1KZ6A

Mutant enzyme w63y/l119f lumazine synthase from s.pombe
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DLKGPELRILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSYELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVIFGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-Dimethyl-8-ribityllumazine Synthase
publication title The structural basis of riboflavin binding to Schizosaccharomyces pombe 6,7-dimethyl-8-ribityllumazine synthase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1kz6A00
1KYYA 4J07A 2C9BA 2F59A 1ZISA 1HQKA 2B99A 1KZ9A 2OBXA 4KQ6A 1KZ6A 1C2YA 2C94A 1T13A 1C41A 1W29A 3MK31 1KYXA 3NQ41 2O6HA 2A57A 5IM5A 1NQXA 1EJBA 1RVV1 2A59A 2VI5A 2JFBA 1NQVA 1KZ1A 1DI0A 2C92A 1NQWA 2A58A 1KYVA 5IM4A 2C9DA 1NQUA 2I0FA 2C97A 1XN1A 2B98A 1KZ4A 1W19A
chains in the Genus database with same CATH superfamily
3ESDA 2CC2A 3H11A 3R5HA 5FJJA 1YWGO 3PKZA 1Y4ZA 4R6WA 3BREA 1DUVG 3KOUA 4ZHSA 4X6UA 4C0HA 4KJZA 1YZQA 1WXQA 4QBTA 3GL9A 1XZIA 3AF0A 3EVZA 4Q03A 3EF0A 3GFPA 4WV3A 1UZUA 5HFJA 4MAMA 3DV2A 1TCBA 4UVHA 3RYFB 4R3WA 1ZVJA 2XQGA 3O8QB 3EXAA 4G85A 4MQEB 4RD0A 2A67A 4HQKA 4YI5A 1OI3A 4IDEA 3SX2A 1BJTA 2ADMA 2ZJ3A 5IVHA 1SA0B 3UPUA 2PSDA 1YA4A 2D5BA 1FDUA 2MSLA 1Y1QA 2Q2VA 3LPCA 1HG1A 3N3BC 4NNJA 5CH5A 2FK7A 4UATA 3H0KA 3LT2A 5DM70 2QXYA 3RRMA 1GUAA 3KEFA 3TLGA 1Y98A 4I1OA 3OHMA 4D0RA 4BE7B 1ISHA 1QWSA 2WWHA 3LCVB 2I4IA 1USVA 3N58A 2ZSAA 4PFQA 3T7AA 1BMTA 1T1GA 3HR7A 4ZHQB 2QXUA 3UUWA 4OHVA 3MS7A 4V0OA 4Y2RA 2AI2A 1XKLA 2YFHA 5TVGA 5JFTA 3KTFA 2PT9A 3DHNA 2W2KA 1YB4A 5KREA 4JS0A 4TKUA 1DFIA 5ALDA 1D7OA 3BAFA 3CRVA 5M34A 4W4TA 2DH5A 2EQBA 3ER6A 2WA2A 3F97A 1VHDA 2X8LA 2VHYA 1IB6A 1OFVA 3S99A 5D6OA 4MDEA 3SBEA 4EHIA 4CV1A 1W5BA 3DMYA 2OFPA 1YRYE 3INGA 4B74A 1BCRB 1AURA 1SUBA 2FQWA 3RUDA 1CUUA 2XOKD 3WKEA 1QYWA 1YUBA 1QZXA 2Q5QA 5G02A 1WDKA 5DP1A 4JBNA 1RRCA 4C7MA 2FN9A 4L6AA 5ANRB 2IBTA 1NQOA 2Y27A 3VYSB 1U5AA 3B6IA 4UBLA 1RXEA 3TGWA 3E53A 3UK6A 4H6VA 3DV0A 1HDEA 3QSGA 4GKVA 3V1LA 2I3AA 4PCVA 2QVXX 3AUTA 5CVCA 4S05A 1XGKA 4HHEA 4BEVA 1CRPA 3N0RA 4JUCA 4P81A 4ZOLB 1H42A 1J8FA 2DT8A 2YJGA 4TOIA 3S6JA 3CPSA 1L5LA 3ZLVA 1K7YA 2QRHA 4NWIA 4HAIA 2UYCA 1ISFA 1E77A 4FYMA 1R12A 4JJ8A 1C8KA 4YT2A 3FDJA 1N8KA 4MJ7A 3EMKA 3U4CA 4WW0A 3ZDFA 5K8IA 3MIZA 1J7KA 2OXIA 3QEMB 1R4MA 3SHFA 1QYIA 5FOUA 2AXNA 3ZXIA 3GF4A 1U3DA 4B3IA 1HL3A 4C4OA 3RVKA 1Z5OA 3F78A 2C04A 4KQJA 2FPSA 3FUTA 5AVJA 4DARA 5I7VA 1EXMA 3M1AA 1JRLA 5B2EA 3W5BA 4NCJA 1IJFA 1SG0A 1L7QA 2OV4A 3NPAA 5F9FA 5AR1A 2GA8A 4KX3A 2YN4A 3ZQKA 1IUKA 1NXTA 4RTJA 1DPFA 2HQOA 2AXQA 2HXGA 1FSZA 3TRDA 3P2YA 1Q15A 3QXGA 2O14A 3AERA 2X0RA 5I7RA 1L9XA 1GU7A 4OAQA 5GJVC 5JD6A 5C8YB 4JDUA 2J0SA 4BPBA 4LSGA 3B36A 4GP7A 5JO9A 4A0HA 2ZSEA 1FFWA 3F9CA 4Q02A 4ZC1A 1KMHB 1WA5A 2Z3VA 5AW9A 7ADHA 3EBPA 2ZBGA 2Y0EA 2X2OA 3DL0A 1XMSA 2GKGA 1SVSA 5KEIA 4KREA 2I91A 1SVOA 3T35A 3NHKA 2PGAA 2JIDA 1ICEA 1R88A 1ZNXA 2ZQ5A 4G8JA 4IOKA 2P3QA 4ITRC 4L5IA 2Q6LA 3PGA1 1P17A 1PQWA 2IYPA 1Q19A 2HF8A 5HIAA 3KSRA 3T1VA 2X2PA 5I3ZA 1DX9A 1V4BA 2HMSA 4JGBA 4TV8F 2B1RA 3A4TA 3UIEA 3I5XA 4RZQA 2OK7A 5JR3A 1JALA 4Q1VA 5C31A 1BXRB 4WFIA 4KMOA 3GFTA 3V4FA 4IJ6A 5K0CA 4WBXC 3AP1A 1NKTA 1HEUA 4NXMB 1NPDA 1BDMA 1Z5WA 2PRYA 1N6PA 3IIJA 3VZCA 3SF8A 5EIFA 5CEFA 1MR3F 4UZEA 1E2UA 2FPGA 5J2TB 4HWTA 1Z16A 5BSEA 5FR1A 1IZ7A 1MOSA 3G8CA 5FPQA 3H2SA 2IEDA 4CMHA 2JA2A 1O5IA 4DBVO 4C6RA 1P7PA 3CU5A 1R74A 2ZWMA 4ND6A 3VH3A 4BP9A 4RTKA 4OLAA 1KSJA 3HSYA 1DQYA 1EVYA 1G20B 2BDTA 1KFJB 1OQAA 1VQ1A 3ESBA 3G1UA 2FSPA 4AS3A 5AVVA 4HWPA 3VDMA 3FRHA 1VL8A 5CLFA 1K88A 4KBGA 2JFOA 2UVPB 1VL0A 3TTWA 4D99A 5B7NA 1YULA 1OX5A 1TCCA 1MAHA 2B8NA 2YVQA 2A9VA 5CFLA 4CEJB 1RLIA 4R1NA 2W37A 4B2PA 3F90A 3PXEA 1W19A 3FF4A 4WLUA 4FSDA 4ZD6A 2OILA 4QD3A 2ZBUA 3HB4X 3ROPA 1HEYA 2D3TA 4YAFA 4Q9DA 2IGBA 5LKRA 1SCKA 1PJBA 3VH1A 4OFBA 2HMTA 1Y33E 3X2EA 4DIUA 2Q29A 2QHXA 2YUTA 2V3CC 4D26A 2RB4A 1XJ5A 4Q3NA 4JJKA 2ZE7A 1HDXA 3T0FA 1B4DA 3V48A 1ORTA 5JD4A 4OHYA 3P9SA 1YCFA 5B3KA 5JSZB 2BIFA 5EFOA 2J9FA 4S2UA 1GPMA 1SUWA 2YMQA 2QTRA 3QQ5A 4DV7B 1VXOA 2WC1A 3ZYZA 4B2LA 4N8DA 2ZIGA 3CPHA 2HREA 3N2NA 1WABA 4E5KA 2KLHA 2NTVA 1WVGA 3ICVA 1MVNA 1T8RA 3PWKA 3HPRA 1MEJA 2JFVA 2BTQA 2UZ1B 1KAGA 3Q6MA 4PVCA 3ZIDA 4A8HA 1PJAA 2DFVA 2IDJA 4QQRA 4RD2A 1ODCA 1LBTA 4V1CI 1W29A 2F43B 2QRGA 1FFBA 2IEBA 2A7XA 2LKDA 3AB3A 2AD5A 3HU2A 3P96A 4FSHA 3CBQA 2AJ8A 4QO8A 4TKMA 2C3YA 5EVJA 5IM4F 2JH8A 4H35A 1BXKA 4ZDWA 3WLMA 4AVYA 3HM9A 4RHEA 4N5DA 4OH1A 3EAFA 3VPXA 3UCFA 1EK0A 1P4SA 2GK6A 3DE7X 1YNOA 4P33A 4PR0A 5LB4A 2ZWVA 1Z0UA 1P39A 2ZI9A 4PQEA 4OHXA 4B8ZA 4EVSA 2QTBA 1WSAA 3TMYA 1KYYA 2WWXA 3OZVA 3VV2A 1GCUA 2J3EA 2YINC 4US2R 2XUZA 3HS3A 5CIYA 3FPBA 1W46A 3JD4A 1PS8A 4DMFA 4FM9A 5MFZA 1OOEA 4QELA 1GFWA 4CM8B 3FN4A 4PBRA 1WCV1 1A9OA 5CNIA 5DHSA 5EFZA 5G40A 4YFVA 5AOBA 3WFJA 5JJCA 5KPJA 1SCNE 4QJIA 3OLVA 5GIPE 1E5TA 2O2HA 1RC8A 1UWCA 2YHAA 3L4KA 4AO7A 4O4HA 1MV8A 2FWJA 4YDSA 3MRXA 1QP7A 1EFCA 1MOQA 1T0JB 2V1UA 2CB9A 1Z7GA 3OEHA 4PAMA 1KSGA 2QYOA 3ZY5A 4P93A 4E07A 1EFPB 3I83A 1Z5VA 2CWWA 3FYCA 3VPAA 2QN1A 3E05A 1Y8QB 1N92A 4M46A 4PGGA 3FFWA 2QMEA 4TM7A 1ZH0A 3RAEC 1G64A 2R84A 3PZRA 1FP6A 3M3HA 2OPHA 1Y8ZA 1MQSA 5IZ4A 2F59A 4D9HA 2XZPA 3QKRB 2NUPB 1MO3A 5H83A 4YRKA 4QYSA 3R9XB 2AKEA 3DHYA 3LM8A 4JV5B 4FD2A 3TSZA 1RTKA 4C7KA 3N6VA 4CLEA 5IKEA 1GG9A 2VXCA 5ULLA 3R9IA 1JFTA 2ZAOA 5KVAA 3KS9A 4OO3A 2LV8A 4P53A 3HK2A 3I9KA 5GOTA 1D3AA 3SEQA 4PICA 4F2GA 1N9GB 5B58T 1Y5RA 4GVPA 4EG1A 1W1WA 4XXHA 3GYBA 1J5PA 1KBQA 3H84A 3FAKA 2O8CA 3SIPA 1OT5A 4EPRA 1EFUA 5AOCA 1QSGA 1ZNYA 1JKJA 2ZSIA 4G8DA 2EJCA 3C5HA 4K6MA 4NI5A 1YQ9A 5E8RA 2IPOA 4D8XA 1TQHA 3PFFA 3QE2A 1H5UA 2PQMA 3PT5A 3ZBPA 3G0BA 4BXOA 3DQPA 2VUIB 1ZJ5A 4BX8A 5B7PA 4I9FA 3M9LA 1N0IA 4YJ3B 1GXSB 2Y0PA 4RZUA 5ARDA 1V71A 3BM5A 1IN7A 1I1OA 1YRQA 3FB1A 3GPIA 3ZNNA 1ZD8A 5AK6A 4Q4HA 3IE1A 4GRDA 1JBQA 3JQEA 1XQ9A 1HNWB 1N2OA 2X9QA 1NXXA 1SUAA 4JD5A 1WW3A 3A6HA 3M6MD 3OCYA 4R1MA 1JDUA 1PKXA 5FPTA 5IF3A 5LZ7A 3IBCA 2FMHA 3L05A 1RRVA 5AI8A 1T5SA 1TW2A 5TS2A 2YY5A 2ZJFA 3UKOA 3ZCSA 4F3CA 3AFGA 1XZJA 1KKUA 2HA2A 2OFXA 4AX4A 4UUMA 2H52A 4RYLA 2GCOA 3OKCA 4AJEA 3DF7A 3BF7A 1TKRA 3KJQA 2C4UA 3KEQA 5E3IA 3QUTA 5E2BA 2C5FA 2VHTA 2ONJA 3OIFA 1W9HA 3U49A 2VWGA 4ZO9A 1BQ3A 1JIJA 1XTJA 4KGDA 2CLKB 2X0FA 3TS1A 1NV9A 4DY4A 4EPXA 1KAMA 3LHFA 1JYSA 2MSNA 2BUBA 1FIUA 1IPFA 2WIFA 1TAQA 2W0MA 1KEVA 2VZ8A 3OMWA 1HYHA 4U9HS 4DJAA 2PH1A 3THXB 2VATA 1U9YA 4LOAA 1YE5A 1AM4D 4DR2B 1HLPA 2BJVA 3GNSA 4PZ9A 4IEEA 1R00A 1A8UA 1QE0A 2HC9A 2NWQA 1NJ1A 3CF4A 1Q7CA 1E5QA 4KE7A 3WGNA 5LYJB 3I6MA 1BH6A 3E9EA 3GUVA 2E37A 2ZE8A 2JCVA 2JAPA 3QYFA 1RM0A 4J49A 1D07A 1SPXA 4OSPA 5EN4A 4B7UA 4GWGA 3QG1A 4IXMA 3ZHOA 3ZE1B 2X0KA 1D6MA 1ZGJA 1SULA 3HXTA 4O02B 3W5UA 2C9CA 1J2YA 2WW8A 1TK2A 1LPNA 2DHRA 4GPZA 4LWOA 4MIOA 1ZICA 3I9NA 3DCNA 5T67A 2GUWA 5JO0A 2C7QA 3NVKI 1QF6A 3DG9A 2B8EA 4WEOA 2PBFA 2I29A 3IVCA 4O8ZA 1FL9A 2NU8B 4BKOA 4RXTA 4ZI7B 1JFVA 3OFSA 3AHHA 2WHPB 1NLMA 3E03A 3KUCA 5HJ7A 4BX9A 1EG2A 2D1FA 4PC1A 5EZSA 4AWXA 5EAIA 4BO4A 1F12A 4GI5A 1VIYA 2QQFA 1XA3A 1B16A 4ARSA 3RR2A 4BC0A 1T0PA 3O4FA 4QAJA 4G89A 9LDTA 2OBLA 1VKZA 2BZSA 3FD8A 4FN4A 2VUSA 3ND5A 4ZT2A 3FMVA 5J2UA 4Z53A 3S7TA 2L17A 3OY2A 1JMKC 1Z6PA 3OCXA 2WFLB 4N3CA 4ENVA 1R8QA 3I9FA 1V43A 1ETUA 4LBVA 2P9CA 2IOHA 3IDZA 2ACEA 3WK7A 4FMDF 1ISMA 4KNWA 3KEMA 3BTOA 2OLJA 4HO1X 2QTWB 4XFDA 1P2TA 1TU4A 2QLNA 4G5SA 4G97A 5BV8A 2RHJA 1QQBA 2HT6A 1ZSVA 4UXIA 1KP2A 1OREA 1XEAA 3THYA 4B3DA 1A9PA 1QH1B 2JLSA 4OKNA 1V6AA 2XMPA 1RXVA 2FX3A 1Y9ZA 2NO4A 1B0UA 3M4NA 1TF2A 1LDMA 3H2ZA 3HDVA 3V8RA 2QZ9A 3HWSA 4ZEOA 1IQPA 1XQVA 2GGSA 2QPTA 2FPPB 5ECYA 4ZANA 4YUVA 1MF7A 2EEZA 3BXPA 4CNQA 3LYUA 1OJ7A 3MTAA 1KYXA 4LYFA 3VR2D 1RZUA 4UZSA 1KQ3A 1XRSB 2IPMA 2EDAA 2YC4C 1GFSA 4KAFA 2CGEA 1ZYUA 4RMJA 3QLTA 1FU7A 4ZO8A 2PUFA 1I5EA 1JEOA 4TVBA 1WM1A 4MWCA 2QRJA 3P4YA 4ISBA 1PFGA 3PTLA 4I55B 4MB6A 4MLCA 3KX2A 4OHBA 3ZYCA 3BIOA 3ETNA 3KHSA 4H31A 4RA6B 4UFNA 4PWYA 5FUVA 3HB9A 3W9UA 3QX8A 4B6JA 4ZU3A 1P61B 4YGYA 1GZHB 2GNOA 1Q0QA 2FLVA 3K2EA 4NMXB 5DM4A 1T1SA 4FOLA 4LXHA 1T9BA 4CEIB 3QEJA 4BJ6A 4HUQA 1DKMA 1MB2A 1SEVA 3EAGA 1R66A 1HT1E 1DUSA 2JAXA 3K6JA 4QNNA 3OEED 2BE7A 3JYQA 2PT6A 4EPWA 3K5PA 3PC4A 4RMNA 4Y8VA 4BKPA 3NAQA 2P68A 1OZAA 1FSFA 1HH4A 3A14A 4LSZA 2PVCA 2VJYA 3Q9SA 5JNRA 3RT1A 4TTIA 1DV1A 1MB9A 3A25A 4BAGA 1I1QB 1N2GA 1O95D 1G5TA 1Y3DE 2HLPA 3ZDBA 3OWOA 2QNRA 5DISB 4E2YA 5BVHA 2FF5A 3H86A 3LQQA 2H1WA 4M83A 3HJAA 5ES4B 4CLRA 1VSBA 2M98A 4E51A 1V5FA 2G9ZA 4ZT3A 1H1LA 3HUFA 4EY7A 1XCJA 1C4XA 4KXYA 1ZN7A 2XLBA 4GL2A 4AYXA 3JD0A 5G41A 1VJCA 2I22A 1W94A 1L7DA 2WTNA 1LRKA 5C3MA 1WF3A 3OEYA 1GNSA 2WE8A 4IIDA 4YRGA 1DWQA 1DRVA 1RWQA 4YJ2F 5AK0A 1P1CA 1M33A 3FHCB 4ID3A 3R7BA 3MCWA 4BVEA 1V6SA 2I2WA 3DLCA 4NG5A 3WDMA 2QTHA 4S1WA 5C3UA 1XNQB 4AURA 1VMEA 1NATA 2Z6QA 4F7WA 2NP7A 1NIPA 1JQKA 3I09A 3JQAD 4PRLA 5CW2A 4LCJA 2DBQA 1O1YA 3O4IA 4BJHB 1ULSA 4LF8B 1CLUA 2AF3C 3HG7A 3I72A 1SKMA 2HKIA 5CM8B 2J8ZA 5EXTA 1M0EA 4Z7QB 4PGFA 1WDWB 1Y5LA 5JAZA 1A71A 1JIIA 1ZD4A 2OBMA 1GTMA 3DEHA 1ZGAA 4D9JA 3PJEA 3ECAA 4MTLA 4FWIB 4UAJA 1L5VA 4EG8A 1JTFA 3EOZA 5TPWA 1A77A 5LXTF 2PS0A 4IHJA 2IPLA 3E48A 5L45A 1QAOA 4A0RA 4DSZA 2J0UA 2ZPTX 2BFEA 3K70B 3L6CA 1FNSA 3AETB 4N5LA 1B15A 4QGAA 4E5DA 2GT1A 2WK1A 1AO3A 2JC3A 5CT5A 1E6WA 4DIBA 1QHSA 1BDIA 1I80A 2VS1A 2ZTMA 4KOAA 5I7FA 3AI2A 1HLDA 4M3NA 1FQWA 1XTSA 2IE0A 2C97A 1H93A 4R1OA 4X7RA 4B34A 5KQRA 1ZI9A 4WY5A 1DIGA 2VNJA 2R60A 3FPKA 2RAUA 4MRMA 4KSBA 1KJIA 3NHMA 3A6FA 2F9MA 4R1UA 5TPZD 4JZKA 4FEYA 3LIIA 5FNVA 3BT7A 3ZWOA 1A7UA 4RH3A 3NNSA 2P69A 3P9PA 1GR1A 3OFVA 5HF5A 5HDBB 3RC2A 4ZV4A 4Z3DA 1T0UA 2F3PA 3E5NA 3JATA 1MABA 2I4RA 3G8BA 1DBIA 4U7FA 1Z7WA 3SS7X 1XVIA 3WGKA 621PA 3NBUA 3OBIA 1CJVC 2JJYA 1POXA 1XELA 2Z95A 3L01A 4MPTA 5F77A 3UUFA 5IJ0A 2AQIA 1FW6A 1N5IA 1JKXA 1LCIA 2VOJA 1CEEA 1I3LA 4C06A 3FIUA 4ZVMA 4KLAA 5A4IS 4JC4A 1CE8B 3ZK7A 1SB9A 4YA6A 1B6SA 4PF1A 4BJ3A 1EEXB 2CY0A 2FCAA 4PINA 2QD3A 1H66A 2ZCJA 3KR9A 1D7AA 7AT1A 3Q6IA 4KK4A 1RWVA 3ZHSA 2GLXA 3LX5A 5KYNA 2IXDA 1X8JA 1DDIA 3IAM6 5ERGB 1V1MB 2PDAA 3RHFA 5J5CA 1QDUA 3RSOA 4O2BF 5BQ3A 3O31A 4BNDB 1RRMA 4Q1AA 5CXXA 1SCJA 4EABA 16PKA 1TAGA 5EHQA 3TMKA 4D1YA 1MTZA 1ZUNA 4GI2A 4R40A 2A78A 1SQFA 4AZ3A 5KNBD 5K0NA 3IJRA 2VNHA 3GLRA 4BQFA 3CY6A 1O9BA 1QHHA 1W0KD 4C08A 4RZSA 1U2RA 5HMMA 5KVQA 2GPSA 3CG4A 3U7QA 3OAAA 1OXBB 1GFIA 1Q1BA 3Q15C 3URKA 4D45A 5JNWA 3PLAE 4GGMX 4MR8B 1QGUA 4RLSA 5TC4A 3VAAA 4I5FA 4KUGA 8MHTA 1QZUA 2X1VA 4K88A 1T9HA 3LUHA 4KLRA 1NW5A 5JD5A 1N78A 4R9RA 1QYRA 1RRGA 4IMRA 4U7JA 3U4AA 3P9YA 4X1IB 5BW8A 2AIRA 2W0SA 5JPDA 1JWLA 3ABSB 1I0IA 2CCGA 5FOXA 3EUEA 4GMXA 2RFLA 4ND4A 1K3TA 5JSFA 4K9OA 3OZRA 2JFXA 3QK7A 1LVGA 3E9NA 4PYLA 4YTEA 4FGSA 2IDKA 5E9JA 1GVHA 2ZIWB 3AR9A 1AV6A 9MHTA 3ZKWA 1E1MA 4P4GA 2QUBA 3GDWA 3WK8A 3ZQUA 5FX2A 5D5QA 5IARA 2WKSA 2QE7A 1QGZA 1NURA 2WDPA 4S3MA 3TKLA 3IE0A 3HZRA 4ETNA 2PUHA 2GJKA 3RUPA 3NTXA 3R7WA 3L7NA 4KXMA 4BQQA 5C4MA 2V0NA 5ALUA 2VSQA 4I50A 3QVMA 2CUZA 2PNFA 1ZGHA 2YFQA 4ZT5A 4BAZA 4HNTA 1GPYA 4J8PA 3K0BA 3SJAA 5EUQB 4TL9A 3TKYA 2H8GA 4GDFA 1BDBA 4PLHA 5HW0A 3N7UA 1WWKA 1WTAA 4RK6A 1U3UA 1Q1AA 2QVZX 3QPCA 1Y3AA 3BDAA 3WLQA 2XITA 4Y6OA 5FWYB 2WAAA 4INOA 1XHEA 3H6KA 4E5YA 1TA0A 5D1NA 3DXZA 4RL6A 3STUA 3UT5A 4ZYWA 2PQ0A 4Z5XA 5KYXA 2R8BA 3LECA 2WUWE 1TYDE 2CJWA 4UFOA 1UXJA 2ZRPA 3QWIA 5FI3A 5IANA 3WTCA 4F4IA 4EHFA 1AMOA 5HCNA 1TQ4A 1ULAA 1SCDA 2Q5LA 5J4YA 4UULA 3PRKE 3ZGYA 2JZCA 3BDIA 3DQZA 3RV3A 2I66A 2QI9C 1E6KA 3BZUA 4JLBA 4PZLA 5DYWA 4DREA 1LPSA 3L0ZA 5HIKA 4H17A 2QTNA 1F2UA 1FDSA 1YGYA 1XTVA 1TAHA 4X9XA 5CFPA 1B0AA 1PNQA 4UXJA 4P3XA 3ER9A 3AY0A 4Z4FA 1NFQA 4XYBA 4LY0A 3DOJA 2FUG1 3ZV6A 2IWRA 1JZTA 4IGIA 1E2PA 4KO3S 5A0FA 2VQSA 4B7ZA 2HLDD 1QRDA 1J0XO 2XVYA 3FVQA 1NVDA 2CLFB 3L7DA 3NAGA 4DLRA 2ZSHA 3RVMA 1NBMD 1NVUQ 3MVEA 1AN0A 2IHZA 3FNIA 2XCLA 1RBMA 4UEWA 4YIHA 4NE9A 1XNRB 4RM2A 1LLDA 3L8CA 4PN3A 3R0IA 1KRXA 3MWFA 2C98A 3OQBA 4NV1A 2PWAA 4RLHA 5A4JA 4WBNB 2HQSA 1M2VB 3ANMA 3HVUA 4Q9JA 4BOYA 1I2AA 4LE2A 2LWIA 4MITA 4QRIA 3VTAA 2PWZA 3F5FA 5CIWA 5DGTA 3KQNA 4M4SA 4R1TA 3I9V1 2Z8ZA 4TROA 4KH0A 1EIWA 2E9SA 2QX7A 2Y68A 4R9VA 2QU7A 4OGGA 1C1XB 3CS3A 2HPHA 3RUCA 5K99A 1PJCA 2GJSA 1CY7A 2YOHA 3HVIA 4XD2A 3GJ5A 4KPUA 3R3SA 3VVBA 2D5CA 2A88A 3DQQA 4RW0A 1Y7IA 4EG5A 5AW2A 1OGJA 2BW0A 3FZNA 3PI7A 3LOQA 1AH2A 4UM8B 2ZJ8A 5LQCA 5FLXA 4YR9A 4NYIR 3EYWA 1IOZA 4KBYA 1I01A 3F74A 2ZI7A 3DZFA 4J2TA 2V6GA 2CCJA 3BORA 2C2MA 2X76A 2NYRA 4CM1A 1AZWA 3TO5A 1HLGA 3NORA 1R0WA 2C8JA 4IIXA 4JI1B 1XQYA 1RZRD 4B47A 4QECA 5TEVA 1XC7A 4GC9A 3LZCA 3ZDXB 3I2IA 3L4SO 5JFOA 1BHSA 4F97A 1JSCA 3QVKA 5A9SB 1HK7A 1H23A 1Z8FA 3DWEX 2H59A 3N8GA 4WD3A 1NUHA 3T41A 3TXYA 5AO9A 4B9EA 1Z0KA 4XUEA 1P1IA 1I3MA 1ESMA 1PNOA 2CHGA 1EUYA 1NJGA 2JLUA 4OMCA 4UARA 4DIDA 2JRLA 1OV6A 4N0DA 1U8CB 2BKUA 2VDWB 3KT3A 4MS4A 1WTCA 5HRAA 1E94E 4ZREA 5CDTA 2JAQA 2GILA 3EBOA 3OIGA 4Q12A 1JQAA 5B1DA 3H2YA 4I9NA 3QUQA 3RK4A 3VH2A 3ZWWA 4P7FA 5KNCH 3ICPA 2QX6A 4P1ZA 4B2IA 5D3MA 1IXSB 1FYWA 1T2FA 2W4IA 3CG0A 3PU6A 3UHOA 3EQ9A 3UWMA 2O50A 4EL5A 5A6VA 1R0KA 3DD1A 2QRVB 2EKQA 4DLYA 1R27A 1SB8A 2QF7A 1TVCA 4W1RA 3IPLA 4OP2A 3T9CA 2QRKA 4JR2A 2CUTA 1G3MA 4ZVQA 2XCOA 2H9YA 4BO1A 4U7TB 3VKHA 2HJ9A 1CYDA 3TGPA 4K3UA 1PK7A 3Q3GE 1E8NA 4OCZA 4UHBA 1FXSA 4EGCB 8ATCA 2AEMA 3U4DA 1TUEA 5DYIA 1U6KA 1S4QA 4MV4A 1BHO1 4TUYF 3TLGB 1KKLA 1XZKA 1BSVA 4QATA 4BO6A 4X24A 1C7QA 2JGFA 1AC5A 4HX5A 2PFGA 1UANA 2XMBA 2CK3A 4BRSA 3PWSA 1EFRA 3ZQ6A 3EH2A 3I05A 3OIWA 2C3UA 3GEGA 3HCPA 4YXWA 3EWIA 1MZVA 1YQWA 4URYR 4F72A 4MEJA 4MULA 4MICA 3KZKA 4RHYA 3A31A 4L9RA 4XQGA 3SQMA 4LG1A 4UFPA 3C3CA 3NHLA 1ZK0A 2IUTA 4K9SA 4QEDA 4C3OB 5CCXA 5IASA 1NSTA 1P6QA 3PRJA 3U6BA 1R3UA 5I9NA 2PXAA 3KOWA 3WDSA 1JZQA 2Z30A 3C43A 4NU8X 1G20E 4CLXA 1GNPA 3D5EA 3QW2A 4N65A 3EWNA 1T1JA 2GRAA 4CDRA 3L7JA 3OFKA 4ZJPA 4I4NA 1YRAA 2G71A 3NCTA 4ZOCA 3WB9A 5I47A 1LC3A 2F8SA 5HF9A 2WHRA 4FEEA 4EK9A 1YZYA 4UXHA 1SQ6A 3SXUA 1J2RA 3SYLA 5AJUA 2O8DA 1JR3A 4TS3A 3ZWQA 1D2CA 3A2NA 1YK0A 3BMCA 3EXIA 3K8YA 5FRDA 5AXDA 3TRFA 3RVBA 2G67A 5A3VA 4FEGA 2QN2A 5AVZA 3ACCA 3FG9A 4BVHA 3V33A 3PENA 3C5WP 1A88A 1EJ2A 4HXFB 1JFFB 3U40A 3TZEA 5D01A 3M6XA 1YMQA 1PJRA 5G3YA 1NOIA 2PZFA 1A4RA 1V1RA 3EVGA 3IHLA 2EF1A 3I4LA 4QOHA 1WMFA 4AJ9A 1H4VB 1U2QA 1KAOA 3AH8A 2I7CA 3DT6A 5H0IA 3V8MA 3SLKA 2VAWA 2FUEA 1RM4A 2Z2YA 3IUEA 2G83A 2PRSA 3H83A 4J0JA 3D6JA 2ZSBA 2IYQA 1SK9A 1DKOA 3EZFA 1SG6A 4QUIA 2A3RA 3GMTA 4L8VA 4NCBA 4PFSA 121PA 5T5QA 3H99A 1P1RA 1G66A 3KJXA 1IVYA 3NH6A 4HFNA 1O5TA 5CDHA 1PV1A 5CPFA 4WMLA 3TUJC 4OYRA 1NN3A 2XB4A 3PT9A 3EXG2 4WN9B 4JLVA 3L2OB 1KVTA 1C8LA 3HCOA 2CHFA 4WNCA 3S2IA 3ZZTA 2CEKA 1EUCB 1NXWA 3H8VA 3AEYA 4O2AF 3ZCXA 3UW3A 4KR0A 3TR0A 5JY6A 4GX5A 3WLTA 1I7QB 2P62A 3I92A 5JCPA 2GNAA 2VSNA 3KWLA 3K9NA 4CLDA 2O7QA 2VF7A 4WQMA 4Z7OB 4AUEA 3PPVA 2ROQA 1MB3A 1DFHA 2FP4B 2HZ7A 3GVPA 3MTGA 4XB1A 2WDZA 3Q6NA 4OHPA 4ZCSA 3FPAA 5EVCA 5PNTA 4DTIA 1C7EA 4M9ZA 5CK4A 5A4MS 3TD6A 4BLUA 2JEZA 3O2NA 4L08A 4P86A 1TC1A 5B1IA 1FQOA 5JZOA 4R9SA 4H4CA 4BQSA 1Q7RA 2VJAA 4K1XA 1YQGA 5KBYA 1BX0A 1OPRA 5IWAB 4BEBA 1XEXB 5J1TB 1OZHA 1E69A 4MV6A 1UBFA 4PHFA 5SICE 3AHEA 2EX0A 3M4ZA 1LBEA 3DEZA 2Q4RA 3JWPA 4IOLA 1P9LA 4MKIA 3KUUA 4JX9A 4R81A 1SXGA 1H5QA 1H22A 1NWHA 2C0QA 2PH7A 3DAHA 1NE2A 4RD4A 4TV9A 3KLMX 1HETA 4KHZA 2SCUB 2WAXA 1FEZA 1NI4B 4DMLA 5JAOA 3P5BA 3CR3C 3I28A 5F9HA 1OCEA 2FQYA 2QTZA 5KMGA 3A4YA 1PK9A 3DEIA 5TLSA 1U0SY 1QIGA 3BQMB 3IXMA 1F48A 3S2FA 5FBLB 4I1YA 3T5GA 3EDOA 2VYCA 1ZVMA 2R4QA 3D3WB 1PEDA 3D4NA 3HKCA 1CUYA 2IZ5A 4G5RA 4JLUA 5E6RA 1RAFA 5JW6A 1M1ZA 1PF7E 5E7JA 3UMRA 2H29A 3BTVA 4JQYA 2V74B 1WQ3A 4NJMA 1QLWA 2G6BA 4UZFA 1E5VA 1YJBA 2KSQA 4OIMA 4UBOA 2YBDA 4P98A 3MB5A 3NWJA 3G2MA 3HNRA 2JGKA 3R6GA 2C99A 2PYDA 1ZC3A 3SHTA 1AF4A 3O8LA 4MV7A 3HEAA 1I10A 5K8JB 2B69A 3H8SA 5ED0A 1H6CA 1FXUA 3QVOA 4B6GA 5BSGA 3OOSA 1Q3KA 5JC8A 2UZ3A 6NULA 5B6IA 3OOHA 3KHUA 1GL7A 4O59O 1Y5IA 2ID9A 5TQVA 4DIMA 4G5FA 1EP9A 2H9IA 2C96A 3FBGA 2HUPA 4N6GA 1O03A 5EE9A 3M5DA 4RY0A 3TVTA 2EZUA 3PQ2A 3QKTA 3U31A 3IV7A 2B25A 2CN1A 1WSDA 1MU0A 4Q1EA 2PGXA 4S0ZA 1KEKA 3ASYA 1PJLA 2YDYA 3CLVA 3QSYA 5AQEA 4DXAA 2Z08A 1Q84A 4IXNA 2H7VA 3GFFA 4WH0A 1S8FA 2GF9A 3NP7A 2WU1A 2J4DA 3PL5A 2VF5X 4S1PA 4YALA 5ERYA 3UOAB 3BRWD 3F7TA 5ALYA 1YXMA 1X9HA 4L8GA 4BKMA 3K4PA 2UUAB 4JUBA 1NW6A 1ENPA 3PF8A 1JTVA 1N0HA 2IS1A 2GAOA 4MVJF 4EGFA 1E2FA 1DO2A 3QH4A 2BTQB 3T3PB 3EIWA 5DLQC 1SGWA 1A9QA 1NV8A 1Z17A 2ZTLA 3SZUA 4UDOA 1KI6B 2VH5R 3CJQA 3WGLA 1GZ3A 2BR4A 1OH8A 5K4AA 3BWVA 2PH3A 1XD2B 1C1DB 1G55A 3NC1C 4DLVA 2ZJYA 1EFLA 2YWHA 3F46A 4N0PA 4O6VA 5C81A 1PU2A 4WEQA 2D1SA 3TIFA 1PFWA 3DO8A 1TCVA 4F5DA 5AIAA 1J21A 5KX5A 1VG9B 1OASA 3OPNA 3KQTA 3CGGA 2FR1A 3O4JA 4DIKA 2W6CX 4XCQA 1CUFA 4P0TA 3W1WA 3L7KA 5A2QA 3EEYA 2DBZA 3L7BA 4L2IA 4GS5A 4L78A 4B0OA 4D6PA 3OWHA 3FSGD 3HBFA 2NQ8A 4OYHA 1BXGB 4OM7A 2FRDA 4RENA 4L5BA 1SAYA 4BCDA 3ECSA 4YAKA 4COKA 2P6RA 1XVUA 2IOYA 2YR0A 2JCGA 4F9EA 5HE8A 3GMIA 1BDJA 1LBQA 3HI4A 3JQAA 4X61A 1EVEA 1WP4A 4ALIA 4BNTA 1V41E 3E27A 3GPDG 1XN1A 4W5HA 1SIUA 1GRCA 3P32A 1MOZA 1IXKA 5TB5A 1NR1A 4J1TA 5AM4A 1EK6A 1XDBA 2JBAB 3M2TA 3WGGA 4MAFA 1QF7A 3HDYA 4Q37A 1OXVA 1SBYA 1YHNA 3RBAA 4DV3B 3O4GA 4G4JA 3VNAA 1TD9A 5E1MA 2F00A 4X94A 1I3OA 2CYBA 2QM7A 1QGED 1VL2A 2UZAA 2B3DA 3B1VA 3D2BA 3HYTA 3I3OA 4U4AA 4ZTBA 5THKA 5HG0A 3UAYA 3UGKA 3SZMA 3TPZA 2JGAA 2PSHA 4PLYA 4MVJD 4PTYA 4ZI3A 2IYFA 1ECBA 3EGXB 3HXLA 2H92A 3CVUA 2BGGA 1U7DA 2QPOA 1Z3CA 3QFHA 3KVNA 2G8NA 1KTIA 2N75A 4UASA 3IESA 1ST3A 4E4YA 3CISA 4FYYA 1ZN9A 3BBPA 5BV1A 3RU2A 4PPYA 1T8WA 4G67A 5DNVA 1I0LA 5A2GA 1ZEMA 1UMCB 3EARA 3KXIA 4A92A 1PFYA 1D6SA 3MJDA 2RAVA 3IBSA 2DHDA 4I99A 3UAZA 3HZOA 4E7OA 1WHTA 1BS1A 3FPJA 3PJGA 1D0SA 1JKJB 1O8CA 2IU3A 3PNVA 4IGAA 4RC9A 3B5EA 4WCDA 5DTEA 2HY7A 2WU0A 2NTNA 1E7MA 3I1FA 3PVCA 5KJFA 4RADA 2M6SA 4W82A 1MRNA 1BW9B 2X86A 3WLRA 4YJ2A 3FOAA 2DSTA 1KY4A 2X9LA 4NENA 4U3JA 5CHEA 4EB0A 4DRXA 2P4UA 2DETA 3A2MA 3BFXA 1MB4A 1TMGE 1CV2A 1C80A 2JFFA 3NHWA 5JI2E 4WWHA 2O8FB 5JWRA 3SFTA 4QDJA 3Q87B 4KVFA 1AKQA 4YV0A 4OQMA 1QORA 1UOQA 2FB9A 1JDVA 2X23A 2ZB4A 2ASEA 3MWDA 4BLPA 4ZOEA 3LX8A 5CFRA 5L40A 2F8TA 2P3OA 4NFYA 2NV2B 4AP9A 1WXHA 3ZTWA 4IDPA 1ZBDA 1FTWA 1TF5A 2FRDC 3EQZA 3TECE 1BA2A 2NT3A 1DEXA 5TF4A 3LV8A 3H7IA 1ID8A 4OQEA 1YHYA 1T91A 2ETXA 2WSLA 3QHPA 1JEYB 4AJOA 5GV7A 5IKPA 1I1NA 4UD6A 9ATCA 3KSBC 3HXKA 3UO8B 5LQMA 1IBMB 4J1TC 4JFAA 3AL2A 3E1GA 1SD2A 1W75A 1HTBA 4B3SB 4AM8A 3AESA 1U4NA 5JBQA 3JU3A 3EVAA 2O2IA 1ZITA 2RC6A 3T95A 4B43A 4DJTA 3NHPA 3PEVA 5KB3A 2JKYA 4DCUA 2BFDA 3FGOA 3CIFA 2FWBA 1WPXA 4KGXA 3OOWA 4KL8S 5F1OA 2BFOA 3T5TA 1EWVA 5ALWA 1W2WB 1GV1A 1Z88A 2CMGA 4INAA 5MDHA 5DCYA 5AKLA 4FWTA 1WKCA 2CF5A 3AR5A 1K7SN 2V0GA 3PJDA 2Q6VA 5TS3A 4JVNA 1GADO 3E4DA 4MB0A 5EG5A 4Z6KA 1HC7A 5HIJA 3IVXA 3NKVA 4MJLA 1TRHA 4ER6A 1MIOA 3H3XA 1D5CA 1JI3A 1G3UA 1KERA 1B93A 3IDQA 3P1JA 3STVA 3ES9A 1HDYA 5EMMA 4U7DA 2OQ2A 5HOEA 5K3SA 2CNDA 1P19A 4KIGA 5CJPA 3CUYA 4DCJA 4XDHA 5LLTA 2WSMA 4O4LF 4KVGA 4CEHA 2I0FA 3DLBA 1E3QA 4BFTA 5EZ5A 1FYXA 4CDNA 2C00A 3KB2A 3FSEA 2HPVA 4YRTA 2Z2IA 2H17A 3SZGA 2D8AA 3FVRA 5K20A 3R6LA 4P4UA 1W85B 1QIJA 1FJGB 2PRJA 1C2YA 4NS4A 4WZ6A 1Z5GA 3UMVA 5LVAA 4B6EA 1K5HA 2WUDA 4CYMA 1U0NA 4QU0A 2YV3A 3NGXA 3TDNA 2Z9DA 3PE4A 5ECDA 1OXXK 1RXSA 2CLLB 2FFJA 2GPAA 1ENZA 2IPAB 2YRFA 4GQAA 1Z4PX 4G1CA 5EPOA 5I8ZA 1RSZA 3RARA 4M1MA 4NR0A 5DI3B 1AKNA 3NM5A 2JH9A 4OI2A 3JW8A 5K0EA 4CM4B 4Z49A 5CB0A 2ERXA 2HH9A 2WF5A 4JUAA 3K09A 1PR9A 3ZCQA 3IEXA 2VZ9A 2IE8A 4YCBA 3DP7A 3WWCA 2ZAIA 4KR9A 2XECA 1TGYA 2VVTA 4LDAA 1KARA 3JQFA 3GRRA 4IFTA 4MYTA 1WUKS 4F56A 4HGNA 1DBWA 3BCUA 4NZOA 2W7TA 3BDVA 5FQOA 4IH4A 3WYNA 1RHJA 3BWXA 3ODPA 5T4HA 3TL6A 2ATVA 4XM0A 4HZUA 2TS1A 2V7QA 5COAA 3UC9A 2JBHA 3VPFA 1LWOA 1JHVA 1K4MA 1MC1A 5EXSA 1ZZGA 5TJHA 4RUKA 2R6FA 3CLSC 3LUBA 3ZWMA 4A2QA 4YLGA 1RLTA 4U5XA 4AN1A 3W2GA 3W7BA 4EYGA 4I81A 4BP1A 2WMOB 4G0OA 4EA8A 1VG0B 3HL4A 4H15A 4RTNA 4E2WA 4RTPA 3P7MA 1JT9A 3Q40A 4M22A 1ZWKA 1IVSA 3VSEA 5T4BA 3AUYA 1AX9A 3IVRA 3I52A 4L8YA 2CVPA 2YJ4A 1PR1A 5B53A 3AEUA 3CVWA 4LJYA 3T5AA 3RC9A 1FQKA 4TYYA 1ACLA 4HDNB 4DXDA 2FZGA 4JXJA 2E4YA 4B46A 5DHTA 1L0BA 2O0KA 2JIBA 4AXBA 3V6LA 3JZFA 1SXQA 4NYMQ 2BE9A 4CQLB 1DJOA 4M1QA 1Z34A 1ISGA 3AZQA 1JXMA 4HUQB 4EKYA 4G25A 2V58A 5HKKD 3CEJA 5ALVA 3DKKA 4ESEA 4ARZA 1UZMA 3ROMA 1JGTA 2RAPA 2EYQA 5JV5A 4ONEA 4OK6A 5KJ6A 1IVNA 4MV3A 5CFQA 3DDSA 4D3SA 1GVNB 1W581 2VP2A 3FNGA 2G5TA 4Z9FA 3VVMA 3WV4A 5DYYA 1XRPA 1ZJYA 4UQOA 5FUBA 4XCVA 2CSXA 5CFMA 4WZZA 4D56A 4MQ4A 5LP1A 3C15C 4C4RA 4EG6A 3BD9A 3GO4A 2ONCA 3A3NA 3B53X 1EDOA 2FX2A 4CLRB 3HYNA 3ZLJA 2V98A 1DLJA 2QW1A 4U2CA 3K09C 2R0QC 1N3LA 1YMUA 3GQBA 1G4UR 3ZTYA 4HLNA 1H1LB 4HD8A 4G0VA 1OI2A 2P0AA 4ZYXA 3T5DA 1N5RA 1GCOA 1Y1PA 4YP1A 3TW8A 5A06A 4W5QA 4OJQA 2WJYA 2GBFA 3L6UA 5AKZA 1SZCA 3EMVA 2W4QA 3ISJA 3JQFC 2WIDA 3JR3A 5E6SA 3PC7A 4CMAA 3LTEA 1IUPA 1EGHA 4HAZA 2YCBA 5DM60 4CF7A 4L4RA 1JR2A 1X80B 4DV4B 3TLAA 2E55A 2CLOB 4PV7A 2V7UA 4CCYA 2YIMA 3INNA 3SQDA 1MN6A 1AK1A 2PGDA 2V7EA 2YQ4A 1P91A 7MHTA 3PXAA 5IWCA 4I08A 2C1EA 2D8MA 4ZV7A 3WP1B 2ZBVA 1RPZA 2E18A 4LJ7A 1T6NA 4MSUA 2OUIA 2FRXA 3EW7A 4MYCA 5JMTA 2IF2A 2PVSA 1KFCB 2CLEB 1IY9A 1M9NA 2P5UA 2PQ2A 1QU3A 2CKDA 4M2LA 4P58A 3KT0A 4PVDA 4X44A 1GITA 1KF0A 5DDIP 3M6WA 3ZW7A 4EVQA 3PTAA 2EL9A 3BGDA 4L85A 1M2OA 5TPWB 1GPDG 1HYQA 1L5YA 4XD7A 4ER7A 5FOQA 3LVQE 2FZKA 5K6AA 1LS1A 5LUBA 4K05A 2JB9A 4S1OA 3GYGA 2Z6VA 2LCQA 5FO0A 2ONZA 4M1KA 3KD2A 4R2LA 1HPLA 2B4KA 3RUIA 3WL6A 3BN3A 1YR7A 1VOTA 3SR0A 1SH7A 5BUCA 5DNYB 1E59A 1CQWA 4YRPA 2G06A 3SQXA 1H2HA 2ILTA 1Z4QA 3GLKA 3NW9A 2BLNA 1RBYA 3TX6A 5F35A 1ZOPA 4ILKA 2WNSA 3ROTA 1LJLA 1H6DA 3BXFA 2XEXA 2OCIA 2Y71A 2R1TA 3PKJA 3SQLA 1GQSA 3Q98A 3PX2A 1VMAA 1M8KA 3W5VA 3MRTA 1E6LA 3PPYA 1CQPA 2REQA 4L6CA 2H5IA 4LI3X 3CX8A 4DIEA 1NG1A 1AUXA 2GJ8A 2G9VA 3BKXA 3LBIA 5JS1A 1KEWA 2XKAA 3K2QA 2OXEA 4IXDA 4FDVA 1F06A 4MR9B 3GEEA 3RKRA 3TM4A 2HK8A 1IY8A 1T4CB 2Y92A 2BMDA 5GQSA 2HA4A 2IOFK 2RHGB 3GG9A 4CQMD 3BCSA 4BIIA 1VJ5A 3RDPA 1ZJZA 1M6VB 4JMPA 1R6AA 5IKOA 3UMCA 4BVFA 2R8YA 3U4QA 3MWJA 3OT1A 5JISA 4LV6A 1D2HA 4BP8A 4D9NA 3H3FA 4G5HA 2HDHA 1W36C 1TT5A 4WXPA 3U0VA 1PG2A 3GLGE 2JLWA 1JW9B 4IQGA 4D9FA 2QVGA 3C8DA 3F5DA 4P4SB 1NUQA 3EG9A 4RAQA 4RCZA 5KQMA 2WTUA 1P2FA 3ERCA 3INRA 4MIKA 2GN6A 1ULBA 3IAXA 3IHWA 4LJ8A 2CJYA 1OLOA 1UBUS 2RHDA 2WNHA 3HL0A 2Z09A 1ZOIA 1KDYA 1WV0A 3LXRA 1JJBA 3MM4A 2JLBA 3QVGB 1UAAA 1YZFA 1CHDA 1GCIA 3LPNA 1QF9A 1S7GA 1T5DX 5K6AC 1JDBC 5K51A 4AK9A 4ZYTA 1V95A 2FKAA 3VVCA 1QS0A 2FQQA 3C74A 4LRTB 4YHBA 1RLUA 5EERA 3ZX5A 2VZ0A 3GLIB 1KDVA 2N0SA 2Q1TA 1AQNA 2XRFA 3LNCA 1ZHFA 2PU7A 1EVZA 3AY6A 3UHAA 4KO8A 3WLKX 1B6TA 2Q21A 1JWBB 2ACWA 4B79A 4PS1A 3S5JA 1OLXB 2ZJ0A 1TYBE 1RAAA 3HKDA 1MAAA 2AUNA 2VQ6A 4M37A 3UAVA 1E7WA 5FPYA 4EZIA 1QK3A 5JVDF 3ZXXA 1NYLA 1KI3A 1ZW1A 2C2OA 1JSRA 3ZKWB 4WDRA 4D79A 4EY4A 1CY1A 2XQJA 1NU6A 1RPTA 2AOWA 2N3ZA 2QT0A 3JQ9A 3SU8A 4BV2A 2FAXA 4DFDA 4MRAA 5DOVA 4MQLA 3N1UA 1G8PA 1ZD9A 2C5EA 4HK4A 5GM2A 4QUAA 5HQ3A 2IS6A 3K2BA 2C9OA 4IHKA 1PGNA 3AVQA 4X54A 5T8KA 3WL5A 1YRWA 3OJLA 1JLMA 4ZAGA 2I2AA 3MJSA 1RW4A 3OPYA 3SYMA 1CZHA 4L5YA 1ZXXA 3ETDA 1TM5E 4WBSA 3RF7A 3UGQA 5D00A 4EOGA 4MV5A 4M54A 4EI9A 1AMNA 3AFHA 3PFNA 1XAGA 2AG6A 1DAOA 1FYDA 3FPEA 1U1CA 1U11A 1RQXA 2QUZA 2Z8XA 1Q2UA 3ETCA 3OZUA 3G0OA 3S2ZA 5LPNA 2WSSD 3GCXA 4EDFA 2B35A 3CF4G 3EB9A 1ZCFA 1QTIA 2H85A 3R3YA 2YFKA 1B41A 2PAAA 3B2NA 4BAUA 4D82A 2ZKLA 4GLLA 2IDMA 2QPLA 3F67A 2YHSA 5KWJA 1P2VA 1QYXA 3KC2A 2BM1A 2VRNA 2QE6A 5B37A 4D6XA 3L8YA 4IDQA 4PFJA 2OYRA 2PUBA 3PNLA 3LHIA 3WA6A 1Y7PA 2P9ZA 2X0DA 2B94A 1H8HA 1GSAA 1RE1A 2NQ2C 5ECGC 5EE3A 5KHOC 1ZR2A 1F14A 3D8NA 3RIEA 1CY6A 3RTBA 4YUYA 2I4OA 4B73A 3RG2A 1COWA 2FGJA 1T9CA 2I2XB 2BRUA 1Q0SA 2JLAA 2OQIA 4QUEA 3PGJA 2UXBB 2AI1A 5F5LA 2Y1LA 2EKDA 2WD7B 3EZ9A 5FUMA 3ADCA 1A8PA 5FKJA 2XB6A 4LXUA 1KZGB 3WGYA 3ICOA 4C43A 1FS5A 3KK0A 3I5YA 3OM0A 2PT5A 1O6CA 4AF7A 3DO5A 1TB4A 1JG2A 4ZVNA 1YA8A 3SHWA 2C4HA 1Q5PA 3CSDA 5BYKA 1UJ6A 3Q2KA 3CPJB 2RHHA 4GX2A 2EHDA 1UDRA 3JQ9C 5DO9A 4HZGA 4YIKA 3PUZA 1A2KC 1DSSG 5HCIA 3RD5A 5K8UA 2GEBA 3MUNA 3UTCA 4OSOA 1THGA 3G59A 3E2MA 3GP5A 2WOOA 3G8YA 3K15A 5DASA 3MGCA 3RE1A 4QGGA 5AESA 5F1KA 2PR2A 3DOHA 1VCIA 4LTMA 3Q7IA 5T8KC 3WHPA 1EGMB 3WWZA 2R6HA 4TTTS 4DLPA 3DEFA 5A3QA 3LRXA 3DZ8A 1DFGA 5JOQA 1X1RA 5FXMA 1P33A 3KDPA 3B60A 4AICA 4QT0A 3AR3A 2B2NA 4F0JA 4OG2A 3SLRA 3GLFA 2EG9A 1SOVA 1DV2A 1JLHA 1TZMA 3MMXA 4IZIA 4LKRA 9LDBA 2HA0A 1X1CA 2VZEA 2NZUG 3KL4A 1V8ZA 3HCRA 3NONA 4J7UA 1NSFA 4KZKA 1Q57A 4RIEA 3MBOA 1OFUA 4GMHA 2PFKA 3F5MA 3NVAA 4XM2A 3CX4A 3RG8A 4C7BA 4CLOA 1G2PA 1N7GA 1XP8A 2YXNA 4FW8A 1DIHA 3A28A 5E0KB 4AY6A 5KPDA 3BHNA 2B2CA 3IPXA 3JQGB 4PM4A 1J00A 3RU3A 3AYZB 5CD1A 2IH4A 3CR7A 4IDHA 5SYMA 4Y2PA 1PLKA 4DCPA 3ABOB 5LQAA 2Q99A 3SFZA 4IBOA 2NACA 3GFVA 4I1RA 3H5NA 5IMBA 1QYVA 4G4IA 2ZYIA 3MCZA 4IG4A 4HGQA 2EWVA 3P0HA 1IZYA 2F9FA 2VJMB 3G17A 4KYTA 2BRUC 4WLNA 1XRMA 4EFDA 2XNKA 4AY2A 4F1JA 2YDXA 1VSUA 2ZTSA 3H9BA 3LY7A 3A1NA 1NVTA 4BKUA 1KAHA 5FA8A 5IXSA 2PJUA 1NONA 4LNUB 1K0FA 4PNEA 4PY2A 1V7ZA 4FIDA 4LC1A 5K3DA 2EWMA 4EI7A 4AMVA 5KOHA 1CF4A 1BVUA 4K6CA 1TOAA 4F9GA 1Z3IX 4A2PA 4D96A 2HJGA 4G0UA 1HGXA 2XA1A 4A03A 1Y8RA 5AW3A 5JYEA 2XMGA 1L7VC 1X7WA 1ZH8A 3CKYA 1TUBB 1H8EA 4YAGA 4YDHB 3O47A 1JDPA 1N2CA 3BULA 1KZHA 3HVJA 2RB5A 4ECEA 4UTNA 5L3QB 1CEYA 2LW7A 1Y1KE 2JVJA 1J2JA 2OD7A 1TVKA 4IVRA 1T9AA 4C3ZA 5LU9A 3L8DA 1CZUA 1PSDA 1W30A 2JI4A 1L1RA 2JZOA 2O05A 4JLMA 4LBZA 4M86A 4R7ZA 4TWJA 2YS6A 5F7ZA 2CXQA 3BZWA 3UK7A 3VOAA 4X8HA 5CLLA 5EY5B 2GLUA 2B5VA 3K5HA 2WT4A 3GXBA 4AY3A 4E13A 4B3FX 3EH1A 4CKCA 3HO8A 2B92A 3QTLA 4JQSA 4XAQA 3N0VA 3OZXA 2QN7A 4IIJF 3VUFA 4FJ0A 4MCHA 2NXCA 1VDMA 4C04A 4YCCA 4IVQA 5JDCA 3S81A 3FH0A 3EHEA 3GGDA 4WKOA 1Y48E 2GESA 3NLLA 3WKDA 4BQRA 5EUMA 3LLCA 2QP3A 1CB7A 1IG3A 1WXIA 4CDMA 1KGDA 1NBAA 2W6ID 2RDMA 3R44A 1C30B 4GF5A 4WZAB 5FWXA 3GVIA 3T38A 3WLSA 3SMQA 3IPAA 5KS2A 4OKIA 1CLEA 3PA6A 1JFSA 5EHXA 4DAOA 3D4LA 5LDHA 3NM4A 2VHJA 1U99A 3E7WA 4E21A 3LY5A 3K9BA 3AO0B 5L8VA 4GMKA 5BPHA 3LU1A 3BTSA 3ZE8A 1TC2A 2ANCA 1C1YA 4KQ9A 3BEDA 4Y18A 3GGPA 1E98A 4FNMA 4DQLA 5JCOA 4A5SA 1BGVA 1Q0UA 1SIOA 2IZ7A 2QWXA 2W9XA 3SC2A 1V1RB 2HRZA 4ZYLA 4HH3C 1YOVA 2UYQA 4P0QB 3A05A 4B3TB 1VYHA 2H48A 4G1UC 1K6XA 1YTLA 3IEIA 2DH6A 4PC6A 2O7RA 4EPVA 2COKA 4QM6A 4KU4A 3SIXA 2W93A 3GRAA 2PYZA 1JIQA 1N1DA 3D3QA 4W5WA 2RE8A 3MPOA 1KZ9A 3ASUA 3WGZA 5D87A 3TZQA 2OFWA 1U7PA 2ZB8A 3E81A 4RS4A 4UHCA 4EF4A 1AQ6A 3BD6A 5FQNA 4B3GA 1PWZA 1WVIA 4IQ0A 2MSCB 3RC1A 3I04A 3U61B 2E3JA 5ARBA 3UMBA 4M8IA 4ESHA 2JJ8A 3R7AA 3RTEA 3OH8A 2C7RA 1BRMA 1FSSA 2VDMB 2W6NA 3DKVA 4ZVKA 1NUAA 4DDWA 2G1UA 4X3PA 2EHJA 5B3JA 2AYYA 4IAOA 2Q5OA 3BA6A 3NXSA 5H70A 5JSKA 7MDHA 3N70A 5CRIA 3AI3A 3TR6A 3V5NA 4B9AA 4CR6A 3MYYA 5LP6B 3T61A 1PBNA 4D41A 3OQ1A 2QTGA 3NOVA 4LMRA 3FYSA 3GCDA 2BH2A 4W7IA 3TLJA 1KEPA 5JDCC 2PZLA 5BQFA 1W73A 4HDRA 4NCAA 1ZH6A 2JEYA 1TO1E 1GQRA 5HIIA 2JFNA 3EZLA 4ASUA 1GO2A 3SKVA 4EZEA 5K09A 3I6IA 4G9BA 4HYEA 2J87A 2AH5A 3LYAA 4QL3A 3CZMA 2QW0X 1KH2A 3A3KA 1PHPA 3I58A 2Q0QA 2WAMA 4BASA 4RSRA 4UCQA 5IKXA 2NZ2A 3KQVA 1U31A 3PGLA 3PFWO 4MQUA 4CN9A 2OGSA 3IMCA 4FR2A 4DLNA 3H5OA 1AUOA 3MNFA 1ABBA 1KC3A 2HRQA 2W43A 2WJGA 3MD9A 4TLLB 1JMVA 1T3TA 2Z0MA 2P6PA 3MAJA 5IVIA 1TLFA 3ON5A 1II8A 1NX9A 3JAKB 2ECOA 4HNAB 4NCKA 1VLLA 4B81A 1GT91 1R4NA 5JCOC 4US1R 2OZEA 4Z4IA 3LBYA 5E6RB 4UEJA 3MB8A 4DABA 2YJTD 3L1VA 4NAHA 3F98A 3QPDA 3T1YB 2X8WA 2YUIA 2ZTVA 5BWLA 3N5KA 1MJGA 5DCUA 4YCNA 3ICEA 5C7YA 3LJKA 2YMLA 6Q21A 5FI5A 1QPZA 3FPCA 1U8EA 2JCSA 3GNTA 2OV3A 1ZS9A 4ILEA 4IUYA 3OIVA 3GG2A 4OXRA 1E1DA 4QEKA 3OCJA 2FW6A 2Y67A 2FMFA 2ZLBA 1VRWA 2W5UA 3AF3A 3VKVA 3HV0A 2UDPA 5F7XA 4L27A 2O0JA 1QR6A 1V2GA 3I0ZA 1F6BA 4LYJA 4OEHA 4EB3A 2YYSA 4YPOA 4URZR 3TAUA 4PZEA 3VAZA 3AY3A 1LEHA 2OHIA 3DLIA 1CVIA 2XE8A 3B8EA 3I9MA 1A9RA 1J0CA 3NATA 2V8OA 4LYHA 4KIWA 4X1KB 3VYVA 5B3JC 4IJ5A 1E89A 3TW4A 4V1CB 1VE1A 3IO3A 1SXJD 5CXSA 5DBHX 5AK5A 1DIRA 2AMVA 5LM3A 1J9GA 3I04M 4NQZA 3S8EA 4ZAXA 1ADBA 2GD6A 3S1AB 1RP7A 4ZOBA 3SVZA 4WKPA 3WY9A 1YVEI 3WRXA 2QQGA 3R75A 1GPAA 5DX0A 4AX8A 1VLVA 1N2HA 1Z8DA 2OO3A 3N3AC 4LBWA 5FWNA 4UJ3A 4QOJA 2E0IA 4FE7A 5HKKA 2BAGA 3G7NA 4AYTA 3AF4A 3FLBA 3F2VA 4RY2A 5F12A 4P08A 4BVGA 2MSKA 3GPLA 1AY0A 5E1BA 3AEKB 4L3VA 2ZUWA 1Q0RA 1YS9A 3ILSA 3MT0A 1SR8A 2Q0XA 3OJEA 4DG8A 4MUXA 3SR4A 2VDVE 3RGGA 5JH7F 1B3RA 1G17A 3VHRA 5BOSA 4W6ZA 3RU9A 1DHRA 1R0SA 2D4AA 4ZZ2A 2ORIA 1EU1A 1HDCA 2PVPA 3QYAA 4Y2XA 3L7IA 2ORED 4H3VA 3W6NA 5JANA 2XB9A 3HUUA 1DPGA 5K0TA 5JS6A 2TMGA 1OLSA 4NMLA 3L41A 3UXEA 2W8BB 4KXWA 4YUZA 1XJWA 4CF3A 2C8KA 1QP8A 2OKCA 2AKYA 1TQ8A 1VTKA 1UKCA 1C3XA 2ZJBA 4FFNA 1G6Q1 2M6RA 5HFAA 5HIMA 4BNXA 2H1OA 3PUKA 4C3UA 3TIGA 1IN4A 2O2YA 5ER6A 3LPMA 1N5DA 1GRVA 1NVFA 4KQXA 3A9CA 4HWRA 3DVAA 1CD5A 3GUZA 4Y9UA 3AOGA 4N6NA 3W1VA 1GPUA 1KFKB 4M0KA 2J5BA 2AEFA 3ZI4A 2GBIA 3I4FA 3VYTB 4NLLA 3NDBB 2HW8A 3RSFA 2JGLA 4AKSA 2J41A 2P7IA 2W6JA 5KCZA 4G2NA 5AKEA 5FEMA 3WLJA 3HR8A 4JH0A 2XUPA 2G7ZA 4JJGA 2TSYB 2NSLA 3LUKA 4EQ6A 4MWSA 2HWWA 3EVFA 3W0LB 3DLPX 1QFMA 2J3HA 3KTDA 2LIVA 3TL3A 4H59A 2FDCA 1BGXT 3ZGOA 1ZCJA 1YNSA 4DDVA 2D0DA 3IP5A 4KBFA 2JRCA 1KY2A 1PJ2A 3LUGA 1AQUA 3WFZA 1D2GA 3WIBA 4A10A 4B6QA 2XWQA 3OIYA 1U0JA 4WA7A 1ZESA 4Z9XA 3WRXC 4I3HA 2DQSA 4IRMA 3DXYA 3KSMA 4G24A 4XM1A 3UHFA 3H97A 3IVMA 4J3FA 5TDHA 1USWA 2I7XA 4C1BA 5DTQA 2O0LA 1DX6A 2OCGA 1AUPA 1L5OA 3D1LA 5E4FA 2RJOA 2HIAA 3G7SA 3ZHYA 3NTQA 3CNBA 3R40A 2ZR9A 3GNLA 3KU4A 2QPAA 3EK2A 5DU2A 3MG9A 1W5TA 4PCAA 5EEHA 4DCGA 2BUCA 3P4XA 3QJ5A 2Q7OE 2V3VA 4NFSA 2FPIB 3E6AA 3CT4A 2I6FA 4EPYA 1Y4UA 3ENNA 3FYUB 1T35A 4ROSA 4B6PA 4FZJA 3ILVA 1A98A 4U2FA 1G98A 1T9DA 2WPDD 1PIWA 4LXQA 3MGGA 3DF9A 1ORHA 3FVVA 3FMOB 1T2UA 1FOEB 1XTRA 2ET6A 1BZYA 4LVOA 1VPDA 1JX6A 1QHGA 2HRCA 4PAOA 3K1AA 3PFGA 4XB2A 5IZCA 3TYXA 1M67A 2AFVA 4C4ZA 1ZFNA 4QFBA 2GJ9A 3R0XA 3KQPA 1SUFA 3GGCA 3CX3A 4ZO4A 3ADDA 3GFGA 4J7AA 4QBGB 3UB4A 2AT1A 3V4ZA 3ZEIA 1XF9A 4N01A 5AM3A 1IY2A 1HYBA 5CCDA 2QU8A 2R8ZA 2PNJA 1AKWA 3EN0A 3H6GA 2NUTB 1JYEA 2PZ8A 3ZR4B 2RHMA 1WNFA 3CVXA 2SECE 4QPZA 1F6WA 1Z6XA 4PCUA 1DTWB 4F4UA 3K8OE 2H5JA 3C1AA 1SVWA 4CJXA 2XTNA 1E5DA 3DLAA 1RAEA 3JWGA 5H7XA 5G0SA 3LXXA 1DXHA 1E61A 5CJJA 3NDRA 3A6ZA 3R3ZA 5HRUA 4EJSA 1L5HA 4KPYA 2P0YA 3U09A 2P4QA 4BMSA 1CRWG 2ZB2A 3IULA 3KZMA 2JANA 3ABZA 5LDGA 1Y34E 3FMGA 1VPLA 4Q4JB 4TX1A 1U90A 4V0NA 1PQUA 4C3VA 4Z4HA 2HV9A 3EXFA 3GNQA 3FKQA 1R6VA 2VLIA 4EX7A 4TTJA 2ZJAA 2A0UA 3EFHA 3IEKA 3KEOA 3NAMA 4P3OA 1GUFA 3W3ZB 4CGZA 4GQIA 4JU8A 2OV6A 3F5QA 4GOKA 2Z58A 4GT1A 4J76A 3S8YA 5C7IO 1YFJA 3FHTA 2CVQA 2V7TA 1JXOA 1ONBA 5DB4A 2PLAA 4IM7A 1BCSA 4W1PA 3CUSA 2BZGA 2WD9A 3SIWA 3VO8A 3FE2A 1YE8A 2PMDA 3HRKA 1CY8A 4FYJA 3VC1A 4JXZA 3A3OA 3DM5A 3LGSA 4B6SA 5CA0B 3CQ9A 3FWYA 4X1YB 2P4EA 3QVWA 2AE2A 1T5TA 5LZ2A 3WLEA 5BN3B 3A7DA 3V2UA 2N1MA 1AKYA 2G36A 2OD2A 2IY9A 4JLDA 4BO2A 4GX0A 1XHFA 2PT7A 3DAYA 3EVDA 2QYTA 1AGRA 3MTBA 5IZCC 2NW6A 3GH1A 1WV1A 1RLOA 2BFNA 4XKJA 1ZUHA 4DBLE 1GDTA 3LRTA 2W98A 1TECE 1YZTA 4KQGA 3RNLA 5DFAA 3CEMA 2PCLA 4JBWA 3MTQA 3AVOA 2AJDA 2FZEA 1QH9A 4GZ6A 5H68A 1ABFA 3RWMB 2X3UA 5KNDA 2BHTA 4P2BA 4CM6A 4K6HA 2ICAA 3F1KA 3JARA 3N6RA 4TM8A 2E48A 2H7CA 1YQUA 1DIAA 2PUAA 4Q1CA 2NZJA 3RYIB 3EY4A 5CVUA 4X5OA 1UUFA 5L3ZA 3DZHA 1YU6A 2I6QA 2IW1A 2FQXA 3CUTA 3PQDA 2FVYA 4HH4A 5BV2P 3L7YA 1F2TB 1YTUA 4EJSC 3DDHA 2DF8A 2ZK7A 3AM5A 1W5SA 4HZUB 4UMDA 3PQFA 1C4OA 2ZUBA 1FNMA 2JJ2A 3HA2A 1SIWA 3RFCA 4EZBA 1W25A 3A2LA 3W78A 1DC5A 2ODBA 4YAIA 1BU8A 2Q46A 2PKEA 3F7NA 4KACA 3GEHA 3PBKA 2B99A 1MO4A 2WM8A 3LLMA 2OBXA 1CK4A 4HR7A 3R7NA 1E3JA 3WNVA 3HYSA 3R5SA 1WZEA 3LH5A 1XWWA 5F3WB 3DPUA 4RTLA 3GRCA 5EHZA 1VPTA 4FGZA 3TTVA 2D4HA 3DOEA 3TOCA 4M1YA 3DZDA 1IIRA 1ZVKA 4J43A 5A04A 3S7ZA 5BQ5A 1XTKA 4O1IA 2Q9AA 3IQZA 3SGLA 1YKSA 1P1HA 2EKPA 1NTRA 5K3BA 1OLUB 4HX9A 4RKQA 4KR3A 1QFSA 1VI5A 4B80A 3BMNB 1GM5A 3C4VA 1QFZA 3VR5A 1A7KA 1NUTA 3EXEA 3FUWA 3G68A 3ZDZB 3TQOA 2PGJA 1MC4A 2JI6A 2WVGA 5DT9A 1JLLA 5F5XA 3T9DA 3TQSA 4Y9TA 5IJ9A 4YUXA 3GAMA 4FOPA 3VPDA 1PJQA 1SM4A 3IP6A 4HFRA 3WRVA 3HCDA 2C07A 1LDEA 1WB6A 2AK3A 4B4VA 3QXXA 1YDGA 1AZLA 1S8OA 2JDID 2OHXA 4MO9A 2WIJA 4G5OA 4OQPA 1O7JA 4HFMA 4XVHA 1PGJA 1DC4A 3FJ1A 1Z5UA 2B4AA 2CFSA 2JI9A 1E3DA 2WYOA 2X9GA 3QLJA 4MUBA 1GL3A 5TT0A 3MJ4A 3TNLA 3DLHA 5CA1A 4Y7DA 1J22A 2E6UX 1AHHA 2PX4A 4QGSA 5IK2D 4ZJUA 1Z4KA 1YR3A 3AG6A 4NY1A 1I3NA 2GHRA 3F3MA 1GPH1 1L4HA 2J32A 2G8LA 2P9EA 4XASA 3KVOA 3LCJA 4UQLA 4M0MA 3RFTA 3KVYA 4NU6A 1C8BA 1W7AA 1N9KA 1Y80A 5FHQA 5CNMA 5G0TA 1UWLA 5FA5A 3OP4A 1TW3A 5E6SB 2DPGA 1LX7A 3G13A 3L04A 5LU8A 5F52A 2GF2A 4RK4A 3RS9A 3GLIE 3AVXA 5LQUA 2FZWA 3S5UA 1XDZA 5CT6A 1TTPB 4WJZA 1MG0A 3EISA 2NGRA 3PXUA 1B43A 2TECE 4CCYB 1YK1A 2G76A 2O4CA 3LDAA 5CVJA 5BNIA 1YT5A 3OZGA 5DGDA 4X63A 1SC9A 3WYAA 1IXRC 2QZZA 4XDZA 3TLCA 1W36B 5J2TF 5DMHA 4KLCA 3N2ZB 1XEWX 2WWTA 3Q88A 3CUUA 4KVAA 5GP1A 4HPJB 2YH2A 1AHNA 1EGAA 1EHYA 2ZUFA 1X7XB 1KYQA 4DMRA 3X2FA 1VFNA 3GBSA 4EKGA 3ND9A 3LQYA 3Q8LA 2OB1A 4G41A 3ZWXA 4CKXA 1EH5A 4P9NA 5EMHA 1NM5A 4HB0A 1ZC4A 2NAFA 2V6MA 2ZRAA 1QC5B 2IU4A 3GDHA 5ABPA 4OB8A 6ADHA 2J9YB 2TMDA 1JDBB 5K0LA 2P6NA 2V03A 1RYYA 2XVXA 3ZY3A 3TQQA 3B5JA 3O9ZA 4ARUA 2PIDA 1WUYA 2CL6X 4YBRA 4LJSA 3KZVA 1L3IA 2I7DA 2XQFA 5E9QA 4Z4CA 4IIEA 1VA5A 3ZQ4A 4GMFA 4CU5A 4DWOA 1K2VN 1VB5A 1XLWA 1B8UA 3CXRA 1PR3A 3JQ8B 1TT7A 3KKOA 3QELA 3NV9A 4EHDA 2ZS8A 4Q1FA 5GY7A 6REQB 4D4KA 4QX6A 4RL4A 4OP1A 1EVQA 2QJTA 1DG3A 4IUCS 5TMBA 1EUDA 3C4QA 4X93A 3AUSA 1ZVVA 5KYTA 4MVJI 4BATA 5JATA 4I4TF 5E4JA 4M38A 1PP4A 2R1TB 2W2OA 3I76A 1Q14A 1SVKA 3QEKA 4RPCA 3RUHA 1S0UA 3RKSA 1OKKD 4GEKA 2ODPA 5CB4A 4PNPA 3UJBA 3WYCA 1WULS 3F3YA 3AJ9A 2WICA 2NO6A 3AI7A 4FT2A 4UTZA 2C57A 1GKLA 4XPZA 3CRRA 4GYWA 3WQHA 4YV1A 4KXFB 1TIKA 4LXGA 3COSA 3LW7A 2WUEA 4LMAA 3BEOA 3LBNA 3VJMA 2FFBA 3DGEC 3EGCA 3E58A 3Q9NA 2QBYB 1AS0A 1JHMA 3QOXA 3D8UA 5FFNA 3IE2A 3U4QB 2WYIA 4LWZA 4EF6A 1ZVQA 3K53A 4GOOD 1LDNA 4IZOA 2ZJ4A 3QE0A 1I94B 1TT5B 1E96A 2JLYA 4CW7A 1JSXA 4MKXA 1N7JA 1DKLA 3AUAA 3UCXA 1MMFB 3N0TA 2IV2X 4F06A 3DV9A 2O3UA 1HNNA 2BSAA 4I9UA 5CCEA 5L7YA 1QTQA 5E2IA 1IDOA 1YVPA 2G1JA 3GA7A 1QX3A 4WLFA 1NM5C 3P94A 4DSAA 4OMUA 5IF9A 1E3TA 2JKVA 2CNOA 3KR1A 4QT4A 5I9BA 3I9V6 5EJ5A 5J58A 4GKKB 1LSOA 3AQIA 3AC0A 5DGHA 3W8FA 3EZYA 3FTNA 4CKBB 5ADWA 1C9DB 4JB2A 1G5HA 1GU0A 3OCWA 3WIOA 2IKSA 4R3UC 1R8SA 2OOSA 1V9SA 3DBVO 3Q4GA 3TOVA 2WJJA 3GHHA 1YQDA 2Z2JA 3JS5A 4GE0A 1K1EA 2QLMA 3OCUA 4YDQA 5FI1B 2DJ5A 3H2BA 4YMGA 1H2WA 4FQ7A 4I7EA 4JYMA 3BXGA 4FGWA 3ZIUA 2ACKA 5T6MA 3CN9A 1LNSA 2RGBA 4Y1RB 1T8SA 3V46A 4B09A 4IJQA 1A69A 1QOQB 4PHCA 5I7EA 3FOEC 1JQDA 3COZA 1CR0A 5CT9A 3THOA 1NRXA 3PQCA 3DWGA 4ZGWA 1MD9A 2YWEA 4NBWA 3PD1A 4HDSA 4BMPB 3OTOB 1NAHA 3S44A 1NY5A 1O9HA 2DUWA 3MGAA 5IBPA 4CIDA 2DUJA 2RG7A 3M9XA 4N5MA 4D3DA 5AVQA 5HQ3B 1EE9A 3M33A 3N2YA 1T6YA 1Z4OA 1X1EA 3UG6A 1G2IA 3B7GA 2PSJA 2ZVPX 4HAUA 4PFKA 3VUEA 3TNJA 4JGGA 3GPCA 5B1HA 5TT1A 5C5CA 2O6HA 4ZRDA 1U7ZA 2PL5A 3AOEA 3WGJA 1EVKA 3CBGA 3DW3X 2WG2A 2MT9A 1XYGA 3IKJA 1NQVA 3PQ5A 3R77A 4G23A 4Y6GB 3V00A 4NOMA 2A1TS 1CUHA 1S4MA 1NQWA 2H1HA 4IYRA 3R8XA 4G9EA 1EE1A 2ZE6A 1CNEA 5G4KB 2NT4A 3K9WA 2ZT6A 2W58A 4ERXA 1M1NA 3G9UA 5L9AA 5LQJA 4U9IS 1H9CA 1P4RA 2R8XA 2XBUA 3C3BA 4EHHA 1IZ0A 4Q48A 2OHVA 5U4XA 3DMTA 3UOWA 1LJUA 4G0NA 1CQZA 5HKOA 1QV6A 5CT4A 3LUFA 1OT3A 1JIUA 2V9CA 1U7TA 3BERA 4JQZA 3UFXA 2X8JA 3FZYA 2FK8A 3DSRA 1GGKA 4MI3A 1VJ1A 2E85A 3KUKA 1FRZA 3LP8A 4RJTA 1DS6A 3WJ7A 4ZIRA 1LW7A 2YV4A 1A8HA 1Q17A 3K5IA 4PWZA 1CUWA 4TWAA 3PDUA 5K0BA 1T2DA 2DXIA 2XADA 1Y6JA 4ND8A 2VHCA 2DAPA 3DNPA 4GPAA 4TMFA 1R15A 2KBEA 2OCBA 3U60B 4NYJQ 4CIXA 3LPLA 1ZJ6A 5KYUB 2NLOA 4WK6A 4DQXA 1BU5A 2UZIR 4DJFC 2HFJA 2VBCA 3D3EA 2AZMA 1XF1A 4IFBA 2QRUA 2G0TA 3H3JA 1C29B 2BFBB 4M7WA 3M2PA 1KBZA 5LYJF 7GPBA 5AVYA 4RH1A 3IODA 3LY8A 2XIQA 2X4DA 5ITZA 3BFVA 4WZAE 4TWZA 1Q16A 2AN5A 2FWRA 1DI0A 1JR3E 3KTAB 3I8OA 4RE6A 1B0ZA 1IDN1 2VYND 1O89A 4CUZA 1R6BX 2BBTA 4LW8A 2H1IA 1MG5A 4YFYA 3WJAA 2VJKA 5IABA 1E9AA 2CE2X 4FMCF 1YASA 1FBNA 2H3HA 1J20A 1YD7A 4DWVA 2VPYA 3OE1A 1E3IA 3AOEC 3MFYA 3NANA 3UV7A 4BU1A 4MW6A 3HBJA 3UT6A 3VJLA 2MYPA 1V16A 3NCHA 4M6WB 2POQX 3O94A 3GLFB 4ZI7F 3IA7A 1E1NA 4FJ1A 1KYWA 1IFXA 2ORVA 4QXRA 3S2SA 2DSNA 4MI6A 1K7XB 1SOUA 2FMKA 2ODAA 4YRMA 1ND5A 4WK4B 4Y2TA 3VX3A 1F7UA 3ZBQA 1WQ1R 4LZLA 5J4VA 2O5VA 4Z4GA 3OVMA 2W4MA 3QFRA 4BFZA 2JHPA 3WVNA 4K9QA 3QIAA 2P75A 1HMYA 1RYDA 4MYHA 3A1VA 3TK1A 2Z3WA 2Q50A 2NV6A 4EMUA 2XYQA 4ALKA 2Y1OA 1NNSA 2EW1A 3RS4A 1QQAA 4PX2A 1JEJA 4NABA 3BRQA 1D1SA 2NVBA 3FMPB 5KZMB 1W0CA 2VYVD 4POAA 1X70A 1P4JA 2ZJOA 3CURA 3DS8A 3RJZA 2F7SA 2VTEA 3UAGA 2J0QA 2JFYA 3CZRA 1I2CA 3H5LA 5F33A 1NYQA 5JQGA 3PGXA 5FULA 4N7RA 4IMIB 1X1DA 4OHZA 2DJIA 3AKYA 1Z9BA 5KAMA 3I8XA 1HFWA 3TCNA 4YMSA 4YMLA 1F9AA 1ZHHA 1A8IA 1VIAA 2HWYA 4AZ0A 1W9MA 2W11A 4YP9A 5ADVA 3DBHA 2B0JA 1TMYA 2BP7A 1Y4SA 3MUFA 3LFHA 2BEVB 2H7YA 2GFHA 3OI7A 4FHGA 1GNVA 3OCZA 3QUSA 4JJFA 1TLTA 2MINA 4MINA 1ULZA 3DTVA 3UA4A 4AG5A 4G86A 1WE2A 3IUNA 1FLAA 3AHCA 3QBTA 5EP1A 3E9YA 3AEQB 3VO2A 4Q9LA 1ML3A 4EMTA 3RRBA 1KK1A 3FTFA 4QM7A 2AHOA 1HSOA 3BMOA 1XMIA 5CK5A 2F6RA 4HV4A 1B8PA 2A0WA 1KQNA 4W1QA 4QTTB 3WLIA 4KITB 3K1JA 1T2CA 5FYQA 2H06A 1YCGA 3OX4A 4LYGA 4JB0A 3VQTA 1GARA 2J9RA 4LRYA 5C2JB 1TQDA 2GAIA 2DWCA 2HBYA 3BK7A 4MV1A 1YZUA 1JT2A 4CM9A 1X7ZB 4F6RA 4JUDX 1XYYA 1JEEA 4CKCB 4UU0A 2VXOA 4B4OA 2HIMA 1XVLA 3SYNA 1ZIPA 4CM5A 3NC0C 1TEZA 2VF4X 2WHQA 4A91A 5DE3A 3I2GA 2AOTA 3CVVA 4BB0A 1RYEA 1YDHA 3GZ4A 3TQIA 3JALB 1UBTS 4K46A 1RC1A 2QN3A 4DR3B 1RPNA 1X1SA 3KKPA 5JQWA 2WIBA 4LJKA 3FCYA 1ZL2A 4H18A 2ESRA 1SKAA 4I5GA 1P6XA 1ZAKA 2XGMA 5A02A 4PSUA 3SS9X 4QQKA 1VI6A 4AF6A 3E9QA 4DJDC 4U7PB 1KVSA 4M98A 4ZYUA 1EWQA 5EMJA 3VBEA 3Q3EA 1VBFA 3CTPA 4DSNA 2V4MA 3FIJA 4BQPA 4M7PA 1N8SA 5FTWA 1KYTA 2FPRA 3KYJB 3FKSD 3FRJA 2F3SA 2RONA 2OBBA 1GSIA 4OU5A 4BGEA 2PZAA 5CB6A 3W5SA 2RD2A 4EDHA 2UU9B 2IEGA 3FA2A 2DFLA 2YVUA 2GRUA 3ZJTA 4TS1A 1U5BA 3ZG6A 4C5AA 1YOVB 1CZKA 2WU4A 1RQLA 1U2ZA 1Z35A 1G3QA 1P2SA 1R5JA 1XK6A 2P41A 2PX6A 1ZM3A 2PWPA 3TEJA 2J6BA 2RGWA 3HH8A 1U0HC 2MR5A 2P2SA 3P0FA 4JIMA 4P83A 4Z1MD 1F2DA 3D5QA 3NTLA 2IIBA 1Y7LA 2O3SA 2EZ4A 1E79A 2AFRA 4GKAA 4RQBA 3W4KA 4BO7A 3FB4A 5A7FA 1YZGA 2TYSB 2ZATA 3IJ5A 2Z6UA 2H08A 1AS2A 3KQSA 3IAM1 3SHVA 5L7TA 5HQJA 4IIBA 5JJLA 1DEHA 3O7WA 1MO2A 3HBNA 1SQ0A 2Q1WA 3C6MA 5KQLA 3P9IA 3RUAA 3F2IA 4BNKA 2A9QA 1NULA 4W8GA 1OFUX 1ICIA 4DLUA 3DXFA 2ZSUA 4Q3OA 2FW0A 2C1XA 2ZCUA 3SOZA 3LOPA 2Z04A 1HURA 1K8YB 1QB7A 2QRZA 3F49S 2PCJA 3OM8A 3V7YA 5LIPA 1NMZA 2ZXFA 3CE9A 3IAFA 4O4IB 5D51S 4RSMA 5EXPA 1E1CB 2VDQB 3PHHA 3OJCA 4GIBA 4TGLA 2OPBA 2V0CA 4DDKA 3A26A 2F3QA 1SQGA 1NBHA 4O33A 4LRUA 3I01M 4E4RA 2EXXA 3ZY2A 4Z0NA 2ATIA 2X7XA 3WADA 2AMJA 3FTPA 3LDHA 5ELXA 2Q0HA 3SZRA 3DM9B 1JKIA 4DNFA 4UOZA 2HU7A 4EJ6A 1LFDB 1XZAA 3M4XA 1JHQA 1BTOA 5TNXA 4JWKA 3U6KA 1I5RA 5EQTA 3CNQS 3WRWA 5BMVA 1G16A 4GUDA 5ALGA 1SOMA 3VZQA 3T3GA 5LNK1 1VLQA 5K01A 1OYWA 3CVOA 2GPWA 3UPDA 1G3RA 1TJYA 1LTQA 5LA6F 4DMCA 3HWX1 2Y1CA 2MSDB 5DM2A 5GJBA 2W8ZA 2WZDA 3M82A 1N8NA 2R5FA 2HK7A 2VJLA 3AVTA 4B3MB 4CXMA 3NBYC 2Q1XA 1PUIA 3ZJUA 4C7JA 2HHLA 2BHSA 4P3PA 1YBHA 1CUDA 1Y1LA 3A1WA 3O2SB 5J40A 1TYAE 3B52X 2Q27A 1WXFA 3LQRA 4XUCA 3G0HA 2J5KA 1Z0FA 3DGFC 1WMAA 5E3HA 4RWEA 1P0CA 1K6IA 4Y3UA 1FNNA 4IEIA 3IXLA 4E5MA 3QMMA 1OIVA 4Z9AA 3DW1X 2C3MA 1R4ZA 3RYFA 3O8QA 1UFQA 4RY8A 3ROQA 4MQEA 3SICE 4A82A 1J2UA 2PH5A 1OY1A 4F3YA 1WHSB 5F7OA 3R5KA 1MJNA 1N0VC 1SA0A 2CDCA 4I9HA 3D4BA 3VNRA 1F2VA 3PRYA 3K70D 3G2PA 2OHFA 2PGIA 2AV6A 3DBIA 1PLLA 1RADA 2BMVA 4XWAA 5KVSA 2Y66A 2X0JA 4RIHA 2IH5A 5T3YA 2VF2A 2HA7A 4B31A 2A33A 2R79A 2XE6A 3ZU5A 1T8PA 3I2HA 5HBRA 1F0YA 5EHNA 3WTBA 4ZCIA 4RIIA 1CUVA 4JIGA 3B78A 3N53A 2R4UA 5I7AA 3NHYA 3R9KA 3X0DA 2RGGA 2VJOA 3ZE7A 3LDGA 3QZUA 4NRDA 4ZHQA 1CS0B 5ALFA 3OQOA 3SOPA 3ZBTA 5L6MB 3ZI0A 4EW1A 2OHOA 3H42B 1WXXA 1VE9A 1FTYA 4ZTUB 1WPQA 1CUJA 1TA4A 1WL8A 6CHYA 1M1YB 1UEXC 3IO5A 5JALA 4M0UA 5MN4A 5KYVA 2BKEA 1GKKA 4X60A 3CNLA 4G9GA 5A6SB 2VRCA 5CYOA 4DB4A 1Q1NA 1SZPA 3H19A 1DBPA 1V96A 3PYLA 4G1MB 4LE1A 5DJ5A 1FP4B 4WIAA 1TD1A 1L8AA 3LYHA 2I4TA 3ECCA 1ZH4A 3A11A 3LVFO 4J75A 3V1YA 5KTOA 4KO4S 2JLCA 3AF1A 2YWXA 4WT7A 4XOUA 1LI4A 1V0JA 1IONA 2JIZA 2PZMA 4NZNA 4ZQHA 4PGHA 3FM9A 3TLMA 3ANLA 2JK0A 3K0AA 1EG7A 1LBSA 1OLSB 2WYUA 3Q8WA 3TTTA 1QK4A 1TEVA 3B70A 4KUEA 3K32A 4D4GA 4MV8A 2P8SA 2KM1A 4QDOA 3SDBA 2CMHA 4EYOA 4RHXA 1NN0A 3K8ZA 5HSGA 1WZ2A 3BXEA 3QKSB 4YRQA 4ZOLA 5IAJA 1DTSA 1GV0A 2ZBPA 3DVAB 4Q4AB 2GHIA 3PEYA 1SKYB 3TLYA 1E9SA 1VBNA 1YDEA 2IXAA 2C5LA 2PPVA 1RU3A 4GXNA 4C5CA 3V34A 2NSJA 4YRIA 3W4JA 3EIOA 1K4KA 1LTHR 2QR3A 3ABIA 4ZVOA