4OSEA

X-ray crystal structure of a putative hydrolase from rickettsia typhi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
283
Chain Sequence
MQINSIKIGPYINLLPLQYIPQHKISYVEFGDPKNKNIILCAHGLTRNAHDFDKIAKELCKNYRIISINYPGRSDSENLKKPYHYNYTTYIKDTLLFFKRLNIKNPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGDYAKKTVLLDDLASAKEHLKLIYAQIGIKNEEDWDYLTKYSVISTFGGKYKMNYDPAITKQEDVKLWSVWNKIKCRILVIHGMKSQILTKSTIQKMKKTNTFDLYEIKYAGHAPSLMNDEEIYYIESWLKQKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Hydrolase
publication title X-ray Crystal Structure of a Putative Hydrolase from Rickettsia typhi
rcsb
source organism Rickettsia typhi
total genus 92
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oseA00
1N5MA 3AIMA 3PF9A 1M33A 1X2EA 2O7RA 3G0IA 2IX9A 2ZYIA 5CH8A 4Y2JA 3WYDA 1CIJA 5AIAA 1CUIA 4G4IA 2DCMA 4OD0A 5LZ2A 1H2ZA 1QE3A 1JMYA 1YB6A 3VJMA 1HQDA 2DSNA 4HXFB 4U2CA 4YK7A 2VAVA 4GI1A 1MTZA 1UWCA 2WLSA 2G4LA 1GPNA 2WIKA 5AM1A 1TAHA 5F4ZA 1NU6A 4GECA 1VE6A 2ZSHA 3DJYA 4Y2YA 1XZJA 1J07A 2JEZA 4CG3A 2XMCA 5EIAA 3KSRA 3B12A 5AK6A 1IUOA 4WFIA 2CUTA 3UUEA 2PSEA 1B41A 4J0IA 1IZ7A 4X92A 5K3CA 3TRDA 4N5IX 2BGNA 2C0QA 1XZGA 4E11A 3K2IA 2DQZA 5HKAA 3V1LA 5LYYA 1DU4A 3WWCA 1JJBA 5DWDA 2FJ0A 2GBCA 3BF7A 4W1SA 4U2DA 4TPKA 4BYMA 4NS4A 2DR0A 3C87A 4H7DA 2WFZA 4UHHA 3STTA 1YSCA 1XZBA 2XMSA 4G9EA 4F60A 3R40A 1XLUA 1EINA 2QUBA 4DSZA 1DX4A 2H7YA 2O2HA 3HRHA 3MUOA 2VT7A 2HRQA 3B3QA 5AM0A 2HU5A 2XMBA 3PI6A 5FLKA 1CUXA 5ALJA 4X71A 1QIKA 3UMJA 4DSAA 1IUNA 4HRYA 2YH2A 1K8QA 2OGTA 3PICA 3MGAA 4Y2PA 2HDWA 5JANA 1AZWA 3NWOA 4EBBA 1JU4A 4EY7A 4EY5A 4QZVA 3DL4A 4K6GA 3WA6A 3NUZA 1CLEA 2OAEA 5D6OA 1BN6A 5DLPA 1CV2A 1B6GA 2Z5GA 4GXNA 3RM3A 4HRXA 3HLKA 5H3HA 5FRDA 5AI0A 5K3FA 3W9BA 1U2EA 4FMPA 5HF5A 1MX1A 4KAFA 4GEGA 2C5GA 4J0HA 2Q0XA 1JKMA 4FTWA 5AO9A 4B0PA 1ZGCA 5E4YA 4XJVA 1XQWA 3AUKA 5ALTA 2JGLA 1DQZA 1YS2X 3V9AA 3W05A 2QZPA 1QFSA 1USWA 3S2ZA 4V2IA 4CIBA 5HF6A 4D9JA 2CKMA 1QO7A 1W76A 4X6UA 4G8CA 1CUAA 1XFDA 4B85A 1LPBB 3VJKA 5ALGA 1LZLA 1GKLA 3WKDA 2CJPA 3V1KA 4JEIA 4OB8A 4H35A 3DKKA 3ZLVA 3QYJA 2AJCA 2ZYSA 4A16A 1SFRA 3FVRA 5JARA 4X3CA 1RP1A 2C5FA 4Y7DA 2JEYA 2XQIA 2WJ4A 5ALFA 1IVYA 1UKAA 2VJCA 2XUQA 1H22A 4BCBA 5EGNA 4YPVA 1AURA 2XLBA 3C6BA 1JJFA 1N1MA 4IHAA 1ZD3A 2QM0A 4AO6A 4BRZA 3D7RA 1EVQA 3IVMA 3GELA 4DIUA 2OQVA 1Q83A 3AILA 3D2BA 4FDMA 1A7UA 4KAJA 4X97A 5FDFA 4FLMA 2V98A 3DEAA 4DLNA 3LS2A 1A88A 4MJ3A 3I6MA 4B9AA 2QXTA 3Q8WA 4KE8A 5E2IA 1ZGBA 1K63A 3G0CA 1VA4A 2FJPA 1EB8A 4MQMA 4UFOA 3HACA 3G02A 1SCQA 2VJDA 5SYNA 3OPMA 3D2AA 1Y7HA 4I3FA 2VAXA 1QIIA 4RGYA 3ZLUA 2QVBA 2WFLA 1QFMA 4GWLA 2OXEA 1G5FA 4W1RA 5KWJA 1CQWA 3I2FA 5FKJA 1YA4A 3O4IA 4KYVA 1XRMA 4H7JA 2YXPX 4BE9A 4ZV7A 3DYIA 4H7KA 2PUJA 1EK1A 2NW6A 2VF2A 1Y37A 2C4HA 3GZJA 5JALA 4HAIA 3E1GA 4XIIA 4ZXFA 3CCCA 3WKCA 5T4EA 4UBKA 2OCGA 4FWBA 1THGA 3A2MA 5JAPA 2PU7A 2R8BA 1ORVA 4MQLA 2GYUA 5ALKA 1ACJA 2ZVDA 4LIPD 2PSJA 4J0JA 5BV7A 1G66A 2Z8ZA 3GBSA 1AC5A 4Q3KA 3RKSA 3A70A 4HVTA 4GW3A 1JU3A 3CN9A 1YA8A 2ZYRA 4M0EA 3IURA 4PF1A 5AHXA 2WSLA 4B83A 4BRSA 3HXKA 3F98A 3R0VA 5LKAA 2Z3WA 1BS9A 3ESCA 3R3WA 1UOOA 1THTA 5DNVA 3QMMA 2HA6A 4Q05A 3I2IA 1DWPA 2ZYHA 5HFAA 2GBGA 4XVCA 1GPKA 4AZ0A 2ECFA 2D0DA 5A7GA 4CCWA 4QDZA 3QM1A 2XMZA 4C4ZA 2WIJA 2Z3ZA 4A5SA 1LPSA 4FKBA 5HCUA 4J0KA 5ALIA 3JW8A 4X6YA 2WHRA 1QGED 5CMLA 1YB7A 4OU4A 3QMWA 1A8QA 1QIJA 3WLAA 2WHPA 3QZUA 1UXOA 4QLAA 4GLBA 4YASA 1CRLA 1DX6A 5AJHA 4BBZA 2PSDA 3E0XA 1EA5A 5HFNA 3AZQA 1AQLA 3O4GA 5AOCA 4UHEA 3OURA 5K3EA 3H2HA 1XZLA 1P0QA 5JAUA 2WIGA 2OGZA 5D7BA 5ALSA 3DNMA 3DD5A 3IUJA 2V9ZA 1UFOA 2GZSA 3AIOA 3FSGD 1WOMA 1EB9A 3EF3A 3FYTA 3ILSA 4LXHA 3X3HA 4AMYA 3QVMA 3BIXA 4HXGA 1WPXA 4PSCA 1N8SA 1L7AA 2GYWA 2XUPA 1BCRA 2I3ZA 3V48A 3QPAA 3EIOA 1XKTA 1CUDA 4KE6A 3WWEA 3IIIA 4BP9A 5LZ8A 3E4DA 5K3AA 5LKRA 4UUQA 4BZZA 4QDOA 3H2JA 4BVJA 2VJBA 5DTJA 5C81A 4B9EA 4BAGA 4G1FA 5JADA 3FLAA 5AKYA 4BAZA 3EBLA 2JGFA 2WG1A 2QMQA 2UZ0A 1ETHA 5HZGA 2HFKA 5BOVA 3C70A 2HA4A 2J4FA 2EDCA 3F67A 3I2JA 1R3DA 3BF8A 3C45A 2WUGA 5ALLA 1QIEA 4ARBA 3WKEA 1XQVA 4ZV9A 3FYUA 1WHTA 5ALVA 4OB6A 3ESAA 2H7CA 5HQ3A 4K2AA 5DNWA 7YASA 4WDRA 2IIVA 2ROQA 1T4MA 4Y9SA 3R41A 1EI9A 5CW2A 1MO2A 3FWHA 3I1IA 2HL6A 2RGUA 3D0KA 3QMVA 4G8BA 4X91A 4QNNA 4INZA 3WYNA 3BE8A 4ITVA 4X93A 1MNAA 4BATA 3STYA 2XLCA 2ONCA 4B84A 3AZOA 3DDUA 1F6WA 3DOIA 1MT3A 5ALRA 5HK8A 4HS9A 3O4JA 1CQZA 2HIHA 5ISMA 3B5EA 3H0CA 1MAAA 5FV4A 5CURA 4PQEA 2WG0A 4B82A 5A6VA 1K6EA 1TCCA 3BDIA 1ZI9A 1XZEA 4N5HX 2OCIA 1UKBA 3IUMA 4AQDA 2H1IA 3FAKA 5ALZA 4AX4A 1ODCA 4QWWA 1SCIA 2QKYA 4XX1A 5LZ7A 4L9AA 1EVEA 3DCNA 4J3JA 3PUHA 2XT0A 1QJ4A 1ZD2P 1R9NA 5AKKA 4NZZA 4ZI5A 1MX9A 1WHSA 1CUWA 4KEAA 4PSDA 1FSSA 4H7FA 4G4JA 3FCYA 1NU8A 2XB6A 4MYSA 4OYYA 2XMRA 3IBTA 4NMWA 2WIDA 3H2IA 4CI9A 3STXA 2HA0A 3O0DA 1KU6A 5LZ9A 4DTCA 2Y6UA 1YAHA 4EZIA 3FOBA 4Y2UA 3BJRA 4FLEA 2XQFA 2Y1KA 3AINA 2OAGA 3C8HA 2VT6A 3ESDA 1W1IA 3R3YA 3LIIA 2FX5A 5KREA 4E15A 2GYVA 4DM7A 4WFKA 5KWIA 4X95A 1QLWA 4C88A 2BUBA 1FJ2A 3WIBA 1IZ8A 2AJ8A 4ZREA 5I8PA 1VKHA 1CR6A 1LPPA 2V97A 4FFVA 1CUYA 1KU0A 5ALXA 3LP5A 3SX4A 2I78A 3STVA 1YR2A 3L1HA 4GBGA 3K9BA 4C89A 2G5TA 1XZIA 3CCBA 1LLFA 3I6ZA 2WG2A 2JGMA 4M0MA 5I9IA 1R1DA 5ALHA 5FXMA 2DFPA 4AO8A 1XRLA 3MVEA 1LNSA 4WY5A 1X2BA 3OM8A 2RIPA 3DYVA 4KE7A 4L3WA 2K2QB 1OILA 4M0FA 4Y2XA 2C7BA 5ALDA 4MEBA 1Q0ZA 3D4LA 3HI4A 2QTBA 4O08A 3QH4A 3T52A 4WJLA 6YASA 2HRRA 3A2NA 2ZSIA 4WDQA 5SYMA 3G9UA 4P08A 5C8ZA 4QE3A 3VXKA 3TGLA 1XROA 3VVLA 2CMFA 3M3DA 4K5QA 2QXUA 5KBYA 3ANSA 4QDXA 1NX9A 4CCYA 3LLCA 2D5LA 2ZJ6A 3BL8A 5YASA 4CG1A 1F8UA 3WWDA 1UK8A 5AK5A 4ARAA 1E8MA 1HL7A 2VA9A 2IITA 5ALWA 4UBJA 4BP8A 1BN7A 2OQIA 4G9GA 2X5XA 1TIBA 1ZIYA 1EK2A 3I6YA 5DTIA 2GBFA 1QOZA 1C7IA 4B0OA 2XQGA 1HBJA 3O95A 1T2NA 4DMFA 1ZICA 5AK4A 3KDAA 3KWJA 4A23A 4FFWA 5ALPA 3NOXA 1G4HA 2WIFA 1OCEA 3H19A 5ALOA 4U2BA 4J0GA 3WIOA 4JYPA 2WKWA 3TEJA 3BJMA 1W4LA 2AJLI 5AI5A 4B80A 5AKIA 4BTLA 3F9CA 4PNZA 4BC1A 2RHTA 1VE7A 4H77A 4OSEA 3FLEA 1FFEA 4BCCA 4K6HA 1XKLA 5EHZA 3ZPXA 1F0NA 3QBJA 4FNGA 3T4UA 3ICWA 1WCYA 5IVKA 5LLSA 1WM1A 5JAOA 4UHDA 3ANTA 2HADA 3O4HA 4UBOA 4ZGBA 1R88A 3G9ZA 4BDSA 2O2GA 5C7YA 3H18A 1ZI6A 2XUDA 2BCEA 2EEPA 3AZPA 1EX9A 1U8EA 2VEOA 3IDAA 4EY6A 1ZIXA 3U0VA 1H2YA 1R4ZA 5JYCA 5A71A 1E8NA 4X94A 2XQKA 5DYYA 2RONA 4UHFA 5AOAA 3SK0A 1H2WA 3CXUA 5K3FB 3WKAA 4RPCA 5HKBA 3GFFA 2Z8XA 4K6KA 4ZRDA 2H9YA 1H2XA 2H7XA 4Y2QA 3RLIA 2HA3A 4J03A 5JD4A 3FNBA 5E4TA 2JGEA 1PJAA 2QR5A 1SOMA 5JZSA 1R9MA 2Y2UA 5AM3A 4Q34A 4AN0A 5JZ9A 1GZ7A 1A8UA 1FFBA 4UBNA 2WUEA 3R3XA 2BFNA 1WB6A 1CFJA 4DMCA 4OCZA 4Y2TA 1CUUA 1BEEA 3L1JA 2XUJA 5JD6A 3FSGA 1DT5A 4B81A 4P9NA 4F21A 5AKGA 1W75A 4QA9A 2OCLA 1LPAB 1CUCA 3BWXA 1JMKC 3PFCA 4E14A 2XUFA 1MX5A 1DT3A 3KXPA 3O9MA 3WJ2A 3D5EA 2PBLA 3IB3A 3WK5A 4AZ3A 5BWCA 5EIHA 3C43A 1GXSA 4TVKA 5ALUA 1LPOA 3PFBA 1P0IA 1XZFA 2C58A 2O2IA 4C4YA 1LZKA 1HPLA 5AKLA 4Z49A 5AICA 3M83A 4F0JA 1AKNA 1CUFA 1VLQA 4LKOA 3W2TA 4Y2SA 2BUCA 5T4BA 1BEZA 5C8XA 2WM2A 2XMQA 4PW0A 4RNCA 2PPLA 2G5PA 4KR0A 1GT6A 2JGIA 2AJBA 2WFLB 1GKKA 3FYUC 1TCAA 2I3DA 2WU4A 4ETWA 4JH0A 3OTQA 4TGLA 2B20A 5ALQA 1ODSA 4P92A 5EHQA 1DTEA 3AJAA 4X90A 1ODTC 3WWOA 1XRQA 1PV1A 5I7UA 2I03A 2WHQA 1QIGA 1UKCA 4BVKA 3NGMA 3KOOA 4G8DA 2QJWA 1ZI8A 5DNUA 2BUAA 5K3DA 1ACLA 2QUAA 5LIPA 3ESBA 3GA7A 1E3QA 3C5VA 4FBMA 4N8SA 1XLVA 5J3JA 1XZAA 3GROA 4GHWA 4B7ZA 2CEKA 1ORWA 1H23A 2HU8A 1CPYA 1XRRA 1QIFA 4MEAA 3WK7A 1BROA 5JATA 5HF9A 1JT2A 3H1BA 3H04A 5HF8A 1L7RA 5JASA 1QTRA 1FFDA 4EHBA 2G63A 1CUGA 3DLTA 2QOEA 4OYLA 1TCBA 4G5XA 3HJUA 2W22A 4PV7A 3WZMA 3G0DA 4MWTA 5AKEA 3FBWA 2OG1A 1VOTA 3V1NA 2XUAA 1A8SA 1TK3A 1MNQA 3I2GA 3F8SA 4H18A 2VATA 2YYSA 1BCSA 3M82A 4F5ZA 2DQYA 1XQYA 1O6FA 3ZWQA 2WTMA 1DWOA 5AKHA 4IO0A 2ORYA 1ZOIA 5A62A 2WHPB 1I6WA 3C5WP 5A2GA 4X7BA 1CUHA 2VSQA 3D2CA 3U1TA 3AFIA 2DHCA 4KACA 2B4KA 1BU8A 2JGKA 1YCDA 2XQJA 5IVHA 1XZMA 2B61A 4N8EA 5D3KA 4Q3LA 4L72A 4FBLA 3PDCA 4MWSA 4E46A 4X6XA 4UFPA 3STUA 5EHXA 4HZGA 1DWQA 1IMJA 1E8DA 2JIDA 3DQZA 5ALYA 4BZWA 1O6GA 3KWFA 1IUPA 4PSUA 4KJXA 4ROTA 1ZD5A 1XLWA 2WJ6A 2XUHA 3DS8A 1XRPA 5AP9A 2HFJA 1GQRA 5FPPA 5DJ5A 3W06A 3G8YA 1Q0RA 4N8DA 2E3JA 4IH4A 2JBWA 3MUNA 3HSSA 3HZOA 2WUDA 4UBMA 3WMRA 3C6XA 5FP0A 4AXBA 2HA7A 3FCXA 4QEKA 1TKRA 1UT6A 5JD5A 4W1PA 1GPLA 2XUIA 4HXEB 3FLBA 1QTIA 3DOHA 1SC9A 2DHEA 2W6CX 3ED1A 3IUNA 3G9XA 5JZBA 3A2LA 3QPCA 1CUEA 3GUUA 2XMGA 4G4GA 4C01A 4DGQA 2CZQA 3C6YA 4U2EA 3VKFA 3C8DA 1XZKA 1ZJ4A 5AH0A 3IULA 3Q0TA 3H2KA 3IA2A 4LYEA 3E3AA 5DYTA 4KE9A 5AI8A 5JIBA 1LGYA 1U4NA 4I19A 3WL5A 3UUFA 3LCRA 2V96A 2HHAA 3FYUB 3WA7A 2OPHA 1W6RA 1FFAA 4ZWNA 4WY8A 4QDUA 5HQ3B 4AO7A 5CBKA 4LXIA 1EDBA 2RI6A 2WFMA 1ISPA 3DKRA 3WKBA 1X70A 2WU3A 2ES4A 5ALEA 5IH7A 4BB0A 1QO9A 1RWQA 4EA6A 4CIAA 2PVSA 2QRUA 4UBIA 4J0CA 1UK7A 3A6ZA 1S8OA 1Z68A 4AN1A 5C8VA 1YASA 4U2GA 3I2HA 2P8SA 1JFRA 2ACEA 1TRHA 5AI6A 4KAAA 5LZ4A 3V1MA 4J7AA 1J06A 3W9UA 1FFCA 1DQYA 1VA5A 2WJ3A 1XZCA 3L1IA 2HU7A 5AI4A 3KD2A 3OC0A 1EH5A 1GGVA 3QITA 2EDAA 4WFJA 4EUSA 1CUJA 1HDEA 1AGYA 3WZLA 2XUKA 3DL7A 1HKHA 3VJLA 2XMDA 4JNCA 1VXOA 2PX6A 4EY8A 5ESRA 3WK6A 2VQ6A 3LIPA 1CUZA 1VJ5A 5CT9A 5FPQA 2J3DA 2Y2VA 2CBGA 1YAJA 1XQXA 3F97A 4C6HA 1E89A 3R3VA 5CXUA 1LPMA 1U65A 2AJDA 2OGSA 3OG9A 3P2MA 2BKLA 5EFZA 4OB7A 4DNPA 1VZ2A 3EQ7A 3G0GA 3WWPA 3STWA 5AM2A 2GZRA 4FHZA 3ZI7A 1Y7IA 2WILA 4H7IA 2PL5A 2WUFA 5AKZA 3ZV7A 4IH1A 5A7HA 5FOQA 4MYDA 2ZJFA 2HM7A 1UOPA 1AUOA 3N2ZB 1UK6A 4B6GA 1YS1X 4UHCA 2VJAA 2VTVA 1N5RA 1XRNA 5JAHA 3AIKA 4LHEA 3EQ9A 1ZD4A 4JUIA 3BIWA 2ZJ7A 1WB5A 1MPXA 2J4CA 2BAGA 2Y6VA 3HEAA 1WPRA 3R3UA 3H1AA 2JGJA 2XI4A 1MAHA 4LXGA 5K5EA 5AM5A 2QT9A 1E5TA 5BWBA 1C7JA 2OCKA 4W9RA 1GQSA 4XWGA 4EB0A 3BDVA 3RK4A 1MU0A 5EHNA 1CUBA 3G9TA 4UHBA 5LZ5A 4Q1VA 4QLOA 1LBSA 1RYYA 4RE5A 5D3ZA 5AK3A 4WCVA 4MXDA 1QIHA 4UBLA 1LBTA 2BGRA 4FOLA 4C87A 4CFSA 1R50A 1UK9A 2J3QA 1VZ3A 4H7EA 4OU5A 5ALMA 4GDMA 4CG2A 1ZJ5A 3WL7A 2PM8A 2XDWA 1QONA 1UZAA 4DNOA 3K6KA 5LP1A 3H17A 2PKYX 2YASA 3I28A 5IVIA 4BC0A 5HK9A 1P0MA 2JF0A 1J2EA 4J0DA 1WB4A 2OLEA 3VVMA 5CH3A 4BE4A 3WL6A 1G42A 5CH5A 1VXRA 2QJRA 1J1IA 4BAUA 1E66A 4KRYA 4Q3OA 5CT8A 3EQ8A 2QS9A 2R11A 1EDDA 4FLFA 3O9VA 2PSHA 1AX9A 2PSFA 5CRIA 2WQZA 3PUIA 4IQ4A 2LIPA 3WL8A 2XUGA 5AIBA 1K5PA 2X8BA 4CCYB 5A7FA 3WI7A 4W1QA 4UPDA 1EXWA 1LPNA 1EHYA 4BVLA 4UFNA 1QIDA 2FUKA 4BCDA 3HABA 4LYDA 3S8YA 3D59A 5CT6A 4S0XA 4PO3X 1W52X 1QIMA 2HA2A 5T4FA 5AI9A 3BXPA 3I1YA 2DHDA 3HYSA 4FNMA 4OUKX 3G0BA 3WJ1A 4H7HA 4DNQA 3F96A 4H0CA 4Q82A 1TQHA 3WQHA 1DINA 1F0PA 1JI3A 3R3ZA 3VISA 2ACKA 3W04A 4DMHA 1CUSA 3ZLTA 2WTNA 5EIEA 3H2GA 3SWWA 1KEZA 3WK9A 3TJMA 1SCKA 4OPMA 1K4YA 3RARA 4BDTA 2BJHA 5T4HA 4C4XA 2XUOA 5AKJA 1EDEA 2HA5A 3D3NA 1AMNA 5DYWA 1MN6A 3OOSA 1MJ5A 4KRXA 1P0PA 4HTAA 4W63A 1Q84A 4QDTA 3YASA 1BRTA 3WK4A 5AM4A 4DYHA 3FVTA 2RAUA 5E4JA 1CEXA 3HC7A 4P93A 5IVDA 2GBIA 5ALNA 1CUVA 1PFQA 4L0CA 2O7VA 4DNFA 3G7NA 3N0TA 3I2KA 3M81A 2C0PA 4X85A 1JJIA 2PU5A 5K3BA 1UOQA 5CTAA 2AXEA 3CN7A 4QWMA 3IUQA 4U2FA 4AMZA 4YX9A 3PF8A 4X00A 2B9VA 5CT4A 5IKXA 4BTVA 5AKXA 1D07A 4JYMA 4DMKA 1CVLA 4EY4A 5FUMA 4NVRA 4Y2VA 3QPDA 1BE0A 5CXXA 4AB1A 1HLGA 4RE6A 1XZDA 3PE6A 3WK8A 5EI5A 2X76A 5AOBA 3ICVA 4IH9A 3VDXA 4Y2RA 2CB9A 1OXMA 3JYHA 3SC2A 1QZ3A 2XE4A 1L7QA 2PUHA 4I4CA 3C6ZA 1C4XA 5CT5A 3JWEA 2RHWA 1XZHA
chains in the Genus database with same CATH superfamily
3NHZA 1RI4A 1N5MA 3AIMA 3TECE 1HX7A 3ZZNA 5JXWA 1WE2A 3OF2A 3M1AA 5EESA 1U3UA 2IX9A 2OBMA 3G0IA 3L9XA 4MARA 2ZBPA 2B37A 1Z5PA 1VMDA 2VNHA 1TQ2A 1T0BA 1A2OA 4HRAA 4Y2JA 5LD2B 4QOEA 3OY7A 2YVUA 4MVYA 2DJ5A 4LJYA 1SZPA 3QXSA 3ZE6A 3WYDA 2DE0X 2I4RA 2JLBA 3IQEA 4WBNB 1QG4A 4X3PA 1C3OA 4B3XA 1L7PA 4Z0NA 3DAHA 3U4AA 2PXXA 2B4YA 1UINA 3RG2A 3MMZA 5E38A 3GN1A 5CNMA 3TQFA 1ZSVA 4I4IA 2Q3MA 1DO2A 1QE3A 3KEGA 1JSZA 4G1EB 4IBOA 2A0FA 4LBVA 3BIJA 4QUJA 5JTUA 3G5LA 2C82A 2Q1SA 3JYOA 4O4IA 5G0WA 3VJMA 2DFVA 3OLZA 2RGEA 4PSVA 1K06A 3D54D 1P29A 1COZA 4GPTA 2R751 4YJFB 2QLLA 3R8XA 1P9OA 5KB3A 1L6IA 3BQ9A 5DT2A 4KJZA 3LZDA 1G5TA 3PFKA 2HCJB 3GMTA 4EKNB 2VAVA 3OWHA 3SICE 4GI1A 2X22A 4FC7A 2NU6B 3LUBA 3RAGA 1RJFA 4TLCA 4C2AA 4RVFA 4PGFA 5DYGA 3C8MA 1E2EA 3FCCA 2IPOA 3KKZA 5BSWA 4A0SA 3R0QA 2JIQA 4MPPA 3KHUA 2VDVE 5GQSA 1FFHA 1TAHA 4F8EA 4QXQA 3B3FA 3OPVA 4W8HA 2D3WA 5F4ZA 3B9PA 2KSQA 1FX0A 4GE3A 1PQYA 1FVFA 1NBWB 2ALJA 2ZEJA 4G5FA 3TS1A 4DB4A 1ZKMA 2DOKA 4IQ0A 3SHWA 4Y67A 1E1QA 1JTVA 1TJ4A 3JAWB 4Y2YA 3UMMA 4GG1A 3OE7A 4PINA 2QD1A 1J07A 3ML1A 2VUSA 4CG3A 2VO1A 4ZMBA 5AUOB 2XMCA 3W8FA 3D3KA 1XALA 2G28A 1I7SB 1U8YA 2HLNA 1U4SA 3I0NA 3KSRA 1CR2A 3V4PB 2FSHA 1WLSA 4YUYA 1VCMA 3HKEB 4RIFA 3UOWA 1JHOA 4OJTA 4LI0A 4OQEA 4DLRA 3OLWA 5C9ZA 5HOQA 4X9XA 4JCCA 4JUDX 2HN9A 1EBBA 2WSBA 1VGVA 4MIKA 3VV2A 3R4CA 1N6KA 2PSEA 3D6JA 3U4GA 3ANYB 3IXMA 1IHXA 2WI8A 2H65A 2B8TA 3LQRA 1H65A 4F3TA 4OFXA 1AKUA 1KZ1A 3L1UA 3WSTA 3S5JA 2ZS7A 3GIDA 4Q24A 4Q12A 3K20A 1WTCA 3CKMA 2XVYA 1GDHA 4JVSB 4ZHQF 4R2LA 1TA4A 2BGNA 1XZGA 2E5FA 4MGKR 4NJMB 3FZEA 4PG4A 4K9PA 2PWZA 1IOLA 3QLUA 2R79A 3DDHA 4P4SA 3O2SB 2O5RA 2VYQA 2XY4A 5KVSA 1DU4A 1VMAA 2B8JA 1K7YA 3NI2A 3O94A 5HMMA 1UJNA 1UQTA 2DWPA 3LZCA 5ESXA 2F4VB 1F3LA 5BUSA 3LDGA 3EVDA 1J5PA 4N7BA 5DWDA 3ELYA 3GARA 3H1GA 3ROGA 3FF1A 5DX0A 4EDHA 4CKWA 4D45A 2GBCA 3WISA 1R4AA 1SPBS 2ZQYA 3TW8B 2GDJA 3I09A 4HBZA 3IP8A 4TMTA 4U8HA 4UM9D 1KETA 2Q1UA 2JL1A 5H5JA 4R7TA 4A5OA 1KAMA 2DR0A 4YUZA 4QOGA 1KPGA 1EYZA 3GC6A 4MV8A 3RAJA 2C4UA 3J7AC 4UHHA 2AZXA 1NVDA 2LZ0A 2PS3A 1XZBA 3B8EA 3VTKA 5JI3E 2NT3A 3IOEA 2HRDA 5BRJA 1C50A 1Y1LA 4PAMA 1P4GA 2OBLA 1RE0A 2B3DA 5CJ2A 2PR7A 4ZICA 1ESMA 1XLUA 3I73A 3OZCA 4WLVA 1EINA 4JKOA 3RTDA 1R0WA 4R69A 1PJQA 1T29A 1UADA 3LNCA 3Q9LA 1WUKS 5GOTA 4GR4A 3SS9X 3D8UA 1J8FA 4OA8A 4LRSB 3ZWYA 3BSYA 2FR0A 3VSDA 2E4UA 4ETIA 3B3QA 1RWPA 4B6SA 5AM0A 1PJ2A 1UUFA 1GSHA 1QH9A 3WOVA 4MV4A 2QLJA 1J22A 1XP5A 2I6TA 3AL2A 3CZAA 4M0DA 1XCBA 1XJWA 2VHXA 4Z0HO 3H5RA 1MEEA 1Y4AE 5FWYB 1EWKA 1ZMXA 3RW9A 5I7VA 3IEMA 1QIKA 3UA3A 5C8YB 3W2GA 4CLOB 4Q6BA 3WLIA 1IUNA 5KTKA 5JE8A 4MR8A 2EKLA 4B4VA 4BQQA 2MMGA 2YRXA 1Z0UA 3KTFA 2OGTA 4QNRA 4N0EA 5A4KA 5ADWA 5IABA 3I5YA 5L3SB 2ZI6A 3WLTA 3AKDA 3DP7A 4CQLA 1YR7A 1YZFA 1AZWA 4ROSA 2YV5A 3NWOA 3EC2A 1EFRA 4WXYB 1DXYA 1NXSA 1IZ9A 3CY6A 2PUBA 1XMOB 5FFFA 1N0UA 1ZHFA 3H16A 1H2FA 4UE2A 1UMCA 1FNCA 3TI7A 1T6BY 4KI0A 1ZM9A 3DHYA 5KDLA 4F4DA 3PD0A 2N47A 1CY1A 3JWJA 3DDZX 3I62A 2C7QA 2X3UA 3H11A 2NTNA 2AFHE 4ICIA 3U4HA 1CV2A 1XYYA 2LP4Y 3GPIA 3C15C 4AF8A 4AMUA 4ZDKA 1PR9A 3RM3A 3U26A 2VI5A 3IVAA 4C3VA 2C8LA 2W8BA 2BWJA 4EA7A 4ENUA 1U1FA 1GOTA 2E87A 1TVCA 4HDQB 4RABA 3EUFA 2F67A 3FSEA 4KPFC 1X7XB 1XKXA 3L5OA 5CB8A 2OQ2A 5BUQA 4MWGA 4Y1GA 2CNOA 1LBHA 2FP4A 4U7GA 3IXLA 5K6TA 1MX3A 2II6A 2PL1A 2IDMA 4FTWA 4B0PA 2FU5C 4ZVNA 1XQWA 3O2NA 1DJMA 1OWOA 3A36A 2YOHA 3UAVA 1PF7E 5KTNA 2QBYB 3BWDD 4MKXA 2QZPA 1NDQA 3PXXA 4XQGA 1FMJA 2BDTA 2VYVA 3Q5DA 4DOMA 1TZMA 1NQUA 2OMKA 3H99A 1MW9X 1NG1A 3UENA 5IT9A 3OQIB 4AJNA 2K7FA 2C00A 3LVQE 4OKIA 1QO7A 1OIXA 3NH6A 3KJZA 3O83A 4RVHA 1V4VA 1FF9A 2AOTB 4Z8XA 1LSUA 1Z0SA 2PRYA 1GU1A 2YCBA 5TS2A 1QRTA 1J8QA 3ORRA 4TV8F 1LPBB 2XADA 1UT5A 4BKQA 5DRTA 3VJKA 4G25A 4KWIA 3I45A 5ALGA 1QRUA 2JAHA 4WN9A 1LUAA 1GQFA 1GKLA 2BDEA 4PAQA 3RRMA 4EB3A 2HU2A 4JEIA 1E2MA 1PJSA 3DKKA 4GD3Q 3LSYA 3Q0EA 2DPLA 3ILYA 3L6UA 5L3QA 3NDPA 4NULA 1NQAO 2ZYSA 1Q74A 2VF5X 3L0ZA 3PQ2A 4X54A 2C5FA 4Y7DA 2JEYA 2XQIA 3V2HA 2D1QA 3MMPA 4GH5A 2IVZA 1GUFA 1XTQA 5DTRA 3DO6A 5KNBA 4ZMSA 2QT0A 4AYTA 1IVYA 1DQNA 2XUQA 3JSXA 1T5OA 3LU1A 2C2GA 5FI5A 5JPCA 1IJFA 2V7GA 4EUEA 3NDRA 1UBHS 4MDHA 4DV3B 1JJFA 4K9RA 2OB2A 1CKEA 3MOSA 3QVGA 4HPXB 4JLVA 2PQMA 4M9CA 4JP2A 3VYSB 1EJ0A 1EFHA 3ZXYA 1R8XA 3D7RA 3UMGA 1RZUA 2OCPA 2X3YA 1HLFA 3HU3A 2ONKA 1EVQA 3OJXA 4K6CA 3UJPA 5JBNA 4GE0A 4CTMA 3Q6MA 4X61A 1JKIA 3B6IA 5SY4A 4HGQA 1ULTA 4WKOA 4DIUA 4Q4LA 1U0OC 3R5KA 4TYPA 1NYTA 4BMOB 5AYVA 5IANA 1OAKA 2EFJA 3OEHA 1EFPA 1KYZA 1Q83A 2I8LA 2UZ3A 3AILA 3FPJA 3JCZA 4FDMA 4TT3D 1BQ4A 1L7EA 2AS0A 2PS1A 2FQ1A 4ZVKA 3GV0A 3SS8A 5BXYA 2I62A 5E6UB 2QT1A 1MQ8B 3LYLA 2O06A 3DEAA 4MULA 4F8YA 1CR1A 3FAZA 5JBQA 1NONA 3VZSA 1IBSA 1TMKA 5HR5A 3PR3A 4NNOA 4PAGA 3HVKA 4NY1A 3EG9A 1E6EA 5C5EA 4W82A 3IILA 4CLRB 4TKVA 5JCXA 3OQMA 2P9BA 2PX5A 3MTJA 2CYBA 5SY9A 3F6YA 4WW0A 3V55A 1UXKA 3FSJX 3G1WA 2BFCA 2LUOA 3EZ9A 2I4TA 1FRQA 4JC8A 4PQFA 4G0XA 3SE0A 4AYWA 3H9GA 1TO6A 2C2KA 2P41A 3WYEA 5CVJA 3ZOKA 4IDAA 3H9BA 4OM8A 4ENTA 1EB8A 1E2LA 1XDSA 1IY2A 2PLRA 4LW8A 3G02A 1A77A 4UFOA 3RTCA 3RC1A 2QMUA 1MBZA 1KI2A 3LVFO 4IMIB 1K66A 3TL2A 3WY9A 1C9MA 4KV7A 4RK5A 1SCQA 4JP8A 5IKMA 1J42A 2VJDA 5SYNA 4A0GA 1SG6A 2J30A 3ICPA 3SYLA 1BW9B 4CR6A 1X8JA 2X9QA 1FZTA 5AJWA 5FJJA 2PD4A 2BFWA 4G36A 1YMQA 3PNOA 2ZJ4A 3BSWA 4G0VA 1WZIA 1QM5A 3A9VA 4OBEA 1JF8A 3FPGA 3L84A 4PS0A 2HJWA 3AESA 1NATA 1QV7A 2WFLA 4GWLA 5KTTA 2H52A 2HNAA 5DNCA 1DQPA 2PMWB 4RY0A 2RC6A 3MHTA 3I2FA 5IC4A 2IUUA 4EZBA 2B2XA 3SC3A 4MUJA 4B87A 2Q5FA 1WNTA 1V8ZA 3S2EA 4RMHA 4H7JA 4CV1A 4M1OA 1W73A 4PNPA 3GR6A 4ZV7A 1BSVA 1FE8A 1Y5LA 2VAMA 3RD5A 5J2TA 4DV0B 2FEWB 1EK1A 3LO8A 5HS6A 2GK4A 2H18A 2EYUA 2WNHA 4I9NA 4P5EA 1PNOA 5ITVA 2VF2A 2NSJA 3QHAA 1ZH8A 3GZJA 5E0OA 2C7RA 4I1VA 1C80A 3GUZA 2C96A 3CEMA 4NP6A 3DKIA 4ZXFA 3CCCA 3WKCA 2GNPA 5T4EA 5AUPB 5HIIA 1II0A 3WLEA 2M1XA 1NN1A 3V2IA 2OCGA 5JSZA 2WYOA 1MB0A 3KB2A 3LK6A 4EHAA 2BEWB 5TMPA 1YZHA 3L0IB 1MZVA 2X6RA 1LX7A 1H05A 2J67A 1RLOA 2Z1MA 5JAPA 2O8CB 3V6LA 2R8BA 3UK2A 1D09A 1ORVA 3DMDA 4QL3A 1UBKS 1GAQA 4O0LA 4XRRA 2H48A 3ZX5A 1SU8A 1URPA 1N8NA 1JIKA 2PFKA 4KLRA 5F64A 5HGXA 2ZVDA 1ZA2A 4LIPD 1RVV1 2Z8ZA 1Q3KA 1AC5A 3C16C 4MUBA 3Q0IA 1CQPA 1U3CA 3LXRA 1HQYE 2AYYA 2CC2A 3KR1A 3P2EA 3EZ6A 8MHTA 1UP4A 4M9ZA 2Z30A 5JVDF 4GW3A 3I34X 1NAHA 3HCFA 3DXXA 3PUJA 5HG0A 2ASEA 1JU3A 2GXSA 2XTMA 1EGHA 2P27A 3BWVA 4UUPA 2ZUTA 3S2IA 4B6FA 3Q9SA 4KUHA 3PKJA 5E9JA 5IF3A 1B16A 2ZYRA 3IE1A 1AE1A 4KFCA 2I4OA 5AHXA 2BGJA 3QYFA 4J07A 2H1LA 5M29A 2WSLA 3ETLA 3O21A 4BNDA 4DCGA 4R0NA 1KZGB 1USUA 2VZ0A 4NH4A 3A6PC 3RFVA 4FQ8A 2Y66A 1T3GA 4PTZA 2Z3WA 2KPOA 4JWTA 4NAVA 4QBIA 2VP0A 5LDHA 1OWPA 2ISSD 2YQ5A 3AHEA 1ORIA 1Y4DE 2JJ8A 1W2GA 2PMCA 5E8JA 5F1KA 3R3WA 4MPDA 1TT5A 3CM0A 5HVNA 5BR8B 5DNVA 4ZHSA 1J0DA 1OLSA 2QPTA 3MB5A 4G5GA 4ZOLA 5GONA 3QX8A 4FGJA 4KZPA 3DCJA 4PWZA 5B7NA 1YWGO 2Z6QA 4Q05A 1ZK2A 3MWDB 2PWPA 3KOZA 3ISVA 2JC3A 3T3GA 2R6ZA 4XVCA 4AZ0A 3TQQA 3JASB 6GPBA 1H4VB 4JC5A 2E5WA 3GLSA 3H0EA 5F33A 3WYBA 4MW2A 3RT7A 1BIFA 1BVHA 3G2JA 4NE2A 4ENWA 3PGXA 3JQFA 2V0NA 3F5QA 4CKCB 1TKAA 3FA2A 3QM1A 4KQIA 2GD2A 5EP2A 4C4ZA 3DLBA 4LF5B 2W6JA 1SH7A 4LYGA 4R8LA 2AUMA 4IXDA 1IYZA 2Z3ZA 4HDSB 3UN1A 1W1WA 4KN9S 3Q7IA 4Y30A 2IW3A 4CF3A 4D56A 4ZFNA 2EKBA 5HCUA 1SU4A 3BMOB 5BUZA 3EPJA 4KXLA 3PD1A 2H1OA 5ALIA 5IM5A 4ZTBA 1L5KA 1T8RA 1Y1TA 4MUGA 4Q18A 2IC5A 1LW7A 3Q5EA 4DZZA 2ZRNA 1C1DB 3O0TA 4WINA 3UY4A 3DZHA 1QS0A 4TLLB 2BHLA 3DLCA 4DHEA 2WHRA 1KI1A 1PZGA 3IEUA 5CMLA 4CZ2A 1A8QA 3IMFA 1N8KA 2IS4A 1FK8A 1UPXA 4CT5A 3LJKA 2GVZC 4QLAA 4ITUA 3UJAA 4YASA 1CRLA 5CEFA 3O03A 4UU1A 3ACBA 3ZXUB 1E3IA 1NXPA 3O47A 4YGXB 1G7CA 4UCFA 3PEVA 2CV1A 4LFBB 1WZCA 1BHSA 4UTZA 4AM8A 1W9HA 3GN2A 4IZHA 5DVZA 5J1SB 1BHQ1 4E08A 4LZJA 3SMVA 3JD3A 1H94A 1JL3A 2DBQA 4P3PA 4BBZA 3DLHA 3C3MA 3KR2A 2V74B 3HE3A 3PFHA 4N49A 3V1YA 3FKJA 3BK7A 4NDNE 4PX2A 4D42A 3N3BC 1NUAA 2FZLA 4L4RA 3UAZA 3HGTA 2YMMA 2GEBA 3LUFA 4EKDA 3T9EA 3CF4G 2EKPA 5F77A 1VCHA 2P3SA 4DCNA 1AQLA 2DLDA 4RTRA 2XUZA 2B69A 1SWWA 4PLYA 2YC4C 3ORSA 3OURA 3RSHA 3H2HA 3TYXA 3MWEA 3D3JA 5JW6A 2OGZA 4DTIA 1VI2A 3BBPA 3WHIA 2E0IA 1G16A 3DEZA 2CLDX 1WR8A 2I67A 4Y1RA 4M7WA 3FSGD 1OX4A 1RTKA 2HMVA 1DTWA 1O77A 2ZKIA 4Q15A 4WK0B 5CK4A 4DBVO 1PLLA 1K7CA 1SJ9A 1V7ZA 4WOBA 3DAPA 1EFTA 2KB0A 4KXYA 3WDLA 4AXXA 4ZYVA 4TMWA 1BNCA 2ZRFA 3QNWA 4LXHA 5FQNA 1NOKA 1SBTA 3RHTA 1WEKA 2RB5A 4EKIA 1C5KA 4HXGA 4MV0A 3DDWA 2VUIB 1KVQA 4GYYA 1UL1X 3C7DB 1WPXA 2EEZA 2HF7A 4HCJA 1MB2A 4X5OA 2QQ5A 3ADPA 4NZ9A 3NG1A 2B6HA 5AJXA 3WYGA 1ENYA 1RAEA 2Y1CA 3JPWA 3NXKA 3PT5A 4X60A 2GYWA 2EQ5A 4G4SP 4XTCS 2COKA 1RMYA 3K9LA 3WL3A 1BCRA 3F5SA 3C97A 3QF4B 4OQYA 1BWPA 3FIUA 1UBUS 1YNSA 2I3ZA 3V48A 3QPAA 4DIOA 5L8VA 2YN4A 4YJ2B 3AUAA 5K01A 4EWLA 3OPNA 2J5KA 1WP4A 2XTJA 4J8PA 4E0BA 1KY2A 2Q50A 2AE2A 2ZGVA 3CW8X 1T3TA 1QORA 3D2LA 1OTHA 4Q9HA 5KQGA 1AG9A 2E5LB 4KPYA 3E4DA 3TXYA 3QF7A 4F9GA 3NHLA 4B1FA 4RTJA 1HT2E 5DV9A 1NF8A 1FTSA 2IE8A 4UUQA 1CVRA 1YRWA 3H2JA 4BVJA 2QVCA 4BUZA 1VDMA 1VKNA 1CDZA 2CDNA 1D2CA 3TD2A 4D3FA 5C81A 4B9EA 4LSWA 1F06A 3TMKA 4ZC1A 2VNAA 3HCOA 4F4JA 3ZWPA 5J2TF 1GQ2A 3SG0A 1FUKA 4F9TA 1W4ZA 4LNUA 5AW6A 3AYZB 3JQAD 2GZ3A 1R0YA 1GFIA 3GJ0A 5LQMA 1GL9B 4CV0A 1RRFA 4RHUA 4XLLA 3KWLA 1ORRA 1GTSA 5HZGA 4M3NA 3U7HB 2CXRA 4S1VA 3H84A 2NNWB 4TS4A 1K6IA 2Q46A 2OA0A 1XTJA 2BKEA 4OXXA 1KY4A 1REQA 4GQAA 2P1RA 4GVXA 3SPXA 5D51S 3OKCA 1BS1A 3I2JA 3GLIE 2O2XA 5AUQA 3VAYA 1ES9A 3UMFA 4QJ3A 1CK4A 2IUYA 2WUGA 3BJEA 3H6KA 2AMJA 4G56A 4I50B 3IAM6 4YMIA 1V9LA 1E5XA 2CJWA 2QE7A 5DHSA 1JQDA 5ESWA 3T7CA 4UQPA 2RGGA 3CLTD 1RHQA 1U02A 1AKVA 1O7JA 1UBNA 4UXIA 5CFLA 3UBTA 1FUUA 1X7HA 1UPFA 2I4IA 3L6RA 3AF4A 4OB6A 3USZA 5ALVA 2I76A 3DTNA 1D4FA 4KXQA 5JJBA 2QVZX 2ZTUA 4G8JA 5TDHA 3WNBA 2O8EB 3ESAA 2H7CA 5DFAA 1V11A 2V7QA 2C2MA 5DEOA 1TIKA 4HFRA 5HUHA 5DNWA 1M2JA 3GPCA 2ZYVX 2IUTA 2YXBA 5H70A 3S99A 3SXUA 4HMPA 5A6SA 1T4MA 1XVAA 1KKMA 3BFKA 4Y9SA 3U37A 4CDGA 5KCMA 4JLPA 3WNCA 5I51A 1H0RA 1KK3A 3MAGA 4B7UA 4MUIA 1RZRD 1H1LA 4H17A 1P2DA 2GMWA 1CY7A 3LHKA 3C3CA 4RPIA 4I9HA 5AVSA 2G8LA 4CPDA 3ELDA 2WD9A 1G0NA 4REQA 3RREA 3BAZA 3GH1A 4QUDA 3T3IA 3MTBA 3LL7A 2JI8A 3QMVA 4G8BA 3SEFA 2PX4A 4X91A 4FM9A 1B8VA 1QH8B 1S2MA 3OCZA 2F3TA 5HQJA 3RSGA 4OHXA 3WYNA 5CB4B 4K9QA 5DW3A 4M46A 3S2UA 2NZVG 1RJDA 3HRKA 4ITVA 1J0BA 3MJSA 4QT0A 3CNOA 4X93A 1M1XB 4PC7A 1XZ8A 2EBWA 1POXA 3D6NB 3MD9A 1E7MA 3STYA 4BV3A 1M2OA 3GFTA 1Q12A 3OZXA 1CVIA 3GAAA 5EMKA 1NF9A 4IDDA 1O5TA 1W94A 1N9KA 1SCNE 1N0VC 2FR1A 3GNQA 3QI7A 3F8TA 2IFTA 4HH4A 4B84A 1B3BA 3M4XA 1M76A 2WF8A 2EL7A 3DDUA 5IJAA 3EC7A 2GR9A 5JY6A 1F6WA 2FWJA 1TDJA 4LWOA 4B34A 4FMBB 1DDOA 4XFJA 4ZEWA 5CYPA 5HK8A 2C2BA 5L3VA 2YW2A 4HS9A 1E6WA 1ADFA 1ZKDA 5CR9A 3VZBA 4GSKA 2OC9A 2VQ3A 5K0ZA 1KAHA 1YACA 2VT2A 1CQZA 4MP8A 3PXAA 2AMYA 2XCIA 3EAQA 2GZDA 2ZIAA 3KOYA 4EARA 1NTOA 1Q95A 2HJ9A 4QBHA 1LFDB 4ER3A 4EM6A 3ITEA 3B5EA 2C8JA 3L7NA 3G1UA 3H5IA 2BF4A 4ZODA 3NHAA 2AI3A 4KHPB 1CZHA 5FL7A 2NUTB 4NESA 3WGYA 3RTGA 4RTPA 1DCFA 5CU7A 4DUGD 1NULA 5KYNA 4NBLA 4NV1A 3OFJA 5IX8A 3PHCA 4XQEA 1IMOA 2Y3IA 3AYXB 4L0QA 4ZEXA 1EG2A 2B4TO 2J9ZB 2QD3A 5M7EA 1U3FA 3DB1A 3UK7A 2OCIA 1CLUA 4BFWA 2GRUA 1SXJD 4AQDA 5IXYA 5TC4A 4N6OA 4KHZA 2ZQZA 1ZVJA 4HJXA 2G07A 1ILWA 1M1YE 1EP9A 3FYHA 3FAKA 5CXQA 1L5NA 1IY8A 2PJZA 2ON6A 3SQNA 1AV7A 3MFQA 5CFMA 1G64A 3AUTA 2HCTA 2WKPA 1SOWA 4MA5A 2OE2A 3ZBPA 2QKYA 4XX1A 4HK4A 4OQLA 4HQFA 5EZQA 4W9NC 1KO5A 2GTPA 3DCNA 3NC1C 1FQKA 2ISQA 3IP1A 3UHPA 3JU3A 3L43A 4EFDA 4PO1A 1U4OA 5DIZA 2XT0A 1E7SA 1GNSA 1ZD2P 4LRTB 4LDNA 2I6QA 4P7GA 4DQVA 3SHFA 2AFHA 2WHEA 3L8CA 1MX9A 2W83A 4G97A 2IZ7A 3NBQA 1TVKA 4FS3A 4Q9IA 5CK5A 2YYZA 1PZXA 1MENA 3AXSA 4RHFA 2ZI3A 4Q3BA 4Z4EA 1FSSA 1EWQA 2JCVA 4URYR 1RPNA 3ZQ6A 3G89A 1N3LA 2VHJA 4XX0A 3FCYA 2ZULA 4QELA 1YVUA 3QFHA 1UJBA 4FR2A 3S7TA 1Z63A 2XB6A 4II2A 2XKJE 1DSSG 1YI0A 4PX3A 4DY6A 1PR3A 2CVQA 1C9YA 4Q1FA 1YE3A 3WXBA 4OY3A 2OD2A 1E6LA 3JAKA 2WJAA 5KS2A 5J1TB 3K09C 1LFAA 4IFTA 2RI0A 3MJFA 3HKBB 4GXTA 3H2IA 5CVVA 4DMUB 4EFNA 2CT8A 4G0UA 3QOWA 2QDXA 2HA0A 1ICEA 1Y81A 4WNIA 5K0NA 1RI1A 3SDZA 3REQB 4EQ6B 1UDXA 3I2YX 4F91B 3FOEC 3AEYA 1OWLA 5C5CA 3CH6A 3ROZA 1RKXA 3QU5A 4P0PB 1DRUA 1NBIA 1W35A 4IS2A 4EGQA 4EENA 2Y6UA 4LYAA 1G2PA 1VHJA 1YAHA 3OZEA 1RJ9A 3FOBA 4Y2UA 2LKCA 1CETA 4HWTA 5BSEA 1T8WA 2H92A 3FVVA 1NNSA 4OHMA 5TRTA 3OTGA 3QEOA 4TVBA 4F72A 3N7TA 2ZUEA 4FLEA 4D3YA 2XQFA 1R0LA 2XNSA 2FLVA 5FOUA 5JWHA 1YBFA 4FMCB 3CVXA 4M98A 3A28A 2KWIA 5BN4A 1Q11A 1RMQA 4D98A 4QPDA 4DXAA 5IJ9B 5LC1A 1O58A 4URXR 3U7JA 2IOFA 3R3YA 1B8UA 3ZXIA 4L95C 4GYKA 4MA0A 5DN6D 1FLVA 5B12A 2NNLD 1IXZA 2GCOA 2QTMA 3TRFA 3LIIA 2P65A 2FX5A 4KN6A 4E94A 4EG6A 4F5EA 2XOXA 3OZ7A 4G0YA 5CHEA 4DM7A 1Z5OA 2JHAA 2UYYA 3EXFB 1Y3FE 2Y77A 3G0OA 4WLNA 2DPGA 3I8XA 1NN3A 1X1QA 2BUBA 3OZWA 5E7JA 3C3EA 3SI7A 4A6EA 4R1QA 2QA5A 2ZCJA 3FDXA 1R4NA 2GA8A 2L69A 1EX6A 4IIGA 1BX0A 1Z35A 2V7EA 1KR5A 3GLFE 2R8RA 3LCVB 1Y80A 3F7TA 5K6RA 5CJJA 1IZ8A 4DM3A 1AQJA 2D3TA 2BGUA 3PRKE 3VPXA 3LSTA 1VKHA 2V97A 3K0CC 3ZU5A 3UK1A 3SC2B 3P9YA 1QB7A 4UVEA 2XAAA 2WK1A 3DE1X 3OZSA 3PQ5A 1CUYA 1QNLA 1OX5A 1Y6ZA 1X7ZA 1QOQB 1AZSC 4CKXA 1NLYA 3QOXA 4KQEA 4X1IB 3L1HA 3KZMA 4FXPA 2PMEA 2HSZA 1T6ZA 3KL2A 3OLXA 4Q7KA 4F6LA 1L8LA 4D8VA 2WICA 1A8PA 2ZLBA 5DE3A 2AGVA 2NQTA 3B36A 3VX3A 4P22A 2XWSA 2G5TA 1ZWLA 5F7OA 3T5PA 1L7MA 1V5GA 5DBHX 4YAJA 2CF6A 4LV5B 5CB6A 2ZM6B 2EFYA 4ZALA 3ROPA 1VPVA 2KM1A 2O1XA 1E5QA 1SHKA 3H8WA 1LLFA 3PP8A 5KNCD 2GNOA 3I6ZA 4GLLA 3A1VA 2AI1A 2YNMD 2JJMA 3A1DA 2HQSA 2J9GA 1GKUB 5DF1A 3V33A 4B75A 5I9IA 1Q7EA 2NZUG 1DXQA 4GOMD 2ADMA 1I4EB 3K1JA 4M8KA 3ZHCA 4FFRA 1T2VA 1FXWA 3U1VA 5JT1A 3WB0A 3FLMA 2RIPA 2NSLA 2BR4A 1GM5A 1DJOA 2J4DA 4LJ6A 4RUKA 3F6PA 3NKLA 1ZYUA 2OEPA 3TLGA 5JJ5A 3PEUA 5E1DA 3MT7A 5C52B 5FO0A 1KOGA 4R71A 2K2QB 3ASVA 5A0TA 3PQFA 3OUTA 2CLSA 1JG4A 1MO4A 4GRDA 5B58T 3R77A 2R7LA 5COQA 1Y3HA 2C4KA 1RWOA 1QHSA 1T4CB 1GPMA 2PRSA 4EG4A 1UZMA 3GAMA 5HJEA 1QYDA 3EVFA 2QTBA 2MINB 3NANA 4PRKA 4BFLA 3CO0S 4BPBA 4GYWA 1WJGA 4KVGA 5E6SA 1V35A 1N6LA 3JQGB 4KDEA 1PT7A 3DDSA 4L4YA 1K5DA 3NAQA 4LPKA 4M7PA 4CR7A 3B3JA 1X9GA 2E48A 1HYEA 2RE8A 2O50A 1ODJA 3SDSA 5AVJA 3QVOA 1EUDA 3FPEA 2HUNA 5C8ZA 2XGJA 1NX6A 4M0PA 3IMEA 3VXKA 1XROA 1Z2AA 1DE0A 1U7WA 4JT4A 2CMFA 2QQ0A 1USKA 3ILHA 3DPUA 2HTEA 4WBSA 1N5OX 3OFNA 3ZK9A 1FMFA 1GGKA 1JZQA 3ANSA 3DCIA 2WWYA 4QDXA 2IDZA 4C5BA 3W3AH 4UM9B 1NX9A 2VBCA 3D81A 5J2UB 1KVTA 2G9NA 3BL8A 1J1UA 1DAKA 4CG1A 3BH6A 3F46A 3F3KA 2C57A 1DC7A 3BWYA 4JFAA 3ZDQA 4DZRA 4IOMA 1OMOA 1UK8A 1K8ZB 1EP3B 2GYYA 4FFNA 4MQEB 3LVBA 4QTUB 3RSFA 1I01A 1E8MA 3MWJA 4L85A 3U16A 1NR1A 1V16B 1RKBA 1J0AA 1ZN2A 4RVGA 4Z1MA 2B7CA 5ALWA 3CUSA 4ZQFA 3TVTA 1GWNA 1GUZA 4UW9A 3VR5D 2UDPA 2JB9A 1MDBA 2RGCA 1MT0A 5F5LA 2OQIA 4G9GA 4IQGA 3DBRA 4NONA 4RELA 4IUBS 2F59A 2HEGA 3NBXX 1TIBA 3UJ9A 2QTHA 1HNWB 3MERA 3RJ5A 5K6AC 2JFFA 3S2SA 2RGNC 5F5NA 2NV2B 1UANA 5LA6A 3V8VA 4EX7A 5CVUA 4EPRA 1QOZA 1C7IA 4D9IA 3RS9A 5J4LA 1CU1A 1SUSA 2PZJA 3KD3A 4RAOA 3RFFA 4U02A 2AOUA 1ISJA 2VXCA 3QJYA 4DLXA 1L5MA 3KDAA 4B8WA 1I0IA 1YUNA 2FEPA 2XWBF 1BE1A 5ALPA 3H6GA 5IAGA 3AETA 1OCEA 1IXSB 4HEA1 4OQMA 3L4EA 3K1YA 3KKOA 4IMPA 4JT8A 1Q0LA 2OBNA 3NFRA 3QVKA 4LK2A 1EFAA 3I6QA 1EE1A 3PJRA 2AK3A 1MMFB 4U2BA 1HI9A 1YBHA 1WSBA 1XEXA 4ZQBA 4ALLA 1W5BA 1USGA 2B25A 3KYDB 4L07A 1E2GA 3EXG2 3HYTA 2R62A 2WKWA 3KQKA 2IP1A 2WP0A 3BJMA 4YRCA 5JSHA 2AJLI 2GHQA 2AN4A 3LG2A 1Z4NA 2L19A 2PGJA 2IYQA 3SF0A 4QGFA 1C8KA 2E1RA 3W6PA 5E3IA 4WXPA 5EPEA 4OBBA 3AY0A 1YR8A 4PNZA 2BDUA 2ZRAA 1JKJB 2W2VA 2QRNA 4B5KA 1NWCA 2RHTA 1WA5A 4OSEA 4YACA 2ZIXB 1MRZA 4ERNA 1UZUA 2JFPA 3QEBZ 1YC5A 3CNLA 1M6YA 5C1IA 4A8JB 2ZI9A 3VH1A 4ACAA 1F0NA 3QBJA 2YS7A 5L45A 4FNGA 4MK4A 1JHZA 3PXCX 3T4UA 2R1VA 4NBVA 3RBAA 5LQCA 3MUFA 3T41A 4ZAGA 4QUIA 2FN4A 1Z8NA 4MB0A 2IIPA 4AMBA 2WAAA 1WM1A 2PKQO 3L2OB 1W4RA 1ZJ6A 4RY2A 1BXGB 2HADA 5FI0B 1YE5A 3VYRB 5I4CA 1E0DA 4QT4A 4RQAA 1C8BA 1SC4A 1RLJA 4UBOA 1YZ3A 3R5JA 4HAXA 4RHCA 1R88A 5KX5B 2POQX 4ZO4A 3GRFA 3BRWD 2QM3A 5EA2A 1J9EA 1ZI6A 4WK6A 1XTRA 1QANA 1DMRA 4FSHA 3RYFA 4NJEA 3OIWA 4RL4A 1DBQA 1KO7A 2BFFB 3HCWA 4RTMA 3CS3A 3FYDA 1PIWA 3NNNA 3RUCA 4OK3A 1UKVY 4WVFA 5FD8A 2JA1A 3LHIA 4M83A 2BCEA 2W6ID 4Y9DA 2ZREA 4MLZA 1QWSA 4N0MA 3SU8A 4XIFA 2QW1A 1XGKA 5EQDA 1P2SA 1NXVA 2BBTA 1DCKA 1GA4A 1P1BA 1YULA 1JEAA 2IHUA 2YTZA 4DJDC 3WRYA 4EY6A 3TZQA 1JDTA 4GKJB 1R4ZA 1XBTA 5H4HA 3M33A 4RH0A 1YFJA 2ZJ5A 1AKRA 4K87A 1E8NA 4L02A 1WV1A 2RHMA 3MMSA 2IQ5A 4K03A 3UWOA 2EX4A 1G7SA 3MJTA 3T6KA 4KLCA 3WLLA 3JRXA 1DKPA 1QO0D 4BEWA 1CR4A 3N2LA 3U3KA 4ZOBA 3DXYA 4WXHA 4ZYYA 1XMSA 5ES4B 1CRPA 2PGDA 3GFFA 1RM0A 2FH5B 1CRWG 1D9ZA 4LTNA 3LVRE 1F51E 3GDOA 3I58A 3V7WA 4US2R 1KRXA 4FDTA 1MRSA 1H2XA 5TQ0B 1DHRA 4N54A 3RLIA 2HY7A 2F90A 2ZRJA 3CNQS 1WPQA 4LXUA 1JT9A 2HA3A 1E69A 4HNGA 1RNLA 2ZVPX 4J03A 4CODB 5FA8A 5JD4A 1UFQA 2VVTA 3T5MA 5KYKA 3AW8A 4O25A 2W4QA 5HTKA 1GG9A 5K1ZA 3DSRA 2FFAA 5EAIA 3ZIDA 1A9QA 1FXWF 4PM4A 3WTBA 4AKTA 3KLMX 5E9QA 4YMTA 1GT91 5CYGA 3NKVA 1Q1EA 4GF5A 1U2DA 2QL6A 4D8WA 1R9MA 4MVJD 2JFUA 3E6AA 4E1AA 2Y2UA 1BD4A 3ZHBA 4YR9A 1NLUA 1RM5A 4UHJA 1RRMA 3AVOA 2ECQA 4Q34A 4AN0A 5JZ9A 3A3NA 1NW4A 5IPFA 2Y0EA 5G3ZA 3U9LA 1O95A 3ISJA 4H9GA 2OP0A 4UBNA 4XXHA 2WUEA 1O96A 1GQQA 3RYHA 4E1BA 3R3XA 1OBFO 3FW1A 2XX3A 1RACA 2WJWA 4M4SA 4DMCA 1T5DX 2ZIWB 4MVJG 4Q5IA 5JSFA 1UBMS 5HOEA 1QC5B 3U4IA 5HTOA 2O7NA 2VDUE 4KDCA 5KYGA 3QFFA 2ZR7A 3L1JA 4HN2A 5DULA 4CJXA 3PFFA 2YINC 1NQ5A 4FQ7A 2IHTA 3Q1KA 3PT9A 2GA9A 4CMKA 4ZI2A 3KK0A 1MO3A 2ZUWA 3S44A 2GLTA 2YJZA 4F21A 4AUKA 3SJBA 3BMXA 4ZK6A 2TS1A 1F2TB 1CUCA 3FDJA 3LPDA 5ITWA 3PFCA 3R44A 4FHCA 4J75A 4YUWA 1MB3A 2XUFA 3QHPA 4RPLA 4R51A 2ZROA 1PJ3A 4R7ZA 1DT3A 3ET4A 2H3HA 3GBPA 1WV0A 4OHPA 4D6PA 4AJHA 5MF6A 1ZR4A 4V0SA 3FJYA 4L15A 1TEVA 3KP1A 3QVVA 1EGQA 3IB3A 4LQDA 3R7AA 1L3IA 1WU8A 1UEJA 2D54A 2GGSA 2PT9A 3WLOA 2UYQA 3AOGA 2F00A 4Q9DA 3GEBA 4JLMA 4JJ4A 1Z4MA 4HUQA 1NVMB 5E95A 3REGA 2AH5A 4CUZA 1H2BA 5SY6A 3GLIA 2NM0A 3P5BA 1YFKA 1P0IA 1OFUA 1PZEA 4HGRA 1KHHA 2X1LA 3R3JA 3GVXA 1K6JA 4FE3A 1VL8A 1M8FA 3OBIA 5SZKB 5ICMA 1HPLA 4E70A 1H2RS 2MSDB 4I1YA 2GBLA 5FLEX 2V1UA 2FW1A 3DVSX 2RHRA 3M83A 2C92A 3HADA 4F0JA 1M6VA 4XA8A 4YRNA 2QF7A 4AF7A 2J8ZA 4DEVA 1INLA 3T1TA 3LQ1A 1L7VC 2Z2JA 4S1TA 3L49A 4TN1A 3W2TA 4HQ6A 4Y2SA 4ZCTA 1TU0A 3DPSA 4JVNA 5B1YA 3WWYA 4LMPA 4DR6B 1RHKA 2QE6A 1E61A 2DWCA 2P7IA 4BJ1A 5CNIA 4FYJA 1MF7A 1PQWA 2YJ6A 4FKMA 3OQPA 2DX7A 4QRHA 2P3QA 3C3YA 5G4LA 1Z4IA 4QJ4A 5HXAA 2GCGA 5HRUA 2IZ0A 4PW0A 5TQVA 4JMLA 2PPLA 3THWB 4N3GA 3NVDA 2G5PA 1W93A 4KR0A 2WAYA 4JI7B 4EHHA 3UWKA 2RHGB 2AJBA 5TJHA 3W8NA 5CA1F 1E1RA 1TXGA 4W8OA 4BYGA 2AI2A 2I3DA 2WU4A 1CZLA 3DT9A 4Y6SA 5KYXA 1ZEMA 3VR4H 1BWSA 3OTQA 5BR4A 1NW8A 1QGDA 2QU7A 2WYWA 4KP7A 2O8FA 1P73A 3LUHA 2CFSA 4MCIA 4OQPA 3DC7A 2B20A 3AG5A 5ALQA 3N05A 4N7RA 4I81A 1BKSB 2PEZA 5GY7A 1OA1A 1H6AA 4GR5A 3T5AA 3ND7A 4GMFA 5EHQA 4D74A 1DTEA 1V5WA 1TM1E 1CQIB 1V1RB 2CJYA 3AJAA 3QEMB 1QVVA 4Z4HA 4IVNA 1IEQA 1EWVA 5KNDH 3IPCA 4C3ZA 1N3IA 1JECA 4YUAA 4PQYA 1ZPDA 3NWBA 4CF7A 4N6GA 1TE2A 3AG6A 1RKVA 5DOZA 4TM8A 4Z6KA 1XUOA 2ZYTX 5TNXA 1P7PA 2D06A 2XD4A 1VJDA 1VSBA 4DSNA 1XRQA 1ADGA 3GGJA 2GJSA 3CF2A 3KB8A 4UZFA 2IV2X 2I03A 2PYZA 2ZRDA 4FQ5A 4NOLA 1C30B 1QG2A 1UKCA 3CKKA 4ZK2A 2YMPA 2FMIA 4IRXA 4BVKA 1YHZA 2LDXA 1V9SA 2Q3EA 4TZ0A 4JUFA 1D1QA 2B21A 5TLSA 4HVLA 1UBOS 1XN1A 3WGQA 2SKCA 2BL4A 1HRKA 2YXEA 5KNLA 2IZOA 1XVTA 3E3NA 3W5DA 3ZCXA 1ACLA 3NM4A 1PUXA 2JD1A 5EIWA 1I3NA 2ATIA 4QEDA 1JWBB 1YRBA 4IIFA 2WUWE 1Q1GA 3H97A 4DV4B 1FYWA 3TD6A 2BM1A 2QP3A 4WNYA 3ITDA 3UCFA 1E3QA 4DQDA 1W5AA 4TTSA 4QTYA 4XZ3A 5EWJB 1VP9A 1XZAA 2BSXA 3GROA 3WQRA 5C5DA 5EEGA 1RIIA 1SRRA 1PFKA 2GHRA 3V8BA 3BWCA 4DCSA 4GHWA 2Z57A 4TUYB 5KHAA 4B7ZA 3V8RA 1TTPB 3PR2B 4FI3F 3EY4A 1H23A 3IIKA 1TYZA 2Z2IA 1M1YA 2FMFA 3RU9A 1QIFA 1DFHA 4Q4AA 2FSVC 2X1VA 1G8YA 3TI9A 3OICA 4M36A 1ZVKA 4IJ5A 4U7JA 3P20A 4NBTA 2PD3A 3R0IA 1QTRA 1FFDA 4FPXA 3TLYA 1K5GA 3OE1A 1GLVA 2R6HA 2DWOA 4O4JB 4EHBA 2ZSAA 2WPDD 3ESXA 1P9NA 2WTXA 3VVBA 1KMCA 3WFIA 2W22A 4PV7A 1SKYB 1KEKA 1P2VA 5BURA 2AVDA 5AKEA 2GZMA 3LT0A 1C7RA 5GJWC 1A7JA 4RKQA 4ZYWA 3BAFA 2GSDA 2OB1A 3E48A 1VOTA 2G4VA 3MEQA 2BKVA 3HJRA 1FLNA 4NMHA 2HJVA 2SCUA 2P2GA 4L6AA 4D8XA 3RS4A 2IHBA 1PJ4A 4WJKB 1A8SA 4JLBA 4BKUA 1QH1B 4BXOA 4OHWA 4NOKA 4PN3A 1EGAA 3EIUA 5CVCA 1ZVMA 5DN9A 3T3OA 3CWQA 1YR1A 4N0DA 4U3JA 2BGGA 4ZI3A 3B1ZA 3F8SA 2OM2A 3KPYA 3I05A 5JNLA 3AFOA 1UC8A 3UA4A 4Z7JA 4B6QA 3FUTA 1YHNA 1KEEA 3EPLA 3K2QA 2VATA 5DCWA 1LK0A 2YYSA 4EO4A 1LKZA 1GUYA 1Z5NA 2V6BA 1OPXA 4CKEA 3MC1A 5EERA 3VVCA 4TWJA 2DQYA 3IP5A 4A91A 1F12A 4LVOA 1AS2A 1DBWA 2WTMA 3P9CA 4HDOB 3ZWQA 4BJ3A 4LV8B 2LBPA 2WWVD 3LCUA 4MRSA 4ZQCB 2WA1A 1IQPA 5KMGB 3IPLA 4J0FA 3ZDBA 2X7JA 2IQIA 2VK1A 1LXCA 4U5QA 3GUCA 2WHPB 4O3FA 4O4HF 3P0JA 5F1PA 3C5WP 2FMTA 5A2GA 5AHWA 1ZK0A 3EZNA 1UEXC 3SX2A 1M6EX 2DHCA 3RIMA 5FYDA 4YO7A 4WXMA 2B4KA 2A5LA 1BU8A 5EJIA 1Z56C 2NYUA 3OCUA 3KVNA 4CETA 4EFMA 2RK6A 1UEIA 1WQ3A 4UASA 1M66A 5E6RB 1C7ZA 2VPXA 3CLRD 4BNYA 5IVHA 1XZMA 2B61A 4N8EA 4QC2A 5BN3B 3MJRA 4FP9A 4E88A 4F1KA 1DJQA 3EZYA 2R68A 5J5AA 5H8WA 3FHLA 1DIOB 3EVZA 3OVMA 4J7CA 3O75A 3PDCA 4JFRA 5JCJA 3GLFA 3CA8A 1EFUA 2C5AA 4E46A 3VR6A 4DDKA 2CE2X 4YRBA 1IDOA 5INTA 3Q5GA 3ZY4A 3BGIA 4HZGA 4Q1DA 4D02A 1G3RA 5F2KA 4F12A 1D8TA 1US8A 5JXHA 3TW0A 2PA3A 4XYEA 3DQZA 2RB4A 5ILGA 4BWGA 3ONNA 1G60A 3DOUA 3ENQA 1RC1A 4Q1CA 2H4YA 4PSUA 4ROTA 1RQ7A 1ZD5A 3HYLA 1V6AA 3T9AA 3TEMA 4D9NA 2WJ6A 5J47A 4QOJA 4MS4B 3JQAB 2YDXA 1VLLA 4W6QA 5BNIA 1KI3A 3KPJA 3QPVA 1FB5A 1O1YA 1TW2A 1FFWA 3CLSC 3RVOA 2C2OA 3DE4X 5JJCA 1V45E 2HC9A 3AUSA 3O9ZA 3Q6NA 4M8IA 5DJ5A 1ZONA 4HATA 3UXHA 3G8YA 3SVZA 4ZN6A 1ABEA 1XK6A 4KV9A 2XYHA 1AMUA 3LM8A 4GRAA 2IYWA 3RROA 3MUNA 2FZVA 2WMNB 1RWVA 4MAMA 4MRPA 1CF4A 1SQ5A 2QX8A 721PA 3M0EA 1U0RA 4LJKA 1YMVA 1CD5A 1WZNA 1TOAA 1AKEA 2GF9A 3RSOA 2JRCA 4DBLC 5FP0A 4AXBA 3MPUA 1IC6A 4AUMA 5B37A 2GK6A 3TJRA 3C3BA 3IQZA 4QEKA 3JV7A 4ZDWA 3EODA 1UT6A 1A4IA 2O0JA 4ALIA 1S1CA 3A6FA 2K5UA 2VAPA 3DBOB 3I6BA 3LD9A 4KFRA 4W1PA 1ONNA 5FWXA 4X84A 2C7OA 2NO0A 1N6OA 4WN3A 3WGZA 3OHPA 5C18A 1M2EA 3FLBA 4QGSA 1BWRA 1XA4A 3DOHA 4UUMA 3T1OA 3TQRA 2O8BA 4QXRA 5KEIA 4Z3KA 4FCVA 3ED1A 1DUVG 1BKYA 3J80A 1TQ4A 3VYUB 4BLVA 3QPCA 5JS8A 3GUUA 3JZFA 4R2HA 4YJKA 3GFQA 1XDBA 4G4GA 3VR3D 3BICA 1ML4A 4Z99A 2HSDA 1CYEA 5F76A 3LHSA 5COBA 3HVUA 4NARA 4YPFA 1C4KA 1XZKA 1ZJ4A 3ED5A 5AH0A 5EFOA 3IULA 2Z2XA 1Z3CA 3L8YA 4X1KB 2VLBA 2PFSA 4M1SA 3R76A 3TLXA 1IZZA 3V7NA 1ZNXA 4YV2A 4IW3B 1M34B 3UCXA 2OG2A 1LX6A 1GSOA 3UB2A 1JQJC 2WWIA 3AI1A 3LBAA 1X94A 4R1MA 5JAQA 1P80A 2UYOA 3TQTA 1VB3A 2H57A 4YS6A 3PWTA 1LGYA 1YDGA 1RD4A 3DB2A 1M7HA 4ESEA 1I2DA 4Q9LA 1DG9A 5I7HA 1BD3A 1JDBB 1V5EA 2V96A 1YF3A 2HHAA 3FYUB 4O2BB 3WA7A 2FE4A 1GYRA 2V3WA 2J7PA 4LXYA 4RULA 2W93A 3ZUGA 3MWKA 1FFAA 2CVOA 2V7PA 3DMTC 4AFNA 4KNYA 1QCZA 1BYUA 5EWLB 1UJMA 5HQ3B 3WO1A 3RODA 3K30A 4V0ME 4AO7A 5L95A 1VG9B 1PT6A 1NZFA 2B98A 2OV1A 3IRVA 4UE6A 1Z5UA 3SFZA 4CL2A 5IAAA 1DS6A 3GHHA 2ZWVA 3ZHOA 1IULA 2RI6A 1UDCA 1NV9A 1T9AA 5CHYA 3W1VA 2HR1A 2VA8A 4L4SA 4ALNA 4F3CA 1LW6E 1MR3F 1ISHA 2VR1A 4GI7A 5DGCA 1RQ2A 3HNPA 3C6KA 5LWHA 4EELA 5ELXA 2IZ6A 2XKKA 5DM60 5FNVB 2B9EA 4MRMB 2C8KA 4AJ9A 2PO7A 4KN5A 2X8JB 5EHGA 1NUSA 3VO8A 4LTDA 4UDOA 1R0XA 1X0VA 4MKRA 5EUQB 1SXJB 4Z2AA 3FNHA 4EJ2A 4OA5A 1ONOA 4Z7NB 3D3QA 1U7PA 2B8NA 3EAFA 1G6HA 4C7KA 3U39A 4J0CA 3S2FA 2VTEA 2ZE7A 3A1NA 4RF4A 2FVYA 4IICA 3BGWA 2GJKA 4XDGA 1KQFA 2YX1A 1SXIA 4ZA2A 3NWPA 4HH3C 3U17A 1K3UB 2G67A 2FPUA 3DWEX 4ND7A 1MJGM 1PJBA 2GEFA 2VDRB 2E18A 1AY0A 5KOHB 3BZUA 2AOVA 1MJGA 3RCBA 3RAFC 1YCHA 1BA3A 1W5EA 3K0AA 3DL0A 4HEHA 2OZLA 2FZEA 4GGPA 3D31A 5DNAA 2AFIB 2HQ1A 4NU0A 4BKRA 2WT9A 5GTDA 4BNNA 4F7WA 3ORQA 3AL3A 4BFZA 4A8TA 3OE4A 5IK2A 5AI4A 5LBUA 3VC7A 3NIWA 1FVXA 3CRMA 1RBYA 3JQ9C 3OECA 1GGVA 4WFJA 5H68A 3MTAA 2R44A 2VDWB 3COYA 3E2PA 3FFBA 3NIFB 2IH4A 4BZPA 3DT8A 3S1AA 3VJLA 3JARB 2ZUCA 5B4VA 1ETUA 4HX2A 2Q7XA 2WTBA 2PX6A 3GEIA 3GH3A 3QJGA 2JJQA 4BNFA 3BQMB 4E5VA 3LO5A 3PNQA 4GOOD 3L6OO 1I13A 2Z04A 4G0ZA 4WL0A 2IODA 2JPDA 3JYQA 3PHJA 3MRTA 4PZPA 5CT9A 4YN3A 1ULAA 2Y2VA 2NTYC 3W5UA 2AVNA 1CRZA 2PZEA 2OLKA 2WJHA 2H06A 4G0PA 4ZVUA 1DKNA 5LCXA 3MINA 3N2KA 3PC8C 4NLLA 4RAQA 2FUEA 2SNIE 3MB8A 2CNWA 2JRLA 4TRRA 5CLIA 3AQ4A 4KR6A 3Q8LA 1X7YB 3R3VA 1F7UA 4IYRA 2HJSA 3P0IA 1C7EA 3QE3A 5TE9A 2OKCA 5HKOA 4QGAA 4J90A 1PFUA 2W0SA 4Q1BA 1WOYA 2C88A 3HWX1 4WGGA 1ZOOA 2P69A 3ABZA 4KPGA 2GEUA 1Y9AA 3F7MA 1P5FA 4HLCA 4J7XA 4R2IA 4AJKA 1R00A 3R2JA 5EJ2A 5CA0F 2OZEA 3PWKA 3OX3A 3P2MA 2XA2A 2F1OA 1WHSB 5EFZA 3W4IA 4MWOA 4B3BA 2EJUA 5JPIA 2BBOA 4ONEA 1JHRA 4XQ0A 5BP7A 4HSGA 1JVBA 1M73E 4JR0A 1T2DA 1VC2A 2SECE 2A0WA 3LLSA 2G72A 3DAYA 5EZYB 5HX7A 4RD4A 1MB4A 5PGMA 4BFUA 1SCDA 4C0KA 3ICQB 2A30A 1P74A 1ICIA 3DBLB 3G0GA 5FBHA 3WWPA 2R7MA 4ZI7A 5HFJA 5AM2A 4AK9A 7REQA 2CXOA 2AQIA 1Z62A 4DT1B 4H7IA 3IVRA 2BHRA 4KGXA 2CSXA 5D5HA 4ZZIA 2IPAB 2ZRMA 3OZIA 4BVBA 5DYIA 5A7HA 4AY3A 3D6HA 2ZT8A 1DG3A 5JO9A 1CNEA 3CW9A 1AUOA 5M5BA 5DDIP 4I3HA 4ETMA 3N2ZB 1Y8CA 3RVKA 1GY8A 2UKDA 8OHMA 1UK6A 3L8MA 4B6GA 1PFWA 3PX2A 4D97A 4TROA 2BM8A 4MGIR 2VJAA 4ODIA 5KKAA 4HLNA 1LLDA 2D0PB 1N5RA 3LQQA 5B3JC 4YHHB 2ZDHA 1RADA 1N78A 2IOQA 3P0HA 3GA5A 3ILXA 4EECA 1G18A 1PR1A 1Q50A 5EE9A 2PVPA 1ECFA 1FFGA 1YU9A 2WF9A 3V1UA 3NBUA 5IAKA 1J7KA 1SUEA 5BQOA 4JX9A 3UUGA 4YCNA 2J46A 2QX6A 2PZLA 3DAFA 3CG4A 2W6NA 3KSUA 3UGJA 3ZE8A 4QICA 1PR6A 2BAGA 3UWPA 1T13A 3PEEA 1M5RA 4L16A 3EPRA 4NPCA 3IAUA 1QF9A 1DBPA 3IUEA 3H1AA 3HEMA 4QUBA 4UDXX 3TRIA 1CS0A 5AM5A 3R5FA 3HO6A 3H42B 2EIHA 2VHUA 4XSVA 2CVZA 1NW3A 4W9RA 1NNI1 3A37A 2WYVA 3JQEA 2CMDA 2NVUB 3BFVA 4JQOA 3EULA 4XWGA 3PRHA 4JELA 4MI6A 3COJA 3EXAA 2PT6A 3DBIA 4PPNA 1Z8DA 4KOEC 3RK4A 3AEQB 3FHJA 3FDZB 5D00A 2O2EA 3G9TA 3IR7A 4UHBA 1QSGA 3ASZA 2DEUA 2C2ZA 5LZ5A 1KDVA 5JNVA 1RTTA 1ISFA 4Q1VA 3A9UA 4X41A 4BNZA 1RYYA 1OI3A 2XF2A 5D8DA 4RE5A 3THYB 3I52A 1E1YA 1S96A 5ETJA 4I4NA 4CKYA 4U5XA 1NMSA 2Z4TA 1U7UA 4OTZA 1OV4A 1AKTA 1QKKA 1U8UA 4BLOA 1WSDA 1QIHA 4JUBA 2FR8C 4UBLA 4XOUA 1SU7A 4RFVA 3QUSA 3H1EA 3G9QA 2G1JA 1HR0B 1XD2B 3CVYA 3Q7SA 1ZMTA 2Q2WA 3R4VA 1R50A 1N5LA 2YVQA 1VZ3A 2FF7A 3JQ7A 4H7EA 4ZVMA 4AY4A 5E7QA 4EGFA 4OXIA 3P94A 3FWYA 3QGMA 3QW4B 2QJOA 3WMWA 4FCTA 1UM8A 3PE3A 2FN7A 4BMPB 1AGNA 4CG2A 4G3XA 3JR7A 1OTXA 2OV4A 2IXFA 3GQBA 3R20A 3DJFA 3WL7A 1ZJWA 5IWCA 2PM8A 2JLAA 2WU8A 4N39A 4OGLA 1UZAA 4WASA 2PRZA 2W8ZA 2JFHA 2X0KA 1KIAA 1U1DA 4MV5A 2ONJA 3K6KA 4UJ3A 1MH9A 2O2DA 2WTAA 5EOVA 2YASA 5IVIA 1BDMA 1P4HA 2X13A 3JD0A 4RKWA 2XXAA 4BC0A 2GHTA 4DSOA 1VPEA 2QHXA 2BP7A 4G67A 4IIJB 4JS0A 2JF0A 4HQRA 1G1AA 1O4VA 3VU1A 4EMTA 2QPAA 3N8IA 4HV4A 1CF9A 3DTVA 4MV7A 3TPZA 3AJDA 4H59A 4N76A 5EWMA 1NQOA 3WRWA 1KMIY 2PT7A 4BNLA 1Y7PA 1HUQA 1OZFA 5CH3A 4BE4A 1W36C 2EBFX 2QQEA 3L4SO 2FRDC 3RPEA 2P1DA 1G42A 4HSEA 4JR2A 1A9XB 1IBCA 1VXRA 1VE3A 4TL8A 3UWDA 1JB1A 3TW4A 3V8QA 3N3AC 4DIEA 3OKAA 1ZLXA 2V1XA 5IBRA 1E66A 2YWHA 3VU3A 3FI0A 3CRZA 4KRYA 2TMGA 3UJNA 4ZZ0A 4IG4A 1GFSA 1K0FA 4EOGA 1U0BB 4HC4A 3HDHA 2BN4A 1M54A 4M1TA 1QYRA 5PNTA 3WGMA 5C53B 4DMGA 3K0SA 1YJ8A 1YZYA 4ID9A 3ZCRA 3O9VA 1BDHA 2PSHA 1AX9A 3DULA 1JEJA 4RJKA 3UV7A 2F2TA 4KQCA 5A04A 4EK9A 4XEHA 4Z9YA 2ZRGA 3R6DA 1JLKA 1KMMA 1QB8A 1R5NA 2BY4A 2ZTLA 3DV0A 3OU6A 2A2ZA 4TKLA 2Q2QA 3PUIA 4IQ4A 4J9VA 1T2FA 2LIPA 2YICA 3OMWA 4D4MA 4RNDB 3GPDG 3WL8A 3SOPA 1WQ4A 5IMBA 1SULA 2Q4TA 1XELA 4L5AA 3FB1A 4YV7A 5BV1A 5AW0A 3A6JA 3R1IA 1H9BA 4EF6A 5AMXA 3C1TA 4R31A 4F4IA 1P4RA 2VDKB 3PWZA 4YP9A 3ZGLA 4BVLA 1ID1A 2W6PA 2GFHA 3ORYA 3F6SA 1VBNA 4JD5A 2IPNA 1DIGA 1K4KA 1PQPA 3HABA 4Q4JB 4EVRA 3PGMA 3SEQA 3ND5A 1FX1A 4ES6A 3NZEA 3B20A 4CMIB 1Q7BA 3SGLA 1P61B 2QL7A 3TB6A 3BFXA 5T4FA 3UGTA 1TM7E 3L8GA 2I3AA 2G0AA 3GZ4A 5FFNA 4CM6A 3U7QA 5LN1A 4YMLA 2ZUFA 3I1YA 5B58C 1I5RA 1SOAA 2X0JA 3OJCA 3RUIA 3G6WA 3O74A 3A7DA 5L4LA 4DNQA 1A3CA 1AD2A 3AW9A 3B1FA 3LNTA 3ZW7A 5CG2A 1EU1A 2D5IA 2I33A 2PZ8A 4TS9A 2XJ9A 3FTPA 4YP1A 1TQHA 3LRTA 3QWFA 3Q72A 3WQHA 1FJGB 1FDRA 2VP6A 1JI3A 4MQFB 4Y7CA 3GCZA 3I32A 1PTJC 3ENVA 3OX2A 1VKRA 3UJDA 2RCNA 3H2GA 4KUEA 1SPXA 4CIVA 3WK9A 1OLXB 3UT5A 1Q57A 1RZVA 2WNIA 1DO0A 3OF3A 4FOOA 4GI3A 1VLVA 3GG2A 4KVAA 4S24A 1JWAB 2AN1A 2G06A 1P9LA 5DIFA 3C24A 4JI5B 3AVTA 4NCBA 1Z4JA 1BHJA 4TXHA 2BJHA 4CCYA 3PUKA 4C1NA 2QY6A 1PBNA 2C4TA 5D85A 1LDMA 2XUOA 3IXQA 3AKEA 3F4LA 2ZPAA 1S0UA 1AN0A 3P96A 5AKJA 4YXWA 1PL8A 3WV4A 1RHRA 3ZGZA 4ZI7F 4AKGA 1SA0B 1MVOA 3HA7A 2O8NA 4G41A 1DEOA 1P0PA 4DQLA 3CYFA 1E4YA 1R0SA 2HOQA 3RI3A 4LF9B 3UAOA 4KB5A 1T6YA 4HZUA 4QDTA 3N8NA 5F5XA 2H1CA 2EBHX 3EXHC 5DRYA 2FMXA 2B4AA 1O03A 3HUDA 2CWDA 3IV9A 3EZGA 3N58A 2G83A 3HL0A 5E4JA 1CEXA 4TL7A 4YJ3B 1Z38A 4YV0A 3L40A 5JS6A 1ID8A 3HXTA 3KB6A 1R5OA 1JGTA 1GTZA 1MCZA 3UQZA 1TC1A 2JIOA 1K88A 1AZLA 3K05A 2J33A 1OXVA 1KO4A 3D6AA 4IOLA 2GBIA 2ILVA 1GGNA 2CFCA 3K53A 3PPYA 3MTGA 3PXEA 2PKCA 1KDPA 1J2RA 1TL7C 5KJEA 5JQGA 5KQMA 1N2CB 2XGSA 3NJRA 2P35A 1ORDA 2OV6A 4NDZA 2F9LA 4ZPXA 3NJ4A 3LKVA 4WADA 3VPCA 4HDRB 2GI4A 1NJ6A 4XCVA 4D6XA 3N0TA 3OFSA 4DLUA 1LV8A 2ID7A 3D6MA 2CDCA 3F2VA 2Q7DA 2QNIA 4I4TB 3V4VB 3CF6R 3I8SA 1KAOA 4Q1AA 1VYHA 2C0PA 4X85A 1DIHA 1N2EA 1RM3A 2QI9C 3EIEA 1VKOA 2BTQA 3NORA 4K86A 4RQTA 4DJ5X 1Q0TA 2ANCA 4FSXA 4WH0A 2DWUA 3CZCA 5AQEA 3BMNA 4ZZ2A 3G3EA 3RBZA 3NO4A 3M4ZA 1KDRA 1GGEA 2R8OA 4EW1A 2W2OA 1LNQA 1KEUA 2H59A 5BN5A 5C3MA 4MCHA 2QNRA 3KCNA 4BNWA 4E32A 1GVHA 4OHVA 4UD6A 4YWJA 1W5FA 3OTOB 1LNZA 5FLXA 2FYTA 3LUDA 5I9TA 1ISSA 3ZEIA 1CVLA 4KI7A 4QD3A 4NVRA 4ZIRB 5C8DA 5FUMA 3SHOA 1IK4A 1Z7EA 3FJ1A 2OESA 2A59A 3CRVA 3ZV6A 1S4QA 2KBFA 1MD9A 2ZJAA 3PVSA 4PG7A 1A96A 2GM5A