4QARA

1.45 a resolution structure of ct263 (mtan) from chlamydia trachomatis bound to adenine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVLKTWGYRGVVQALSPPPSGYDLWINAGFAGAANPNIPLLKTYTITSVKELTPTTSVEEELEVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYTTREGQDFLKNNKVKLSQKLAEAIFPIYSSFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of Chlamydia trachomatis Hypothetical Protein CT263 Supports That Menaquinone Synthesis Occurs through the Futalosine Pathway.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Hydrolase
molecule keywords CT263
total genus 55
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qarA00
3LA8A 4F1WA 5I3CA 5CXQA 1TGVA 3DPSA 4L5AA 1Y1RA 1M73E 1Z33A 5B7GA 5B7NA 1RXSA 3KUKA 3OZCA 4L5CA 2QDKA 4DA8A 4ECEA 1K27A 3INYA 4MARA 4QAQA 1Y6QA 1PF7E 2HN9A 4NY1A 5CXSA 4LZWA 2ON6A 4TTIA 3NBQA 3UAWA 3C74A 3OZEA 3UAYA 1U1FA 3OZDA 4TS3A 1U1EA 4G8JA 3BSFA 1Z35A 1G2OA 1Q1GA 3F8WA 4LNHA 1YQQA 2P4SA 1SQ6A 4TXLA 1OTYA 1A9PA 1RYZA 1V3QE 2A0YA 1A9SA 1TD1A 1T0UA 4YO8A 3IOMA 4MCIA 1PKEA 4D9HA 4R31A 5DK6A 3OOHA 4GMHA 1CG6A 1ODIA 2RJ3A 1SD2A 3OCCA 3KHSA 5IU6A 1YR3A 1RSZA 3FNQA 5F7XA 3KVVA 4OGLA 3KVYA 3ONVA 4LKRA 3EMVA 1LX7A 4EARA 1RCTE 1V45E 4DA6A 1U1GA 1OVGA 1PWYE 3MMSA 5F7ZA 1PK9A 2QSUA 5CYGA 1JDSA 1V2HE 1ULBA 1Z5PA 4TYMA 4JWTA 1JDUA 4NSNA 2OXFA 4H1TA 1JYSA 4R2XA 1ZL2A 5F7OA 4TXNA 4FFSA 1A9RA 4F2PA 1CB0A 3PNPA 5F77A 5B7PA 1VMKA 3K8QA 3UAVA 4L0MA 5FAKA 5B7QA 1TCUA 4EB8A 1Z38A 3U40A 1YBFA 5EPUA 4KN5A 4R2WA 4QASA 4TS9A 2QTTA 1JE1A 1XE3A 3FUCA 1RXYA 1B8NA 2A8YA 4F3KA 2PGAA 1ECPA 1PBNA 1U1CA 3DP9A 1NC3A 4JOSA 4BN0A 3PNSA 4YJKA 2H8GA 4D98A 1OV6A 4I2VA 3E0QA 3T94A 5EUBA 1JPVA 1OTXA 1A9TA 4PR3A 4U2KA 4BMXA 5KB3A 4LNAA 2OECA 4DA0A 1PR0A 1NW4A 1NC1A 4YNBA 4BMZA 4WKOA 3LBAA 1Z36A 2AI2A 4BMYA 4TXHA 1PR1A 4TXJA 1B8OA 1V48A 2A0XA 1PR6A 4DA7A 2Q7OE 4M7WA 4L5YA 1Y1TA 2IQ5A 1VHJA 2A0WA 1PK7A 1ODKA 3FB1A 4F3CA 3TL6A 1T8SA 5JPCA 1PR4A 3UT6A 4M3NA 1VHWA 4RJ2A 3KVRA 3GB9A 4L6IA 5F78A 4GLFA 3NM5A 3PHBE 2AI1A 1YQUA 3NM6B 3FAZA 4D8VA 2ISCA 1V4NA 1WTAA 1JP7A 3BJEA 3OOEA 4UC0A 1JDVA 1A9OA 3P0EA 1TGYA 3FOWA 1T8RA 1ULAA 4YMLA 1Y6RA 4PNPA 1Z5OA 4K6OA 5ETJA 1T8YA 3LGSA 3NM4A 3GGSA 4MCHA 1N3IA 1SD1A 1C3XA 1V41E 3DF9A 1Y1SA 4JP5A 3O4VA 4OJTA 4TTAA 1SJ9A 1RXUA 3P0FA 3BL6A 5EFOA 1RFGE 1RT9A 4DAOA 3SCZA 4D8YA 1A9QA 4DABA 4P54A 2I8AA 1PR5A 1JDZA 4E1VA 2OC9A 2OC4A 3E9ZA 5F7JA 3O6VA 1OU4A 4DANA 4QATA 4OEHA 4DAEA 1VFNA 3QPBA 4QEZA 4GLJA 4OF4A 5F76A 4DARA 1FXUA 3DJFA 5F73A 3ODGA 1PW7A 3IEXA 1JE0A 2AC7A 3ENZA 4LDNA 1Z34A 2XRFA 4X24A 1Z39A 3UAZA 4D8XA 2AI3A 3E9RA 4NS1A 3K8OE 3OZBA 1K9SA 4TXMA 5IFKA 1YRYE 4G89A 4WKCA 4OY3A 3PHCA 1ZOSA 3OPVA 1U1DA 2B94A 4IP0A 2QTGA 1PR2A 1A69A 4G41A 1ODJA 3KU4A 1QE5A 3BGSA 3OF3A 4QFBA 4QARA 3UAXA 1T8WA 4WKPA 2I4TA 4OGKA 4WKBA 4GKAA 2HSWA 1JDTA 1LV8A 2GUWA 3DDOA 1ODLA 2QPLA 3D1VA 1OUMA 1Y1QA 4F2WA 2HWUA 2HRDA 1TCVA 5K1ZA 1Z37A 3MB8A 1LVUA 2BSXA 4M1EA 5CYFA 3EUEA 1RR6A 4TTJA 3FWPA 4WKNA 5CCEA 3EUFA 1K3FA 1Z5NA 1I80A 5C80A 5CCDA 3EEIA 1RXCA
chains in the Genus database with same CATH superfamily
4XDGA 3RC7A 1CDOA 3WE7A 4BIIA 3NALA 1TJPB 3PP8A 5GAJA 3ZDYB 1LW6E 2YWRA 1OWNA 4ND3A 4I50F 4F6RA 3Q8LA 2XUHA 3AV3A 1ZLYA 1JMYA 3NRJA 2Q0QA 4U9HS 3QXHA 2C5AA 4GEKA 4WOBA 2IBTA 1ULTA 3IV9A 4KCGA 1GPKA 2LDXA 5AVKA 3GXOA 4GQAA 4MNTA 3S99A 4ECEA 3H65A 3F2IA 3AUJB 3KJGA 3N70A 1Y6GA 4N40A 1OTHA 1Q77A 1TZKA 1A4UA 4XJXA 1LSSA 3I04M 3O7WA 4DY4A 1ZK4A 1IFXA 1NXWA 1O94D 5C8VA 1GYPA 1GAXA 4ND5A 4B3IA 1ZM2A 5CXSA 2AYZA 4CTOA 3V7NA 4X20A 2B3DA 4YAOA 1QCDA 2PO7A 3LC2O 1SY7A 1ZFNA 3WGNA 2V7PA 4OP1A 5AD1A 5HOQA 4B46A 3G5TA 3ZE0B 3IIIA 3SHVA 1IZYA 2C8VA 1C0EA 4Q3LA 1UJ6A 3LCCA 4KLAA 3DF7A 1RADA 3DR5A 1Z4PX 1NFQA 5HTKA 3SLKA 3LQKA 2R97A 4D5GA 1PG5A 5IUKC 1C4XA 2QR3A 3I0NA 5CGZA 4UTOA 3PLAE 3LKBA 4U2GA 1A5BB 1M66A 1JKJA 1O6ZA 4HWKA 4I4NA 1I1HA 4RELA 4RPHA 2XBLA 1A8UA 3PEYA 4KW7A 4PG4A 3GJXC 3GJZA 4RZQA 1PQWA 3ZHRA 3WC4A 3LRTA 3F5SA 2C42A 4JYZA 3COSA 1JNYA 1SCUA 2EP5A 2W9XA 1L4UA 2YCLA 2ZIAA 3UHAA 1W0KA 3DULA 3UJDA 1H8HA 1GGFA 2RH8A 3WGVA 3OU2A 1TRHA 3NAMA 2QVBA 1CEYA 4P35A 3STHA 2ZWPA 2O2YA 4V38A 2GKGA 2ZIGA 5DT9A 2CXOA 2PLWA 2NO0A 4AMGA 5KJCA 4EF4A 1C7RA 2HIGA 2Z43A 1F2DA 3DMGA 4M0LA 4Q7MB 3U4HA 2NO6A 3FSGD 3FRJA 2QGNA 3G23A 4MRVA 4OSPA 3IEUA 3RT7A 1JA9A 1YMQA 2HA6A 3DC2A 4NV0A 3SN6A 3SR0A 1RZUA 3N8IA 3QQPA 1IXZA 1T1JA 3IQFA 1RWXA 1X7XB 3HCPA 2F8MA 1UKYA 4OHVA 3R7LA 5C8DA 2XAUA 3IAUA 2C5SA 4B9AA 2XEXA 9LDTA 5KAPA 1HC7A 2MTBA 3GZNB 3QSGA 3I2IA 3JD1A 1NMZA 1NX9A 3TZHA 3FPFA 4FFRA 4MVJG 5IH7A 5JC8A 3REFA 1RSZA 4ZT5A 2BMWA 2ZRLA 1IBLB 4BLPA 3FYHA 2VDVE 3VJKA 4DJTA 2PBZA 3FF1A 2AYXA 3W5VA 1GARA 1UFQA 2UV8A 3NU1A 2AV6A 5E4TA 1IVYA 1VSVA 1JAIA 4P32A 3IMKA 5BWNA 1J0CA 1XMXA 2OVFA 2QN3A 1OH7A 2Y2UA 3KKNA 1BA3A 1Y82A 5TVKA 5KTSA 4KV7A 2I7XA 3NDPA 5E1OA 2I6TA 1OVGA 3IP3A 3GELA 4BKOA 3EC7A 5EKSA 3REOA 2PUGA 1EP9A 2FAXA 1QH9A 1XLUA 1WSWA 2PYIA 3VVMA 5DM4A 4Z7OB 1CNFA 1NQTA 1U6JA 1X13A 1LPBB 2C4TA 4YJ2B 4CXMA 1R0RE 3HA2A 4H6WA 1JDUA 1TW2A 3ZHQA 2C5LA 4O8ZA 2IYFA 2F3TA 1TMYA 1X7DA 4H1TA 4JX8A 3SGLA 2MSWA 3O91A 1L9KA 1E9BA 1AXEA 1VHTA 2A86A 3H1FA 4KXXA 5FI1B 2Q2VA 1J70A 2HU5A 2V58A 2DFDA 2Z5VA 2ZJ7A 2J9FB 5D7BA 1CJUC 3WQQA 5FL7D 1VC2A 3G0CA 3MJRA 4KB5A 2ZJ3A 3BQMB 4E08A 4ER3A 3UJNA 3HZOA 1N2BA 2A5YB 2PD4A 3D3WA 5ECYA 1SUBA 5IJ0B 3I6ZA 2WQ7A 4MLZA 1RCFA 2FSFA 2WM9B 2Z57A 1OB2A 4C6HA 2PUAA 2FN9A 1P1BA 3H5IA 2V6GA 3CJRA 1UJ5A 4K1LA 1TCUA 4LMRA 4NQZA 5J4YA 3DLBA 1SMKA 2G5CA 2IEDA 3GDHA 3VGPA 3RSHA 5JYBA 1OB5A 4U9IS 3WMEA 4XOUA 2BBSA 2CNLA 4RE5A 2QP9X 3TLXA 5JU6A 4XJTA 1JLRA 1R6VA 3PDHA 4L9AA 1ZIYA 3FSRA 5K05A 1G3QA 1QORA 3PT5A 2OOSA 3DWEX 3BL8A 1KKMA 4NATA 2FSPA 3OCJA 4UBIA 5IJAA 4ESEA 4E2WA 3QTBA 1HZZC 1Q74A 2GCPA 2P9CA 1G4UR 1YR7A 1WLYA 4TZKA 1J8YF 1IZ7A 1HKHA 3O8OB 1RJEA 3DOIA 4X8LA 3GQVA 4K05A 2F1OA 3B36A 3O2SB 1A98A 2BGTA 2HSZA 1M5UA 1W36B 1B8NA 1NMQA 2O7QA 2C4HA 3DCNA 3V32A 1I5RA 5INTA 3BL5A 1C81A 4KP7A 3D7MA 3FCAA 3MVEA 4MVJD 4O2BA 4M86A 3CINA 5AJUA 5EOVA 3VPAA 1N1EA 3QPCA 2WWXA 2G4LA 3L4BC 2H2DA 3KWFA 2XB6A 3R0XA 4JOSA 1NVVQ 1WW2A 3CNEA 1U3GA 4H6VA 4R7GA 1GCIA 4G85A 1II8B 3JQ7A 1H0RA 1J6UA 1RYYA 1KC3A 2PD3A 3DL4A 2ZM5A 3FTPA 2WYHA 4GFDA 4L2IB 1CUDA 4MVCA 5ICFA 2SECE 1I2CA 3MCTA 2Z98A 5DYTA 5KWEA 4S1WA 4ZPJA 3VPSA 3NYIA 2NZUG 4DLWA 4JL8A 3V8QA 3AL2A 4ZXPA 4H7JA 6Q21A 3FVQA 16PKA 2PSJA 4GQBA 3W6PA 5KTNA 5LIPA 2XF2A 2HL6A 1VMEA 4KYIB 4DCPA 1KGDA 4F06A 4BNWA 3AXSA 1L8XA 3MD9A 4OX9B 1WCYA 2YXDA 2R79A 1UAAA 3EH2A 4PLFA 2ZUWA 4KMSA 4WNYA 2NO1A 4X5OA 4RXUA 3QLVA 2H54A 2OO7A 5AK4A 3AHFA 3QV1A 2LCIA 1OAKA 2YJ3A 5FQOA 4MVJH 4R8SA 1KAMA 1LTHR 1VDZA 2HDWA 3M5WA 1E5TA 4UZEA 4YYEA 5CLFA 1DRJA 1EEXB 5LLSA 1Z08A 4PCAA 1CR6A 1AY0A 3RUIA 4UM8B 3QUSA 4KJZA 2CJXA 4LRSB 2I9KA 5ECWA 1XD8A 4DTCA 1B8OA 4C5BA 1Y6FA 4LC9A 4ZYZA 3O73A 4RY0A 5BOSB 2I67A 1XVLA 5E7QA 1XAHA 3G68A 2OLKA 3AERB 4K0RA 2YOGA 4H0NA 5DM2A 1E2JA 5B3JA 3T4PA 4DWOA 2GM4A 3SAJA 4O4JF 4RTRA 3DHVA 4EGQA 1GPDG 1JBKA 4JEMA 5JCJD 1CUBA 2PZAA 2D1FA 1ZG3A 4MQLA 5IAOA 2FEOA 5DBHX 3T4XA 2GA9A 1YZGA 4OUDB 1TCBA 2AQ8A 3HBAA 3SP1A 1PV1A 4LJRA 1D2HA 2PBFA 1UC4B 3DHYA 4JZYA 1P7PA 3ZH9B 4GL4A 3W2GA 3ZOKA 3CVUA 1RYNA 2HSJA 1ZN2A 3OIWA 4FSXA 5CT8A 1ZJ5A 1PUXA 2EGGA 1D4AA 3DW3X 3H4VA 3PXXA 5AJHA 3L49A 4CW7A 4KC0A 1E60A 1WXIA 2O3SA 3KZVA 1XXHE 2WAYA 3HY4A 1F0NA 4Y30A 4C3OB 3WJAA 1EE1A 5GGXA 1WZUA 1JFFB 4TLBA 4ZOAA 4UUQA 1YQUA 3KZ1E 4JYPA 4EITA 1QQ7A 3OLWA 1OZGA 4FT4A 2ISCA 1OYWA 3ED1A 3LZ6A 1YNOA 1HOXA 2J4CA 4IMPA 3K0HA 3WGLA 3GAZA 2QE7D 1B16A 1YCDA 3TYXA 4CKYA 3OTHA 2W6JD 4DFDA 2HCJB 3WXMA 3AHIA 2B0JA 3BJEA 3PTLA 5DISB 4F1KA 3W8EA 4F4UA 5BRJA 4U7DA 2G76A 4X8MA 2OBLA 4G81A 1SXGA 1GKYA 2PQ0A 4UC0A 3RS5A 1JDVA 5ALQA 1CW2B 3ZGNA 4NMWA 4EPWA 4EGAA 4S0XA 2E4XA 1P1RA 1K7SN 1E9VA 1MPTA 3KVNA 4E07A 3NIDB 4E5PA 5KSOA 3H05A 4YMLA 1CS0B 4Z9FA 2Y1XA 3S2ZA 5JNWA 2YJZA 4DUZB 2QSZA 2OK8A 1J8DA 1T5TA 2GK7A 2V9ZA 3L1VA 3O83A 1MTZA 2JLSA 4C06A 1WQ1R 2V8OA 4MICA 4AVYA 5F23A 3ZKWA 1G2PA 5C3MA 2VRWA 1SBYA 2P3OA 1OR8A 5IXYA 1BQ4A 2Q9UA 4PCUA 3H1TA 4L8YA 2XCTB 4KWTA 4AZ0A 1QCYA 4D96A 2GJAA 3N5CA 3TNLA 3HMQA 4XUGB 1KFKB 4N7RA 2HM7A 5IZCC 3EIFA 4QBIA 4HCJA 3G82C 3VUFA 5JQGB 5KNDH 4LHSA 4KU4A 1T9CA 2BTQB 5HBRA 1YRAA 1UKCA 1B23P 2G6TA 3W5HA 2JIQA 2WW8A 3VV3A 1EINA 1XEXA 2BISA 2O2CA 3BWCA 3NXKA 4YREA 5DBFA 5DH9A 5DN6D 5LOVF 1E2NA 3EVZA 4HLCA 3N2GA 1KNXA 1B0AA 1XK7A 2ZJ6A 3CKMA 3G02A 3G5AA 3G9QA 4H31A 4RKWA 1HDZA 4KPFC 1TTPB 1M7GA 2NVBA 3V6LA 2E3JA 1JJVA 2QV0A 1XWIA 4NBSA 1JR3E 3RSQA 3B85A 1R50A 2DKNA 3U31A 5NULA 1TADA 4PYLA 3UJ8A 1Y8ZA 4W5NA 1ZISA 2Q9BA 2ZWOA 4BFSA 3UFXB 3PWSA 2I76A 2P4EA 4D9KA 4I5EA 1E2FA 4FW9A 1GTZA 1JX6A 5FP0A 4UMDA 1DBPA 2FG5A 4IYJA 1DAIA 5CBPB 2WMNB 4KPEC 1W4ZA 4MVJE 2O3RA 5G0WA 1Q7CA 2XA9A 1N2JA 1I0LA 4L3WA 2P0YA 4V02A 3CS3A 1CRQA 3H0KA 5DSTA 4ZVTA 1E77A 1WUKS 1NSYA 1CRPA 2OXRA 4A9AA 2HWYA 2Y6VA 1EWKA 2ZIFA 5LQSA 5EMNA 5LDDC 2DMRA 4JJFA 1R12A 4MRRA 3MINA 4REQB 2ZYUX 4WBNF 1EWQA 3T9FA 3ODGA 4A0GA 1AUVA 3IRUA 2WJZB 1NF2A 1J00A 5DNDA 4BFCA 2EJBA 5BWMA 3RAFC 3A4MA 1FPQA 1UXJA 4O1HA 1OVMA 3GLQA 1GIAA 1UK8A 5KNLA 1YDWA 2FP4B 2IE8A 1G20B 1NULA 3LTEA 2ORED 3VSEA 3D4BA 2LWIA 1AUQA 2YZKA 4LK2A 1IBKB 1N1MA 1LPOA 1JHXA 3VU3A 2FPWA 3DOHA 3FN4A 4ZV9A 3Q3HA 4PLPA 2HLPA 3RHSA 2X7XA 4DV3B 1PV2A 5C52B 1IULA 1F3LA 5EWLA 1G5RA 5TB5A 5IFKA 2UVQA 1RM5A 4GBGA 1VL6A 1XMIA 1U2GA 1OXKB 1XF1A 4RL4A 3SHTA 2HNKA 4MTCA 5FI5A 4NK5A 4H18A 4QJ3A 3EWAA 4BO0A 2R3SA 1PTKA 1OGIA 4DF3A 1ACJA 5KDLA 1P0IA 4WY2A 2A5DA 1WETA 4XE5A 2EFJA 1O9GA 1K7FB 2EG5A 1BGVA 1UXGA 3NT5A 3RFVA 1DLJA 2WHXA 2PKQO 3W7VA 4LWZA 4DGSA 4YJ3A 1H3FA 1GQ2A 3N86A 4UBNA 1OH8A 2H52A 4IGEA 3BZBA 4BPBA 3AY7A 3DZGA 2H4FA 3W5IA 4BTEA 3BE5A 3Q9NA 1C7FA 5TPWB 4MDEA 4QDZA 1N1DA 1DEXA 4R54A 2VF7A 3VPDA 2R4QA 1Z29A 2GVNA 4P7BA 5F64A 1KBQA 5JBQA 3LL7A 4MCJA 1KY5A 1XX6A 4BQSA 1L3IA 3RKUA 3THXA 4CG0A 3LV8A 5D01A 3WO1A 1A9YA 2AW5A 4X63A 1QLWA 1AT1A 1BJRE 1CBUA 2UYQA 4MVYA 3UMBA 3ZZMA 5CFMA 2B8NA 2WKRA 3I34X 2D7CA 3C7TA 4A2WA 1YO6A 3F1KA 3QUCA 4BNHA 5BT9A 6NULA 1L7PA 5IT5A 4O02B 4FBMA 3Q7TA 4OIMA 1UM8A 1DC7A 5T3UA 4F71A 3KL4A 2HF2A 3CUYA 3EEFA 2ZPAA 4TLCA 1WW8A 3F7NA 3KHUA 2J33A 4G4JA 3ZV7A 3MBOA 4Y6PA 1NHWA 4DT1A 4DG5A 3U7QB 5DNVA 3SX4A 1CUFA 4BMNA 1U2PA 4Z6KA 5I9NA 3OIVA 3OEED 4D82A 4TTJA 4LYHA 2J59A 3M4YA 2O48X 4Q4CA 2JJ1A 1GFZA 2YMMA 2WI8A 3MUOA 1RPJA 3N8DA 4YJFB 3PKZA 2DERA 5C80A 4WI1A 4F1WA 3THRA 3VYRB 3AU8A 2HNAA 2AMFA 2NLOA 1Q20A 5ALNA 5JTTA 4FUTA 3SDBA 3DPSA 1KDTA 5AK3A 5ITSA 1S02A 4MP6A 2QOEA 3CLTC 1Z33A 3A3YA 2P6OA 1TLFA 3FA2A 5B7NA 1RXSA 1F38A 2H59A 2JDIA 3ZVRA 3OZCA 5I8ZA 5ALPA 4BNNA 3HB0A 3SFVA 1DAFA 1Q3HA 3LBIA 3MWGA 1T9HA 5LD2C 2CWDA 4BWGA 2CW5A 2PZLA 2C3MA 2H5JA 3E3OA 3IUJA 2IYNA 4R8KA 2CL6X 4NCBA 5BURA 3CPSA 3ANXA 4DZRA 3IVRA 3MELA 3WWDA 2ORVA 4KE8A 1XPJA 3U16A 1OU0A 5LQAA 1UBRS 2MWMA 5CB6A 1HKUA 3FCCA 3UAWA 2AJTA 2W6ZA 3OUUA 2ODAA 1EIZA 5FNVA 3OZEA 4L3VA 1E7QA 5EHXA 4JI5B 4AJNA 1H42A 4R8VA 4YJ3F 5LXTA 1XZEA 4Q21A 3BWMA 1MJNA 1EK5A 5AVVA 3KC2A 4F97A 3RRMA 2E4UA 1EBFA 4QQNA 5CH3A 5HSGA 1ECFA 2CXNA 2BZSA 3H87A 4QUGA 3U1VA 1Y89A 1CUIA 4CIVA 5L3QB 4N65A 1TA9A 4L5IA 4BMDA 3EXIB 4YT2A 1SUIA 2W6MA 2WP8J 2FFHA 2WWTA 4Q39A 4TXLA 2H85A 5EXPA 4BO2A 5I4CA 5IABA 5JAIA 3L82B 4CIYA 1AHHA 5F1OA 3U9LA 2AN5A 1RI5A 4G0MA 3L7LA 2NO5A 2P90A 2QG9A 2CBZA 2NUAB 3K8ZA 2GXAA 4QXQA 3ZCXA 2QTLA 5ELMA 4ME6A 1CHNA 1TD1A 4UVGA 3TH5A 1G291 3GLIE 1FS4A 4HNUA 1T35A 3IOEA 3FHLA 3F97A 5B6PA 3KEMA 4N76A 1XJQA 3K53A 2G25A 5F2KA 2D0DA 3B7GA 4QU5A 3WRVA 4D9HA 4H6XA 5LDGA 1GZUA 2IYTA 4BQNA 1D4OA 3ROFA 5C1OA 5TXGA 3DE6X 1ODIA 2OHIA 5C8YF 3L1JA 2FUCA 3D4PA 3QBDA 3NTVA 5K3SA 2YQ4A 1GRRA 3FE2A 3BEOA 1A8IA 4JLJA 4A5SA 1XAJA 1YVUA 3FYCA 1OFIA 4R84A 1L4LA 1G6Q1 2QAJA 3PE4A 4MSUA 4QYSA 4V0RA 3VI4B 4RKQA 3JAWA 3K4HA 4BX3A 1NLZA 1VRCA 1WXDA 2H29A 5A04A 2HNBA 4LCEA 3TBFA 3KVVA 3WLHA 2EARA 3W5AA 5AKZA 2JLXA 4V2UA 4NEHB 1PG2A 4AO6A 4UBMA 2ZSBA 5DCWA 3TRFA 5JSZA 1V8DA 3I52A 4Y7CA 4RTSA 2I4NA 5CFNA 4N49A 3OF2A 3CZPA 1M74A 5AESA 3QVGB 1MBZA 2F7SA 1E2KA 1J25A 1PS8A 1TM1E 1M34E 4GRIA 1LPNA 3FBGA 4HGYA 5DCYA 3ACBA 2VK8A 2PN1A 1RFLA 3EHDA 3KZXA 3Q72A 1JECA 4INPA 4Y9TA 2PL1A 2VTBB 2QSUA 1DDIA 4B6QA 1JT9A 2M1ZA 3PSAA 4DCCA 2APJA 1II9A 3OUTA 3OD1A 4CLXA 1USWA 3MMPA 4IH4A 2NU9B 2UUAB 4YQEA 3VAAA 3PFFA 1VJ0A 3B9QA 4DPKA 4J1TA 4BGIA 5TIIA 2C88A 1AKWA 2BMVA 2VUUA 5LOVB 4QVIA 2X0IA 1SURA 1TT5B 4TSRA 3SQNA 1R1DA 1YULA 4O4IB 3NTXA 1VL1A 3RWBA 3W2TA 5LP6F 3QENA 2CFRA 1V47A 3CB4A 1NUHA 4MULA 1FUIA 4G84A 3KPWA 1UFKA 2Q49A 4FNGA 2RE8A 2FDXA 5E0OA 4H7KA 1U11A 5KI6A 1JG4A 5B7PA 3ILXA 1WTCA 4HGNA 1Z88A 3KBOA 1LWOA 2PJUA 1IONA 2V4UA 4MLPA 1MO3A 3R8CA 4JVLA 4Q37A 3WKAA 5L40A 3G89A 1IUOA 2D06A 1ZR4A 2BFPA 4EJFA 1D9ZA 2A6PA 1XTRA 4L78A 3N05A 3QLUA 4K87A 6REQA 1YGYA 2AMJA 5FLEX 2FWMX 3AWIA 5CNKA 3GK3A 4QLOA 4EY5A 1Z4JA 2IKQA 4JJEA 3ELBA 2XCSB 1OZAA 2CMGA 4HADA 3M9LA 3SQMA 4EHKA 1G3IA 3CISA 4JQZA 5IC4A 2AEJA 3T61A 4YJDA 3WL4A 4JELA 1TJ4A 2PRKA 4KQ2A 2CLLB 3B1KA 4YAJA 4JJ6A 1CUSA 3ODPA 1SELA 2HT6A 2IPXA 3GNLA 4IM7A 3ZD6A 4JLWA 1OGJA 4J4BA 1UDRA 2Q1XA 2O2DA 1DFIA 1P7CA 4TVOA 2B30A 2IGTA 1XAGA 1I3KA 2J6IA 2VHQA 1GZSA 3MXTA 5F21A 2NN3C 2VPQA 4IV8A 4AQYB 5TJ9A 1LF0A 4TMYA 1IIBA 1TPZA 2XYQA 2VK4A 2W42A 1K4MA 1TCAA 2VQDA 1SM4A 2XUIA 3DMDA 3OCZA 4FYJA 3T6KA 5IDQA 3K70C 4AYWA 2GMWA 3NHFA 3ONFA 1BHSA 1JS1X 1WB5A 3SIXA 3E7WA 3PC6A 4DYDA 8ABPA 4AKEA 3F6SA 1ZGGA 4NBWA 4OFZA 4XH9B 4X91A 2TMYA 4LDQA 4QLBA 5C8ZA 4L95C 4D57A 1C9DB 1UC9A 4P98A 1P2BA 3DDNA 3EGCA 3RT1A 5BN1A 3MCAA 5DBEX 3W5SA 4MYCA 4B32A 5L95A 1QIIA 1L0BA 3FI0A 4FONA 5KNCD 1JHUA 3CLSD 3DTNA 4AZSA 5LQJA 3IAM1 3PNQA 2OV1A 5ERXA 3JQRA 3GLKA 1ACLA 2JIDA 1X8XA 3O5AA 4ALIA 4DQVA 2ZR7A 1IN7A 3IE1A 3VYTB 1BAPA 2FPIB 4K9NA 4MLDA 3HJTA 4RANA 5FNVF 4I1PA 1RYMA 1K8RA 4D2IA 1JDBB 2R5NA 5EC8A 1TECE 4GECA 2QRPA 3U3DA 4H15A 3EIHA 3LX6A 3BIWA 3ONEA 4NXMB 2GN6A 4MHTA 4FFPA 5E3IA 4YR9A 1EFTA 3A25A 2WLTA 2GBFA 3UKDA 1O8BA 2H00A 2X9VA 3THOA 1KFBB 1PL7A 1ORTA 1CQPA 2GB4A 3GLVA 2P9HA 4HWPA 1KAGA 4QUJA 4TRNA 4C4OA 4CF3A 3BERA 3CH5A 1GG8A 2WSLA 3C1TA 4DSUA 4Q12A 4PYRA 4HRVA 5FLXA 1P3DA 3EQ9A 4IJUA 5DMXA 1NXPA 3JQ7B 4BMYA 3UB3A 3RYIA 3OOWA 5HHTA 3R75A 4DCJA 2BRUC 5KZMB 2WTXA 4FR0A 4FR5A 3TZQA 5IN4A 2LP4Y 3PU6A 3QVJA 1CZUA 3L7KA 5JR3A 1ZUWA 2GAOA 2BGLA 2I2XB 4KYUA 5AJWA 2UXCB 4W6QA 4B84A 3K92A 3QRWA 5FAXA 4D4HA 2WPDA 3R1IA 1YTUA 3I72A 1DKNA 3KT3A 1JLLA 4EZIA 2GSWA 1EWVA 2CLMB 1DB3A 3UC5A 3RNOA 3OE5A 5B2FA 4AS1A 4JB3A 1RBZA 1S01A 1XJWA 2N46A 3NEJA 3B6JA 3DAPA 4H7PA 1T8SA 3TUIC 4DMRA 4Z0TA 3OWXA 4EG7A 1H6CA 1I9GA 3ZUGA 1B6SA 3W7BA 2D5AA 1C7IA 3RFXA 4ZMSA 3FTNA 3FUUA 1Z5GA 3EF0A 5AKIA 4CEIB 1EE2A 2WFZA 3W5BA 1MXFA 1T6YA 4TYWA 1NW3A 2CL0X 4RH1A 4ZRDA 4DCTA 3ZU6A 2P6RA 2ZS8A 3HKCB 2Y1DA 1RHKA 6AT1A 3VU9A 2DOKA 2FZ4A 1X1EA 4DG9A 4HAVA 2PMFA 3MAAC 1I4WA 1MB3A 1TM4E 5FUVA 3S2UA 5LMCA 4MGIR 4C2BA 1FZTA 2FZLA 1W49A 2B5WA 3AX6A 3C6BA 4YRZA 4GBJA 4CEHB 3FLBA 2WHRA 4B6RA 3HBJA 2KM1A 2NM0A 5SYAA 3TINA 2H06A 1SXJC 1XO1A 2PGDA 2ZR0A 4AIIA 4TTVA 3A8TA 2FGJA 3RJ9A 2RH4A 4J0EA 2V4MA 4TWRA 4W7IA 4DMMA 4E5YA 3EEQA 1R4MA 1ZD4A 4M88A 2ERCA 2P9JA 3QF4B 4MKXA 4PYNA 5KTPA 3T9CA 3I9LA 4HATA 4QDTA 5CVVA 4RSGA 4D41A 3H3FA 1T2NA 3G3EA 1P74A 4MUYA 1HNNA 2D2VA 3HA3A 3O1LA 4N0QA 5FTLA 4P4UA 1E4VA 2NG1A 3PWZA 1KO7A 4K9MA 3HXLA 4JUIA 4ITUA 4Q1AA 3RQSA 3L8DA 4H7IA 4F72A 5LQKA 1QIKA 3C3EA 2YMQA 4FYWA 4JFAA 5JO9A 4C7MA 5GZ1A 3WLQA 4BLTA 3CLRD 2HMAA 1SUEA 4DLLA 1F7VA 4QDJA 2CJFA 5JXGA 4ZVVA 1WUIS 2XYVA 3WZLA 5AVRA 1DHRA 3A11A 4OPMA 4WIAA 1V8OA 4IINA 1A5AB 3O8DA 1NMXA 1BMQA 1MQAA 1MT3A 1C3XA 1T1SA 3BDIA 2GAJA 4KTTE 3GGPA 1M0SA 3JASA 3KYDA 3JVIA 3VVCA 2FGKA 2IYYA 1APBA 3LIIA 4QVKA 1MAVA 2CCGA 2J0SA 2J3QA 4PRZA 4MW0A 2D7JA 1VMDA 4KAXA 3K4QA 2DFVA 4JITA 1CV2A 5IX8A 1IK4A 1EFCA 4NZMA 2DQZA 1U2GC 3OKAA 4PSVA 4XSHA 3PIRA 4Y6SA 4QGGA 1NX6A 4DZTA 1CE8A 4HAUA 2PS1A 3HYCA 4UHFA 3T0FA 2V54A 3WNVA 1FJHA 1RFGE 5EZYB 3X1JA 1QB7A 1VA5A 3QXSA 1LQUA 1MN6A 1SVMA 2VPWA 3S4YA 1HRDA 1V7ZA 1VZ2A 1YBMA 4HC4A 1FQKA 2EG9A 2YV3A 3EXFB 1E64A 4MQEA 3DFFA 1B3BA 1TZJA 2WFLA 3A9SA 1U90A 3BWXA 3JWEA 1OMOA 2I8AA 3DR3A 3PTZA 2ZYVX 3FKQA 4GOJA 1BVUA 1HEIA 1KDVA 4BATA 1PX2A 3KTAA 1JDZA 1RMYA 3PEVA 3PNBA 3HN7A 5HCIA 1NJGA 1UANA 1DPFA 2B0CA 4NOMA 3B78A 2O23A 3L7YA 3SZOA 2LKCA 4RPGA 3Q3IA 1VG0B 3HZZA 1KP3A 1L5WA 2CDNA 2A78A 2P9QA 4YHBA 2I7VA 4MEBA 5T5QA 3R4VA 3E35A 3ITDA 4IRXA 1XKTA 2BCJQ 1M1ZA 2J7KA 2Z2YA 3SE0A 4EUSA 1ZSYA 3EC1A 1DQRA 1R2QA 4Q6WA 2OESA 1ZXBA 3GGGA 4YALA 2VPTA 2XODA 2CD9A 3BIJA 3H1GA 4OH1A 1SC6A 3PRKE 3AW9A 1XZLA 1U3CA 4WXMA 3VMFA 4CM9A 1R7RA 4JBGA 3N2GB 1QP0A 3SI7A 2G9VA 5GJVC 5BV8A 2POQX 3PXBA 2BP7A 5F73A 2VDWA 1OYYA 4KL8S 3GRKA 1UODA 3AEKA 4K81B 4NNOA 5ECDA 3RRXA 4AUNA 2GQ0A 3K35A 4DBLC 5HIAA 3DLHA 1W5TA 3D43A 5I3ZA 4Q9HA 2LIPA 3UMGA 1BKDR 1DBIA 1SVLA 3L4JA 4MQ5A 4NJOA 3NGXA 5H5JA 4S2UA 2HHAA 2WF7A 3UYLA 4PN7A 3M5CA 4MYRA 4WZAE 5KJEA 1NWHA 2X5NA 1ZI6A 3PQ5A 4P0PB 1YGPA 4LRYA 3EW7A 2I87A 3G8CA 3KBBA 5K3FA 2ZIVB 1MHTA 4TM7A 1IZ0A 4MWTA 1QHHB 1XHFA 4TUYB 3UH0A 2C4NA 2YY7A 5M34A 5BMVA 4PO1A 1GGJA 2CLIB 2GZSA 4MV3A 4QO8A 3AUFA 4RSHA 4UBOA 1X80A 3G59A 2I2DA 3OJCA 2QRUA 2PGJA 5DDIP 3BXOA 5GQSA 1QUFA 5K0EA 2O0KA 2RK4A 4EKDA 3UJ3X 1JB1A 3KYBA 4IQ0A 4LSGA 3C7AA 1W4RA 4ZDWA 4B3SB 3OIFA 3H2HA 4RDCA 2VCEA 5IKOA 2PVPA 5KYXB 5C31A 1JNXX 1Q0UA 4HQ6A 4UJ3A 3TM5A 4PPGA 3VTKA 4IVNA 4AN4A 3IEKA 4BVLA 3QYJA 4BJ5A 1A50B 3IUNA 3D6JA 3VZDA 4B17A 5JJIA 2V4ZA 4Q9IA 2OB2A 5FOTA 3N8GA 3LK7A 3MOGA 1FVOA 4B6SA 2Y2VA 1KXZA 1C9MA 3MWKA 2C29D 1ILWA 4RMJA 1EP1B 1Z75A 5HVNA 1QJCA 3OTOB 4B44A 5B6JA 2DLNA 5T8KA 3SR4A 2XQKA 3QUTA 1ZM4A 3KQTA 4ILKA 1I3NA 4J29A 4ZZIA 5T4HA 4BNDA 3DG9A 3PPVA 1G3UA 5K1ZA 2CXUA 4DEYA 1HX7A 2PUHA 1I0IA 1X7YA 2GBPA 2ZUBA 1Z2DA 2ZZKA 3LPDA 2G77B 2OQVA 3MB8A 1J23A 3DDZX 3H1BA 2PS9A 4FDLA 4F96A 4EO7A 5CYFA 2QRGA 4X93A 3HFGA 1T5OA 3A2LA 1A04A 1CLEA 2XNHA 1PEDA 2ZUTA 4B2LA 2ZS7A 2AFIB 3FOAA 4PNHA 2FWJA 3GRUA 1P7YA 2C61A 4BRSA 1GJRA 2A9RA 3PENA 3JYLA 2EKDA 3KETA 3LY9A 5I3CA 4Z1OA 3YASA 2W6JA 4RJLA 2EGUA 2C5HA 4HQLA 4BNIA 3AKZA 4L5AA 1RLUA 1SOAA 3HABA 3UWPA 4C6RA 4I99A 2FPLA 1M73E 2RD2A 3ROPA 5LZ2A 2EJCA 4P83A 4IJVA 1VYTA 5LBIA 1I3CA 1V5EA 3WHPA 3SMQA 1KEPA 1P9OA 3OY7A 5DYGA 2WIBA 1Q0LA 3H5RA 5LA6F 4IFEA 2W8BA 3QW2A 4PWYA 4ZVSA 3INYA 1RI1A 1RQRA 4Z7NB 2D5CA 4EZEA 2R1VB 3OZWA 5IK2D 2E2WA 1Y6QA 2CHGA 1CUYA 1NYRA 2HUNA 4RKEA 3TLGA 3QBJA 3U7QA 2GCEA 1L8AA 2JKZA 2VJOA 1DIAA 1TVEA 2W0MA 3HEBA 4U7JA 4UEQA 4BB5A 4DDMA 3Q40A 5IT4A 5F9FA 2HK8A 3HSYA 1ZBDA 1OFVA 3EQZA 4M8KA 3HDTA 4UNIA 2IU0A 1I2MA 1ZN7A 1XL1A 3OICA 5CNIA 3SZ3A 2C1ZA 4RD6A 2F8TA 1CQIB 4X1KB 1M2NA 1CK4A 1YL7A 2ZSUA 3F0TA 3FNHA 3JRNA 3P27A 4QJIA 3V8EA 3WO0A 2VYVA 1YT5A 3FVWA 2WTUA 3SQOA 4ZYLA 1FFDA 1AZTA 1PR9A 4ZDIA 1AGPA 1DAHA 4JBWA 1D6SA 5KIAA 2VS1A 3F5DA 3FJYA 4GPBA 4ND2A 1CQXA 1DL5A 4I8DA 2QM3A 4QREA 4C0KA 4HS4A 2V7TA 1IDOA 3MLAA 5M3BA 1UBHS 1USUA 2J0UA 5GJWC 3HN2A 1WOYA 1ZNZA 2QX6A 4WMLA 1NQ5A 4I6JA 4Y2RA 4YRLA 4IWNA 3P9QA 4TKLA 5FFFA 4XYMA 4L4RA 3CUWA 5WRFA 3QLJA 4F4FA 1NKTA 2HGSA 1NVXQ 4U4AA 3TQOA 3TEJA 3BCSA 1E6WA 4RV5A 1TJNA 4XGNA 1GN9A 2H63A 3ITKA 2W5UA 4DSOA 2GLXA 2R5FA 4WLNA 4C0SA 5DT2A 2UZ4A 4I8IA 4MR8B 2QRHA 1N2HA 1CNMA 3RAPR 1D8TA 3BWBA 2X14A 1TAGA 2YNMA 1LQ2A 2UUPA 1D09A 1TA0A 4DJAA 2O9JA 4ZJUA 3ZHXA 5ALKA 2QD3A 5DK6A 2LPMA 3QLUC 2VJPA 3M4XA 2O05A 1ZAYA 1GFSA 1MEOA 2HD4A 4BIMA 2CNWD 1VGVA 4FS3A 5L4LA 1ZGBA 2J5QA 5FJJA 4PS1A 1N4AA 3F3MA 5IAEA 1G60A 3IMFA 2UVDA 4XVQA 2GPYA 3CCBA 2PKEA 3OCCA 2RSLA 3AM4A 2VYND 1IN4A 1JQDA 1AKNA 4OAPA 2I3BA 1LS1A 2UYOA 1XXLA 4RO0A 2WT9A 3V2GA 1HE5A 4TT3A 4DVGA 4BUZA 4ABYA 4CIBA 1FMCA 1QIJA 4PQYA 5JCPA 2B5OA 2W2QA 4PC1A 4JEIA 5JNSA 3DO6A 5BV7A 3ND5A 1C9YA 1DINA 1NWCA 1E7SA 4K9KA 3EXAA 2HYIC 4PGFA 2R11A 2DBRA 2PKRA 4M2LA 2HLHA 5IJ0A 4AY6A 4B3HA 4DA6A 2EW1A 2G40A 1EA7A 1PFVA 5JCJA 1F8XA 2ID7A 5JZSA 3CUEF 5JS7A 2ZP1A 5K20A 3EH1A 3SJ7A 5KPJA 2OD9A 3N1UA 4UDXX 5E6UA 3TQTA 1U28C 3AT1A 3K4PA 3D8TA 4TPKA 1X1BA 4QPJC 2CYBA 5TDHA 4XUCA 3RVOA 4DCUA 5JAOA 3HGMA 1DBRA 4KH1A 3PPXA 4IG9A 2X23A 4IVPA 4ZO4A 5CT9A 3V7YA 2C97A 5FFNA 3PQCA 3LQQA 1PKXA 1LFDB 4ROTA 2PUTA 1GNSA 4W9NA 4OHPA 1LXCA 5F7OA 3C14C 2GZ3A 2ZBQA 1V7CA 4F2PA 3PYMA 4D42A 1G59A 4ZCIA 1CYEA 1KYXA 1U0JA 3N7UA 1IZ9A 3RO7A 3ZHOA 3QKRB 1JHPA 1LBSA 4O2BB 3TZLA 1EXVA 2RAVA 1G7SA 2JKYA 4IDCA 1X86B 3OFVA 3RF7A 2BUBA 4AO8A 1L9XA 3GAFA 2KLBA 3BHIA 1ZNQO 2NVUA 5DYNA 5FAKA 3H2IA 2PMEA 5TQJA 1SN7A 1ZDMA 3VNAA 4BZZA 2G36A 1UBMS 4EHDA 1D2GA 3GWGA 3NEYA 1ZBQA 1II8A 3F78A 2WVAA 4YJ2A 1IZ8A 1K88A 2JCVA 2BRUA 4XA8A 1AF7A 1Q11A 2H4JA 1MRNA 4NDZA 3WZ2A 1CEEA 3B53X 1UCFA 3KV3O 3FNIA 1U7OA 5AJYA 4TKMA 1FIUA 4CIXA 5MHTA 5EUCA 1T0HB 2RONA 3A4NA 3CEAA 4O4IA 4URZR 3RVNA 3GUHA 3WQBA 5JLJA 5JZVA 2IZ5A 1CZOA 1XLVA 4MPTA 4LPSA 5ED4A 1WQ4A 4B7AA 2V1UA 1IXYA 3K2EA 1P3Y1 1WCV1 4BV8A 2WYWA 2HJ9A 1LFAA 2A7QA 2R84A 3RF6A 4WDRA 1IVNA 4YP6A 2Y77A 4GO1A 4WXPA 3TDMA 1DMRA 2DQKA 3S5JA 1PRYA 2XGOA 3PS9A 3IS3A 1IY2A 3BE4A 4MWCA 4TGLA 1SUFA 2HQRA 1HXHA 3CNOA 1GL6A 1W6UA 3X44A 4AXBA 3ESCA 1O5TA 1URPA 2IEGA 1DFGA 4C03A 4R2MA 4D98A 5CT5A 5AXCA 1UEJA 4YCBA 2MOKA 2HCBA 2X58A 3O8QA 4TV9F 1OTXA 5KQGA 4PQRA 3MWEB 1Q14A 1USGA 3TLBA 2ZYAA 1I13A 4LISA 3IV6A 5KSZA 5JASA 4ZYXA 3ET5A 2NW6A 1SEVA 5JYEA 1GPYA 1YQEA 2ZVDA 4LQDA 2A7XA 1BDMA 3GEIA 4EUEA 3P0JA 4NBUA 3FMVA 1VTKA 3UFXA 2WILA 4DR3B 2PUBA 4BNVA 1Y9ZA 1RRKA 3GYGA 1HTBA 4FJ1A 4F3RA 3IJRA 3WKDA 5IJ9B 4L5BA 4CKCA 3E3LA 4MUBA 4XIIA 2B36A 3EGVA 4PR0A 1Q91A 3WLKX 3AR3A 2O5EA 4JLBA 1YOBA 5JAPA 4Q18A 2G7ZA 1M9NA 4H4CA 1P1KA 1I94B 2I3DA 5AKGA 1HGXA 2AI2A 2QLLA 3I62A 2W58A 3SLRA 2WWHA 4UTVA 3UTDA 2IBSA 1MHPA 1NN1A 3TLMA 1X1AA 3HTXA 4C4YA 5GZ3A 5A0VA 1C4WA 5KOIA 4I50A 2GD2A 2XX3A 1PWXA 2Q2QA 2IYEA 2VBIA 1T0PA 2XZDA 3DE0X 1XYYA 3VVLA 4AZTA 4TZ6A 2OO5A 4YK7A 3C6XA 1JIQA 2O1SA 1ZHHA 2EFEB 2ADOA 2FR0A 1WE2A 2KS6A 3KXPA 4HF7A 4M9QA 2GFQA 4JBNA 3WX0A 2ZW9A 2WJAA 4ENVA 4CKWA 3W90A 3RSFA 2IQ5A 1CZRA 4FWBA 2JIRA 4CTJA 1OZHA 5IXSA 1RYDA 4D56A 2NPOA 2NSYA 1MABA 1VA4A 3K94A 1R27A 4GU5A 4XDYA 3AESB 4Y1EA 4WY8A 3V7FA 4KQFA 1X92A 1UXIA 1O3YA 2B34A 3GHHA 2ZYIA 1ENPA 5DRYA 3F5QA 2DBVO 1DRVA 1IK6A 2VTDA 3C8MA 1Q84A 1IQ0A 1Q17A 3BXPA 3JD0A 4R81A 4M83A 5AI5A 1JF8A 5G2OA 3L8ZA 5K6AA 3UPUA 2ZFUA 3D4LA 5AW2A 4DIEA 2C2MA 4FYYA 1QV7A 3Q2IA 3JQBA 3KG2A 1R3UA 4G86A 1M72A 2G1KA 1WXFA 4B4DA 2Z4TA 3RTBA 2BGKA 1AHPA 2H1OA 4HNTA 1NLUA 2MYNA 1S1MA 2AUNA 2OV4A 3B6MA 1C3EA 2BFWA 3QVKA 2IWHA 2ZEJA 1NE2A 2HBYA 4MRMB 1WZIA 3SKYA 1P5FA 3PRHA 4HKTA 1V9SA 4DSTA 2H5EA 1T13A 3U49A 1DBQA 3D8NA 2IQIA 2HFKA 3AEUB 3B6KA 3CRVA 1LVGA 3I2YX 2GARA 2QN8A 5HKLA 7GPBA 2BT4A 5J4LA 3TNJA 5JS1A 3CXUA 3RVKA 1XRPA 1SA0A 2EJTA 3VHLB 1ZC4A 4KDEA 4C2AA 4F4HA 2Q0SA 5AW5A 1BZYA 3S2IA 4RNCA 3RYHA 1E5LA 2YVQA 1N6KA 1VIAA 3SDZA 4KR7A 1Q57A 2CJPA 3RSSA 5HM6A 3DT6A 3E3NA 4K86A 3LXMA 3DKVA 3CJQA 1RP1A 3DL7A 3JRWA 4IDPA 2Z5GA 3AYZB 2VHVA 3CW9A 3TZKA 5BW4A 4UAVA 4PG7A 4HTAA 3VPXA 1H5NA 4UXJA 4Z1MA 1GR0A 2CLEB 4FMCB 1FL9A 1E2LA 5C1DA 4CM3A 3JYHA 4IUDS 4TRMA 1MB9A 1U7UA 4DT1B 4BXOB 3KOXA 1JDJA 2I4MA 3KQVA 1EB9A 1IBSA 3R24A 3RKSA 4NZOA 5IKXA 3HFSA 4QNRA 5J2UF 3M7IA 4I36A 1AKMA 4LXQA 1QE0A 1IOWA 1B6GA 3HVHA 4XX1A 3KKPA 3BDAA 2I4OA 3HBNA 1QFMA 3N2KB 3MJCA 3ZJ5A 1MW8X 4AF8A 1DG3A 3CBQA 4UPVA 2WQZA 1N9KA 5KCZA 1FY2A 1BMTA 4XRRA 2WWWA 3HS3A 4CLOB 4ALNA 3DVLA 3AI1A 4IH9A 2DWPA 2YYSA 3CC8A 2XE4A 4UASA 1PZFA 2FLKA 4HLNA 1WLSA 3ZQKA 4ZHQB 1U0NA 2QJTA 3P20A 4DZZA 4BC0A 4B7UA 3CVWA 4REQA 1J99A 3GCGA 1CZHA 4BUJA 1MAUA 3HM2A 1IIRA 1M2FA 2ATCA 2Y4NA 2ZWVA 3A14A 3NHYA 4P54A 3RVBA 4GAEA 1GP2A 1AB5A 4YV2A 1N9ZA 2GKSA 1HFJA 5IANA 2XMDA 2RMKA 2W2XA 2PQ6A 3W2EA 4I1YA 1Y7IA 4FX5A 3K72B 4ARUA 2IXBA 4CCYB 4YWJA 1FDIA 2VRBA 2YXBA 1JR6A 1A8SA 3ELUA 1TQHA 5AW7A 3NVMB 3VDMA 1Y98A 3DGEC 1VRWA 4YAWA 1NUUA 2H5IA 3E05A 3HRKA 4JFRA 3WGJA 3JR7A 2LKDA 3H11B 3W2FA 1MV8A 1MLDA 1OZFA 1VMAA 4RESA 3LKDA 2OENG 3L1KA 2ZBGA 3CM0A 3JTEA 3Q98A 1MZVA 1OJ7A 3JZFA 2Q2WA 1KRXA 1SZDA 1DT3A 2DT8A 3OURA 5CH5A 2OM6A 5C46F 3HN6A 1W87A 2DHEA 3JW8A 3OCYA 5L3QA 1T3ZA 3B38A 4P82A 1CRWG 5FBRB 3F9IA 3AVUA 1QFJA 1GAEO 2OGWA 3NBKA 4UQPA 3TX6A 4E94A 3BG5A 4ARVA 3BF8A 3ZX5A 2C1XA 4HXEB 2ZSIA 4U8HA 4KYVA 4C29A 4B6PA 4BGEA 2REXB 4AG6A 3OOJA 3LLVA 2JZCA 1NP7A 3B1YA 3LQRA 4LW8A 4LY3A 5ALTA 1Y7TA 1QDEA 2OUKA 2XRFA 3MSCA 4OKNA 3KS9A 3SC2B 3S44A 2O2IA 5TPWA 4V0OA 5ADHA 4MROA 4PLGA 4H3KB 4C0HA 1EJ6A 1L8LA 1E1YA 5HA5A 4BS9A 3L92A 1P7VA 2BEUB 1DAMA 1AMUA 3ITNA 1Q2XA 4HFMA 4HEHA 4OYLA 5FV7A 3WYGA 1ZW1A 3KJEA 3VDQA 1YRYE 1ZIOA 2VOJA 3AI7A 5A9SA 3WHKA 3KJFA 3JQ8A 1J2YA 2WM3A 5G40A 3OSZA 3KPYA 4UVHA 4IJKA 4O2BF 1JEEA 5CFQA 1YIAA 3P2EA 3LUJA 4UHJA 3LHIA 4FWTA 1QQ5A 3HU2A 3TG2A 2IHUA 4BNGA 1WV1A 2GPNA 1U99A 4LJ9A 4Q3BA 1L5OA 4QDXA 3NWOA 5C4IA 1P61B 4GWGA 3G2KA 3OF3A 1SQ5A 4W8HA 4N47A 1SBNE 2DPXA 3EY4A 4UD6A 3EGOA 5EJ7A 1U9IC 2RCYA 2RHGB 2B4RO 2RH9B 1WXWA 5D3ZA 4HGZA 5BYBA 5KJ6A 4YY3B 1G8FA 1RJ9A 1BH2A 3FTEA 3DCYA 1OAOC 2XVZA 5ES3A 1L1EA 1KMIY 2DPGA 2DFPA 2WD7B 3VDNB 4A0HA 1EX9A 2BHSA 5K3FB 2QAIA 2ZT6A 3D0OA 3I83A 3DZDA 2NUBA 2HA7A 3E7XA 1JTEA 4TLAA 3ZHCA 1HTTA 3BEDA 1T36B 3E18A 2JFOA 2HRDA 2O07A 2VTBA 2PUFA 5DWVA 4I1OA 3VZRA 3IAS1 5EQTA 4OHXA 3UOWA 4D43A 1YDGA 3EIQA 3MOSA 4QBTA 2C00A 4POOA 4EG0A 3KZNA 5I45A 1KKUA 3UC9A 1MQ8B 5ADWA 1PD1A 5AQ1A 2GPSA 4KGVA 1QC5B 3IBGA 3A9WA 5JS8A 3DQZA 3L0SA 3AR4A 1HTWA 3CR8A 1GZ3A 5DX1A 3ZZUA 4PAWA 1YK1A 1I6LA 1OI7A 4ZVNA 2B99A 2O7NA 3ZHUA 5AWFC 1WKCA 2R00A 2DX7A 3EEIA 5FA5A 5IBRA 4Q7QA 4B35A 5MFZA 1D5WA 3D0KA 3O3MB 3D7LA 4XEHA 4M4SA 1RWBA 2C9BA 3TE7A 4LXXA 2RBEA 3PC8A 3C1UA 5A6SB 2O54A 1R66A 2C03A 4V0NA 5IVKA 3IUQA 2ZVPX 3DTYA 3C3YA 5FA6A 3V2IA 4BKUA 1IEVA 1UWVA 1THTA 2NXNA 5LXTF 5BVHA 4KDRA 2HA4A 1EUCA 4BDSA 1RXVA 2I0FA 1RHUA 1T29A 3EXIA 4EVSA 3CX4A 4CG3A 2F1KA 2VRCD 4A2PA 5EIFA 2IH5A 4QAQA 4B4UA 3M34A 3G2PA 1I5OA 1T2UA 3AHGA 1Z6AA 2I3AA 1W29A 4HHEA 5AHRA 1YQTA 1RBQA 2O50A 4YRNA 5HRCA 3FOZA 4EB6A 3R9XB 1HDGO 1DC3A 1WV0A 3CO0S 4IY1A 5KWJA 2BEVA 2R62A 3CQ9A 3Q88A 2BFAA 1PGPA 4PZ0A 1PWHA 1Z5VA 4CM8A 1Z0UA 2ZE5A 3CIFA 4S12A 3SSNA 5C5CA 3P2KA 2R6JA 1IN1A 3ZTYA 4R9RA 3W6OA 2H8KA 3ZI0A 1ZMRA 4G1MB 2C58A 2OVBA 3R5XA 2CHUA 1UWLA 1DO0A 5ALXA 1D6JA 1Z6XA 2ORWA 2WTAA 4M9CA 1H2ZA 1U1EA 4QZVA 4IL5A 5KC9A 5E6RA 1T1GA 1W2HA 5KVQA 4FFMA 1P17A 3GOHA 4MWDA 1YR8A 5FWYB 2ZR8A 5LWQA 3DBRA 4D9NA 1XLWA 1GY8A 4GKKB 3HO6A 1JIKA 2ZRFA 4KO4S 5FTMA 3UJHA 1BCSA 3CNLA 2I29A 4L8LA 5IHPA 1KQFA 1AUPA 1TIKA 1U28A 1NVTA 1TTHA 3QX9A 4A73A 1U63A 3TIVA 1UBFA 3B9BA 5DLQC 2W8BB 2F43A 2X0EA 1XEAA 4OI2A 5K0JA 2NSHA 3MRSA 1VPDA 2QHXA 3A6ZA 3P0IA 4RHYA 1H2XA 3C3XA 2R48A 5DI3A 2KB0A 1KO4A 3HACA 3M6LA 4GI3A 2Z8YM 4HWOA 3ZQJA 4GC9A 3C4QA 3ICPA 4D74A 4M9ZA 4INOA 1NXQA 4QWWA 1YA6A 2PK3A 1W46A 2HO5A 2PRZA 4FVTA 4UHBA 4BEWA 2YWJA 1WXGA 1KYYA 1AQIA 1CP3A 4ZVPA 3MT9A 1TA4A 4DM4A 1QG2A 2PH7A 4YO8A 3QNWA 3TW8B 3KT6A 3F90A 3BS4A 3EQ6A 1ILEA 2W2VA 3NP7A 1OA0A 1KR2A 2DQSA 4E4RA 3LAWA 3WHLA 4U0KA 3JQAB 3LOPA 1FYFA 4FGKA 4ZANA 2O2SA 3IERA 3B1XA 4GSLA 3RFCA 1MJ5A 4QD3A 3V42A 3DFKA 1N2CA 2W00A 1THMA 3K0KA 2F9MA 3K09C 3L7CA 5LZ7A 5TNXA 1TU3A 2XNCA 2P9FA 2Z2JA 1JRLA 3HDQA 2VDPB 1H4SA 1JXQA 2NV6A 1E6UA 1SG0A 1SD2A 1UBNA 4GYYA 4LQLA 3T5CA 4XYLA 2AK2A 1Q21A 4G0YA 1LH0A 2OHJA 1XDSA 4JI8B 2JAQA 3WQHA 5JXWA 4KKVA 3UQYS 1VIMA 3ZXXA 2CZQA 4M9XA 4BJ3A 3U60B 2IA5A 1J42A 2J5XA 4CMEA 3RFTA 5DBOA 2J85A 2ZU0C 3QI2A 4C7KA 4RK7A 3ND6A 4Y2PA 1GPAA 3CNNA 3RYFA 4L3OA 3EIXA 4PFJA 3O8RA 2WUVA 4DIKA 3RBZA 2Z56A 1K8YB 1AS2A 3N2YA 4QYTA 4FWIB 3ZNPA 5HX7A 2VC2B 4MEJA 2TYSB 3SEFA 3PQ2A 4L4SA 3SBXA 4IDHA 4KXYA 1ECGA 5H02A 3P1JA 2OSBA 4BKMA 2ZWIA 2BLLA 5ALSA 4KRGA 5E0KB 1JQBA 1NLMA 3VPBA 4NAUA 3HCOA 3FJOA 3UXYA 1QRAA 1KFCB 1Z5PA 2Y05A 2ZB7A 1TM5E 2PLRA 4OD0A 4YRPA 4PPQA 3BK1A 3QEAZ 3H6HA 4X9XA 2IYOA 2C8KA 4HI0E 4DRXA 5JJ5A 5SZIA 5IH3A 2B35A 2QA5A 4EDHA 1XVAA 2JLYA 1ONOA 5EIHA 4J76A 1FLDA 2ZVQX 2IPMA 3B48A 4WACA 1JWBB 4CGYA 1EX6A 3DO8A 4TVSA 1U0OC 1D2RA 4FR2A 4IXDA 4GVPA 4L0MA 4ND1A 4C14A 5LMUB 1G17A 3T3NA 4DNFA 5JG7A 3A32A 5IASA 4ZVUA 4RHEA 3QBVA 4NX2A 1G3MA 2XIJA 2VDUE 4L74A 3AETA 2P5SA 4UM7A 4WGFA 4E03A 3WG9A 4BEVA 1G41A 3GDOA 4I9FA 1BEUB 1T6XA 1KZ6A 5AM5A 4EJSB 1V71A 4LE1A 3MA0A 2JVKA 4GBMA 2A5GA 3OZAA 4JQOA 1Y1KE 3AU9A 1YB7A 2IYSA 2C98A 3NHAA 3GF4A 1PN3A 1W93A 2EHJA 2VCHA 1ZONA 3EVEA 4J4TA 3UK7A 3GEDA 3Q3EA 4I46A 5LOVA 5EPUA 4EUHA 1NN0A 1S3IA 2E1PA 4UNQA 4FFWA 4J16A 3B6ZA 1D03A 2I2WA 3L8MA 4JJGA 5IBPA 3DZIA 3RAGA 1K5HA 1MO6A 1MTOA 1T6NA 3EXEB 3OIUA 1XFDA 4EY8A 1SKAA 4HEA6 5JI3E 5L4SA 1GEEA 4OHKA 2ECQA 1KY2A 1RE1A 5DWQA 4ZEXA 4UXHA 1WO8A 3TWOA 4DUYB 2P69A 4FOPA 3GLIB 3ZDCA 3IAEA 2CFOA 3LFUA 4AZ3A 3ZLJA 4MVJF 2IIVA 3WIUA 3WLRA 5C2JB 1R8XA 1QIHA 4PSCA 2PGXA 2RGDA 3MK31 5HFAA 3R0IA 2D13A 2IPOA 2ASVA 3ADKA 3BK7A 3L3BA 4QYWA 5FWNA 1T91A 1E9DA 2J3IA 2L69A 3MFYA 4JJAA 4X6YA 2IHVA 2REQA 1HM5A 4KUGA 4RD4A 2CN1A 1CE8B 4NP6A 3GDFA 1GQFA 1BHJA 1BA2A 3BHNA 3KWMA 5EZYA 4HXGA 4P0TA 4DIFA 1YCGA 3WQSB 5L6MB 4FMBB 4QDOA 5JANA 1U94A 2IW3A 3LFHA 4MW7A 1SKMA 1MH1A 9MHTA 4KQHA 3NKFA 3BIOA 3DZ8A 1Z6YA 4BAUA 1PJSA 1DBVO 2V0CA 2G67A 3SC4A 1PEAA 3U3MA 1GSOA 2AFIE 1LEHA 2OFOA 3BH7A 1HFKA 1B15A 2VXYA 2Y1WA 5ILOA 2FRXA 4G4IA 2H2WA 1PQPA 4FZ3A 4QECA 3AL0C 1I9CA 1NY6A 3FGZA 2R0QC 5KHLB 2OD7A 3ZR4B 1F8YA 3VSAA 2J32A 4QBHA 3QE0A 2GD1O 5DRTA 3ETEA 4BP8A 4IF6A 3ZS9A 4C5CA 4TV8A 3HA5A 3IODA 5LU8A 1VPWA 1M1UA 1RZRA 1DBSA 4ZMRA 3DFIA 1A8PA 3VH2A 1BMDA 3GFBA 3U17A 1IOLA 1XTTA 4LSWA 3OQ6A 3ZGYA 5G4LA 3F8TA 3OZUA 5T64A 4D8WA 3EJ6A 4C5AA 4NMXB 5JS6A 4OHCA 1YS6A 1SXQA 2WRZA 5AUNB 3ANSA 4LTMA 4MUMA 1KSGA 4MRSA 4K0KB 2JFGA 4LY6A 4AY3A 2A0XA 2WVJA 3CA8A 4RKFA 4MWSA 4L5YA 3CU5A 5L7TA 2VDWB 3F1LA 2H5LA 3A3PA 5HJEA 4IAOA 2AXQA 1Y1TA 1ENOA 3A6DA 1GQOA 1IM5A 3VOTA 1J09A 1W34A 4NE2A 3PQFA 4X7PA 1E3SA 5KTMA 2GHQA 1UT8A 2QV7A 1QR6A 3T7KA 3VR1A 1JQLB 4E5NA 2JD0A 5L9AA 4DREA 4C08A 1FYEA 4OV6B 2JI7A 3DOOA 1P2VA 4IIEA 5AYVA 2WUEA 1SOWA 5KYVA 2RHDA 5DXFA 4TV9A 3P9CA 4AG5A 4DV5B 3MXOA 2B1IA 4W82A 2CB9A 1IJKA 1N0WA 2D0IA 3TTTA 2QAGC 2WT8A 3PJGA 1FYDA 2BMDA 2VJDA 1ISSA 3VISA 2BM9A 4ECAA 4GLFA 3BIXA 2NZ2A 4R83A 2K2QB 4RPCA 1PWZA 4MAFA 5EFZA 4KLRA 2QUZA 3PFGA 4ZYUA 2QVCA 4OHRA 5U9CA 4C4ZA 3BXEA 3H2BA 2VQFB 2VQEB 4FINA 5E4YA 3RCBA 3LPAA 3K1TA 3E1SA 1PJ8A 1VCNA 2ABWA 3S2YA 1VI2A 3THSA 1JHAA 4ER6A 1ORIA 1T4GA 1TF2A 2ZRJA 3JASB 3KYDB 1H4QA 1P9WA 2BKUA 1THZA 4H3HB 4DDHA 2C95A 3FMFA 3AHHA 1GDTA 3EOZA 3SY8A 2I5PO 5F33A 3T9BA 3NC1C 3KDSE 1F14A 3IAM6 3D3EA 1COZA 2OTCA 2ZIUB 3EPPA 1W44A 3OOEA 1E1DA 2BGIA 5AM1A 3FWNA 1NR5A 4M9RA 3S2GA 1W9HA 4AJOA 2V7BA 2VVTA 4UZFA 1CF4A 2XT6A 1YQWA 3OFKA 3PGXA 3FOWA 3BKWA 3N0TA 4G26A 3D4NA 3WSVA 4RIHA 4HRXA 4E5SA 2Y67A 4OM8A 4RZIA 2J0QA 2J5BA 4B09A 2ISQA 3AF4A 4LVCA 4N6GA 3A31A 3F7OA 2XOXA 4WDQA 4B87A 1XU9A 4DPLA 4P4NA 4A6DA 1CCWA 2C2BA 5KJFA 3TRDA 2SNIE 4FB5A 1DWUA 1U31A 3L06A 4J2TA 1RVV1 2GBLC 2VJKA 4IFBA 1XJ0A 1OE0A 1DWPA 1WU8A 2YC2C 2G83A 2ZTUA 3FFTA 4I19A 1G16A 2VPXA 1NVMB 3K16A 4Q66C 5JIBA 4JP5A 4NQRA 3C43A 5EA2A 5TGDA 3VOAA 3DEZA 1Y7LA 2OHXA 4V39A 1IJEA 4AX8A 3L7JA 1W73A 4IZIA 2W43A 4TTAA 4YMIA 5K2OA 1SJ9A 3AI3A 5HDQA 3E22B 4F6LA 3I9JA 3MYYA 3G9XA 1EVQA 3NO4A 4ZGGA 2ZJ8A 1XK6A 3GT4A 3S55A 1MOZA 2Y27A 1BN6A 1QHYA 2PBLA 4P86A 2AJ8A 3WYBA 3U4IA 4MW9A 1ICEA 3IUYA 3UMFA 4H08A 3BL6A 4YONB 2ORIA 1T9GS 3FLEA 5K0SA 1QQAA 1XTQA 3IQZA 4MW6A 1RM3A 4Z8YA 4KX5A 2IWRA 3BWYA 3DBHB 1VGQA 4LWQA 4D1YA 3SSOA 1Q1BA 2NU8B 2PSHA 2Q29A 1R15A 4IILA 2E9SA 3G0HA 1ISGA 1ZHFA 3MCZA 3S81A 1K63A 4E5KA 1ZEMA 3BKXA 1ZKDA 1PSZA 4JU8A 4L08A 3QXGA 2OC4A 2HA3A 2C77A 3OA2A 2FMHA 1RKQA 1WKBA 2AB0A 2XDAA 4TTTS 4M7RA 3LA6A 1E89A 5CNMA 4L0DA 3ZWXA 3TZEA 5B2EA 4XQGA 1CQIA 4MQFA 1NI4B 3R0ZA 4JT8A 3TNFA 2WAOA 4QEZA 1W35A 1WIWA 2XITA 3AP1A 4FJ0A 3OKCA 1NPDA 4KG7A 3U3KA 1FX1A 3ICWA 5CB4B 2BGNA 4URXR 3TX2A 3DMRA 5LD2B 5LUAA 4RFLA 3UAOA 5CITA 3OZ7A 1VBMA 4GNRA 2WFLB 4JJZA 3PEFA 5AR1A 5KBYA 2ATVA 1Z2CA 4F21A 3LC1O 3EB9A 1KBZA 3PWTA 4US0R 4EL5A 1EEHA 1UBLS 1H2AS 3L8CA 3OZXA 4CCYA 4ZQGA 3L6UA 3RTDA 1M1NA 4DV6B 4FHCA 2GEBA 4OHOA 4KFCA 3G9TA 4E1BA 1F5SA 3K1ZA 1MA0A 1S2OA 1SHUX 4KFSA 4XWYA 3I0ZA 4HV4A 2VTKA 3TDNA 3SZUA 3NC4A 3HXMA 2VNSA 3C7CB 2ZK7A 3WJ7A 4NFLA 3DUFB 4BDTA 1GSHA 3FNBA 4D44A 3U4QA 1HEUA 2RGXA 1KJYA 1WPRA 3F7TA 3WGKA 4B48A 1XZNA 3BWVA 3WISA 3BT7A 5G0VA 2ZSJA 3FZYA 3V2UA 2D1YA 1Y7HA 2W2LA 4MWEA 3RSOA 1IAVA 2ODWA 5DNWA 5C37A 2JF0A 1CRZA 2EW2A 1A69A 2HTFA 3G8BA 2J67A 1WDMA 2WFMA 2GEJA 1XCMA 3EOBI 4LCJA 1IHOA 3FUVA 5EE5B 1JMVA 1K6EA 4HX9A 3LOQA 1CS4C 1TM7E 1ZRHA 1O08A 2JLCA 4S0ZA 4GOMD 2C7QA 4KR3A 1HT2E 2C2YA 1SC9A 2WJ4A 4KZKA 4WCFA 4FMDB 1U8FO 1W85A 4N9WA 4UVEA 3LSTA 2KPOA 1YJXA 3F98A 4OLJA 1T8WA 5HM8A 4JVNA 5LLTA 1SBTA 4J7XA 2BEUA 4JDPA 4D6YA 1H3EA 4U02A 4BVHA 3QXXA 3C85A 3OOYA 3D1VA 2WBLC 1OUMA 3DD5A 3KR2A 2H16A 1W25A 4TUYA 1Y1QA 1TUIA 1JFSA 4IZHA 2BGJA 3EWNA 4IJ6A 4LJAA 1MMFB 1W0CA 2I78A 4BO4A 4BWFB 1B93A 2F1IA 3CUUA 3UJ9A 1TCVA 1BHQ1 3EXHC 3PNKA 3ZKAA 4GYKA 4GPEA 5JY6A 5LBUA 3FJ1A 3DV9A 4EVIA 1Q16A 2FHPA 4PAOA 4EUNA 1S4MA 4F9GA 3RHZA 3U4CA 1JFTA 3NEAA 3EUEA 4DBVO 1RR6A 3L43A 5LJLA 2HCRA 4L7QA 2QTAA 1OY1A 2Q46A 3SF0A 2ONZA 5K4GA 2F3RA 4B81A 3MEQA 2C1EA 1IHUA 2YYYA 1Z5NA 3EUFA 3NOXA 3OKFA 4WW0A 5TS2A 4IMJB 1I80A 5CNJA 4MGYR 5ANRB 2BTEA 4Q9JA 3WSTA 4JLOA 4CF5A 4F45A 1SD5A 1YZNA 3NUQA 1A9XA 3GIDA 3T5DA 3DEFA 3WFIA 2MINB 2BR4A 3A6LA 1OILA 5JFOA 1E2BA 4XVHA 1QTNA 3LBYA 3PDWA 3CNQS 4NE7A 5TEVA 5FUQA 3PX7A 3A6EA 2OBFA 1UZMA 2BEWB 1GILA 3O1HB 1PVOA 3ZCVA 5CFRA 2G1UA 1X8JA 3DOEA 3QVOA 2QUAA 5C3UA 4BECA 5LQNA 3AF6A 3IPLA 1GTMA 3I76A 4EM6A 2IOQA 3PJDA 2J0UB 2ZOSA 3PWKA 4PAGA 3R7SA 2VDQB 2GZHA 4P08A 3SYTA 1HR0B 5F98A 3CN7A 1QVRA 1M3SA 4N39A 4B75A 4QWMA 4U7FA 3PICA 1MB0A 3ZVLA 4RAQA 4YRSA 2ALJA 3DPUA 4PLWA 1K75A 3AONB 4Y1RB 1QYIA 3HDHA 1QE3A 3R41A 4RZUA 1K5GA 1RI2A 1FDVA 4XGIA 5IKPA 3LJKA 1FEZA 4Q4AB 4ZU3A 5CEFA 1U3WA 3OEWA 3HM9A 2PUDA 1C1DA 3DEAA 1GXSA 3HU1A 1WPGA 3KQWA 3LUPA 2DWQA 2DHRA 4G8JA 4PLYA 1D1QA 2B9VA 3GAMA 2JS7A 4ER7A 5CEJA 1N78A 1JA1A 2ES4A 4OP2A 3RVPA 4RKRA 2Y4OA 2BLNA 4IUCS 3GLFA 5ECGC 2G04A 4QXAA 5BVHB 3R6WA 1BGXT 3AUXA 1SUSA 4PO8A 1Q1GA 2E49A 3RBVA 2UZ1A 3CUTA 3HP4A 4AD8A 4LFAB 2C59A 4P3YA 4BB0A 1YCFA 2P4SA 3G9ZA 2AN9A 3G7NA 4PZCA 3H5VA 2B98A 3LVRE 4KO8A 1CXZA 4GI1A 3RVLA 4UHKA 1A9PA 1KZGB 3ZE7A 1Y5RA 3CZQA 4YX9A 4X7MA 5HR5A 5AIAA 5KU7A 1DADA 4CMAA 2BEVB 4QBGB 4CM8B 5BPHA 3E7FA 5H1YA 1U5BA 4KOAA 1OV4A 2EZ4A 3O0TA 2CSUA 3PUVA 1NBAA 5KSPA 2RC6A 3RROA 1N2EA 1UFRA 2MR6A 3NT4A 4MWBA 4YRGA 3W9SA 3ZQ4A 1XXHA 4V03A 2PUCA 5H68A 4OQLA 4ADSG 1I33A 2XDQB 1CJCA 3A05A 3IUSA 4MCIA 4IDBA 4PE5B 1A71A 4H35A 1Y8QA 1YFJA 2CF5A 2IXAA 3N87A 1HWYA 3MT8A 2I33A 5L8VA 4DUGD 3O8LA 3D6NB 4BFLA 3VHXB 2QMEA 3DPIA 3OOHA 3VC3A 2FEPA 1OXSC 3BD6A 5AOVA 4TZ0A 2AQKA 1AS3A 4LF9B 1ULHA 3I1JA 3FRIA 1T8TA 3DZKA 1E69A 3PSHA 3C3MA 1AQUA 5HIKA 2AFVA 1ZH0A 4EJSC 2O20A 3N3AC 3TJRA 1X8LA 1DX6A 4BAZA 5GM2A 1POWA 3DMFA 3KHSA 3PLNA 1O96A 3I30X 2CYCA 3KT0A 3R2JA 4MAAA 1R5JA 4Z4QA 4MMYB 3QVTA 3SHWA 3HSKA 3UANA 5IN5A 3LVQE 5DTQA 4S3MA 1FSZA 1K8XB 1JVSA 4CF4A 4FZRA 2BMEA 2AOTA 3SYNA 4FI3F 2ZANA 3EXHB 1GPNA 3CEJA 3ITEA 3RODA 4GM4A 2GUGA 1RAEA 2GN9A 4KGZA 4FJ2A 3CX8A 4RK5A 4AI6A 3GFGA 3R3WA 5AVXA 2FPUA 1DC8A 1NFFA 4G25A 2R8EA 2BCGY 1T2FA 2F3UA 4MYDA 3T4EA 3SQXA 1SZPA 1OI2A 1YIDA 4GKBA 3GT7A 5F7ZA 1J5XA 3V4VB 3KM0A 4HH0A 1DTWA 1OXMA 1QBKC 2DRIA 3ND8A 2IC5A 4I1RA 1TFUA 4Q00A 1FXWF 3W05A 4RD0A 5GTDA 3USCS 2R4UA 2LTAA 4E5VA 4ZIRA 2GLTA 4AY2A 4IIYA 2FSHA 1HO3A 1NKVA 5DTRA 5CAEB 4IO1A 3QMPA 4K8OA 3PGJA 3TSAA 1NLFA 3ZXSA 1IEQA 5T8KC 3VYUB 2ZYSA 1U3TA 2JH9A 4YRIA 4P9NA 4MRMA 2QU7A 3AZQA 4TKZA 1PCXA 3JWIA 4FQ7A 4CTNA 1S7GA 2BKVA 1O03A 3JWPA 3NYRA 4C87A 4RTQA 4JT4A 5I51A 3A2NA 4DNXA 1EZ4A 3BJZA 4HNSA 4NJEB 4IHKA 3AVTA 1Q1QA 2Y9MB 2Z6QA 1NUQA 4MR7B 2ZBUA 1CEXA 3P4YA 4QNMA 2QGZA 4R2KA 4X6LA 3S0JA 3V1KA 3FTDA 1TNDA 4MWZA 2RGRA 5B7QA 1DJMA 4LXGA 1RI4A 1VLLA 4M37A 2IIQA 1HOTA 1LWNA 2ZYHA 1T8PA 2RG1A 4ND6A 3E3AA 3QIVA 3VDRA 5HRUA 4Y2SA 2O8EB 3NOOA 3PRYA 1FSGA 1XQXA 3AW8A 3FVTA 3PGKA 5BOVA 4DGQA 1U3FA 2OUIA 1YBFA 1TO6A 4NICA 3C3BA 3NBMA 4OK6A 3I3OA 1F0PA 2BMJA 2PPLA 5A4FS 3N2IA 3DDCA 3BBLA 3OX4A 1DIOB 4HFJA 4LDPA 4QASA 4FBLA 5CLHA 3I64A 5ER6A 3N07A 3UJPA 3H2KA 1T2EA 3BA6A 2X19A 2DTDA 1NOIA 1BS9A 2RAPA 4QGSA 3RS7A 2WUWE 5IT0A 5KYYA 4CQNA 2IHNA 3NLLA 3JATA 1JW9B 2C96A 4PFQA 3V9AA 2XWJI 2G9NA 1WG8A 2XB9A 3NDIA 4NDNE 5FL3A 1FW6A 3M81A 4E7OA 4A8JB 1EFPB 2KMLA 1X2BA 3EFEA 3IAS6 4RORA 4WZ6A 5FI0B 1TKRA 4J90A 1AKTA 4I2VA 4OHMA 3RFFA 1YB1A 4JIMA 4OP3A 3W3AH 2OBBA 1EFVB 4GRDA 3PVCA 3MAGA 1N6PA 3GCDA 4IGAA 4TSKA 1XOIA 2DLDA 2FPMA 3L04A 4FEGA 5EKXA 5EZQA 1JJFA 1WZ2A 5IM5A 4LFBB 3KELA 1Q15A 3RTAA 2W4IA 5DGDA 5FB3A 4ZKDA 5KB3A 1YV9A 3GR6A 2JW5A 4TKUA 4KNVA 3MGBA 5ER9A 2PCLA 4KQKA 5A05A 2XNJA 4H60A 3PDUA 3WXBA 3EE6A 4PYJA 2W6OA 3PQ7A 3KEFA 2XCRB 4ZI7A 2FOXA 2R7LA 5K3CA 2WHPA 4JCOA 3F4KA 3H11A 1DO8A 3UUGA 2ONCA 3AB8A 3K5PA 2HPZA 1MO4A 3DZBA 1UOEA 4YP7A 3QVXA 5J5VA 2HPAA 3CF4A 1Z6TA 2PS3A 2Z3ZA 3IIKA 3LX5A 4KFUA 4ZVRA 3ROQA 3TOCA 4B85A 1H9CA 3IAFA 3IPRA 2V7QA 1WQ3A 3HCNA 2FW6A 3LUBA 4LMBA 3A04A 2PH5A 4RCVA 2OZLB 1M8FA 1UKAA 2BONA 1X1SA 1W96A 4Q16A 5BO5A 4DIBA 1YJCA 3AB3A 2AEEA 3I1YA 3USZA 3T0GA 3WGQA 1CVRA 3ZIAA 1MQ9A 1V6AA 1OXUA 2C7BA 3UT5B 3DE7X 2GBLA 1OCEA 1M6VB 1VJ5A 1CJSA 2XPCA 3JQDA 2A0WA 4YXFA 5BNTA 4MKIA 5JD6A 1WRBA 5BN5A 4ACAA 3FB1A 4UBLA 1POXA 4NPHA 1QCCA 1QS0B 2IHBA 3E0XA 4OKIA 3E8SA 2C57A 2V65A 2WICA 4U7PB 2MSLA 1K4KA 3QE3A 5IJ9A 2OAGA 4QUDA 4DNPA 3CMMA 5JRDS 3IQXA 1E1QD 4B6GA 4DA9A 1DXYA 2CFCA 2DWUA 4WN3A 5H16A 2AF4C 3H9EO 5EE9A 2OWDA 2NU6A 3WWPA 4J8PA 1RAAA 1M2EA 4O29A 4F9TA 4IX1A 1GDDA 3QVUA 1AXRA 1XBTA 3M33A 1NG9A 3HFJA 2O8CB 1B0PA 3DXFA 5K99A 3K5HA 2FZGA 3DB1A 1UMBA 2BKLA 4XYBA 3GDWA 3AEYA 4I50B 4WXEA 1RRVA 1C2YA 2P35A 2J3JA 2MT9A 1NG1A 4P33A 2D2XA 4TMXA 1L5KA 3I09A 4NAVA 3PA6A 1U2DC 2HIHA 4ATNA 3HU3A 4CKWB 7MDHA 3TOXA 1JPJA 2Q6LA 2DUUA 4ZO8A 4HEQA 1NN5A 4N54A 4AKGA 2PMCA 2Q9AA 5DLDA 2JDID 1U7TA 2Q5EA 5ALRA 3I9OA 6ADHA 2ACEA 1C8BA 1QYRA 1OKKD 1DQSA 2JCXA 3LM8A 4NRDA 1T2VA 2VF5X 4YN3A 1JGTA 1U0FA 4P3PA 4ERNA 2COUA 1Z25A 2ZTMA 3AQIA 3FAKA 2ANCA 5KTRA 1L4BA 1RJ9B 1TKAA 1OBVA 5JMTA 4L7VA 3F3KA 2R1TB 1T4CA 4CKBB 4RABA 2XMQA 2KE5A 2DR2A 4O4JA 1ISRA 5K8IA 4OOEA 3I28A 1M1YB 3LC7O 3AR6A 1K3TA 5FOVA 3ZWAA 5JDIC 1R0WA 4UNPA 1FFSA 1ECCA 1T8RA 3M8KA 1SRRA 1WDKA 1RQ2A 1T36A 1YKFA 2PTHA 4OA5A 5ALEA 3T7RA 3TSCA 3UTCA 2DFKB 2ZE6A 2ZI9A 2V7EA 3TLYA 4IYRA 1R3DA 4R7ZA 4CM6A 2VUTA 5MFPA 4KIJA 1LU9A 2A1TS 1A96A 5BSGA 1VG1A 1DIHA 1Z16A 1Z45A 2GYYA 1QP7A 2FW8A 2Y71A 2EQBA 1V41E 3WGHA 2A9PA 4NDAA 3VRHA 3VJMA 5KOYA 1SA0B 4PRYA 2XUFA 4G0XA 5LYJA 3MS4A 4LHVA 4AKIA 1J20A 3V4LA 2P1RA 3CHYA 1MFZA 3GAAA 3LW7A 4H59A 3G79A 5FR2A 2N75A 3QV2A 4CJXA 4M76B 1JWAB 4K5QA 3VNSA 4B9EA 1KZYC 1S2NA 4E13A 3LT0A 5MN6A 4GXQA 1K3UB 1V1RB 2HJWA 3EF1A 1JV2B 5TGZA 3O8NA 1QFXA 4LZLA 4C6TB 2OKGA 4F5DA 2F4NA 3ICCA 4DMLA 1QYXA 2XLBA 4XX0A 3M0EA 4AL4A 2QRMA 5H80A 2MSDB 1A9QA 2IDKA 4NBKA 4FHDA 1LSOA 3OFJA 3MTQA 4HQRA 1DAPA 4JBIA 2WLSA 3ZJTA 5C81A 4ZOLB 2CKDA 3V48A 2DG2A 5J2UB 5EJ5A 4JC4A 1RHQA 2HLDA 4EG3A 2J08A 1EG7A 4HLDA 1KZ1A 1RKUA 1E3JA 2EGHA 3MTGA 2I34A 1XTZA 3SF8B 1E9RA 1YJ5A 2BDUA 2ZI3A 3P97A 3E9ZA 1WVMA 4RJIA 4C0QC 3TFOA 3ZLVA 4RTLA 2H0AA 5LQRA 4NL4H 3QFSA 2VPZA 3P4XA 3QPBA 4GI5A 3HA7A 5ULLA 5JMWA 2LDBA 2Y76A 3JQFC 4NZNA 4OUKX 4DQ0A 5BT8A 5K8VA 3MHPA 5HUJA 2P65A 4LAFA 4H16A 2R6GA 4MJ7A 3M5DA 4DRZA 2CXPA 4O4LB 1BCSB 2PKQP 1AN9A 3CRQA 3EDRA 3PX2A 5U4XA 4DARA 3CE9A 1BWSA 1FXUA 1VKJA 5CM2Z 2O59A 4PRLA 4MV9A 4YMWA 5HIJA 3TNDA 3UBTA 5AI9A 1BFKA 1PW7A 5E6SB 1R9MA 4BVKA 4YBZA 3DNMA 4JVMA 3ZE2B 5DI3B 5IWCA 4R2JA 4G1VA 1T5LA 1MCZA 1UPTA 3AKEA 5T6MA 4LDNA 4G5HA 4YJ2F 4GOND 4D7AA 4R5HA 2QT0A 1FPMA 3A0UA 4FP9A 4TL7A 4WTOA 2X1VA 1JHZA 2EFGA 3H17A 3SE7A 2GN2A 2AHOA 2PEYA 2QYTA 3HG7A 3KX2A 2FYTA 3O92A 4US1R 5CU7A 1MA3A 2NOAA 3INGA 3ETDA 1M8KA 4IOLA 1GN8A 4MI3A 1RJGA 5CX1A 2ZTHA 5C0OE 1ODTC 3NS7A 1H23A 5IAJA 2VWGA 3NYQA 1Z2EA 4IRUB 4B3CA 3PHCA 3EC2A 3DSRA 5HF8A 1J97A 3WJ1A 2L19A 3P8ZA 4XFDA 4Q3AA 3VNVA 3EBOA 3ZBQA 3OM0A 4KQWA 2FFQA 4ZA2A 4RA6B 4DJEC 2Z2IA 4E3WA 1SGWA 4ASUD 4M6WB 3L46A 1BRTA 3UHPA 2FSGA 1GTRA 1R0YA 4O3FA 1DRKA 1E1CB 3E9MA 2HBQA 2BH2A 2FSIA 3LLMA 3CVVA 1V11A 2LCQA 4AICA 5DE3A 1KL7A 4QJ4A 2WINI 1I5EA 1JBQA 1E3EA 1LBIA 4I3FA 5FTJA 4NESA 4X1YA 3KZMA 4JLKA 3UAXA 2UXBB 3KPVA 3QLTA 1G19A 2AIRA 1EG2A 4JD5A 3ASZA 4Y0AA 2C7VA 3AGPA 4WX2B 4OI1A 2PG3A 5DPMA 4FB4A 3H8WA 4RK6A 3DUFA 2P2NA 1TK3A 4EPYA 3WRWA 2YKGA 1JQKA 1KQPA 4HYYA 4QTYA 4ZICA 5J2TB 3PKIA 1QLJA 5THKA 3UMRA 2PQ2A 3OA0A 3QOXA 4EHBA 5LM3A 4RVOA 2B4TO 2OY0A 3C8DA 1CKEA 2EP8A 2FN4A 3GQBA 3P26A 3TIGA 2Q1UA 3CF2A 4ZPXA 1U0LA 4MP8A 4AROA 1KI2A 3ULKA 1H69A 1BQ3A 4NOJA 3FZQA 3HLKA 1EM8A 3UV7A 5ELLA 4YMGA 1T1EA 1PFYA 1LDBA 2XMRA 1UOOA 2VL7A 2YYAA 2NAFA 3OIYA 2CXHA