1KZ6A

Mutant enzyme w63y/l119f lumazine synthase from s.pombe
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DLKGPELRILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSYELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVIFGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-Dimethyl-8-ribityllumazine Synthase
publication title The structural basis of riboflavin binding to Schizosaccharomyces pombe 6,7-dimethyl-8-ribityllumazine synthase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1kz6A00
5IM5A 1KZ1A 2A59A 1W29A 2B99A 1ZISA 1XN1A 1RVV1 2O6HA 1KYYA 1KZ4A 1NQWA 2B98A 4KQ6A 1W19A 2F59A 4J07A 3NQ41 1T13A 2VI5A 2C92A 2JFBA 2I0FA 1KYVA 1HQKA 1KZ9A 1KYXA 2A57A 1DI0A 1NQUA 1EJBA 1NQVA 2C97A 1NQXA 3MK31 1KZ6A 2C9DA 1C2YA 2A58A 2OBXA 1C41A 2C94A 5IM4A 2C9BA
chains in the Genus database with same CATH superfamily
1XI2A 1A8SA 1ODCA 1E1CB 4KQ2A 4NU0A 3IUBA 3PF9A 4HH3C 5IYZA 2Q2NA 5IAEA 1J2JA 3DNFA 5AJYA 1TFRA 1E89A 1BYIA 4IXDA 5C8YF 5CT4A 1E2NA 2AFIE 2JJ1A 2ZVQX 3M8KA 3HL4A 1L1EA 3JTEA 4Q1VA 3HV0A 5AW6A 2IEIA 2NU6B 5KWJA 1T9GR 4YT4A 2DJ5A 2JIZD 1CZOA 3OZBA 3LKBA 3ZDZB 1HMPA 2PNJA 2FZEA 1XTSA 1L4FA 2CL5A 4IV8A 1K3TA 1NW6A 1Y4UA 3A10A 3CRVA 2FFQA 4WADA 3FI9A 5CJJA 3ZGVA 3FHOA 2ZT7A 3G5UA 1RFGE 4G26A 4RKEA 2FN3A 2PBZA 4WL0A 2H2FA 3D54D 2CDCA 3WE7A 5HDBB 2V7BA 3I58A 3NS7A 3OHMA 4S1PA 5AJWA 3WWOA 5KTRA 1HTWA 1QRSA 4E2WA 1F14A 3MOSA 4D81A 5JXJA 2BEVB 8ATCA 2BTQB 4Q39A 4RK7A 5FO1A 3RHZA 4FILA 1EP1B 4C7JA 2E4WA 3MMNA 2F1OA 3A37A 2QAGA 2Z5VA 4QOHA 3E9YA 2P9GA 5GONA 5BR8B 1C1HA 4Q7QA 4WK6A 4RF2A 4TV9B 3E9EA 4KQJA 3ANSA 4ZDJA 2IYTA 3NGLA 1TEVA 3SF8A 1PQWA 2XODA 3L06A 3COZA 1HF3A 2C1ZA 1O94C 2X5NA 3CFYA 2C4MA 3ACCA 4G2TA 3ZHRA 1PAUA 1SBZA 1HEIA 3NM5A 1ZGJA 1H9BA 1U8CB 4WFKA 1D7AA 2PH5A 2Z3ZA 5D2CA 3KL2A 1RXSA 1YA8A 4XB2A 1TIBA 5FO0A 2HA0A 2XEXA 3R9IA 4E5NA 1LCIA 2D4HA 2BGGA 3LPMA 3WB2A 4EQ6B 1YZNA 2CCJA 1CULC 4R2XA 5E7MA 2BMWA 1P2VA 4GRAA 3CLUC 2D0DA 1ZK1A 3K05A 4Q9JA 1U4SA 4EARA 5ESWA 4BJ6A 5I7OA 3RTCA 3D8NA 3DT8A 1E5LA 1VKNA 1A8IA 3GCGA 3NBKA 5K8LA 1C4XA 2WAMA 1JU4A 5IH3A 2WDZA 1TO6A 1FNMA 3S27A 3F8WA 1TQ2A 4A2QA 2NUPA 1E3SA 3GJ4A 3R5FA 4OJKA 1U63A 2AX3A 2VVTA 4R0MA 1JJVA 3KOMA 1A97A 1PFVA 4NK4A 4C5CA 1L5KA 3QUTA 3VR2A 2JDID 3EUAA 3KZNA 3NAMA 2AQIA 4JQOA 4AY5A 4MYDA 1LTHR 1U7OA 3ILXA 2QTVA 1EVLA 4C7BA 2I7VA 3KAJA 3LFUA 3BE5A 3F4KA 1TLTA 1USWA 2QRVB 3BCHA 3RRMA 4EUEA 1V5IA 1XTTA 3QX7A 4ARCA 4FC6A 4ALKA 4M21A 1CWUA 3T3GA 5IKXA 5EZYB 3BD7A 1LA2A 1EFTA 1WR8A 2VUUA 4EGFA 4V0MA 3AETA 1X8KA 4HQRA 1RYYA 2AR0A 1NXVA 1LDEA 1Z7BA 1UZAA 2X0NA 2ZBPA 3MRSA 5KHLB 1BU5A 1FDWA 2X8AA 3QBEA 4J76A 3UB3A 4DHWA 2WOOA 4HYEA 1Y1QA 3P2MA 1W96A 3QYFA 2CNWD 2EJVA 3EH2A 4J4TA 4RHTA 4X1OA 5FX2A 5LUAA 3PDHA 2CDAA 5CRIA 4PFKA 1ZIXA 1ZCJA 5L7WA 5KYWA 4PFJA 4B74A 2Q9UA 5CVVA 3I12A 3GGCA 1V7QA 3DBOB 3IELA 1G38A 3TTSA 2ZJZA 1GUYA 1Z0ZA 2ZB3A 4F1WA 1ZH0A 2VP3A 4TKVB 3CUKA 4ND8B 1Y9AA 4UMDA 1T5HX 1QYCA 1RM0A 3Q8LA 4Q7MB 3TLGA 4LY0A 3DEFA 3IMGA 1N77A 1YBFA 4BMYA 3L92A 2WWRA 5AHRA 4GF5A 1KEVA 2Y71A 4NZZA 1SCQA 5DYGA 2VDJA 5TPZA 1XAGA 1T6BY 1ML3A 3KHUA 2B36A 5IMBA 5JYCA 2PX2A 3I0MA 4PHGA 4U7DA 5TY0A 3E8MA 1OYYA 2X23A 3S2IA 3UXYA 1Y98A 2XF8A 3G2MA 4MINA 1XZNA 1T2CA 3AEXA 2C3YA 2ZI5A 3E3MA 3AGQA 4PO8A 4G5QA 1G8KA 2AFVA 5FUMA 4KK3A 1A98A 3BXHA 3LBNA 1P19A 1TGVA 4N5LA 1VG0B 3EVGA 3PRKE 4DRZA 3L7DA 1V8PA 3PI7A 1S3SA 3U7QB 3CB2A 5FBWB 5TQVA 1XNQB 1PWHA 1QGED 3LP8A 1I3LA 1D2CA 3IP1A 1J2EA 3L0YA 4FN4A 4WXRA 3CF0A 4F8EA 2QTTA 4DWWA 3DL4A 1XQWA 1DIRA 1SEPA 1RHRA 3L1HA 1QGZA 1T0PA 5MHTA 3SC6A 1FU4A 3A36A 2J3EA 3AM3A 6REQA 1MAWA 4IV0A 1DCTA 3H3JA 4BMOB 5DBHX 1N2OA 3K09A 1TVEA 5DXJA 4N41A 1ODKA 2ONCA 1AK1A 4RYDA 3VKUA 1MV8A 1LBTA 2PX0A 4QUKA 1GM5A 4JJZA 1A50B 1KYWA 5JSUA 1E8DA 2A9QA 3JSAA 4G09A 3LF1A 4CFYA 3GLGB 2WVAA 3LVRE 5K45A 3R2JA 3B1WA 2WIKA 1H85A 4NU8X 4PC1A 1L6IA 2HIAA 1JHXA 1TU3A 2Y99A 1POWA 5AM5A 5K1ZA 2UUOA 1LV8A 1ZIYA 3COSA 1K0FA 1K1EA 3D3QA 1C7EA 4KH1A 4RHYA 1NVVQ 4YAEA 4DR1B 1BRMA 3JWIA 3I1YA 3ZCUA 1Z0UA 1DV1A 3TEJA 5LOVF 1GARA 3SBEA 1RRMA 1ZL2A 1X38A 2BMFA 3A6ZA 1QP4A 3L18A 1U0NA 5BPHA 3GGSA 3EK2A 4LAFA 3RVLA 3UAGA 3VNSA 1PEKE 2P2DA 1TD1A 5DBEX 1OX6A 7ADHA 4X7MA 5JZSA 4MQUA 2BFCB 5I8PA 1D4ZA 1XD8A 3HA3A 1E2KA 1H1DA 3MPUA 1RHQA 2WLTA 1QZUA 2PXAA 3NHWA 4OGGA 1T2AA 2OQVA 1HH4A 4IDFA 1TC2A 3WB9A 3SJUA 2OXFA 2PSSA 3KCNA 4GI2A 3SYLA 3WK8A 2GJ9A 1XJWA 3FTQA 4JQYA 2AV6A 2IU6A 4OAQA 4Y7DA 3VQTA 5FA8A 2C4UA 3L9WA 4D4LA 1DDIA 2D0IA 3D4NA 2HW8A 4PYLA 1YFKA 4TXHA 3TQIA 1PD1A 2FPKA 2Q4RA 1Y5MA 4ILKA 2HLHA 2QE6A 3NXKA 1JX6A 1RLUA 2XYVA 3UAYA 4XCQA 1AGXA 4HDQB 4RNDB 4YCMA 2Q27A 2HRDA 4Z9AA 2I1LA 4RL4A 1VE7A 1ZNYA 3CEPB 4W9NC 1DGQA 2ZR8A 1C8BA 4B3CA 5AK6A 4GAEA 4A8JC 2KSQA 4C6SA 1GXSA 3DXYA 3OUUA 3V4OA 3LZCA 3PYXA 5AW3A 4GXQA 4U2DA 3IOYA 1KSHA 4PLFA 4TTVA 5KKCA 3DFIA 2C9OA 4RHCA 4Z99A 3T94A 4BMSA 1PJQA 1P7WA 1SBYA 2GBLA 2W2QA 2D1QA 3DMNA 3O47A 3UYKA 2EV9A 1K2WA 1KH3A 1U7PA 1BD4A 1NY6A 4G4GA 5LA6A 1Y4DE 1VE3A 1LBQA 3HJAA 1HDCA 1NX9A 3B2NA 4N8EA 4BO0A 4IIJB 3A6LA 1XCPA 4C0BA 3JPWA 5AXDA 4GQBA 3VYUB 3WK7A 1V2HE 1DV2A 1TT5B 2Q8PA 1MCZA 2Y3IA 3MJVA 3MFYA 3DONA 2G08A 1LNZA 4NEGA 3FYUB 2IPMA 3WQHA 2ZBGA 5ADWA 4ML3A 2JKZA 3TPFA 1OI2A 4AFNA 3U6KA 2WUFA 1IY2A 3NT5A 3AUFA 1FB5A 1GILA 3AKEA 4JLOA 5D00A 4BQFA 4OM8A 5FQOA 4CMGA 4PNEA 1FFAA 2PANA 3GUHA 3BX1A 4OG2A 5EWLB 3TUJC 4O8ZA 4R2MA 3CE9A 2A5LA 2BD0A 1XRQA 4YRKA 5T6BA 4GUAA 4AS3A 1G66A 3O83A 2H4JA 2IE0A 4IICA 1WCIB 2ZM5A 4B6PA 3BWXA 1SURA 2OXTA 3M6VA 1FTGA 4JLUA 2B4TO 3DE0X 4KQ9A 1BNCA 3BORA 3NIWA 4O2RA 4YRQA 2GASA 2P11A 2XNJA 3SMVA 3L4BC 4BRSA 2H7XA 1Y1RA 3X1YA 4L5BA 4PRZA 1E9AA 1NBHA 1NM5A 2BUBA 3KWLA 3M5WA 2QAIA 1YS9A 2YBDA 4MPJA 4E88A 5G0UA 4Q48A 1J9EA 1OVMA 2ZAIA 4UU0A 5A9SB 4C1BA 1SWVA 2N47A 2YNMA 1HRDA 4OGKA 4PBTA 1UQRA 4KN8A 1RJEA 3EVCA 3K0FB 4E5SA 3EDRA 2B1RA 3VXKA 1ZOSA 1WSBA 3HN6A 1SU4A 3GCDA 4A5SA 3RK1A 1YFLA 2NQTA 1J7JA 1LX6A 1PVVA 4HDRA 2Z09A 1S3IA 2VQDA 1XYVA 1JMKC 3H1FA 3KQOA 4O2AB 3LBHA 3N07A 3RTEA 3H19A 2D4AA 1GITA 1T25A 3UWMA 4J0CA 3W9UA 3OE7A 3LT5A 4RZUA 1R10A 1XN4A 1YS6A 5J2TA 1MA3A 1VCHA 5HFNA 5AJUA 2R2GA 1QAQA 4IYJA 1EVEA 1PNTA 4TWJA 1XJQA 1DFIA 2M6RA 4HI0E 3AVWA 4WZAE 4W5QA 1Z28A 4YNBA 2DP4E 1W47A 2GEDA 2RGBA 5EE5B 3H3XA 2Y1WA 1J8QA 3V48A 3K9CA 4F9GA 5JPCA 3FSGA 4YCDA 4M88A 8LDHA 3H18A 1JHPA 2YS6A 5TF4A 1ZD8A 2AG5A 2L42A 3FUVA 5GGXA 4EB0A 1WCYA 2P4SA 3K9GA 2GA8A 5ENZA 1EFRA 4RULA 5LXTB 3AZQA 3I61A 2KLHA 3K0HA 1M1UA 5TMDA 2JLZA 2DXIA 2C2BA 2HGSA 3K5PA 4PLGA 1JF8A 5JAIA 5DHRA 1O0BA 4OQMA 3MGCA 3QPDA 4YXWD 3EMKA 3VR4H 3BXPA 2ZSDA 1AXEA 1J97A 1IOZA 2PL1A 3OZVA 2IV3A 1PI3A 2ISSD 1KZYC 4EVRA 3RFCA 3P32A 4KDFA 1D2MA 4TYQA 5FV7A 4BVGA 4NJOA 1T10A 2GN1A 3NT4A 3HWSA 1HFWA 3CRMA 4KMSA 4Q3AA 1AE1A 1CQWA 1XRPA 3O4GA 1S1MA 3ZS8A 4IILA 3SDZA 1Y1SA 4IXWA 4D3YA 4DR3B 1BC5A 3WHLA 4DOMA 2ZOSA 5HDQA 4YRSA 2IPLA 4L08A 3NHRA 2WTMA 4N0PA 3F74A 1U5BA 4IDEA 4ZO6A 2XPCA 2PA0A 3EZXA 2IXFA 5CK4A 2NUTB 1G8SA 4L3VA 4B9AA 1UZLA 4ZMBA 2MSCB 3AEKA 2O2XA 5L45A 5DSXA 4KLAA 3O73A 2OD9A 1YRQA 2NZ8A 4HF7A 2NYAA 4TZ0A 3VSEA 2M2IA 3KUXA 2FE4A 4MUJA 1E0DA 3ZE8A 4DR2B 2VJYA 2ZAMA 1U2PA 4FNMA 2C5SA 1V37A 4JVMA 4X20B 3MINA 5ALEA 1H8EA 4B34A 4QHTA 4XCVA 3BK7A 4YAOA 5HCIA 1ECCA 1RAGA 4EF5A 5KJ1A 4N5NA 3WDLA 1OLUB 2RAFA 3JYNA 4IGKA 3DXZA 3A1TA 5FXMA 2FWNA 3NYIA 4JLVA 2QD4A 5U9CA 5AKEA 3AR2A 4H7KA 4WUVA 1P31A 3OECA 4WVFA 1LPNA 1R74A 4LGYA 3T3NA 5JAUA 4O4JB 4QODA 4CMJA 2JLAA 4F5DA 4D98A 4RS3A 4UU8A 2TMKA 2YIDA 2C92A 1LRKA 1JFFA 3GFBA 1CQJA 3JQ8B 4H9GA 4NKRA 3R7AA 4E14A 3FJOA 3PDUA 4LGCA 4BIIA 2FPIA 3GT7A 1Y9DA 3KEMA 4I4IA 4Q16A 3KT8A 4NFYA 4DA9A 4F12A 1AMOA 4IZOA 2WT8A 4HMOA 1QGUB 4Q12A 4TS3A 5AXBA 5J1TB 4ER6A 2HN9A 3W2TA 2XJ9A 3DXFA 5H81A 3HMKA 5K0JA 3INTA 1F8YA 1ISSA 2HMWA 1C9JA 2RHMA 3OQBA 3E27A 4WAUA 1BGXT 4BUZA 3A6EA 5JTUA 1SXHA 1WP9A 1MTZA 2F3SA 2PZMA 2YVKA 4KREA 3U6BA 5BNFA 5KINB 5L53A 5TQ0A 1HE3A 3OFND 3MG9A 2JGAA 3VJMA 1R4ZA 1YE5A 3KUUA 2VHJA 5CNKA 5H9WA 5IM4F 1W36B 1CYEA 5TX7A 2P5TB 4KFRA 2GCIA 3ET4A 2FOXA 4D46A 1A7KA 3CPHA 1CY4A 4DIEA 2VJKA 3NWPA 4IDPA 1ND6A 3LUHA 4DQKA 2YJ3A 4UZFA 4ZFNA 1H2WA 2WWHA 2O2SA 1CVLA 1XZKA 3C2QA 1MPXA 3D3WB 3MGGA 4IINA 4RCVA 1A8QA 4XYBA 4JI1B 4RZSA 4I4TF 4QRIA 3V2HA 1JLMA 1QOZA 2MR6A 4FD3A 2VTVA 3W5HA 2P5UA 3VO9A 4EPRA 1ADYA 1JQEA 2V7PA 3U4IA 4K81B 2YXBA 3UMSA 4FP9A 1CP3A 1NULA 3W6NA 4F2HA 1ELOA 1P2BA 2CWWA 2OV4A 3I6QA 3MUEA 1R4MA 3B89A 3DR3A 1OXVA 2OSVA 3N2KA 4RSHA 4KCGA 4NYJQ 2QLJA 4OCZA 4W5JA 2B8EA 3GX1A 5ES3A 2LXNA 2JD2A 4CM3A 2BJWA 2I4OA 5TMEA 2J4DA 2H85A 2OOSA 2Z9BA 4AJLA 1J2YA 3PFIA 3HY4A 1Y5LA 5CURA 4YREA 2BKEA 2OO3A 4Q1FA 1T6ZA 3V33A 4B75A 3K1AB 1OWNA 2CNOA 4QO7A 2Z5FA 4X3PA 5DHUA 1VE6A 2WYWA 3BZWA 3OLWA 4GM1A 4BFZA 4XQ9A 1X94A 4DRXA 4LN1A 3KSBC 3E58A 4PBRA 2G06A 1CHDA 3AUAA 3EGWA 1GGJA 3KJGA 1RIFA 2ILVA 4MVJI 5GINE 1E7SA 2NVOA 1D2RA 2Z98A 4EH1A 4KPUB 1QK4A 4I1UA 5KNBH 5F7OA 1NQAO 1ZZGA 5ERGB 4OHPA 1G5TA 2BKXA 4J3FA 4R1SA 3T4UA 1IY9A 1XAHA 1Z2AA 3BL5A 1NP3A 3R3XA 1XFDA 2O3TA 3EZ7A 3H8SA 4G1BA 4MP3A 4MVXA 1D03A 2EKBA 1LPSA 1ISJA 2B8NA 2XUKA 1XHLA 4AM8A 3TAXA 1JHVA 1DG9A 4J1SA 4PS1A 1WVIA 3QRWA 3ND7A 1O9HA 5GJVC 3FPEA 1JVBA 2IUUA 1KDZA 3I5AA 4EL5A 2PJZA 3NHJA 3OSUA 1YBHA 5EKDA 4CG3A 1N0IA 3BCUA 3Q8XB 1VYTA 4JU9A 2H08A 1G5FA 5CFRA 1XZPA 4ZXFA 4X1IA 3EVEA 1MO4A 4GLLA 1U2SA 2C1EA 2WNSA 4G5OA 1JAHA 3E1KA 4O59O 1BMFA 4LNUA 3PGKA 1T5SA 1EVZA 2B20A 5CPBA 1Y4ZA 3CVYA 5DX0A 1ZD2P 5JROA 5DHFA 1OTHA 2VHTA 1GYQA 1VCMA 4MJ7A 3T5PA 2BFBA 3D64A 2PZAA 2V6MA 2YW2A 3EFBA 1KK2A 1L7NA 3KQQA 1F8GA 1OXKB 3IXLA 3HCCA 1GZ3A 2JHAA 2Q5CA 3KQTA 1F1BA 4EUFA 2JH8A 2X0FA 5HZKA 1JR6A 1EJ2A 1A77A 1S96A 3LECA 3WLTA 2YTZA 1XYYA 3JQBC 2H0QA 4AYTA 2IL1A 4YUVA 2HM7A 2XLCA 3SCZA 1Y8ZA 1CJMA 3WLOA 4Q02A 5C37A 2CNDA 5FHQA 4BX9A 2VRCD 4JOSA 4LZPA 3RD5A 5HK8A 5ES4B 4FCWA 3GDWA 5CDUA 1KRWA 1YDFA 1Z29A 4S0XA 1JIVA 4AMUA 3C7CB 5EZ6B 2W9XA 5HBGA 1K6EA 1EUDA 1PTKA 2RJOA 1P3Y1 3KXLA 4ZJYA 2IOHA 3OP1A 4DSOA 2BFAA 2OXEA 3FSRA 1MR3F 5IS2A 1PJZA 4ZC8A 4U2FA 4TKZA 3ZLJA 2IZ7A 1NVDA 2Q1TA 3PKIA 1TYDE 3UXEA 4E31A 2AF4C 4Q7JB 2VDNB 1WF3A 5EEHA 4NYJR 4ZQHA 3I04A 3P0RA 2Y4OA 2FOLA 4ZQCB 5G4KB 3JQQA 1BWPA 1NN0A 2MDTA 3GWGA 3KYIB 3TBFA 1XMJA 3WGNA 1WDMA 3PXCX 3QMMA 4NBWA 4F4IA 5LP6C 3VM6A 1IJKA 2W70A 3O38A 4XLZA 1O94A 1JIKA 4UXIA 4QAQA 2CMKA 4P53A 5KTPA 4OMFG 1YMQA 2K87A 2OLEA 4I2NA 2JIOA 3UC9A 4I0WB 4RIGA 3STVA 5E1OA 3L1JA 1N9ZA 3NONA 1MC4A 3NHYA 1JIXA 2QRJA 3FDFA 1IWPB 4RA9A 4XLLA 5F5NA 4Y1FA 1PT7A 3CT6A 4PTYA 3HM9A 3A6PC 1HLFA 1T26A 2JHCA 3RVSA 1VZ2A 2VNSA 4TTIA 6AT1A 5ITVA 2H6EA 3ELWA 2P9YA 4FQ8A 5DHSA 3C0KA 5CW2A 3GGOA 3AZPA 3ADPA 3JU3A 2DERA 4KSBA 2JRCA 3QV1A 1FTSA 2FHPA 4N9WA 4EB6A 5A7HA 2NO0A 3N2GA 3O8OB 5B55A 2V7QA 2R8RA 4UMFA 1S4MA 4ZCPA 3WJAA 1K5HA 1A76A 4HFJA 3H05A 4Z3OA 3U44B 2R11A 3A9VA 1UXGA 3U09A 1W0CA 3FGOA 3RUHA 5JC1A 4HSEA 4ZRMA 1YJAA 2HA4A 1L4NA 3M3HA 3KQSA 2W48A 2ANBA 2YMQA 3O0TA 4IFEA 5G3ZA 4CF3A 4X6LA 1DI0A 1W25A 1FVFA 4MLDA 4BQIA 3RSCA 3FCCA 2F3UA 3ZJ5A 4CTJA 4RMIA 2RGWA 2XWSA 2BGNA 4KQ1A 3NORA 1VYUA 2C9BA 4MEBA 3ZHVA 4O3MA 2W6ID 3PSHA 4TV8A 3ZK7A 2BBOA 1KU0A 3D1JA 3EPRA 1WMFA 2ERYA 4TYWA 1E1RD 3TNYA 4BZXA 1QZTA 1LGYA 1GAQA 3IV6A 4ZCMA 4G5SA 1JV2B 3IAFA 4PS0A 1G63A 3OJCA 3P0EA 2HUNA 4IQ8A 4QUJA 4R83A 3ZWNA 2OWEA 4PTLA 2YHBA 4AWBA 5J3JA 2WB4A 2QWXA 4KHZA 3V7FA 1P4SA 1P17A 1HM5A 1K68A 4BNGA 4ZQGA 4BRWA 4UC0A 4DF3A 4CF7A 3KSAC 2QL9A 3PENA 4B87A 1F20A 1WEHA 2C97A 2EX4A 1ZIPA 2NVUA 1NQXA 4I4NA 4Y1EA 3GPBA 4IHJB 3IVRA 5AKJA 5SYMA 9GPBA 3WSVA 3WAGA 4AZTA 2R3SA 4E08A 1EESA 2OXCA 2XCQA 5AOVA 5DKFA 3SZOA 3JTMA 4LYJA 3S28A 4V1CA 1ZS9A 1GPNA 3J7TA 4XGIA 5C34B 1P81A 4R1OA 4LW8A 3M6XA 2AEJA 3EMBA 5ITZB 2EERA 1ESDA 4Q34A 5HHTA 2PMCA 4RJTA 1LK5A 4ID3A 2YHIA 4XIFA 3RU7A 2P6OA 3TMYA 4KO8A 3WLEA 2J8ZA 1L7XA 3EXFB 4ER7A 4TYNA 3U7HB 4KMMA 3IAAA 3T7CA 5MGBA 1JR3A 5ALKA 5JY1A 2HLPA 4EJSB 3IV9A 1JPJA 2YH2A 4C43A 1QVVA 4U7JA 4Z7OB 3W4JA 2PGIA 1E7QA 1NURA 1AN0A 1PW5A 1Z6XA 1GIAA 3ZXUB 1Z38A 2FI1A 1JECA 3EGCA 5DSZA 2RHLA 4BNJA 5FBKA 3KO8A 1IU9A 3RBXA 4D4MA 1PDWA 2IC5A 4ZGGA 3HXKA 3U4QA 4AU1A 2GPJA 1PLLA 2OSBA 2O57A 2C42A 4AY3A 4CKBB 3K7EA 1UKYA 3IJPA 3NFYA 4JVOA 1YS2X 4FNAA 4C2UA 3J80A 1Z5VA 4EY7A 3WQRA 3OVMA 1B0UA 5LUBA 5FTLA 3QKSA 4JY7A 3RSOA 2V1XA 3ZXIA 3U7GA 1DQPA 2KLBA 4TXMA 3O26A 4MVJA 1R9MA 3M2PA 4ZJUA 1X1AA 1SA0B 3GDOA 1TDJA 1QR6A 3WGVA 2QOEA 4YRDA 5EJ2A 3VNQA 5JNWA 2HU2A 2O2HA 2G80A 2I8LA 1T0IA 3R6LA 4QDKA 3ZY2A 3JZIA 4ZI3A 3I37X 1A27A 3NG1A 1WDWB 4L75A 1YQWA 2H8KA 3B6EA 3EXG1 4UHCA 1M8GA 4KNWA 1MENA 3QW4B 4O4LF 1E0KA 2GF9A 2PXHA 3FVTA 5B2FA 4KWHA 4RVNA 1SGWA 2G71A 3LQYA 2XEDA 4UD2A 4CMAA 4ER0A 4ZARA 2SCUA 3LC0A 3QOYA 5AVOA 1PRYA 1A4UA 2JJ2A 3F5DA 4JK3A 5LPNA 2JD0A 5JQGB 1UWCA 1L5OA 1RM5A 3ODGA 4M8IA 4ALJA 4QG3A 1G8GA 3R4CA 3SFVA 3ACBA 4QVGA 1X7WB 1T5DX 1OXTA 4GBMA 4Y6PA 4H1TA 3I5YA 3EF1A 3VTFA 4XH9B 1HNNA 5J43A 4RLQA 4PLZA 1LDYA 2QJOA 2CZQA 4QGSA 5JFGA 5A5GA 4AUMA 2FLWA 1NPTO 4B1FA 1DXOA 3FPSA 4RWEA 2HJWA 2XA9A 3AIIA 3I72A 3M89A 1VHLA 3OO0A 1TTHA 4ER3A 1E9SA 1EFKA 3RLFA 4EFKA 1I6MA 1WW3A 3PVCA 4MGEA 4P7GA 3UT5B 2M9MA 1Q44A 5H3HA 3GLFE 4LXGA 3JVUA 2HTEA 2ODWA 4MUXA 1QC5B 3QEBZ 4BWVA 4KPEC 1ZICA 3KUKA 3ZWKA 3LDHA 5I4KA 4QM6A 1BDIA 2B0JA 3AIMA 3MS7A 2VP4A 1LBEA 3AHFA 3H2KA 3U3RA 2MWMA 3AZOA 4W9NA 4GBGA 4BEWA 2OM6A 3MA0A 4RVHA 1DIHA 1P0FA 3QGMA 1CW2B 5FP0A 3FVRA 1H1LB 4A8JA 1R7RA 1PGQA 5DSTA 3ZI7A 4ARBA 5DMHA 1RAIA 3EIXA 5DM0A 4B3JA 3W5UA 3PC6A 3QXHA 3EA0A 3FTPA 3H5AA 2I62A 4LJ8A 3ZGOA 1WMDA 1UT5A 1TEZA 1NU8A 4V3CA 4WASA 5JEEA 4D4GA 4P08A 1T5LA 1V96A 1IJEA 1E5DA 2QU7A 2JFYA 2CC2A 3DOJA 3MERA 3QELA 4H17A 4LQ4A 2CNLA 3L4KA 2P77A 3JD2A 1SXIA 3O8DA 4CIWA 4E4TA 3IXQA 3F5SA 1F6WA 2P75A 3HCFA 3GRRA 3FI0A 1CR4A 2EKDA 3KT0A 4FT4A 5C5DA 2YZ2A 4YV2A 3IT2A 3IEVA 2NPFA 1ULUA 4A2CA 1DKRA 3RANA 3ZDDA 2YR0A 4B2YA 1CDEA 1GNLA 2PL3A 4FZJA 3FNFA 1J0EA 1V4BA 2KWIA 4Q6WA 5PNTA 3HGTA 2JIZA 3M4YA 3ZU3A 3URKA 1UM8A 1OIWA 4FHDA 2AFHB 1KHTA 1FQJA 1BGWA 4FDMA 2E49A 3IUYA 1U11A 1FVHA 3ED5A 3NHZA 5JDIC 4PHFA 2CVZA 1NNEA 2O3SA 5LD2B 3F7TA 3BGIA 4IH1A 3W79A 4YUYA 5L7YA 4K6HA 4L51A 2IDJA 2YX1A 2QF7A 2FZVA 1ZPDA 1E5TA 4M1QA 4AKSA 4OH7A 1EK0A 3V8VA 4ARUA 3QE2A 4B83A 2XZDA 2XMDA 4B3HA 1ACJA 3FPGA 3NYQA 4IIEA 3PL5A 1QLHA 4WDRA 3HR7A 5IVIA 4JYBA 3TB6A 2WJPA 2XB2A 4CDMA 1HG0A 2FRDC 2O7SA 3ZD9A 2EGHA 2R1TA 1YI0A 4LK2A 4RELA 5AHXA 2JARA 1W75A 4CT0A 1Q7BA 3AJDA 2ACEA 2XV1A 1VQ1A 4TMXA 2WTNA 2HQ1A 3HP7A 4RIHA 3D8TA 2VDWB 1SXJD 2FWMX 3RRYA 1SK8A 1VPTA 2HZ7A 3UPDA 5IAKA 5I9IA 1PT6A 3K6JA 4LBYA 1GTMA 1DX4A 3CINA 1ECLA 3ELDA 3JQ9C 4IRUB 4U02A 4RDIA 5EE0A 1NVWQ 3OX4A 2FFJA 3GP8A 1O6BA 2IYOA 1M0TA 2PBFA 3QWBA 5G3YA 3VI4B 4C6TA 4KI7A 3L7NA 1G3QA 2HHCA 3N8DA 3OLXA 4L72A 1G16A 1YL6A 2IELA 3HXOA 2XXJA 4XD7D 2BZ0A 3CHYA 5K0GA 3TW8B 3OT4A 2O07A 1ZCAA 1M1NB 2EFDB 1NT4A 2GZSA 3K9FC 1L1RA 4EB8A 2EBFX 2P2CA 3IKMB 3L46A 3GLGE 4MW1A 2DUWA 2QN6A 3B2EA 4C4SA 2HU8A 2P0YA 3W2FA 5K0CA 2OO5C 5MFPA 1PV4A 1M2VA 1A9PA 2VPZA 3Q5EA 3B1FA 1B6TA 1WZUA 4NMLA 1NF8A 5AM0A 1ILWA 2L18A 5M29A 1F7VA 1WMSA 2E37A 1BZYA 3V80A 4OLHA 3V4PB 4LOHA 1EINA 2OR3A 2IS4A 3PKZA 3PD7A 3O9ZA 4D0GA 3M6FA 5KTKA 2Q1YA 1JXOA 1NW8A 1Z7YA 3B13B 3GIDA 4R3WA 5CT6A 3KJEA 2PBRA 3DOEA 1KHHA 3O0DA 2VT3A 1GVNB 3VPDA 3EWAA 3KD2A 2C20A 3R7WB 3KCQA 4IAOA 4DSTA 3UQYS 4KQKA 3GARA 2R85A 3HSKA 3KJXA 1N0WA 3ITEA 3LO5A 4DTIA 2R7MA 5A1JA 1VJTA 1D1PA 4K9OA 3E3OA 3SC2B 3WJ1A 3ISTA 3JZMA 2B21A 2D2EA 2B30A 3KUCA 1MVNA 2O5VA 3IVGA 4JUFA 3ZGXA 3KZMA 1KRHA 5IN5A 4AJNA 3Q8KA 4ZEWA 3P9IA 2CNWA 2X2FA 1C8VB 1Y8AA 2H52A 1MT3A 2VA9A 1TLLA 4HH4A 1N7JA 4P93A 2ZPTX 3LT1A 1E7MA 2OV3A 2Y93A 4NEHB 3VR0A 5KMGA 2A7QA 3R3VA 3QIVA 3G2LA 2XWJI 2ACKA 1LI5A 1CUVA 4NQRA 3MC1A 3NANA 1VGRA 2NADA 3KXKA 2XTJA 1UK7A 1LEHA 2G72A 2QVLA 2VH1A 1XXHA 3M6MD 2IYXA 4QNRA 5FH9A 2FN9A 2FQXA 2WFMA 5L7TA 4GDFA 4X94A 4L02A 2CYAA 4KOEC 1E7YA 3O2QB 4MHSA 5A03A 4HNQA 2CXNA 4BQEA 5JD5A 4AVYA 1ZI8A 2AXEA 2NZYA 1H6DA 2O2JA 3Q9UA 1W8DA 3SR4A 3W5IA 3F6EX 3QX3A 2P7IA 4NYMQ 1TAQA 4OHBA 4BKMA 1V1JA 1W88B 4C7OA 4P4GA 2OPBA 1V3VA 1I4TD 3DMGA 1LDBA 3I6BA 5LYJA 1N3IA 3GGGA 5D5PA 3TRKA 1DT3A 1HEYA 1ORIA 1XHFA 2QIPA 4CMIA 2XA1A 4JYPA 4GUDA 5KTOA 5JMWA 5MN5A 2VUIB 2WJGA 1GPJA 1M6WA 4LSZA 4M9CA 1EDDA 1H8HD 1QIGA 1QQTA 1CZNA 1VPEA 4DM4A 3NDRA 4HYYA 1DIBA 2ROQA 4NFSA 3WYDA 1FRNA 4XX0B 3IT0A 4GMFA 5FD8A 2BFFB 2I6SA 1OH7A 3MCAA 4P22A 1GTZA 3T5DA 4DSNA 4POAA 1Z5PA 4XVQA 4CM7A 2J3QA 4MUBA 2GHQA 1UAYA 4QNNA 1XL1A 1D7OA 4FT2A 4K0KB 3JQ6A 2IYNA 3HUDA 3GVCA 3CX7A 4LDZA 13PKA 1L5VA 2ZRBA 3EXG2 3O92A 5A3VA 5DW3A 5KVCA 4J2OA 1J42A 1F60A 4EG8A 2R44A 2OCBA 3RVOA 5JYBA 1QFSA 3D7SA 3DE3X 1J5PA 2QQ0A 3F4LA 1U9YA 3GCWA 2FZ5A 1PJBA 1EUQA 3MTIA 4DV4B 3IA7A 2RJNA 2C5BA 1F3OA 2B3TA 1T2DA 4BLWA 3U31A 3DEKA 3GF4A 3ZQUA 1FUYB 1QK3A 3IAM6 2PQ6A 2FP4A 5DNDA 1DLIA 1OB5A 1NMSA 1YMUA 3ROMA 2OZLB 1N6PA 4MKZA 4PO3X 1IAQA 1XQXA 1H4VB 1I9GA 1YR6A 3A70A 2I76A 1WLYA 3OPVA 3PUKA 2BM1A 3D8RA 3PQ8A 4FBMA 3VPFA 4YUXA 3GZ4A 2YBEA 3VR5H 1Z0AA 3WV4A 1NC3A 2RGAA 1OZGA 1UXHA 1XEAA 1K4KA 2HJSA 1YZ3A 2XRMA 3EOBI 1GYRA 3OPNA 4XFKA 5AJHA 4GI7A 4AICA 4LF9B 4N76A 2ZDHA 4ZI7F 1NZJA 2VSOA 3AVTA 4WKBA 4BTVA 3EF0A 2WYUA 3ON5A 3S7ZA 1N8TA 3D4LA 5HJEA 1MC5A 1YO6A 1KE1A 3W8DA 5KSZA 3RTBA 1EVIA 1PNRA 5TF0A 4PG7A 3ZQJA 4PYNA 1XEXA 1HETA 1CEEA 1PLKA 2Q4EA 2J08A 4AMZA 4AQ7A 1X92A 1OXMA 4PG6A 2PJRA 4KGZA 1Z73A 3DP7A 5AW9A 1E4YA 1O89A 1JDBB 4ZAWA 4XA8A 5EJ6A 3WZ2A 5A4AA 4OQNA 1ITZA 3GLHB 3S68A 3YASA 4LDRA 4D8TA 2PRKA 1HE1C 4IW3B 3FUWA 3P0FA 3K0AB 3WRXC 2FN4A 3N0WA 5E38A 2QX7A 1ENOA 3X0DA 1I24A 3AR4A 3D4PA 4D0LB 5JAZA 1UKAA 1P1RA 2Q49A 2ZSFA 3KHKA 3WTBA 2BFEB 2GN0A 4Q1EA 2IDZA 3QVJA 2X4IA 4K40A 1GU1A 1ZC4A 2CFSA 4LMPA 4FFPA 4GE0A 4B81A 1DOHA 3M0EA 4OFWA 5U1PA 1XQYA 2ZWVA 4P92A 3PLAE 1A9YA 3I2HA 2P78A 3VYVA 3IVCA 3OFSA 4OKIA 3DWFA 3ZHZA 3HFRA 4COOA 4HEA6 1Z4LA 5ISMA 4EEKA 1F9AA 2ZBDA 4YP7A 1WXQA 1XMSA 2OCXA 2HMAA 5E6RA 4KG7A 3L7IA 2ARKA 3KZKA 1V5WA 4EG4A 4JFAA 5G41A 5KJEA 3DCJA 3RPEA 5JZOA 1H42A 2ZWAA 5E1MA 3F5QA 3LPNA 4DMFA 3EASA 3T06B 1US8A 4OKNA 1E2PA 4NZYA 2CMGA 4WBSA 1P72A 4MA4A 1PZHA 1E3WA 4H1VA 1XZCA 5CDHA 1IE3A 3F49S 3GFPA 4TRRA 3FF1A 1U0EA 4YP9A 3UMRA 4PAGA 4Z4GA 3BRQA 2ZBEA 2VLIA 2PZFA 4BO4A 1XDBA 3G6KA 1AV7A 1N2ZA 1UZUA 2WHEA 2CJPA 2P6UA 1XZJA 1EFLA 3EODA 5AK3A 5B57C 1JL3A 5SZHB 5HIKA 1XQ1A 2VJMA 3JQBA 5JE8A 2PQMA 1KY2A 3QITA 1LI7A 2DBRA 5CYPA 1Z35A 2PKXA 2ORIA 1ZKDA 3LNCA 5KVAA 4NY1A 4QREA 1N6RA 1DNPA 1CJKC 2B8WA 3G59A 4KZPA 1O9BA 2PX5A 1BN7A 2XCSB 3ONVA 1JHZA 2QW1A 4HHEA 1WSDA 5F7JA 3Q7SA 4GIBA 3VUFA 1OXXK 4B7UA 2PU5A 2QLLA 5JVDA 3TFQA 4ONEA 3NTXA 3PDIB 5JBQA 1A7UA 4ZV7A 5SY9A 2ZYTX 1H22A 1LBSA 3F97A 4PZ9A 1NE7A 3IODA 4FYIA 1NQ5A 2IP1A 3I30X 4RZ3A 4C03A 1XT6A 2AOXA 2G63A 2POCA 4OQFA 5D8DA 5HF8A 2QSZA 2LR0A 3DDCA 1FYDA 3EDCA 1QMGA 1XKLA 1OVGA 2FUCA 1Z5OA 4JOBA 1XZQA 4OP1A 5EP1A 1ZMBA 3T1HB 4X3OA 2B2XA 1RWXA 3W78A 1GUDA 3ONNA 1PL0A 3UJCA 3RFVA 2AN1A 1ATZA 1MV5A 1SXJC 2JBWA 1MJHA 1NLFA 2ZE5A 3I52A 3IT1A 5KYUA 4KFUA 5LP6A 2YWXA 1YBAA 5JJLA 4BX0A 3KWFA 1CUEA 4QEKA 3S2EA 4YRZA 3I9V1 1I32A 1SHKA 1G7TA 3TCNA 5LSAA 4QGBA 4NECA 4YP6A 3WIVA 1MAHA 3A3YA 3WXBA 3QBJA 1RU3A 1RMTA 4Z3DA 4DIDA 1YUMA 2BFMA 2ODAA 1CQIA 3AO0B 1MMFB 2IW1A 4R9VA 3DB1A 3DUWA 2HB6A 1XJCA 1FA9A 3EWSA 3H0CA 5D5HA 1N2EA 2ORVA 1NBWB 3ESZA 1GPYA 1Q57A 1M2OB 2CD7A 2ATCA 5TGDA 3PNVA 1MJ5A 2OB2A 2JLWA 2ORWA 3C5CA 4W82A 3W5BA 1V11A 2VYQA 4IP0A 5KQLA 4B3DA 2IOYA 3KNZA 4HAOA 4EHDA 3OCZA 5EMJA 4H60A 1TCAA 3NNDA 3TX2A 3C74A 3P97A 1YVPA 1QPBA 2ZE7A 1IN5A 2FUG6 1TRKA 1UANA 4RPGA 3UJNA 4D4HA 2AD5A 1ABEA 3RG8A 4YXWA 1P8AA 3PQ7A 1Z4MA 4MRMB 2JK0A 4UCQA 2A84A 3DWEX 1HXHA 1OC4A 2LW7A 5K2OA 3JWHA 1E2BA 1JHMA 3ZKWA 2EFJA 2KW5A 3N0TA 1IXKA 3MILA 5KU1A 1XMQB 4S1NA 4IKEA 3HKDA 4QTZA 1KE2A 4UHBA 1IHPA 1IB6A 3PIIA 3IDSA 3E1GA 4WK4B 1CDOA 3NHMA 4G23A 4WKNA 2PZEA 3PHGA 4HYQA 4URVR 4XM2A 3V32A 4CCSA 3DSRA 2JBAA 2QJWA 3LKDA 5G1PA 1XZFA 4GRIA 3RS5A 2PLAA 3DBRB 1Y6FA 1ZNWA 3B82A 1MPTA 1ZQ1A 2C7BA 1K7YA 4M3NA 3L6BA 4L78A 4Y2YA 4Z9XA 2X0EA 5KNCD 1L1FA 5LBTA 3IIJA 3AYXB 3QKIA 1FJXA 3D6HA 4HTAA 3K70B 1XVUA 4QJIA 4WCDA 4H0FA 4K9SA 2PX4A 4XSVA 5AW4A 4RCYA 1U7TA 4AJKA 1UFQA 1JG6A 3MEQA 5CVUA 3KPWA 2O59A 1RCFA 5CA0F 4PQGA 2FCAA 2FPPB 2DYKA 4GI1A 3MTBA 2J5RA 3AFNA 4AO7A 4XDHA 2FUNB 3UNXA 5DF1A 5JY6A 4TTTS 5JAPA 1LRLA 4JYMA 1E1DA 4REQB 1NDUA 1GLVA 1Z75A 1ZY2A 2NWQA 3LQKA 4I2VA 4MULA 4TQ9A 3I04M 4IHKA 3BJIC 1IHYA 4JQZA 1J9GA 1BDMA 4C14A 2Z2YA 1NVEA 3AU8A 3GAFA 1M5TA 3EEIA 1ZK3A 2GAFA 3ROXA 2C31A 1FIUA 3ZG6A 2BHNA 2QBYA 4MQFB 2B78A 4M7RA 121PA 2I4IA 5EZQA 1QVWA 1SPXA 2QNIA 2VATA 3PDWA 2F00A 2XA2A 4MV7A 4RTQA 1OZFA 4M76B 5BXYA 1JIIA 3JQPA 4PXYA 4QU5A 2X76A 3O95A 2K4MA 1DTWB 3OT1B 2DHCA 3PQ2A 1U2GC 4LC9A 1L4YA 3ET5A 5FUXA 1LV7A 4WN9A 3S2FA 2NUAB 3ZW8A 2EDAA 1N34B 4XEUA 3FZGA 3ER8A 4EW6A 4O25A 4OJQA 3PIRA 3PD0A 3NP7A 5AQEA 2ZLBA 3BWEA 1VMAA 1HURA 2YWEA 4MUFA 4UVEA 3R9XA 1TYCA 2LCIA 4JP5A 1QM5A 1W73A 3QVGB 4LJ9A 2CFOA 3F71A 3OEEA 3KOYA 3PHHA 5CM2Z 4F2DA 2HMVA 1K8YB 1U0OC 1VI2A 2ZYAA 4XWTA 3PX7A 4G86A 2CZCA 2GJAA 4NOMA 4DYDA 4CTNA 2PO7A 2ZSBA 4DLBA 3UV6A 1PW7A 1WABA 1QJ4A 2Q5LA 3BK2A 3I83A 4B46A 3BMCA 3HNOA 3VSAA 1S2GA 3ESQA 5KTTA 2WFLA 4LTDA 1DC6A 4A0FA 4JUBA 4YFVA 3O8BA 1JHOA 3EGXB 3UH0A 4ZYLA 1ISRA 3RBVA 3E22B 2VHEA 3K5IA 4Y2GA 4FCCA 2ZCJA 3KLNA 3CZPA 2H5LA 3IOMA 3ORRA 1FUEA 2AJTA 3C8UA 4NSNA 5J63A 4OK5A 5GIPE 3E0QA 1M1YB 3UWKA 5JYDA 2PTHA 1QRUA 3DM9B 1JB9A 2YN0A 1RHUA 2GZ3A 2OZKA 3V8EA 4YBRA 3BPSA 3IUMA 2W2VA 4KVFA 3PFGA 4HDNA 2OCKA 3FFTA 4R8KA 5EFZA 1Z0DA 3HU1A 5DHAA 4R05A 2WPNA 3RJ9A 4CDGA 3GAZA 4GP9A 3H17A 3IIEA 4JXKA 3RC1A 4ALNA 3EUFA 1M34E 1G1MA 1QHFA 3DZDA 4DQ0A 5LL6P 1OH8A 1X39A 2O52A 3HBAA 2Q0HA 4IJMA 2WJVA 5D7BA 3T8YA 3S99A 1O6GA 1P2DA 2E4XA 3T3DA 4B3TB 1SVSA 1Y63A 2JFPA 3O1JC 3UANA 4I4TB 1H23A 3C8HA 4HWKA 4ENTA 4OK6A 4Q37A 4RXUA 4PX3A 3W1WA 1NASA 4DNOA 3BD9A 3EG9A 1SOVA 3AT1A 4HJRA 1MOPA 4DPMA 5KQMA 4RD0A 5HYVA 4P31A 2C29D 3IKVA 4DCGA 1PZGA 2PKCA 1B0AA 2FPOA 4ZCRA 4A0SA 5K0TA 3UOAB 2I3BA 4PLHA 3JQGA 3K72B 3DZBA 4PHHA 2ZAYA 2LDXA 2R6HA 5KC8A 1ZITA 4DV1B 3Q1KA 4WFQA 2XVZA 4RD1A 4QLOA 4M1SA 4K9NA 4XUEA 1NVBA 2VH5R 4BFTA 4NENB 3DZKA 1GN8A 3ZDXB 4YR9A 1ETUA 1VSBA 2BLNA 1G20A 3L6CA 5FPQA 2EJTA 4URWR 4F85A 1HYEA 4IXMA 1MABA 1OX5A 1BXGB 1EK1A 3G23A 4R1UA 1NOJA 4WLFA 1LY1A 3WMRA 1MB2A 5EJ4A 5I8WA 1UK8A 3LIPA 5JANA 3UJBA 1KZ6A 1B1CA 2HWKA 4W8OA 2C95A 3A6DA 1YZYA 3G2QA 3I3OA 3ICEA 1OCEA 1DARA 1E7RA 1KY4A 5KCZA 3BRSA 1W9HA 2CLOB 2N75A 4MMZB 3X1WA 2WJJA 3EVZA 4V0SA 5JSYA 3UMBA 3TLKA 3HXPA 4D8XA 3WGHA 5HJ2A 5E7JA 4LCBA 5CX1B 4DW8A 2R7LA 1MHTA 5DISB 2P1DA 3GUYA 3SDSA 4EA6A 3SVTA 2X1MA 5D5QA 4ZXPA 1EQ2A 4M9RA 1JJIA 2REOA 4MIKA 4UZSA 5J2UA 3A7DA 4U5QA 2H8GA 2PUTA 3SXJA 2B1JA 4MVJM 3BRWD 1FNBA 1D4FA 2VRCA 2WK1A 4AG6A 4E5YA 3L0PA 2Y27A 2JCGA 5JDIA 1JU3A 5LLTA 2QUIA 2W6JD 4TRMA 1DU4A 4Q7EA 2JAUA 1AZLA 1KJIA 1P6XA 3G6WA 3DMFA 1N5OX 3JQAD 2WSMA 4KMOA 5COBA 3E9CA 3FNHA 2G76A 3RYFA 3UJHA 3WLFA 4M38A 2BEJA 4AY4A 4XR9A 2FFRA 5BVHA 1PS9A 2WJHA 3C7AA 1FF9A 1PKXA 2REBA 1OGYA 3SFZA 1GUFA 4MVWA 1BN6A 2HK9A 1YE3A 2I7DA 4YP1A 4RSRA 5A6VA 1WMAA 5THXA 4EATA 5KNBD 4WA8A 5AI9A 1U6KA 1NI4A 3VPXA 2FRDA 3PGXA 1A0OA 2HC9A 4O5AA 1QQ6A 3HE3A 2Q50A 3BWBA 3H2HA 5E6SB 1IPEA 3CIOA 3PXXA 2Q4DA 1UXOA 4MPRA 4U9UA 4P5EA 4F5YA 1OF1A 2N3ZA 4Q03A 1P75A 4HDAA 2B7CA 1E3EA 3K73O 3OICA 1NA5A 4XTRA 4ADSG 1P2GA 2H54A 1X14A 4BNZA 2MTBA 1E8NA 2WT9A 1PZMA 3JQ9A 3WGKA 3LPAA 3I1FA 3P9RA 1X1QA 1T8TA 1UDXA 1KP9A 1N7HA 4OHKA 5F64A 5JCJD 1D4OA 3EIQA 5AUOB 1WBDA 1BHQ1 3IPAA 4R54A 2O1XA 4I9UA 3HJFA 1C3OA 2AK3A 4U2CA 1JJBA 1KEPA 1EBFA 2BP7A 1Y7IA 2EP7A 3ND6A 4MV9A 4C3OB 4OXYA 3OIFA 4RD4A 3ETGA 5HGJA 1OAKA 1VJ5A 1MOQA 2IHZA 3H9UA 4W5WA 3KBBA 3PGLA 3ZDBA 4UAVA 1E3QA 4RLHA 1YL5A 3H75A 2ZRKA 4ZWNA 1XVAA 3BXXA 2OO5A 4H7JA 1RQXA 1W5TA 3ECAA 3NETA 4PG4A 1THMA 3G7UA 2HMUA 1RTKA 2I22A 2PT9A 3OZTA 4GMDA 5AKGA 4Y1RA 3LCMA 4X1YA 1RACA 2HF9A 1F3LA 3ROKA 3ROTA 3UKOA 3WMFA 5AW7A 2C9CA 3NALA 1M67A 1TPYA 3PGJA 4JEUA 1J1UA 4MVJG 2C59A 3B1YA 3SBDA 1KP2A 4WNIA 3D8BA 1T4CB 3DAFA 3LKVA 2CMDA 3QG5A 1IZ8A 2IYWA 1YQ9A 4ND3A 2NZ2A 1MXHA 2A9VA 1L5YA 2HAEA 2W6IA 2IIPA 2HADA 2EWMA 3MM4A 1CJCA 2NZUG 2V0CA 3OZWA 3CONA 3ICPA 1SCDA 3NEAA 3R7SA 3FKQA 4PCAA 1FDVA 5DWDA 3U56A 1JQDA 5E9QA 1YNOA 1Z39A 1RPJA 5E95A 4TXNA 2C8LA 1BX1A 3PQCA 4X90A 5DYWA 3HEBA 1OBVA 2SKCA 3ZU6A 1L5QA 4KUEA 1VP3A 3FLEA 3ESCA 1G8AA 2J7PA 4GRDA 1CC1S 3JARA 4EG5A 3KETA 2GNAA 4HUJA 3INYA 4N49A 4TSKA 5D3ZA 3HFJA 4ZU1X 5BWNA 3VHQA 4TWBA 3LV8A 1A1SA 1N5KA 4F4JA 1TKCA 3RAGA 2GF0A 2O2DA 3FCSB 1RKUA 3ME5A 5EVJA 2IE8A 2HA3A 1TQHA 1XDSA 3B51X 4CM5A 1SG9A 2QVZX 2UZ1A 2UXDB 2NW6A 2HWYA 2RI6A 3IP9A 3PSAA 4E2ZA 1YAHA 1FX0B 1YJBA 3ZK8A 3KYDB 1W34A 2ON6A 3DKVA 4RGQA 1B6SA 4CEIA 5H3LA 2H1VA 3QXSA 1ZUWA 4BFVA 1AB5A 1TA0A 1TYZA 1U2RA 2ECFA 4PO1A 5EESA 1R0SA 2PV0A 2CXSA 2Z04A 2XQGA 3HJTA 3GJ6A 1HTTA 2PWBA 4CQMA 3S81A 3PG5A 3QF4A 2L0XA 1RHMA 3LWDA 4Q66C 4UTOA 4ZO9A 2XZPA 2XCLA 4EPYA 2R1TB 2AXPA 1ZK2A 1HTBA 1YXMA 4ZT2A 2OV1A 1LK0A 1RFLA 3GLFB 3FYSA 3ADDA 1INLA 3DF7A 3THRA 2BSAA 3AV0B 1VIMA 3DVQX 3P71T 3KKQA 5C1DA 1P9RA 2QYOA 3AOEC 4MIEA 2AFHE 4Q3BA 2QGZA 1Z6YA 4LF7B 5DXFA 4N3GA 5F23A 2PS9A 1XDZA 3VKFA 1QYDA 4IV5A 4BE7B 1EE9A 2CVPA 4JQSA 1QIFA 3IR5A 1L7EA 3R0QA 2UUBB 3FNBA 3RO7A 4OP3A 4MS4B 3ANLA 2AC4A 3GJ8A 2ZIZA 3MS2A 4X6XA 2OBYA 4I3GA 4BO8A 2YV3A 2BBTA 1LQTA 2O3RA 4BFLA 1D1QA 1TEXA 5A0VA 4ED9A 1FSPA 1L3BA 1TC1A 3K3PA 4LRXA 4C22A 2O2GA 2W43A 5B4UA 2XUZA 2GKGA 4YJGA 3PHIA 4YRFA 1QRDA 1DUVG 1WXWA 2ALJA 3FCAA 3IH5A 5ALTA 1XMXA 5CPFA 5CB4A 1IN8A 4OTZA 1FP6A 1L7DA 5C51B 1U9CA 3FTFA 3HBNA 2J46A 3OCXA 2F8TA 4G4SO 4UJ5A 4A92A 5AUNB 1KETA 3BGVA 4C1NA 3WNDA 1W4RA 4LJ7A 4M37A 1ZIDA 5K3BA 2W37A 4I6GA 2H2GA 5EC8A 4PWZA 1DCMA 5DNVA 5BXQC 3B9QA 1L7AA 4HL6A 1QX3A 2R8PA 5F1KA 3RV4A 2E55A 2I4RA 1ZD9A 2IOFA 1E7WA 3AY0A 3KBOA 3A9TA 3LHDA 5BSRA 2RCYA 4L28A 3MMSA 2X8BA 4BBAA 1XF9A 2JVJA 3FMFA 4OYLA 4NL4H 4D9NA 3MT9A 4RZHA 4BKUA 4IZHA 2C7GA 4LHWA 2VYCA 3WRXA 2ZIFA 3C7KA 3FLMA 3MUFA 5DLDA 4A1FA 2JK1A 3VX3A 2GPWA 4NIMA 4F5EA 1C2TA 2YWJA 4R9SA 2IV2X 5AM3A 5JECA 2JD1A 3OURA 1K08A 5JPIA 5FBQB 3HK2A 2V3VA 1SVNA 4PLVA 3TD9A 2OCAA 2O14A 3EGOA 2PMDA 2W2MA 2Z1DA 3IFSA 3ILHA 4O4LB 1M2WA 1VI5A 1Z2DA 1WETA 3U9LA 1J39A 5CAEA 6NULA 3LLSA 2LZ0A 3WZMA 3C16C 5ALYA 4LGVA 5FPTA 2IODA 2GAAA 3T1NA 4G85A 1RYZA 1E1NA 5CFOA 2CE2X 3GBPA 2YXNA 3D3NA 1KFKB 2WTAA 3GYBA 4MYSA 3HB9A 1QHYA 2QPOA 3CEHA 3PUWA 1IQ0A 1NVUQ 1Z2EA 5LQUA 2H51A 1M0SA 4OF4A 4Q3KA 2HCTA 4JB8A 4R8LA 5D7NA 5ELXA 1H4QA 2QP4A 3QYAA 1Z8FA 3FB4A 1G21A 2GBPA 3D0QA 1U8FO 4AZ0B 3L1VA 3OIVA 4DCVA 1CYDA 1BVYF 4WY8A 3AEUA 2WZQA 3W4KA 2WD8A 1NQWA 1TUGA 3UMVA 1X6VA 2PEZA 5L3SA 2PCJA 1GGVA 2HRQA 1PR5A 1BXRA 3BFVA 5K0LA 5EMLA 3N28A 1KDTA 1C1XB 1CNFA 4M89A 3PKJA 3MQ4A 4G3XA 1UK6A 4I7EA 4OP2A 4NV3A 2VOEA 1QNLA 2GEJA 1Y6JA 3TOCA 3JXEA 2NU8A 2MMCA 5FNVF 2F4VB 4DSUA 4F6RA 3EHEA 2VK8A 4I1VA 1SELA 4RH1A 4U7GA 2JA1A 4WY5A 5GJBA 1UFOA 1EG7A 1IUOA 1HWYA 3NNNA 3FTNA 3PT9A 1UEIA 4KYTA 2HXYA 3DUFA 4PX2A 5IARA 3REOA 4A03A 4BJ5A 5BWOA 1G4HA 1R4AA 3UA4A 1SXPA 5DTJA 4A73A 3CM0A 1YU9A 1AKTA 1Q11A 6CHYA 2R8EA 1JQ3A 1WV1A 4K6CA 4A0RA 3IEKA 3F0TA 4L3WA 2OCGA 1N8NA 1SD5A 2GO7A 2HF2A 1Q1EA 2W6ZA 2GRUA 1MZVA 2RGCA 3EZGA 4IDAA 3TGLA 1ONNA 1X8JA 1PR0A 4CIYA 2N1MA 1Q91A 3RYCB 4Q93A 1ENYA 2WHPA 1G3UA 1HI9A 1VCOA 2ABWA 2YJGA 3FZQA 3QE4A 4NBVA 4QWMA 1M76A 4EJ6A 1SXJA 1TF7A 4HX5A 1R0YA 3OQMA 3T1YB 3ENVA 4AKEA 4QXMA 3D6AA 2XD9A 2D0OB 1XEXB 1LSSA 2J0UB 3G82C 2G8LA 2KYRA 1I7SB 1IK4A 2Q3JA 2HHAA 1UC5B 2SKDA 2Q9CA 1PYDA 3CO5A 4OUDA 5DGIA 2YFKA 3F6CA 3RYIA 3W5CA 1LVUA 5KNLA 3BE4A 3BIFA 1SKUA 4JJFA 1EX7A 1IYZA 3D3KA 4HDSB 1K7FB 1UPAA 2H1FA 2NO6A 3SR0A 1P61B 1BAPA 2B2CA 3CN7A 4GVPA 1Z0IA 2Z57A 3F3KA 1UJ2A 3GI1A 1QU3A 3PBKA 1NJ8A 1ISMA 3B6ZA 2CZGA 5LQNA 1MG5A 2JCVA 5I9SA 1H3EA 4I81A 4ROSA 2Q7DA 1GG8A 1Z74A 1U3TA 1OV6A 3I05A 2HEIA 2HMTA 1OI7A 3MJEA 4M8LA 4X1KB 1M6HA 3T9EA 4CF6A 4J6EA 1VFPA 1J99A 4JROA 1U99A 4HZUA 4XOIA 1YASA 3RLIA 3E9ZA 2IPXA 4V0QA 2WWVD 4DL9A 1JYSA 1T0BA 5JZMA 2I87A 1NYLA 5HM8A 3BIOA 2Y1XA 5HZGA 1U0TA 2G5CA 4PM4A 4RLSA 3AL0C 2CY0A 5F9HA 1QG2A 1HDOA 1PF7E 2HA5A 4GP6A 1Q77A 4OHWA 4RPHA 3ROEA 1Z2PX 4B9EA 4UDYX 4MKHA 1IDOA 3NEJA 4DT1A 4AI6A 1R9GA 2WI8A 2O0LA 5E1DA 4Q9AA 2AX4A 2PGLA 3BQ9A 3GLHE 1YS1X 2ZULA 3QSGA 4MUMA 1RQ7A 4NI5A 5EWJB 5H02A 1YQEA 3KTOA 5T4BA 3DPUA 3ABIA 1F4VA 3I0ZA 4IZ6A 1X7GA 3REQA 1E6MA 2HU5A 4F4UA 5HKKD 1C30B 1I7QB 3ACDA 2NV6A 3LQQA 1XMVA 5G0SA 5JNLA 4GE3A 2NYRA 4R40A 2ZIAA 1L3IA 1U4OA 4DZRA 2XLBA 3B3QA 1J8DA 5B3KA 4AKGA 2VYVD 2P9CA 1PEDA 2GWHA 1C7FA 2V9CA 4EHAA 2ZTVA 4TZKA 4OIFA 1JEDA 4CKYA 1TM7E 3ONEA 4HDKB 3A28A 4ND4A 5EUMA 1FDRA 4ZEXA 1NONA 2IHBA 4OQYA 1ANKA 2ZIEA 4WT7A 4N0MA 5DTEA 2ZS7A 4PYRA 2NU7B 3WS7A 5FWYA 3KQKA 2VT6A 5CFNA 2Y6UA 2EFHB 1PG2A 4R31A 5ARDA 5DTQA 1QCZA 2FZKA 2HDWA 1V25A 3PJGA 4GT1A 2O8CA 3LAWA 4CHGA 4P38A 1ZW6A 2P4EA 3UUGA 1TMGE 2P3QA 3PYMA 2CV1A 4LMAA 5E4YA 1IJFA 1OKKD 3C1TA 3OCWA 2O23A 1GRVA 1NDHA 1K63A 1Y6RA 2AG8A 2OESA 2WZCA 4OB8A 2FFAA 2YV2A 1K8ZB 1PO7A 3F3YA 4PZUA 3O8QB 2E48A 3HFGA 4ND6A 3UIEA 4W7IA 1AS3A 1U2GA 1PUXA 3EJWA 3HEMA 4Z0TA 2PRYA 5BN4B 3H7IA 2QLNA 2BEWB 3W5AA 3D4OA 4LE0A 5ABPA 2UYGA 6GPBA 4DIKA 3S1AB 4WESB 1P2FA 1TQ4A 4C3ZA 4DJTA 3AP1A 5F5XA 4RFLA 2Z3WA 4P86A 1A7JA 2Z43A 1W5SA 4BNTA 1DXHA 1ZK0A 1UBTS 1S2OA 3E61A 4NVRA 2D54A 4ZO4A 1AQJA 2XDAA 1YJ8A 5IJ0A 1Q83A 4D9GA 2WIFA 4C4TA 1A8UA 2KJQA 2QZJA 3ELBA 2ODNA 3GLKA 4L4RA 4HAYA 3W34A 4TMFA 4TS4A 1JA9A 5YASA 3C3MA 3FMPB 4KFSA 1WMEA 5F3DA 2BELA 2WWYA 2C9YA 3JWJA 3F3MA 3V8BA 1EYZA 3F73A 5L4SA 3OZ7A 1WY7A 4Z4CA 3U7IA 3TZBA 2QLMA 1IPHA 3BA6A 3EVAA 3NH9A 4QSMA 5B58C 4YN3A 3AHIA 1AXGA 4DLYA 3BILA 3C43A 4KR0A 5EHNA 4BB6A 2VG8A 3GFVA 1GNSA 2AKEA 3BXGA 1EIWA 4PY2A 4GGPA 2YIJA 5CJPA 3TLXA 4X64B 1D0SA 1NWCA 2YJ5A 3ZNNA 1XPUA 4PLCA 2R0QC 3KVYA 5KB3A 2Q5QA 3EB9A 4DV7B 1C8LA 1FSGA 3IIMA 1M73E 2XDQA 4DNPA 5AMXA 5KCMA 2A3NA 3T0IA 3TF5A 3ONDA 4EPTA 4II7A 4A5OA 3I9LA 2XIQA 4DKXA 1RCUA 1K97A 2WHXA 4R1PA 4Y2JA 3SIPA 4GZMA 3CZRA 3SYTA 4NARA 3BQNB 2VUSA 4YJHA 1Z18A 1VIAA 4HY3A 5AK0A 5JLAA 5BNIA 5GM1A 4OH1A 1GUBA 3ID6C 1NP6A 4JC4A 3LUJA 3PNBA 4L50A 2GHRA 5B53A 1XRNA 2XVXA 4P4NA 2NP6A 5K3FA 3C3AA 1RZVA 2JBAB 4QYXA 4XWYA 5AVYA 4BE9A 3S2SA 1WUTA 4B6EA 2VYNA 3BMOA 4R5MA 3UFXA 3X3HA 4F3TA 1Q95A 1JBQA 1D2NA 1YAJA 5DNAA 1BKSB 4UAUA 5EPEA 2MHCA 3WZLA 5HQ3B 2VXYA 3FPHA 3O8RA 1NG1A 1KBZA 3HCEA 3NIDB 4L4UA 4YO8A 1EUCB 2O1EA 2VKTA 3SSOA 3ITDA 1MZPA 1XD9A 4ZI7B 5IULC 4FK8A 2IWRA 2C04A 4OSPA 4FNGA 1XRSB 2JGIA 1P4HA 2LRHA 1QOPB 3S29A 3ZHQA 3ZHCA 4K9QA 4TVSA 3WL4A 1UZNA 2WIJA 4R2HA 3THXA 1YRWA 4W99A 5HMMA 4OK3A 4C0SA 1FPMA 5B7NA 1X7ZB 3TRDA 4EYQA 3PA8A 4JBIA 1PX0A 4H7DA 2V7TA 2XJ4A 5D84A 3OEYA 1C2YA 4MGYR 1HYQA 2DFDA 4QU0A 4YQZA 3UT0A 3KALA 4G07A 3SBXA 1Z25A 4D82A 3RADC 4PZPA 3SZUA 2Y1FA 4DBLC 2W90A 1M1XB 1RXIA 1AO3A 3MCTA 4NE2A 1KWKA 2NO1A 1ZHHA 1ZM9A 2JIQA 1Z6GA 3KLMX 3QPUA 4I14A 4FOPA 4QPDA 4A0HA 4KO3S 5JBIA 3WYCA 4OX9B 2XI4A 4D8YA 5CVDA 4MWSA 4M60A 4S0ZA 1IDN1 4UHEA 2KB0A 3VR5D 2QZSA 2B4RO 2HIHA 4R8SA 3U4DA 3W6UA 4B2PA 1B0ZA 1KVRA 4EY4A 5JEDA 1AUOA 2FSHA 4IDNA 5BY2A 3WDMA 2RHOA 1JA1A 1GKLA 1W4ZA 1ZG3A 4FYKA 3TS1A 4LHZA 2G1AA 3OAAD 2GESA 4US1R 3T3MB 1IIBA 2Q0SA 3LKZA 4DCTA 4RETA 1N9GB 2ACVA 2ZYIA 3JAKA 4OREX 1JDSA 1KSJA 2ZYUX 4QO8A 4BBPA 5JI2E 2HIMA 5KTYA 1ESCA 1SD1A 2A33A 1YZTA 2J6HA 1ZISA 3ZE1B 3T7AA 3AONB 4JB3A 4AC9A 1QAOA 3EQZA 3R8CA 3AKZA 5EUBA 3MOGA 1AY0A 4FIZA 5DHPA 2O8BB 1LLFA 4DKJA 2DH6A 1V71A 4GSKA 1ZJYA 1GWNA 3K9WA 5IKPA 1G8JA 4FFVA 3A05A 4L8FA 3BZUA 1NU6A 5IT0A 3CUTA 2BTEA 1HQCA 1P7CA 3IP3A 4N18A 5ENVA 3CS3A 3F6SA 1XLUA 2BVNA 3E7PA 4EO4A 4EPXA 1YB5A 4MQLA 3RF6A 1TAHA 1GKIA 3ASZA 4UQLA 3S8EA 2UU9B 1B74A 2C2ZA 3C87A 2HBQA 4JEIA 2CB9A 4PGGA 5FFNA 4QLAA 2FWAA 1Z62A 3T9DA 3CV3A 5EXEA 1V8OA 2W42A 3V55A 1ESNA 1PR6A 2PR2A 4GX2A 3GLVA 1DOAA 2GUGA 1BA2A 1IXRC 5I48A 3QTTA 3B6KA 1UBJS 1NYRA 4I50F 4Q24A 2BONA 3LY5A 4CBVA 4YTEA 4N0DA 2PCLA 3HABA 3ZD7A 1IZ0A 3ADBA 3C3EA 1J8VA 1LNQA 4IWYA 1MH1A 5ICFA 5IT5A 1KRXA 3CC8A 2FPGA 3IO3A 5K6RA 4LXIA 2EF1A 1R66A 2OEPA 3WAKA 3U49A 5JSZB 3CF6R 2GEUA 3HV2A 4YALA 2GCGA 3R0VA 1WXXA 1P1CA 2VAPA 2WSSD 1NW7A 1SHZA 1EFHA 2D5CA 1JI0A 3E81A 3ETDA 4YASA 4RXMA 4CKWB 3G0CA 4FUTA 1IEXA 2F6RA 2JZCA 3AUSA 2OCDA 3KVRA 4TM8A 2ATXA 5DU2A 5TARA 1EFPB 3HB4X 5IZCC 1KZ4A 1X7YA 4K9MA 3I9NA 3CMCO 1WXEA 5JH7F 3WK9A 1OD6A 2B5OA 2I7XA 1QONA 1Y7TA 4HN4B 2VAWA 1W0KD 2AOUB 3HJGA 5AVTA 2Z8YA 4TROA 1JWBB 1O0CA 3FKSD 3KZXA 3E2PA 3MRTA 2A57A 4RTNA 1ENPA 1DAHA 3AXTA 1A69A 5IZ4A 4GBED 4L76A 4OAPA 1CR6A 1A8PA 4EPWA 5IDXA 4BLTA 1ODFA 1RLMA 3K4QA 1DAPA 2HFKA 4GFDA 3TOVA 2UXCB 4K6MA 1A5SB 3GJTA 1A2QA 5A5FA 3SFTA 4B82A 4BV9A 4BEJA 5LQKA 2EATA 1CUDA 1IG0A 1NATA 2HO4A 4NJEA 4TLAA 4FCTA 1FX1A 1E60A 3GHYA 3GRKA 3PWKA 3BWDD 3CZQA 3IJ5A 4HFNA 3TZQA 3U4CA 4ETMA 1OT5A 4MYCA 3TG8A 3VU8A 1KQ3A 5KNCA 1V8BA 2N42A 3LY7A 5F2NA 1A9XA 3LXUX 1XHEA 2W0MA 1JH8A 3FUTA 3LI2A 4UARA 2IHUA 3AF5A 1UODA 4GPBA 3LBIA 5K0FA 2AUNA 2P1ZA 3ST7A 2OVFA 3GK3A 1UKBA 5ALLA 4ENVA 5CT5A 1AGNA 4LJ5A 4BKQA 3N76A 4BKRA 1C4OA 2HSWA 3H9QA 4QFCA 1J1ZA 1RYHA 3I2KA 1OA0A 4Z8YA 1DC5A 4BLVA 5B6JA 1NPYA 3HKEA 3R3YA 2QUAA 1VG9B 1KNQA 1U3VA 3UJPA 3DL0A 1BEUB 3SF0A 2ISCA 4UEOA 3EF3A 1JLLA 3SICE 2HCJB 4ACAA 2VF7A 2FB9A 4HQKA 2DECA 2C88A 4JA0A 3WYNA 1L9KA 3KR0A 1COWD 1HL7A 2EP5A 2Q8QA 4CR8A 2CLKB 4OHOA 3E3LA 5DO9A 1CDZA 1ULAA 1XFAA 2E82A 5B3LA 3QKRA 1C80A 4KR3A 3I9FA 1DKNA 1NVKA 4IX1A 3K2QA 3TLZA 2Q6VA 4KAJA 1BVHA 1T3GA 4FFMA 5EWMB 2UVDA 3EDOA 1BQ3A 1M5RA 2CKDA 2I8CA 2QY6A 4KBGA 1YCDA 2C3OA 2GJKA 5A3JA 4TS9A 5IT9A 2YICA 1FTQA 2VQ6A 5BQOA 1U1DA 5CA0B 3R9KA 2I2DA 4WFJA 2SKEA 5EIAA 1MTOA 3ZGYA 5KOYA 1BMDA 2PU7A 3AOEA 3U0VA 4B76A 4UTRA 1H2EA 5D3QA 1UJ6A 2C2WA 1OPRA 2IZ1A 1GZ4A 3GFRA 1UBNA 3K4PA 2Z1NA 1FP2A 2I2BA 1CUZA 4R8RA 1S8FA 3B53X 4PPQA 2HQOA 2XRZA 3R74A 1Z0KA 1FXWA 1WUYA 3SZRA 3ZW7A 1R5JA 4KIFA 1X13A 4Q9LA 1BCRB 4HAZA 2QM0A 5A0FA 4C3VA 4M1OA 4FQ7A 3DKRA 5BV0A 1I6WA 3FDZB 2YWCA 4EG1A 2O8EB 3FDXA 4BATA 3DKPA 3DTVB 3K6SB 3FNRA 3H9EO 3W5DA 1VJ0A 5FI0B 4ZK6A 4UHKA 3OF3A 4KPYA 5DMXA 2ACWA 3CUWA 1DC3A 1Y1LA 1YFZA 4PONA 1KAGA 3D5QA 5LC1A 2OTCA 3CW2A 3IP6A 4I5GA 4JC0A 1GKUB 1VBMA 5A4KA 2HOQA 2P7HA 1QV6A 4Z2YA 5KYXB 2Q1SA 3U48A 4FFDA 3AR9A 3ZI0A 5K0EA 2KI5A 1NBMD 1S9DA 3OT5A 1ND5A 4KE9A 2XYHA 5IH7A 2H18A 2X7HA 1CZUA 2A86A 2VHZA 1JEQA 1I2ZA 3K8QA 3MXOA 3L4EA 4GPEA 4MR9A 4C30A 4ALLA 1UL1X 3ZIDA 2XGGA 1UZMA 3P1JA 4LYFA 3RUDA 1PU2A 3L0IB 2NIPA 4CM8A 1X1DA 2WAOA 4TTAA 4NCJA 4GZ3A 1PUIA 2DTDA 2QM7A 3NOXA 2ODTX 2GTPA 4GG1A 1YWGO 4ZVQA 3KR1A 4JYAB 2WWIA 3IPRA 3IQXA 5DNWA 4UNQA 2CVFA 2ZRFA 4DMRA 4F91B 4RSGA 3CF2A 2XGSA 1Z7GA 3GOHA 3PLNA 5A71A 3TRHA 3G0BA 4TUYB 2RBKA 1YOVA 1OLXA 5A5DA 3HR4A 1Z22A 2ZBRA 3GC6A 3QQ5A 4IIBA 2X8JA 3QFTA 2ZR7A 4WZBB 1Z34A 4BJ3A 1ZH6A 3M4XA 1T91A 2YQ5A 3RUFA 1GU7A 4OJYA 4PPGA 3BZBA 1ZCZA 1E6WA 4EBBA 1ONBA 3S2GA 5ICGA 3T3IA 1IHUA 2O2YA 4YMVA 4FW9A 4HQ6A 4CMBA 1ZSYA 3AI2A 4R1MA 4AJ2A 1KO1A 3QKTA 3PDJA 1RM4A 3QK7A 4MWZA 4QDZA 3VSDA 1DEKA 4QKQA 3MRXA 1CZKA 2BOVA 1DQSA 1P39A 2XGMA 1HDRA 3A9WA 3AWDA 3BHIA 4L4YA 4P4LA 5JALA 5LNK1 1XU9A 3PUXA 4MW9A 3S5JA 4PXSA 3UAXA 2JW5A 3D59A 4L07A 4HNAA 4B6RA 1QCCA 1J2UA 3O2JA 5DNEA 2PUWA 4BZPA 1ZSVA 3U7RA 3DHVA 5IC5A 1TOAA 1I6KA 4CQMB 3HACA 2R79A 1L5RA 4BTEA 1QMPA 3IPYA 2UZIR 3NHLA 3OO1A 3ANTA 3D4BA 4MYRA 4NWIA 2FK7A 2MSWA 1YR8A 2DWOA 2RHWA 1ISFA 1I5RA 1KI1A 2IBSA 5DOZA 2CJWA 4PC6A 3QHPA 1DC8A 3G0OA 5K8IA 2X40A 3R5JA 2OKGA 2WLSA 3QFRA 3DEIA 4HGPA 5JG7A 4HDMA 2B1IA 4OLFA 4QXRA 1AQ6A 1CJVC 3CURA 4C0JA 4E2YA 3BRWA 1P7PA 4AQYB 2VDVE 4FXPA 5BMVF 4YJ2F 4UPDA 1JSRA 2RCNA 5EMHA 3E84A 2VPWA 5C1OA 1E4OA 4GNRA 5TC4A 4JT9A 2O4CA 5J5CA 4CQLB 4KXMA 4PF1A 1II8B 3VJRA 3JQAA 2JCSA 4DA0A 3AL2A 1E9VA 3NBXX 1OBCA 1HE4A 2PEYA 3IE0A 5AVJA 1MRSA 2ZPUA 3G2KA 2VBCA 4EHFA 1HZZC 3WHKA 1P3DA 1A2KC 2Z4TA 1U2ZA 5C52B 4HWSA 1N3LA 2OWDA 3HZOA 4R51A 4RCZA 4N7RA 5FL7D 4CLOB 2QZZA 1ZNZA 1F2UA 1JNXX 4K88A 4BUJA 4EJMA 4CKZA 2R6CA 1KEEA 2PGJA 2AT1A 5LJIA 3M9WA 2IXAA 1CVIA 3E6AA 5H0IA 4ESEA 1GPH1 1YGPA 3LPDA 1S8OA 3MF4A 2FSUA 3TDKA 1PHPA 4BRZA 4LWQA 3G9XA 5JCZA 2CHVA 3OMLA 2GKOA 3FWKA 2FPLA 1RRCA 1NW3A 1IM5A 2RK3A 1U1IA 2YY7A 5D85A 2Y1GA 4PR0A 2WIGA 2WM2A 2X5KO 5FCDA 2O19A 2GFHA 1RJDA 1UMKA 4DSZA 1ULZA 1DBRA 1E3TA 1YVRA 2WD7A 3FGPA 1CRQA 4K9DA 3NH6A 4OQDA 4P81A 2FR1A 2LV8A 4YBZA 5EPOA 3U80A 1B8VA 2E6UX 4PYOA 1WV0A 3I01A 4YLGA 1SZPA 2VHXA 2AN3A 2REQA 4G5XA 4MWTA 3FR7A 2BY4A 4LVOA 3EXIA 4FR2A 1F2TB 1YR2A 2VQSA 1N5DA 4KU4A 3MBOA 4JR1A 4Q47A 4UBKA 3WBBA 3V1UA 2AQHA 1XTBA 3DZHA 4FLMA 1MO3A 5AVRA 2PD4A 1E5QA 2ZFUA 3IAS6 3GUVA 1UQUA 1YOBA 4OA5A 5HMLA 4BNWA 2IX3A 4N0QA 1FDOA 3QW2A 1Q7GA 4PCLA 2B6NA 3X1MA 3OE1A 2NTEA 1Q1AA 1P9NA 2QXYA 5DCUA 1HT2E 3HCDA 3V46A 5CBKA 3GFFA 4JEHA 3HSYA 3A31A 3FBTA 1YIAA 3WGZA 3RHTA 3WMXA 2WWFA 4KUHA 1NSFA 4O1HA 4R2JA 1T1RA 2XZTA 3OJEA 1Y9JA 1HLDA 1F12A 5IPFA 3D6NB 1ZNQO 1IOLA 2X9NA 2PV7A 3NOOA 1IAVA 1EWKA 3NJ8A 4JSTA 2X3YA 3TOSA 4C6RA 3BFXA 4ETWA 2ZRIA 2JLSA 1A2OA 3EFEA 2W0SA 4JJKA 4C0QC 1OIXA 3GEPA 4YRTA 5KOJB 2Y0DA 3ZNOA 2X3FA 4BVEA 3EIUA 4X84A 4EOGA 2PZKA 4OFXA 4FGZA 3WWEA 4E46A 4EKEA 3W9BA 1GZSA 3L0CA 3FYDA 1ZWLA 2A67A 3CUVA 2VS1A 4FPXA 3MWDB 1WD7A 3ETLA 4JL5A 3WGLA 4WN3A 2QRLA 4EEZA 2R5FA 2DG2A 3H3FA 1YDWA 3NEPX 4ZVLA 1TUBA 3T3PB 1VBFA 1Y7LA 2JJYA 5FUYA 4Z1OA 2Q5OA 3I8XA 4XI9A 1ZZEA 4HP8A 3F8TA 4J75A 4LSWA 4CV0A 3ZCPA 4LXUA 4ZI2A 3Q5GA 3R7BA 1KARA 3UJDA 3IB3A 1HSOA 2AKYA 1CJSA 4FZVA 1IG3A 1EM6A 3EN0A 1Q17A 1QS0A 7AT1A 1L5GB 1OXSC 3GQBB 3P4YA 1EGVB 1QZ3A 5IU6A 1U1FA 2J4FA 3HMQA 2J32A 1JAZA 1I4LD 3RSZA 1HQYE 3ABZA 1PT8A 3TTUA 3QU5A 4DLZA 4CEHB 2IT1A 5E3IA 3IDZA 3NI2A 4YMGA 3JQEA 2OBNA 2QMHA 1NP7A 1H0SA 4K9LA 3DLHA 1FNCA 4LYGA 2AF3C 2LP4Y 4Y98A 3WXMA 1MDFA 2V0NA 4IRMA 1TB4A 4CMCA 4PFQA 1XRLA 1YDGA 3EQ7A 2D13A 3HKBA 3ZTWA 2IEDA 2AN9A 1QKIA 4H3VA 4L0CA 2JANA 4UPEA 4KQMA 9MHTA 4Z7JA 3QLVC 1JWAB 2ZB8A 3BIWA 4C78A 2VBFA 1GGFA 3NBQA 4WLUA 4E5KA 4BCCA 1AUPA 1C5KA 1A5AB 3J7AC 4NJMA 2C4NA 2W2OA 5C3UA 3WKEA 1HORA 4TV9F 3DDNA 3M6IA 4N54A 4X8HA 3TCXB 5DXAA 3DOFA 5C9ZA 3GW8A 1SU8A 4CEJB 3V8RA 3LT2A 5JWHA 2HBYA 3DBHA 4NBNA 4RZXA 4TQGA 3KSMA 1H65A 4WY2A 4RZ2A 3I73A 5DLYA 1JSXA 1R00A 1ZVMA 1NG9A 2XT9A 2BGWA 2BDTA 4HTFA 5I7UA 4NZPA 4DIBA 1N5LA 4KV7A 1M72A 1JH9A 4H7EA 4FMPA 4L5IA 3DFUA 5HJ7A 2JASA 1P5RA 5F33A 3BBPA 4PO9A 1W0JD 3VSCA 3ZX4A 3I76A 1LTKA 1UPUA 2GWRA 2WUVA 2E5WA 2XR1A 3BDIA 4WLOA 1C14A 3KOOA 4JBWA 4U3JB 3QLEA 2DFTA 4CTMA 5BN1A 5EHQA 4RM2A 3EUEA 3QNMA 1S2NA 1TEHA 3G88A 3KM0A 3AG5A 1MA0A 3NHFA 3PXBA 4TGLA 4WA7A 4XCXA 3ADKA 3DYVA 4KMRA 4G0QA 2A14A 4DDUA 5I47A 4AKHA 4MWGA 1B3RA 5HK9A 2AJLI 3CR3C 3KTAB 4M1MA 5CVJA 5T3YA 3ZV3A 4DQDA 2RK6A 2VPTA 2W6MA 4QT0A 1CUCA 4GOXA 3ZEAA 3AF3A 1KFCB 5BVGB 3N2ZB 3LVBA 5CB8A 2WKWA 3R76A 1RR6A 1EB8A 4UU1A 3WWYA 1EWQA 2BI7A 5K3OA 1F5NA 3I2JA 4I6JA 2C2XA 4CCYB 3E18A 1BFDA 3PZRA 5B2ZA 1ZWKA 1PYGA 5B1IA 5BP7A 2JEYA 3R5XA 1KQOA 1N36B 4FMBB 2C5FA 1ZBQA 3NBUA 4PEVA 2RG7A 5TQ2B 1EJBA 1IXYA 1OH5A 1J8FA 2NZVG 5BUZA 2GM4A 2WWXA 2XOXA 3OETA 5SYAA 3ECSA 1DKMA 1DRUA 2R47A 2VPYA 4R8VA 3ETHA 3SIWA 2Z0MA 5HM6A 2GXSA 1A9OA 2P8SA 2H4WA 1M2EA 1VLZA 5AHKA 2A0KA 4OGWA 4PFSA 2G9RA 5CFQA 5J59A 2VPIA 4J0EA 5DFAA 1ZUNA 2CYCA 2NLOA 2ZZKA 4GLOA 4LDNA 2E18A 2QDXA 5DBFA 3SJBA 3WB0A 5BV8A 2NO9A 2RIPA 4UHHA 3TTWA 1EE1A 3GA5A 2VRNA 4W1RA 4RAQA 1Q19A 3K0CC 4E70A 5L3ZA 1CE8B 1UR5A 4AP6A 2Q28A 4M0DA 1YV9A 4WLVA 1NUPA 2QD3A 2FP3A 4O4HF 4URZR 2E89A 3Q9NA 1KR2A 1T1JA 1RDFA 2I2AA 3LQRA 3LYAA 1RPNA 2ZI3A 5JU6A 1BVRA 4MA5A 2ASEA 4YJKA 4BMPB 5BV2P 3QNWA 4LYYA 4Y0VA 1D04A 1D2AA 2LNDA 2OAGA 5DBOA 2EJWA 3RWOA 2PK3A 3BDAA 2H9YA 2VHUA 1BFKA 2K7ZA 2VZ0A 4FJ2A 2I03A 4FZ5A 4I19A 4UCWA 4KIJA 3HU3A 4N65A 5HIJA 2B37A 4ZVMA 2HR1A 1DBWA 1PWEA 2A1IA 3BEDA 1EFCA 2A88A 3NUQA 5E3JA 3WMGA 5I9MA 5K4AA 3CCBA 3CBGA 2Q1UA 4D9BA 3AY6A 4UUMA 1VL8A 4ZVRA 1QORA 2G7MC 2GJ8A 1EMDA 1UPBA 4JELA 3KEFA 4K9RA 3X43A 2DETA 4NHEA 4NBRA 1PJRA 4QG7A 3FHJA 1U7ZA 2IHNA 1XWIA 4J1QA 3VHRA 4KBFA 5JR3A 1UPXA 1KPIA 5I45A 4TTJA 3BIXA 3LM8A 3LIIA 4B3FX 3B7WA 4ZOLA 5FTNA 2AG6A 3P9PA 4WXEA 4GQAA 3VZBA 4UUAA 3PCXA 3CRNA 4WOCA 5D6NA 3UAWA 4DLXA 1TK2A 3TW6A 3G1UA 3VDXA 1SIBE 3UWOA 3ZZUA 4DXDA 2FMHA 4MO9A 2IHJA 4KL8S 4EVIA 2WIBA 1R27A 2QRZA 2JLUA 1EWVA 4W6ZA 4UJ3A 5KX5F 3HGQA 1RM3A 1NJ2A 1LPBB 4FYPA 2TMGA 4EWLA 3SNKA 4HS4A 4F04A 4F9EA 4KRFA 4D02A 4U0JA 2PS0A 2EHDA 2ZS9A 3I3SR 1WY5A 5D86A 3WK4A 4EEXA 3KU4A 2FEKA 8ADHA 4TYYA 4HUQA 1MAAA 4IBOA 2A3RA 3FOAA 5I6DA 5L3QB 3PGA1 5A9TA 1NW4A 4YMHA 4S1OA 2LKDA 4UEJA 1RKXA 3HLKA 5FNVB 4EGSA 5JW6A 2JGDA 5KPDA 5H9VA 1F8XA 1Y89A 1R3UA 2FUKA 5F12A 2Y1DA 3LFTA 4HB0A 4JQCA 1XOIA 4NCHA 5DTRA 5F1OA