4OSEA

X-ray crystal structure of a putative hydrolase from rickettsia typhi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
283
Chain Sequence
MQINSIKIGPYINLLPLQYIPQHKISYVEFGDPKNKNIILCAHGLTRNAHDFDKIAKELCKNYRIISINYPGRSDSENLKKPYHYNYTTYIKDTLLFFKRLNIKNPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGDYAKKTVLLDDLASAKEHLKLIYAQIGIKNEEDWDYLTKYSVISTFGGKYKMNYDPAITKQEDVKLWSVWNKIKCRILVIHGMKSQILTKSTIQKMKKTNTFDLYEIKYAGHAPSLMNDEEIYYIESWLKQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Hydrolase
publication title X-ray Crystal Structure of a Putative Hydrolase from Rickettsia typhi
rcsb
source organism Rickettsia typhi
molecule tags Hydrolase
total genus 92
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oseA00
5C7YA 5CURA 2QS9A 4BB0A 5A6VA 1MX9A 5AOAA 1YB6A 2ZJ7A 3ESDA 1VLQA 1ZJ5A 2WTMA 2GYWA 2WG1A 4B6GA 4ITVA 1CUHA 2RIPA 2VA9A 1MN6A 2RONA 5ALIA 4U2FA 2GZRA 1SCKA 4UBLA 4DMFA 1HKHA 1X70A 4PQEA 4H77A 4Y2UA 1XFDA 4Q3LA 3EF3A 2I03A 4KAJA 2WJ3A 4BBZA 4M0EA 1DWQA 4MQMA 4RGYA 3BIXA 1IVYA 1IUPA 1CFJA 5AK6A 5IVKA 4J0KA 3JWEA 2B20A 2IX9A 1UXOA 1J07A 3BJMA 4N8SA 1W6RA 2HM7A 2K2QB 4JUIA 5EHZA 1XRNA 4UBKA 1EB8A 1PFQA 3DDUA 1ACJA 2DQYA 1TIBA 5HKBA 4C4YA 1A88A 5FKJA 4RNCA 5T4HA 3C70A 3KWJA 4X6YA 1XLVA 3A6ZA 4E46A 1R1DA 2OQVA 4YASA 4DSAA 4UUQA 3AJAA 3C5WP 2RAUA 4L3WA 3FYUC 5AKHA 5A7GA 4DGQA 4PV7A 4LYEA 1LPAB 1TKRA 2AJCA 4AO7A 2JEZA 1YA8A 4B0OA 1CUFA 5AI4A 4I19A 5AK4A 5D6OA 4WFJA 1XKLA 3IBTA 2Y1KA 4FFWA 2XUPA 5JAOA 2V96A 3BL8A 4P93A 5AM2A 5ISMA 1CUWA 3I2JA 2HA0A 5K3BA 1QGED 3CN7A 5FPPA 3BJRA 2CKMA 5DYTA 2JGJA 5DYYA 4ETWA 4B85A 2RGUA 4EZIA 4E14A 4C88A 3EQ8A 5T4EA 5HF5A 4PSCA 3WK5A 3G9ZA 4B84A 2HFJA 4BATA 1BS9A 2GBIA 1IUOA 4BDSA 5JANA 4BAGA 3W05A 4NMWA 2HL6A 4J0IA 3WWPA 5EHXA 2P8SA 1UK7A 4GWLA 2G63A 2PSHA 5LP1A 1XRQA 5LZ9A 1JJFA 3GA7A 4FNMA 5AI9A 1UT6A 3PDCA 3DNMA 1ZGBA 5IVHA 5E4YA 1R3DA 5CH8A 3BDVA 2QUBA 3G7NA 2PU5A 3C6YA 5JYCA 3ZV7A 5I8PA 3BIWA 3ICVA 4MXDA 4UBOA 4BP8A 4DLNA 1RP1A 4H35A 1CUIA 1G5FA 1CUVA 3SK0A 2OLEA 4X71A 3IIIA 1CVLA 2EDAA 2PPLA 4BP9A 2G5PA 5JAPA 4F5ZA 5JZ9A 1QO7A 3AIMA 4EY5A 2VQ6A 3AILA 4UBNA 1UK9A 4CG2A 4DM7A 3M82A 1DQYA 1J2EA 1SOMA 2VATA 4UHCA 5ALXA 3FWHA 2V9ZA 2QM0A 1UK6A 4J03A 4E15A 3C43A 5DTJA 1H23A 1DU4A 1CRLA 2C5GA 5SYMA 4NZZA 1E89A 5K3AA 2WSLA 2QTBA 1ZJ4A 1C7IA 2BKLA 3FLBA 1VZ2A 4HXGA 3DQZA 5CT5A 2WG0A 1OCEA 2WFLB 4A23A 2O7VA 3VJLA 1R9MA 5CT9A 2V98A 2GZSA 1AUOA 1VA5A 5K5EA 1JJIA 4HS9A 5CH5A 5LKRA 1XZGA 5D7BA 1F8UA 3R3VA 5AH0A 2HFKA 1TCAA 4CIAA 1MU0A 4WJLA 4XVCA 5BOVA 1MNAA 3WK6A 2C5FA 1K5PA 3SC2A 2JGLA 4ZV9A 1IZ8A 4X97A 1SCIA 1LPBB 3MGAA 3F67A 2GYUA 4HXFB 2FUKA 4X85A 1XZAA 3VVMA 2H7CA 1WM1A 1P0PA 4F0JA 3H2KA 1MAHA 2BGNA 1XRRA 1FFDA 3OG9A 5HF9A 2WFMA 1H2YA 4UBMA 1R9NA 3WZMA 3HACA 1OILA 2C0QA 1N5RA 4CG1A 1LPSA 4H7IA 2OG1A 3RLIA 4MQLA 1H2ZA 3QMMA 3H1AA 3ED1A 4GBGA 5ESRA 1EK1A 3WWDA 3N2ZB 1ISPA 5ALTA 4P92A 4Y2SA 2HIHA 3C6ZA 3I2GA 1LPNA 2WLSA 3IUNA 4FMPA 3D3NA 5BWCA 1P0MA 3D4LA 4QE3A 4X93A 1EHYA 1FJ2A 4EA6A 3H2GA 4FLMA 3RK4A 4RE6A 5FUMA 4G1FA 2ACEA 3QM1A 4U2BA 2AJBA 3GELA 1Q0RA 3O4HA 1VKHA 2B4KA 1WB4A 4HRXA 1EA5A 5AOBA 4MYDA 5AKJA 4KRXA 5AKKA 5AKLA 3EIOA 4K6HA 1LPOA 4Q34A 3TRDA 2H7YA 1QJ4A 4MWSA 4UHBA 4EB0A 4G8BA 4UBJA 4CFSA 2QR5A 3I2HA 1E8MA 2Z5GA 4AQDA 1ODCA 3FVTA 4QDTA 3WA7A 2GYVA 3V1LA 4OPMA 5CRIA 1F6WA 5DJ5A 4J0GA 5IVDA 2ZSHA 1UK8A 3UUEA 1TAHA 2ORYA 4GDMA 4QLOA 1U2EA 5JAUA 1SFRA 3QVMA 1ORVA 1GXSA 1FFCA 3HLKA 3B5EA 2ZYSA 4BE9A 2GBCA 5CXXA 3LS2A 5KREA 2JF0A 4BTLA 5HKAA 2HU8A 3RARA 3QPAA 5FOQA 3NWOA 1X2BA 4DTCA 2BCEA 2QUAA 1XZKA 4L9AA 3BXPA 3B3QA 5ALUA 3AZOA 2QZPA 2BUCA 5BWBA 4X94A 1NU6A 5DLPA 3DL4A 2BAGA 4GXNA 3H2IA 5JARA 1QONA 2WM2A 2OCLA 4AMZA 2QRUA 1S8OA 2PSEA 1XZDA 3A70A 3FCXA 2WHPB 5AO9A 3AZQA 5FV4A 4Q82A 5HCUA 4DYHA 4GEGA 5E4TA 1J1IA 1EH5A 4G8CA 4MEAA 3WL5A 3H2HA 5HF6A 4AZ3A 3C45A 2UZ0A 1XQXA 1WCYA 1RYYA 2O2GA 5C8XA 3IDAA 3B12A 5ALVA 3WWEA 1THTA 5AI0A 3O95A 4TGLA 4M0FA 3FLAA 3WYNA 3WKCA 1R88A 3DOIA 4HZGA 1VZ3A 2B61A 1HPLA 1JU4A 5C8ZA 1ODSA 2WHRA 1HQDA 1LPMA 4KE7A 3CXUA 3HJUA 5CBKA 4LKOA 5A71A 2PUJA 4L0CA 1F0PA 1XRMA 2JGFA 2JGMA 1CUXA 2Y6VA 3L1IA 2OGZA 5AKZA 1KU0A 3BWXA 4OUKX 1JT2A 2J3QA 2XUKA 4F60A 2I3DA 4AN1A 5ALYA 5CT8A 2RHWA 3STVA 2JGIA 5ALDA 5JASA 4PW0A 4QNNA 1CQZA 3D2CA 2BUAA 1CUCA 4C87A 5JALA 1T2NA 4Y2PA 3DLTA 4N8EA 1ZI8A 4OSEA 1BN6A 5DNVA 4K6GA 5FPQA 2PL5A 3WKBA 5CXUA 1J06A 1LLFA 3QITA 2WIDA 3QPDA 4XWGA 4WY5A 4X92A 4C4XA 2ZYRA 5T4BA 4UHFA 5FRDA 2CMFA 1MJ5A 4X95A 1AZWA 3WL7A 2OAGA 3HI4A 4WDRA 1GPNA 1YAHA 3S2ZA 2ONCA 5I7UA 4LYDA 2HA4A 2QJWA 4XJVA 1LZKA 2PM8A 1BU8A 4EY8A 1CUAA 1JMKC 4C89A 4QDUA 3NGMA 4BAUA 1EVQA 5ALLA 2ZJFA 1PV1A 2X76A 4DNPA 2ECFA 3UUFA 1H2WA 3WL6A 1ZI9A 2VJCA 2VF2A 4J3JA 4KE6A 3D2AA 4G4IA 2ROQA 3STYA 1ETHA 2WUEA 4BZWA 1JFRA 4DNQA 4OB8A 4Y2XA 2D5LA 1KU6A 1DQZA 5SYNA 2HHAA 1U4NA 4OU5A 2CEKA 1CUSA 4EY7A 1E8DA 5CMLA 2Z8ZA 3G9UA 2PSJA 3HZOA 5AKXA 1XKTA 4W1PA 5IVIA 4AMYA 4L72A 2VJDA 1WHTA 3STXA 3D59A 3WQHA 3E0XA 1ACLA 4TPKA 1XRPA 3O4JA 1CUEA 4K5QA 5EFZA 2QOEA 2PSFA 2IITA 4UFPA 4PF1A 3ZPXA 5A2GA 2H7XA 3ZLUA 3DCNA 4UHEA 3QBJA 3WWCA 4ZI5A 1VA4A 1UWCA 1XZHA 2GBFA 1DT3A 3I6YA 4BVKA 3KDAA 1ZOIA 3HC7A 4B83A 5AIBA 1GQSA 2C7BA 2VT7A 4P9NA 1L7RA 4B9EA 4ZWNA 3HABA 3AIKA 3OTQA 2ZYIA 1XQVA 3D0KA 4GLBA 1BEEA 1R50A 3H0CA 3IA2A 5AI6A 2H9YA 3FVRA 4KAAA 2WUDA 4UPDA 1CUZA 1GT6A 1D07A 2XUGA 1YAJA 2XQIA 1CQWA 1XZCA 4GW3A 4UFNA 3YASA 3DS8A 4X7BA 5AJHA 4ZXFA 2XMBA 4J7AA 4DIUA 3O0DA 1HDEA 1K6EA 1EB9A 4C6HA 3V1NA 4CCWA 3R40A 3ILSA 2HDWA 1BN7A 3F97A 5E4JA 2YYSA 2ZYHA 1YCDA 4Y2RA 4C4ZA 5ALEA 2DR0A 3PF8A 4X90A 4LXHA 1JI3A 1CUUA 2WFZA 2VT6A 4X91A 4JYMA 4G5XA 3DD5A 2HA2A 3LP5A 1EXWA 5DWDA 5FXMA 4CCYA 3ANTA 3WKAA 1GPLA 2XMDA 1XZBA 3WKDA 2XUQA 4Q1VA 1K8QA 4HXEB 1Q84A 5F4ZA 1ZD5A 4MYSA 2X8BA 3I28A 3D5EA 3WI7A 5HQ3A 1E66A 3ANSA 5C8VA 3KXPA 5A7HA 3HXKA 2HU7A 2WIFA 2PVSA 3X3HA 3PI6A 5EHNA 4BCBA 5JATA 1BRTA 1FSSA 2C58A 4BC1A 4BCCA 2PBLA 3G9TA 4X6UA 2WKWA 4C01A 4ARAA 4GHWA 2FJ0A 3HSSA 1F0NA 2WILA 5T4FA 3EQ7A 4IH9A 4EBBA 3A2NA 3PF9A 3H04A 1MPXA 3AIOA 4KE9A 5DNWA 2HA6A 5ALRA 2DFPA 4KEAA 5CW2A 5HK8A 5AM1A 3D7RA 4QA9A 2HA3A 3F98A 5A7FA 1MTZA 1CIJA 1XZEA 1QIDA 2WG2A 1Y7HA 4BTVA 2G5TA 1LGYA 2OXEA 5C81A 3QZUA 3D2BA 4F21A 1M33A 1OXMA 4FNGA 2QJRA 1BROA 2WIKA 4BDTA 3IUQA 3UMJA 5EIEA 4ZRDA 3PUHA 1U65A 1ZIYA 4Y7DA 1XZIA 3C8DA 2ZVDA 1UOQA 5KWIA 1RWQA 3I2FA 2CZQA 1ZD4A 2YXPX 3DYVA 3BF8A 1CUBA 2DHCA 3O4IA 1AKNA 3R3YA 4DNOA 3JW8A 2OPHA 5FP0A 5AK3A 5CT6A 1PJAA 4INZA 3FSGD 1XZFA 4FHZA 3GZJA 1DT5A 3KSRA 1YS1X 1DWOA 1VXRA 2BFNA 4BCDA 2NW6A 5AKYA 1DWPA 1UOOA 1AQLA 3I6MA 3FYUA 1VE7A 3WZLA 3Q8WA 5K3FA 4IQ4A 4KJXA 6YASA 1YSCA 5ALWA 4BRSA 5LZ2A 3ZLVA 3FNBA 3A2MA 1DX6A 2WTNA 4ZGBA 1DTEA 2Z3ZA 2VSQA 2ZSIA 1JJBA 1CUJA 3OM8A 3LLCA 4W1SA 1VXOA 1XQYA 4AXBA 5IKXA 3WKEA 3OURA 3GFFA 3EQ9A 4IH1A 1L7QA 4A16A 3IURA 1WOMA 3FSGA 1XLUA 3STWA 2I3ZA 1YR2A 4H7KA 1GZ7A 3IUJA 3WMRA 5AP9A 3BDIA 4AO6A 2OGSA 3ESBA 2WUGA 2DSNA 3H19A 4I4CA 5ALZA 4NVRA 1UZAA 2O2HA 3IB3A 2QKYA 3ICWA 4QLAA 5A62A 3E4DA 4EY6A 1EDDA 4PNZA 3I2KA 2E3JA 3L1JA 5LIPA 3O4GA 2Y6UA 1MO2A 4J0HA 2WHQA 4BVJA 1HL7A 1JU3A 2ACKA 4OB6A 1IUNA 1QIJA 1FFBA 3LIIA 3U1TA 3WJ2A 4YX9A 4J0DA 5CT4A 4OB7A 2J4CA 1QOZA 1QIGA 4W1QA 3I1YA 4QDXA 5ALKA 4BZZA 3WK4A 1Z68A 4DSZA 3Q0TA 3DOHA 2ES4A 3FAKA 1AGYA 1BE0A 1WHSA 5AM5A 2OCIA 3WYDA 2BUBA 5E2IA 4AX4A 3TGLA 2CUTA 1E3QA 2G4LA 5ALNA 3DYIA 3VJKA 4N5HX 1H22A 4LXIA 1BEZA 1SC9A 5ALMA 3L1HA 2EDCA 1UFOA 2XUJA 3W04A 5FLKA 3W2TA 3PUIA 4CI9A 5JADA 3G0CA 2WUFA 3IVMA 3WA6A 1UKBA 5DYWA 5HF8A 2HRQA 4IH4A 5D3ZA 1N1MA 3RKSA 4EHBA 3TJMA 2W22A 2OQIA 1USWA 1HLGA 1EVEA 4DNFA 1G42A 4DMKA 2JIDA 3M83A 3WIBA 3W9UA 5ALFA 3W06A 1CUYA 1QIHA 2XUAA 4ROTA 3PFCA 1CUDA 1O6GA 3CCBA 1UKCA 4KYVA 5KWJA 5JZBA 5LZ4A 3SWWA 1ZICA 1CR6A 1YASA 1TCCA 1Q83A 2DHDA 4IO0A 3MVEA 3H17A 4P08A 4PSUA 4YPVA 1YB7A 3R3ZA 3IULA 1IMJA 4G9GA 5AM4A 1P0IA 2XQFA 4U2DA 2XUDA 3F9CA 5ALPA 1ZGCA 3AINA 2XUFA 4Q05A 3C6XA 4LHEA 2QXUA 4FLFA 2PU7A 5HK9A 5JZSA 3G0GA 1MX5A 3BE8A 2CB9A 1XRLA 1QO9A 3C8HA 4JH0A 3SX4A 3G8YA 4G4JA 4JYPA 3M81A 1XZMA 2AXEA 1UOPA 1QZ3A 3QPCA 4FDMA 1ODTC 1TCBA 4QDOA 5JIBA 2YASA 3N0TA 1GKKA 1GQRA 4ZV7A 2PX6A 3GROA 4QZVA 4QWWA 1GKLA 4K2AA 3K6KA 1FFEA 4Y2JA 2XMQA 2XQKA 4J0CA 1W4LA 1N8SA 4EY4A 2PKYX 2OAEA 2BJHA 4EUSA 3EBLA 3C5VA 4U2EA 1NU8A 4NS4A 5LZ5A 2IIVA 1THGA 1EX9A 4QEKA 5CTAA 2R11A 5ALQA 3DJYA 1G4HA 4BRZA 1KEZA 5H3HA 2AJ8A 3A2LA 4X3CA 2GBGA 4G4GA 1O6FA 1DINA 4BC0A 4XIIA 4K6KA 3VXKA 1VE6A 1BCRA 2JGKA 3H1BA 2QXTA 4ARBA 2JGEA 2CBGA 1BCSA 5DNUA 2XUIA 3H18A 1X2EA 4H0CA 4GECA 1SCQA 4I3FA 2WIJA 5AM3A 2FX5A 4FBLA 1QTIA 3AUKA 1VOTA 4AN0A 1QIIA 1QIEA 2O2IA 5DTIA 4G9EA 2XI4A 2OCGA 4UBIA 2DQZA 3T4UA 2WQZA 3T52A 1E8NA 2WFLA 3NOXA 1C4XA 3WK7A 4B0PA 5EI5A 4Z49A 2R8BA 3I6ZA 2XMRA 3WLAA 4OYYA 1EK2A 3WJ1A 4S0XA 1AC5A 2Q0XA 4G8DA 1WB6A 2XMSA 2DHEA 3OPMA 3ZWQA 1XROA 1T4MA 4X6XA 3K9BA 5EHQA 5EIHA 5AI5A 5LZ8A 1CUGA 3OC0A 3G9XA 3QH4A 3C87A 1K4YA 1Y7IA 2OGTA 2JBWA 1W76A 4WDQA 3VJMA 3DKKA 2J3DA 2JEYA 3HEAA 4CIBA 3E1GA 4Y2TA 3AFIA 1UKAA 2ZJ6A 3RM3A 3FLEA 2HU5A 3PE6A 1XLWA 3R0VA 4B7ZA 1R4ZA 3QMVA 1N5MA 4DMCA 4WY8A 4JNCA 3KWFA 4HTAA 4V2IA 2Z8XA 2J4FA 3DL7A 4W1RA 4AZ0A 5HFAA 2C4HA 1JMYA 5JD6A 2QVBA 5K3EA 3O9VA 1ZIXA 2WU3A 3IUMA 3KOOA 4Q3KA 1AX9A 2AJDA 2PUHA 1QE3A 2VAXA 4LXGA 4WFIA 2RI6A 1JKMA 1QIKA 1NX9A 1QFSA 3VDXA 1A8SA 3VVLA 4Q3OA 1QLWA 4AB1A 5FDFA 3JYHA 5AICA 4UHHA 3FBWA 1YA4A 1LNSA 2XDWA 4MJ3A 1TQHA 4FOLA 1LBTA 4HAIA 1QFMA 4UFOA 1K63A 4OCZA 4RE5A 1W75A 2XB6A 2H1IA 4Y2YA 4GI1A 1U8EA 2HRRA 2XMGA 3R3UA 3STTA 1CEXA 2C0PA 3F8SA 2I78A 4YK7A 1Y37A 3M3DA 4FWBA 4KACA 1W52X 4J0JA 4PSDA 3ZLTA 4H7EA 2HADA 2VJBA 3CN9A 3C6BA 2W6CX 7YASA 2XQJA 4H7JA 4B82A 3FYTA 2RHTA 4MWTA 5AM0A 4M0MA 3ZI7A 1LPPA 2WJ4A 5EIAA 4H7HA 1MX1A 4KR0A 5ALOA 4TVKA 4CCYB 2WIGA 3HRHA 2FJPA 1IZ7A 4Y2VA 1CPYA 3VKFA 3CCCA 3QMWA 4B80A 2XUOA 5AK5A 3G0BA 2X5XA 1L7AA 2EEPA 4BE4A 2BGRA 1XZJA 3GBSA 3HYSA 3STUA 5HQ3B 3K2IA 4OU4A 3S8YA 5AKIA 5HZGA 4QWMA 1P0QA 2AJLI 4RPCA 3I1IA 1A8UA 2OCKA 3R3XA 4HRYA 1QTRA 1B6GA 1EINA 2WU4A 2O7RA 4N5IX 1YS2X 2XLBA 1DX4A 4Y2QA 2Y2VA 3VISA 1G66A 1LBSA 5K3DA 1MNQA 4B9AA 1Q0ZA 2XE4A 4H7FA 2WHPA 1XZLA 5AI8A 5BV7A 3WK9A 5ALJA 1B41A 4BAZA 2Z3WA 3DKRA 5LKAA 1WPRA 2CJPA 5AIAA 3BF7A 5AKGA 4BYMA 4Y9SA 3U0VA 4W63A 1I6WA 4B81A 1ORWA 2QT9A 3ESCA 3DEAA 5I9IA 3V1KA 2VEOA 1FFAA 4AO8A 2LIPA 1HBJA 3FCYA 1EI9A 5D3KA 1ZD2P 5J3JA 4HVTA 3NUZA 3WIOA 4A5SA 4FBMA 5YASA 1H2XA 3OOSA 4WFKA 4IHAA 4FKBA 3LCRA 1QIMA 3G02A 2XUHA 4FTWA 4JEIA 1TRHA 2HA7A 3AZPA 4FLEA 5ALHA 2XQGA 5AOCA 2XT0A 4X00A 1MT3A 3W9BA 3I2IA 1CLEA 4OYLA 1ZI6A 5AHXA 4U2CA 4W9RA 5HFNA 1XQWA 3LIPA 5ALSA 3F96A 5K3CA 3GUUA 3V9AA 1LZLA 3WWOA 1AURA 5JAHA 1A8QA 2VTVA 3TEJA 2B9VA 1MAAA 2VJAA 2VAVA 5JD4A 4DMHA 2WJ6A 3PFBA 3O9MA 4D9JA 3FYUB 1CV2A 4KE8A 4UHDA 1ZD3A 2XLCA 1C7JA 1E5TA 1QIFA 3G0IA 5K3FB 5LYYA 1AMNA 3V1MA 3MUOA 4H7DA 4CG3A 3WK8A 2V97A 4E11A 5KBYA 5ALGA 4OD0A 4LIPD 5AKEA 3ESAA 3E3AA 4ZREA 1EDBA 3FOBA 4WCVA 4U2GA 2XMZA 3MUNA 4BVLA 4MEBA 2D0DA 3G0DA 3R41A 2XMCA 3P2MA 3H2JA 2YH2A 1W1IA 3R3WA 1A7UA 4FFVA 4N8DA 3KD2A 2DCMA 1EDEA 5IH7A 1GGVA 2Y2UA 4XX1A 1WB5A 4H18A 4KAFA 2PSDA 1VJ5A 4QDZA 3WL8A 1WPXA 5JD5A 2HA5A 5LZ7A 3PICA 3QYJA 5EGNA 1GPKA 2QMQA 3V48A 4O08A 4PO3X 1TK3A 4KRYA 5LLSA 5CH3A
chains in the Genus database with same CATH superfamily
2EFJA 5C7YA 3KSBC 4WVLA 1WNFA 1D09A 1WWKA 2GM4A 2WWVD 2BH2A 3IELA 4RELA 2LV8A 1LLQA 4EHJA 2WWIA 4GOXA 3RYFA 5DXJA 3X1ZA 1HC7A 1Y3CE 3FB4A 4ZANA 2R1TB 3UXYA 1KQGA 5IMBA 2WE7A 1ZCFA 3ESDA 3SKVA 4D9EA 1VLQA 3VKHA 3VYSB 4HX5A 4BBJA 4CTNA 4IVPA 1FTYA 4XWOA 3S81A 2WTMA 1IL0A 2GYWA 3O38A 3A4YA 4NESA 1YIDA 3R9IA 3TLJA 4YUWA 5IXJA 2E4VA 5HSGA 4ITVA 2OD2A 1W0KD 4UUMA 9LDTA 6REQA 4HDMB 5CCEA 3CNOA 1RMQA 1KI4A 1SD1A 1KPGA 2I2FA 1PEAA 4FB4A 2O3RA 2EHDA 4NZPA 4EG5A 2O19A 2I34A 2DT8A 1YTUA 5U9CA 1CY8A 2XGSA 3D6TB 4PU0A 3SSOA 5LQRA 3RCBA 3S7TA 1T6NA 4U2FA 4EB8A 3GJ6A 4A7PA 4LZJA 2FEKA 3FMOB 1U7ZA 3PDIB 4W99A 2E6KA 3VR2D 3E3LA 1FP4A 1X70A 2WNSA 1FDWA 1GQ2A 3B5IA 3GFSA 4NV3A 1RQ2A 1XFDA 3Q2OA 3EF3A 4Q3LA 1AQYA 4Y2UA 4J3NA 4RPJA 3W2HA 1NXTA 1GZUA 2B7CA 4DBZA 2AFIB 2V54A 4ARSA 3U56A 4FX5A 3P32A 1MJFA 3HJBA 3OZAA 2AS0A 4M0EA 5I9MA 4KXFB 4GL2A 4M9SA 4LMPA 4RGYA 3ER8A 1Q17A 1MOSA 3JQ6A 2VDNB 1CFJA 4ZMBA 2WOOA 1VMKA 1JFSA 4JENA 2IP2A 1B7GO 1WE2A 4HQFA 5D1NA 1JIQA 1LLUA 4L9WA 3L0CA 5I4KA 4KQCA 3TL3A 1B0PA 5IVKA 5A4JA 1XLTA 1ZBQA 3JSXA 3GNSA 5SZHB 4MTCA 2W2OA 1BSVA 3ZZNA 3ZWWA 3HLYA 1NUSA 2IUEA 2VOEA 4H7PA 4CQMB 5C80A 4XE5A 2N1MA 5TPZA 4EAQA 2K2QB 2OLKA 2XJ9A 2YIVX 3WLSA 2I6SA 4D92A 4ZC8A 2WPDD 4W6ZA 1Z4NA 1QAMA 5B58T 3WDLA 4A6DA 1SCBA 3BGSA 121PA 1ECJA 2GVZC 1PFQA 3DDUA 2AHRA 4TS3A 1ZRNA 4HK4A 2DQYA 2ZW9A 1N2BA 1TD1A 5L4SA 2ZZNA 1L7OA 2VWHA 5HKBA 1KP2A 3GT7A 5KSOA 4M7OA 2A6PA 4WUTA 4BNTA 2VS1A 3KWJA 4KGZA 4XIYA 5AW8A 3LX8A 1C8BA 2ZSKA 3UMRA 4NCBA 2ISQA 1MDFA 1XLVA 4L51A 3GP3A 4E46A 4FMCF 5A9TA 2J46A 4TZ6A 1NJ8A 3DVQX 4JI4B 4K6CA 1MENA 1R1DA 1KF0A 3NHJA 4YASA 1ZITA 1SXJB 1VLVA 2KLHA 5SY9A 3C5WP 3IAHA 3S27A 5ELXA 3FYUC 3KUXA 2DU8A 3N8GA 1M6VA 3KZMA 4IQGA 4U0KA 4QFMA 1COWD 1YGYA 3DTYA 1BMTA 4LYEA 4DHWA 2AJCA 3R7SA 4HI0E 4EJ2A 4B0OA 2DM6A 3D7KA 2IQIA 1X86B 3HWSA 2VZ8A 4RD4A 1P39A 2XCUA 1ZXBA 4FJ0A 4TWZA 5AK4A 3VDMA 1UPXA 1F48A 4B3GA 4EX7A 3UMSA 3DAHA 1HFJA 2GLXA 2N1BA 2Y1KA 5AHOA 4BMCA 1KK3A 4FFWA 1YZNA 2XUPA 1XTSA 2BFEA 2P9GA 2V96A 4HNQA 3SBOA 1JLKA 3GJ8A 1N57A 3BL8A 1XD2A 1A97A 4P93A 2PMWB 1KDOA 4TV8B 4BB9A 3C3BA 1GAXA 1YUBA 2EGUA 2I6QA 3SYRA 3TNFA 2A78A 4A0GA 1QU3A 2HA0A 5K3BA 3CN7A 4LRYA 1CR0A 5FPPA 1CQIB 3N05A 4LXXA 4ZVLA 1P6XA 1VHDA 4HDKB 3RK1A 1N2IA 4ETMA 2JGJA 2E4XA 3IBSA 4YJ3A 4WBNB 4JWTA 3TQSA 3OU7A 3EC1A 1YQ9A 3GHHA 4UUNA 4E14A 1IDN1 3UHAA 2R6GA 1JYEA 1UBHS 4I50F 2RHHA 1VYTA 1M8KA 5CR9A 3RS0A 5T4EA 3WDKA 1OLXA 5DHAA 1XTRA 2Q7OE 3G9ZA 4RADA 3RIEA 4HH0A 4HYEA 1XAIA 5FL7A 2HFJA 2MIIA 1HYEA 2JJMA 2XTZA 4YP5A 3T1VA 1FS5A 1XPOA 3GARA 1VBNA 1Y1LA 5JANA 3EBPA 3HSYA 2OILA 2Z9DA 4PX2A 4BAGA 4XOIA 4C0WA 1W49A 3TDKA 4DGSA 2QV0A 4P4UA 3OF3A 4MUEA 2F62A 3E22A 5B7QA 4NYMQ 3A2KA 4J0IA 4O6VA 3A6LA 4Z1MD 2P8SA 1XZ8A 2XKAA 4GWLA 3QEOA 3OE4A 5CLQA 2GESA 2R5WA 4DA9A 1UEXC 2W93A 2FP4A 1GAJA 1MOZA 2B8TA 2QHXA 3FGOA 3IR6A 3GEDA 4FR5A 2NVUB 2YV3A 3PDCA 2D3WA 4A5OA 1ZGBA 1K4MA 1EVZA 1HL3A 1JQKA 1JZQA 1PDVA 1Z34A 2I87A 2VHTA 3EVDA 3GT3A 3KZCA 4HWRA 1EFPA 1CS0A 4D8UA 2QUBA 3CX3A 2PU5A 3F1KA 3G7NA 2OFPA 1KYWA 3AETA 5CD1A 2OORC 2X0JA 1U5BA 2QU8A 4LISA 1YBFA 1HLPA 3BZWA 3ESRA 3ICVA 2O5RA 1U81A 1XD8A 2JLCA 1LTQA 3D81A 4MXDA 4QU0A 4XQ9A 4ZKEA 2O1EA 2QAJA 3EYWA 4KDEA 4DLNA 5A4FS 1AQJA 4BLOA 3HLTA 2WUVA 1JIIA 1GGJA 1XT6A 2IXEA 1OU0A 1ENYA 3OMXA 1A5ZA 1WP4A 1G5FA 3Q3IA 1E0JA 4OHOA 2CLEB 5CTJA 1TUGA 3I45A 2PFKA 3T12A 8GPBA 1SC1A 3ZEIA 2AN5A 2IZOA 2OLEA 5L51A 1H66A 1M1NA 4G5SA 3ZY2A 3U44B 3U4IA 4WGFA 3IIIA 1M75A 3GGDA 3KYDB 5LQAA 1II0A 5AWFC 4JHXA 2AFRA 4TTQA 5JHHB 3R6TA 5JSHA 3LQ2A 2FH5B 5F33A 3LLVA 2FPGB 2FSFA 1E0SA 4DJAA 2RAFA 4PC2A 2GF0A 1T0IA 2ZB4A 3I73A 4URVR 2BMVA 3DB2A 3IHTA 3KV3O 4FSXA 1OFGA 3QOWA 2VQ6A 1NBME 1O87A 3C4QA 4TSFD 3W8NA 2FZ5A 3O8LA 1OZFA 3QWBA 5CNMA 1P1RA 3WOVA 5IS2A 2V7VA 4PAWA 1I0ZA 3IKLA 3LBNA 1Z56C 5JCJD 3BRSA 1NBHA 4D6YA 4PG6A 3D6JA 4NCHA 1WA5A 1RAEA 3OZWA 1M7HA 3I6QA 3QG5A 3GGJA 4UHCA 4R1QA 1KOFA 4CDMA 2XHEA 2BM9A 2QM0A 2GXAA 4IIXA 4RGQA 2BEKA 1UK6A 1Y3HA 2B69A 4Q1FA 5DTJA 3I3SR 1Z4QA 3V00A 1H23A 2D1YA 1DU4A 1XU7A 4IJWA 1CRLA 1UBTS 4MW4A 3WNZA 3DWEX 5F4BA 1JGTA 3T61A 2ZUSA 3KJIA 2W43A 1WSWA 3USCS 1DDIA 1V7ZA 4YJHA 3OZVA 2G82A 5AW9A 1PWXA 1RAHA 2WSLA 4BNGA 4EVIA 1E1RA 1KMHB 3VYVA 4XWWA 1XE3A 4MV0A 2QTBA 3QF4B 4JJAA 4MV1A 1E58A 5AVQA 1C7IA 1L1QA 4G1VA 1VE3A 2BKLA 4WOBA 5EIXA 2ZIZA 2GZ3A 1O54A 1VZ2A 2H5JA 2R8YA 3Q5DA 1NN0A 5IUKC 4TUYF 2JJYA 1LH0A 2WG0A 2YZ7A 3QSGA 4HNRA 3DNFA 4M89A 2W7TA 1L7DA 1XZPA 4D7AA 2H06A 3LDUA 2O8FB 2WFLB 1VL5A 4TS1A 5I4IA 1EVYA 4RVHA 1NQVA 5CLHA 2QRPA 2ZCVA 4NOJA 2FEXA 4A23A 1G8FA 2EP8A 3OP4A 4AJ9A 2WWRA 4FMBB 5FFFA 1JXMA 3FSRA 4MPDA 4TQUS 3AOEA 3HYCA 4TLDA 5DHUA 3PZRA 3VJLA 2PZJA 3FPSA 5HQJA 6ADHA 4IMIB 2F48A 3TMYA 8AT1A 3NAMA 2Y0EA 2BTQA 5CH5A 5KEIA 3KR0A 3F0TA 3CNQS 4RD3A 5D1HA 1NJ5A 1F8FA 3WRXA 4C1BA 1YB1A 2PRSA 2AN4A 2D3TA 4C6SA 3VSCA 3AEKB 3OCZA 2WYUA 5FULA 3TMAA 3GVHA 2Z04A 2MDTA 2VP0A 4HLCA 1H1TA 1M0EA 1FNCA 1WQ4A 2NXJA 2QPOA 3BKXA 3PCRB 4HDNB 4PYKA 3KLMX 3RVJA 1G8AA 4JB2A 3SC2A 3WLIA 3AKZA 3H8WA 5B7GA 3ZJVA 4BMNA 2XR1A 3KWLA 1Z39A 5DK4A 5F3DA 2PX8A 3RJTA 4LGVA 1PWZA 4CV3A 1XZQA 3HCWA 3BS4A 3A1VA 2WSYB 1PFYA 5CDUA 1W30A 5I45A 1MD9A 5L53A 4GT1A 3SLRA 2PNJA 4YCDA 2IP4A 3J81k 3NH9A 1CQPA 1E3LA 4HXFB 2OXFA 2BM8A 3HJTA 3RQIA 2YV5A 5DT9A 4CLOB 2FQ1A 2ZRMA 3MQFA 1CY4A 1T15A 1OXXK 3M3PA 1NUTA 1P0PA 3ZQUA 1IN5A 4F0JA 3PXGA 4OFZA 1D04A 3H2KA 1I3MA 2FRXA 2R4UA 5D8DA 5HE9A 2BGNA 4V38A 5B1IA 3W2FA 1NC1A 4W5QA 4CNQA 2HT1A 1H1DA 2WSBA 4S1VA 2IPAB 3ZS9A 5C1DA 4NMHA 1AHNA 2OO5C 3SHVA 5CM9C 2P2YA 4NZNA 1TKAA 1ZUNB 2I2WA 3QUCA 3FAZA 4Q5IA 5B53A 3U49A 2CFIA 2OT3B 3P7MA 5LP6B 3HACA 4UCQA 4WGGA 3BAFA 3SBXA 2G40A 1QLJA 3MMZA 4CG1A 3IVAA 3S0JA 3MTDA 1RLIA 4LFCB 4S04A 4NE7A 2OFWA 2F3TA 2OG1A 5CB4F 1YBMA 2O0LA 3D4NA 2Q29A 1XPUA 3D6MA 2LDBA 2WAYA 3EXEA 4MR8B 3QMMA 4YA6A 2O4CA 3H1AA 5KJEA 3W3AD 2QTMA 1F17A 2HRDA 3GRPA 3GX1A 3VPDA 4GUAA 3LQKA 1OX4B 1P5HA 1OLUA 4YHHB 3Q7EA 1DBPA 3EARA 3WWDA 3HA5A 3ANXA 2XCTB 2QD4A 2BISA 2P1RA 2VT3A 4QTUB 3KQTA 4YY3B 2NX2A 4A0FA 1PR4A 4ZYTA 4HH1A 3I2GA 4C08A 1LPNA 4EHFA 1I7NA 1VLZA 4ZQEA 4DQLA 3AU8A 3STHA 2PVCA 5KYWB 5EXDA 3IUNA 5E1MA 1FBTA 3CBGA 4GMGA 3HB9A 1F0KA 1QVZA 2FEMA 2FWMX 3EFOA 4M53A 1CBUA 2WAOA 5DM4A 4B5LA 4HR7A 4TXMA 3K1YA 4CEJA 4JLOA 1JUDA 1T36A 1ZC4A 3TRFA 4OL9A 2CV2A 2FWPA 4MPPA 1ZO8A 1JDZA 3HVUA 2R1VB 3CEPB 4C7JA 5IHPA 5L8VA 2BFCA 3KKPA 3L5KA 4RE6A 4XGIA 2HMAA 5KYTA 1QVVA 2JBAA 4HTFA 1VMEA 4IIFA 1GN9A 2GMWA 5K3SA 2C92A 2WP8J 2Q3JA 4Q47A 2I4IA 2ACEA 4D4LA 2MYPA 5G2OA 5LPNA 2J48A 3B6MA 2AOTB 4EKGA 2QTVB 2VPQA 3GELA 1GGEA 3NYIA 4KQIA 2RD2A 4XUDA 5DGIA 1D5WA 4WN9B 3PKZA 1EA5A 2IU4A 2RKWA 3OI7A 4WOCA 2FXVA 1UPAA 1FFWA 2MCFA 4NP6A 1G3RA 3MRSA 5ETJA 3HBJA 4E51A 3D3WB 1YMVA 3VR3D 3RRJA 1NRJB 4CM3A 1Z8FA 3CFYA 5AKKA 4C43A 2C8JA 3EIOA 2FETA 1G2PA 2VQSA 2Z3VA 3NTQA 5JAQA 3AKYA 3TRDA 3UG7A 1WULS 2Q1UA 3WIEA 4UHBA 5C9ZA 3R8XA 3U4HA 1HFKA 2C4TA 1YRQA 3FTPA 4A03A 3ZHUA 1NVBA 5IW8A 4XXHA 4BJHB 3C7TA 4FFMA 1B8NA 1DADA 1MFZA 2P9EA 3MT0A 4QDJA 4DYVA 4MRPA 3KQSA 2Z5GA 4TXLA 4L8GA 4FHCA 3O21A 1U5CA 5F1YA 3SIRA 5HW0A 5C3MA 1A77A 1I1QB 1ODCA 1KNQA 3DV9A 1JG6A 3FVTA 2ZRGA 4CV1A 3AI2A 3WA7A 4H59A 1MO3A 3K15A 3GP8A 3HXOA 3ZJUA 3EGWA 4TV9B 1F6WA 4J16A 1HE2A 2JHPA 4J0GA 4KO3S 4GQBA 1AKEA 3DCJA 1Y5NA 1T9ZA 2H5LA 4V0OA 3UUEA 3C7AA 4GDMA 3U7GA 3IOMA 2DPHA 1SFRA 2EBFX 5JAUA 3KPYA 3DLIA 1ORVA 1ZGZA 5CNKA 2BF7A 1TK2A 2F90A 2Q6KA 2IH4A 4P84A 2JFWA 3PYXA 3PE3A 4QVGA 1FFCA 3HLKA 3N86A 4WFQA 3SLGA 1AGPA 1IY9A 3B5EA 4NKRA 1CYEA 3QXHA 5B2FA 3LS2A 2IXTA 3CR7A 3U1VA 1T5BA 4DV1B 5KREA 3MEQA 4N7BA 4ON9A 1T3TA 4O2LA 3BMOB 3LKZA 4RF2A 3MNFA 3MIZA 5AR1A 2PPVA 3I4LA 3EVFA 5LXTB 4TLAA 2FDCA 2PVPA 2X41A 1PO7A 3QXXA 1C9NA 1IEQA 4R1UA 1E2BA 1KJQA 1NW7A 1YVUA 2I62A 2NVOA 3BYZA 4FZVA 4ZAYA 3RS9A 4C0KA 2IIPA 2BCEA 2CVHA 2CLLB 3ONDA 2WOJA 4DTCA 1HDCA 4BWFB 1M6HA 1QG6A 1Z5ZA 3Q5GA 1I6MA 4CV0A 2QUAA 2ZRIA 4B76A 5BW4A 4L9AA 1OH7A 3COWA 4NPCA 3EZGA 1JDJA 1NBEA 4P81A 1JHAA 1O3YA 1N5DA 4JJGA 3QX3A 1AOXA 4LOJA 1NUQA 2AJTA 3AX6A 5DX8A 5FLYA 4WKNA 4EHNA 3K1AB 3L04A 2RGEA 2XF8A 3B3QA 4B6PA 3RVMA 3W79A 3HJRA 2JI4A 1YNOA 3ZBTA 1VLJA 5JRDS 1MQ8B 3E5RA 4P7FA 2R85A 4NCAA 1FNMA 3JAKA 3L4SO 4F06A 3BMNB 2VDWB 2HDOA 3A4VA 4R2XA 3BMQB 3PE4A 2B8WA 4YAOA 2OP0A 1O8BA 3DQPA 4GXNA 4PG5A 1ZUWA 3G5AA 4YMVA 1RLUA 1EM6A 2RE8A 5JARA 3ORRA 1WCIA 1BRMA 4BXOB 1BWRA 3IEMA 3GLUA 1IH8A 1QXSA 1GNLA 3LY8A 1R5NA 4IJMA 3FF1A 2F1OA 2QRUA 4C4TA 1HY3A 1VKOA 3FYHA 5L4LA 1RXEA 3KJGA 4B75A 2Y99A 3S2IA 4OFWA 1FYDA 4MIOA 4MLPA 5DXFA 5AO9A 2G70A 4RC9A 3TAXA 4MS4A 2QTGA 1R00A 1VGRA 2VAPA 4P2BA 1FYVA 3C24A 3UZUA 3EW7A 4FINA 4JQSA 1V7PC 1QNFA 3P2JA 1ZM4A 3ET4A 4H17A 4DYHA 1N78A 3HXPA 2PIAA 2EQBA 2IWHA 4BL5A 4D1YA 3GPLA 3M33A 4NG4A 3MZ0A 1XVLA 1EH5A 1LTHR 5H3CA 1KSJA 1R15A 3UY4A 4YXFA 3DFMA 5BQFA 5KQGA 4L8VA 4MCIA 3BH6A 3PUWA 1SB9A 3G2QA 4B32A 4MNTA 3HZRA 4ZVOA 4G8CA 4U00A 1RMTA 2IL1A 4MGYR 2XPCA 3L7YA 3HQ4O 2G76A 4LGMA 1Q1EA 3C3PA 2EL9A 3H2HA 2P9JA 1MDBA 3JAWB 3ZWYA 1M5RA 7MHTA 3Q3EA 1ESDA 4YQZA 4A6PA 3AXTA 2NWQA 3ZDQA 1GU1A 3A36A 3U4GA 1GRCA 2D2XA 4MIYA 4CM9A 1NDUA 1USGA 1WCYA 5AW1A 4TT3D 16PKA 2CL5A 3B7PA 4J1NA 3RAEC 1P73A 4KXMA 1QK5A 1Z3CA 2B0CA 3T8YA 3WB1A 1JLLB 1XI2A 3IDAA 4YV2A 2PLWA 3PIRA 1OY1A 1XK7A 2VP3A 1MO6A 2V74B 3ZE0B 1E7SA 1E5DA 3CVOA 2CXRA 4MI3A 2AMYA 2WJVA 2BKAA 5AI0A 5A4MS 5JSQA 2C9CA 4N48A 3GV0A 2MSEB 3O95A 3QWAA 5DI9A 4PFKA 2IYEA 4UTNA 4FHEA 1R88A 4LAFA 3EULA 3JQ8B 1B8OA 1UADA 4DR1B 2C0CA 3P71T 4P22A 4IJVA 5EP2A 3B2QA 4IIEA 1GP2A 5TMPA 4K7JA 3AH8A 5CK5A 1ODSA 2JZOA 4AP6A 5IK2A 4W5JA 1NNSA 1XZNA 5F9HA 3W7VA 2DWOA 3DE2X 3BFJA 3F5FA 2FFAA 5A71A 3M2PA 4K05A 4DLPA 3HKCB 2FVXA 1PT8A 3ORSA 5A04A 4BO5A 1GPAA 2VDOB 1XRMA 5JROA 2C9YA 2XRFA 3R7BA 2Y6VA 2HMYB 3T3HA 2R6JA 3HADA 2C3MA 3I4CA 4FI3C 4RS4A 5GMOA 4Y9TA 1QHYA 1KU0A 1PR5A 2HNAA 2ZRHA 4FXOA 3SD7A 2COEA 3EISA 4E4YA 3KEMA 4E08A 2XBUA 1YE5A 1J0XO 4QHSA 3Q87B 4BFVA 1KI3A 5JOQA 4KYIB 1CJKC 3OZCA 4RA9A 3HR7A 4KYTA 3UAVA 5F76A 4F60A 2VK4A 2ZJ8A 1KTVA 2DLDA 1EEHA 2L2QA 5CT8A 1GG8A 2PYDA 1P91A 1XG5A 2GEJA 2AE1A 3A6KA 3NATA 1B6TA 5TQ0A 3WRVA 3STVA 2AC4A 2EBHX 2JGIA 1X9GA 2FPWA 3K09A 3RTBA 4FCWA 4IHQA 4HT3B 5ALDA 1RHKA 4I8DA 2X9LA 1X1CA 4UCWA 2V4ZA 3MXOA 4XM2A 3AEXA 4R0MA 1W0JD 3IOEA 3RJMA 3W8FA 2XH8A 4C87A 1DC4A 5E0OA 1T2NA 5LOVB 4ZU1X 4Y2PA 3JQDA 5BR1A 4FZRA 2PEYA 4GMHA 5DTRA 3W8RA 5JS6A 1Y89A 1K86A 5JYDA 3A1DA 2QRHA 2QUJA 2C5HA 1I4WA 3RHSA 3BTOA 4N8EA 4RMHA 4IQFA 2IPOA 1TVKB 3FR7A 3CZ5A 4WASA 4K6GA 1W5FA 1K7EB 2GZMA 2E0IA 3G59A 3EZ9A 3EIQA 1BGVA 1DOHA 3P2KA 5CXUA 1U6IA 1Q14A 5MN4A 1VTKA 1C81A 2BCJQ 1OA1A 2HK6A 3QLEA 4G0XA 4X1IB 3CKMA 4XWGA 3RSFA 3GLIA 5DSXA 3FWKA 4C4XA 1S2GA 3CNLA 2OO5A 2Q7DA 3EDCA 4Z4CA 4UM5A 2M9MA 1C80A 4JY7A 2A86A 4PN3A 1C41A 1Z2AA 1J42A 4HNHA 4PPYA 1VPVA 5BN3A 1W36D 1D7OA 3BWYA 5E95A 3M6WA 1Z26A 1J39A 3FOCA 3BIOA 5CVDA 2BRUA 2ZUTA 5BQ3A 1I10A 2A9PA 1GPNA 2M1ZA 3T9EA 1AQIA 2C2XA 1GCAA 2GAJA 2HPZA 3QG1A 2VHVA 1U6JA 3AWIA 3EMBA 3ND7A 3PNKA 4RPGA 3GEGA 3U3KA 2G04A 4Y1GA 2P9TA 4IOJA 1C8VB 3U9SA 2IH5A 1P29A 3W6OA 3JYLA 3EDOA 4EY8A 1O6CA 4ZFNA 4R8MA 5J2TB 1C9JA 1QVWA 2Z2KA 2Z6AA 2QTNA 1EJ0A 1AO3A 4LY6A 4QDUA 1YF3A 4O33A 4BAUA 2KBFA 1F38A 2WU1A 5IC6A 4NCJA 5ALLA 3K1ZA 3G1TA 5FWYA 4KO2S 1OXVA 4GPAA 3RS4A 3SEAA 5CB6A 1ZNYA 2JJ8A 2ZIXA 3FVWA 2C8LA 1I14A 4JLBA 3MK31 2VJCA 3EFEA 3T3MB 5KNCD 1R8QA 5KYGA 4NYJR 3NHSA 1M73E 2ZWVA 2NAPA 2Z95A 4WK6A 1ZGAA 4X1OA 1YJBA 4E5YA 1BMDA 1PX0A 4ZZ1A 1OOEA 1Y0BA 4MJ7A 1PYOA 3V4PB 4I9UA 2JI7A 2L18A 5KOHB 3RSGA 1Z7EA 3GEHA 1LLDA 3F2IA 3ZE1B 3VKUA 4QYTA 5CGZA 1T5DX 4BNMA 1F2TB 2DBVO 4G0UA 4HZUA 3SN6A 1CR1A 3MWDA 1E94E 3HU5A 3T7TA 3GUYA 1FNDA 2JHGA 4YAEA 4EY7A 2Z8ZA 2IYZA 2GDJA 3LX6A 1EWYA 3ZWOA 4HGZA 4C7OB 1XR3A 2C5BA 1U0BB 1JKFA 4JU8A 4WZZA 1XCGB 4MVJF 3FYDA 3NHRA 1YHYA 2YQ4A 4Z2AA 2BZGA 1OB5A 3CURA 3VPFA 5I7HA 2CXNA 3C3XA 1SVSA 2AQIA 2VJDA 1WHTA 3TM4A 3RYFB 3FDZA 1X14A 3D59A 1LA2A 3WQHA 5GZ3A 2WY2D 2GUGA 3E0XA 3G68A 3E9YA 3BN3A 2DTXA 3W5VA 1PX2A 2I0FA 3P20A 5EFZA 1UMCA 1XCPA 1NBIA 5D87A 2QOEA 3ZVNA 1VLHA 1XP8A 2PSFA 3D5TA 3HMKA 2HMWA 1E2LA 5FQNA 3RS7A 2PZFA 5JNLA 1TYDE 2Z5FA 5A2GA 4P4SA 3RODA 2CFRA 1ZN2A 6REQB 5EQJB 2Q21A 3A0RB 4G56A 2BE9A 1RACA 2BFPA 3K05A 4N0EA 4AG5A 4ESHA 1L5WA 2NMVA 2YHAA 3W4JA 2JFZA 3JTMA 5GWXA 5B30A 2VDLB 2PMDA 3QX8A 3I6YA 2JPDA 1NTOA 1R16A 1NKVA 4IIUA 2PXCA 3KDAA 3NP9A 3EXHC 4AF7A 3NALA 1FP4B 2H3HA 4UM9B 1I01A 2G9QA 2GN8A 2HXSA 3WAKA 4IHKA 4MVWA 2C7BA 4EPVA 2FR8C 3IKVA 1WIWA 3DGEC 3INTA 1X7ZA 4ZWNA 3CRW1 3DDSA 3HABA 1TJYA 5EIBC 3WL4A 1U5AA 2ZYIA 1BOOA 2SKDA 1LQTA 2CCJA 1GQFA 3IA2A 1Q20A 1R50A 4BX2A 3I64A 3S40A 3KQNA 4ZYWA 1SUFA 1Q7EA 3TSCA 5LNK1 3TTUA 1Y8RA 5J2UF 4KAAA 2FG7C 1I2BA 2QLTA 2VHEA 3OCVA 4HL6A 3VVBA 2XKBA 2CHGA 2XODA 1V39A 3A6DA 4H4EA 4I50A 3X1JA 4TTPA 1OYYA 2JB9A 3DOUA 2EFYA 2XUGA 3GRKA 2HF9A 3T7DA 1VCNA 1YAJA 2G4VA 3IQXA 3K0FA 2V6FA 3LT2A 4LXYA 3ZNPA 3OLVA 5IKEA 3HVIA 4G5OA 2ONYA 2VPPA 3PNSA 4LCJA 1D8TA 2HCTA 2FCAA 2AVDA 2XE6A 1G8JA 3TBFA 3P4YA 4FOTA 2AXPA 3P2YA 4NMLA 4QJIA 4GKBA 4RXTA 4X7BA 3GJZA 3ID6C 3OX4A 4OVKA 1K66A 3H5IA 3OTOB 3NC4A 2RGWA 3ORYA 2BTEA 4DIBA 2IIBA 5CFMA 1PSDA 3IRVA 5JT1A 1XDWA 3ANMA 1M2NA 4DIUA 1JHZA 1OFUX 3KKOA 4Q3NA 1K6EA 4AF8A 4M3NA 4D57A 2ZSUA 3M3HA 4PC7A 5K45A 1RAFA 3GPBA 1AB5A 4R7GA 4UDNA 1T8TA 1C0EA 4JOCA 1WKCA 4P3XA 4PLCA 5FIUA 3MWKA 3DDZX 2NZUG 3AWDA 1FRVA 2YIMA 4E70A 4QRHA 3F46A 1GFSA 3KVNA 3O4VA 2HTEA 4KFUA 1KGSA 2RAVA 3RLFA 3CT6A 3Q2KA 3KKZA 4JDUA 4QQNA 5L95A 2J45A 3I5UA 4IUYA 4ZAGA 1VJ1A 3C8MA 3L7OA 3RG8A 4JU9A 4DHEA 5KNBH 3HYRA 2YYSA 3PYMA 5IBPA 3U4MA 1FMCA 1K2VN 1RNLA 3MGCA 4Y2RA 1M6VB 5E6RA 1DEXA 2WM8A 3G8AA 3VU9A 3CSSA 1DC5A 1XTTA 4V39A 4XWAA 4AY2A 1RKXA 2JCYA 2BSXA 1M8PA 4L5AA 1DCTA 4Y1EA 4IEIA 4YJ2F 2XXAA 5BNIA 1J2JA 1GR0A 1CUUA 3RTEA 1IVSA 2A67A 4WADA 3EUWA 2I7CA 1SKYB 4LJSA 3EZYA 2J7PA 3BTUA 1LS1A 2PFSA 1TFUA 5DWVA 3GFOA 5FNVF 3K73O 5TVKA 2FF5A 2X3FA 2CK3A 2BFEB 3E2IA 3L0DA 4JL5A 4KQXA 4OLHA 2HLHA 5FXMA 1CWUA 1AY0A 2MINA 2XMDA 3LFHA 1NR7A 3X1XA 1XD2B 5T5QA 1DWUA 3N6XA 1P1HA 4OKIA 3I32A 4GPD1 4AU1A 5LSAA 4MZXA 4Q1VA 4Y6QA 1K8QA 1YR7A 5K01A 2VZEA 1FJHA 5KYYA 4EP1A 1Z28A 3CEAA 1UJCA 3IJRA 4BBAA 5CLLA 4US2R 3S70A 2OXTA 4Z3KA 4AECA 4YJ3B 5AT1A 4MSUA 3LCMA 3D5EA 3UEOA 3WI7A 1PGJA 1NQTA 3B1FA 4CKBA 1A7JA 1BKSB 2GETA 3TKAA 2GYYA 4L8FA 4U6QA 4DIEA 5HQ3A 5I9LA 4B3TB 3ANSA 3G79A 3NG1A 1P81A 5C8VA 5DCLA 1OLXB 1DUSA 1JU9A 3KXPA 4G6ZA 4JB8A 3HXKA 1W59A 4A0QA 4Z7NB 5CXQA 3F6YA 1N7GA 1F8XA 1FVXA 3UMMA 4D0SA 3L40A 3I0NA 1IFXA 2WYIA 4QD3A 3X3HA 1KK1A 2YWHA 3PI6A 4OXQA 3B48A 5EHNA 3H5OA 1TM2A 2I3BA 5FAXA 1UPBA 3E22B 1EVJA 1K3UB 5EWLA 2QSJA 3TDNA 2YWCA 1BRTA 3WDSA 5KKNB 3DXFA 1DGQA 4R2KA 1NE2A 5EKSA 3PGLA 4RZQA 1FRQA 2JAWA 2LGJA 2UUPA 1GTZA 3UMVA 4ZGGA 1ORDA 4C01A 4E2ZA 5KNBA 2O0KA 3MBOA 4H6VA 4TUYA 1XU4A 1NRIA 2O0MA 5K0TA 2FP4B 3G2MA 4TZTA 5FHRA 3WS7A 1KJYA 4BFWA 4DLWA 1FRNA 1PL7A 3D3QA 2II6A 3GGGA 1F0NA 2ODTX 4BS9A 4X7RA 1EFPB 1CS0B 1DHTA 1V47A 4MKIA 3IT2A 2ZI6A 3AETB 4PQRA 1SD2A 1U5BB 2WILA 3BG5A 4PZAA 4RHUA 5TV2A 5KVAA 4JKYA 2P3OA 2FSPA 3Q40A 2EX1A 2GPBA 2AF4C 3QHPA 4MDEA 2ATCA 3ZBPA 4NXMB 2Y66A 4ASUA 3BMCA 2WSSA 1RHJA 2E37A 1BHSA 1CZOA 3AY7A 1DAKA 3JY6A 4N12A 5DU2A 3UJ6A 5CFPA 1NWCA 4MGIR 1L5HA 2APJA 5CDYA 4P1ZA 2PX0A 4PLHA 4JLMA 2H18A 3LY9A 4KE9A 3NASA 4PXAA 5DNWA 2HA6A 3N2IA 1M1NB 3S55A 1GVHA 5ENVA 4ZD6A 3TH5A 1NF2A 1NQ5A 1KO5A 3HYLA 4HNSA 3X2FA 5LDGA 1KQ3A 1SUWA 2A0UA 2W83A 3OLQA 4QJBA 3ZCXA 5AM1A 3RSOA 1SZCA 1PT7A 3NV7A 3O31A 2EBUA 2E2WA 2HA3A 1BHQ1 2LNDA 1VLLA 1YBVA 2P9BA 3CZQA 4M1EA 4R8SA 4ZAXA 2H65A 4LV5B 3AHFA 5JSYA 4E31A 4YT2A 1CIJA 3HUTA 1U7DA 2Q3EA 3UK2A 3MRXA 4ILKA 1I2DA 3ILYA 2FE1A 2P6OA 5CUQA 3ROXA 1NXXA 2G9ZA 3AR5A 1YZVA 4BP3A 2JL1A 1LGYA 1L5KA 1NMEA 4XX0B 4CGZA 2Q2QA 1ZAKA 3QZUA 2WMYA 5T8KC 3T3PB 1NSTA 2QT1A 2DUMA 3CUUA 3IEXA 3O4RA 1ZIPA 1IQ0A 2WP0A 2LKDA 5IUJC 3M5CA 2QJRA 2DTDA 4JP3A 1BROA 3M4NA 3CE9A 2CN1A 1ZNZA 3JQ9C 3CR8A 4IOLA 2NP6A 3IE1A 1T6YA 1KYTA 2HXYA 2P2NA 1Q7TA 5BYAA 1ORHA 1NG9A 1ZCBA 3H6GA 3IUQA 5D5HA 3GVIA 3R0QA 3LP8A 3WRYA 4FFPA 5EIEA 1D4AA 3OT5A 3F5QA 3P9RA 4J9UE 4MUFA 1ZIYA 2F1KA 1Z2EA 1FP1D 2FZWA 2WZBA 1SD5A 1OBCA 2G6BA 3C8DA 3OTHA 1G4AE 4BGIA 1N36B 1RT9A 4MH0R 4EW3A 4YJHB 2I54A 1JEYA 4JI6B 3CVVA 1EFTA 1ZD4A 4MYRA 2FSUA 3L84A 1Z4MA 1MGPA 4LZWA 1Z2PX 1GN8A 2YJTD 4IXDA 1RFLA 3BF8A 5CB4A 5HKOA 2BGJA 3O4IA 4JIGA 1Q3HA 3L4BA 1Q7BA 2ZTHA 3R3YA 4KMRA 2V59A 4DNOA 1FW8A 4EABA 4JXXA 1DXHA 1GA4A 4FKZA 2OPHA 4EWLA 3OCUA 3I0ZA 1SC6A 3ZXXA 5A9RA 1LBHA 4OGLA 5AK3A 4ZVRA 1HMYA 2OK8A 2X5OA 3NYRA 2NTJA 2QTCA 5HTOA 5KAMA 2YDXA 4JSTA 2ZCUA 4Y98A 4YXWD 1MQ9A 1GQQA 2O59A 3D6AA 2UUAB 2AW3A 5F7OA 3DD1A 5J5AA 4UEWA 1V8BA 1SAYA 2BTQB 3DMNA 2BP7A 1QUFA 3BHJA 1YS1X 3SQMA 5HWSA 2AIRA 4QG7A 1F12A 4M1ZA 4BKRA 5JVDF 1I3CA 2NW6A 2QVGA 1X15A 5AKYA 1KL7A 4D8WA 1XHLA 4GDFA 1WO8A 1Z6PA 1CQXA 1H9AA 2J0VA 1K88A 1UOOA 2A9RA 1GL9B 1OFUA 1SQFA 3I6MA 4J9VA 4LEIA 1NPDA 1ECCA 2I2AA 4N6OA 4P5DA 4ROSA 1JIUA 1KORA 1NVTA 1EGAA 1U0JA 1ZK0A 2QVXX 3ZCTA 4ZZ3A 5AW3A 3NFRA 1KQPA 2G67A 4NICA 4DLLA 4CCSA 3HBAA 4R54A 3E3MA 1M34E 1FX0A 1XHEA 3BFXA 3T94A 3SC2B 5DBGA 4D3SA 4XQGA 3TTSA 2R6R1 2VPZA 4WK4B 2HSJA 1R5JA 5K3FA 1HH4A 2B8JA 3R20A 5F52A 1YS7A 1TI7A 5THQA 3I9LA 1GWNA 1U98A 4D9KA 3NM5A 4NOKA 5CYPA 1HEUA 1Q19A 1Z6AA 3UKOA 1W5AA 3L07A 4IIDA 2HXGA 1D1QA 3SVZA 4QREA 2O0HA 4L15A 1RXSA 3PNBA 4XSVA 3PJGA 3JQGA 4ZGBA 3QPUA 4URFA 4KRFA 3ZWXA 4AY3A 4EVRA 3QFCA 3KVOA 5JJIA 1O0SA 3E2PA 5A5EA 1ZUIA 3LC7O 1JJBA 3JAMA 1K8YB 4W1SA 9ABPA 3IAXA 4MW2A 3SJUA 5HS4A 5IKXA 4EJ6A 5FV7A 3WKEA 1IIRA 2LWIA 1N8NA 4L08A 4R3UC 2AG5A 3GFFA 3L7NA 1VSTA 2M6LA 3TJZA 1M7GA 3EQ9A 4IH1A 4JBXA 1OASA 2QUHA 1L7QA 3EXHA 4MRAA 4R3WA 2J9XB 3BWBA 1UBGA 2Q5LA 4TT8A 1ZU4A 2NLOA 5DBIA 3TAUA 2C3UA 1WOMA 1RBMA 1XLUA 3EXEB 2B98A 1U0LA 4BNIA 1QORA 1A1SA 2F17A 2I76A 5F51A 3T5GA 3Q6NA 4Q21A 3IUEA 1OLUB 1H05A 3IUJA 2UVPA 4J1SA 5SZKB 3LPCA 4M9XA 4ZVQA 3OIDA 3WMRA 2WD7A 4FQ7A 2C2BA 1SWVA 4J29A 4OSOA 5E6UA 3UB2A 4F6LA 1L4LA 3E7DA 2XKJE 3JQ7A 2JH8A 5E7MA 3EGDA 4R1LA 1G20A 4L07A 2ZKIA 5JNRA 1UBUS 2PE5A 1RE1A 2YHSA 2OGSA 2O2JA 3OLWA 1SHUX 3EFOB 1BMFA 3ESBA 2A88A 3G5LA 3R3JA 5EP4A 4C1NA 5BVHA 5KDDA 2WUGA 2DSNA 3C85A 3KPVA 1C4OA 4CEJB 1T36B 4I4CA 4UEKA 2YHUA 2OECA 4G09A 2X0IA 5B7NA 2IUYA 1CZHA 4DLBA 5K4AA 1NN5A 3DAPA 3MS4A 1V5IA 3ZCSA 4CMCA 1BJRE 3IP1A 2H8GA 1U63A 3UWPA 1XELA 3LQRA 2JBAB 2PUCA 2O2HA 4HTFB 4DWOA 1NZDA 5EIOA 5IZCC 4BUZA 3OEHA 1WZIA 3LA8A 4LDAA 3W1EA 4LHVA 4AJ4A 4BTEA 3O1LA 2C7GA 5CFNA 4DDHA 4QLAA 2P40A 3K5PA 3E4DA 4TRMA 3CH7A 1V6AA 3I9NA 1PGNA 5KI6A 3OLXA 4G2TA 4PNZA 4LY3A 4IMRA 1I1OA 3LY5A 4F8JA 4QO7A 1II9A 4ANFA 4YUZA 2GN1A 3P9KA 2FU5C 1MO2A 2YJ5A 3HCPA 4MWBA 2ZR0A 4BVJA 3JYQA 4ZI7F 1JQBA 1JU3A 3REQA 4U9HS 2LZ0A 1NV9A 3P9QA 5DEOA 3WMGA 4YX9A 3ZY4A 4C4SA 2NV6A 4WD3A 1DQNA 4Q7QA 5LLDA 1V71A 1T5HX 2A94A 4HFJA 4OB7A 3KEFA 4BO7A 1A2KC 1QIGA 1RHUA 4W1QA 3EX7C 3EGEA 4KPYA 3R4VA 3I1YA 1T3GA 4QDXA 3B70A 1Z9BA 4BZZA 5AHKA 3BRQA 1Z68A 3A3KA 2MSDB 4RJLA 3KZOA 3LDHA 1IY2A 1PUXA 2FX3A 3PSAA 3FJYA 4J75A 3CF2A 3CUSA 3LCCA 4CFYA 5B3KA 2PCLA 2H4JA 1BE0A 3SVTA 1UIMA 5KVQA 5JWRA 1TF7A 3AR2A 2ZE5A 3FWNA 2ZBGA 2WM9B 2OCIA 3KB8A 5AM5A 4DIDA 4H1WA 5KKCA 3EIHA 3QUQA 3WNVA 4DREA 3VR5D 3KEGA 3PEEA 4AX4A 2ZR7A 3FPJA 1ZM3A 1LWNA 4YP0A 4AYTA 3U5TA 1JTVA 3L9XA 4OA8A 4YMSA 2C5LA 3T3GA 3VJKA 1H22A 2ONZA 5ESWA 3FZEA 5F77A 1SN7A 2BBTA 4CQJA 2DQKA 3D4OA 3L1HA 3EASA 3LHSA 1XMVA 2YXBA 2X1LA 1IMOA 4KMSA 1M2VA 1XTZA 2I99A 3ZGXA 3CF4G 2ZWOA 3V7NA 4S12A 5FLKA 3LX4A 3R1IA 1QGUA 4C06A 3NKFA 4XWYA 2GM3A 2WA2A 2M32A 3G0CA 5K6RA 3IVMA 1NI3A 1D2NA 1KZGB 2VFAA 3CO5A 3GLKA 4O4LF 3T5TA 3VAYA 1T2EA 3JYOA 3HDHA 5D3ZA 1S8FA 1ULTA 4NHOA 5I9BA 4DQUA 4WXHA 2EZUA 3TJMA 2B92A 2OQIA 3DNPA 4K9QA 5KVVA 2VJQA 4P2GA 3MFYA 2ZYUX 3DQQA 4F4UA 3CX6A 1ABBA 1NF9A 4P0PB 1E4YA 1HLDA 5AJWA 1QJCA 1DAHA 2SHKA 1BD4A 4I46A 1V16A 3AUAA 2ECPA 3MLEA 1TADA 2VYVD 5GIPE 1G21A 1VIAA 4ROTA 5JHGB 4PG8A 5FTNA 1PR3A 4ISBA 3CCBA 2BFBA 1UKCA 2O8NA 2IOFK 3AEQA 1L6IA 4KYVA 3GVXA 1N2GA 5FEMA 4YWJA 1KJJA 3JAKB 4FYHA 5CGQB 5BSKA 5JZBA 3TSYA 1TCCA 1DZIA 1Q83A 3CE6A 3GRYA 4DM4A 4EA9A 3CLTC 4QGSA 2FUG6 1QRRA 4GXTA 5LBUA 1GNVA 1BJTA 3FMPB 1TE2A 1S3FA 1A4IA 4P08A 4RK1A 1E1QA 1WCIB 1TAQA 2O07A 2XQVA 1DC8A 3I5YA 3ANLA 4YPVA 1OPRA 1YB7A 2XZLA 3R3ZA 4F8YA 3P96A 5KYXA 3ADBA 1GCOA 1PFVA 4RGBA 2ZCJA 3GQBA 3WMFA 1D03A 4QGHA 4P53A 5COQA 3VSEA 2P9ZA 2D1SA 1C0KA 4W5OA 3P0RA 1GHTA 1LF5A 5ALPA 3RSCA 4MS4B 1QFJA 2YWEA 3AJ9A 4LI0A 3I9V6 3KL2A 4ZDJA 2DQ4A 3QEMA 4LHEA 3LRPA 3AL2A 5A6SA 4DR6B 4IV0A 1KVTA 2IP1A 3GXBA 3G0GA 1SXQA 2PT7A 3H6KA 4JH0A 1ML3A 2ZTVA 2FRDA 4KVAA 2XV1A 5DW3A 3THWA 4WXEA 2IHVA 1FB5A 5ENZA 2XTNA 3C6QA 3N5CA 3PNPA 3ACDA 1Y34E 2H5IA 4L16A 4C2TA 4OAOA 1EX1A 4KI0A 3M81A 4ZV4A 1E9VA 4QTZA 3HB1A 3OZDA 3V4SA 5B4TA 1EWTA 5IG2A 3K1TA 5JBQA 2AXEA 5E9WA 1AJEA 1X19A 2XADA 3B3AA 5FO0A 1WMFA 1NFFA 2ZBEA 1ZNWA 1U0EA 4FDMA 1R6AA 1TCBA 5CVTA 3HCAA 3BL6A 3AEZA 3KJNA 4U1RA 3UXEA 4MKGA 5BXYA 3IAM6 2VTBA 1RYMA 1UC8A 2ZBFA 1J90A 3P2EA 3Q88A 1AKTA 2QMZA 1LY1A 1R6UA 1OXKB 4DZTA 3SSNA 4JR2A 1P17A 2DHQA 2PO7A 3DZHA 1ORIA 4RVNA 4K9NA 2PGAA 4QWWA 4GP6A 2XIQA 4KHZA 1FFEA 4O4JA 4ENVA 3E7FA 3GLVA 3LL4A 4KREA 2JLAA 4KUGA 5IX8A 2RKOA 2XMQA 1D3AA 1DL5A 1HYBA 2P2GA 5BR7A 3QQ5A 2W6OA 2HMUA 1FYFA 3KDSE 2R60A 2AUTA 1V5FA 1Y6FA 4YRAA 1EG7A 2GD2A 3PXEA 1AK2A 3QKRA 4EUSA 2VP4A 1Y3FE 3QU5A 2BT4A 3MG9A 1NU8A 2NG1A 1CZUA 3H0KA 2CFTA 4GGPA 1THGA 4R2IA 5CNIA 1U2ZA 2XOKD 4LRUA 4WCFA 2OSVA 4B45A 1QSGA 2FFJA 2ZPTX 2XVXA 3L01A 5IKMA 3DZFA 1PN3A 3N74A 4JZYA 5EJ2A 3K70C 4MV6A 3SDSA 4LJRA 4PRKA 2W2VA 3ED5A 4RA9B 2Q41A 1WV0A 1MB0A 5H3HA 1PL0A 4RVFA 2SBTA 4FYKA 2IU0A 3B6JA 5KPJA 1XL1A 1M34A 1DINA 2H85A 1C9YA 4XIIA 5JCOA 2J9ZB 1XDZA 1U2RA 5HQTA 5TQ0B 1BCRA 3H8VA 2DT5A 2JGKA 1WW2A 2D2VA 2C98A 2ZROA 3NOVA 4ARBA 2AD5A 3PVCA 5IF3A 821PA 1CFZA 2BHLA 1YCFA 1YU9A 3URMA 2PZGA 4K0RA 2I8CA 2F3RA 1XBTA 4Z3OA 1ZVQA 4EG7A 4O63O 4YT4A 3W2GA 1WR8A 3CRVA 4NBUA 4EVQA 1C9MA 2V3CC 2C88A 4I3FA 1EK5A 2OO3A 4QSHA 1Z83A 5IDQA 2ONKA 2FX5A 2G1JA 2Q9AA 1ZX1A 3O26A 2ZJZA 4FBLA 1QQAA 4LF8B 3Q8MA 4AN0A 2QRMA 1Y4SA 5DTIA 5FO1A 4ZYYA 3REFA 3DMPA 1RWPA 3LPLA 2DUJA 3E53A 2R00A 3TSZA 2X3YA 3OIFA 3QFSA 4E6PA 4UMEA 4XEUA 2VXYA 3JD3A 1AV7A 1CNFA 3E8SA 3WSWA 3GLIB 4UBIA 4L4RA 4I1UA 4YT8A 3AVTA 3HFSA 1ZC3A 2WQZA 4KBGA 1PKXA 5BN3B 1NVFA 4EGSA 4EW1A 3NOXA 3TWOA 4HATA 4P38A 1AGRA 3NS7A 5INTA 3WK7A 4MUHA 6Q21A 2JEOA 2O1XA 3O2JA 1K3FA 3AV3A 4Z7JA 1A04A 3A28A 4EG3A 4GAEA 1EK2A 4S0XA 1OGYA 4KV9A 1AC5A 3KELA 3KFLA 1ZGHA 4G89A 1KFJB 2JVIA 4DMLA 2B37A 2VBCA 4NH0A 3OBBA 1E6KA 2HY7A 3BL5A 3UH0A 2FOIA 2C03A 4Q37A 2DHEA 5JFOA 4OKSA 3IPXA 4UNPA 2JLQA 2I3GA 4WA8A 4CMGA 5FWYB 1ENPA 4L76A 3PKIA 2HQSA 1QE0A 1C5KA 2OTCA 2ZIXB 3HI6A 4X6XA 3K9BA 4R8LA 5HM8A 5AI5A 3H2ZA 1NYLA 2OB2A 3L6EA 3AUSA 1FFYA 5J2UA 1PYDA 3H84A 3OZ7A 3Q6IA 4TXNA 3WV5A 3C87A 1C1YA 5EKXA 2OMEA 4BVEA 4DWWA 3F6CA 1SUSA 1T5SA 1K4YA 2VQDA 3AVQA 2HCFA 4NSNA 2QX9A 1ULAA 1VRCA 2OGTA 5HNKA 3BRWA 4PVDA 4KR7A 4YAWA 5FBLB 2B5OA 4M9CA 4UMFA 2PT6A 1MA0A 3HFRA 1L5GB 3ENZA 4M8KA 5BURA 5H59A 1V11A 1ULSA 1W76A 5JNTA 1TCVA 4HZUB 3CZ4A 1FTGA 2W6JD 3MWDB 3SZLA 5A5DA 5K0GA 4MGKR 3RFCA 4KX3A 2YWBA 1TIKA 1IULA 3HEAA 4JLJA 2FVYA 3DV0A 4DY6A 3AFIA 2OGUA 3F8WA 3RVLA 3MUEA 3MTQA 3EOZA 1OZAA 2ZJ6A 2ZUBA 5FOVA 1SXGA 3ITKA 3SY8A 4CF6A 2X9VA 1YRLA 4LWPA 3PE6A 3UJDA 4K9LA 1G98A 1MORA 2B36A 4C76A 3L93A 4B7ZA 1WHTB 2AMFA 3T7CA 5EJ5A 1E6CA 1ZFNA 3FDZB 1WB9A 1QH0A 2V6JA 2XRYA 4KPGA 3DR3A 4GBED 3THOA 4YO7A 3FF4A 4DADA 4DMCA 3CZMA 2J5RA 1IHDA 4WY8A 4UTRA 1UEJA 3ABRB 3EAGA 3NJ4A 4DVJA 4PR0A 2IX3A 1UMCB 1C3VA 3OPYI 4FILA 3WB2A 4ER3A 2JG3A 1Y7TA 4MICA 1NUPA 1BKYA 2J4FA 3DL7A 4P4SB 4RQAA 3TOCA 2RH8A 4DG5A 3NMUF 4CMKA 1FDOA 5CJ2A 2VYND 1W2GA 4YJGA 3NVDA 4YJ2A 1PU2A 2W2XA 2DGDA 3CB4A 4YCMA 4R51A 1WUTA 4QBFA 3A1EA 5JD6A 4D9NA 1FW6A 2Z09A 3O9VA 1JNYA 1QG0A 3K7EA 3LCUA 4OQQA 1Z22A 3GWZA 4KOEC 4YCSA 5BORA 5FNVA 1FU8A 1ID1A 3IUMA 3E3OA 2X7JA 1E1DA 1ZJYA 1THZA 3ZOZA 1HSZA 3A6FA 1OXSC 3NC0C 2AZXA 3ILVA 2NTNA 1A5TA 3GFQA 3ZDFA 4ZJUA 4QEZA 1WF3A 1X7ZB 4H08A 4LSWA 1L5QA 1BD3A 2VF8A 4GRDA 4WFIA 3UANA 1JKMA 4IX9A 3AFGA 5KWEA 2PKWA 4ZDKA 3UOAB 3JWJA 4DSOA 1T3SA 1I2AA 1JDNA 1X38A 3VDXA 1Y8RB 3VVLA 4GZ3A 4L4XA 4I50B 1HE3A 3AP2A 3KJHA 1QC5B 4S3MA 4G65A 4REQA 2C7OA 1Z33A 4GE0A 4YR7A 3AI3A 3OFNA 3DHYA 4RHEA 4AMBA 4DB4A 3K0FB 4Q1DA 2DFTA 1TQHA 2W6QA 4DV4B 1O89A 2BBOA 3JQAD 3EUEA 4FOLA 3NHPA 1H0HA 2C7QA 2ZLBA 4UFOA 5TIIA 3D54D 1RPTA 3KT3A 4M6WA 3T5PA 3OE7A 2VSNA 4ARUA 4J2TA 3U7EB 3WLFA 1USVA 1W75A 4RE5A 5KJ1A 2RI0A 3C7KA 3HBNA 3OHMA 4UTXA 3AF4A 2FW9A 4YLEA 1U8EA 2XMGA 1EJBA 1IBMB 4RK5A 3SDZA 4LQCA 4FP9A 3ZDYB 4PG7A 2CNWA 1K6XA 1XGKA 2ZT6A 3ASUA 4WLEA 2QTRA 4YK7A 4D4JA 2JGNA 1Y37A 1E6MA 1CEEA 2ETVA 1TZKA 5B3LA 3K4QA 2FLWA 3SZMA 5FOWA 1G16A 3F4KA 2QW1A 3K31A 1TNDA 5D00A 1H8ED 4EFNA 4GD3Q 1DLJA 4LNUA 2M1XA 3NWBA 5IC5A 1N1DA 4H7EA 221PA 2HADA 3RRMA 1J09A 1TOAA 3E23A 2N75A 2VJBA 2ZYAA 4GR9A 5DHPA 3GDOA 4BASA 4KQWA 4Q3AA 3CN9A 5T57A 1ND5A 1IG0A 1E1LA 1K92A 2B5WA 2DC1A 3WISA 3ZKWA 7YASA 1BZYA 1WX1A 2XQJA 4H7JA 5E6RB 1NV8A 2TMGA 4MI1A 3VU9B 5JWOA 2PJZA 1U0RA 3A26A 4AJIA 2EX0A 1U7WA 3CPSA 2RHTA 1ZJ6A 4MWTA 5B3JC 1I30A 2XEXA 5AUOB 3ZI7A 1LV7A 1LPPA 4LDJA 1BJKA 1KZ4A 2CNLA 1YQWA 4RFVA 5CW1A 5EIAA 3PB3A 4H7HA 2DPYA 1EUQA 2PLAA 3ASVA 3PJDA 1WW3A 4K46A 2IYAA 3GRCA 4OXNA 4UAUA 5C0OE 4BNXA 4CU2A 4TVKA 3VDQA 3HGMA 1U90A 2GHQA 2JFBA 3A58B 1P7WA 1WD5A 4GEKA 5L3SA 3ZX4A 4HX2A 2MT9A 4L8YA 2IYPA 2MINB 5LQJA 1YJQA 2FWRA 4LV6A 4IDGA 3OWXA 3REGA 3HXTA 2Z2ZA 3RH0A 3GFBA 4HLQB 4KQEA 1JG2A 2IYTA 3FI0A 3E9NA 3Q4GA 1LC3A 3QTTA 1A8IA 4EENA 1CPYA 4JJFA 3VKFA 1MC5A 5KYYB 3FB1A 4N4AA 4QEDA 3COSA 2G0TA 1NASA 3DMFA 1H2HA 1GA6A 1CYDA 1L4HA 2RK3A 4MOWA 4B80A 1NC3A 1VMIA 3AR7A 5K8IA 1JL3A 3VAZA 4KW7A 1V35A 4CKBB 5BP7A 1XZJA 3CNBA 3STUA 1SK8A 1W2WB 4EELA 5HQ3B 2FGJA 2PWAA 1Q3TA 5LLTA 3S8YA 1RI2A 4RJIA 2NXCA 1Q95A 4OK6A 3B89A 3ZE9A 4L6CA 4XQEA 5HZGA 1XTKA 5MF6A 2ZUVA 4PCLA 2QM3A 1KQOA 2ZSBA 3SM3A 4B34A 3M6MD 2OCKA 3ZU2A 4HRYA 5F9FA 3IMEA 4KO8A 4IUDS 1QTRA 3IHKA 1LEHA 1E2PA 1SCDA 1JHVA 2WTBA 3FPAA 5GONF 4ARIA 4Z51A 4UVEA 1FYWA 2KB0A 1GTJ1 2O7RA 4NWIA 5EWLB 4QXRA 2QRVA 1LFAA 2EWMA 2I9PA 3G5TA 5LQDA 2J0SA 3OEED 2CJWA 4RBNA 4I66A 1J7JA 4Z86A 4FT4A 3F5SA 2CCGA 4ZT6A 5IEBA 5GJWC 3MTEA 1G66A 1LBSA 2FFHA 2ZRQA 4TUYB 1KY3A 4NBLA 3RU7A 2VUIB 2XE4A 1M0SA 3B9QA 3H6HA 2FWNA 4YP6A 4QYMA 4AKGA 1XDBA 1QP4A 3MPOA 4BMOB 1T3HA 1LS6A 3PQ6A 1SVIA 1WCWA 1XZLA 1J25A 2KLBA 3EQ2A 5AI8A 2MU1A 3N2EA 3OICA 3DEJA 4ERXA 1JDVA 2YX1A 4O8ZA 4BAZA 2IYLD 4NNOA 3JZIA 3LYHA 4LWQA 3PL1A 2X4DA 3IAS6 1WPRA 4MVJM 4LBYA 3BMCB 5SZJA 1Y4UA 3CRNA 5FCDA 5IN4A 2R8EA 3LDGA 5JVDA 1L5HB 2Y0BA 1SPBS 4Y9SA 2DERA 4B74A 4W63A 4MGEA 4JJ8A 1I6WA 5ABPA 4B81A 4YQEA 5FBZA 3RGGA 1EGHA 3CA8A 2HJGA 3ESCA 2Y0DA 1PYGA 2HRCA 1WG8A 2OQRA 2R79A 2YHIA 1Z73A 1NVXQ 3V1KA 2VEOA 1FFAA 5IAJA 4EUKA 3L7DA 3PC7A 1W4RA 1CD5A 2PGIA 2F9LA 4GXRA 3K94A 2QL5A 3CHYA 3NT2A 2LIPA 1NVGA 4L0DA 3UA4A 1HBJA 3CF6R 1T4DA 2FWBA 1Z7BA 1RYFA 1J99A 2WMDA 1X8KA 2VJOA 3DGFC 3DFZA 4JL8A 4BJ3A 1EUDA 5T3UA 2P90A 4QJ5A 2ZUCA 3MSXA 2BI8A 2DF8A 4IIGA 2VAWA 5DGDA 1CF4A 2IPMA 5IAKA 3NBZC 1MOPA 2AL7A 2FDXA 4RTQA 4HVTA 1TO1E 3NUZA 2EKPA 2G06A 3WX0A 4FBMA 2H1OA 4YLGA 5FBWB 2FZVA 3K8ZA 5TS3A 2YV4A 1THMA 2GTPA 4TOIA 2Z4SA 3KU1A 5JZVA 4LXUA 2FK8A 3OOSA 5HG0A 3OQ1A 2VNIA 1WJGA 4BLQA 3VNRA 2BFMA 1LRJA 1WUYA 1M76A 2QRLA 5TRTA 3KSMA 1SNYA 4RH1A 5EPEA 2ZAYA 3LCRA 3H9CA 2G1PA 1EFVA 1QIMA 3EIEA 3FSEA 3G02A 2VJNA 3LC0A 5C31A 5I4BA 2I1QA 1LC0A 3G7UA 4FTWA 1XCLA 2AI1A 3GLTA 1QG4A 1YFJA 4LDZA 4JQCA 5AVWA 3H1PA 3NTUA 1F14A 1UDAA 2IYOA 1N0IA 5AXBA 4ENUA 1JEYB 4JYAB 3H7IA 3LO8A 5MFPA 4HFMA 3I2IA 4U2KA 2D4HA 1X1SA 1GZSA 3IP8A 3KUDA 1IIBA 3NCHA 4B31A 5CB4B 1UL1X 4MPRA 4JD5A 3AVUA 4YRNA 4D3FA 1B2LA 1TC1A 4OMUA 3RVSA 1QNLA 3OO0A 1RPJA 3BD6A 3RE1A 5IAOA 1T0JB 4N18A 1XQWA 3VZQA 4FDUA 4S1NA 5K3CA 4PC1A 3ANNA 1G8KA 1CIVA 1WQ3A 2VBGA 4QBIA 3VO1A 1TYAE 4F91B 3QYFA 3QXJA 3AUTA 3NHYA 3R4CA 1MJGA 3F3YA 3T54A 4DDUA 4WZBE 2D2FA 3ITEA 3LKDA 4OXKA 3TUIC 1DKMA 2H63A 5FB3A 3VPCA 3IEVA 1ZH8A 1DRWA 1QKKA 2BP7B 3A9VA 5CCDA 3ZYZA 1QDUA 5ESXA 4GLOA 5HF5A 1JMVA 4A10A 4XYMA 5LQNA 3NBAA 4LBWA 2VJAA 1NQUA 2ECOA 4O2AA 2M6KA 3SXUA 4PONA 4BGEA 1J8DA 5JD4A 2V1UA 3A4IA 1YR6A 2DLCX 2G08A 3PFBA 4FCTA 2DPGA 4KE8A 1AO0A 1Q2XA 4DWVA 1EA7A 1KI2A 1SXHA 3AM4A 5E3IA 4Y6LA 2C1ZA 1OTXA 3MWFA 1RI3A 4UM8B 2FSVA 4E21A 5LQMA 1FX0B 4PYIA 4MA4A 4LZPA 5LD2B 2WMOB 1C7JA 1A3CA 1Z37A 3MGBA 3NEYA 4OIFA 4RHCA 1NMSA 5K3FB 3TX2A 4AKSA 4WRRA 1AMNA 3DR5A 1OVMA 1J2YA 5J23A 2A0KA 1RZ3A 1XDUA 3GUVA 4QVIA 1CJTC 4H7DA 2R8XA 5DE3A 1E5QA 3VUFA 3T1QA 4FONA 2YJGA 5DBOA 4UPEA 4O3FA 1LB1B 1A9OA 1GD1O 3DZIA 3E9CA 4DUZB 5HEKA 5KBYA 5ALGA 5ADHA 2O5EA 3DBLA 2FE4A 2X0RA 4CLRA 2QD5A 1ESZA 4ZI7A 5E1BA 5BO5A 1UXGA 2KQUA 3JQGB 3UC9A 5DNYB 3F73A 2CNNA 4K86A 2G28A 4QHTA 2JJQA 2IXGA 1D9ZA 1UP4A 1GYRA 2AEMA 5CNJA 4LF6B 2UYQA 2ZUEA 1Q3KA 1EDBA 4PTYA 4A91A 1M0WA 1UWKA 2PS1A 5EE9A 1MEEA 2JBHA 5FOTA 4BNDA 3KB2A 4U2GA 3WMXA 2E85A 2ZBQA 1KGDA 1OXBB 1XMPA 4I3HA 4A82A 2GD1O 5JS8A 5C4IA 2RIRA 5GZ6A 3O03A 3OMLA 4OHRA 2P91A 2IUTA 3T9DA 1JG3A 3JVUA 3P2MA 3EXHB 1JE1A 1OH5A 4ZAWA 3ICQB 4F2WA 1DEOA 4LWOA 1TIPA 2I3AA 3X0DA 3A1NA 3MWGA 4P3YA 1GGVA 3RYCA 2Y2UA 2IU6A 4XX1A 3RRFA 1GFWA 3VR4D 4NDZA 4ZO9A 2ZJOA 1JWBB 3KKEA 2PX4A 4O3MA 1XXHB 3VYWA 2DBRA 3TZBA 1ONNA 4K3VA 1BE8A 2PANA 1XN4A 1E6UA 2UVPB 2X4IA 1T9KA 5JLAA 5JDIA 3V4ZA 1M2JA 2WD7B 5FORA 3B36A 3L6CA 4ARZA 2C7VA 5E6UB 1CJCA 5EGNA 1MRSA 3JQ7B 5EINA 3EGDB 3ETCA 1G20