4OSEA

X-ray crystal structure of a putative hydrolase from rickettsia typhi
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
283
Chain Sequence
b'MQINSIKIGPYINLLPLQYIPQHKISYVEFGDPKNKNIILCAHGLTRNAHDFDKIAKELCKNYRIISINYPGRSDSENLKKPYHYNYTTYIKDTLLFFKRLNIKNPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGDYAKKTVLLDDLASAKEHLKLIYAQIGIKNEEDWDYLTKYSVISTFGGKYKMNYDPAITKQEDVKLWSVWNKIKCRILVIHGMKSQILTKSTIQKMKKTNTFDLYEIKYAGHAPSLMNDEEIYYIESWLKQKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Hydrolase
publication title X-ray Crystal Structure of a Putative Hydrolase from Rickettsia typhi
rcsb
source organism Rickettsia typhi
molecule tags Hydrolase
total genus 92
structure length 283
sequence length 290
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oseA00
5AI6A 2QTBA 1C7JA 5ALMA 4BCCA 1A8QA 4BYMA 4KEAA 2HU7A 4W1SA 5T4HA 3IA2A 4IH1A 4ARBA 2ACEA 4BATA 4LXGA 1DX4A 3GZJA 4CFSA 3WWDA 1CUSA 3M81A 2XUGA 4DLNA 1A8UA 3LS2A 3MUNA 1NU6A 4FBMA 5LKRA 1UFOA 5IVKA 3FLAA 3UUEA 3AINA 5K3FA 3DJYA 3QVMA 1BROA 4FNGA 2WFZA 3ZWQA 5DTJA 3FYUC 4LHEA 2Y2UA 1DT5A 5AK5A 3I2GA 4C88A 4L72A 1EHYA 3SK0A 1UKCA 5CT8A 3QZUA 3W9BA 2ONCA 5J3JA 4ZV9A 7YASA 2FJ0A 5FLKA 1DWQA 3C6YA 4TVKA 2I3DA 4H7EA 4ZXFA 2C5FA 4H35A 1HBJA 3WWPA 4F0JA 3TJMA 2CEKA 1AC5A 2HU8A 1K5PA 1XZEA 1XZJA 3C70A 3I2JA 4YX9A 4X95A 5AK4A 4BP8A 4H77A 3DYIA 2H9YA 3C6XA 2VQ6A 4INZA 3WWCA 4X93A 1MTZA 2VAVA 4LXHA 5ALUA 1XZDA 4H18A 5KWJA 5BOVA 1SC9A 1PFQA 2Z5GA 5HFAA 4C89A 1F0PA 1EA5A 4KACA 1AUOA 3DCNA 2G5PA 2O2GA 2HM7A 1ODSA 3N2ZB 4X85A 4WDQA 2DHEA 1ORWA 3R3XA 1AURA 2JGIA 4U2FA 3DDUA 4C87A 4Y2YA 4EUSA 3PE6A 2OCLA 5ALKA 3PF9A 4N8EA 2XUJA 2WFMA 5A7FA 3JW8A 4FNMA 5F4ZA 1EINA 4ITVA 1LPPA 2ZJFA 2WTNA 1QONA 3O4HA 3OPMA 1ODCA 4K6KA 4X97A 4HZGA 5HFNA 3LIIA 4WFJA 3PICA 1R88A 4CCWA 2HA7A 3ESBA 2OQIA 4PNZA 3X3HA 2QOEA 2PBLA 2HFJA 5AICA 5JAHA 2WLSA 5HF5A 1LZLA 2K2QB 1K4YA 4QWWA 4AN0A 2XMBA 1TQHA 2XLCA 3F9CA 2VJCA 4FKBA 1K8QA 2VJBA 2EDAA 4RE6A 3QITA 3STUA 1VKHA 2ZSHA 2DQYA 4GI1A 1EXWA 1GKLA 2CZQA 4UUQA 3GELA 3T4UA 1H2WA 2D0DA 2XMZA 2JGEA 4LYEA 1XLWA 5ALEA 4RNCA 3G7NA 5FDFA 3G8YA 3FCYA 4NMWA 5HZGA 3EQ8A 2PSDA 4KE7A 2V96A 1EI9A 4DNQA 1ETHA 3QM1A 3FVTA 4J0GA 1TRHA 4U2GA 4J3JA 2EEPA 4ROTA 1AKNA 2BCEA 2WIGA 4EY5A 2NW6A 2JGKA 1TCCA 5FPQA 3GBSA 2XE4A 4MQMA 5AM4A 2GBGA 2GBIA 5K3CA 2WG0A 1ODTC 3QBJA 4G8BA 2XQJA 1AQLA 3PDCA 1JJFA 5A2GA 2HA5A 4E11A 3ZLUA 4DGQA 4FHZA 3A6ZA 2PVSA 4U2BA 4O08A 4OYYA 3EIOA 5CH5A 3WL8A 3M83A 3PFCA 1QIMA 1DINA 4KRXA 2OGTA 1NU8A 3UMJA 1MPXA 5K3DA 4AMZA 4BRSA 4OU5A 3H2IA 3WKEA 5A7HA 4G8CA 2C58A 4L0CA 1KU0A 4B9AA 4L9AA 1GPNA 1B41A 3N0TA 3D7RA 3C5WP 4FLFA 5AKZA 4L3WA 2WTMA 2VSQA 1TKRA 5JASA 4G1FA 1EDDA 1JU4A 2QXTA 4MXDA 2H1IA 4JH0A 5ALIA 1IUNA 1D07A 4UHCA 3WJ1A 1B6GA 4QDOA 4UBJA 4DSZA 1EB8A 1ZI9A 3B12A 3EQ9A 5JAOA 4H0CA 1YR2A 5DYYA 3WWEA 5JAPA 5A7GA 5AKIA 3FNBA 5HCUA 2PSJA 1W1IA 1Y7IA 1VZ2A 4Q3LA 1XRMA 1MAAA 4EY6A 5CT5A 4J0IA 5DWDA 1CVLA 1CUDA 2AJLI 3WYNA 1XZFA 2HFKA 4NS4A 1R9NA 3C6BA 1WB6A 4OPMA 2ORYA 1VE7A 4A5SA 3BF8A 5AM2A 3G9UA 4LKOA 2QT9A 3QPDA 3BWXA 1SOMA 1T4MA 2HADA 5ALSA 2OQVA 5ALJA 2YASA 1AX9A 1Q0ZA 4HS9A 3BE8A 1VJ5A 5HQ3B 1A7UA 2CMFA 2QR5A 3H19A 3ESAA 1UOOA 4ETWA 1BCRA 1QIKA 2V9ZA 5AIBA 4B85A 1BCSA 4Y2RA 3PI6A 2HRRA 2PSEA 2VATA 4HXEB 4PO3X 5D3ZA 4BE4A 3LP5A 1E8MA 4TGLA 2WKWA 3WK5A 1XRQA 4G9EA 2OCGA 1SCIA 3G0IA 5K3EA 4UHDA 4BBZA 4HXGA 5AI8A 2HRQA 1Q0RA 4BRZA 4W9RA 4X3CA 4Y2QA 3GROA 3WL5A 1JJIA 2B4KA 2VAXA 2VA9A 1AGYA 4Q34A 1XLUA 2PX6A 5AKHA 1MN6A 1X2EA 2HA4A 1F0NA 1XQWA 2PUJA 3WK9A 4EY7A 5C7YA 3F98A 1LBTA 1CQWA 4IHAA 3T52A 3H2JA 1IZ7A 4QNNA 3WK8A 1GT6A 4RGYA 3H0CA 4X6XA 1UWCA 2J4CA 2HA0A 1VE6A 1QFSA 4E14A 3F96A 3AILA 3NGMA 1JFRA 4QEKA 5AKJA 3HEAA 5FRDA 1N8SA 5ISMA 3JYHA 1T2NA 1R3DA 2VJAA 1JMYA 2AJCA 4F5ZA 2OAGA 4FTWA 2ZYRA 3WK4A 1YCDA 1MJ5A 2RONA 3OTQA 1P0MA 4IH4A 1FFDA 4FWBA 2XUFA 4X90A 1BE0A 1O6GA 2GYVA 5K5EA 1ZD5A 2BGNA 2QXUA 1TAHA 1DT3A 3LIPA 5ALNA 5CTAA 4H7FA 3C8DA 1X70A 2X5XA 4B84A 3R3UA 4WY8A 1L7QA 2AXEA 5C81A 2E3JA 2YXPX 4S0XA 1EK2A 5I8PA 4YPVA 3WQHA 5AHXA 3F97A 3D0KA 4CCYA 1X2BA 4E46A 1CFJA 5CRIA 1IUPA 3NOXA 2WFLB 1USWA 5C8XA 1LNSA 4OB6A 5EHQA 1WPXA 3VJMA 4ZREA 1E8DA 4FBLA 2PU7A 4P93A 2PPLA 3G0CA 4AB1A 2H7CA 4JYMA 4JNCA 5AI0A 4BC1A 3STYA 1XRNA 1G66A 5DJ5A 4J03A 1XRPA 2Z3ZA 2H7YA 4MWSA 4CIBA 4MQLA 2XUPA 3CCCA 2VT7A 4IQ4A 5ALRA 4QDXA 1ZOIA 2XB6A 3OC0A 4KJXA 5CT9A 3HLKA 1ACJA 3W9UA 3F67A 4FDMA 5AI9A 2OCKA 2ECFA 3DS8A 1UKBA 5ALVA 4DMKA 4Q05A 1XRLA 3A70A 2JEZA 2WG1A 3BL8A 3S8YA 3AIOA 4BVKA 2XQFA 4DMFA 1YB6A 4H7IA 1RYYA 4QLAA 1U8EA 5SYMA 4M0FA 3WL6A 4AO6A 1ZGBA 3R0VA 4OD0A 5AI5A 4QWMA 5AJHA 3I2IA 1LZKA 5FXMA 1EDBA 4C4ZA 1J07A 3G0GA 5EHZA 4DIUA 1ZD2P 1FFCA 3R40A 5DNVA 3I2FA 5AKYA 5AIAA 5EIAA 2HIHA 1JMKC 5H3HA 1YS1X 2Z8ZA 2WHQA 1PV1A 1DQYA 3FYTA 2DHCA 4P92A 1LPSA 1MNQA 4E15A 1CUHA 4G4JA 1BN7A 1SFRA 3VVMA 4DM7A 1U4NA 1LGYA 3R41A 2OPHA 5HK8A 4GECA 5CBKA 3WLAA 2QRUA 4BAGA 4GLBA 4X71A 3G0DA 5EIHA 1CUBA 2ZSIA 2Z3WA 1PJAA 1XZBA 3VVLA 5A62A 5HQ3A 3FLBA 1XZIA 4H7HA 3NUZA 1VXRA 2RIPA 1ZGCA 1QTIA 3AZQA 3A2MA 3WK7A 1EH5A 2IITA 1CLEA 3WIBA 3BJRA 5SYNA 4Y2TA 4OCZA 5JAUA 3GUUA 2WILA 5AOBA 2ROQA 4X91A 2WUEA 4UFOA 3HZOA 5ALWA 2HHAA 4HAIA 2EDCA 1CR6A 1CIJA 2QM0A 3WL7A 1YASA 1OCEA 4KYVA 5AOAA 3V1MA 3E1GA 3H04A 1LPAB 2V97A 5LLSA 2HU5A 1IZ8A 2P8SA 3R3YA 2VF2A 5E4YA 5JATA 3FCXA 4EY8A 1W4LA 4I3FA 2QJWA 1Z68A 2J3QA 5AK6A 4GHWA 1MAHA 4BVJA 5LZ4A 3PUHA 1P0PA 5JD6A 4BP9A 5AM5A 3MGAA 4HRXA 1MX5A 3L1HA 5K3AA 1XZHA 5ALXA 4UPDA 5EGNA 1UK6A 5DLPA 2FX5A 2WUDA 3DOHA 5A6VA 3KD2A 2J4FA 2HA2A 3STTA 3ZPXA 3EQ7A 1CUWA 2XQKA 3ILSA 2ZJ7A 1JU3A 1LLFA 1CUUA 2I3ZA 3A2LA 4BDTA 3H17A 1QLWA 3WA6A 4D9JA 1I6WA 2WFLA 4QLOA 3D5EA 5BWCA 4B83A 3C87A 3VJLA 4DNPA 4BDSA 3C45A 2WU3A 5CMLA 4FFVA 4MJ3A 3STWA 5E4JA 1CUIA 4GBGA 5FPPA 3GA7A 4UBMA 3DOIA 1G42A 4FFWA 4KE6A 3KXPA 4FLEA 3K9BA 4FOLA 5EHXA 4W63A 3FWHA 3TEJA 1Q84A 5KREA 2DR0A 3VISA 3I2KA 5ESRA 1C4XA 4G4GA 3LCRA 1EVEA 1HKHA 3C8HA 4Y2VA 3UUFA 3BXPA 1LPBB 4DTCA 5ALTA 2WHPB 2Y6VA 4WCVA 4C6HA 5LYYA 3WKBA 5JZBA 3ESDA 3H1AA 3IURA 2PKYX 1UZAA 2XUHA 2RAUA 4W1PA 1J2EA 3FLEA 4MEAA 4NVRA 1HQDA 4OB8A 1EVQA 2R11A 3B5EA 3CN9A 3VKFA 2XUQA 2W6CX 3IULA 3CXUA 4J0KA 4CG2A 4AXBA 2ZYIA 3DKKA 4KE9A 1QIHA 1THGA 1XKLA 4UHHA 5BV7A 4K6GA 3V1NA 2XMRA 1TCAA 3V1KA 4GDMA 1W52X 4Z49A 1HDEA 3FBWA 1EDEA 1GGVA 3H18A 1GQSA 3D3NA 1VOTA 2HDWA 4MWTA 1JJBA 4AQDA 3C5VA 2BFNA 5K3FB 4DYHA 1TCBA 4IH9A 4XJVA 3O4GA 4BVLA 3C43A 3IUJA 2G4LA 3ZLTA 1F8UA 2GYUA 3D4LA 1F6WA 3IUNA 4ZI5A 2JGMA 2ZYSA 2FUKA 4X6YA 5FUMA 1VZ3A 3FSGA 4PF1A 1UXOA 5IVDA 5JD4A 1N5MA 1ZIXA 4XIIA 3D2BA 2RGUA 4QDUA 4JYPA 2O7VA 3OOSA 5AM1A 1XZKA 1FFAA 4PW0A 3E4DA 3BF7A 2QUBA 4Q1VA 4EHBA 5HKBA 2QMQA 1WHTA 4B9EA 2BJHA 4P08A 3O9MA 6YASA 3WMRA 3A2NA 1FSSA 5AI4A 2XT0A 2OAEA 3ANSA 4CIAA 3VXKA 1G4HA 4RPCA 4EZIA 5IKXA 5DNUA 3G02A 1MNAA 3G9TA 1QJ4A 3D59A 4WJLA 2BUAA 5EIEA 2LIPA 4J0CA 2ACKA 4G4IA 1M33A 5DYTA 1YA8A 5DNWA 3O9VA 1E5TA 3ICVA 3WI7A 1QIJA 5AM3A 2CB9A 3I6ZA 4I19A 5AKXA 1GKKA 1DWOA 5ALYA 1WB5A 1AZWA 1U2EA 1QE3A 2DHDA 2GBCA 2JIDA 3EF3A 1K63A 1DU4A 3OG9A 1W76A 4Y2JA 5CT4A 3HC7A 5FP0A 3O4JA 4PQEA 1CUAA 3BIWA 3KOOA 5CH8A 4K5QA 3H2HA 4QDTA 5KWIA 1Y37A 1H22A 3WA7A 4EY4A 3W05A 2XMGA 4ZGBA 1GQRA 5CT6A 5ALPA 3O95A 3ZI7A 3HYSA 3AIMA 4KAAA 3I2HA 3G9ZA 4CI9A 4DNOA 3BJMA 1DQZA 3MVEA 4C01A 1WHSA 4A16A 5EI5A 5AKGA 4PSDA 3VDXA 1FJ2A 2XUIA 3L1IA 1UK8A 4Y2SA 4B80A 3WK6A 5ALFA 1CUCA 3STVA 1HLGA 3H2KA 4OYLA 3M3DA 2X8BA 2OCIA 4N8SA 4W1RA 3BDIA 2FJPA 2WU4A 3HXKA 2ZJ6A 4J0HA 2RI6A 2C4HA 2Y2VA 3HRHA 3I1IA 4M0MA 5AKLA 3PF8A 1YA4A 5JYCA 5ALOA 2B20A 5ALLA 4UFNA 2PM8A 5CXUA 3WKDA 5CH3A 1CUGA 4MEBA 1CPYA 2Y6UA 3LLCA 1QFMA 1YS2X 4ZV7A 2WHPA 4NZZA 3I1YA 1JI3A 2YYSA 3SX4A 2C0PA 2QUAA 4EBBA 2Z8XA 2AJ8A 2GZRA 1EB9A 3V1LA 2O2IA 4AO8A 1CUXA 4DMHA 4Y7DA 5AH0A 1O6FA 2VTVA 2XUDA 5CXXA 3HJUA 4ZRDA 5ALHA 3O4IA 2DCMA 4BZZA 2O7RA 2OXEA 3DL7A 4G9GA 4N5HX 3SWWA 1CUEA 2WIFA 3KWJA 1QO9A 5HF9A 1FFBA 5HKAA 1R9MA 1SCKA 2WJ3A 3AFIA 3C6ZA 4Q82A 3G9XA 3IDAA 5ALZA 4XX1A 3TGLA 2RHTA 3STXA 1QIEA 3KWFA 1G5FA 4W1QA 4F21A 3EBLA 2C5GA 4F60A 4UBNA 5AKKA 2ZVDA 4QE3A 3JWEA 1J06A 3QYJA 3QPAA 5LZ7A 3ESCA 1XQVA 1YAJA 3WZLA 5HK9A 1MT3A 2OLEA 1HL7A 3D2AA 2OG1A 3MUOA 4BZWA 4HTAA 5T4FA 1W6RA 3I6YA 5E2IA 4EB0A 1QTRA 2C0QA 1WB4A 3HSSA 2WJ4A 3DEAA 1H2ZA 4N5IX 4P9NA 4Y2PA 2QKYA 5A71A 1MX1A 3BIXA 2JF0A 4B82A 1GPKA 5I7UA 5EHNA 2DQZA 1ZICA 4DSAA 4UBKA 3FOBA 4V2IA 4K6HA 1UK9A 1CUZA 5JARA 2WIKA 3OM8A 4C4YA 5T4EA 1ZJ5A 1QZ3A 4KAFA 4IO0A 1ZD4A 4QDZA 3H2GA 3RM3A 2XUAA 3DLTA 1P0QA 1U65A 3R3WA 1GXSA 2RHWA 1ZI8A 3IIIA 3QH4A 2BGRA 2YH2A 4UBOA 3S2ZA 4YASA 1LPNA 2I78A 3AIKA 5HF8A 5BWBA 1XZCA 5CURA 5T4BA 1HPLA 3FYUB 1VLQA 2JGJA 3WKAA 1UT6A 4MYDA 4OU4A 1ORVA 5JZSA 2QS9A 3F8SA 1XZLA 4H7JA 4U2DA 1CEXA 4GWLA 3H1BA 4GW3A 3W2TA 5D7BA 1DTEA 4PSUA 3ZV7A 4BTLA 5LKAA 4GXNA 2IIVA 1VA5A 4AN1A 2WG2A 3FSGD 3VJKA 1BEZA 4WFIA 4WDRA 3KSRA 3AUKA 4AX4A 4AZ3A 1IMJA 5HF6A 3IUQA 5AP9A 3DD5A 4UBIA 3P2MA 4BCDA 2OGSA 4AMYA 1N5RA 3QMMA 3RARA 4KRYA 3RLIA 3BDVA 5D6OA 1XLVA 5AM0A 3M82A 2CKMA 4UHFA 1CUFA 4ZWNA 5DTIA 3ICWA 4BAUA 3V48A 5IH7A 5LZ8A 5C8VA 3TRDA 2CBGA 2XDWA 1IUOA 1CUJA 1WCYA 2XUKA 4DNFA 2C7BA 2JGFA 4HXFB 2VJDA 3DYVA 1Q83A 1R1DA 1ACLA 1XZAA 2ES4A 1A88A 1CUYA 4B6GA 2X76A 1JKMA 1ZD3A 2Y1KA 5AKEA 5ALQA 2XMSA 4BC0A 1RP1A 1RWQA 4C4XA 4XWGA 4JUIA 5CW2A 4AZ0A 3K6KA 2WIJA 1TK3A 1J1IA 2G63A 2GYWA 3HABA 4LXIA 5DYWA 5D3KA 1QOZA 3DKRA 3ED1A 1XKTA 4EA6A 1R4ZA 1DX6A 3QPCA 2XI4A 4X92A 2WQZA 3IB3A 4Q3OA 5LP1A 1VXOA 3Q8WA 3SC2A 4J0JA 3W04A 2DFPA 4CG1A 4CCYB 5JANA 3WYDA 1YSCA 4X7BA 1SCQA 1E3QA 1GPLA 1KEZA 4N8DA 2WM2A 3DNMA 2Q0XA 4KR0A 2JBWA 2O2HA 3B3QA 4B81A 3IUMA 3CCBA 3W06A 1WOMA 1GZ7A 1H2YA 3U1TA 4TPKA 1CRLA 2GBFA 1MU0A 1E89A 3WWOA 4H7KA 4Y2UA 5JALA 4X94A 3ANTA 4OB7A 1E8NA 3KDAA 1TIBA 2JGLA 1Y7HA 5IVIA 4X6UA 3WZMA 4KE8A 5JIBA 2XUOA 5JZ9A 4BCBA 2WSLA 5JD5A 4K2AA 1P0IA 1LBSA 2XQGA 4RE5A 3AZOA 1UKAA 2WIDA 3PUIA 2JEYA 2WUFA 4QZVA 1L7AA 5E4TA 4UFPA 1YB7A 3DQZA 1VA4A 1XQXA 2CUTA 1QIFA 1XQYA 3NWOA 2BAGA 4BTVA 1UOPA 2I03A 3HI4A 4G8DA 4B7ZA 4A23A 2IX9A 1AMNA 3FVRA 2B9VA 1QGED 3HACA 3YASA 2WUGA 4UHBA 5JADA 3PFBA 3Q0TA 1EK1A 2CJPA 1THTA 1JT2A 4LYDA 4KAJA 3I6MA 3QMVA 4OUKX 1XZGA 2QZPA 4U2CA 5I9IA 4DMCA 1ISPA 1BN6A 4FMPA 4WFKA 2PUHA 4FLMA 2PL5A 2GZSA 2QVBA 4LIPD 3CN7A 5AO9A 3R3VA 3R3ZA 3V9AA 2H7XA 2W22A 5FKJA 1QIDA 4BB0A 1OXMA 2XMCA 3WKCA 2XQIA 4QA9A 2HA6A 2D5LA 2XLBA 1K6EA 1BRTA 3AZPA 4B0PA 4G5XA 1YAHA 1BU8A 4WY5A 5LZ5A 1S8OA 2AJDA 3FYUA 1NX9A 1IVYA 2BKLA 4Y2XA 1WM1A 1C7IA 2R8BA 4HVTA 4Y9SA 3RK4A 2VEOA 4M0EA 3E0XA 5ALDA 1WPRA 4H7DA 1LPMA 5LZ9A 3RKSA 3IBTA 5KBYA 1ZJ4A 4PSCA 5FOQA 5IVHA 3WJ2A 1QIGA 1BS9A 2PSFA 4OSEA 1CUVA 2HA3A 1MO2A 3OURA 1FFEA 5FV4A 1XZMA 1L7RA 2WJ6A 1ZIYA 3DL4A 1H2XA 2BUBA 2PSHA 4MYSA 1CV2A 3K2IA 3D2CA 1ZI6A 2ZYHA 1CQZA 2BUCA 1E66A 3WIOA 2UZ0A 5AOCA 2V98A 1OILA 3E3AA 5LIPA 2QJRA 4UHEA 4J0DA 4J7AA 1XFDA 2XMQA 4CG3A 4HRYA 1UK7A 2PU5A 3IVMA 2B61A 1W75A 3ZLVA 4XVCA 4ARAA 2AJBA 1XROA 2VT6A 1R50A 4Q3KA 4I4CA 3FAKA 1A8SA 4YK7A 1QO7A 2DSNA 4PV7A 4BE9A 3QMWA 3U0VA 4UBLA 5LZ2A 5EFZA 4GEGA 1XRRA 1EX9A 2G5TA 1UOQA 2XMDA 1H23A 4U2EA 5ALGA 5C8ZA 1LPOA 4X00A 4AO7A 1N1MA 4BAZA 2WHRA 3O0DA 2J3DA 3AJAA 3GFFA 1BEEA 4B0OA 3G0BA 5K3BA 5AK3A 5YASA 2OGZA 1QIIA 3L1JA 2HL6A 3I28A 1MX9A 1DWPA 4JEIA 1KU6A
chains in the Genus database with same CATH superfamily
1KO7A 2OSBA 4C2AA 2R87A 3S8EA 2QTBA 1HT1E 4M88A 2VHQA 1KZ4A 1ZFNA 2OBBA 2AMFA 3WXBA 5C52B 3NO4A 1KK1A 2P6UA 4DBLE 4BCCA 3DEZA 3PHCA 3PD1A 2I7VA 5AOVA 1M83A 4Q66C 4FHDA 5SV2A 2JJ1A 1LA2A 2QRJA 1WSBA 2W71A 2VTBB 5TY0A 2NUPA 1PBNA 2XKJE 9LDTA 1AGPA 1LDBA 1MIOB 2J46A 5K45A 3I9LA 4YHBA 1HDRA 3IA2A 1TM7E 2CXNA 3D1JA 3ROGA 4ARBA 3K35A 4EEKA 1PO7A 1XA0A 3UWKA 4Y1RA 1E9CA 1B16A 2RI1A 1J8VA 5JJIA 2PX4A 3WWDA 2FMUA 2G08A 4NJEB 1SK8A 1V8FA 3S2UA 1X14A 1N1DA 1YCGA 4EJSC 4J75A 1GADO 2W2MA 1WUTA 3UXYA 1V95A 2BFEA 3OLWA 3LDAA 3OPNA 4I9NA 9ABPA 5IVKA 3FLAA 3P4UA 2PMEA 2H11A 1L7PA 3QVMA 4I50A 2I65A 2IYEA 4LHVA 5K3FA 5KTNA 2R4UA 1ZM7A 3N74A 2CXTA 5DLQC 4FNGA 3UMMA 4OMDA 5AQ1A 4WXRA 4NH0A 4PGMA 2GN4A 3DFZA 1CZLA 1E9AA 1F48A 1G2IA 4YIKA 3G6WA 3KC2A 4JELA 4CM6A 5IG2A 3INTA 1V2GA 1ZBDA 2OENG 5DTJA 2ZI9A 3FYUC 3BHNA 1NI3A 4YPOA 5AVOA 1J0CA 1DT5A 4KTTE 2YN0A 5AK5A 5FPSA 1V7ZA 4L3OA 3SK0A 1UKCA 5CT8A 5IABA 1PS8A 2OT3B 4ZK6A 1M0TA 1SUAA 4OHXA 3PA8A 2ONCA 4JI5B 3E15A 3VGJA 2W5UA 2FRDC 5J3JA 2X42A 2ZITA 1KDYA 2QVGA 5B2EA 4ZEMA 2NVWA 3DF9A 3PR3A 5AD1A 1DKNA 1W34A 2IYVA 4EENA 1AA9A 3KHTA 5EXPA 5T3UA 1YGPA 3CW9A 4PGHA 1SGWA 5HKLA 2P4QA 5IC6A 2YMMA 5L4LA 4OKNA 2ILTA 3OECA 4TT3D 4TVOA 3ZGVA 3OJOA 4ZAGA 5NLLA 4BO8A 1TGYA 2BGKA 3PT5A 1TCVA 4H35A 4RHFA 2IW3A 3IE1A 1JAZA 3BRWD 1GUYA 2C9CA 2PX0A 3O1HB 2CEKA 4Q93A 3B1VA 3OZDA 4W5WA 1WZUA 1PR4A 1AM4D 1B0UA 1AC5A 1SUDA 3KM0A 1ISIA 1S2NA 4OQLA 4IBOA 2C5EA 3MMPA 1CS0A 1K5PA 1GYQA 3ICPA 3IEPA 4IQ8A 2WWVD 3WDSA 4Z5XA 5JHGB 3FUCA 2EYQA 1GRNA 2WP0A 2Q9BA 2CYBA 3OLZA 4JDUA 1NWHA 3Q0EA 3RU3A 3R9WA 4PRYA 4EZEA 1X13A 4CETA 4BP8A 4NICA 4Z4GA 2C7OA 5T6MA 3DYIA 2H9YA 4WOBA 4FMCB 2VQ6A 3GT0A 3RREA 3THRA 3TQSA 3V55A 3CVYA 4CV2A 1P5JA 2RHOA 4KO3S 1I7DA 3PITA 1NRJB 5ALUA 1MJNA 5ETJA 1Z4QA 2IZ6A 4RVUA 4GOKA 3D6AA 1P72A 4CF4A 3HCNA 5E6UB 3ZWYA 4H18A 2M98A 2FF7A 2X77A 3HJFA 4V0OA 3P2YA 4AROA 3ESQA 2H9AA 1F2UB 2WPDA 4RL6A 2X0DA 4PN3A 1NQ5A 2P7IA 3RROA 4ITUA 5CFPA 3BILA 1POWA 1PG0A 3IESA 1XD2B 2JCSA 1P0FA 3QUBA 4WLVA 4HTFA 1OWNA 1VYHA 2I1LA 2QROA 3R24A 1QV6A 2HUPA 2Y0BA 3THXB 4CT0A 3Q7RA 4X45A 5ESDA 1AUOA 3DCNA 1ZP6A 4JP1A 3ZTTA 4WLEA 2J0EA 3UJ9A 4XIJA 4GYWA 3KJQA 1LV7A 2DHEA 5ERXA 1LEHA 2IZOA 3MT0A 4WD3A 4DDKA 1RCTE 3CRMA 3ROZA 3O5AA 1L5MA 4NABA 1Y4UA 4KWTA 1OH8A 1VLLA 3W1VA 1X7WA 4RHEA 1WE2A 1BOOA 3O8BA 2PT6A 2QMOA 3OJCA 3K0CA 3PC8A 2GZMA 4U2FA 3ZCTA 2FE4A 1A9RA 1OTYA 4Y2YA 5K6RA 4KUHA 4ZOCA 4RY0A 5JWHA 3NM4A 2P91A 4YN3A 2Y67A 5CP8A 1OY1A 2L0XA 2OCLA 1YFJA 5ALKA 2DQKA 5DHRA 2ZI3A 3MXOA 5IBCA 1KP9A 3QX7A 5KVCA 3LC2O 3IAHA 1G19A 1UL1X 3E48A 1RKVA 3JYNA 1GUDA 2WK1A 5AR1A 2P2GA 4OREX 3DAGA 4FGLA 4ES6A 3CPJB 4JD5A 1ABBA 4QPCA 2BE7A 2D62A 2F67A 1Z6TA 2ZIZA 1I1NA 1RXEA 1SCUB 5DB4A 4Z1MA 5TQ2B 3O82A 3UWPA 1JSLA 2DBYA 3U1BA 5MHTA 2JDID 5EC8A 3IOEA 5JSHA 5LN1A 4X97A 3PSAA 4CU2A 1D3AA 1Q22A 2Q3FA 1PJ4A 4KB5A 3UPUA 4K03A 4PSAA 2FFAA 2I4TA 3HPRA 4PWZA 5DRTA 3USZA 3WY9A 2QD3A 1R88A 5I4KA 4C0SA 4CCWA 1ISMA 4IHQA 2HEGA 4XWYA 2FOXA 4P32A 2VCYA 3AKCA 2PBLA 1Z5WA 3WGNA 1UC8A 2YFQA 4Y3UA 2ZRIA 1AY0A 3PQ3A 2JD1A 4ZVUA 2Q2NA 3RYTC 1ZUWA 3S81A 3F5SA 3HO1A 1IXZA 1VFPA 2YTZA 3PGXA 4IJ5A 2G9VA 2R68A 4I6JA 5IEJA 1I1HA 1LZLA 1E3WA 1T8YA 4JYAB 1YTUA 2PBRA 3NEPX 5KSWB 3HWRA 2J0QA 5BSMA 1VPEA 4J7UA 2I4IA 2ZREA 121PA 3U3XA 2ILVA 3JZFA 2VH5R 3OFKA 1P1JA 4YP1A 1AKWA 5HEKA 4AT1A 2V0GA 1O94C 5LXTA 2IHUA 4OLHA 4KUEA 3UCFA 4BRUA 2O48X 1V6SA 5F2EA 3RYFA 1NY5A 3K5IA 3NJ8A 2CL6X 1CNEA 4MI1A 1D6MA 4O2RA 4TXLA 5F64A 2CDCA 2ODQA 3RIEA 3NYQA 2ZSHA 1PWHA 2DQYA 4GXQA 4HAUA 1DV2A 1GSHA 3A3PA 4KVAA 4LJ6A 4TSFD 5C1DA 1G3IA 2P77A 2OWEA 1EXWA 4XE5A 1K5HA 4WOPA 4RFLA 4AECA 1H6CA 1J6UA 4UUQA 3T4UA 4A0HA 3OFVA 4N3GA 1TEVA 3TPZA 4DUPA 3KQWA 1PJCA 1H2WA 4Z2YA 4EA7A 3AWIA 5DDIP 4FOSA 2DFLA 2QW8A 5BT9A 2DWQA 2A67A 4TV9A 1M8PA 4HNAA 5EVCA 4M7PA 4OQFA 2H06A 4ZARA 3F7TA 3ISTA 1BXGA 1I9CA 2B1JA 3NQ41 5B4VA 5KHOC 3CWQA 2A0YA 3GT3A 4UAGA 1RKUA 1XLWA 2Q3CA 3PWZA 4RNCA 4UVEA 1V3QE 5A1TA 3L7NA 5CDHA 3G6KA 2YV2A 3PEEA 1U2QA 5FDFA 2O6HA 4HOYA 2AN4A 4I4TF 3ETEA 3FCYA 4J16A 1KH2A 2X9GA 4FYKA 4R51A 4BU1A 3L4JA 4MDHA 4M9SA 5HZGA 5IPFA 5LMCA 2PSDA 4G63A 4F45A 1N5LA 1BYUA 1D6SA 1GTJ1 1U7DA 2F3PA 4OBEA 1FL9A 2QL7A 2OCYC 4JIGA 3U81A 4DNQA 3NJ4A 2L2QA 3B2QA 1XEXA 2CHFA 3A6JA 1TRHA 3B13B 3HKDA 4L3VA 2II6A 4LGMA 4Y2GA 5THXA 3HR8A 4J3JA 4DDWA 4UTRA 3OWXA 4BMDA 4BVGA 1CBUA 1GUAA 1P2VA 3A9VA 1VJDA 3MGKA 4OHPA 4ROTA 1AKNA 3RJ5A 4BNLA 4TYMA 3RJMA 1DDGA 2X0KA 4Z0PA 3K9HA 3UMVA 4JOQA 3SP1A 2AF4C 3WWZA 1K8RA 4AF6A 3BMQA 5IX8A 1GQFA 2Q1SA 1L5QA 4J9VA 3DOCA 4GC9A 3EAGA 3GVHA 2EQ5A 1LS1A 3K2BA 3LPCA 2AWNA 1IZ0A 3NWPA 4QVGA 2JGKA 3UCEA 3IB6A 3N8NA 5E6RA 4EKNB 1QYCA 1HG1A 1DKMA 4ZIRA 1U28A 2OO7A 4MQMA 2GBGA 4N0MA 3ZE9A 4F3RA 1PZXA 5K3CA 1FYFA 4TWRA 2IE8A 3DT9A 2HHJA 1K7XB 4KIFA 5FUWA 3NOVA 5BVHA 5F2OA 4ALKA 4XD7A 1C7QA 4BQFA 2BONA 4A2CA 1Q92A 1FTWA 5GP1A 1AQLA 3HJAA 3PDCA 2OO5A 2CNKA 3T7TA 2Q1XA 2CNWD 4D8WA 4E11A 2JI6A 2C5HA 3WB0A 3ZLUA 3TJZA 1FU8A 1LDNA 1SG9A 4FHZA 4WKNA 5E7JA 3TXAA 4B34A 3Q7TA 3HBAA 4KODA 1NNUA 4L8YA 3RNLA 2PVSA 3DHEA 4H4DA 4U2BA 2X3UA 4OY3A 3AEUB 3CJRA 3SJAA 3QV2A 2FOIA 3IAM1 4DXDA 4H1WA 4MHSA 1QGZA 1WP9A 2NV6A 3M5CA 2JBAA 5IJWA 2Z3VA 4PS1A 3C3CA 2Q3EA 2NU6A 3PFCA 1R5JA 1QIMA 1ARZA 1XTKA 4IO1A 4U7FA 1VCIA 1DINA 3TRKA 2YN4A 5DCWA 2P1DA 3GJ4A 3RYHA 3C85A 1NU8A 2DQSA 3IDSA 4B45A 3DL2A 3H11B 1PR3A 1V4BA 1BX0A 2NYRA 4NCXA 3UMJA 1MPXA 4AMZA 4OU5A 2V6IA 5AMXA 1IEWA 3HCEA 4G8CA 2O20A 3L9XA 2IHBA 3SM9A 1SMKA 1KU0A 2MWMA 3RRNA 3ROQA 1N33B 1K3UB 1OGYA 3S55A 1T2VA 2B7CA 2VEDA 3WSVA 3FZGA 1Q19A 1YONA 4CMAA 3KQPA 4L8GA 4TROA 2R66A 2QLMA 1EK0A 4WVFA 1KSHA 1UOEA 2IU4A 2RGNC 4IXNA 5J4HA 2R6JA 1ZIOA 3NRBA 5B53A 2R8ZA 2GNPA 3C5WP 2AMJA 1UBFA 3FFXA 3LL7A 3OJFA 4FLFA 5DT9A 5F5XA 5FWYA 1CF9A 1A5BB 1ZUNA 2O1SA 5FLXA 2B82A 1F12A 1S8FA 1UFVA 1Y6ZA 1RRGA 3U7GA 4RJJA 1J97A 4OG2A 1V5FA 3SAJA 1G8SA 2ETXA 1PK9A 4NZ9A 1E98A 2PRIA 4LY6A 2Q41A 3NTLA 4OBWA 3ZOZA 1BE1A 2PGIA 2R00C 3SZUA 3WISA 2FG7C 3EPKA 1M9NA 4MGZR 1NUQA 2WF7A 5HMLA 4C1BA 4MXDA 4HH0A 2HLDA 1T3ZA 3ZZNA 3Q9UA 3EW9A 2C97A 4V2UA 4LYHA 3VFDA 4OFZA 4F8EA 3K7EA 1KYYA 2J3EA 1UBJS 1Z6QA 2B6NA 1YIAA 4UHCA 4HEA1 4BO0A 3SNHA 1B6GA 5I01A 3GAZA 4F92B 2FW6A 1MDBA 1T4DA 4UVDA 4ZCTA 5JXWA 1TK9A 4XTRA 3K0AB 1ZM3A 3B12A 4YGXB 4GOJA 5M3BA 3QFFA 3EN0A 2CUKA 5L7YA 4H0CA 4UNRA 1T3TA 3SZRA 5EJ8A 3EOZA 2O3RA 2D2FA 1I6LA 4RSHA 3E35A 4TXMA 5M7EA 4EYOA 1II9A 4EB3A 4R83A 5ICCA 1CR4A 1VKZA 3FR7A 3SQOA 2G6TA 1PGQA 1OI3A 3K0SA 3GNQA 4QUHA 4UDXX 5JAPA 2YVUA 1GA4A 3BRCA 4RELA 3DKPA 1OQAA 1VL2A 5HCUA 3PNKA 3MMSA 1W1IA 2BP7A 1I4WA 4OATA 4EVIA 2W2KB 4MULA 1MAAA 2FZ5A 3O74A 4EY6A 5B3JC 1ZM4A 3DMDA 4J0IA 1ZO8A 3DBVO 4EUEA 4EO4A 4KDCA 1YDHA 3OMXA 3C24A 2RGEA 5LUBA 1M2KA 3JAMA 3O92A 1XL0A 2WKQA 1EJBA 3EDQA 3OQIA 5H59A 4O2AA 5LP6A 1KVTA 4NS4A 2W0SA 1IY2A 1AIPA 5CFNA 3OZVA 1QQAA 3L40A 2JNWA 1O94D 2ISQA 3FROA 2OXTA 4IS3A 5TMPA 3U9SA 2C88A 2PUTA 3UBTA 2UXDB 1BZYA 3OJXA 2XTJA 3KOXA 3LRTA 3G9UA 5A5DA 1T8PA 4LKOA 1ZJYA 2QTLA 4GPD1 3QPDA 4S1PA 2EW2A 4F9EA 3NYWA 2CVQA 1T4MA 3E8SA 5EJ9A 2FAXA 3I8SA 2HADA 3KZNA 3N5KA 2IH2A 2OQVA 3IQHX 3ZDBA 1H0HA 3QK7A 4H16A 4QO8A 2ZW9A 3B36A 2IWRA 3TD6A 4LZJA 3VNRA 3QLTA 5I9NA 2YFKA 4ZA2A 3UJAA 4GUAA 1YNOA 2X9QA 2YOHA 4C6TB 3DMTC 5KNLA 1JXMA 2B8WA 2AB0A 2VRCA 2IP4A 4WBSA 1J39A 1PNTA 4ABTA 3ZXUB 4A6EA 1X8XA 3VOSA 3WV4A 1MW9X 3L7KA 4BLVA 3F5FA 3ESAA 2VTDA 4L74A 3NDBB 2DECA 1N2EA 2EX4A 3F2VA 3FTCA 4RJKA 1VCMA 5CVUA 4CODB 2YC2C 4NRDA 4WBNB 2EFCB 3RRXA 2PZJA 3JQEA 2H1RA 4OXKA 2D0OB 4CKWB 5KU7A 1I01A 4UTOA 2Q6VA 3O8LA 4HF7A 1SO8A 1UM9B 2OB2A 1MUUA 3T35A 1APBA 2V9ZA 1RQNA 2JAQA 2Q5FA 3B5IA 3A6FA 1BCSA 3GIWA 3CZ4A 3PI6A 3B53X 4HQFA 3ZHSA 3GRKA 1CY6A 2VATA 5BPFA 1EEHA 1SC6A 2WF5A 2PLNA 3MRSA 3PUVA 1I36A 4MWDA 4YRKA 2IYSA 3I9OA 2VT3A 1XDBA 4FYPA 3K1AB 1NIJA 2CDRA 2XYHA 3DBHA 3WK5A 4K9OA 4LGVA 4YDRA 1G8AA 4B35A 1CXZA 3JD1A 3REQA 5C4GB 3U6KA 4K7JA 3N2KB 3G0IA 1SCIA 2GPYA 1M7BA 2DTDA 2BFAA 4UHDA 1MAWA 2V8BA 3IEIA 2DMRA 5DSZA 4MR8A 3RVSA 1Z2AA 2DUNA 3HDQA 4BRZA 3AO0B 3DMPA 4L8FA 2OLKA 1N6NA 3ZKWA 2B4KA 1UWKA 4MO9A 5F9HA 1TL7C 2HMAA 1JG2A 5BR4A 1DWUA 1U7OA 3P71T 3V8MA 1GY8A 1MN6A 2HHCA 5DZSA 2QHXA 4O4LA 3DO8A 4Y1EA 3I4FA 3MJHA 4RV9A 1SWVA 1W94A 3A36A 5FOTA 4M0PA 2WICA 2YY5A 1A9YA 3P26A 4IDAA 4IVPA 1P6QA 3RC3A 3RUIA 3K9WA 1IZ7A 2ONZA 1SQ5A 4QNNA 4CF5A 3IODA 2C2GA 3P4XA 1DMSA 3V8PA 2OXRA 4RK1A 2C3MA 3H0CA 5JNWA 3R6TA 1UJNA 5BP7A 3UHJA 2F1OA 1UWCA 3L6OO 1Q1GA 2JAOA 4Q4HA 2HA0A 4MCAA 2GPBA 4MCJA 3V8BA 4ZFNA 4YI3A 1VL5A 1CZOA 1QKJA 1QH1B 3GMIA 4EO7A 1I30A 5AESA 1ONSA 1JLHA 2P4HX 1R0LA 2BKEA 1U0NA 2NO5A 3EWIA 3MWDB 2PUWA 2HTFA 1U0RA 2JHPA 4D5EA 3NGMA 1RBZA 2QTCA 3DZGA 4A26A 1FP1D 3O8DA 1AG9A 1T2NA 4X9XA 1UJ6A 1E1YA 2AJCA 2PYDA 3L8GA 4II2A 4D97A 4F5ZA 3THWB 3CKMA 1LDEA 3V8NA 4AJPA 3COWA 1V0JA 1K7SN 4YY3B 4HWTA 4D9CA 1J4AA 3R7BA 4N49A 1FFDA 5P21A 4BFYA 3OZXA 5IF3A 4YXWA 4FFSA 3PCRB 3JAKB 3AFOA 1ZU5A 1ZHOA 1WBDA 3TGPA 1PL6A 4KIJA 4NYIQ 1FP7A 3MSXA 4PLFA 3WB1A 1ZD5A 2IBTA 3NIFB 2OM6A 4QXOA 4W9NA 4DR6B 2IOHA 5J58A 3PGVA 1TAHA 2JHAA 3AUTA 3EXIB 4QD3A 4X64B 2D2VA 3LIPA 5F5NA 2XY4A 4DMUB 3NU1A 5E4FA 2OD7A 3QWAA 4IOLA 5A3RA 1Z4MA 3TOSA 1WNFA 3C8DA 2GFQA 1Q1ZA 2X5XA 1LWOA 3KHKA 4TWIA 4B84A 4R1QA 2QSJA 4YMSA 3TNDA 4C4PA 3R3UA 3CS3A 2HDNB 3Q3VA 1KFBB 3DO5A 1HNXB 2GS9A 3CRW1 3E27A 5DW0A 4OKSA 3ESYA 4S0XA 1QVVA 2QLLA 2QYHA 3HFRA 3I01A 3OPYA 5I8PA 4OQNA 4ZODA 4DC1A 1QDLB 1TNDA 3DW1X 3JQ6A 2RGDA 1QFXA 3OPXA 3WQHA 4EUFA 3D0KA 5IBPA 3EGXA 1Q14A 1RACA 4M87A 5J40A 4CCYA 5K09A 4M3NA 16PKA 3AR4A 3FDIA 2NYAA 3T7DA 3U3DA 3BVPA 1GTL1 5FNVA 3D0QA 5KJCA 3AF1A 3A9TA 2JFHA 3ACDA 4G1VA 2RIRA 1ZDMA 2J5RA 1Q1QA 1RRVA 2FPOA 4D9GA 2GJSA 4WADA 3C7AA 2B69A 1ZN2A 3UKOA 4OYRA 1NQWA 3GMTA 3WZMA 3SICE 1QYVA 2AG1A 2P27A 3EK2A 2PU7A 4OHOA 4ENUA 1LS6A 1YK1A 3KKOA 3KTDA 4MI9A 3HLYA 4RK5A 1DC4A 4CGZA 1EXMA 2C00A 2VZ9A 4WA7A 3ZH2A 1DAKA 4I7EA 1WB9A 3WTCA 3ZE1B 1MQSA 2CNBA 3I6BA 4QGFA 5BNWA 1XRNA 1G66A 2KJQA 5H0IA 2O8BB 1H5QA 2EBFX 4XEUA 3W5JA 4S04A 1KE2A 2FDXA 4B09A 4GR4A 5CBPB 1Z0SA 2DAPA 1NR1A 3HJRA 1KNQA 2Z3ZA 5ENVA 1FMCA 2XTMA 4MWSA 4CIBA 4PYNA 1TJYA 4B3RB 3CCCA 2GH1A 2UVPA 3NBQA 4ND1A 3VX3A 4EMBA 5BR7A 3ZR4B 1UEIA 3TSOA 1THZA 1JN0A 3OC0A 1J09A 3HLKA 4UULA 3CX4A 5K0SA 4ND7A 3GJSA 5ELMA 3CZAA 3DWIA 4FDMA 4NZMA 4V0RA 5KNCH 1GLVA 4RADA 1GGJA 2ECFA 3IT1A 5ED0A 1O4WA 1A98A 5H9WA 1UR5A 5J63A 4R2XA 4DMKA 3URMA 1ATZA 4Q05A 1N4DA 2XOKA 4ILEA 1XRLA 3A70A 3WWYA 3MB5A 3AIOA 4GF5A 4XQ0A 1R10A 2B5WA 4NOLA 4EK9A 3PNMA 1Z16A 2IPAB 2GAJA 1IOWA 3SHFA 5CUQA 2FZKA 1R6AA 1RAIA 2VBIA 2ZULA 2OFPA 2FN8A 1JEDA 3E4CA 4RCZA 4DMFA 5HJ5A 4NP6A 3L7AA 4JX8A 2HCJB 2IWHA 3RYIB 1DBRA 5TC4A 2P6PA 1F14A 2AW5A 4PXSA 4IWNA 1U1IA 4PRKA 2ERCA 3MEQA 4C5AA 3UENA 3M4YA 4O59O 1PZFA 5AHRA 3VPFA 2B8TA 2SCUA 3TG8A 4G2NA 3QKUA 4FZRA 1RMTA 2Q3DA 4UHKA 5FXMA 4EYEA 1YV9A 4ZDIA 5KQSA 4IWXA 1T1RA 2D3TA 2P2YA 4KGXA 3FF4A 2DJ5A 2RK6A 3UWMA 3GD5A 2MMGA 3OZSA 4DIUA 2M9MA 4JC0A 2ECPA 2HXSA 1Z9BA 3GGJA 1YU9A 2I87A 4RQTA 4XIGS 3C3XA 3ILVA 2JCGA 2QBYB 1UBMS 1NXSA 2JJ2A 3HKBA 1N2ZA 2IF0A 1EYZA 4ZCIA 1NI4A 1Z75A 4B7XA 3GLGB 3OE4A 1P4SA 4R98A 5ECGC 4IFTA 1IQPA 4CKCB 2H1CA 4S1NA 4CLRA 2X9LA 5HVNA 1B93A 3O2SB 3QVOA 4JYBA 4JENA 3T4XA 5EKUA 1Z36A 1ST2A 3OOHA 2NPIA 3DV2A 1PV1A 3SJ7A 3V00A 2EWMA 3B85A 4P92A 2I34A 1LPSA 4XB1A 3UM9A 4K9LA 4CPDA 2CE2X 4DV6B 3AFGA 1R6XA 4RBNA 2D5IA 4LZAA 4PHCA 5JCZA 2XVAA 2J33A 1UAGA 1CUHA 1MQ8B 1Z5NA 4G4JA 1FBNA 1HE4A 3B2NA 1SFRA 1U81A 2JH9A 3E3OA 4G26A 4IIJB 1OWPA 5LB4A 4EATA 3S1SA 3R23A 5L3VA 2W4IA 2ZSEA 4J6FA 5GPBA 1N0VC 1J24A 1U4NA 5CNMA 4CIVA 1I13A 1XJWA 4QVKA 1QK4A 4BO5A 1RJDA 3VSCA 4YGYA 3WLAA 3GUZA 2EP8A 4RC9A 3WV5A 1XKQA 3F1LA 2A9PA 2QRUA 2ZSKA 4MRMB 3RGGA 2CF5A 1RHQA 4JI3B 5TNXA 1PSWA 2NG1A 5EWMB 5I4CA 3Q40A 4D6YA 1QHNA 5FEUA 1CUBA 1XTTA 4HG2A 1N92A 1PJAA 2AC2A 2VFAA 1P4HA 1XZBA 3TNLA 1K3TA 1PJZA 3CONA 4BE7B 1EFAA 1R0ZA 1D0VA 4HDKA 5A62A 3R5TA 3MERA 3FLBA 2VK1A 4B74A 4PGAA 2LVBA 4YCJA 5FI3A 3BPSA 4EOGA 3HTXA 4H7HA 1N7IA 3VX4A 2GN8A 3IE2A 3JQQA 4HSGA 1SWWA 2BGIA 3D1LA 4Y2HA 3JQBA 4X62B 3AKEA 1COWA 3LPNA 1FPMA 2E0IA 2TMDA 3IP9A 5EP2A 1E0DA 5A04A 4BMOB 4DY6A 1VXRA 2P75A 3KQUA 1C7EA 2RIPA 2AIRA 2NO9A 1DDOA 1QTIA 1GUBA 5AXBA 4PZ9A 5A3QA 1CIVA 1CJSA 3G88A 4HDAA 1QHSA 2R1UA 5B1EA 4G86A 3O7MA 2RGCA 4JSRA 2P8JA 3QLEA 3WK7A 5KUTA 3TK1A 1HEYA 1WHTB 1ZC3A 4P81A 3W6UA 3UF0A 2GHIA 3EVBA 4BNMA 3GEPA 4U3JA 5C32A 2ZTLA 4PPQA 4A8JB 4OCZA 5JAUA 1Y6RA 3AM4A 3ENVA 4K3UA 4F96A 1U98A 4J0FA 4MR7B 3MJDA 1O89A 3TX6A 2DFTA 1DB3A 1ONBA 1C1DA 2YJGA 4IRMA 1OVMA 1WDKA 3BKXA 1NJ5A 2WUEA 3MWJA 1WCWA 3R7AA 2XNJA 2IDMA 3CU5A 1QWOA 3D2LA 3RRJA 2EJUA 5BN4A 5KTYA 2W6JD 3NTOA 1Y6JA 2IYOA 3FZNA 3UJPA 3OQNA 4MITA 1T6NA 2HBZA 3JQGB 4YT4A 1VBKA 2GN0A 2OBFA 3LDHA 1U3CA 1NJFA 3MMXA 3N7UA 1O4VA 2P2DA 4IKOA 1YASA 5EMMA 1V11B 3WL7A 3GNSA 4KYVA 1ULSA 2ZU6A 1WKVA 3Q3IA 4MKFA 2JFVA 4YI5A 1RQGA 3V1MA 1OMOA 3R0XA 4F85A 4URVR 1EXDA 3M6IA 3EFHA 4KBYA 4QOJA 1GPDG 3RIGA 5TJ9A 5JOQA 4R6XA 3IEUA 1LPAB 1NJ6A 2B4TO 3BYZA 5A02A 2GPNA 1YZHA 2XA1A 3P45A 1WMAA 1DLIA 3RFCA 2WWFA 3D3KA 2AQIA 2XTZA 4ENTA 1DAMA 2WF8A 1BDJA 2P8SA 3R3YA 2P9CA 1JLLB 1PJTA 1Y3BE 2LV8A 1TKBA 1OIWA 2LXNA 1D1PA 2X4DA 3FJ1A 3LZ6A 3QX8A 3CF4A 5B37A 4OJKA 3RBVA 3TI9A 1KIAA 2XIQA 3FDZA 2BFWA 2J3QA 3RF7A 1Y6FA 2JCBA 3RT9A 3VOAA 3WNQA 3BFXA 4G5OA 1L7NA 3ORFA 3KBOA 2EGHA 4D43A 3RSGA 1Y8RB 2BHLA 1V1MA 3HJCA 4ZYWA 4Q3CA 1P5ZB 3VZDA 4BVJA 3PSHA 4CTNA 4DE5A 3PUHA 2G07A 4ENVA 3OT1B 5LZ4A 2QDXA 2XCUA 3PKIA 5BMVF 1QYXA 5BVGA 5AM5A 1WSWA 1Z7BA 4PGGA 2PFKA 5K3AA 1N5KA 1O03A 3EB9A 3KJXA 1HYBA 3P9SA 4JUFA 3TXYA 1MB3A 2CK3A 3BGDA 5T3YA 4UPDA 4GWGA 5EGNA 2XEXA 2DWCA 3RW9A 5J2UA 1RQ7A 1AV7A 2W2TA 1PJ3A 3VI4B 1ZIDA 1TVKA 2QUJA 1I4LD 5IF9A 4I9UA 1ZKDA 3NP9A 1JFVA 5KYVA 3VBCA 4NK5A 4EX6A 1J0DA 2O8NA 5CCXA 2WUDA 3CVUA 4WOJA 2ZP1A 3I83A 3ZLJA 1BWSA 3H1GA 2HI0A 2W6PA 3PA6A 5JS2A 1W5FA 1R9JA 2WW8A 4UHJA 3MD9A 1YKGA 2E4YA 3KD2A 1WXHA 4RXMA 2GI4A 1EGHA 2B5VA 2C61A 2PCJA 1GV1A 3ZGNA 2HYIC 1L8XA 1VSBA 1IDN1 2C29D 3ACCA 4BJ5A 4I55A 2NVUB 2COEA 3VHQA 1CUWA 4G07A 4GP6A 4XJXA 2HMWA 4E03A 5KTRA 1NVEA 1O5IA 1PQUA 1JU3A 1LLFA 3QMPA 2ZJ0A 4CV3A 2P6RA 4C7OB 3TLJA 2RD2A 2HZ7A 3RABA 3FXAA 4FI3C 3AF0A 2PA3A 5HQJA 5E95A 2I3ZA 5E3JA 1QG0A 4CLOB 2RJOA 1E92A 3BDAA 3V3KA 2GRUA 4D9JA 4X1IA 4QGAA 1XTQA 1I6WA 2WFLA 3QUTA 3IOBA 4Y6QA 4KR6A 2EU8A 3TFQA 3GJZA 1KI4A 1GNLA 2R6CA 4K86A 4XVQA 2QYSA 3RFTA 1P7PA 3BBPA 3AL2A 5K0BA 1JS1X 3RDPA 3RFFA 1JKJA 1Y3FE 2OZLB 2DB3A 4CTOA 4C07A 1JA1A 2EW1A 1SC4A 4HV4A 4BPBA 1E9VA 4JEMA 5E4JA 2AOUA 2V4MA 3CZ9A 4U7HA 1NVGA 1XF1A 1KOLA 4DKJA 2E5LB 1TOAA 3QUAA 5IZCA 4ZJYA 5JPDA 3SF8A 3QTLA 3TIVA 5CB4B 5CDTA 4P83A 3HB4X 4KE6A 4HDOB 2VSXA 3MS4A 4MUFA 4RTSA 3LBHA 4LBVA 5KMGB 1N7GA 3RI3A 3EVDA 4LDAA 3D7MA 4FOLA 2LCQA 2UUAB 3UGKA 3GYBA 4LN1A 3U4MA 1GRQA 1A2QA 4E2FA 2C9ZA 2ZXEA 2IKSA 4R54A 5LUAA 1E79A 2ZYWX 1H6BA 4EH1A 1WXXA 3EPJA 2PUCA 1J20A 4GBJA 4GPZA 3TEJA 3VISA 5DIZA 1WBBA 4PZUA 1KFEB 1L1QA 3M1AA 1BGXT 4KX5A 5ESRA 3ZU6A 4G81A 3P9CA 2YCBA 5IWAB 1Q0TA 4Y2VA 4W82A 4DDTA 4DV5B 3MTAA 2BFMA 3GYGA 5HTOA 4CDRA 3GMDA 3DP7A 1M0SA 4DTCA 5ALTA 5I4BA 5I7WA 3MQ4A 2VSNA 3B6IA 4PQFA 5CNIA 3EBOA 1LTKA 3QENA 2UDPA 1ML3A 3JASA 1JIKA 3QVSA 4ZAXA 3AF2A 5AVUA 2D4AA 1SVWA 3FF1A 4JCOA 5BYAA 3HCDA 3GJ8A 4N5NA 4R8KA 3DHYA 4P86A 3C7CB 3IURA 3HB0A 1BX1A 3LPDA 5B4UA 2W43A 3NXSA 3ILXA 2RAUA 1I24A 3ZHUA 4BQNA 5HJ7A 2EZ9A 1AS2A 1B76A 1J2EA 2X22A 2CXPA 3CJTA 2YWBA 3FLEA 4W1PA 1V41E 1WP4A 4F04A 5ED4A 4QASA 3NGXA 3CN9A 2XADA 5BRNA 3QNWA 3WR5A 5T64A 4C5BA 10MHA 4B79A 1W2HA 3AC0A 3JALB 4H1VA 5FD8A 4CG2A 3FZYA 2EXXA 3CINA 3DKKA 5C7IO 3LTNC 2C4VA 2AVDA 3EVTA 4G1EB 4JFAA 4QEZA 1AK9A 1TMYA 5TPWA 5DP2A 1T91A 3LUJA 3T6KA 2AOTA 2XMRA 1G4AE 4TKMA 4K46A 3V1KA 4K9NA 4NE2A 2QUIA 3VVCA 4JXZA 2C5AA 5THKA 2O8DA 1W52X 3FBWA 1VP9A 3BFVA 1EDEA 3DUWA 4DM3A 4MVJD 1JMVA 3H18A 3HKEB 1JIXA 1M6HA 3AJ8A 2ZSBA 4E4RA 1GU1A 1LDMA 2HPHA 4NYJR 1VOTA 3A1FA 3STHA 1JJBA 4AQDA 1L4EA 1ZNXA 3MMNA 1P1FA 4E6EA 3OQHA 4EBFA 2VQSA 3QBTA 1JNXX 5DGIA 4OMCA 2J6CA 3IR7A 4UASA 1EM8A 3FPAA 4JI1B 5GM2A 2CDBA 3MC1A 3GRAA 3P0JA 3ZQ6A 4AWAA 3ERCA 3C43A 3OX3A 1K3FA 3R6DA 3IUJA 4RTNA 4Q03A 4UKDA 3G0OA 4RKWA 3ZLTA 4FUQA 4EW3A 3N86A 3DOJA 3CLUC 1M10A 2N75A 3D4LA 3VDMA 3A6DA 3KV3O 1F17A 3DG9A 4MRRA 1PJQA 3V1YA 4CM4B 4DR5B 2XE7A 3LQ2A 3L92A 4MZDA 1DEKA 3ZHVA 1O0CA 2P9YA 2Z6UA 4GR5A 2I6FA 6ABPA 4OAQA 2O8CB 4FMCF 4JKOA 2AOWA 3WAJA 3CZQA 4YUZA 4J7XA 3KZ1E 4B31A 1GG8A 5JNUA 2HH9A 1S1CA 3OTWA 1Z5PA 3LXUX 1V2HE 2XPCA 5JI2E 3W78A 2WTUA 4CKEA 3VKVA 3L0DA 2FUKA 1G7CA 3L0CA 3QX3A 2XYVA 5AW0A 3PQDA 1ZU4A 4LWPA 1TFRA 1UZNA 3IPXA 1TT5A 2SHKA 4PF1A 1WCV1 5JNTA 1TD9A 5K0FA 5KWVA 2X8WA 5JD4A 1KJYA 4LTNA 3F7MA 4HDMB 1QJCA 1ZIXA 4Q3NA 4XIIA 1XEWY 3A1DA 2V65A 4POAA 4QDUA 4X3OA 3PRKE 4NNOA 1V7CA 2W4MA 2ZR8A 3EY9A 2Q7OE 2OQ2A 2QPLA 4JYPA 5DLYA 3OOSA 3UJCA 1MO3A 1C8BA 1L7DA 4KIUA 4PW0A 5HILA 4DQ0A 1WMSA 5JSKA 2RC6A 2YXEA 1KI9A 3MINB 2PUGA 2FPRA 2BCJQ 3EYWA 4MI6A 2COKA 4PR0A 4R7ZA 1GL7A 2W2OA 3SHTA 1H66A 2W2NA 2OCPA 3DO6A 2JRCA 3HY6A 4MV9A 3AI3A 3ABZA 4ECAA 1FP4A 4BFUA 1JDJA 4ZI2A 1NBAA 3G79A 4BS9A 4BMYA 1K4MA 3D31A 3VAYA 5EOVA 5DNYB 1J5XA 3QY9A 3W4KA 1TUIA 1XPJA 3T3PB 3K70C 2V7XA 3JWPA 5JG7A 1QLHA 1ZRNA 3RSFA 2G1JA 2VJYA 4R9UC 3J7TA 4WN9B 3DFIA 4YR7A 2IX3A 1WVIA 3T12A 1NQUA 4RIEA 4MYCA 4X3PA 3DE4X 3OUUA 4EDFA 5KNDH 2VUSA 1B8NA 3IBCA 2RG7A 4EJ6A 5KDOA 4NKRA 3B3AA 1EG2A 1R12A 3VR6D 3QVKA 3SHOA 4X61A 1E3JA 1ESEA 1GCOA 4WACA 3WLKX 5JMTA 3FG9A 4FEAA 2X0IA 2BUAA 1KQOA 4D8VA 3AKDA 2NV2B 2ACKA 2G0TA 1TI7A 2ZEJA 3BWMA 4NL4H 2F43B 5JFGA 4EG3A 3E61A 4OI0A 4KQ2A 4QJIA 3ICVA 1H2HA 2WB2A 3I05A 1I3KA 2DRIA 3ELUA 2XXAB 3NRCA 3LQQA 2XW6A 2Z4SA 3HDVA 4ZI7B 4O2BB 2XODA 3D4IA 4LSWA 3L4BC 221PA 3KPYA 5D6NA 5F9MA 3L6UA 1SKMA 3A3OA 4AL4A 3G85A 3ONNA 4E7PA 2J3IA 5DEOA 3GWGA 1JHVA 1QBGA 2RHRA 2JHFA 3EF3A 3UXHA 4P33A 2D1FA 3VR5H 4HVAA 5BUQA 4WY2A 3MS2A 3FTPA 1DBPA 1Y8ZA 3DGFC 1Q3TA 1NUSA 1LBEA 2ZRAA 3QXCA 4BFXA 5H82A 1DQSA 4AJJA 2FXIA 2QUKA 3Q7PA 4IZHA 3FWPA 5BUZA 5I7OA 1QRTA 1MO4A 2HD4A 1E0AA 1Z37A 1E64A 1SCBA 1E2HA 4CNBA 3CKYA 3EIHA 3L8FA 3UVEA 3F47A 4PAGA 3IHTA 3PU6A 3IAEA 1FUUA 1E1CB 1ENYA 2J0VA 4UZSA 5CVEA 3OZWA 1KVUA 4QDTA 4ENRA 3SNKA 2C9MA 1Y37A 2YIMA 3JZAA 4YP5A 5FI0B 4MTLA 5JDCC 1GZ4A 4FDUA 4NY1A 1OAOA 2FMKA 2PZEA 1IWPB 2RAPA 4KWIA 4YRQA 1STOA 1PR2A 5ELXA 1G5PA 1M7HA 2X1VA 4GM4A 3AIMA 1A0OA 1KKLA 2WC1A 4TKVB 4DMGA 3HU2A 3KP1A 4GKKB 1FX1A 4CI9A 1X9HA 1M2OA 1E5LA 4EL0A 1VQ1A 4EA9A 621PA 4E09A 3MVEA 1XTPA 1LU9A 1KXJA 4DDVA 2WD8A 4C01A 2F1KA 4V02A 4A16A 3IUBA 1O77A 5EI5A 3SXUA 1QPGA 4XVUA 5JMWA 3VDXA 1F2VA 2IHJA 3AHDA 3D7LA 1FX0B 5DWVA 1UPCA 3VNSA 1M6WA 1KMCA 2M1ZA 3L1IA 2BMAA 4Z8XA 1ZOPA 2O05A 3H2ZA 2FQXA 4Q3AA 4JGGA 4Y2SA 4B80A 5F9FA 3AF6A 4ENWA 2EP5A 4TWJA 2XKBA 4DIDA 3ZI4A 2WQ7A 2E4WA 2Z2XA 1XVVA 1HURA 1HLGA 2ZAIA 2C2WA 1I2AA 1DOAA 5F98A 1SY7A 1VI5A 4HH4A 5IULC 4OK5A 2QE7A 1NN0A 3SLGA 3W6NA 2KE5A 2QZ4A 3M3DA 3PDJA 3ONDA 2QX9A 3AKYA 4XSHA 5BW4A 5HWSA 3OQJA 5DHTA 2X8BA 1EWYA 4WA8A 1V25A 2DP4E 2J9FA 1UC9A 3B1FA 4OVKA 4PAOA 1YCHA 2OCIA 4MVJF 5JFOA 4JL8A 4X63A 5D01A 4S05A 5A0VA 3GVCA 1SQ6A 1U4SA 1AKMA 1P1HA 1P5HA 2C1EA 2G6BA 2ZJ6A 3KYDB 5E8JA 3PE4A 3ZXYA 4DRZA 1T0JB 2A5YB 3SBXA 2F8TA 2GCIA 2D1QA 2H31A 3WGYA 3I1IA 3V2UA 1UBEA 2XSZD 1KI1A 3DXFA 1NVVQ 2AG6A 3BFPA 1JQEA 1QGDA 5BV2P 2B20A 4OP1A 4R81A 2IP1A 3PRYA 4TWZA 4Y9RA 5E9QA 1M2FA 2Y8EA 3EC1A 3A9CA 4MEBA 3DGEC 2SKEA 4PYKA 1TJNA 1ZN7A 3P2EA 4H0FA 3WLOA 3CLUD 1YS2X 5EUBA 1Y89A 3EUWA 3NB0A 1EXVA 2QRVA 2R6HA 1VB3A 1JSZA 1JI3A 1U1EA 3FLMA 5FPKA 1JG7A 1BXRA 3NOQA 5IT0A 1B74A 4AJNA 2O2DA 2LDBA 1L5NA 3AHFA 1Z4LA 4YBRA 3R75A 4AUNA 1IB6A 2EZ4A 5IJ0A 2JCYA 2QUAA 2ZWMA 3NGLA 5HIAA 2BSAA 3PUKA 4A2QA 1RT9A 3JQRA 2RC5A 2H07A 2V7UA 3MYRA 2W2QA 4TYWA 1FW8A 3JQ8B 1ICEA 1U3UA 4QDKA 2UZIR 3UV3A 1SEVA 1VP3A 3ADOA 3U7JA 4AZ0B 2AJ8A 3ZCUA 1P5RA 5L8VA 3TTVA 4ESEA 3SGLA 1EB9A 2PGDA 2O2IA 1JVBA 4ZVKA 4NPHA 5AJYA 1RAFA 5CAEB 4OQ4A 4IV8A 2E37A 1EUYA 4PIPA 3W3AA 3VNBA 3O4RA 4Y7DA 4AG6A 5JEEA 1Z15A 3PQ6A 3UT0A 4EJMA 1XELA 4GU5A 1O6FA 1CDZA 3DBIA 4Z9BA 3NWBA 2AR0A 4FQ8A 2IYLD 2OB1A 3IMEA 4Z7QB 3EZ9A 1YZ3A 4A8JC 4KO1S 4X54A 2HNKA 3AQ4A 3FUTA 3H5NA 4FOPA 1P7YA 3HJUA 2D2XA 1NYQA 3WGHA 1GNVA 2IELA 4JUAA 5L3SA 3SC2B 2Z58A 2YX1A 3AI7A 3O4IA 4HQLA 4QSMA 1GSIA 1O9HA 2DCMA 1JEAA 4KAXA 3PTLA 4RPKA 3UOGA 3F6RA 3PQ5A 1L4NA 1XI2A 2F3RA 1XXLA 2PWZA 1H1TA 3JYPA 2QQFA 3QOFA 5GIOE 1XK6A 3N6RA 2WIFA 3U16A 3F6EX 1QO9A 2DY0A 4CR8A 1KJZA 1HFJA 2E1PA 4GXTA 4ER5A 3DFKA 1R9MA 1OFUA 3GHHA 1C0PA 1FVOA 3FCEA 4HYTA 3AFIA 1Z4KA 1XTBA 4LF6B 4Q82A 1CEYA 3K70D 1T5IA 3IDAA 3V80A 3VU9B 2PMDA 3DMHA 4RVSA 2HJ9A 3T0FA 4TLBA 5G1OA 3STXA 1HETA 3VNUA 2F64A 1G5FA 1MF7A 1ZVQA 3RUHA 2VHEA 1QP0A 4Y1GA 1JHMA 2YY6A 2VZLA 1N5JA 2AOXA 2GZDA 3RWBA 4HI0E 4M76B 1T4CA 4D0GA 2H4ZA 2VWQA 3B6MA 4BLSA 3CVVA 1E99A 4F7DA 1E2MA 1USKA 4CYMA 1ND5A 3H9CA 4FI3F 1C9MA 1Z4NA 4D4KA 1E4YA 3QPAA 2DCUA 4QATA 5DASA 3U44B 1KH3A 4YRTA 3KO8A 1M1YA 4TTVA 1Q15A 2C1XA 2OCXA 3TW4A 5JXHA 2EJVA 2VJMA 3FW1A 5JAQA 4R2IA 4DSOA 3OJLA 1YAJA 2HWKA 5IYZB 3O73A 4AP9A 5HK9A 3CVOA 3F6BX 4JP2A 1S9DA 1R0KA 1TAGA 2I6XA 3CUEF 3FNGA 2R5NA 3LXXA 3PDWA 1Z2PX 1IJFA 3D2AA 4JVLA 4A0RA 3WGUA 1TF7A 1B15A 1NTOA 1BH6A 2PRYA 2YWRA 1DJQA 3Q8MA 3MJVA 2G70A 3L8EA 4AM8A 4F6LA 2Y93A 3MUOA 4DXAA 1XYVA 4Y0NA 3D4PA 4HTAA 5I7HA 1W6RA 4L15A 5J1SB 2JIZD 4F2DA 1R8YA 1PGJA 4EB0A 1FPQA 5CITA 2BF4A 5CYGA 1PQWA 1RC0A 3ELYA 3SU8A 4LXQA 3MUFA 4QC2A 4ZQGA 2WJ4A 3SEZA 4LA4A 2RGYA 1YTLA 2VS1A 1Y80A 5B12A 3OOJA 2Q1TA 3W90A 5KDDA 3VO8A 5M04A 5K8IA 4PC2A 3H8WA 1G7SA 3LSTA 2ZVPX 4ZAWA 3JAWA 2EHDA 1MX1A 3JQAA 2V7GA 5D85A 2AN9A 2RHDA 5LYJA 4C7KA 1GPKA 1JQJC 3A1NA 4YFVA 5TPZD 5IJZA 2RGAA 4EHNA 1LJ8A 3MK31 4BRWA 3V1TC 3ZDXB 3GLRA 1ZICA 4DSAA 5EERA 4UM9B 3GLUA 4UBKA 3R7WB 3E3MA 3FOBA 2J4DA 1UP7A 1X80B 4MA5A 3OCZA 2G80A 1XJCA 1R5OA 4RXTA 1A2BA 5CA0B 1Z88A 1RTKA 5FOUA 3JZDA 2WYOA 1MXHA 2DE0X 4RWZA 2WIKA 4UDNA 1RLTA 3VMFA 2NQTA 1QHYA 3QPBA 5J2TA 1JBKA 4BO6A 3GRUA 2QTZA 3KOYA 4F97A 4FZ3A 1DUVG 4H1UA 1RJFA 2QD2A 3ZJTA 1WABA 2CXHA 4EYSA 4WBNF 1MB2A 1S8NA 2O07A 3S0JA 3NTQA 4U4AA 4KAFA 4C3VA 3B3FA 4MV5A 2Y1DA 2YYYA 4IO0A 3ELWA 3UAOA 3IL2A 5GINE 3MSCA 1WY7A 1KEUA 5E8RA 4AN4A 3RM3A 4S2EA 1JHXA 4JA0A 3N2NA 3AUJB 4GLFA 5A2QA 2DTXA 2QMUA 2FN7A 1ISRA 2FQYA 2PRKA 1TYDE 3NTRA 4Q48A 4YJKA 4WHMA 1XQ6A 5AT1A 4JEUA 2CVHA 5FOVA 1TJ3A 2F3QA 1ZCBA 4P1ZA 3AW8A 2BEUB 5CX4A 5J59A 2HK6A 1LF5A 2BFDA 3TECE 1IEXA 4G23A 2RGNA 3DVLA 1XMIA 1UQTA 3TR0A 4OJQA 4YASA 1U02A 3A37A 1IRXA 1OJ7A 2PT9A 4FD2A 3AT1A 1G17A 4NECA 2GVZC 1Y9EA 1R18A 2W98A 4ZYVA 1LPNA 2I78A 3GGDA 3SX2A 3L0BA 4IRUB 5HF8A 2FPIA 2PUVA 4O1HA 3RVNA 6CHYA 1S2OA 5LQAA 1DQPA 3TOVA 1HPLA 3JVEA 3WICA 4PWYA 4TQUS 2ZVQX 3IKMB 2EBUA 4LK3A 1XJ5A 3C1AA 1UT6A 1XCBA 3I58A 1R9GA 1JDVA 2R47A 1ORVA 4B2IA 5JZSA 4EW6A 3HQ4O 1WV0A 2ZIXB 4FGKA 4H7JA 4RQBA 4U2DA 1MKYA 1XA3A 2PQ0A 1NF3A 1CEXA 3MWKA 3ER9A 3E9NA 4WXEA 3K71B 5BNZA 2NO1A 3KT3A 4MMZB 3TMKA 2AJTA 2BEWA 5D7BA 1EX1A 4FZJA 3NPMA 2GN9A 2WM3A 4PVDA 5F1OA 1PL8A 3ZGZA 2AMYA 4D4IA 3IP1A 4AJKA 4BASA 1CE8A 2IXDA 4YJ2B 5LKAA 1WOYA 3BBLA 2B8NA 4YDSA 2NVUA 3FSGD 3VJKA 4CMIA 4DCJA 4QQFA 1BEZA 1TU3A 2O3TA 1HRDA 3DXXA 4Z7JA 4LVUA 3AUKA 5KNBH 2MT9A 1IMJA 2LP4Y 1I3MA 2QSZA 4IVRA 1P19A 1D8TA 3AWDA 3I5MA 5E3HA 1CQIB 4NBLA 4PR3A 3HA7A 5KWSA 4QXRA 1C4KA 1SVUA 1L4UA 5KX5A 2IYXA 4DUGD 2VQFB 5CX1B 5LLTA 3P2MA 2CLMB 4OXXA 4YP6A 1DXYA 3Q3CA 4M1KA 3UV7A 2NACA 1VG9B 2HK7A 2YY7A 3E9MA 2OGSA 4O63O 1MCZA 1NXWA 3OKFA 2I3BA 3OPVA 2XRZA 3QBVA 4Q24A 3RARA 1H85A 1O2DA 1U2PA 2K5UA 2Y9PB 3BRSA 3QHPA 4YNBA 1FMFA 2F55A 3PB3A 4N3NA 4ZYZA 3N2GA 5D6OA 5F1KA 5AM0A 5G4KB 2JGNA 3TE7A 3SQMA 3M82A 2E5FA 3OMWA 1CUFA 1LB1B 3ZQ4A 1E32A 3GOQA 2EBHX 4IX1A 4BAUA 1Q7TA 5ILOA 1Z35A 4V24A 2MSWA 3HU1A 5LZ8A 4FINA 1RXVA 1PNQA 5E9AA 1LSOA 2XDWA 1VYVA 3FGZA 2X15A 3GJ5A 5EMJA 4ZU1X 3X1YA 1J0BA 1SEPA 3IVXA 5L53A 3KX2A 1JWBB 1WCYA 2PQMA 4JC4A 4UQPA 4UUMA 3MCUA 4UMEA 2XRFA 1V8ZA 4KXMA 4MOWA 2C7BA 1OLSA 3HBFA 3I72A 3VRHA 1AS3A 1DKUA 1MOPA 2VJDA 3SHQA 4H0NA 4AX8A 1PZMA 2F3UA 1XNHA 3H75A 1V5EA 1SR8A 2NXEA 3VDNB 2X0NA 1A9QA 3M6FA 1ACLA 1QAMA 5K8TA 3VYSB 1GFZA 4B3TB 1QG2A 4F11A 2QSYA 3RS9A 4X20A 5DCYA 2O2JA 3EZ6A 3NFRA 4E1AA 1HMPA 2C78A 9MHTA 2I54A 2J5BA 3X1WA 2MOKA 3CLRC 4BXOB 1RWBA 4XWGA 3FZEA 2JCXA 2MMCA 4NONA 4KGVA 4PCVA 3AHCA 4DBLC 1PTJA 5EJAA 2YHUA 2O0JA 3L1VA 4H59A 2C42A 3SJCA 1OGJA 2H2DA 1USIA 2VHCA 4GKAA 1KBZA 2B4RO 2EQBA 1N2BA 3T7EA 3DKRA 3EA0A 1YL5A 3OLXA 4K9QA 4M8SA 2QVXX 3OCXA 4QTYA 1SD1A 2XITA 1BDBA 3G7UA 3M1IA 2FI1A 4IS2A 1P7VA 3C0KA 3I1FA 4ND2A 3SF0A 4EFMA 1ISFA 3TL6A 3AVUA 1M2JA 1CY8A 2MSNA 2C2ZA 3L0ZA 3WS7A 3M6MD 1Q44A 4TTAA 2ORWA 2BMFA 4Y98A 4JLUA 5C5IA 3DAYA 1V1RA 2QLNA 4LQDA 4FB4A 4KQ9A 5A6SB 3W04A 4ZD6A 4I5IA 1FVHA 4TUYB 1EESA 3KDSE 4CG1A 1WUIS 4Z54A 4K9KA 4WXPA 4CN9A 2ALJA 3I3SR 3E84A 5JANA 3UQYS 4JQYA 4ZYTA 2F1IA 4X7BA 2IBSA 2R8OA 3O0TA 4NK4A 1PEAA 1KEZA 5DBHX 2FNAA 1D09A 5GZ3A 4CM5A 4BVAA 3H1PA 3KTAB 4I5GA 2Q0XA 4LF5B 4DDHA 2DWUA 2IYFA 2JBWA 4KR0A 1X38A 5ERYA 3EC2A 3I64A 4CIXA 1IN7A 3V1UA 1CEEA 2FKAA 2GM3A 4QAJA 3TTUA 3DLPX 1N34B 2F8MA 1EVJA 3OUTA 4RHUA 2BBTA 3UAXA 2G7MC 3PJFA 3QLUA 4BFTA 6ADHA 3GDHA 3AUSA 4JSTA 2ZOSA 1EE9A 4R3UC 1OI2A 4JS0A 4QWWA 2IS2A 2GBFA 4CEHA 4LF4B 1CVRA 2CHQA 2IF2A 4ODIA 1E89A 4FFDA 1GNSA 3C2QA 5EE1A 3WWOA 4EW2A 4GI7A 4H7KA 1NKSA 4Y2UA 2NYUA 3VDQA 3H4VA 4XWKA 3KR0A 5HS4A 3E8XA 3A6GA 1OA1A 3DE5X 4X94A 4UOQA 2Y4NA 4PFSA 2BE9A 2MSDB 4TL9A 3ELBA 1TIBA 1WZIA 1BGWA 1T5DX 3KDAA 4ZMRA 1SOAA 1VSVA 2YV3A 2W90A 1IL0A 1CJTC 1QVZA 4KE8A 2CYCA 2RARA 3AEKA 4MKXA 5CTJA 5DGXA 2WNIA 2XUOA 3DR5A 7REQA 5JZ9A 2JGDA 3I53A 1GAWA 2QRPA 3UHFA 3SKXA 1OYOA 5F1YA 2WSLA 4K0KB 3T1TA 5GADl 2W42A 2BFEB 2DFNA 3HGTA 4HPXB 4TMWA 3PT9A 1EFLA 4JP3A 4L5BA 4FYMA 4YECA 1ESDA 4A1FA 2V55B 1OA0A 4Z4EA 4M49A 1YD7A 3IKLA 3N6XA 4IG9A 1Z39A 4RE5A 3WGJA 4RVFA 2J3KA 2XWBF 1KOGA 2B94A 3M6VA 3T3NA 1L7AA 4PFKA 2OE2A 4R40A 4EB8A 2N9UA 4MQFA 1TJ5A 3AY7A 2O5CA 1RYZA 2LNDA 3KOMA 1TZKA 4D4LA 3EHDA 4HC4A 1Z0DA 3GLQA 4KLNA 4ZQCB 2YW2A 1TUEA 1VA4A 3WGZA 3H5RA 4PN7A 5HQTA 2J48A 2BMDA 2QJOA 2H3EA 3OE5A 4IIJF 4HNSA 1IJBA 2HT6A 3BOSA 3NWOA 3VOTA 4S0ZA 2BAGA 2C77A 4EYGA 3KPWA 4UMFA 5EP4A 3DE2X 1UOPA 4GBMA 1MPTA 3MRXA 5COAA 1O3YA 3KQYA 5TDHA 4ALIA 4ESHA 1I1QB 4YRMA 3ZGLA 5JQWA 2GXAA 1TM4E 1KHHA 5EIFA 1T9ZA 1AMNA 4Q1EA 3MT8A 5LMUB 3T7KA 4A2WA 4AUEA 4EAQA 4A8TA 4DG9A 4YBZA 5AVTA 2YWCA 1QCZA 1XMSA 4OL9A 3MJ4A 4UHBA 5J4VA 3ESXA 4JP8A 4MYRA 3URKA 5D2CA 1UDCA 1V5WA 1VPVA 2Y0DA 3UZUA 1YJBA 3EOBI 1W85A 3D4BA 4AMUA 4LYJA 4CBVA 1PEYA 3SD7A 1NNI1 1SVKA 4MV0A 3LPMA 4F4FA 4F5WA 2Y1FA 1GYRA 4OL0A 1KPIA 5FA5A 4L0QA 3TXXA 1ZCJA 1KJWA 1XZGA 2CB0A 1CS0B 2Y0PA 4AY2A 1CW2B 2QZPA 3V7NA 2A0XA 1GPBA 3OBBA 4MW7A 4N6GA 3VZQA 4TZ0A 5CFQA 1G4UR 2DFKB 2QLJA 2VDMB 3Q9NA 2VIIA 3UC5A 3L9WA 2AVNA 3G2JA 3LKBA 3ZZTA 2E18A 2AT1A 3LQ1A 3LY8A 1WXIA 3DTNA 5D5PA 2P7HA 1P1CA 4EG0A 1X94A 2E4XA 2GZSA 3QU5A 1NSFA 4V1CA 4LIPD 1DKPA 4D56A 1MJHA 2AEEA 3Q12A 4P38A 5KAMA 4LK2A 4D4HA 2FZ4A 4XLZA 3R3VA 5AO9A 3GEGA 3EXG1 3LWZA 2XOXA 1PQPA 1AVTA 1QIDA 4YLYA 3EZNA 3KB1A 2BM1A 1Z0AA 3WKCA 2XQIA 3B48A 3V34A 5K9ZA 4L57A 1HNZB 1XCLA 1F51E 1Z6GA 4GC5A 5FI1B 2HA6A 1DV1A 4X8OA 4HO1X 1P77A 3QF7A 1ITZA 4KU4A 2OQRA 4OHWA 1IHUA 2EAUA 2CNNA 3F3SA 2GAIA 2LCFA 1K6EA 4O02B 4U7WA 4CMEA 4FFPA 1I0LA 4HTFB 4CLEA 1KQ3A 4UVHA 2O52A 1VDMA 1YAHA 2GXUA 2ZUUA 3QOYA 5DGHA 3VR4A 1JUDA 4B7UA 2BFCA 1W2WB 2GCEA 1U2DC 1S8OA 1UJCA 2AJDA 2QPOA 3T5DA 3KZCA 2OD2A 1R37A 4MGEA 4DM4A 2WQ6A 4QYIB 1IVYA 1MH1A 5J1TB 4WOCA 1ESMA 2WMYA 4OI2A 2DPGA 3H6KA 2I55A 5K0EA 4B3IA 3ZWCA 5HFJA 1E3LA 2G04A 2FPLA 4Y9SA 4G36A 4R0NA 1X7WB 3RU9A 4EG6A 4MUHA 4MVWA 4FHCA 4M0EA 4N4AA 2PUFA 3E0XA 1F7UA 4W99A 3CR7A 2P3OA 4H7DA 5FL3A 1E2LA 4AKIA 1C1HA 1P75A 2X4LA 3UJ6A 3RKSA 3UYLA 4LZNA 2Z09A 3ET4A 3IBTA 4XR4A 4CM9A 4R8MA 4G0VA 3QVLA 4PSCA 4OQEA 1C9DB 5FOQA 1NHGA 3CLRD 2RHCA 4ZVLA 1JFLA 2QN2A 1BS9A 1MFZA 1XNGA 1KL7A 2PSFA 3ZYCA 4AK9A 1ZG3A 13PKA 4IUCS 4OSEA 3SFTA 1C4OA 1WCIA 1L5RA 4Q9JA 3HFJA 1ENZA 4KQJA 5FV4A 1KAMA 1RRCA 2GM9A 4ZVOA 4EGQA 2ZS8A 3HU5A 4ZAYA 5BSUA 3V33A 1RZUA 2WJ6A 1Y5NA 1AT1A 3HWWA 4P0TA 1ZIYA 3DXYA 1WW8A 3ONFA 4C08A 1NR7A 2IUTA 2ERYA 1H2XA 1KR5A 3KHSA 3ZY3A 2CDNA 3ZC3A 1ZRSA 5CPBA 2QX4A 4RA9A 1K9SA 4D0LB 2OZKA 3GNLA 4NZNA 1IYZA 2R48A 2G9NA 2XX3A 1KVRA 3FUUA 4PG8A 5KYTA 5JH7A 3UMGA 4Q7EA 5JI3E 2GZ3A 1AQUA 2Q9AA 2X9VA 3DEKA 3X1MA 1DHRA 3IP6A 3EIWA 3D7KA 1M67A 3PLRA 2H2FA 3W2FA 4CGYA 1P3DA 1TUGA 2QTRA 4CU5A 4D9MA 3DLBA 2DETA 1XA4A 1AB6A 3WIOA 1UBOS 4IIXA 4JK3A 1E3WB 1KC3A 1R15A 2D54A 1NF8A 1ZSYA 2NTNA 4PC1A 2QL5A 5C7LO 3ENZA 5TE9A 4X7RA 2VCEA 2QJRA 3ZWXA 2CCKA 4MVJI 4J0DA 1B23P 4PZEA 1T5LA 3BXGA 4P84A 3SC6A 3HCBA 2ZE8A 4O0LA 3AOEA 4NAUA 4CG3A 3T3EA 5DGCA 3ZJ5A 2PE5A 4NFHA 2ZBRA 2IJGX 3E5NA 1JB1A 3LZCA 3WRXC 1W75A 3DL0A 4BKPA 4EHKA 1DCTA 2IQIA 2Q0SA 4IWYA 1KDPA 5BN1A 2PEYA 4HR7A 3RYFB 1OWMA 5ABPA 2QP9X 1PT8A 2AJBA 4L4YA 3TD9A 1RXUA 4E2YA 4HLNA 3I4LA 4GMXA 3DWGA 4PLCA 4ZEXA 2Y1LA 2OLJA 2OV1A 2C31A 2X6QA 3FAKA 2FR1A 1FUIA 3L7LA 4KWCA 2JLSA 1A8SA 3FZQA 2OAQ1 4NBTA 3B82A 1DC5A 1D8AA 2PNFA 4BE9A 3TSYA 2UZ1A 4XTCS 5LZ2A 3ANNA 4OFXA 2QP4A 3FMIA 2A1IA 2PWPA 3LLVA 1TW3A 2G5TA 2JKZA 5IXYA 3TLGA 2FEXA 4QICA 4TV9B 3P0FA 5CB4F 4HNAB 3K5HA 4MAFA 4XVRA 3S1AA 3WGTA 2YKGA 1JBQA 3GLHA 3I62A 5DULA 3V42A 1E9BA 1A1VA 1BXGB 4S3MA 5BXQC 3HYTA 3A1EA 3IBFA 3U40A 5C8ZA 4B73A 2VDVE 4WXMA 2ONKA 1VPTA 2P62A 4Q9LA 2P78A 1HXHA 3DDHA 2V6GA 2RG1A 4QFDA 1KH1A 1WR8A 4X00A 4AO7A 3R2JA 3AU9A 3EZGA 3QXJA 3I04M 3L7IA 2CNLA 3ED5A 1H42A