U4HA 2CE7A 3ZW8A 3KQNA 2I3AA 2QSYA 3CU5A 4O4JB 1KFKB 1Q7GA 2PX3A 3GNSA 3WLKX 1WSAA 4D8UA 1ZU4A 3KETA 1MT3A 1E1CB 1U0TA 2QJFA 2Q5HA 2YN2A 4Q9AA 1M7HA 1DKOA 4N47A 4LXHA 2VHYA 3RSGA 4AUKA 2X5KO 4CQLB 2QVBA 1PEAA 2P40A 1RAGA 4JEMA 4C78A 5F1KA 1HT1E 5IABA 1CY6A 4NCBA 3F6CA 1MCZA 1FSPA 3H3FA 1VLHA 1MAUA 4HT3B 5KYNA 4YCAA 3WLQA 4CF6A 4EY5A 3THWA 2C1XA 2NUPB 4RE5A 3TTSA 2JFNA 1Z6QA 2IE8A 1ZRSA 3RC7A 1MB3A 5FBVB 5JJCA 1Z3IX 2BM9A 4Q21A 3ZQJA 1P75A 1UMDB 1YR8A 1XD9A 1JIXA 3F5MA 3QEKA 3DDNA 4YHBA 3G8CA 2ZJ4A 1X86B 1ULAA 3LBNA 4WIAA 5IXYA 2QTVB 4G5SA 1MX3A 1NFFA 3SC6A 4DLUA 4BIMA 2XYGA 5FL7D 4R2HA 1SO8A 4KIFA 3T7RA 1C81A 1V6AA 3CUTA 1U0BB 4EHKA 3NHAA 3TZKA 1FS4A 1KI8A 3R9XA 3WB0A 4TM7A 4GPBA 4DV1B 5I48A 3ZDEA 3JAKA 5EE0A 2EERA 2AF3C 4JASB 4P54A 5CVVA 1IUPA 4EPRA 2FWIA 1RFLA 2YHIA 2H2GA 3UJ9A 3ZG6A 3JATA 1UJMA 3V32A 3ZV7A 4B2PA 1B73A 1BO6A 1DCMA 1VLZA 2I6FA 2QW8A 6Q21A 5HMLA 2AZDA 4MJLA 1XAGA 4JP5A 4DR1B 3TKYA 3LQYA 4JVSB 3TZCA 5IJ0B 3A1UA 1YS7A 5LIPA 3UBTA 3R5JA 3D6JA 3LXUX 4JOQA 4FB4A 5KYGA 2R6FA 1MJNA 2GEKA 4PSDA 4GP9A 1H2HA 1Z7GA 1TUBB 4J9VA 3ITKA 2F43B 2PX8A 3FZGA 2GCIA 3HGQA 1Z35A 4IIYA 4KQXA 4Q3DA 1SY7A 3KSBC 4BU1A 2WHYA 5EXTA 2A1TS 1T24A 1RJFA 1NSYA 2WICA 5KZMB 2AR0A 3COPA 3FJYA 2MINA 3PNVA 2CSUA 4OQYA 4RPJA 4DJTA 1Y3HA 1ZK2A 1AUOA 4FDAA 4NYMQ 4ZQBA 4IHJB 5FEUA 2QQFA 1A4RA 2GCEA 4KE6A 2JLSA 2MWMA 1H4QA 3T3DA 3PYLA 2XXAA 3V8VA 1Q74A 1R9NA 4JKOA 5AHKA 2Q5OA 3FKSA 5JO9A 3UVEA 5LQNA 1PO7A 1V6CA 5AXAA 1XL0A 1NVVQ 3EJWA 1KARA 5FTNA 1MB0A 1P74A 2RHGB 2RK4A 3TSCA 4DEXA 5HXAA 2H4JA 4A4DA 1JWLA 1B6GA 3GEBA 4DSOA 4LJ6A 1VSVA 3PR1A 4GVLA 5FI3A 4D81A 2HBYA 2FWNA 1IPEA 3ADPA 3GI1A 2O3SA 3QLEA 4QYSA 3TMYA 3EWIA 5LZ2A 2EJTA 3K7EA 4Q3EA 4HBGA 3SS9X 3L4KA 4LY3A 2ZRHA 3IDFA 3O4VA 5U4QA 2YJNA 2VUIB 1CS0A 1NFRA 1XD2A 4MW1A 5L3QB 4FFDA 2F6RA 2Q9UA 1XXLA 2XKJE 1Q22A 1GR0A 4PO1A 5E2IA 1E1QD 3W5UA 4YX9A 3HJHA 5GVSA 1ZM3A 2YXBA 3L79A 3NDBB 5DHAA 1VKHA 1A7JA 4L8GA 1E8NA 4UHJA 5DU2A 5T7BA 5D3ZA 4L0QA 3EGEA 4UASA 1Q7TA 2ACEA 3M4ZA 5JAZA 3DVQX 1LLCA 3K0CA 3CEPB 5ALRA 1A9XB 4QYIB 5FKJA 3ZLTA 4BQQA 5JNRA 4KTVE 1ZG3A 2CXUA 3U37A 3ZWWA 1B6SA 1KO4A 3SFZA 3Q11A 4KXFB 3DAGA 2HWUA 3NVKI 1Z7BA 3ZLBA 4NEHB 1XROA 4BLTA 1ATIA 5ERXA 1OBCA 2GK6A 1GGFA 1XMJA 4JVNA 2A8YA 4HDKA 1GARA 3VPHA 4N3NA 4RHYA 3QNMA 1D4ZA 1YFKA 2QQEA 3AKCA 4OU4A 2B9EA 5BOSB 3WGMA 1OZHA 3G7NA 1JG7A 1GQRA 2RGYA 2Z3VA 1E2KA 1I4WA 4LTDA 4P22A 5BSRA 4DLTA 5C1PA 3ABOB 2P0YA 3DO8A 4H08A 4KN5A 1ZUHA 2YQ4A 1US8B 5A4KA 3BQ9A 3JYHA 5KYYA 1RKQA 3KKNA 2P9QA 4OAQA 4I55A 4BVAA 1GNQA 1GLVA 1UADA 2VWQA 3A4VA 3CR8A 2Z2KA 8ADHA 2Q1YA 3DT8A 4DMKA 2CNLA 4LHSA 1RWXA 4Y9UA 1TMYA 4BO7A 4CYMA 3SX0A 1RHUA 5HNKA 3C4QA 5A5GA 2CDNA 2RH4A 3G49A 3Q9UA 1YI0A 1XG5A 2BFWA 3DAPA 1JB1A 2HPVA 2W0SA 3KAKA 4X90A 4CIVA 4C3VA 4DMLA 1UBJS 4OSEA 2JPDA 4WDQA 1U90A 1U7ZA 3T7DA 1XKLA 4BRZA 3EFOB 4A8JB 1OIXA 1GCOA 5JTTA 2XNDD 2B37A 3GLGB 1CUJA 1A1VA 4CMJA 3KNZA 1WDMA 2W48A 3BJMA 1Y63A 3IVXA 1X7WB 5DNEA 2GN6A 1PL8A 1CUXA 4ND4A 3AERA 3I0MA 1UM9A 4CPDA 1GY8A 3VX4A 1UK7A 3VOTA 2D5BA 3MTGA 4BNDA 5CH5A 4IYRA 4IDBA 4M76B 1JQ3A 1M1YA 1H4TA 2XVZA 3ZQ6A 1C1XA 4PSCA 5DF1A 4R54A 1T2AA 1VG0B 4L8YA 3O4JA 3EEOA 1FFCA 3H1FA 2FG6C 2YICA 4N0QA 4N48A 5HQ3A 1RQXA 4I8IA 2B6HA 2HJHA 2K2QB 4X8OA 1SXGA 2V96A 5DHQA 4AJHA 4ZYVA 3T7SA 3ICEA 5DJ5A 5KQPA 1EJBA 1VJTA 4XARA 4M2LA 5EUBA 1XDWA 2O57A 4HEA1 2FDXA 3WKCA 3I01A 4A73A 4ZI3A 3RU7A 2RGUA 5EWMA 1NRJB 1YRHA 3M6UA 1Q11A 4I1YA 3ZTTA 4D4JA 4G0OA 2CJWA 5LUBA 3FTFA 1LNQA 2PANA 4NMLA 2HSDA 1B8VA 1ZK3A 1JAHA 4QFCA 3C8UA 1EDOA 5K4GA 4UUOA 1OGJA 2AUNA 1EESA 2W6IA 2WFMA 3E9NA 4FYKA 2ZIUB 3ULKA 4L4SA 3MMZA 5C7LO 1KDOA 1XK6A 3R74A 4PG4A 3ZIDA 2Y0PA 5JRZA 2Y27A 4N4AA 3TGWA 3TLYA 3SSNA 4QUDA 5CRIA 2QLNA 3FDZA 2HF2A 2R8OA 3U4MA 3HJNA 4FOSA 5U1PA 3ZE6A 5JYBA 3FYTA 1L7NA 1VBNA 2DWCA 1ONNA 3DVRX 3KYJB 4NEGA 4YJ3B 1FRNA 4UFNA 4WERA 2QRZA 3ABIA 4OO3A 1M0TA 4XI9A 2VO1A 5CG2A 5AKLA 5BUCA 2AG8A 3QHAA 1R6UA 4PINA 2ZRKA 1P62B 3AM5A 3V8BA 4FDVA 4RESA 2C97A 1EFKA 2FY8A 1NV9A 2XMPA 4AG6A 3P9CA 5IH3A 2LBPA 1UANA 1Z5GA 4HVLA 4CW7A 3DKRA 1WPRA 3O82A 5AJTA 3CRMA 1J0EA 4KO3S 3UUWA 2BVNA 3JVIA 1MX1A 3ABSB 3B60A 5TV2A 2CV2A 3DHWC 1O1YA 4L5CA 1BSVA 2C2WA 2HBRA 1H2ZA 4IKEA 2QP4A 4UCWA 1NGSA 5J59A 3AR9A 1R6TA 2WLTA 2IYQA 5LR6A 5HMMA 3KZKA 5HCIA 3NRJA 1GZVA 4HAOA 3Q7RA 1VYVA 2I2XB 4FXOA 1GM5A 4Y0VA 4E1VA 5KJFA 2ZE6A 3EGXB 4XFJA 1GEGA 2PWAA 2VATA 3SF0A 5KCMA 3VNUA 3HZHA 1TEVA 4JUAA 1R4NB 2WUGA 2PAAA 1ZIDA 3WC4A 3OOSA 1F14A 3GFTA 5LB2A 5AVQA 5JANA 4IXNA 1QFYA 3NGXA 5IF3A 3ERCA 5L9AA 4DUGD 1PG5A 4OBEA 1FXWA 2D0OB 3TDNA 5AW7A 3BF8A 4QPZA 1UXJA 2C2ZA 4Z9YA 2EBHX 5PGMA 4DZRA 1I4LD 4TGLA 2G77B 5H68A 5JY1A 1QIHA 2JJQA 2AZXA 2H3HA 2DSNA 5CTJA 4CM5A 1G66A 1N5JA 1AS0A 3I34X 1XTVA 3IAM6 3TBKA 3H5AA 1SOUA 4JB2A 5CDSA 5KWIA 5KX5F 5BUSA 4LDNA 4MR8B 4EQ6A 3KL4A 4GPZA 4RAQA 4RVHA 3GLGE 3CLHA 1WMSA 3OKFA 2QE7D 1I4TD 3ZTYA 4DLYA 4US1R 3PVCA 5LUAA 2DULA 5INTA 5IN5A 4I5GA 3S2SA 1N2CB 3F8WA 2ONJA 4ZK6A 3V7UA 1G3IA 1CUBA 3GRAA 1AA9A 3L4SO 4BO8A 1AQ6A 4XWWA 2VJOA 3TQCA 5IU6A 3FOCA 4NAVA 1D2NA 1UJ5A 2REOA 2TMKA 1IN6A 3R1IA 4MVJM 3ETDA 4KQ6A 1LZKA 4AZ3A 5M2QA 3U09A 1QR2A 5LMCA 5KOYA 4ARCA 4B6RA 1A76A 5EP1A 4MVJP 2G72A 3Q3CA 4M36A 1FA9A 1PNVA 3ROPA 3TLEA 4YRRA 3AUTA 2J7PA 2GJSA 3GMTA 3A37A 3NM5A 2JLVA 4GH5A 4TLEA 1E96A 2V7QA 4HWKA 3ZDDA 3WYCA 4XGNA 4OOFA 4CL0A 2PUJA 2Q0QA 2QVZX 1BXGA 4ZMBA 3VPAA 4TYPA 4HNVA 2HGSA 2V4UA 3TLBA 4P7KA 3ROEA 3IBGA 1SG9A 4JJIA 3ROQA 1Y6GA 1YOVB 2R7LA 1FFEA 1Y6QA 3DTVB 3RS0A 1OZFA 5L45A 3RTGA 1G7SA 2WUEA 3U56A 4YXWD 3N2EA 4DB4A 1NE7A 3IULA 5KAPA 2COUA 2EZTA 2WUDA 4W1QA 4TKVB 1DQNA 2NU9B 4G0PA 2IQ5A 2RHWA 3STUA 1MH1A 1SUEA 2PO7A 3OJWA 5D7BA 2B4QA 3M4NA 2OB1A 4P0PB 1W87A 4QG3A 2KJQA 2GASA 4CUZA 3ROXA 2HR1A 1DQPA 5FI5A 3BMOB 3QWBA 1TTQB 4RF3A 1T2NA 1B14A 4TMKA 4OFBA 1R4MA 3VPBA 3R0XA 1NN5A 4AG5A 4ESHA 1V3VA 3KD2A 5ALIA 3R3YA 5JCPA 5EXEA 3M5PA 3QMWA 2CCJA 1S2DA 2I1VB 1O94A 4KQ9A 1CVRA 2JARA 3EYAA 4HWPA 4M9RA 3U7GA 2OHJA 4NCKA 2IXEA 2BTEA 3I9V6 1ZH4A 3OOHA 3OKCA 4G9BA 3SGLA 1JFRA 3CISA 1BG6A 4NJOA 4MYDA 4WX2B 4E31A 4ARAA 5DP2A 2FZLA 4PCLA 3GRYA 5EE5B 4U7DA 3UW1A 1U7UA 3UATA 1S3SA 1ZW1A 2PRZA 1OFVA 2A9JA 1NDUA 3PJFA 4L6CA 4QECA 4QTTB 1SPBS 1E3JA 3B9BA 4YQYA 1XD8A 3O7MA 5I7HA 2PJRA 3DQQA 5EY5B 1KFCB 3GAZA 1NJFA 1JWBB 2IUTA 3BQNB 3CVYA 1XQ9A 1PWXA 3QBDA 1TF7A 3IA2A 3FUCA 1G5RA 1KL7A 3MGCA 4H31A 3B8HA 4IDCA 3RUCA 1EX1A 2BFBA 3QA9A 3UWOA 1QQBA 3MSCA 1WKVA 3SHVA 4FMDF 2VVTA 1S8AA 2F1IA 1EX9A 4Y1RA 1HZZA 4F8JA 4PSUA 1XAIA 1QZ3A 3WB9A 1ADFA 5FO1A 1ZGGA 1LDNA 2F9FA 3V4ZA 4DIOA 4OV6B 4E4TA 1PUIA 3PXDA 5CU7A 3P2KA 3OOJA 4F04A 1Y5MA 1UEIA 3QKRB 2Q2OA 3RYHB 3TXYA 1ZY2A 4LZPA 4UQPA 4UTRA 2I71A 3LV8A 1GNRA 1F3OA 1KEWA 2FN7A 2QM3A 5A05A 3G23A 4F2HA 1YB5A 4UW9A 3U2QA 4URYR 4G4IA 5C35A 1JTEA 2ZJBA 2IBTA 4FGUA 3EZFA 3VSBA 1Y1KE 1ZQ9A 3I9JA 1K98A 3C3JA 3CBQA 3TQRA 3DMPA 1NU8A 1GU1A 4QPDA 4XB2A 3D5TA 4K1XA 1YDWA 4MMYB 1M74A 2WWRA 1NATA 1BEEA 3ZX5A 4FS8A 2G0NA 1O96B 2Q8PA 3NWPA 2DTEA 5K1ZA 4FILA 4HS4A 1DT3A 2B5VA 5EIBC 2FPLA 2B7LA 2FKNA 1UKVY 2DH6A 3RSZA 4Y1FA 5AVSA 4TYMA 1ZNYA 2YZNA 3H97A 1NSTA 2KMLA 4OP2A 2G36A 1EP9A 4KWCA 1IY1A 1L4HA 4OGKA 3TX6A 3VI4B 5DIZA 3T1HB 5KVSA 2JFWA 1N2CE 1GQ2A 2QRPA 1AUQA 1VSBA 1KVQA 1WQ3A 3DTNA 4RA6A 3IUSA 2BI7A 2DG2A 3BGVA 4RD3A 3D2CA 4W63A 4ETNA 1ODKA 3U80A 2PXCA 2Z8YM 2Q7XA 4TZ0A 4NHEA 1CUYA 1TF2A 1J9GA 1VHQA 1XTIA 2Q3FA 1YS6A 3NUZA 3OUZA 1FMFA 3UF0A 5CLIA 2OXRA 1DUIA 2R9VA 4TN5A 1GSIA 2ZSBA 3LZDA 4J0HA 4U9IS 4DA4A 1CZHA 2FOLA 4MHTA 3GRZA 2VF7A 4PYOA 3WICA 4J6FA 4PWZA 3K8ZA 5G0TA 4F6RB 1II8B 3CF6R 4NE2A 1IPHA 2I1WA 4BQRA 1HE3A 3OLWA 3R41A 5CT4A 4TROA 2X1LA 4TKUA 4LV5B 5CDHA 1AUXA 1T91A 4RE6A 1XTKA 2QG6A 2ZAMA 3VR6A 3IUBA 4BNZA 4O2AA 4J75A 3IRVA 1PX2A 2YOFA 4GS5A 1M72A 2PXAA 1H6BA 1R6VA 1Z74A 3CUEF 4IOLA 3HUDA 4MR9A 2H4WA 1QYWA 2OCBA 2IZ6A 3IELA 4YBZA 2V9ZA 4P7JA 3TKLA 4E5VA 3LYHA 4OYRA 2R85A 1GYQA 1NN3A 2R2GA 3G2QA 2GJ9A 1Q84A 2P6NA 4L3WA 4YONB 2CFCA 4OU5A 2JI8A 1PG0A 1FSZA 4LVUA 4P4SA 1N2IA 4AM8A 1QG6A 1PSDA 4URVR 1GV1A 3UJ8A 2O8EB 3U3OA 4JBIA 2HJRA 4JA0A 2UYOA 1A1SA 2W6MA 2X3UA 4AKTA 4RJLA 1WXQA 1JH8A 1M8JA 2JI7A 3DW3X 3AL2A 3I2KA 4KBGA 4TTQA 3FZQA 4G3XA 3I6BA 1YK1A 4U7GA 2MYTA 3WGYA 1YZUA 2AXNA 4U5XA 1KQNA 3ZGLA 4GWKA 2FP4A 2A58A 1TJPB 1FLAA 3I2GA 4MDYA 2ZIAA 3U3XA 1V16B 3CT4A 1N5LA 2MYPA 1NVAA 1SUWA 4ZGWA 1HKUA 1Z0SA 1MABA 1QMGA 3H11A 3SDSA 3VPGA 1E6LA 3HCFA 4C0XA 3DVAA 2OUKA 1G8SA 3I04M 3DKPA 2O7VA 1M76A 5F9HA 3DKVA 1CIPA 1CB7A 4IXWA 3OM8A 1VP9A 3NDIA 1SAYA 3OZGA 1XMSA 3VV3A 3C1OA 3CXUA 1E1RA 1V7QA 5ALXA 3KQOA 4MA0A 5TRTA 1Q1AA 4X65B 3D1VA 2WM8A 4L0DA 1Q0RA 3SE7A 4ZEXA 2UUPA 1LPBB 2O59A 4OATA 2V59A 5J5AA 3H6GA 3A28A 2OZVA 1G98A 3H2HA 5DHRA 3D8RA 3MJHA 2JCVA 1OVGA 2HSZA 2IY9A 2VFAA 3IHLA 3QFHA 2N1MA 2PGJA 1Z0AA 1ISHA 2O2GA 4MVJD 4QSMA 1C9YA 2WT9A 4OX9B 2F67A 3U9LA 1GQOA 4DQXA 2A3NA 4BJ5A 5EP4A 1Q1QA 4IFTA 4MKRA 3PIRA 5E7JA 2Q5IA 4B48A 2AMFA 4ENUA 1M1UA 4AJNA 4E11A 2QMOA 3UWPA 1FQJA 5NULA 2FLKA 4HDOB 2ZFUA 3AUKA 5C7IO 1CR2A 4YYZA 2XXBA 3NM4A 4HGPA 4E15A 4RKRA 4LXGA 1YB2A 5EJFA 1VKRA 2BONA 3P9PA 4ZZ2A 1QQ6A 2V3VA 3G85A 1Q5PA 4NBLA 1TZJA 4V0NA 3RU2A 5I7OA 4CN8A 1V1RB 1IRIA 1DAEA 4KYTA 1RVDA 3GMSA 1GA1A 4RGQA 4U7FA 1G8AA 4RWZA 1BHSA 3FBTA 5HF9A 4CEIB 4CTJA 1SULA 3K92A 2BHSA 1SBYA 1Z08A 3H05A 3P2JA 4IIJF 3BH0A 4I1PA 1M9NA 1XRPA 4N7BA 1MENA 2H8GA 3SZUA 5IT4A 4XM1A 1TD1A 4EPXA 4YMHA 1JBQA 1YVDA 4GO1A 1BRMA 5ELLA 1ODTC 1Q7RA 3CPHA 2W6NA 2BZ1A 4QUGA 4C4TA 5JWRA 1YA8A 3O47A 2VJCA 4AC9A 1DOHA 1T9CA 1YQGA 5EFZA 4RWEA 4Q4AB 1XCOA 1P1BA 1T2FA 2E82A 2EDAA 3UK0A 1WL8A 5LU8A 1HF3A 2BGTA 2PFSA 3KKEA 4ABTA 3HXLA 2O1WA 5DVZA 2VYCA 2ZRQA 2JI6A 4DLKA 1OXTA 1CW2B 4WK0B 3EARA 1QTQA 3R7BA 1WR8A 4XSGA 3MCZA 1LRJA 3EZLA 3KEQA 4TZKA 1TVEA 3AVOA 1GPMA 1GZDA 2B25A 5BSTA 2AN4A 4LNUA 2CSXA 1P0IA 2IDKA 5L95A 1T43A 4XSHA 5HOQA 1JJBA 3DMDA 3F97A 1U9YA 3DWGA 4OA5A 1SBIA 1KI6A 3O8OB 3VOSA 3QWFA 1RZ3A 1PZGA 1VZ3A 2OGWA 4F84A 3I52A 2CCGA 2ZIWB 3GARA 2QMQA 3GJRA 1FFGA 1GG5A 1WZCA 2GYUA 1U1GA 5COAA 5KTMA 2V0GA 4CM9A 3I4LA 4WESB 1IEVA 3DEKA 3I72A 4H7EA 5IVKA 1VKZA 3PK0A 5DLYA 1IFXA 3OWXA 1WY5A 3LQQA 2NADA 2BSXA 2EL7A 2IEZA 1UK6A 3MK31 4D57A 4ZYWA 1IBMB 4KQJA 3KJIA 1W6UA 4D56A 4JJ7A 1NNEA 5BWBA 2O3UA 2YVUA 4NR0A 5AIBA 3P5BA 1OI2A 4FNAA 4XB1A 3SIPA 3GLIA 4TXMA 3TSOA 4C4XA 2V6GA 3P96A 4GBGA 5EHGA 4KQGA 1RE1A 4JHXA 4CV3A 2PGAA 4YP0A 2O2JA 1QMPA 3R44A 5T8KA 3SBDA 2II6A 3BGSA 4C7OB 4B3XA 4NU8X 1QANA 2LDBA 1QH0A 5B3KA 4X1YA 3G13A 3ZXIA 2VL7A 4FFVA 3PSHA 4QU0A 1KI2A 1MUUA 3C6KA 1O6CA 4G65A 1GFIA 1HEYA 3MJDA 2GBLA 3CF2A 3FUTA 4OI1A 2B1QA 2IFTA 4Q7LA 3K5IA 5CYOA 3UMJA 1J49A 2CJFA 3R20A 1HDCA 2CMKA 2D1TA 3ND7A 4IJ6A 4DMRA 1C1YA 1CJSA 2XF8A 4S2EA 4D9IA 1QIFA 1V8FA 2CDCA 3VDRA 2PWZA 1XZNA 3MWKA 1E0JA 2ZS7A 3DMGA 1DEAA 2JIOA 2GPSA 3ILYA 3SNKA 2PUDA 3M4YA 3OUTA 3D3KA 3IC5A 4HX9A 4QULA 4RH0A 4B31A 1QH1B 1W36C 1ODJA 2E18A 4CGZA 2X6RA 4N49A 1GCGA 2GNPA 2PV7A 4QYXA 4B0PA 3BL5A 2UZAA 3AHFA 3L7LA 3N8HA 1MR3F 1J2TA 2WE7A 2YIVX 1PHRA 1QHNA 2EOAA 3PGKA 1AGNA 1P39A 1AY0A 5TGDA 5FNVF 2WE8A 3G5AA 5FPYA 3OA2A 2QAIA 4CF7A 3W2TA 2OXCA 3EUFA 4UBKA 3AVQA 4ACBA 3WB1A 3BJZA 2CYAA 4PYKA 2WI8A 3IUNA 3GELA 4MZDA 2AE1A 1WPQA 2CBGA 3VO1A 4DJ5X 4QDXA 1X94A 2FRDA 4OHRA 1S8NA 1QYVA 5L4SA 4IZIA 1GVNB 1PDVA 2VH5R 3V8EA 1T1RA 2A4MA 3RFTA 2AQHA 4RTLA 2H5IA 1I9GA 1XDGA 1SG0A 4G5GA 4XIIA 4ZHSA 1WCIA 4I3HA 5JATA 3U1BA 4D9MA 5BWMA 2IPAB 4PPNA 2VQDA 4HB3A 1HFEL 2GN0A 4Y2PA 3SXPA 3WSTA 4YUAA 5I7WA 3MJFA 5K0LA 4DT1B 1MO3A 2QWXA 5F23A 1JUDA 3G2OA 1A2BA 2A9PA 2Z08A 1ZSNA 2OZLA 1PEDA 2A92A 2GZ3A 5TF0A 3UQYS 5IYZB 4L5BA 1VJ5A 2J3EA 5HF6A 3TCNA 5LMUB 1RHJA 4Y6GB 3AIOA 5FPTA 3TRKA 1C1HA 4BJHB 2Z8ZA 3AB3A 3VI3B 4C0JA 5T3YA 4DQLA 2MSEB 1JT9A 1OYYA 3W34A 1E2MA 4EYGA 1KIAA 4WY5A 2ECQA 4FYWA 4LYAA 4PZ0A 4MYSA 5EZYA 4YRKA 4GRIA 1KMQA 2C4UA 1J70A 3BRQA 1L4YA 4ZALA 1L5QA 5ED4A 1QKJA 3TE7A 2BEVB 3JQGB 2I2DA 1ZESA 3RIYA 4E5MA 4IHKA 1N3LA 1OWMA 4PGFA 1WBDA 5DGTA 4K88A 2P5SA 1NUSA 4RU1A 3ZS9A 1QIDA 2P65A 4H1HA 2AZTA 4HS9A 4MUEA 1QG2A 2FSFA 3DL2A 2CNOA 2W98A 3MJVA 3WBBA 4P36A 3N2GB 4F1JA 5KPDA 3GJ8A 5B1IA 3TAUA 4KE9A 5CT5A 3ZCUA 5I6DA 5HSGA 1LS1A 5DCWA 1ECCA 2CN1A 2FN8A 3UHPA 2R65A 2BFOA 2FPPB 2IVZA 4PY2A 5IAJA 1KE1A 4IUBS 9LDBA 2RGXA 3D7RA 3BTVA 4FN5A 4X44A 3OMLA 2ZIEA 1X1TA 3LWDA 3OT1A 3RGGA 2WZDA 5GZ3A 2BV3A 1RCFA 4AU1A 3L0ZA 4JMPA 1C3JA 3OPNA 3TSZA 2P75A 2ZUUA 1FNNA 1E5LA 4MVJH 1Z62A 1X9IA 4J4TA 5EC8A 4W9RA 1H1DA 1P80A 3FHTA 4XRRA 5FPPA 1DPFA 1LTHR 4FXPA 3GGDA 2CVHA 5T57A 3WYDA 2EV9A 2BMEA 3M89A 5K0JA 1WF3A 3LFTA 3T35A 5C8XA 4ZAXA 3W78A 3INRA 1KI7A 5JCXA 5BN3B 3KXLA 1R8QA 1PWHA 1H5UA 1LSJA 4QPPA 4CRWB 3Q1LA 4YP6A 1GPJA 1TAQA 2LIVA 3KTAA 3GPLA 4HC4A 2P6RA 2G6BA 2VXOA 3EOAI 3W8NA 1EFPB 2Y1DA 2Z43A 1N4DA 1J8DA 3JQCA 4CM8B 4D4HA 2IHVA 4QHTA 5KYXA 3F5FA 4LFAB 4EHDA 1LLDA 4DJFC 3I73A 3M83A 4QUKA 2YZMA 4RKQA 3F74A 4RA9B 3CRRA 1VHDA 1VECA 2C4HA 3MJTA 4QQRA 3PUXA 1IXRC 1TM5E 2CNBA 5DTMA 4RANA 3D4IA 1G8MA 2Y9MB 5FXMA 4FQ8A 4WBNA 2Z8XA 3RC9A 4JB3A 4XLTA 2KS6A 5H3HA 1E61A 1G8HA 1O9HA 4KGZA 4O25A 3THRA 5F1OA 3F67A 3X1KA 4MEJA 4JNCA 1LBSA 3OTQA 5CMLA 4ZT6A 1RBQA 3V8QA 1QE5A 2D7JA 2IBMA 5F7JA 2BI4A 4W5OA 2F8TA 2Y1WA 4FGZA 2O5VA 3N59A 5BT8A 4AY4A 1WDLA 1VCNA 2OSVA 2QVYX 2YYSA 1R74A 2V5UA 5WRFA 4CFSA 5C2JB 1YAHA 1X2BA 1ORDA 2LE0A 3NTRA 1TCBA 1VB5A 2HK8A 4ZCRA 2AVDA 2FWMX 3MS2A 1X0VA 1JV2B 3E9EA 3LQKA 4HFRA 4MAMA 2HRDA 1T4GA 1MQAA 3P9ZA 2C3PA 3Q3HA 4JH0A 4OFWA 1Q6ZA 4BFCA 4NNOA 3ODPA 1K4YA 2UVPA 2ZRDA 1KFJB 3E3NA 4GRAA 1A82A 4US0R 2EEPA 3P5SA 3EODA 4LFCB 4B3HA 4DAEA 4JJGA 4ECAA 3K0FB 4MUIA 5CHYA 3ZTWA 3NC1C 2JJ1A 3WYEA 2PS3A 4JSTA 5K0FA 1MEEA 1SHZA 2J07A 2GPYA 2DUMA 4IKPA 4B3BA 2VA9A 3M4JA 3BA6A 1WNTA 2DTXA 2QJTA 4PF1A 3TSYA 4YRMA 5LQCA 1A88A 5CXXA 1ZHFA 3B85A 4LPKA 2Z2IA 1GAJA 2I2CA 2NVUB 1WTAA 1SXJA 3HZZA 1VOTA 1CIVA 2AZ4A 2VRCA 3AZQA 3KB1A 3N3BC 4H4CA 4J1SA 4MVJI 3RT7A 1CZLA 1E2UA 3PSAA 4WINA 1XEAA 2PX6A 4ND7A 1L1EA 2WJJA 1V95A 4RF2A 3GLHB 1L4KA 4GPD1 5A1TA 2GK4A 4L73A 2PMCA 4RY8A 1KP3A 5SY6A 4BVBA 1ILWA 2BW0A 3HNRA 3ON5A 1Z3CA 3C0KA 1Z4LA 4KJXA 3ND5A 2B20A 1WHTA 1ZWLA 2EHJA 2IYAA 1L8AA 3DTTA 3R0ZA 1W96A 4JQCA 4N01A 3GH1A 4PE5B 4BAZA 4PYMA 4XYGA 1JLLA 4V0MA 1ZRMA 5HA5A 3BM5A 2J6CA 1PZXA 2JVIA 2VQ3A 3AEQA 1Z2PX 3MC1A 1KZHA 3SQDA 4NYMR 1YZNA 3FYHA 1CT9A 1JGTA 3KOWA 2O2CA 4FEAA 3SQOA 4C9BA 3SM3A 2XQKA 1ZIXA 2WYUA 3SQLA 1Z38A 3TMKA 5HWSA 5HZGA 2QV7A 3V1KA 3U1TA 3QQPA 1AU9A 1GZ6A 1KVTA 4ASUD 2GPAA 3C45A 4QXQA 1KU6A 2PGNA 4DDMA 4MV4A 5E1BA 1QE0A 2F1RA 2PEZA 3E22A 1NVVR 4BTEA 4B3IA 2J09A 3I01M 2C4NA 2QVXX 4R2XA 4D0NA 3HPRA 5G0SA 2RHOA 3VC1A 4KACA 3UY4A 2Q5FA 3KXIA 3OLZA 4GM4A 3S68A 3HCEA 1K92A 2O2IA 2UZ0A 4AY3A 2IVFA 4LISA 5EINA 2B8TA 3WLHA 1S2NA 1TLFA 1WMDA 3LC1O 3A70A 4BCBA 8MHTA 1XLTC 3V2GA 3VM6A 4DY4A 3ZV6A 5T3UA 2FZKA 4YWJA 1IUOA 1ENYA 1EK5A 3D0QA 2FJ0A 4N18A 3NAQA 5DCLA 3ZNNA 2PUAA 4ZZ1A 2GN2A 2JFZA 3LUKA 4OJYA 2JK1A 3PFCA 4NE7A 2C96A 3W3AD 3A3NA 5AHRA 3KLOA 3OZIA 2FP3A 3NJ4A 1QONA 3QX8A 5IBCA 1LVGA 2MSWA 4WCFC 3A26A 3ROMA 4PV7A 4DCSA 4OQPA 4ICIA 4FJ1A 3CRQA 4BWYA 4H1TA 4KOEC 1IB0A 4LJ7A 1D1TA 4Q3OA 6REQB 2V9PA 4OQZA 3RVMA 4AMBA 2XB4A 2XOEA 4H7KA 4GNKA 1OI4A 2WJYA 1FP1D 4GWLA 1N3BA 1NBIA 1P3Y1 4WZZA 4RTSA 4MQFA 2F9MA 2P9JA 1MLDA 5HX7A 3UB2A 2NNLD 3G2LA 2VSXA 1GYRA 2IHYA 3F98A 3UV7A 1BN7A 1S2IA 2GK7A 3SG0A 2CL0X 1K7FB 1KAHA 2WWGA 4X7MA 5FAKA 4NARA 2IV3A 5A7FA 4I14A 4KFCA 3W5BA 3VU9A 4C6RA 2W42A 5CIQA 4EI8A 1E9RA 2VNJA 2N42A 4R6XA 1X70A 1Y5NA 3AR7A 2J9FB 4P81A 3VJLA 4BBPA 2G82A 2OO5C 3FR8A 2AUTA 2O48X 1ID8A 3KSDO 2LIPA 1M7BA 1RCUA 1XTBA 2VJMB 3COJA 1M3SA 3ADKA 4I9FA 1NN0A 1V4BA 2PTHA 4INZA 5EP2A 2L2QA 3GRPA 1QVVA 1QZZA 3JD3A 2HWYA 3I62A 4LDPA 5KQMA 3LNTA 5JJKA 1MDBA 5J5CA 4BNMA 1GLNA 2FEXA 3KP1A 1ONPA 3OQPA 5JMOA 3ZDCA 1QGUB 1AUPA 3IMCA 4QBIA 4IJUA 1VHLA 3ONEA 1K75A 5J2TF 3CINA 5EHIA 4ROTA 5CR9A 1HDEA 2R5FA 1CUZA 3VR5A 3ZWOA 3TOXA 4A8HA 3FIUA 1QZUA 3WIDA 1PG2A 1QIEA 3WLFA 2RGBA 1I0ZA 1SOVA 1D2GA 1VPEA 4EHBA 5LMNB 4UUNA 4GF5A 3FKSD 1A9YA 2WT4A 4E13A 1H3EA 3E82A 3LMKA 4NCXA 1DMSA 2VAVA 3Q12A 4UZEA 1N1GA 4BZPA 2E0IA 3BRWA 3LFHA 4LX0A 1A7KA 4KR9A 3L4JA 1U4NA 3FPHA 4OLBA 1VLQA 4LRWA 2XE6A 3KT8A 4X1KA 3BWVA 3DLAA 4IIDA 4AVYA 3ENZA 1RYEA 4RGYA 1CDOA 2ZR7A 5H5JA 3IIEA 4R9NA 4G4SP 1RYYA 2VDNB 3PT9A 1E3SA 1CRZA 1ONBA 5KKAA 4ZI7F 4ZZ3A 1SKQA 3HYNA 3TL3A 3WDLA 4E2ZA 1L5LA 3QVGB 3KSMA 1AUVA 5JI2E 5J40A 3RRBA 5FPQA 1RZVA 2PSJA 1J56A 2WF9A 3DC7A 2A4KA 2X9GA 1N9GA 3A4IA 3GLHE 4FD3A 4FSHA 1C3EA 4IXDA 3L7YA 4UHCA 1WBBA 4GSKA 3OH8A 2X42A 3L6OO 4MW5A 4ZIRA 1FFBA 4H1VA 1VKOA 1J2UA 2WJPA 3G2JA 3VTFA 2VT2A 1JIVA 1K3FA 1EEXB 2W6ZA 3TG8A 3UJCA 4YALA 1KMNA 3QK7A 1CY1A 2D3TA 1OXMA 3A1VA 5JSUA 3DWIA 5CJPA 1POXA 5DWVA 3HKDA 3EDMA 4HYYA 4E30A 2XIJA 5TT0A 2OK8A 3RF6A 2E87A 3GVXA 1ORTA 1QYCA 1VCIA 5CAEB 4HUQA 2LD4A 4ZU1X 1PK9A 3C3WA 2VDLB 4Y7CA 2JIDA 2ZANA 1QHIA 5B58T 2AD1A 3GL9A 2Z56A 2YDYA 4MJXA 4AZ0B 3EXEA 1JP7A 1Q1NA 3BCUA 2QBYB 2G06A 2X2OA 4TTTS 1OPXA 3PXBA 1L8OA 3NZEA 1AKUA 4YMSA 1QKIA 2J5QA 3CF4G 1DVRA 1PR6A 4WOJA 3T7TA 3U3KA 5A5FA 1AHNA 4OHBA 1EVZA 1YT5A 3DHEA 4AUMA 3TSWA 1Q17A 2QROA 3KQPA 4RZ3A 4A8PA 2CV1A 3SZOA 3U0BA 4KITB 5F33A 3VYTB 2PN1A 3HSYA 3KT3A 2PRSA 1PJ2A 3NTVA 4ZKDA 1JFSA 4FC7A 2F8MA 4UM9D 4RO0A 4TLDA 5AO9A 2X8JA 1JI3A 1KK3A 2E21A 3JYPA 2ZKLA 2XLBA 3Q15C 4NCJA 4XVQA 3TQHA 4BRUA 5CFLA 2GI4A 3NHKA 4P8RA 3S44A 5HP4A 2P27A 1KJQA 2G63A 2XWJI 4GT1A 4NZOA 4XGQA 3UUEA 3S7TA 1JHYA 2DKNA 2PZFA 4RDHA 3WJAA 2PKRA 3R7AA 2B6NA 1TM4E 1MEOA 3K0SA 4AN1A 1OTXA 1Z0FA 4GD3Q 4DA7A 3KAJA 1K6IA 4AF7A 2G9RA 1TZBA 3DMRA 1CDDA 1RPJA 4JYZA 3PC6A 3IUYA 4F4JA 5EHZA 1VJDA 1QAQA 4N5HX 2XQVA 3GT0A 3N39C 3AP1A 1FP4A 1YF3A 4YVFA 1U02A 1AKNA 3WBJA 4QLBA 5SZHB 1WXIA 1NBMA 3WFIA 4OHWA 2DBQA 1JX6A 2XMCA 4DG5A 3QTLA 3PXCX 1T4DA 2G9VA 3MS4A 5EJ7A 4C6TA 3AF2A 3HI4A 3UWKA 1MAWA 1Y42X 3IQZA 5IYZF 1I3CA 1KHHA 2E6KA 3LHKA 3PC3A 4R84A 2LRHA 3REQA 3RU3A 3UEOA 3MAJA 2G3YA 4UVHA 4A16A 2JRLA 1GKYA 1KERA 1W19A 1GGVA 9LDTA 1ZMBA 2HSWA 4KXQA 2PUBA 4AWBA 4X1IB 4Z0HO 5D87A 4MW7A 5BQPA 2IYUA 2PUVA 3E7XA 3JWHA 4LS3A 3WL3A 2XDWA 3FOBA 3MG9A 5KINB 4D45A 2BFCA 2IOFA 4ZAZA 3ZK8A 2P7HA 3ANSA 3PEEA 1NJGA 2VZ8A 2MMGA 2JLWA 4A9AA 3SZMA 1QS0B 5KOJA 8OHMA 1VRWA 4PHGA 3SHOA 4C20A 1NAIA 1SUFA 1L5GB 1LK5A 1EP3B 1KMHB 1HDGO 2OFOA 2G1PA 3U44A 2IP2A 5KU7A 2FQXA 2BBOA 4PHCA 2HK9A 4Z9FA 3WWCA 2JD0A 5CB0A 4UOZA 3BD7A 5IM5A 4YCCA 1WUIS 2MT9A 3JCZA 3TPZA 4KX3A 1EBFA 4HWGA 4OFZA 5FLEX 1IYZA 2XGSA 2Q62A 3BWEA 3HRIA 1TT7A 1N1DA 1RPZA 4WL0A 4FMPA 2NP6A 2Z83A 3PF8A 1I6WA 1PLJA 2PZ8A 3SXUA 1OBHA 2YNMA 3KUUA 4QBFA 4R1LA 2X4GA 3LYLA 1T13A 4NPHA 4DCCA 1Y9EA 1RAIA 3AR4A 2IXDA 4GI5A 3V33A 5LPNA 3DP7A 1CEEA 4UDOA 1S1MA 2ZJFA 1YZQA 3TIIA 3WP0A 4ISCA 4DILA 5ISMA 3IXMA 1C2YA 4U2KA 4Q6BA 4FFOA 4GX5A 2QZ4A 2J5BA 2DU8A 3WZLA 3U7QA 5BR1A 1JH9A 2HU8A 4ERNA 4KK3A 1LX7A 3ZS8A 3ZJVA 4H35A 3AHJA 1PU2A 1AGXA 3NP7A 4EHHA 5B1SA 4ITRC 3LCRA 5H70A 1T8YA 4AF6A 1AG9A 3FLBA 1JQKA 2A9QA 3MIIA 2ZJ8A 4LJ4A 2V74B 3HBJA 3TIFA 2R6DA 2OV2A 4DC0A 4G56A 1ESMA 1GADO 1NVDA 3PNBA 5JZMA 3FDFA 3OU7A 1E69A 1N2OA 4IFIA 2X1VA 3R9IA 3TTXA 3AL0C 4JLSA 3V48A 1MA3A 3B53X 3FETA 3AY7A 4D02A 2V7WA 3L8MA 4Z4EA 1IU9A 4I2VA 5IF9A 1ENZA 5DTEA 1NM5C 2CDBA 1BE1A 2XIQA 3K6KA 5DGIA 1PS9A 1ZJ4A 4DM3A 4BNHA 1R5JA 3D6VA 2A35A 5T67A 3T94A 3F78A 4BN5A 4MR7A 4FGLA 3IQWA 2BEWA 1WZUA 3BTSA 4JLJA 4YBRA 2IHZA 3SYRA 2ZATA 5DT9A 1JSRA 1DAKA 1UBUS 3EIOA 3IKJA 3TAXA 1EXWA 5LLTA 1NW7A 1A5TA 2GAJA 3WGKA 1V1JA 4L8LA 2R8EA 1KFEB 2OECA 1LDBA 2SECE 4JJEA 4HLQB 3B3JA 4L50A 3ZXYA 4KJZA 2I5PO 5K4AA 1EUYA 4FOTA 3EZNA 5FI0B 2CUNA 4UNIA 1REQB 2OYRA 2IEIA 3DPIA 3SBEA 4WN9A 4XLZA 2ZQYA 1W0KD 4U5QA 2R1TB 4A3SA 1Y3AA 2CKMA 2JF0A 1VMEA 1AZTA 1CUEA 1UJBA 3ESZA 3GD5A 3JQPA 3NC4A 3PHLA 3V9AA 1CRLA 4C14A 1BX1A 2C84A 1G42A 2WPNA 5I5GA 2EAUA 1C7QA 1DWUA 3IDQA 3V46A 1RWWA 4NV1A 5JPCA 2GZ2A 1FLVA 4DM7A 2BT4A 1NVGA 3OEHA 2HJSA 1FDUA 4LI3X 1PZNA 4BFSA 2Q6KA 3W77A 1ZMRA 2PBRA 4XJSA 5DCUA 4DCVA 1DKMA 3ABZA 4R8KA 3HZRA 3L6EA 2YJ5A 2C9YA 4ENVA 3KDPA 1IZYA 1UJ2A 1E32A 5C32A 3HKBA 2WP8J 5F2KA 3IVMA 1KJ9A 2ICAA 1Q77A 1Q14A 2XV1A 4YAEA 1NQWA 2R8YA 3KTFA 3DE0X 3QYPA 5C5IA 2VHUA 4KLZA 3L8GA 3NHRA 1MXFA 2WMYA 4M0KA 1VP3A 2AGVA 1BEUB 5TQ2A 3AEUA 3S3TA 4F91B 1BTOA 3HA7A 2IWHA 2P8SA 1Q2UA 1QHHB 4R9VA 4PYJA 2J7PD 4HCJA 1PVVA 4J0JA 3ZZNA 3FMVA 4YK7A 1W85A 4YASA 1K4MA 3E2MA 2V7QD 4RDXA 2GLUA 1X1AA 2C2XA 1I3LA 3BMCB 4LKOA 1Y8CA 3FHOA 3BWBA 3V9PA 3AOEA 3PPVA 1ORWA 1NOKA 3VAZA 1BFDA 1JSZA 1UOEA 3CMMA 4R9RA 3R7WB 4FDLA 5IBRA 2COKA 2OMKA 6YASA 2K7ZA 2HUNA 3RVPA 3UXHA 2VDUE 1U9JA 1V48A 5HQJA 3G0HA 3ICPA 1IULA 1C8KA 1JJAA 4DS3A 4XTCS 1FTWA 3HBMA 4C88A 1G41A 3VV2A 2YOHA 3URMA 2YRXA 4KXMA 3EQ8A 3KRTA 1NR7A 2QGFA 3CTMA 3PHIA 3QM1A 4JGGA 1NBWB 2A0WA 3HKEA 4MP8A 2AG0A 3NKVA 5AP9A 3QUCA 5HHTA 3FZNA 4O2BF 3IVAA 3RK0A 2CNWD 1EUZA 2PK3A 3I8SA 3M81A 2JI4A 4KUHA 4DGQA 4LK3A 1A9ZA 2YMPA 3OBIA 3QU5A 4LXIA 4I8XA 3O8CA 1U28C 4B82A 2AI3A 2VEOA 3QX9A 1Z06A 2AKAB 1RLIA 2FWRA 4FE4A 2PBLA 2C1EA 4G6ZA 1I6LA 1O94D 3SBOA 3FNIA 2C8VA 3HDYA 1KP2A 4F9FA 3B51X 3TCKA 1UL1X 2OBXA 2QNBA 3KJNA 2JIPA 2WTAA 1KK1A 3LXMA 3PWSA 3PZBA 3LRTA 1Z16A 1NFQA 3VDQA 1U8AA 1PR5A 2F1HA 2Y0DA 1COWA 4NK4A 1N8NA 1DWOA 1WVIA 2JJYA 2N9UA 2NAPA 4V39A 4HZUA 3RPEA 3WIBA 4HUJA 3TEFA 1ZRNA 3KQQA 3ZKWA 2FZEA 2J3MA 3PVZA 2HA6A 5ESWA 3GDGA 5F7ZA 1L5KA 2PXXA 1P44A 5BW6B 3V2HA 2WG0A 1HTWA 1O54A 5JNVA 4ZARA 3RS2A 3A4YA 1HE4A 3BL8A 4NI5A 1E4YA 1W5TA 5ILQA 1JHQA 1S02A 3CH5A 1AD2A 1L4EA 1QCZA 1V0JA 3PA6A 1ZZEA 1FRZA 2FPMA 1U8TA 2NTJA 4PANA 4PCVA 4D3FA 1NZFA 4R2LA 3ONDA 5EJ2A 1KPHA 5FX2A 1OT5A 2ZTSA 4D7AA 1JEQA 4QE3A 5COQA 3V1MA 4REOA 1N2SA 3I42A 1LDEA 3CZ9A 3D59A 3PU6A 3LTNC 4WACA 4KV7A 4EB3A 4J1TC 3JAWA 1N34B 4AB1A 3W1VA 3MWYW 4YH1A 2E5FA 1X1SA 2R8PA 4IQFA 4UKDA 2GAIA 4YRDA 2GEUA 1U6JA 1CUSA 1ZITA 2OM6A 2EKBA 2C58A 1YQQA 3TX2A 2VH1A 4MO9A 3V3KA 4E5PA 1TRKA 3DA8A 1HA3A 4M1EA 1WXGA 1E59A 2HI0A 2C4VA 5AKGA 5LXTB 1NF2A 2QP9X 3AEZA 1WY7A 3EEFA 5J2UB 1SVUA 3KXKA 3PRJA 4F9EA 4F93B 1Z73A 1U0JA 2BP7A 5ADWA 4XLLA 4YAOA 1W4CA 3J81A 1KY4A 1NU6A 3RAJA 1YRBA 2ZUWA 4DLSA 4WKCA 5GVRA 1YTLA 1XDDA 2IELA 3QG1A 2Y76A 3WV4A 4ZYLA 2BMAA 2Y71A 3CA8A 4C6HA 1KQGA 5JSQA 1F17A 3LT0A 2PRIA 4HY3A 3DBLA 1BGXT 5KJ1A 2YYAA 1H1LB 5KYWB 2HYIC 3FY4A 2UZ1B 5DZSA 1AO0A 1W4BA 3K72B 1R66A 3NBFA 2JIMA 2ZRJA 3ZWVA 1O7JA 3WRXA 2W2OA 2O8CB 2QPLA 2P2ZA 3THXB 2VQEB 2VHEA 3Q7EA 4WCDA 1P77A 1SK8A 1KZ7B 1XMPA 4KDFA 3RDPA 3B6MA 3ZXXA 4AY5A 3AY6A 4MRPA 5AUOB 2PD4A