1KZ6A

Mutant enzyme w63y/l119f lumazine synthase from s.pombe
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DLKGPELRILIVHARWNLQAIEPLVKGAVETMIEKHDVKLENIDIESVPGSYELPQGIRASIARNTYDAVIGIGVLIKGSTMHFEYISEAVVHGLMRVGLDSGVPVIFGLLTVLNEEQALYRAGLNGGHNHGNDWGSAAVEMGLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-Dimethyl-8-ribityllumazine Synthase
publication title The structural basis of riboflavin binding to Schizosaccharomyces pombe 6,7-dimethyl-8-ribityllumazine synthase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2002-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1kz6A00
5IM5A 1EJBA 2A58A 2C94A 2VI5A 4KQ6A 2B99A 1XN1A 1KZ9A 1KZ1A 1KZ4A 1NQUA 2JFBA 1HQKA 1ZISA 2OBXA 1RVV1 1NQVA 1NQXA 2C9BA 5IM4A 2B98A 2C97A 2A57A 1DI0A 2C92A 4J07A 1NQWA 1KYVA 2C9DA 3NQ41 1C2YA 1KYYA 2A59A 3MK31 1W19A 1KZ6A 2F59A 1C41A 1W29A 1T13A 2O6HA 1KYXA 2I0FA
chains in the Genus database with same CATH superfamily
4MUJA 4TYWA 5HFJA 3ZCVA 3LXRA 2LWIA 3N53A 2OCIA 4O4IA 4R6XA 4U0JA 1A4IA 1KAMA 1U5BA 2ZRAA 3BIWA 4K9RA 3MIIA 4AWXA 1HRDA 4CF6A 2IIBA 2IKQA 2DR2A 3C5HA 4M0UA 2BKAA 2QKYA 4S0ZA 2QUIA 4O4JB 5LOVB 4RADA 5KYVA 3EC2A 1FXWF 4K6KA 4WK4B 3W3AD 1YZFA 4RF3A 5EQDA 4HXFB 3FPSA 4GLOA 4EEZA 1IQ0A 3DFMA 3KYJB 3OFND 4YMTA 5JD6A 4RTKA 3VR2A 5LSAA 4UTXA 4BEBA 1GPAA 1KSFX 2ZITA 4M53A 4ZOLA 5TGTA 2BHLA 3UHAA 2I6FA 2LE0A 3VVLA 2R44A 1EWQA 2QRVA 2HMWA 2NVUB 1HWYA 1AY0A 4ZPJA 4PYIA 2OKCA 1EE1A 3SCZA 4KKVA 1KERA 4B3CA 1O03A 1FZTA 2ZDQA 2RDMA 1LDEA 1FYDA 5KCMA 3R7SA 1GFIA 1VBNA 2QIPA 1C4KA 3CZAA 3R3JA 5ES3A 3IBYA 4WH0A 3E9EA 4PZLA 3VSEA 3WRWA 5BP7A 4Q7MB 3SK0A 4CLOB 4CQMD 1U0OC 5AJHA 1MX9A 2ORED 3V32A 2AHOA 3Q3HA 4OJKA 1F0KA 3BWBA 5E1MA 1JKFA 5F76A 4E31A 4NZYA 2R00C 2DPXA 1X6VA 2YN0A 4X1KA 1V8OA 4ZO6A 3SN6A 2CC2A 2CLMB 3H8JA 1OXMA 1P9OA 2GX6A 3HS3A 3KL2A 4EYSA 1VMKA 1BOOA 2UVPA 3QE9Y 3ZWOA 2HLDA 3K09C 2VTKA 2J1LA 5ENVA 2SNIE 2XV1A 3D4PA 1UBMS 3DV2A 1ZSNA 2PJUA 4TXLA 1UPTA 2HCFA 1PG5A 3KQWA 2VAVA 3A7EA 4IHJB 4FN5A 3B9PA 2OFPA 4J2OA 3UMBA 4Q47A 1EFVB 2V1UA 4CKBA 1SWWA 1NI5A 2Y93A 3DAYA 3NXKA 2FWJA 3ZBPA 4B85A 2XIJA 4B43A 1CY2A 1QOPB 2CHEA 1IQUA 1PVVA 5HF9A 3VGJA 3PLAE 1XD9A 2FFBA 3T5CA 4PGHA 2CMKA 1B43A 4I2NA 5FWNA 4CI0B 4YMVA 2G09A 2C0PA 2IJGX 5AXCA 3HPRA 2G9NA 3QITA 4ZVPA 2O5EA 3P2EA 1KZHA 2C61A 3B5EA 5AESA 2PX2A 4MO2A 3KV1A 2AL7A 1UCFA 4LIPD 1DEHA 2C5EA 3G7SA 3L84A 5AHKA 3NFYA 4QRIA 1CS4C 1HQCA 3KTAB 3D5TA 1P7YA 3Q5DA 5DEIA 1NR5A 1FSZA 1TCUA 1QYDA 3D3KA 5FD8A 1WF3A 1S96A 4NFSA 1UPFA 1T2FA 2Q5JA 2VTBA 1JDTA 1WU7A 1XMPA 1S2MA 5DLYA 1V3TA 2J7PA 3C6QA 1NUHA 3KR1A 4IX1A 2EFJA 4N1AA 4PLHA 2UYCA 3JASA 3QXJA 4G5FA 4WLEA 3EZ6A 5AM1A 3JAWA 1JVNA 3L6UA 1MO3A 2RCYA 1Z56C 4DABA 4Q34A 3EVEA 3N3BC 2N3ZA 4MITA 4MYUA 4W5NA 4V02A 2OV6A 4FHZA 1T2CA 4P3YA 3FAKA 1TUBA 4GU5A 3WSWA 2DPYA 3F73A 2FG5A 3OD5A 2ZAMA 5EJ9A 1R5OA 2G1UA 5EHQA 5G4KA 5I4IA 3K1ZA 3QYFA 1Y1RA 2K87A 2ZXFA 4ABTA 3R9XB 5LZ8A 1YIDA 2Y76A 1G3QA 2A94A 2OMKA 4X91A 1PDWA 1JA0A 2QYOA 4CR8A 4EBFA 3ITDA 1NZDA 3PL1A 4NE2A 1KI4A 3VJKA 2IXEA 1HFEL 3NIGB 3QBTA 2DBRA 3OLYA 4MYRA 2IYOA 1QXSA 1CUJA 1R15A 2Y77A 3GT4A 5KHOC 1ZM4A 4YH1A 1AGXA 3AWIA 2F00A 1G3MA 5CPBA 1L5RA 4MDYA 4URYR 1X7YB 1H4QA 1I0ZA 4LSZA 5K0EA 3RF6A 3S8YA 3WNQA 3H3FA 4C7BA 5K8UA 3N7AA 4NYJR 4DLRA 5CNKA 1CUFA 1Z8NA 1G66A 2O2CA 4HQOA 4PYKA 4KQIA 2OC4A 3USZA 4OHZA 1FP4A 1SHKA 3P9NA 5I5EA 4C0BA 2ZYDA 1Z7WA 2IPAB 2ZIEA 3ENVA 5E1OA 3RJZA 4GLLA 1KHTA 1KDYA 4ENQA 2W22A 5JAPA 3SQWA 3MJSA 4PRLA 4HAWA 1CB7A 2IZZA 2O3SA 3DBIA 1QIKA 3I61A 4RM3A 3RUAA 2PUBA 3EA0A 3K70B 2JAPA 3T52A 4JOSA 1PWEA 2B4AA 5AKXA 1P60A 4RESA 1I6MA 1FX0B 2BFOA 4F06A 4IJVA 1A8IA 4AKHA 3LF2A 4ND8A 5CVUA 3NDBB 4O4LA 3TFWA 3LLUA 4C1BA 1M33A 3L8YA 2F64A 1QHHB 2BCGY 4JUDX 3GLRA 1OXSC 3IX7A 4R6WA 2D62A 4F3TA 5CG1A 3KJNA 1CP3A 4KH0A 1B73A 3AHIA 3I76A 4BLRA 3TG8A 4X1YB 3RSGA 5B3JC 5EJ7A 1UDBA 1SU6A 2EV9A 2XNDA 3CX8A 4GVXA 4F7WA 2X4IA 5JC8A 1PKXA 3QU7A 1DL5A 3ACBA 3MWGA 5FKJA 1LDBA 5SZJA 2YINC 2FGJA 1GRCA 1I14A 2IYSA 4DDVA 4AKIA 1R12A 1GD1O 5B64A 3NZEA 4DMHA 4IRUB 1KJNA 1R7RA 1SULA 1TYAE 2VOJA 4XIJA 3DDHA 5KKAA 5MHTA 4MKZA 3E1GA 3NHUA 5KOIA 1C30B 5TVKA 4DOMA 1N9KA 2BFCB 2INGX 2IW1A 3ZVRA 1RTTA 2OZVA 3HJAA 4M7WA 2RGRA 3ONFA 2IOYA 5TF0A 1K8QA 4DXAA 2GCIA 2L69A 3N2YA 4NU0A 4URVR 5EHZA 5CXQA 5C8YB 2XY4A 4HOYA 3SX0A 3LTEA 3M6IA 2ZRNA 3BMOB 5DEOA 1G0NA 1V9SA 3L4KA 4YRTA 2J32A 1F2VA 3CGGA 1ANKA 2B78A 2O8VA 3R8CA 5CEFA 4NYIR 3KKNA 4RGYA 3FPEA 3ZEAA 2GM5A 3WISA 1XYVA 3CBQA 4PF1A 3DR5A 1R4ZA 421PA 3ONEA 2YIJA 3HKDB 3P52A 1KDVA 1BAPA 3SR4A 1XPOA 5CIWA 1KKMA 3GOQA 1JPNA 3VRHA 3LKDA 4LSMA 1PL8A 2DTDA 4IEEA 1QNFA 4H77A 1WHSB 2J31A 3R7FA 3WVNA 2HBZA 2J8ZA 1NFRA 3PF8A 5CW1A 1FVOA 1BX3A 4GOND 2AUMA 1SHLA 4AUKA 4FQ8A 3TW0A 2HHAA 3DAGA 1XB2A 1O87A 4MAFA 2HC9A 2RGNC 4JLAA 1IXRC 4NFYA 5LN1A 3VDRA 1LPBB 3TLGB 1FY2A 1XDZA 3FBTA 3IUQA 2DTXA 3TUJC 3FFAA 4DGSA 4YDQA 4RACA 5HJ5A 3EWSA 5HE9A 3QPUA 4H35A 1C0PA 5AJTA 4REQB 4KXYA 1H8HA 1VE1A 4J9VA 3ZHRA 1OT5A 1VLZA 1GAEO 1CQIA 4JN6B 2JCVA 2GBPA 1LFDB 2WKSA 4WVFA 5CMLA 3VR0A 5LZ2A 4M1QA 4ZC1A 1PLJA 1XFAA 1Z0KA 3T9CA 3TCKA 1LS1A 5T6MA 2HW8A 1I3CA 3R5TA 4URXR 4QPCA 2O5RA 3BK1A 3DTYA 4YONB 2FXIA 3F7OA 3IIIA 2G9QA 1FUKA 4EB0A 1SXJE 3O95A 1PDVA 1ESMA 3IV9A 3NEJA 1DLJA 1JIIA 2UVQA 3SXPA 2OGWA 2K6GA 2FSGA 2YW2A 4FOLA 4YIKA 2HV8A 3X43A 3KR2A 1XU9A 2DVMA 5TMPA 1W36C 3KXDA 4DYVA 3IPRA 3HCPA 3NHZA 3E9CA 1AB5A 1FW8A 5C80A 1T36A 1IEWA 2ZSUA 1R6VA 1Z5ZA 4IEFB 4RSHA 4QHYA 4PZUA 4RXMA 5AKHA 5F9MA 1DZ3A 4DDHA 3A2KA 1UZAA 5EJAA 3JALA 2O05A 3RIGA 1GA4A 3IEPA 4V39A 5CB6A 1LX7A 3AF1A 4XQEA 5HR5A 1JDNA 2PKRA 4KI0A 1T5SA 4B6GA 4ER0A 1G6OA 3MWEB 4GI7A 2HRZA 4DCSA 2F3RA 1M66A 2J67A 2WF5A 1P73A 5DYWA 4BLSA 4DQDA 1FFYA 4KPUB 4TM7A 5ELMA 4JVLA 4D45A 3P0EA 4J0HA 2P8JA 1GFWA 3KOUA 3L0OA 1FLNA 2AA3A 3ENKA 3I1JA 4Q4HA 4RKWA 3R5KA 4KXXA 4R1SA 3RVNA 1BDHA 2WZBA 2BBSA 1Z5WA 1N5MA 1L4FA 1IATA 3LCRA 3GZ4A 3KDPA 4NBRA 3IEUA 3IESA 2E18A 4YUZA 5TSDA 1KI9A 2VWGA 1XZIA 2FPWA 2VQFB 1M75A 1N2CE 2P90A 2WNHA 4B6FA 5HQ3B 4EHAA 1WCXA 3IILA 4C0WA 2PXAA 4FC7A 3K7EA 3ANNA 1ZI6A 2AN1A 4HNQA 3FRHA 3RSZA 2RGBA 4MRSA 7ABPA 5IDQA 1ZCZA 1FS6A 1TJPB 1XQWA 3JXEA 1HUQA 1U2QA 2RHCA 4NEGA 4DQKA 3TRIA 5I6DA 3QLTA 3MMZA 3BBPA 1BH2A 1IN6A 1H2XA 1VCOA 1A9OA 2VSFA 3DHYA 1VCHA 1RLMA 4IDOA 2BZ0A 1L5WA 1STOA 4G56A 4RK4A 3UXEA 1TCAA 1GAQA 3DO5A 4KZPA 5IF9A 1KKUA 3BMXA 4P3OA 4C03A 2CL5A 3P19A 1TK2A 2XB8A 4FMPA 2BEVB 2ZJ2A 4ZO4A 1KO1A 4JQCA 5JQGB 2OZEA 1CG6A 4CM5A 1WJGA 1DAGA 3F96A 1QRAA 2E1RA 2JIDA 1ZIOA 2MSLA 2ZOSA 2Q8PA 5CGZA 3HRIA 3CH7A 2QVYX 1IY1A 4C5BA 4DC0A 1PHRA 2ET6A 2ZRCA 3TL3A 5ECWA 1BVUA 1N0VC 4R2XA 2FZWA 1ZH2A 5ALXA 2PQ0A 1G20B 4UD2A 2MSWA 2LXNA 3KETA 3PD1A 4B3SB 2ACKA 3QY0A 4UFOA 2PZKA 4YT4A 3EJWA 5AM5A 1HY3A 4KW7A 1JFSA 3VO9A 3BXPA 1U4SA 3EGDB 1CBUA 4RNDB 4GMGA 4WECA 1TIPA 2BSQA 1F5NA 1CJSA 1N32B 4AI6A 3ME5A 1A77A 2GPNA 2YYZA 1KEEA 4QA9A 3DUFB 3GW8A 5DK6A 3I9LA 5ESRA 4YQZA 3UW1A 3GUCA 1VJGA 3RBXA 2ZM5A 3QEMB 2LIPA 3KZOA 2QB5A 4LJ9A 4BP9A 4NCAA 4PBSA 4EEKA 2RH8A 3T41A 1JAXA 3GD7A 4ZZ3A 2CXNA 2JGNA 3OOYA 5B12A 1WPRA 5H83A 1Y9DA 4WOBA 5BN5A 2G07A 3U3JA 1C7ZA 8GPBA 2P6OA 4CKEB 2CHVA 5G0WA 3K0EA 1LBHA 3H16A 1GGJA 2MOKA 4NOJA 1BW9B 1GKYA 1N6OA 1ZINA 3HUDA 4G5QA 4JBNA 5D01A 3KQUA 2AIRA 2MINB 3RFXA 1VB3A 4ZDWA 3TMAA 2GTPA 3VTAA 1GZUA 2WY2D 1U3UA 3IHWA 4GX5A 2O2DA 4NZOA 5KC9A 1N5OX 2RHLA 3K9WA 3KSZO 4R1OA 2Y99A 4TSKA 4TWJA 3IR5A 3QVGA 1J07A 2QZJA 3FLAA 2P3OA 2WJPA 5L8VA 1ZUWA 2WIKA 5EMHA 2V6GA 2Z2KA 4D5GA 4TUYB 2C7VA 3A9VA 2UYGA 4DSAA 2GXQA 3J81k 4HADA 1FLDA 2WSYB 3LLCA 2O3UA 2EFYA 5EIHA 3CLRC 1U98A 3O8DA 3LTNC 1OLOA 1ZP6A 3RHZA 4P7BA 3UWKA 4OB8A 2JIPA 3VHXA 1LQTA 4BNMA 4ERXA 2L19A 1D6JA 4MTLA 4BXOB 4GI5A 3HVUA 1XT6A 4BQQA 1TZMA 1MUUA 4O4JF 4KK4A 2DY1A 1RWOA 2FP4A 2OCXA 2CUTA 3TX6A 1ODIA 4RPKA 1C7QA 1J5EB 2Q1SA 3MCWA 2YZ2A 2ZATA 5ADHA 3D8RA 1U31A 2D74A 2I29A 4A6XA 1BRMA 4QXQA 4BJ1A 4DKXA 4UOZA 2X5JO 4MUXA 3NBQA 4B6SA 5BV8A 1QV6A 1XWWA 4R69A 5KCZA 2OV1A 5JYBA 5B5SA 1LCIA 4IJ5A 3I9MA 3PV0A 5EWMB 2DETA 4UMEA 4B8ZA 1G9XA 1J21A 2CYCA 2QNIA 2IZ5A 1ZQ9A 4JXKA 2AR9A 4PC7A 3SEAA 3HVHA 3F71A 5LKRA 2HR1A 4P7KA 4XGIA 2FRDA 2ERCA 1U3FA 3O8LA 4A6PA 1Z39A 4R1UA 1GSIA 1V4BA 1VSQA 4CM1A 4BB5A 1S02A 3UHFA 3L7OA 4PO8A 3DL2A 4DR7B 3KD2A 3ST7A 1AQNA 5KSYA 5IYZB 1K7EB 1THTA 5FRDA 3GLHE 1P9RA 4IYRA 3RSHA 5CFOA 1L5ZA 3FVVA 4Q9IA 2OB2A 3HLTA 2QVLA 5LB2A 4DEVA 3DOEA 2W2LD 1JR4A 3JQGA 3O4FA 4MRRA 1NQVA 3VBCA 3W5UA 1E79A 1XXHA 2O1WA 1EPUA 5JRDS 2JZNA 4P4UA 1D7OA 2LDBA 4JBGA 3OLVA 4RLHA 4NF2A 5GIOE 1NVUQ 1TL7C 2LGJA 3CLUC 1P0IA 2A8YA 4JEUA 4TXJA 4P2BA 3Q7PA 2GLTA 3FJOA 3HU1A 3TZ6A 1JHUA 4ALNA 5FBRB 2VFAA 4QGHA 3EEQA 1FCJA 4JODA 4LY6A 4MVJM 3LZCA 1THGA 2HXGA 4OBWA 4PIVA 1EJBA 4C30A 1RBQA 2HU7A 4X92A 2WT8A 1MAVA 1XEFA 2P11A 3F6EX 5IDYA 2JZCA 2WYWA 1VMDA 4KQKA 1BG6A 2AQ8A 2GBCA 2FEKA 3HHPA 3VVBA 1NJ1A 3PHBE 3QTBA 1ECLA 4H27A 3PGJA 3SHTA 3W5JA 4OQXA 5HWSA 1FU8A 2QI9C 5FBZA 2VN8A 3IKTA 2QSJA 3TNLA 4PHCA 2LCQA 1Y9ZA 2G1PA 5EEGA 3RRYA 3WG9A 5JS8A 1CU1A 3CLSC 3U3RA 2ZRFA 4KX5A 1T9HA 1ZWKA 4D3DA 1YJ8A 4FGJA 1LTQA 1E5LA 2E48A 3QW4B 2Z3ZA 4CM6A 4CJXA 1MJGA 2EZ9A 3QV2A 3N0XA 1ZCJA 3GHHA 3AF3A 3OBBA 1F1BA 4RS4A 3SE0A 1R4AA 2QE7A 5L3SB 5HVNA 1HG1A 1T9GS 1H2HA 1XDUA 1J09A 2AEFA 2CBGA 4KN6A 4D74A 2ZULA 1O0BA 1U02A 3OAAD 4CM3A 4CMIA 4W5OA 3M1LA 5CLHA 3E9ZA 3T9BA 4PPGA 4BJ5A 3T12A 4ERNA 2C5GA 4KJZA 4MMZB 4W1PA 1TAQA 1T1GA 4JOQA 1IB0A 1E1RA 4TSFD 5DBEX 1G5HA 3LCMA 5JCZA 3EX7C 2X3FA 2KE5A 3LUAA 4BFUA 1Q50A 5BSEA 3CIOA 1VGVA 4JNKA 1QH1B 4CEIA 1XCLA 2XOKD 3WNDA 1G3RA 2XT6A 3IP1A 1OBCA 3GFBA 1ECFA 1REQB 1S3FA 1T2EA 2AJDA 2JCSA 2I3DA 2YTZA 2Z58A 3OIWA 4X63A 5HZKA 4K6FA 3BFXA 5F4BA 4BWYA 4UM7A 3GXOA 4IJWA 3BDAA 5C7YA 3F9IA 1M8PA 1TVKA 5A3RA 4D9EA 1B93A 2QDXA 4UMFA 1SC6A 5ALIA 2QPOA 1P7ZA 2XUJA 3HYTA 1NOJA 4L07A 4DMKA 4E88A 1Q7GA 3ND7A 4ZC8A 3L77A 5KNBD 4KJXA 2ZDHA 3AR6A 4F7DA 1R4NA 1N0HA 2RHDA 1ULSA 5DGDA 3KLPX 4JU8A 2I6XA 3F6YA 1S4QA 1UBUS 2FRXA 5D7NA 2YYAA 3QMPA 2W2MA 3STVA 4I4TA 4C5AA 1K8XB 4N7RA 2VA9A 2DJIA 2J5RA 2JJ1A 3M81A 4FHDA 3CVUA 2VDLB 2QX9A 3SJBA 1UBCA 4Q48A 2NVWA 4OJYA 4MI1A 3AVXA 1PCXA 4XSHA 4CMAA 5D5QA 5H3HA 1EK6A 3CSDA 4G41A 5CA0A 2X0KA 1R4MB 3JARB 4J4TA 1RWXA 1FSPA 1T3GA 3RRFA 3TTYA 1UKZA 4BFLA 4B46A 3ZD9A 3FPLA 2JBHA 1EFLA 2XBLA 3IAM6 2X1VA 4YI3A 2J9FA 4BMYA 3ZH2A 4Z7NB 1Z82A 2P41A 1QCDA 4EF4A 2OQIA 1K4YA 2CMHA 4EG1A 2XWQA 3ILHA 4GBED 3NANA 2TMYA 2V03A 3HI6A 1SZJG 1A9XB 4FYIA 3ROPA 3D7MA 3NPMA 1IY8A 3WL8A 3PKIA 4MQ4A 1QYXA 3SIWA 4DCVA 1VGRA 1PL6A 2ALJA 3BF8A 3UT6A 2WJYA 3NNSA 2PL3A 4EI2A 3WICA 1K98A 4O4IB 4QBGB 1U5BB 2WM8A 4MS4A 1DAEA 5JCPA 2AG0A 1ELOA 1JJ7A 2YR0A 1KNXA 1WXWA 3W5HA 5EJ6A 3RIHA 3HWSA 4O8CA 1PYOA 4LMPA 1WXIA 2O1EA 2R6DA 3IVCA 3Q2OA 4R7TA 4X54A 5CDFE 1RXSA 1Q1QA 2DP4E 4F9EA 4HPWA 2HUNA 4MS3B 1A9ZA 1AXRA 2I71A 3MLAA 3N86A 4YRLA 3ET4A 4ZOLB 1FQKA 3CZPA 3LLSA 3RLFA 1XA3A 5DNYB 4YR7A 5B30A 2J0SA 1YIAA 5BUCA 3DYVA 1L7MA 4LOKA 1O94A 3I6IA 3NKLA 4U0KA 1CTQA 2PRIA 4JX9A 2WU0A 1VLJA 4JOBA 3I2KA 3PCTA 3ZLVA 3CX3A 4AC9A 4DY4A 4UU8A 2K7ZA 2ZB4A 5H1YA 4EELA 3NHYA 1E3DA 1J2RA 1JAYA 1WMDA 2RMKA 3KALA 2FSPA 3IS3A 1KTIA 1BX0A 1YFZA 2ZI4A 1KS9A 4NTZA 4OAPA 3RG8A 2JGAA 1G2PA 3LQQA 2GLUA 3G17A 3MMSA 3NETA 5A9TA 5ALPA 3M4YA 2IUEA 1M2VA 3QBVA 4X8MA 5EINA 5IJAA 3GUVA 4X1KB 3FLMA 1T2AA 1QF6A 4OXRA 3B7WA 3RU7A 2AXEA 2B92A 1IZ8A 2UVPB 4I8IA 2I99A 1F0YA 4L85A 4PTZA 4MV1A 3TBHA 2NQ8A 3VJRA 2P5YA 4Q9NA 5A3JA 2FR1A 1GG9A 3DCIA 4Q00A 5CVVA 3TYXA 1W34A 1Q1GA 1FNDA 1EX1A 4BN4A 3KKKA 1HDRA 2WKPA 3R5FA 4EKIA 1XBTA 3DLPX 3QYAA 3MJVA 2GETA 2I76A 1QMGA 2YASA 4J1NA 2XGMA 4NBTA 1ZFNA 5C35A 4XM1A 1SVLA 2C94A 5IW8A 1M7HA 3ADOA 2OV4A 4UCFA 5G0SA 4ZCQA 2VQSA 4GPZA 5TQVA 1KXZA 3EQ2A 1P2UA 2CD7A 3U9LA 2P2YA 3JWEA 1Q84A 2P2GA 5E9WA 2I3ZA 1Q0UA 3SVTA 3ZGNA 3VNVA 3I01A 1CUVA 4RPIA 1HNNA 2WB4A 3PQFA 2Z83A 1K6EA 4R40A 1UAYA 2A1TS 4D43A 3G0HA 4BIMA 1LI5A 1TJYA 1XGKA 4K3VA 4LOAA 2CSXA 3EW7A 3H6KA 4DLUA 2EKBA 2IRWA 4DCTA 1GRRA 3D2AA 2H7VA 3VX3A 2VTBB 2BF7A 2K2QB 1MD9A 3BIFA 3ID6C 3ZI0A 4RWEA 1SHUX 3JASB 3JQRA 3M1AA 4I4LA 3W6OA 3JAWB 3BXOA 5FULA 3O31A 2YMMA 5IKMA 1UXOA 1MAAA 5AICA 5LWQA 1PZGA 1TUBB 3RM3A 2PL5A 1U2TA 3GYBA 4ASUD 5AVKA 2GB4A 4YUXA 2NSDA 2PKWA 2ZJ1A 5G4KB 1DMSA 3E2MA 1IAQA 3PUHA 3S1AA 5J4VA 4MIKA 1KGDA 3COVA 4MS1A 4HRXA 3FBWA 5B7NA 2O5CA 1YS7A 3U81A 1KMMA 1AS3A 3FCUB 3VU0A 2HCTA 3ZBQA 2X9GA 3QGMA 4MWSA 3BCUA 1U0GA 4UBIA 4OXNA 3SSOA 4KSBA 1IONA 2B7BA 2HI0A 3DMGA 1EX9A 4KRYA 4EATA 4CI9A 3GJ8A 4JP8A 4N6GA 2FZVA 2R1UA 2QZPA 1PL0A 4ARCA 3KQVA 3G9QA 2P0EA 3HR7A 4RKQA 5BYKA 4F4IA 1FYVA 4DZTA 3Q11A 2BFFA 2QPAA 2LP4Y 1P3Y1 4TL8A 3PEWA 4YFYA 2AH5A 4D3XA 3U4AA 5L4NA 1Z5OA 1JEOA 1CERA 1YDWA 2GCOB 3PRKE 4KH1A 4PGFA 4ZV7A 3Q7QA 3W9YA 3OKAA 1WQ4A 2XPCA 4Q4AA 1RZVA 4G0NA 2P2SA 3EK2A 2VOEA 2RK4A 5C7IO 3DLHA 4X85A 2XWPA 2RGAA 4NLLA 4Z6KA 5BORA 1FQWA 2E1PA 2FRDC 3FYTA 4G63A 4OREX 5IBQA 3EEYA 2XEXA 3RG2A 4C6RA 4EMTA 1A5BB 4YN3A 4JAVC 5G0VA 5IKXA 4ND8B 1PFVA 4JLDA 3K0BA 4O4LB 3V8EA 2VSOA 5F3WB 1XAJA 3PA6A 5D1NA 4EKEA 4KGXA 5JRJA 3OQJA 2JAXA 4YI5A 1QHEA 3HB0A 3AJ9A 4I9GA 1XL1A 1IJBA 2C5FA 4C7JA 5FUMA 1JWBB 1UOOA 1SK8A 3CLKA 1VTKA 3JQAA 3E15A 4FHEA 2XMSA 4MR8A 2EJWA 2CHQA 2PGAA 2O52A 1QK4A 4MULA 1C8BA 1LLDA 1RHUA 3C8HA 3Q1LA 3RUIA 4I4IA 3OWOA 1N9ZA 1O7JA 1T9ZA 3UGQA 4EHJA 3DMNA 3L7MA 2NACA 2QPTA 4LV6A 2R7AA 1DQNA 4R83A 3PGKA 3EUWA 3Q15C 1B1CA 2PUFA 4OA8A 1T15A 1XMXA 3VU3A 1DJLA 2NUBA 3PC3A 1L5LA 3ZNPA 5CDHA 4ZYLA 3LGAA 4YCSA 2V0NA 3UICA 4ZTUB 3CKLA 4PQRA 5ALEA 2E4VA 1QHFA 2YN2A 4QAJA 1WBDA 4H3SA 2AW5A 3FI0A 6Q21A 3QWFA 2DXIA 4URZR 4UREA 1U4OA 4KODA 1WXGA 1N3YA 4TUYF 3FWNA 4AL4A 4ENUA 4XCXA 4OP3A 3A10A 5AM4A 4H16A 4RPJA 4EGJA 3ANLA 3DAPA 3M6FA 4AW9A 3F5FA 2ILTA 5EGSA 1M9NA 3EODA 3HFJA 4GZ5A 4M0CA 3C7KA 3BDIA 1DAIA 1RJDA 3THSA 5FCDA 3E7PA 3SXJA 2X1MA 5BPFA 2F4NA 1H0SA 4QDKA 2C9DA 4WEQA 1P1FA 3O8QA 3T4UA 1Z33A 4RTQA 4DR1B 2GWRA 2CXQA 4II2A 4PPNA 4H0NA 4N6OA 3PTLA 1E58A 5CFZA 5DCWA 2IPNA 4ICIA 4Y6RA 5KJFA 2KJQA 3MQFA 5BWBA 4R98A 4BZWA 4R3NA 1P31A 4LJAA 1CVRA 4BO7A 3F7MA 4E3WA 1HORA 3LFHA 4J4HA 4DLLA 4EY8A 3G0OA 5TQ2A 1IWPB 3PWKA 6GPBA 2DLCX 2VT7A 1ABFA 5MF6A 5CIYA 2A0XA 3ASYA 1E7QA 4FTWA 4R84A 2XT9A 1L5VA 3L3BA 2DEUA 3LKVA 1CQIB 4RS3A 2WU8A 5T67A 5B6JA 1YZ3A 4K2AA 1PSDA 3HJTA 2JB9A 1VRVA 4NPHA 1U1DA 2FN3A 1DRWA 5C31A 3WWYA 3EPHA 2BFEB 1LW6E 3RU3A 5KTYA 2QX4A 5AK4A 1O8CA 4JZKA 4EDFA 2FV8A 3I32A 1QFXA 3G9ZA 5C5CA 4R7GA 4Z4GA 1OLXA 4ZRNA 3SYLA 1SZDA 2P9ZA 3GAMA 3QA3E 4ZQCB 4AM8A 2GXAA 1LGYA 2H2HA 3I5UA 5HKBA 4KHPB 5CURA 2Q2QA 4P6VF 1T10A 5H3CA 4INPA 1K0FA 1L7OA 2CXTA 3R2JA 2A5LA 1XD8A 3G6KA 3DEYX 2D0PB 3DMRA 1I13A 1U8FO 3JALB 2CJYA 5C2JB 2ENUA 3NYIA 3F47A 1AQUA 1KVQA 1Y6RA 2HCBA 2ZPTX 1GQRA 1X1EA 2ZBEA 3KXLA 4H4DA 2X8JB 1ZGJA 5DWVA 1ML4A 3X1DA 4F8EA 1DQSA 3GPDG 5IEBA 1C4WA 1HLDA 2CE2X 3O8OA 4AQDA 3TL6A 1M2JA 2CNDA 3H2BA 1XZEA 1RXUA 4UHHA 2FPGA 5U4XA 3FDZA 1VXRA 4W8OA 5IUJC 3EVGA 3DHVA 3L0IB 3AP2A 2HF2A 3G0IA 4EAAA 1BJTA 5KTOA 3LT1A 3NPAA 4B3GA 2Y05A 2F2TA 4K40A 2FPRA 1Q7BA 2Z1MA 4X6UA 4ZT6A 1XR3A 1IY2A 2GEBA 3IOMA 2JCBA 3E5MA 4XYBA 1NAHA 1V8FA 4UTOA 2JGLA 2ODNA 3V1UA 2MCFA 1GZDA 4WZBA 5ELLA 5CBPB 4BLPA 2ZLBA 1NTRA 3M6MD 2BW0A 3KVNA 3OURA 3B2QA 4YAFA 2IY9A 4LGCA 1EAMA 1GXSB 5EMKA 5AKZA 1VYTA 3ZWXA 2QL9A 1G17A 1W1UA 3JVEA 5EESA 5LBUA 4R71A 2CLFB 3DEAA 3WP1B 1PV4A 1L9XA 1C2YA 1SUIA 1WD7A 2AE2A 3EC7A 1JH8A 3E27A 1UKBA 3FF4A 4H0CA 1QZXA 4YJ3F 4U7FA 4JNCA 4I5EA 1GAJA 3WADA 2FZEA 4B9EA 4D0SA 4JKYA 4NDZA 1AKQA 4CM9A 2HPVA 1PQ4A 1E2BA 3PWSA 3O4VA 3OQVA 4G4SP 4JLNA 1JQBA 4YGXB 3MYRA 5ALMA 4Z9AA 1NLUA 4B6QA 4ER3A 1E1LA 2DBYA 2X4GA 3A6KA 4YLEA 4G67A 1DT5A 1FXSA 2A2ZA 4MQFB 5BSUA 5LZ5A 1OA1A 1O94C 1HE4A 3IQFA 1ZJ6A 2ECKA 3CNBA 5AO9A 1EVEA 1H3EA 3VVCA 3WGYA 1Q1ZA 1RHRA 3BFVA 3EEOA 3LDHA 5ECGC 2PIDA 1U2GA 3GFSA 5T8KC 4D97A 2H2IA 1OE0A 4MKFA 3M3DA 4MAMA 3SM9A 1C1YA 3E23A 4N47A 4KOEC 1KH1A 1XVVA 2ZI5A 1GU7A 3EDYA 3LWNA 2ZTHA 3M4NA 4CKWA 2RCNA 1MF7A 5FUQA 1I51A 4H7EA 4O29A 1W4RA 2FK8A 4BATA 5B2FA 3VZPA 1BN6A 2H7XA 3E81A 4PYLA 4LF6B 1S89A 1U1GA 2JIMA 4R8KA 5CM9C 1Y5IA 4TPKA 2RGUA 3EY9A 1GPWB 1HGXA 3LRTA 3NBUA 4DJAA 1H0RA 1OU4A 4FD2A 4I19A 5KQSA 3PFNA 3E0QA 3BT7A 2PANA 1INLA 3HCWA 1N0WA 3K1JA 1WQ1R 3PI7A 4IVPA 2YIMA 4KQ2A 4LY9A 1NBIA 3VR6D 1N8NA 2CDCA 4UASA 5GOZA 5BN5B 1ZISA 1FDWA 2IDZA 1URPA 4FCWA 3UYLA 3ZJ5A 1GZ6A 1PTKA 3BD8A 5A62A 5KTTA 2PH5A 3EGEA 4HYEA 4QVGA 1AUOA 5LJLA 1XZFA 3LCVB 5DASA 1G0OA 3GMDA 3TDKA 1DQPA 2P9GA 2DM6A 2R8BA 4K3UA 2VCYA 3GJ0A 4QJ5A 1O96A 4Y7DA 3VTFA 4QTTB 1EQ2A 4BAGA 4C0JA 1R8QA 2FFHA 1EP9A 3KZMA 1DKOA 5C4GB 1IMJA 1MB4A 1N1DA 1BJRE 2LVBA 4NCBA 1Z6QA 3EPLA 3OEED 4QATA 1DC6A 1F6BA 3LE8A 1HKHA 1F4VA 4FZ5A 4YLGA 4IJKA 4L3VA 5K3OA 3NHPA 5SICE 3AEQA 4YRFA 1SU8A 4ZCLA 1J33A 1WW3A 4EB6A 3VYVA 3CIFA 3VDMA 5DM1A 4YT2A 3GVCA 1DBRA 2JARA 1Q0ZA 2ISSD 3GG9A 3G5UA 4XQGA 2IEYA 2LBPA 3C1UA 3CKMA 3GRUA 5DNAA 4KNWA 2FE1A 3TJRA 2EWVA 2BEUB 2VK2A 4QPJC 4DB4A 3VHXB 3KWFA 4O4IF 5EOVA 4X7PA 4OFWA 1WBBA 4Z4CA 5ITSA 2FHPA 1LK5A 1V1MB 1P5JA 2H2WA 4XFDA 3LIIA 3WR5A 1F1JA 1LVHA 2HBQA 3BL8A 4B7CA 1W5AA 1WUJS 4R9NA 1GPDG 3MGKA 5AVXA 2FP4B 3DTVA 1RCUA 2FWAA 2OXTA 3IT1A 2GI4A 1R5JA 3E4CA 4NL4H 4NYIQ 4X5OA 3PEFA 5HA5A 1RW4A 2DFLA 2RG1A 3G8BA 4XDGA 3P9CA 4ZOLF 5AK3A 4MVJD 4B34A 1XZ8A 3A9SA 3AHHA 2YRFA 4KQHA 5JISA 1Z29A 5JMTA 5AUQA 4TZ0A 1VYUA 1XU7A 3RK1A 3H2GA 3K0SA 5ALSA 4FFBA 1ZMBA 1KVTA 2BDEA 1OBVA 3BRWD 4AZVA 1B4DA 2PUJA 2IP1A 3O9ZA 1ZNWA 3ZHSA 4D46A 1T2DA 3KFLA 4D96A 2ZTLA 3RV4A 1EJ0A 3PLNA 4B3XA 4XE5A 5A4KA 5AVJA 1UXHA 2ZFUA 4Z3OA 3L93A 1FEZA 1Z28A 4Z49A 1WP9A 2PVPA 3VPGA 3QEAZ 1WCIB 3EGCA 1AMUA 4K6MA 2EX4A 3DQPA 1H0KA 1RJGA 3D8HA 3OX1A 4FWTA 2ZWVA 1IEXA 1N7JA 1NR7A 1RRFA 3E9DA 3FVRA 2FSIA 2Y0PA 3R3UA 4EFDA 2BV3A 3T9DA 1E2DA 4UUMA 3D4IA 3NM5A 5JD5A 1X80A 3IDQA 4DMUB 4MZDA 1JR6A 3O2SB 5KNDH 4HDMA 1X13A 1N2CA 1DDIA 1I2BA 1XTPA 3W8DA 1KJ8A 1TDJA 4AS3A 3RUCA 3ETJA 4WKOA 4S04A 1FFSA 3HVJA 1NC1A 1SXQA 2JJ2D 4ABYA 1MJGM 3NDPA 1G21E 2Q5FA 2Z6AA 3H9GA 2CMDA 2UZ3A 3CMCO 1SUCA 3QUSA 1YC2A 2XDQA 2OO3A 1VG1A 3CRZA 5LUAA 2EKZA 3OZFA 1PJZA 4EJMA 4PAOA 2IYQA 1UZMA 5JATA 3GGJA 8ATCA 4IDCA 4A73A 3FOEC 3OT1A 4F71A 1DBWA 1MEJA 1Z37A 5I9NA 3ROGA 1R6XA 3UOAB 1RIIA 3F4BA 1FUYB 1UJBA 3ND5A 3O2QB 4M0MA 4HWRA 5EVCA 1NFQA 1BHJA 3IA7A 3KYBA 3FCAA 3NHRA 4UEJA 4XVCA 2QGFA 3ZZTA 1UIRA 1Y3AA 2H7CA 2OYSA 3NDIA 4YNBA 2ZM6B 4PY2A 4E33A 2XZOA 1RZRA 4DLAA 1FYWA 2H4JA 1NMZA 4Z0HO 1Z8FA 1F8GA 4FW9A 1QLWA 4RFSA 4M99A 3WBJA 4B7UA 5EUQB 1D4AA 1KK3A 2C78A 3G8DA 3HDYA 1XU4A 4MJ7A 1Z83A 2EG9A 4PICA 5DTRA 3SC4A 3RT1A 2O8FB 3ZLTA 3HA3A 3DHEA 1EK2A 1WG8A 4JD5A 1ARZA 1EVKA 1EB9A 3CSSA 3TQSA 2BI7A 3K9CA 3M9LA 1GV1A 2QTVA 4WOKA 4AP5A 4C1NA 1MPXA 4GNKA 3ZCSA 4EH1A 1K3TA 1I10A 1KQNA 1RADA 3C7TA 3FDFA 1BVRA 4QFBA 3PHGA 5CNIA 3NAGA 4ZDIA 2WYHA 1RZ3A 3F7NA 4HDAA 4O3MA 1NOKA 1XJCA 4CEIB 3I42A 4NV0A 3TIGA 2CXXA 4DJEC 3AX6A 4B5KA 1SOAA 4N39A 3AM3A 4W4TA 2IDMA 5ENDA 4ZT3A 2HNKA 2J6IA 3CN9A 3VR2D 4QSMA 3NHLA 4EGSA 4C7VA 1CR4A 2YCBA 3EZGA 1TVKB 4L6IA 3LF1A 3KTFA 2QVZX 3LHKA 3OESA 4HK4A 3NWBA 4MYSA 4GDFA 3QI7A 2A5FA 4P4SB 3RHSA 3GNQA 2ERXA 2J45A 5B1YA 3O03A 2FWBA 5EWLA 5EZYB 3SZMA 1PNVA 5F12A 4I6GA 5LZ7A 5JNSA 1I7LA 1Z45A 5GJCA 2X42A 2ZI6A 1S1MA 4P22A 1MORA 4COKA 1EM8B 4I4TB 4Y1EA 1PQPA 3LC1O 2XUDA 5LQMA 1GSHA 4C0KA 3I05A 2J3MA 1X7XB 4KOAA 3CO5A 3RVRA 3ZVMA 3BB3A 5JANA 5DLEA 1KYVA 3MOSA 2VT2A 4S0XA 1KAOA 3PLRA 1I7QB 4LA4A 1YD7A 4Y1RA 5DN9A 2HLDD 4M8KA 3OJFA 2Q3MA 2BGMA 1Q20A 1QHNA 4DGQA 1H4SA 1YOVB 2G1KA 4DV7B 1Y8QB 2ZUUA 4RF4A 3IKJA 4O3FA 4PYNA 4AIIA 3BA1A 3I3OA 4PG8A 7REQB 1DSSG 3MINA 4BP3A 4O4LF 1WP4A 4JP5A 3ICQB 4C21A 1UP4A 1BU5A 2J9FB 3ABRB 3CG0A 1MV5A 1C0KA 4QDUA 3AW8A 3ZX5A 4OMFG 3A25A 2WJ4A 4P93A 2I3GA 4KX3A 4TWBA 4QTYA 3A6PC 3KJFA 2D0IA 4OHBA 1FQOA 3PIDA 5DI3A 2QI9F 4F3NA 3WE7A 2XWJI 1TQHA 2O2JA 3NATA 3GROA 1T3LA 2WV9A 1M2HA 2YMLA 3CEHA 3QOYA 2ZYGA 4WT7A 2REQB 1N1EA 1Z5GA 3T7JA 3ZH9B 4V0OA 4BX8A 3AFOA 3ZGZA 2XLBA 4E0BA 5DHTA 2GO7A 5A5EA 2A4MA 3G1WA 3QX9A 4MS4B 4BMZA 4PYMA 3DC7A 5EHNA 1QGED 4DR4B 2YBDA 3PKZA 4LF9B 4FSXA 3V4SA 4J7UA 1U90A 2P4QA 2NNLD 3REOA 1PJLA 3U1BA 1QRRA 3CLRD 4PG6A 4RJ2A 2J7PD 3CXRA 3TX2A 3UJ9A 4PPQA 3FZEA 3W3AH 5LXTA 1GJRA 4L4SA 1LWOA 4DILA 4MQMA 1L4MA 1JIKA 3PJRA 4KREA 3I6BA 3IC5A 3I5MA 4JP2A 3TW8A 4QJ3A 4EITA 1L7PA 2GPBA 1XA0A 4EUSA 1E9CA 2JGDA 4M3NA 4CMCA 1JHXA 3BXEA 3PVZA 4DN6A 4FNGA 2FUG6 2XXAA 3SQMA 1ZN2A 1R9GA 2AQIA 4KQEA 3AOEA 3FFTA 2BMDA 4KDFA 2F48A 4MEBA 3SGLA 1VL0A 2ZRKA 3KZXA 3TBFA 4FR2A 3QUAA 1QKKA 4JMPA 4RVSA 5E6SA 1TEXA 2ZREA 5HTKA 1NJ2A 3RTCA 3WL4A 5AI0A 4F4CA 5IT9A 4LXTA 1PG2A 1M2VB 2QTCA 1JALA 4EUNA 1Y6JA 1AUXA 4GG1A 3DTNA 1YR9A 4B2IA 3CURA 1KDZA 1QP7A 3I01M 1SRQA 4RO0A 1C4OA 2COEA 5I7OA 3TZLA 1A8SA 3PX2A 4ZARA 4XRGA 1G16A 3UUGA 1SIUA 5ITVA 1NG9A 2PPVA 5DOVA 4C3OB 5LIRA 4NCHA 5KMGA 1GNLA 1YZLA 5FQNA 1K6JA 3HBMA 3MUFA 3QPAA 2E82A 1ZJZA 4YDSA 2OHIA 1ZNYA 2ODAA 5KTMA 3FGNA 621PA 3OCUA 1XEXA 3I9FA 2ST1A 1EX7A 3PYMA 2P7HA 1U2GC 3VYRB 2M6LA 3GLGA 1YRQA 5DCLA 4H18A 4DA7A 2Y1XA 3LOUA 4PLFA 4D9MA 4EOGA 5J4LA 1C1DA 3OETA 1ATIA 3RVOA 2F8TA 1O3YA 4IV8A 4B0OA 4ZEVA 1BZYA 1BD4A 1OHHA 2X9NA 3HRKA 5JV5A 4ID9A 1G1AA 3P26A 1MO4A 1TPZA 4M9XA 3ZJUA 4WXEA 3CLUD 3DMPA 3S2SA 2VNJA 4A1FA 3DH0A 3E2IA 1TFUA 3F98A 3I58A 3W5SA 1ODTC 3MTBA 4OQZA 4XUEA 4YLYA 2QK4A 1R5NA 5HYVA 1KBZA 1F6WA 5DMXA 4YJFA 3O75A 1ZU4A 2PQ2A 1E7SA 2QTGA 3EIHA 3LX8A 3R3ZA 3KAQA 1BX1A 2NO4A 3ZXYA 2AKAB 3M4XA 3U7IA 1DTEA 1VZ3A 2VHUA 4BNGA 1G8PA 2DQZA 2JHCA 4F45A 1JX6A 1N4DA 4JGBA 5CT4A 1YZVA 1NVDA 3FWPA 2YJGA 3E22A 5EPOA 3B3FA 3EVZA 4RMJA 3LWDA 4UTVA 3TIXB 3BL5A 1I1OA 4B9AA 3T7SA 2PXCA 4LDJA 1E20A 3UKDA 3CLSD 5DTMA 3NO4A 4G0YA 3BB4A 3RANA 1P2BA 2H65A 1L8AA 1W0KA 2QQFA 1XQ1A 3AKCA 5D3MB 2I34A 4UVGA 3VPDA 3IEVA 3WIDA 2PL1A 3B6EA 2KWIA 3S1AB 1A7UA 1VL2A 4HH3C 4MS1B 2YS7A 2IZ0A 3KHTA 1H9BA 2PRSA 5EA2A 5LMCA 2F1IA 4MYHA 5TRTA 1Y80A 4J90A 2MU1A 4RAOA 3MJHA 4D9CA 3U5TA 2X15A 3E48A 1CRQA 1AQIA 2CN1A 2M98A 4LYHA 1TKRA 1RCFA 1K7CA 2EW2A 3AIMA 2O9JA 3PFWO 5A5DA 2NXJA 2O8CA 1ESCA 1SXPA 1TM2A 5LLSA 4WINA 3D59A 2GBLA 5CB4A 3STHA 3HZHA 1JBEA 3OZWA 3T3GA 3TDNA 1NVXQ 1IPFA 1V4VA 3IP9A 4CODB 4UOQA 5EGNA 4B4VA 4GFDA 3KSUA 1JIJA 3VHRA 4BL5A 1QDEA 5H02A 3HMKA 3LNCA 2EU8A 2G9RA 2BFFB 2R97A 4MK4A 1YR6A 1U7WA 4C2AA 1DRKA 2VYVA 2E6KA 2FZ4A 1F0PA 4GYWA 1NSTA 1W76A 3VO2A 3IL2A 1SXHA 2IEBA 1A2KC 2WMDA 2ZT5A 4P58A 4Q4AB 1K2VN 5IU6A 1ORRA 1XKLA 2HU8A 3PNOA 3AQ4A 3MF4A 1KRXA 5ED4A 1Z5UA 2AG6A 1ZH4A 2BWJA 3WHKA 5JXIA 4PSDA 2LNDA 4D9HA 4JSYA 4PHFA 2FWMX 3HG7A 2NZ2A 3BXFA 3N7TA 1C9KA 4HAZA 5YASA 3N7UA 1UFQA 3EOBI 1EQUA 4GMKA 1GG2A 1N2BA 3Q85A 3CV3A 4MQ6A 1YI0A 4WW0A 4XH9B 2WM9B 1D8TA 1XTJA 2FSSA 3P94A 3TCXB 1RKQA 3ZVLA 5IJ9A 2J3EA 1G6KA 1PT7A 1XTQA 4AYWA 4BNJA 4ZFNA 3OZRA 4OHPA 4TQUS 2WTBA 2V6JA 4PGAA 1H8HD 2MMGA 5HJ7A 3BB1A 1UFOA 2ZUSA 4IP0A 4ZAYA 5CDFA 1LI4A 1YKFA 1WPGA 4N0PA 5DHQA 4UVDA 4M1SA 5DBFA 2QF7A 4KIFA 4RDIA 4UNQA 2X0DA 3RJ5A 1TLFA 4X94A 4ETMA 1KZ6A 4DTCA 4WZ6A 5EC8A 4FILA 3GDGA 1C8LA 4OGLA 4B32A 6YASA 1QAMA 1ADGA 2W83A 3ZCQA 1E1MA 2GJ9A 4AJNA 1ODFA 3AFHA 3PKJA 3S55A 1NDUA 2IEDA 3MNFA 2WYOA 3QHAA 5ICFA 2OO7A 2HGZA 1JEJA 2V0GA 3M6UA 2P68A 2GSDA 4JEIA 3SIRA 1I3NA 5BWOA 5KJ1A 2XUPA 3QOXA 3EN0A 2H6EA 3HLKA 4QECA 1V2HE 2FSVC 1XZLA 2EFDB 4G89A 3UPTA 4AICA 3U60B 3DM9B 1PFYA 1RXIA 1OXTA 4HEQA 4M88A 2NZ8A 2P6NA 4B44A 4KNYA 1L7DA 1GRQA 5DSZA 1KQOA 2RHBA 4QARA 4GQAA 2DRIA 1QV9A 4NH4A 2DKNA 3U19A 1NRIA 2VHVA 3PC7A 2IE8A 1IXZA 2BHNA 3BRCA 4PC1A 3A31A 3TD6A 5K03A 3SPXA 5AMXA 1DTWB 5LQJA 2WJ6A 4CEJB 1PJ3A 2HMUA 2IXFA 3E6AA 4OFXA 1NBMA 2P9TA 4KKXB 1CS0B 1Q21A 3AI1A 4IOLA 1F2DA 1JNYA 2EF1A 2IYUA 2JIRA 4WZZA 3WWOA 4F2WA 4CIWA 3FH0A 1VJRA 1YJXA 3AFMA 1EFCA 3SIXA 3O92A 4U02A 4BB0A 3I6ZA 2C9YA 3IT2A 1QHGA 3NGLA 5FYQA 4BLTA 1HURA 4ND4A 2HEIA 2W0SA 1LPNA 3S29A 1PWXA 2VJOA 2MDTA 5TQ0B 2BKVA 1HFJA 2QX8A 5CYFA 1CYDA 1AQJA 4TTTS 2ZYSA 1JSZA 5A5FA 3AB8A 4KSYA 2Q3HA 3WLKX 4YRRA 4BFTA 4PYQA 2Q1UA 3ZHQA 4CCSA 1B6RA 5TQ2B 1J7JA 1EA7A 1ZUHA 1E3SA 1WW8A 3CRQA 2P3QA 4HAIA 4NZ9A 3Q5EA 3B6JA 1QZ3A 5JH7A 2HJRA 4NDNE 1H2BA 4PM4A 1DU4A 5DLDA 3UMFA 1ZN9A 2RHTA 2WD8A 1QAQA 1JWLA 1NIPA 1XMJA 2PKQP 3FNGA 4YV7A 3GN1A 3IP3A 3L18A 5LD2C 1FPQA 2QJRA 3CA8A 5AVYA 2CSUA 1PBTA 2ZI9A 4MV4A 4K26A 3ILSA 2N0SA 3AIKA 1GZ7A 1U0FA 3B1YA 3WOVA 2JKYA 3F6CA 4HDNB 2DC1A 4LDRA 1L5SA 3NU1A 4PZZA 4AT1A 2ZUWA 3FKSA 1Z74A 2TECE 2YC2C 4YO8A 1A7AA 3ON5A 1KDRA 2N47A 1EHYA 1Y34E 2IXDA 3NBAA 1KU0A 1W4AA 3LUKA 1ZA2A 1V47A 3LZDA 2VRCA 3SF8A 5G1OA 1Y89A 1AXEA 2FKAA 4B09A 3N2KB 3Q8KA 4QT0A 1M67A 2PZ8A 3FWKA 4MCJA 4IIJA 3TLMA 5JALA 3ABOB 3ZY5A 4R3WA 4J6FA 5DM60 1Y5LA 4G0PA 2PEYA 4DAOA 1JVBA 3NOOA 2XRZA 2W6CX 1DV1A 3O8OB 3PFCA 4GOMD 4LG1A 1MJNA 4PCVA 5JHGB 5JNLA 4BGIA 5A6VA 2H9IA 3K8OE 3RT9A 3IE0A 2FPGB 2Q6TA 5K3AA 3FDZB 1Z0IA 2V9CA 3AFGA 3KOYA 5F73A 3UFBA 3WBFA 2YS6A 4U7DA 2IBSA 2O3QA 5HF8A 2QP9X 4WDRA 2AOVA 1UQUA 2I2BA 4CDNA 1U7DA 4DM7A 2AFRA 3TZBA 2DAPA 4D79A 3VU1A 4BGDA 1UPAA 4B83A 4DYHA 1ZGGA 1R0BA 5C3UA 3AUXA 4Y2TA 4BRZA 1JKIA 2NU7B 4ZKDA 1SCKA 1KEPA 2CCKA 3BKWA 4PYJA 5A7FA 1E4VA 1AJEA 3NMUF 1DC4A 1HRKA 2Z09A 5E6RA 1G9SA 3AVYA 3HKEA 3HVRA 2J0UA 3WRXA 1KKLA 2P8SA 4A5SA 5SYAA 5BUZA 3WWCA 4ROSA 2FPXA 2IC5A 2ZIAA 4W9NA 3FZNA 1CCWA 2XXJA 1NXOA 3BCRA 3HMQA 2HMAA 2X4LA 4PXYA 3Q0EA 5U1PA 3V1TC 4EJSC 4L9SA 2CCJA 2B3DA 2FCAA 1Y6FA 1SUFA 3CUEF 1PEKE 2N46A 2VZEA 2ZQ5A 4L50A 4BAUA 1L8QA 4EGCB 1K5DA 1OYWA 4GYYA 1KORA 1P8AA 2G08A 3TLBA 1E89A 3TSCA 1T34A 2A9OA 3KD3A 1S2OA 2B61A 2UYYA 4NMMA 3ADDA 3FGZA 5NULA 1ABBA 3K0FA 1I6LA 2HQRA 4M76B 1YZTA 2R11A 4TRMA 1TJ5A 3H1EA 2OAQ1 4EAQA 4CKWB 4EKDA 4MHTA 3U7QA 3HE3A 5THQA 4RMIA 3N0RA 4JUFA 1I4WA 3CW2A 1PFQA 5DJ5A 4D9JA 2BONA 2IODA 2X5XA 1TGYA 1XXLA 2O0LA 4O8ZA 1GNTA 2H5IA 3FDXA 1KI7A 5JJBA 3AR2A 1NM5A 3F2IA 2PU5A 4F2GA 4LZOA 4GM0A 4I4TF 4C7XA 1FPMA 4OQEA 5H4GA 3RIXA 2LTAA 1D4OA 4QYMA 1SXGA 1IOWA 2W0MA 2HH9A 4ZODA 2D5LA 5I47A 1U8UA 2I78A 2APJA 4L76A 4XSGA 3FYUA 1GKLA 3BZBA 1XTIA 1NVEA 2D3WA 3I1FA 2QRNA 1E79D 3O26A 5EQFA 4KWCA 3UB3A 1OLUA 3V33A 4AUNA 2I7XA 1AGRA 1XCBA 2VXOA 2NSLA 1E3JA 2X4DA 4TS9A 2QG4A 4BO5A 1P2VA 1DLIA 2QN6A 2QRLA 1OXUA 2OXCA 3E5HA 2PLRA 2RGDA 3GCXA 4LJ5A 4N0QA 4P82A 3URKA 4G97A 4IMIB 4BO1A 5AW7A 4BVBA 4J0CA 3AEQB 3BMCA 3QLJA 4RPCA 1NUSA 4EB6B 1SGWA 3AY3A 4Q6WA 1ND6A 5I8ZA 3HCCA 1KETA 1N6LA 3M3HA 3P32A 4D8VA 3TQTA 2F55A 4A82A 1MFZA 3ZWMA 4BJHB 5A6SA 3HWWA 3RS2A 4B74A 4JKOA 3ND8A 1VPLA 1M3SA 4FOTA 4C76A 5HS6A 4AB1A 4ZAZA 4AQ7A 1ICEA 3IAUA 4PLTA 2PK3A 2GRJA 3I6MA 3Q1KA 1CF4A 2O0KA 1DUIA 1GFSA 3I09A 4LXQA 1T4CA 3VDQA 3DTVB 4ZHSA 1IQPA 4S35A 5IAAA 2QSZA 1WSDA 1KBQA 2DQSA 2Y6UA 3D8SA 1TECE 4BE7B 1G38A 4C7OA 4UAGA 1Y7TA 1DKNA 2P67A 3AT1A 2G17A 5HNKA 1YJQA 3T7CA 2PSDA 1MIHA 4NCXA 2AYZA 2QE7D 2CVFA 1QQ7A 1M5UA 4UZEA 5H3LA 1N2JA 5TEVA 4HD8A 5CH3A 1PD0A 4GIBA 1JGTA 1N6PA 3E5RA 2GNAA 2GYUA 4NNOA 3AVPA 4FGUA 1ZAKA 4KE9A 4FFBB 2BDTA 4LNAA 4CTOA 1VBKA 2GBLC 2I22A 1Q14A 4FEYA 4N65A 1UMDA 1QE5A 2BFMA 5IVPA 1YR7A 3BG5A 3EMDA 5F9FA 1LD3A 1C3LA 1E1RD 2JGEA 3QM1A 1D2EA 1MB0A 4C01A 1XZGA 3H2HA 3H18A 1NFFA 2HA6A 1P74A 1ESNA 4OA5A 4QD3A 5EIEA 1XPJA 2BMJA 3GMSA 1MQ8B 4RD1A 2OO5A 3D6NB 5MN4A 1UFVA 3PPWA 1EXMA 3M4ZA 1JTFA 5TS2A 1U0HC 1YT5A 5GJVC 3TEMA 1V25A 4Z7JA 2OWDA 4W5WA 4AJHA 5IJ0A 1LWNA 4YCLA 4W7IA 4XCQA 4OB7A 4HDQB 1S8NA 3S5UA 1YQUA 3BJRA 1ORDA 2RGWA 3I28A 5E7IA 3BGDA 4HX2A 2BJWA 5CAEA 4PAGA 4HDMB 3PC8A 1N2CB 2FRVA 3VR4H 3AJEA 1LK0A 1TM7E 3GMTA 4Q6BA 3A27A 1MOQA 3I2YX 1L5HA 2IXAA 3FW1A 2HQSA 2W00A 4BDSA 4EQ6A 4EYOA 4JJIA 1JG6A 2JJ1D 3OPXA 4PYOA 4WA8A 2XDQB 5ETJA 4BECA 4OK5A 1FDVA 4MW9A 2VJBA 4ALJA 3AERA 4Q19A 2IH2A 1FA9A 1YNSA 5DNEA 2DBVO 2A0FA 5DYNA 1QX4A 1UBRS 1MJFA 1QP8A 4JI1B 4DC1A 5IXYA 4BYMA 1S8OA 1BROA 1TRHA 2D4AA 2WF9A 3BGVA 3KOMA 3CUTA 3VR5A 3KJIA 2XDWA 2QW1A 3F1KA 2XTAA 3MLEA 3EXAA 4CR6A 1QQTA 2R6R1 3OT5A 2HHCA 2V54A 3JQBA 4QWMA 3Q98A 4UDXX 4W5TA 3AL2A 3L06A 4AMGA 5B1EA 3GJZA 4RXUA 5JYEA 3I5XA 4AZ0A 1T8WA 2YHBA 1HDYA 2VL7A 4GLJA 4DV4B 3I2FA 2JH8A 2DUUA 2V6MA 2F9FA 2VXYA 3SHFA 4PNEA 3X1JA 1JLKA 4IRXA 4O08A 3ETHA 4RFSB 2FZLA 1ZOSA 4AJJA 2JLAA 3BTSA 5B58T 2I4MA 4Q1DA 1RBYA 1QRDA 1ZJJA 1RJ9A 1JPUA 4CV3A 2WHRA 3SJ7A 1KJZA 2EX1A 1L4HA 2QUKA 3LQKA 3OZCA 4PQYA 4AY3A 3FNRA 3SMVA 2OWEA 1GN9A 1MVNA 4XB1A 4B4KA 3SSAA 3KQLA 2IBTA 1SC1A 3MXTA 1EKXA 4H08A 4EG8A 4YMHA 2G88A 4EJFA 1F60A 1OI3A 4JFRA 1NI4B 2D06A 3L9WA 3M5WA 5F2EA 3W6PA 1ZA1A 1O9GA 4WN9B 1NE2A 2G7ZA 2HA3A 3H5IA 5DHUA 4ZCTA 2AZMA 3ZTYA 2B30A 1CUGA 3U1TA 4C7KA 3ZV6A 1JDPA 3T1VA 4E2FA 1NC3A 2HK8A 2ZIWB 3MWLA 5IRCD 3ZCUA 2ZU0C 4TV8A 4E46A 2J3IA 1SBCA 4HB3A 4L22A 1DDGA 2HSJA 4UQOA 5HIMA 4P92A 3ZDDA 2Z98A 4D41A 1O94D 4YQFA 5EE3A 4N3AA 3RVQA 3WNZA 3MIZA 3MS2A 3LVRE 2CUNA 1E5QA 1U6JA 4MARA 4AD8A 5DKFA 4J9UE 4ZN6A 1FIUA 3NHKA 3HDJA 3TQIA 3HKBA 1A5SB 5K45A 4J7XA 4Q39A 3MTIA 4R8RA 4EPWA 1G8JA 5ALQA 4NU6A 1DOZA 4TZTA 2D2XA 1YRBA 4F3CA 4PGMA 4UMDA 5JBQA 4MRNA 1LPPA 4IF4A 1U94A 9MHTA 3KL4A 5KKCA 4Y1RB 2XZLA 3RS4A 1DKRA 2IT1A 4AY6A 4FFMA 4ID3A 4LISA 3RREA 3DLTA 3P4UA 1XQXA 3K9HA 2FVXA 2OTCA 4RHFA 4X1IA 4U7HA 4KPEC 1P3JA 3FOWA 5J5VA 3CVWA 2C2XA 2Q41A 2QN7A 4BLVA 4G37A 4HFJA 4ZOQI 5HKKA 1YMQA 4D9IA 2HM7A 2F1HA 1YS1X 2GJSA 2WJZB 4ME6A 2E5FA 3ZE6A 4ARSA 2Y1DA 5LQKA 4CZ2A 3ZHVA 1HNXB 2NX2A 3WYGA 1X39A 3MLBA 4WEOA 5E8JA 3RYIA 4GX0A 4DDWA 2ES4A 4TKMA 3KDSE 1DO2A 2FFAA 3RKUA 1R8JA 3R7LA 2D6FA 3FCEA 1JQ5A 4GBGA 5DI3B 5F35A 4DIMA 2B34A 4EX7A 5LL6P 5FPPA 1YB7A 3PENA 4JC4A 5DNUA 2VTEA 3L0CA 1IL0A 2Z8ZA 3O73A 3CRMA 2Q4TA 4GEGA 3OI7A 2H52A 4IH9A 4JY7A 2X0IA 4C20A 1IXYA 1AKYA 2XNSA 3K1TA 3OJLA 5FT9A 3PSAA 2QLNA 5IT0A 1YDFA 2QD4A 1RMTA 2VR1A 3G0GA 4PSUA 4YCDA 4WFKA 1TZCA 1PIWA 1RMYA 2GBFA 3E84A 5GTDA 4KR3A 4ZI3A 5HHTA 1DIBA 4MW7A 1N25A 4N3GA 4NAVA 4K2HA 1WXHA 4QUGA 3ADCA 4G1FA 3C43A 4M2LA 2C2BA 4HS9A 1EHCA 2XRYA 3GLHB 2H0RA 4MPPA 3AXSA 2OHHA 3ONWA 4EJSB 1QP4A 1V1RA 1QIEA 4BZQA 1NXQA 2Q8NA 1H4TA 4P08A 4UUNA 2GFHA 5CHEA 2CWDA 3VKWA 3JCZA 1O54A 1FQJA 4PG7A 4Q1VA 5JJ5A 5FUXA 1H22A 4RAQA 2XXAB 1HE1C 3N6XA 4K6CA 4B73A 1EBUA 4ILKA 5CT6A 3L7CA 4MINA 3KPVA 1LC0A 2F6RA 4L78A 5E6SB 2C0QA 4D4JA 4PX2A 1L3CA 1YFJA 1UF9A 3HY3A 3AVOA 4LYDA 2O8DA 3WRXC 2XX3A 2GJKA 3DT9A 4EEXA 4F60A 2XW6A 2FEXA 3PGMA 1J06A 2P4HX 2QG9A 3SHWA 5KEIA 4E13A 1VPEA 3AV0B 1L9KA 2J9GA 2QJWA 3EZXA 4NJMB 2EEZA 3LA8A 5HKLA 3TBKA 3ZHBA 4EG3A 2JVKA 3PX7A 5TVGA 4U7JA 3C85A 3OC6A 4L7QA 4G0QA 2CDBA 2AFIA 2ON6A 5JPIA 3EC1A 5KMGB 2CFIA 3D64A 4Q05A 4RFVA 1MN6A 1KMQA 1G1MA 1OWPA 5J2TB 5LC1A 4MEAA 2QRJA 2LKCA 2PRJA 1RRCA 4MGZR 2N42A 4EA7A 3FOFC 1WMAA 5H0IA 4UQLA 1P2FA 1QRSA 2FOLA 1KOLA 1AQYA 1UM9A 4QYWA 5AHXA 4CGYA 2PXXA 1YQEA 3AB7A 3EXFB 3IUYA 1YQXA 5B36A 5ADWA 2VKTA 1BHSA 4V0SA 4E5MA 2R8OA 1NM5C 3OFKA 4CFZA 4YAWA 5JBNA 3N0TA 1UJMA 3K8ZA 3LP6A 3A1UA 4G01B 2X3UA 5ILQA 4U39A 4YJFB 2YHUA 2GEUA 2R751 4RX1A 2JI8A 2RSLA 3IERA 4XDHA 2C7PA 4E6EA 2MR6A 3KXIA 4MTCA 4XKJA 3QRWA 4IIEA 5ICGA 2QG6A 3ZU2A 5JROA 2GHQA 3FYUC 4MKGA 4HN2A 1THMA 1YE8A 2RAVA 4I8XA 3JQAD 1WW2A 1AF4A 3LT4A 2WUVA 5K7SA 4XD7A 4ETIA 1T1IA 4NMLA 1U3WA 1G4HA 1L7QA 3IE2A 6AT1A 2J5QA 4RF2A 1BS2A 2YWJA 3NBMA 1QSGA 1XTZA 2AOUA 2XUOA 4R9RA 3HNRA 3SQDA 2ZTUA 1J00A 3EUAA 1NN1A 3PJFA 4GLBA 4IGKA 3WAGA 3M82A 2C1EA 1MR3F 1IZZA 3IBSA 2BE9A 3BRSA 1MRNA 1FMTA 1OCEA 1RKBA 3PU6A 4HWSA 3EIWA 2PMEA 5JH7B 2CF6A 2Z3WA 1SD2A 4LKOA 5EIWA 4D44A 1Y8CA 1T4BA 3OMXA 4MW1A 1OI7A 5BSVA 2OCGA 5CCEA 5CB4B 3BTUA 5K6TA 2NNWB 5AD1A 2I4TA 1VLLA 2QMHA 2WHQA 7ADHA 1DC3A 1DRUA 1E2NA 5A3QA 3TLXA 1AURA 1JKJB 1D1SA 3ZR4B 4YRMA 3L1JA 4NOLA 2W6ZA 3VA7A 4JXJA 1JVSA 4U7TB 4MLDA 4DV1B 3ELWA 3ZC3A 4LJSA 2JJMA 4BNFA 3QKSB 4Q3AA 1CEYA 1V3UA 4X7BA 4OQ4A 5M5BA 5G3ZA 1DMRA 2YV3A 2W2VA 1TMKA 4JSRA 4LQDA 4Q1EA 5JZVA 2HJSA 3R5XA 3VPHA 1SVIA 3REGA 3CT4A 5CEEA 3STWA 1P0CA 2FPSA 2LW7A 1PT5A 2QEQA 2R60A 2ACVA 3EYAA 3F5MA 3K5PA 3PFFA 3PITA 4R2LA 1RLJA 2BI4A 3IAS1 4FW8A 2JFHA 3N2NA 1EZ4A 4B48A 2V4ZA 4ZEXA 4RFLA 4LYGA 4B2LA 5CFQA 1ZGCA 5B1DA 3GI1A 3WHLA 3FFWA 2CGEA 4WK2B 1UK9A 1OGJA 1O0SA 2C7RA 4ZGWA 5KNDA 1BXRA 3HU3A 5IUNC 4GP9A 4HQRA 4OQPA 3S2IA 5I3ZA 3RIMA 2UDPA 3I6YA 4GP7A 2HOQA 1BGVA 1E5DA 2OLKA 3HJBA 4MW6A 5D5HA 4YAGA 3AGQA 1KNQA 1OI2A 1JFTA 1TTTA 3AUSA 5GAJA 1N3BA 1E1CA 2XCIA 4RK0A 1CNFA 4Q5IA 5AM3A 3WLTA 3S5JA 2R7LA 4JBYA 3MTAA 1CE8B 3PR1A 4XRRA 4AG6A 3DB1A 4RPGA 5TT0A 3JQ9A 3SBEA 4DG9A 1JTEA 1EWVA 3NXSA 4YUVA 3OQMA 3HM9A 4LFBB 3N2GA 1OKKD 2Q7XA 4NJEB 1LS6A 5ALGA 5KYYA 2ODBA 4I1YA 4JDPA 4MUIA 5DN6A 3WRYA 4A6DA 1G2QA 4HZIA 3ZLBA 3WRVA 4D8UA 2XQVA 3ZOKA 2POQX 1ZM7A 5CLGA 4ZCRA 5CVTA 1CT9A 2QMUA 3GRKA 3RI3A 3VSAA 1TTPB 1KY4A 5HG0A 3VI4B 4EZIA 5CVDA 4MAAA 1SKYE 1FUEA 4NS1A 5DP2A 1T1EA 4UUOA 3UWDA 1PT6A 1DB3A 1KQPA 1QO7A 2FVYA 3WBBA 1WHTA 1E6CA 2EL7A 1PWZA 2NZUG 1QHIA 3NASA 2GK6A 1PUIA 4A0SA 4KO1S 3ABIA 2P0YA 3DFUA 5THXA 1GGNA 1U9ZA 1NVKA 3H9UA 1UBGA 3JQBC 2NU9B 2XYVA 4GM4A 2AI2A 4YAKA 5C5EA 4RZSA 2Q28A 4FGLA 1HV8A 3RTAA 1C0LA 1EDZA 1GDDA 1V45E 3TUZC 1BXKA 1TE2A 2I7DA 3AI7A 1U6KA 3PT5A 3TLYA 3U3KA 1JR3A 1M1UA 3VPBA 4A23A 1AN9A 3ZE1B 4DLYA 5KYWA 2ZVDA 3A6DA 3WS7A 3G3EA 4HMQA 2GYYA 4X45A 3ZS9A 4TQAA 3B5IA 2JEZA 3PNBA 1P17A 2BL4A 3SU8A 5AXAA 1KY2A 1UBEA 4BY9E 2NO9A 2A33A 2J9RA 1PWYE 2FCRA 5CXSA 5AJZA 3SDSA 2W6IA 4WSOA 5ALFA 2L82A 3GVPA 1NBAA 1T13A 5JNUA 4CM9D 4HGOA 2H1HA 1VJCA 3EIQA 1T25A 4H7JA 4RD4A 2E4AA 3DAFA 4AO8A 4UNNA 4Z7OB 3ZHOA 1SHZA 3RC7A 3RQSA 1M34E 4LPKA 1Z88A 3CZRA 3GL9A 3A0RB 1L5NA 2WFAA 4IO0A 4F9TA 2G06A 3TOZA 5EJMA 3LXMA 1RRMA 1L7RA 4N5IX 1PZMA 3T7TA 4XM2A 2I80A 3NIDB 1TKBA 2QNBA 2XLCA 5JTUA 1DCKA 2R96A 3KZCA 3SF8B 1PK9A 5EEHA 4HAXA 4K6HA 4PX3A 4Y6OA 4ARAA 1IWBB 3MAGA 3NTOA 2X5NA 4Y2XA 4FHFA 3O5AA 3Q9SA 1YDHA 1YU9A 3NUQA 1WMBA 4JYBA 3V1KA 1DIOB 5HQ3A 4HDSA 1ZIPA 4EY7A 3C8ZA 2JAOA 4ZTZB 4U6SA 2GESA 4RQBA 5K01A 1BDMA 2KB0A 2RIRA 3IJRA 3C3WA 1WSAA 2ZIUB 3ZU3A 6REQB 3IO5A 3OO1A 2C4VA 4FB5A 1ID8A 2QLJA 2ZT6A 3S2FA 1YVEI 4LV8B 3Q2IA 1GA1A 1U7UA 3ZDFA 1SCIA 3D6HA 1E9AA 4ZXPA 4UZSA 3ROQA 3GRFA 1GN8A 1R0YA 2EFCB 2GVNA 2JH9A 4KIJA 1XTVA 4FXOA 3C3BA 3CB4A 2WG1A 4ZU3A 1T5DX 3N5CA 3UK0A 3VH4A 3RR2A 1PTJA 2QN9A 2NLOA 2VA8A 1L5KA 4XWAA 4I08A 4Y9DA 1I2MA 1ONBA 2R1VA 1J9EA 2IF0A 1GG5A 2F67A 4YAOA 5M34A 2XT0A 4EECA 5KWEA 2BFDA 2OAP1 3HKEB 2J0UB 3FG9A 3INRA 1WIWA 3KXKA 3K2EA 3WA7A 1IDOA 3P0JA 3TVTA 3SNKA 1CHNA 2W2TA 1C9MA 1H05A 3QF4A 4M1TA 4JI5B 2SKEA 1YC5A 4B4WA 5IDWA 1QDLB 3HO6A 4E2XA 5FOTA 4F85A 2JIZA 1R2QA 1TTQB 3PT9A 1MBZA 5AVOA 1AKUA 5GONF 1LV8A 2FPUA 2CNWA 3UJPA 1W44A 4FYWA 2WTXA 3A6LA 4TVKA 4YREA 1LBTA 4CMEA 4F1WA 1CV2A 3DTVD 4A1OA 1QPGA 3CWCA 1ACLA 2W6QA 3RD5A 1JF8A 1M2OB 2PS0A 2JVIA 5TXGA 4MYDA 1P4JA 2W48A 5ALTA 3WKEA 4BMXA 4FGZA 1AQLA 4BBZA 3QPVA 3U7QB 2XE4A 4JJZA 4P4TA 2DHQA 3WLIA 4OP2A 1I32A 2YWGA 2XMCA 4Q21A 2QX7A 3SLGA 2D5IA 1VSUA 3GBVA 3E9RA 3DNMA 1Z2OX 2PKQO 4RVOA 2XYGA 1WXDA 4AS2A 3G5AA 3VM6A 1N2EA 3VR6H 2XTZA 1WV1A 2VNHA 1GLNA 2B82A 4LCEA 1G7SA 3FYUB 1K89A 4LWZA 2ZWPA 4RPHA 4IKPA 3GLSA 3CJQA 1JJFA 4DFDA 1G18A 4LI0A 4JYZA 1OLUB 1PEDA 3D3WA 4J1QA 4KIGA 1G41A 4DUGA 4CM4B 2EL9A 2NZXA 2ZBGA 3TGLA 2IYLD 3DEZA 2X2EA 3A1NA 4U6NA 5E2AA 4L2IB 2NWQA 3IDFA 1UOPA 3BQ9A 2P9YA 3PNPA 1Z4IA 4FKMA 4GLFA 3EDRA 2VH5R 3KR9A 3KFVA 3UFXA 1BMQA 4U5XA 1NKSA 4PFQA 4B5LA 3BMCB 3ZWWA 4JU9A 1HZZC 4ZGGA 3NTVA 2ZWMA 2PV0A 2F62A 3CEPB 2WHXA 4LC9A 1R6AA 1T35A 3LM8A 1V3QE 2XJ4A 2B99A 3M2TA 4LQLA 3FMVA 2FJ0A 3PXBA 1P2DA 4FPXA 4IDFA 5DCYA 1OYVA 1E2MA 1EE9A 1MC1A 2RC6A 3COSA 3IMFA 1SOUA 4BFYA 4DPLA 4FDUA 4BEVA 3EY4A 1NW5A 5FUYA 5EXTA 3ICEA 1Z25A 2RJNA 4PSCA 2IX3A 3K32A 1YK1A 2JFOA 2VHXA 3BH7A 4QSHA 3WMGA 4KR2A 2ISQA 3O2JA 4KU4A 1BHQ1 1T4CB 3K2IA 4CLDA 2ZZNA 3UV6A 1E9DA 2J0VA 3DOHA 5CHYA 3T0GA 3W5DA 5K3EA 1IBLB 4CMHA 3BAZA 5LA6B 1BDBA 5IPFA 2YOGA 4UM5A 4KV9A 4V24A 1RZRD 4IDPA 2DFTA 3TE7A 3W2IA 1D6SA 5LXTF 3E9NA 3BJEA 2HZBA 1ZOIA 1DG1G 4Z4FA 3EVFA 4LY3A 3FE2A 3WIVA 4HDRA 1J4AA 3EWAA 2BP7A 2FW7A 4AXXA 3ZCPA 2ODWA 2HA7A 3R44A 1ADFA 2X5OA 3ETEA 3UMSA 3BM5A 3G8YA 5D85A 4ATNA 2XCRB 2R87A 4AZ3A 1YUBA 1ZYUA 1US8B 4Z8YA 1UMDB 1VSBA 5BMOA 5LNK1 3NVDA 1WXXA 2BRUA 3FTNA 1F9EA 4JVMA 1OR8A 1U7PA 1RBZA 4D80A 2MYTA 3SYNA 4CKYA 2D0DA 2B9VA 4W5QA 4P0QB 4YDHB 1CUAA 4UBKA 5FF9A 2ZVJA 3V42A 4OAQA 3F97A 5DIZA 5C1BA 3PG5A 1DAOA 3U0BA 4YV1A 3HY6A 1KY5A 2FLKA 1E59A 3B82A 1XAGA 3UKOA 2IXBA 4HTFA 3GBSA 4QUAA 4EFNA 1GCGA 3ZE7A 2ONZA 3RRNA 3QUTA 4RA9A 4WUVA 4RJTA 3LYUA 1HLPA 1W5EA 4LRQA 4XYLA 3AJRA 5CAEB 5JY1A 3QBJA 1I7PA 3KTOA 1JHZA 2QD5A 3S0JA 4UBOA 5HCUA 4G07A 5FA8A 3KOXA 1F7UA 5EHIA 3OZBA 3DCYA 2CXUA 5K3FA 4P3PA 1ZDMA 4IEIA 4BIIA 4LYFA 4EQ6B 2JD0A 3DZBA 3DVRX 4QDTA 1Q6ZA 3C6MA 4P0PB 3MQ4A 1TAUA 3H6HA 3PC4A 3AERB 4JYMA 3LUBA 3W8FA 5KYKA 5JO0A 2I03A 4ND3A 2X22A 3OP1A 3E8XA 4K86A 1ZZEA 1DCFA 1GYPA 2AFHE 3OF2A 4K5QA 5A05A 5KDOA 5T41A 5AVZA 2I6QA 3SEFA 1QO9A 5C7LO 1QPBA 3TQQA 5KTKA 4L15A 4W8GA 4L9RA 1KAGA 2XF2A 4PU0A 3VYTB 4DBZA 2OAGA 5CG2A 1XN1A 1PK7A 1FFAA 3GY0A 4IV0A 3UA3A 3OJOA 1I2AA 3W5BA 1QCCA 4A2WA 3E3OA 3SX2A 1JZTA 1OV4A 3DWFA 4AZ0B 4EO9A 1KYWA 2X1HA 3WO1A 3V4OA 5CLJA 1E9VA 5FPKA 5BQ3A 1X92A 3TRDA 2XBUA 1ISGA 4PX9A 3VUEA 1GQ2A 4F04A 1I5OA 5L3ZA 2ISCA 3ZE2B 1G5IA 2QTMA 3IMKA 2QQ5A 5KWJA 4ZI7A 5L95A 3ZJ4A 2OCAA 4A8TA 4CDGA 1DJMA 1RJ9B 3R0IA 3DMDA 1I0IA 2IYPA 2ROQA 3USCS 4RTNA 4M87A 4BV8A 2C00A 4H6PA 3RHFA 3EUFA 3A37A 5LWHA 2ECOA 2PH3A 2JI9A 1NF9A 3OKPA 4WKNA 3ZE9A 1N9GB 5EIOA 4FIDA 1ZNZA 1GV0A 3L49A 1VCNA 3O7WA 3OE1A 4OSPA 5AOCA 4CMKA 3L8DA 4O2AA 2IYZA 5DHSA 4RKEA 2WIDA 5CLQA 3K6JA 3PHCA 5E9JA 4M54A 4F2PA 1POXA 4KLRA 4Z1MA 2IYTA 2RAUA 2AOTB 3KEOA 3PL5A 4KITB 4TV8B 2V6IA 2XUZA 5ES4B 3IDAA 5AVSA 4M7RA 3T7IA 4J6EA 2EBWA 1PZNA 2M9MA 4CV1A 4XUDA 4DUYB 5F98A 4YP1A 3H7IA 3QVXA 1WM1A 3HCNA 2BTQA 2QUZA 1SRRA 1C8VB 2BOVA 1DP4A 2FEOA 1BQ4A 2C5HA 2Z30A 4X44A 3M1IA 2QQ0A 2EP8A 1EGAA 1TFRA 2ZR0A 1VZ2A 1RU3A 1E1DA 3DDNA 4IYJA 2VP5A 1UKAA 1IZ0A 2NV2B 4RSGA 3EJ6A 1PP4A 3MUEA 5HEKA 4JB8A 3TO5A 1HMPA 1EINA 4Y18A 1OD6A 3TN7A 1ORVA 2GPSA 2P4EA 3AEUA 1T5BA 2HQ1A 3L8CA 2W9XA 3N59A 1VFNA 5K09A 1IJFA 1YL7A 3MYYA 4DDUA 3JAMA 3LT5A 3QKIA 1XCPA 4MLPA 5J23A 2WPNA 3H0CA 1ZONA 4UXJA 1IYZA 3EHEA 3IVGA 2NTEA 5CRIA 1U0SY 3DT6A 3AIIA 5D3KA 1M1ZA 4W6ZA 5KPJA 4MJLA 5T4BA 5CFMA 2Q4OA 2UZIR 1OB5A 1JQDA 1K8YB 4XFJA 1MGOA 1OLSA 5IZ4A 2WD7A 4MVJE 4F97A 2W6JA 1V16B 3RPEA 1PYGA 4L0MA 2QTLA 1YI8A 1L4YA 4Z0NA 3T1HB 3QXSA 4N7JA 1GZ5A 1E2EA 1IPHA 4Q1FA 3KLMX 3AUUA 3SVLA 2W5UA 1ZC4A 2JFUA 4JC0A 3FBGA 4QYSA 1HQKA 4R5HA 3OT4A 4W6QA 4EF5A 4S2EA 1E0JA 3GWZA 5JMPA 1OHHD 2TS1A 3HBAA 3IA2A 1ZHOA 5JADA 4Q9AA 2HF7A 3PFKA 3GXBA 4CM8A 4NXNB 1VXOA 4J07A 2JLZA 1XZBA 1FRQA 5DTJA 4M8SA 3RIYA 1T8RA 5J4YA 3OKFA 4EBBA 4EL0A 5JIBA 1AKEA 3W5VA 1XHLA 1C9EA 2CNKA 3NTUA 3IVRA 3KZNA 1KJWA 4RCZA 4XLTA 4DNPA 1RJWA 1ZL2A 5ILOA 1OH6A 5KSOA 1AVTA 2LCFA 2AI1A 3LP8A 4LJ8A 3I92A 2Z2JA 4OF4A 2GSWA 2XHZA 4US0R 5IVHA 1E2GA 3BX1A 3L0SA 5GVRA 3RS7A 2PVCA 3BK7A 3DE5X 3IVXA 3FCCA 4J3JA 4PG5A 4V3CA 2D7JA 2P2LA 3DW1X 1ZD9A 5FEMA 3V4VB 2WQ7A 4G8DA 1J8FA 2IEIA 3DL7A 3SOZA 1LVGA 2CMFA 2C4TA 3CVVA 3OICA 3B6ZA 1SY7A 3OTIA 4BMCA 3DOFA 2WNSA 3VOBA 1IK4A 1F12A 2AHRA 1A76A 1QH9A 3H2YA 4EHKA 5DWQA 4NY1A 3EIEA 4O1IA 1PTJC 1M8FA 3UK6A 4AVYA 1SG9A 1W0KD 2O20A 3F9CA 1T6NA 4HPXB 4YHHB 3VKGA 3LPNA 4EUFA 5BVHA 5GINE 3ASVA 1FP6A 1G21B 3QVVA 4JJ8A 1E2IA 3GZNA 4A03A 4K8OA 3P9ZA 2QMYA 1HM5A 1CUDA 1K5PA 2CHFA 2VF4X 2WVAA 3DG9A 2A1UA 3F1LA 3TQOA 4ZHQA 1OJ7A 1JE1A 4C05A 4U7PB 3KOOA 1JHOA 1TF2A 2YNMA 5K8CA 4KMMA 3G7NA 1UMBA 4NZNA 4RVCA 4Z8XA 3RF7A 5SY9A 4CG0A 4CYMA 2F43B 2BGTA 2AFIB 3RVPA 4EJ2A 4M1MA 2C9ZA 1O58A 4IJ6A 1VQ1A 2AX4A 2HGSA 2VDJA 3AG6A 3W8NA 2HRBA 2CVZA 2WR8A 2WTEA 3JATB 5ERXA 3UK2A 4CMEC 3ZDYB 3GUHA 1EE2A 3VPXA 4D26A 3FSEA 5JH7F 3N6VA 3OHSX 3ZW9A 3EBPA 1QG6A 2FUKA 2VYVD 4WA7A 3ZY2A 2CVPA 2QV0A 1Z63A 4XW2A 3T35A 2X8BA 4LVNA 3NT4A 1IJEA 1KBOA 3ETDA 3T5MA 4CN8A 3DLBA 2QUJA 5JS2A 2WP8J 1M8GA 4I3FA 2BM0A 2VJAA 1UM9B 4M22A 5KU1A 4P81A 3L6OO 1CNMA 5EYPA 2HBRA 4DNQA 1YULA 2KI5A 1SQ5A 4IQFA 7AT1A 1O6BA 4FGWA 2SCUA 2UUPA 1V11A 2VF5X 3H4IA 3FYCA 4PHTA 2A3NA 4DL9A 2G9ZA 4QDOA 2PGXA 5F5XA 3OIDA 3L41A 3WFJA 3QU4A 1IPEA 3DYBA 2QUHA 4OHUA 1N5RA 2R8ZA 2ZTMA 3V7YA 5J1SB 4IZHA 4XPZA 1WF6A 4PSKA 4F11A 4O59O 3AF5A 3WB2A 2HF9A 3B3GA 3IFSA 1PR2A 5JT1A 4IIJF 3K9NA 1QVVA 4BQOA 5ALRA 1JHYA 3FR7A 4P2GA 1WB9A 1OGYA 3KQOA 4U9IS 1E0KA 3HXLA 4KMRA 2GNPA 4C08A 4JGIA 3PUWA 1XQYA 1TZBA 4IV5A 4JBWA 1KOGA 3WLRA 4V0RA 1C80A 2Q0XA 3F90A 3QPWA 1B0PA 2QY6A 3WLJA 4RU1A 4KWTA 1N5JA 3RADC 4FUQA 1IUPA 3EZ2A 4BNWA 4E5VA 2BI8A 4KQ1A 1P1BA 5REQA 3BREA 4UUBA 1J8VA 1HBJA 4HB4A 1YJCA 8LDHA 3FTFA 1EK1A 3M0EA 3KEMA 4V0ME 1RRGA 2QDKA 3ZWPA 4YFVA 3IHLA 4QHTA 1T5HX 2EBHX 4D6PA 2ZYVX 1KSHA 1N75A 3EASA 6LDHA 1MAUA 5DGCA 1O5IA 2TMDA 4HH4A 5L7YA 5F9HA 5AKJA 1SJ9A 2WFMA 5BN4B 4FLEA 1U7HA 4XWOA 3O84A 5D3ZA 4C07A 5K0ZA 2QLBA 3L6RA 1SG6A 3H2KA 2C4NA 1K6XA