4QARA

1.45 a resolution structure of ct263 (mtan) from chlamydia trachomatis bound to adenine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
b'MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVLKTWGYRGVVQALSPPPSGYDLWINAGFAGAANPNIPLLKTYTITSVKELTPTTSVEEELEVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYTTREGQDFLKNNKVKLSQKLAEAIFPIYSSFID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CT263
publication title Structural and Biochemical Characterization of Chlamydia trachomatis Hypothetical Protein CT263 Supports That Menaquinone Synthesis Occurs through the Futalosine Pathway.
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Hydrolase
total genus 55
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qarA00
1OUMA 1PR5A 2B94A 4WKOA 4K6OA 3OOEA 2HSWA 3DJFA 1Z5PA 1VMKA 4GLFA 1T8WA 2AI2A 1SJ9A 5CCEA 3KUKA 4H1TA 3NM6B 1PR0A 4TS3A 1ODIA 5CXQA 5EFOA 5FAKA 1RXUA 3LA8A 2QTTA 4MARA 4DA7A 2HRDA 4QASA 1T8YA 1CG6A 1ULBA 2RJ3A 1A9TA 4D9HA 2HN9A 2OC4A 4YJKA 1JPVA 1OTXA 4GMHA 4WKBA 1SQ6A 1U1CA 3BL6A 1A9QA 1NW4A 5I3CA 3T94A 1JDVA 1JDTA 1T8SA 2GUWA 1RCTE 3FUCA 4M3NA 4DA8A 2OECA 1ZOSA 4OF4A 4L5CA 4FFSA 4BMZA 4TTAA 4TS9A 3GGSA 5F7ZA 4LDNA 1Z5NA 4JWTA 4QATA 4DA6A 4L0MA 4OY3A 1PWYE 5F7JA 2A0YA 3ODGA 1Z5OA 4WKCA 1Y1QA 3UAWA 2AC7A 4E1VA 2A8YA 1U1DA 4OEHA 3F8WA 5CCDA 2QPLA 5DK6A 1U1GA 3PHCA 1C3XA 3E9ZA 3K8OE 3FB1A 1V2HE 1A9RA 1JDSA 1LX7A 1TCVA 4DAEA 1OV6A 4QARA 4F3CA 1PF7E 1CB0A 5EUBA 4YMLA 1A9SA 1U1FA 3ENZA 3UAZA 1JDUA 1RYZA 3E0QA 1A9PA 2QSUA 1Z36A 4GKAA 3OZEA 3BJEA 4OJTA 3ONVA 5F77A 1OU4A 4D8XA 4DA0A 3EEIA 1V45E 4P54A 4NY1A 2AI1A 4JOSA 4DABA 3O4VA 3NBQA 1OVGA 1LVUA 1Y6QA 1PW7A 3IEXA 4TXJA 4WKNA 4F3KA 1Z39A 1VHWA 3MB8A 1RT9A 2ON6A 4DANA 4R31A 2P4SA 1Z35A 1PK7A 1ECPA 4LKRA 1RXCA 1K3FA 1Y1SA 4YNBA 3U40A 1NC3A 4IP0A 1V4NA 3LBAA 3DP9A 4EARA 2QTGA 1A9OA 4TXLA 1Y1RA 1NC1A 1VHJA 1V41E 4DARA 3QPBA 1YQUA 5F7OA 1JP7A 4MCIA 3LGSA 3FOWA 1M73E 1N3IA 1ODKA 4QFBA 2Q7OE 4WKPA 4LNHA 4NSNA 1LV8A 1Z38A 3PNSA 4LNAA 3UAYA 4R2WA 5F78A 1RXSA 2A0WA 2AI3A 1Z33A 3PNPA 4L5AA 4RJ2A 4ECEA 1T0UA 3DPSA 3BGSA 2OXFA 4G8JA 1ULAA 1Y6RA 2I4TA 4BMXA 3KU4A 2ISCA 4TXHA 4NS1A 1B8OA 4KN5A 4X24A 5IFKA 5CYFA 5EPUA 1K27A 1JE0A 5B7NA 1RR6A 3PHBE 4TYMA 4UC0A 2IQ5A 2HWUA 4JP5A 1PBNA 3FWPA 1OTYA 4PNPA 5K1ZA 5C80A 4OGKA 1Y1TA 3BSFA 1K9SA 3OZCA 4OGLA 3OPVA 1YRYE 4D8YA 1PR6A 1ODJA 3EUFA 3KHSA 4EB8A 1RSZA 1Q1GA 4QEZA 1XE3A 3DDOA 3INYA 5ETJA 1PR4A 4U2KA 3UAXA 2H8GA 1YR3A 1JDZA 4LZWA 1YQQA 3OOHA 4PR3A 1SD1A 1PR2A 1PK9A 1FXUA 2I8AA 4R2XA 3UT6A 3FAZA 4F2PA 3SCZA 4L5YA 2A0XA 5B7GA 1WTAA 3OCCA 5CXSA 3KVRA 3P0FA 1JE1A 2XRFA 3OZBA 4TTJA 4TXMA 1B8NA 4M7WA 3KVVA 1VFNA 2BSXA 1JYSA 1Z34A 3E9RA 3C74A 5IU6A 5B7QA 3K8QA 3NM4A 1TCUA 3KVYA 3D1VA 4L6IA 3UAVA 1RFGE 1ZL2A 1T8RA 4G41A 1U1EA 5B7PA 4D8VA 1YBFA 1A69A 4TXNA 3IOMA 5F7XA 2PGAA 4I2VA 2OC9A 4F2WA 1G2OA 5CYGA 3GB9A 4F1WA 3EUEA 4QAQA 3NM5A 1PR1A 1V3QE 3O6VA 1RXYA 4GLJA 4TTIA 1TGYA 1SD2A 5KB3A 3FNQA 1QE5A 1TGVA 1TD1A 1PKEA 5F73A 1V48A 1ODLA 5F76A 4D98A 4G89A 3EMVA 3DF9A 3OZDA 3P0EA 4BN0A 4M1EA 2QDKA 4YO8A 4BMYA 3TL6A 3OF3A 3MMSA 4DAOA 1I80A 5JPCA 1Z37A 4MCHA
chains in the Genus database with same CATH superfamily
5JAPA 1RTKA 4IHJA 3DTTA 4NFYA 4YQYA 5A7HA 2OO5C 4OIFA 3SGLA 3PX3A 1LVHA 3STWA 3ZWQA 5DBFA 3RARA 1QGUA 2JI8A 2QOEA 3WI7A 2AJDA 5AQEA 3W5CA 3U3DA 4UNPA 5A6SB 3BXXA 1CUFA 2QK4A 3ZHCA 5B1EA 1J2TA 2VJQA 2AI2A 2GARA 4P5DA 3C1AA 2WM3A 1CWUA 4HXGA 1EM8A 4NC9A 4AXXA 3NC4A 2PLRA 3ZHXA 4CDMA 3MF4A 3LKZA 1LDMA 1MZVA 2W6OA 4IZIA 3TE6A 3WLMA 5D01A 3X44A 1MJHA 1X1QA 1O54A 1W9MA 2I1VB 3E1KA 4H3KB 3MT0A 4P93A 1RU3A 4V02A 5JNVA 3ZZ0A 4YJ2A 1AM4D 1U90A 3EW7A 3GEDA 1KK0A 3E61A 2GPWA 3K94A 3OTWA 3QM1A 4U4AA 3SEQA 1CNEA 4Q7JB 4J75A 2L69A 4Q3NA 1R4MB 3UMSA 4RNDB 5A1JA 2BEVA 2Q7DA 3F6YA 4LY0A 4CV3A 1HDZA 4GBJA 1HBJA 4KE8A 1JU9A 4N1AA 1KZHA 2UUPA 4M4SA 4Z7NB 5IJ0A 2HN9A 3AFOA 5F1PA 5EJGA 5K0LA 1ZISA 4P31A 1F7UA 3N6VA 5J47A 2CL0X 1YF3A 3B1ZA 3BEDA 1QOZA 4LYDA 1BMFD 3SHOA 3KT0A 4MUIA 3D2LA 4DLPA 3AW8A 1E3SA 4LCEA 3W1VA 1TW2A 3SC6A 1KFEB 3UBMA 2RH5A 2D4AA 3LBNA 5C4GB 1CRZA 3PJGA 1A7UA 1KMNA 1NQ5A 4D96A 3G8BA 3RBVA 3MFYA 2DYKA 4UUOA 4XX0A 4Y9DA 3HDTA 2XODA 4NZZA 2BFDB 5E7QA 2EZ4A 3IUJA 1Q57A 5EWMA 2FPUA 1QGYA 3JQFC 4ZA2A 4C2UA 2QZJA 2PUHA 1TJNA 4QG3A 3VBCA 1OKKA 2FJ0A 3RHTA 3H9GA 1Z6QA 2A5LA 3E5HA 2OMEA 5H9VA 3OOWA 3VC7A 1U8FO 1ZNYA 4M9XA 4PZYA 2YJ3A 5TE9A 3RJ5A 2W4QA 1RQ2A 4WNYA 3FDXA 3F3YA 1L7DA 1YI8A 3DPUA 2WVAA 3D8HA 2HREA 1Y33E 3AXTA 1XDUA 4UU8A 1Z22A 5IBQA 5SYNA 2PKYX 5CNJA 2V98A 3WL3A 5G3YA 3I04M 4XM2A 4NFSA 4W5HA 3FCXA 5GP1A 4EJFA 4J90A 4OG2A 5H82A 1TZ2A 3NYRA 5JS1A 4W82A 3WQQA 5F64A 3ORHA 4DM3A 3SC3A 3WMFA 5DNYB 4N48A 4YJFA 3Q40A 3V4ZA 1JLLB 4TLDA 4WUTA 1WCIA 1QK4A 4KE7A 4UU1A 5SZKB 4AZSA 4CCYA 2N42A 5CB6A 2O8CA 3AVPA 3I2FA 2Y92A 3CO5A 1OX4B 4BFSA 4CEJB 1E3WA 1R9NA 3H4TA 5KPJA 5F7JA 2QUZA 1UXIA 3QENA 1L1RA 1USGA 2LRHA 5IXJA 4UVHA 1M1YA 1BCSA 3G9QA 3OHPA 3QYPA 1WLSA 1I33A 4FOPA 4KEAA 1ZD3A 5DCUA 5E6RA 3BMQA 4AJHA 2ZSUA 3N86A 4AULA 5F4ZA 4A6DA 5LIPA 4J1NA 1W4RA 4F4JA 4NATA 2R6AA 2HD4A 3LM8A 3S70A 4YRIA 2GI4A 1Z15A 1J0CA 2FFQA 2MIIA 3PTLA 3GHHA 1UZLA 5EKDA 4BE7B 3TBFA 1A5BB 4MV3A 4KQ6A 1IOLA 1VBFA 4QFMA 4G5XA 4Z5XA 2VO1A 2ZLBA 2AGVA 3GI1A 3HL4A 4A0RA 1V9CA 4MICA 5HE8A 2GF0A 2A9VA 4P4SA 1UT5A 4LJRA 4REQA 5FTWA 1WSWA 5J1TB 3ZWAA 1OB2A 3B1XA 1QU3A 5JAZA 1MU0A 3HMKA 4QUIA 5LDDC 2ZXUA 4BLUA 4QNNA 4F9GA 3UW1A 4DLKA 3I2IA 4N76A 3IPLA 4M0MA 3MC1A 3PXUA 4J94A 4U7FA 1G20E 3PP8A 1O0CA 2DBVO 3B1FA 3KR9A 4YV1A 3OIFA 5L45A 2QQ0A 3HJUA 3EZ9A 2B2NA 3QBDA 2KLBA 4R1SA 1LTQA 1KQGA 1OSNA 3ILYA 2CVQA 5IWAB 3SJCA 5K2MA 2AFHB 1FW8A 1BOOA 2VVTA 3PWKA 3KFXA 3C1OA 4M1MA 1XAIA 3TECE 3A04A 4FFRA 4B6OA 3WWPA 5DTMA 3ZWPA 3DV0B 2FMHA 2GJ8A 1XMXA 5TF0A 2W42A 3ZD7A 1LK5A 3WLKX 5HM6A 1IQUA 2H1OA 4FT4A 2X23A 4JSRA 2QBYB 2HIHA 3VO1A 2GKSA 1V7PC 1HK7A 3EAQA 1HFJA 4GOLD 4HMPA 4LMAA 4X7PA 5TC4A 4C0XA 4CIWA 2P9GA 2Q3MA 5EZ6B 5KU7A 1AJEA 3ABIA 2HKIA 4GFDA 4XCQA 3IHKA 4TV8B 2QKYA 4M0UA 3ZBUA 4LBVA 2CD7A 1U2SA 2OAEA 2PSJA 2X42A 4XB2A 2IH5A 4G84A 4ARIA 1W25A 2Q9UA 3D6UA 3B78A 3S7ZA 1THMA 3LP6A 4TPKA 3TD9A 3U4HA 2DBYA 1PSZA 1RIIA 3L7DA 4HBZA 4LZZA 3UKOA 4EABA 1QIKA 5KSZA 2R79A 4Q3EA 1E1DA 3MYRA 2AR7A 4MULA 2NSDA 2GM9A 4AMVA 4B3GA 1NQXA 1TZBA 3L6UA 1CF9A 2RDMA 3EEFA 3OC0A 2LKDA 5E1OA 2JANA 3MQ2A 3GWGA 3LGAA 4FWIB 2P77A 2CK3A 1Z0ZA 3ZE8A 1ACLA 3NCTA 4HGPA 4LXQA 1NVGA 3MB8A 1CQIB 4R6WA 3PFGA 4A7PA 5A03A 1AQ6A 1FQJA 1RT9A 3KJQA 3TSYA 2QT1A 5FTJA 3QH4A 3AKDA 3TUIC 2WF9A 2ZU6A 3E9CA 1XZDA 2JFYA 1T5DX 3GLKA 4G65A 2G9NA 1S96A 4M54A 1PK7A 2WJHA 3JQ8B 4DOMA 2TS1A 5IKPA 2R6DA 1JXMA 2JH9A 2XCIA 1P0PA 3EARA 3ESDA 1EAYA 4IP0A 2QLNA 3D3QA 1N6RA 1CZLA 1EFLA 5IJ9A 2H85A 2OOSA 4G5GA 3L8EA 2PT6A 2LBPA 1RLOA 2WHXA 2XF8A 3M8KA 4TXLA 5D1HA 1NLUA 3DFUA 2XOKA 4E2YA 1QIMA 1I7SB 5JCJA 3WK8A 4YN3A 4YV2A 2B0JA 3ORFA 3ESZA 1S4QA 1CW2B 2BFCB 4H1UA 4QSHA 1H2RS 2RJOA 5DXFA 5H4HA 3KK0A 1KH3A 1ZCAA 2IA5A 3R41A 4G4GA 4UVIA 4BUJA 1DWOA 1N33B 4G0XA 2V7EA 2X9VA 4TUYA 3IDSA 1PT9A 4L73A 2UZ4A 5C31A 3LGSA 5KWEA 1E0JA 3TFWA 2VOJA 3AJDA 4B7CA 3RHZA 1E8MA 2P6NA 2WU0A 4Q02A 3EGXA 5FL7A 3ZD9A 4OB7A 4Y2QA 3WLJA 3ZE9A 5CFQA 1D2GA 3W5HA 5GZ1A 2WA2A 3Q7PA 4AWXA 2Y8EA 4NCHA 2VK2A 2GR9A 1R6VA 5F2EA 4RULA 1X1CA 3GUHA 5JCZA 1QHIA 3LCRA 3ILHA 3Q6IA 4HSGA 1Z6PA 1DOHA 2DQSA 3EGDA 1K6XA 4D97A 1VPVA 3MIIA 4QG7A 3IA7A 4W1PA 5DSZA 4OP1A 4EG6A 1IULA 1KY4A 2HMSA 4NECA 3GPIA 5ALIA 4IIUA 3AHFA 5FOVA 1RZRA 2HWYA 3AUXA 2BD0A 2REXB 4OFBA 3ZLBA 3CZQA 3RUIA 4HWGA 1T5BA 3HWX1 2FW0A 3GHYA 4Y0VA 3ANMA 1M2FA 3H6GA 3V2HA 1SEVA 2QI9C 2X3UA 1G66A 2Z95A 5LOVF 3COPA 1T1RA 3U56A 3B5JA 5DHQA 3AIMA 4JLWA 3D8RA 2BUAA 2Z2YA 2DP4E 2J3KA 3BFKA 3FD8A 4KU4A 5BWLA 4Z8YA 2QXTA 1EVEA 2OXEA 4YUVA 2ODBA 4DXDA 3PB3A 4MJLA 2EIXA 4MPTA 5JWHA 2FSVC 1S6YA 5BQ5A 5EJ8A 2JIZA 3G02A 1E9RA 2BGMA 5JXGA 3EGOA 2A5GA 1N5KA 3IE1A 4B6RA 3V42A 3CG0A 3IP9A 5CH3A 2R97A 1XTIA 3RUEA 3TQHA 4YLYA 5JNUA 5IFKA 3AI3A 3LO5A 3JYLA 2WB4A 1G8HA 4WXRA 1JR4A 4EO7A 1TPYA 5CYFA 3DM5A 5G0WA 1GXSB 1ML3A 1OLXB 1Q0QA 4EUSA 4Q4HA 2IP4A 4CGYA 1SXPA 2ZBGA 3DXFA 3AF3A 3O9ZA 3OCVA 5T6BA 3V8PA 3Q5GA 2YJ5A 2CBZA 2HL6A 2PZJA 4Z51A 2B34A 2FFBA 3W34A 3K35A 3NNDA 4JP5A 4GM1A 4MB6A 4UU7A 2JJYA 4ITVA 5SY6A 3ME5A 1T2EA 1XTQA 3DTYA 1ZLYA 3Q7RA 4KZKA 5JJCA 5A0VA 1DX4A 1Z06A 2JCBA 3FWPA 2X0EA 1FFEA 3RRXA 1KIFA 5AKJA 4OKSA 1CUUA 2MSLA 2Q1XA 3D59A 4NAVA 4BB9A 5CBPB 1Y1TA 4EFMA 3SP1A 4JASB 4TGLA 3Q9UA 3KSMA 3DVAB 1R37A 3MINA 2P91A 1DX6A 2WTMA 4JWKA 3PPIA 4RMGA 5CIWA 4ZAWA 1JJ7A 3KFVA 4XYMA 4YDSA 5DB4A 4A0HA 4P0QB 3B3GA 4EA7A 1KY2A 5FPQA 5JQGF 4RTSA 3EUFA 2HWKA 1XTSA 3IQXA 3NANA 2F8TA 2CXPA 4HDRA 1AG9A 2R6R1 4HSEA 2C2KA 2DULA 2EKQA 4UHHA 1XE3A 5AJYA 3WB1A 1SCNE 2LIVA 3GELA 3INYA 4KXYA 1XRQA 4ARAA 5KOHB 3GRFA 3K5HA 3VH3A 1FUYB 1YR3A 3OE7D 3VTZA 5THKA 4OHUA 2O6LA 1J2UA 1YFKA 5FPKA 3G5LA 4OQZA 4BFZA 4LA4A 4ZHQB 3SN6A 1ESZA 5DHAA 3TX6A 1QF9A 1ORWA 2D1FA 3LV8A 4L72A 5I7HA 3KXDA 1GZ6A 1Y1LA 4EUNA 1QTIA 2AXPA 4V0KA 2V6JA 5CH8A 2VDOB 3EFEA 5KHOC 4CQJA 3ZDZB 2C0QA 1MIOA 1QMGA 4BFWA 4FYXA 3B1YA 3MS2A 3QWHA 2GN6A 3N2NA 4LPSA 2ZYUX 5LXTB 1IEXA 2P8JA 1K5HA 1LDYA 3HSYA 3MB5A 4X1YA 2XSZA 4IXWA 1J9GA 5E4JA 3VR5A 3L6DA 4MVWA 2C20A 2PM8A 2SICE 5HF6A 2CV2A 1STOA 2FUEA 1M2OB 2JD2A 4N9QA 1XMVA 1XC7A 2XRFA 3BMOB 4NMWA 2YWXA 2WSMA 2O2HA 1ZWKA 4IIJB 3AFGA 4IQFA 2RAFA 3IEMA 2H9AA 2OEPA 2WP0A 3DW1X 3DFFA 2X58A 5C8ZA 1UKEA 1BEUB 2QA5A 1T2AA 1MQSA 4F9EA 1J00A 1II9A 2AOUA 2W2XA 4BFXA 1LLFA 4XPIB 5I7OA 3IDOA 3SHQA 5LA6B 3WK5A 5JDIA 2ZWIA 3SZUA 3C3WA 3O4FA 3DBVO 4ES6A 3IEUA 4PG5A 4R1MA 2W7TA 1GLNA 4XQGA 4Y9UA 4C6SA 4QUAA 5TJHA 1AUPA 1MOSA 4TN5A 3D1VA 4WK2B 5AM5A 1E0SA 4BNUA 4RJTA 1G17A 1DTSA 2FPOA 3I6ZA 1NMEA 2I71A 3EPLA 1UMDB 4WVFA 3ULKA 4ZGWA 4FJ1A 1BXRA 5KAPA 3RAPR 4B4UA 4QOJA 1KJWA 4NAUA 3LRXA 2JBWA 1LPOA 4JMPA 1SU6A 4JR2A 2I33A 1GYPA 2QRGA 1NY5A 4YDRA 4BU0A 1WHSA 3S68A 3L1KA 2CYAA 3U7EB 5DXJA 4EFDA 5AVTA 5HOQA 7REQB 4EL0A 3EGCA 4QOGA 1VSQA 4GLLA 4Q4AB 4CLXA 1QYIA 1NA5A 5ESWA 4XUCA 4YRPA 1ZMTA 5COBA 1T5SA 4MVJG 1T9AA 4OUKX 5IARA 4C4YA 2YL2A 1GN8A 4O29A 4PNZA 3U3RA 3V4LA 3B38A 4UM8B 3B2QA 3HA5A 3JU3A 1B0ZA 4Q7MB 1WBDA 1NJFA 1PW5A 1V3QE 2H2FA 3GT4A 2DTXA 4MW1A 4FHGA 1U98A 4TTIA 5FBZA 4CT5A 4MIKA 1JHZA 2VYVA 4KHZA 4NYIR 3D3WA 4E6EA 3B7GA 1E3LA 1X9GA 3N74A 3OLYA 2LVBA 3O95A 4I36A 4XKJA 5TQ0A 2MR5A 1OROA 4IJ6A 1NW9B 2IZOA 1W4CA 1LTKA 2Q21A 2QVLA 3LC0A 5AW6A 1MTZA 2O2ZA 4JQCA 1F6WA 5GTDA 1IPFA 4XWTA 1KPIA 3V32A 1YBVA 3UANA 4ZV7A 2YWEA 3QI2A 1KAOA 3QEJA 4MR8B 4ZU1X 1FE8A 4BEWA 1R64A 4M87A 1WABA 4JVMA 2DWPA 3L4JA 1AZSC 2CJWB 3CWCA 4ABTA 4JYZA 3IIEA 1VBNA 1D3AA 4ND3A 4UQLA 1WLYA 3D8UA 3LY8A 4H16A 1BU5A 2QYTA 1R6XA 1XF9A 4C01A 5H4GA 1U5BB 1TMOA 1YL5A 3PA6A 4KYTA 5DHFA 2RGRA 3QMPA 2P62A 1ENPA 1TK2A 1W94A 2H5LA 4RVFA 4W1RA 1EFDN 1ZUD1 2B35A 4HNSA 1OMOA 1KXJA 1DOAA 1V8PA 2C84A 2JFZA 4LHXA 1KEKA 5YASA 1U0LA 3NQ41 1NG1A 4V2IA 1EB8A 5AUPB 3FCEA 2IYNA 1EG2A 4L9RA 1ILEA 4KNVA 4A1OA 2PD6A 3IYLW 1FNCA 3LK6A 4K0RA 4C76A 2L17A 3P26A 5LNK1 4C2TA 3CUKA 1XTUA 4TV9F 1I3LA 1Y3AA 3U26A 3WDMA 2EFGA 2RH9B 2NXJA 1UK7A 2F3RA 1X8JA 2ADMA 3ZHUA 4OHYA 3FLBA 3HYCA 4WAUA 4L6CA 2IUUA 2OHHA 1T8WA 5G41A 9LDBA 4EG1A 2QD4A 2ES4A 2IPAB 2YASA 2XYVA 4HEQA 4QOHA 3ID6C 1G2QA 4O1IA 3NVDA 1PR0A 2YXBA 3A06A 1E1CA 4RLHA 3IDQA 1DOZA 1H2BA 2VT6A 1NBOA 4P36A 2GCPA 1B42A 3ZGZA 2IE8A 3NDPA 2DXIA 2UYHA 3OZAA 3OHSX 4R83A 2IH4A 4JVLA 5UKDA 1Q95A 4DSAA 3WC4A 3H2HA 4D9JA 2GBFA 2I4NA 2JK0A 1JHXA 1HT2E 1FLNA 1XMSA 3C4JA 3W2FA 5HR5A 1FMFA 3AERA 3BXFA 4CMJA 4WI1A 1Z5GA 1UIRA 3PNBA 3ZVKA 2F9FA 3JAKA 3SX4A 4AZ3A 5CIQA 4BGUA 2G8LA 2WZCA 1TU4A 3T41A 2Y2VA 3VZQA 3WGVA 1NG9A 1DQSA 4IQ0A 1A9TA 1WW2A 3KG2A 1Q7RA 5EKUA 1KAGA 5TS3A 2AQIA 1WCV1 4B34A 1IZZA 2QYHA 1X9HA 5G53C 4K6KA 1TVKA 2VP0A 3SX2A 1TMYA 1EVZA 2FR8A 3KD3A 2Q5FA 3ZYCA 4ZVUA 4FEEA 1A9QA 3K71B 3II6X 4TQUS 1RC8A 1G2PA 2F3PA 1JJBA 4HUQB 4F5ZA 4B8ZA 4PCAA 5FO0A 1GPAA 3ICWA 4KWIA 3IEPA 2F43A 5J2UB 1N6KA 3CC8A 2GS9A 4BJ6A 5GJVC 1RE1A 2J3IA 3BFPA 1U8YA 3HVIA 1M5TA 4O4HB 3HCPA 2Z43A 2VOEA 5U4QA 2G04A 1G8YA 4DY4A 4KQ9A 4M49A 5ILOA 3OQHA 4WTOA 3RS3A 3LC2O 3MIZA 2ECKA 2XYQA 1PVDA 3C45A 1WOMA 2NUTA 4YAEA 3PGKA 3NVAA 4PPFA 4WLVA 4RMIA 3LE8A 4WXYB 3GFSA 1XAGA 1SB9A 4WNIA 5KNDD 4A03A 1Y8CA 3LMKA 1RQRA 3E70C 2VSOA 5EEGA 3NIGB 5LQCA 1GOTA 4E5SA 4XYLA 3GLQA 1N5MA 2H52A 5K6AC 1NNSA 2BUCA 1E2FA 1E62A 2NN3C 2VXOA 2XUGA 2ZIVB 4LSZA 5DNUA 4B7ZA 3D0QA 2C2OA 1NJGA 2VA9A 1O4WA 3CRW1 1CJMA 2HQ1A 4XIIA 4HVLA 1N3LA 2X2FA 2YS7A 3SQDA 2W2OA 1US8A 1YR6A 5FFNA 2BI7A 4GZ6A 3A4IA 3IURA 4M7PA 4UBMA 1B6TA 2BMVA 1TM5E 1RJ9A 1Z5NA 3E5RA 5LYJB 3C3XA 2EJBA 4EQ6A 2MSEB 2JAQA 5A71A 1WZEA 2BCEA 3HUTA 4HD8A 4KQ2A 1SU7A 3T99A 4AZVA 4OY3A 1IUPA 1C8LA 3CT4A 1B1CA 1Z3IX 2GDJA 2GMWA 2R96A 2QD1A 5E6SA 5ALXA 4Q1BA 4ZOAA 4L7VA 1N92A 4JLMA 4TN1A 3NWEA 1U8AA 2FEMA 3M6IA 4ZAGA 5AVJA 1CZKA 1USUA 2LE0A 3SF8B 1NBAA 2QF7A 2WG2A 5JT1A 2HR1A 1JJIA 4MKZA 3DMGA 3KV3O 2PQ6A 2Y1EA 3CEHA 1X6VA 1KI6B 5C46F 1SXIA 5BQFA 4EUEA 3ZVLA 1E3IA 3QMMA 4OO3A 3R6TA 4QPDA 4Z8XA 4FDVA 2YIMA 3P2EA 1KP3A 1GTMA 2EWMA 4WIAA 1B1AA 1TYAE 5DLYA 4EM6A 2C83A 2CMKA 4M76B 2YIJA 3UOGA 4ZYVA 3K0CA 2ZI5A 5FPPA 3K05A 1O6GA 4RSHA 5CM9C 4EVRA 4E08A 1GUZA 2G4VA 1AGNA 1Q16A 5FWXB 4EFNA 1QK3A 4JC8A 4HF7A 1XHFA 4X85A 2GK4A 1SUEA 3DZHA 5BSHA 5K2OA 3UC5A 2XIJA 5JYCA 5IT4A 2OQIA 4YX9A 3AG6A 3AM4A 3CH6A 2BI8A 3M4ZA 4ZKDA 5I8PA 2IC5A 1Y3BE 2I29A 1UP4A 3MLAA 3S8MA 4ZMBA 2CSUA 3AR2A 3ELUA 2R8RA 2FW6A 5ALRA 2R11A 5AVZA 3TR0A 2ZQYA 1R0ZA 2YW2A 3TAXA 4NG5A 3EWAA 4KO4S 2IF0A 1ZK3A 3AW9A 1DFHA 1H5NA 2WC1A 1BAPA 5EJFA 3SKYA 3WQHA 2H65A 3LXXA 1WXXA 4RAOA 1SCBA 2Z5VA 4RLSA 4RXTA 1E94E 3Q2KA 3OZEA 1C1HA 1CQPA 1M34E 1RJWA 1E3DA 3BMNB 2G4LA 3OKPA 4HN9A 1LNSA 3ONVA 5DV9A 5AJHA 1OU4A 5CMLA 3F47A 3PI7A 2VUSA 2EBUA 2XMDA 3UJ3X 1OI2A 4PHGA 4F91B 2QJRA 3QU9A 3KJZA 4QGHA 2MSCB 4WZBB 3AHIA 3FRJA 3CMMA 4JOBA 2PD3A 2D54A 2P0YA 1H1LB 4ODIA 5AM0A 3TRKA 3BZWA 3QGMA 3FDJA 3ZDAA 4RPGA 1R74A 4NMXB 4P2BA 4YRLA 1QR6A 4DABA 4LNUA 2WF7A 5GV7A 3H5TA 3RQSA 3IOEA 2Z1DA 2OLJA 1N75A 3F6BX 2W6ZA 3NH6A 3RAGA 3I83A 3O92A 3IB3A 4CNBA 4UAJA 4DUGA 4RESA 1IPHA 1VHWA 2MDTA 1CF2O 1Z4IA 2FZGA 1DWPA 3OG9A 2JATA 2GF2A 5ALTA 5F3WB 3U0BA 3KYIB 1YHYA 1XZJA 4G8BA 2B8EA 4IIHA 1XA0A 5B3AA 3JVVA 5FF9A 5IVPA 3H5AA 3PUKA 3WIBA 1UPFA 1EI9A 3OTGA 3PRHA 4LDJA 3RI3A 2XKKA 2CC2A 1EVKA 5AM1A 4IIVA 4F45A 2PWPA 2YUIA 1GZVA 5C5IA 1FPQA 4O59O 5TDHA 2BSQA 1VA5A 1UMCA 1FNBA 3UJ9A 1D6NA 1Z0KA 2BDUA 4W8OA 4EVQA 4JBHA 3GAMA 1D5WA 4QHYA 3QX3A 4MI3A 3D8BA 4HLUC 3EYWA 1CNMA 2GHRA 3QIAA 3PJRA 2I7VA 5JI2E 1JG2A 2IS2A 5KNLA 1JT2A 2HU5A 2AYXA 4F5EA 3CXRA 2VRCA 2O7NA 4JYMA 5HZMA 1T26A 2QTMA 3SX0A 2C97A 4INZA 4G9BA 5BRNA 3T9BA 1ZJWA 1GL3A 4JU9A 4M0FA 2OT3B 1X7YB 2V7WA 3H1GA 2JAWA 1DUIA 2ZOSA 3FOWA 1HG0A 1NL3A 5FNVB 3DL4A 2EF1A 3R7AA 4Z3KA 4JP1A 4YWHA 1GFIA 1FMJA 1YS6A 4DBVO 1RWBA 3QKUA 4LYYA 4TYNA 1N8NA 1HI9A 3PGJA 2HDOA 2BEUA 3OKAA 4OX9B 2YMQA 3KHTA 4LVCA 5HS6A 5FNZA 4ZTZB 3FMGA 4KQKA 5JCOC 5GIOE 1E58A 3CONA 4MRVA 1TT5A 1NZFA 3FMVA 4IUBS 1D9ZA 1KYTA 4JLUA 4YMGA 4AFNA 2WUEA 3VH1A 4DMFA 1CJSA 1BD3A 2AR9A 2XITA 3EWNA 3MCVA 1ACJA 3KEGA 1E96A 3ORRA 4QKQA 1X7XB 4R2WA 4IEEA 1QNLA 1PD0A 1IAVA 4NK5A 4F4UA 4OUDA 1XMIA 2ONYA 2X8JB 3F4LA 3NAZA 4XXHA 5E6UA 2G5PA 2NYAA 3IR7A 2OHGA 1WW3A 1NDHA 2X77A 4IKOA 3SS7X 1N7JA 2QQEA 1EJBA 3GQBA 4KAFA 4N0QA 3DCNA 2P2YA 2H51A 4PPQA 4AN0A 3HU3A 5EIBC 1MRNA 1E98A 5I8ZA 3T7EA 1I4OA 3AF6A 1J90A 4QBTA 5EJEA 1SVNA 4UOQA 1H5QA 2MYUA 3A1VA 5IDQA 2QGFA 1SQFA 1MV5A 3L5OA 1U7UA 4BASA 3I9JA 2ESRA 4TLAA 4WFQA 3HCBA 2XNSA 1KZYC 1IU9A 3DWIA 2Q8PA 2DPMA 2H54A 3ZVRA 2DHCA 4G1VA 1E89A 1B6RA 2CL7X 1YNSA 1L7XA 2G9UA 2I78A 4MR9B 1JBQA 1X1DA 2B69A 4RQBA 3F7NA 1NLFA 1EFKA 2NU7A 3EA0A 4KQHA 1XMQB 3G0HA 1ZCZA 4FZRA 3JQ7B 5DW0A 3ZY6A 1U3UA 5T4FA 5C9ZA 2ZSFA 3DTNA 4BO7A 3FUVA 3K9QO 1HZZC 2VHCA 2AUTA 3FWYA 4OU5A 1F1BA 3FYUA 1MP0A 4FE3A 2CLKB 2RI0A 1FK8A 4O2BF 4CT4B 3C6QA 3JD2A 2HSZA 1RPJA 4ZREA 4RZQA 3NRJA 3LWZA 4ZU3A 3LUBA 4LJAA 1BH2A 5H02A 3GARA 3WX0A 1GO2A 5KKNB 3CY6A 3IT1A 1GVHA 2COEA 2NACA 1PCXA 3L7JA 4MTLA 1JR6A 2J5XA 1T4MA 3JCZA 3ZIAD 4DR2B 2CUZA 1BMTA 4W7SA 4DJTA 4D8YA 1M83A 1UM8A 1E6KA 1C4KA 1D1SA 3QZUA 4UM5A 1I1HA 3KSAC 3RVNA 4CEIB 4DYVA 4N7RA 3HB9A 1Q1GA 4S24A 1JSLA 2FUNB 3DHNA 1N5IA 3A6DA 1W5EA 1EP1B 2FPGA 4YGYA 1PR4A 3O1HB 5AHRA 3JARA 2J9FA 2HZ7A 1JDZA 4KQGA 1Y7IA 2DQZA 4IX9A 1D03A 3QFSA 1OJLA 1X42A 1IK6A 5DOZA 3ESBA 3R23A 1BHO1 3M3HA 4Z0HO 1LBQA 1PJRA 1VYUA 2ATIA 1Y6FA 4MS3A 1JLKA 4IDDA 4JKIA 2VN8A 4GKKB 4FDMA 5AKXA 1IG0A 1JZTA 1JQKA 1PAUA 1PR2A 2CNDA 3L8CA 3C39A 3EOAI 3F8TA 1LEHA 1BD4A 1PSWA 5D87A 3RVLA 3THYB 2W6JA 3LHKA 4N39A 4R2XA 4YCLA 5TIIA 2H31A 3QVTA 3FAZA 4ID9A 4OKNA 1Y3FE 2VJMB 1N0HA 5FPTA 2QLTA 3M1YA 3GLGA 2IDJA 1W49A 2FQ1A 2BZ1A 3ED1A 3QLVC 4HGRA 4RDHA 4ZVLA 3U3OA 3GAAA 1P1RA 3AGPA 3C5HA 4IDNA 1L4MA 4EYOA 4GPBA 2IYWA 3GIDA 5FJIA 3AKCA 2EJUA 2C42A 5AVSA 4X66B 2J0QA 1RI2A 3UMVA 4I3FA 1L6RA 4M6WB 1RVV1 2VHEA 5K0BA 3JQDA 3KALA 2Q5QA 3O21A 2BSXA 4E4YA 3GC6A 4EGCB 2BGLA 2QVGA 5BW4A 5F9FA 4Q9IA 3OJLA 4JVNA 4KO1S 4P3KA 2ZSDA 4RZXA 4B2IA 2VF8A 3DJYA 4LHZA 3IJRA 1JU4A 2H2AA 4QAJA 2X4GA 2ZUSA 3OLQA 1OC2A 2GLTA 2JJ2A 4INAA 3MJRA 4NHEA 3DFKA 2XOEA 4Y2PA 5EYPB 3CX4A 4KQJA 2F1OA 4GDMA 3ENVA 4M1YA 3CGGA 4U7JA 3EXEB 1JAHA 2Q5LA 3OFVA 3UAVA 2J33A 3ND8A 2KE5A 4ZOEA 3FFAA 3ENQA 4PQRA 5JJKA 2CJYA 3MJEA 4D8VA 5IT0A 5E9QA 3RRMA 1A69A 1ECGA 2PAAA 2QAGA 1ETUA 2XQFA 1DZIA 2DHDA 2G67A 2ZB8A 1LS1A 5CG2A 1MNQA 2UYCA 3A25A 3O4GA 1P31A 1XCBA 1K98A 5B1DA 2DX7A 5JG7A 4FFNA 1C0KA 1TQ2A 3BJZA 4KPFC 3SIRA 1I2ZA 2CYCA 2RHOA 2VSXA 3AK4A 3JALB 2ZRFA 3L6CA 1XZFA 1MDBA 3PXBA 4FD2A 5EIWA 4E09A 3EVGA 1A04A 2B4QA 3B48A 4NIMA 4F1WA 2YV4A 4TKVA 2Q1YA 4FE7A 1TVMA 4MDHA 1B8VA 2GEBA 5E7JA 2ZAIA 3WWOA 3HU5A 4QPZA 4GQAA 3B12A 4GVPA 4YRTA 2ZJ2A 3GUYA 4GLJA 5TY0A 5KVSA 3GCZA 3EC2A 3HG7A 1TGYA 1GTL1 1HM5A 2YNMA 2QB5A 1HFEL 1NATA 2ZBQA 2HSDA 2W6CX 2ZCUA 3FTQA 4YJ3F 3FTFA 1L8AA 2WTXA 5CFLA 2WM8A 1UC4B 1TK3A 4MGYR 3BFXA 1OC4A 5EMKA 4ALIA 2ZVPX 5CX1A 3C3BA 3RGGA 5ESRA 4K7JA 1L5FA 3CT6A 3CFYA 4J0JA 3IL2A 5BYBA 1U3TA 3DLCA 3PUWA 4J3FA 3TINA 1P81A 3DF9A 5JJ5A 4P58A 3TBHA 4MQEA 2XF2A 4Z54A 3N6RA 1QIFA 4RVSA 1PJSA 4W5QA 4JROA 1G21A 3AXSA 5F52A 5M5BA 3OF3A 1OREA 3HSKA 5JCXA 2O48X 3M0EA 3K1AA 1A2KC 4DV6B 3DC7A 5AKHA 2EWWA 1VMDA 2E82A 4IX1A 4J7AA 4OQ4A 1BMQA 1M2KA 2WF6A 3IOBA 1K88A 4GE0A 1EZ1A 1M67A 1IQPA 3OQ6A 2EL9A 3WNZA 1OI7A 4GNKA 5SZJA 2BHNA 2VDMB 5HE9A 3F73A 3WHKA 4CKCB 4NFLA 5JC1A 4WZAA 4S0XA 5ECGC 3C6MA 1I3MA 2OHFA 2XJ9A 4KXWA 1KEZA 3GRAA 1V6SA 4IGFA 2RK4A 3BJIC 3DL7A 3WL6A 1G3UA 3AL0C 5AIAA 1X1EA 2JHAA 3VR2D 2CHVA 3GLUA 1NJ5A 6LDHA 3UWOA 4HRXA 1X70A 3WQRA 2DEUA 5JD4A 2Q6LA 3CX8A 3V1TC 1M8KA 3PEUA 3D4LA 4OK6A 4I2NA 2AB0A 4HRYA 3N9IA 3WWDA 2J6CA 1W0CA 4UUAA 3CNEA 1EUQA 1MABB 5HQ3A 4AI6A 5EP2A 3RODA 5C4IA 1JKMA 3LLVA 3RVOA 5DN6A 1L4EA 3N2EA 3NPAA 4MV5A 4N41A 1IXRC 3E7DA 4UD2A 3F3KA 4PGMA 1DQYA 1KO5A 4YPVA 1R0SA 2OCBA 2QTCA 1CTQA 1QOQB 4LEIA 3LT0A 2EARA 4NYIQ 1HOTA 2PS9A 2C5HA 5ER9A 2Z56A 5TPZA 3RBXA 2E55A 2FSHA 1T13A 4YB8A 3WZLA 1U7DA 3RBAA 4MW7A 5LNK6 3U44B 1JG1A 1IBSA 1OPXA 4UCFA 4I5GA 4N6NA 2PCJA 4GMHA 2VZ9A 3IQHX 3X1KA 5FTMA 4DF3A 3KPVA 3G8YA 1OIVA 2DWQA 4Z3OA 1XDGA 4C03A 1Z8FA 3WLEA 2R1TA 5A4DA 1ZITA 1RZVA 3FRIA 4RHCA 2II6A 5I3ZA 4CF6A 4MRMA 5KX5B 3AF5A 1Q6ZA 2ZE5A 3PQFA 1QANA 4HL6A 2G17A 2GEKA 1R0BA 3BE4A 3DP7A 3MMNA 3ONNA 3DWEX 3QLTA 4HADA 3CLSD 5FI3A 4AS3A 2IT1A 4PX2A 3K1ZA 2H9YA 4D7AA 1EBUA 2Q4DA 3VV2A 2ZAGA 3CF2A 4FOTA 4JI6B 5BN1A 3W8EA 4KX5A 2JFUA 1AXGA 1WSAA 3QV1A 4RADA 5BN4A 3OPMA 1Z7BA 3PQ4A 4R1TA 1J6UA 1WPRA 5EY5B 5EOVA 4D3XA 5CLHA 1RPTA 1XPRA 3E7PA 2BW0A 2XZOA 1LWNA 1DJMA 2ETXA 1IATA 4DHEA 1GRCA 4Y9TA 4FD3A 1NBME 4B6EA 4GX1A 4HTFA 3T9DA 1ORIA 1F4PA 1V9SA 2PVCA 2MYPA 1UBGA 3L0YA 5THXA 4MHOA 1LW7A 2GETA 3CG4A 2D2IA 5IK2A 4DC9A 4DN6A 4ERXA 2I4RA 4U0JA 3ZY5A 4AKEA 4C04A 3E9MA 2P1ZA 3EXIA 1IBRA 1A5AB 1COWD 2F3SA 4QOFA 4DA8A 1P44A 2OE2A 2GFHA 5F51A 1NQUA 4MP8A 3RU3A 4ASUD 4EA6A 4YUZA 3AIOA 4TTAA 1ZH2A 3L0DA 3UUEA 1YH3A 3L0OA 2QM8A 3LPDA 4GAEA 1UPBA 4LHSA 1UKYA 2BFPA 3VSBA 5D3QA 1BMDA 4JQYA 5A3RA 4K0KB 1CLEA 3GLTA 1CUXA 3WV4A 3IC5A 4LUCA 1VKJA 3STYA 4CMAA 1MLDA 3U1TA 1NVKA 3BPSA 4FX2A 1GGNA 2YZGA 3JQ6A 2C07A 1Y37A 1ND5A 4WDQA 4JUFA 4TTRA 1ZAYA 2EFHB 4CFYA 5DLDA 1A82A 1Z4QA 4IIGA 1QO7A 3OIGA 1H6DA 2CDNA 3ZZMA 1ZXLA 3MXTA 1IZ8A 2P9CA 4U39A 2BP7A 3IOYA 1GL6A 2W0MA 1M8JA 1NVFA 3LF1A 1ZI9A 3G17A 4AQDA 1RJEA 1YIDA 2XBUA 1IBKB 3PHCA 2YC4C 3EXFA 4P80A 2YVLA 3KRTA 3U17A 1R4NA 2JGEA 4MSUA 4K40A 4P82A 1CY6A 3AETA 4OGFA 1V5GA 3F0TA 4CM9D 5JZ9A 3KE9A 3PGMA 4L8GA 5HUHA 1FMCA 3WG9A 1RJDA 1Z0SA 3FB1A 1U8CB 4XRRA 4LRUA 3H5NA 1R8SA 3UXEA 3ZJTA 3CF0A 5EGSA 1WMFA 3HYLA 5DBOA 3DF7A 2RH8A 4BVBA 1XFDA 2QL7A 1SUIA 4DSUA 1Y1KE 3HXTA 2R00A 3BRSA 4HLDA 1J5EB 3HU1A 2FDCA 3HM2A 1R5JA 1XVLA 2Q3EA 4RIHA 2ZCVA 2J9YB 4Y2JA 1PE0A 4N49A 5LP6C 1FDWA 1QDUA 3D1JA 2C00A 1KMHA 3C15C 4A73A 2I2BA 2OQ2A 4EFLA 3LYLA 4LRYA 6ABPA 2Z6QA 1TOAA 1A9PA 4QIHA 3QY9A 2Z5GA 4CE6A 2H0AA 1MAWA 4U2BA 4OJQA 5AVQA 5JIBA 2AG0A 3V3TA 1VL5A 3L49A 4EPVA 1SBTA 1FRFS 1YL6A 1G5HA 2I03A 1N2CE 1K1EA 1UBOS 2OV4A 2J0EA 3M9WA 3LA6A 4Q9DA 4KFCA 2B1GA 3DLIA 1C7RA 3CW9A 1UADA 2QNIA 5HIJA 4YMUA 5IHPA 2JC3A 4QPCA 3ANXA 4DWVA 2GHTA 2RARA 4BP1A 4S12A 4ZOLA 3MWKA 4Q7LA 4KUHA 3HNOA 2YCLA 5CA1F 4UXHA 3ICOA 3CW8X 2MYTA 4W5OA 4B3SB 4D3DA 5I7EA 1SNYA 1VCNA 4X1IA 2O7RA 5EIXA 1D2RA 2C4UA 4HDOB 1N2SA 1WWKA 5E2AA 1U2TA 2VDWA 1WW8A 2YY5A 3OZUA 4KKVA 2J3LA 2XDWA 3CUUA 2CT8A 2YN4A 2J48A 1TM3E 2W2LA 2C2WA 3K6RA 3V2UA 3GLSA 2PNJA 4WKNA 2FRDC 3LOQA 3EZ6A 3N0TA 5JNWA 5JTUA 1NBEA 3JZIA 5EQTA 1WL8A 4OGGA 4E22A 1M1XB 1QH8A 1XSEA 3RU7A 1WD5A 2PSDA 4B6FA 2A1TR 2CHFA 2YS6A 4Y7DA 3RC9A 3DB1A 3PXXA 2HUNA 2IUFA 1C0LA 5EESA 4NCAA 2ZU0C 4RIFA 3PL5A 3WO1A 1D2MA 4W5TA 3HDQA 4OXKA 1XCLA 3MLEA 4N5MA 2OFPA 2EF0A 3A8TA 3LX8A 4TVOA 1IMOA 4DCNA 3T95A 2EJCA 1PX0A 3H5WA 2GCOB 2QMUA 2UYOA 3MMXA 3G2HA 3P0IA 4JJGA 3TNYA 3E4CA 1I4TD 1SR8A 4PEVA 4F06A 4QYSA 5IDXA 4AMZA 1Y0BA 2ZSKA 2EBHX 2ZYWX 3DWGA 3IIMA 5BWMA 3IALA 4AW9A 4FMPA 4B3CA 3N3BC 1XYVA 4BZWA 2I2XB 3I34X 4I6EA 1BE0A 1R0YA 1UBHS 3DYBA 4LK2A 2Q3JA 3H2JA 3OLVA 2PQMA 3CEMA 4QGBA 1NVMB 2JW5A 3JPWA 4PX5A 2BFMA 4KE6A 5JISA 5K3EA 2FB9A 3TRHA 4C4AA 1LSSA 2Q5CA 2I3GA 3BXZA 1WDKA 2AQHA 5AI6A 3BIWA 4EP1A 2W2TA 1AGPA 4XUEA 1NN5A 4F8YA 4O2AB 2YHBA 5A6SA 4CQLA 2QMOA 1O57A 4GS5A 2Q7OE 3T7SA 4LNHA 1ZD9A 3CE9A 2OESA 3T7TA 4JJIA 4XCVA 5C7LO 2AH5A 3BWYA 1P6XA 4MRPA 5IM5A 4YREA 3SFTA 1OFUA 4Q7KA 1QZUA 4R1QA 5LCXA 1LSOA 2ATXA 1PN3A 2XZPA 1C3JA 4DKXA 4I6GA 2X6RA 4B4VA 3T5PA 1UJCA 3RPEA 3B5IA 3LW7A 3QWBA 2NU6B 2DETA 1SXJC 4D44A 4DB4A 1RXSA 1JFLA 3OQVA 2ECOA 1A9ZA 4ZI5A 3EA4A 3OY2A 3FDIA 3WRWA 1H6AA 3N76A 1J1UA 1GZDA 2CNNA 3WLHA 1IFXA 2UVPB 4RHTA 4X41A 3RVPA 4AMBA 3VO2A 2D5LA 4KMOA 4GEKA 3ZV3A 2CVPA 4FGUA 3O3CA 1R4MA 3P9PA 2QP4A 1NT4A 3QX9A 1UWVA 3DAPA 4HB3A 4LK3A 5JHHB 4RTKA 2FEWB 2YJNA 3TJZA 2VHWA 1HLGA 1ZM9A 1LU9A 3DONA 1TD9A 4WRRA 4B1FA 4GI2A 3KOMA 3WV5A 3G82C 3DG9A 1CULC 1A95A 1QJCA 2ZKIA 3O75A 1DLJA 3WK9A 2V54A 5EPUA 3ITNA 3M6UA 1GPBA 4B33A 2GSWA 2QTVA 3DOCA 3GMTA 3IH5A 3OQJA 1ZH8A 1GUBA 4TYMA 4TL7A 2Q5EA 2IQ5A 4JC4A 8LDHA 2XA2A 3JAWA 3UTDA 1M1YE 2DBQA 3BB4A 4RYDA 3PWTA 2HQSA 4FLFA 3F46A 4QXAA 1XZEA 1GT6A 1OBOA 2ZPAA 3G2QA 4WERA 1QCCA 4L3VA 5JARA 1BHSA 1I6MA 2LNDA 9ABPA 4NJEB 4QYMA 3C7TA 4QXMA 5FBLB 1SVUA 4HZIA 1QSGA 3RK1A 3QLEA 1OTHA 2HPZA 1ISGA 3R0IA 4H7PA 4OHMA 1H0SA 2O06A 3P2IA 5THQA 4MW4A 4H2DA 2H7XA 2OG1A 5EL0A 2ZT6A 1UF9A 4I50A 3CNLA 3R3HA 3KKOA 4HNHA 4EJSC 2ZSEA 3EVCA 1PR3A 3I2GA 2WUVA 4AG6A 4F2GA 1EU1A 3ISTA 3L4SO 4G6ZA 4KFSA 3H2GA 4O4LB 1U0EA 3NFRA 4AG3A 4ENUA 3IUEA 2WYWA 4C7JA 3RYFB 4PC3A 1JDBC 4DA4A 5IF9A 1JH9A 4EI9A 3A1DA 4UCWA 2WPNA 3Q9NA 4BZQA 1EIWA 5I48A 3F7MA 4YS6A 4NDAA 1VIVA 3LOUA 4GG1A 2V8OA 3AMVA 4A2CA 3V4RA 3K0BA 5CYPA 1JLLA 3GRCA 4RZUA 2Q7XA 1HRKA 2GT1A 5ITZB 2XUIA 1PI3A 1SIWA 2LP4Y 2AJBA 2E4XA 2ZI9A 1KERA 1FVHA 3K4QA 4BV9A 2NXNA 3Q6NA 3LQ2A 3QKSB 1CB7A 4O4JB 1BQEA 1XTVA 2OHIA 1AKTA 2YHSA 4OLAA 1EQ2A 1OWLA 3R9KA 2BKVA 4TVSA 4ZI7B 3MCZA 1ZMXA 3IXMA 3U16A 3OLCX 4N3BA 2Z3WA 2QLMA 4BQPA 2JCGA 3KAQA 2IWHA 1OH7A 3UYKA 1I8TA 2IHUA 1NF9A 1UJBA 3MCTA 4OP2A 1Y81A 4YH1A 1ZH0A 3STHA 4YT4A 6PFKA 7MDHA 4W5RA 2P5UA 4KRYA 1DAIA 4OXIA 4G37A 1L4FA 2HA6A 1PTKA 1VL8A 5EE5B 3WDKA 3HR7A 4WXPA 2L18A 3FR8A 5KHLB 2MSNA 2X15A 4UM9B 1SG0A 4AJJA 4AO6A 4RUKA 1K8QA 3KT3A 2AFIB 1H9CA 3SSNA 3N5KA 1Y1PA 1MT3A 1N6LA 4WXHA 3S4YA 2IOHA 2FW9A 1SXGA 4EG7A 4OREX 1Q74A 2VBCA 2PZLA 3WGOA 2B25A 3BHIA 3MJFA 1Z34A 3QIVA 2QG6A 3L6RA 3CVXA 3JD4A 4J4HA 4LE2A 3T0IA 5EXTA 2ZPTX 3UJ8A 3EZ2A 4PGAA 2P2GA 3RTCA 1GA6A 3HLTA 4XFKA 1ZOPA 2FW1A 5J59A 2FPPB 4ZO4A 2PZBA 1R6TA 1YGYA 4EB6A 3VI4B 2XUAA 3NGXA 4J1TC 4PICA 2JKZA 2IIQA 1O5OA 4QVKA 4AB1A 3DFMA 4NLLA 1VGRA 3E4DA 2CFSA 1YRHA 5TXGA 4BO8A 1IN5A 2WFLB 2RHTA 3A6FA 4K1XA 4J03A 1JWLA 1CP3A 1UBNA 3HLYA 1KEVA 1B76A 1ZL2A 2ISQA 2C5SA 1PNOA 3F6RA 4ZOBA 2GAFA 1RPNA 1YJ8A 4LOKA 3TZCA 3U9LA 4X90A 2C5LA 1DADA 2VDJA 2G0NA 4TXNA 2QBYA 1UK8A 2AJTA 3RFVA 1ECJA 3G2KA 1VOTA 3IOMA 3WSVA 1Z5WA 3TLKA 1Q7EA 3W1EA 2B5VA 2GRJA 1PT6A 2VEDA 2VNHA 2ZW9A 1DRJA 4TV8A 2Z09A 2Q4BA 3KKLA 3KV1A 5EIBD 1T25A 2O59A 3K30A 1CRLA 3RFTA 1DNPA 2TRSB 2A78A 4QWMA 4FKZA 1NU8A 5DSTA 3CNBA 2BMJA 2IPMA 1YD7A 1JV2B 3FJOA 5DHSA 1ZHHA 1IZ9A 1UJMA 1Q7TA 2BV3A 1ZRMA 2AMLA 2NPFA 1W1WA 4KHPB 1YZYA 1Z75A 3NUQA 2D1QA 4BQNA 3SKXA 3LFTA 2WAYA 3H05A 1J2EA 1ZJ6A 5ALKA 3T54A 5GINE 5B6PA 1XXHB 4DSNA 1D5CA 1F8YA 4IIYA 3FJ1A 2QN3A 3L8HA 1BWRA 1QHHA 2VATA 3WA6A 4TRMA 5ALZA 2XVMA 3KKQA 1RKXA 3HCWA 1P5ZB 1V48A 2LWIA 5I9IA 2VRBA 2AX4A 3QXGA 4FFOA 3A9UA 4QHTA 2SHKA 3PDJA 1LH0A 2FQYA 3I8OA 5FUQA 4YXFA 1DIGA 1MAHA 3TLYA 3EEQA 2B9VA 2J9RA 4B6GA 3LBYA 1RWKA 4BN0A 3AEUB 2O14A 3Q8WA 3W5UA 1BDIA 4FDTA 2IZ7A 4BMYA 4JIGA 4LXGA 4HR7A 5K03A 3B6MA 3D6AA 4LIPD 3HYTA 2ZFUA 3ZDBA 1H2XA 2H92A 3A2NA 4IFTA 1PTJA 4ZYYA 4ZOCA 4TKUA 5WRFA 4CLOB 4G5QA 3F96A 3TTYA 3ZEIA 2PX3A 3UFXB 1J09A 1YK0A 3HVKA 2G6TA 2PYIA 5FLYA 1SCIA 5HX7A 1PR5A 1PIWA 1KEWA 2B94A 4L2IB 3FUXA 4WKOA 1P9NA 1U2GA 2DPYA 5CGZA 1Z63A 1UBSB 4H1HA 4BGVA 1DJPA 2VDKB 3K15A 3DMTA 3K4PA 3QU2A 3RAFC 5DK4A 3P9XA 4GLFA 4ZQIA 2PX2A 1FVFA 3GZJA 3KWMA 1PYGA 2FPKA 4WXEA 1F12A 4XD2A 4PQFA 2DUJA 3NM6B 5DHTA 2WTNA 2BMAA 3WSWA 3M6FA 1LUAA 4INOA 5H68A 4PLWA 4XB6B 1LRKA 2HDHA 1E0DA 1X8LA 5BV2P 4QTTB 4ZMSA 3AI2A 4N8DA 1WMAA 1I32A 3K9BA 3QP9A 1USVA 4HGZA 5DOVA 3KEFA 3WYDA 2ZWMA 3NOVA 1YUMA 2ETVA 5C7YA 4DA7A 1SOMA 1G5QA 1N2OA 3U13A 1P60A 1MOQA 1SQGA 4GXQA 4QU0A 1MUUA 1GQQA 2AEFA 3THWA 3ZU6A 3FHCB 2BR5A 1QGED 4YBRA 3ZDRA 1P72A 3SBEA 1XL1A 3WRYA 2C9YA 1FFGA 3ZCTA 4MUFA 1DG9A 4NPAA 2XGJA 3IVCA 3TK1A 4GXNA 5A4IS 3ECAA 1M2VB 4ARBA 1N77A 3TNJA 4ZEXA 3B52X 3UJPA 4KGXA 3NEPX 2ZIXB 1I4WA 2AEMA 3OOSA 4HQOA 3NMUF 3FUTA 1ZM7A 5JPIA 3K53A 3NHJA 4MQ5A 4BX3A 3CKKA 4LDPA 5TQJA 4R54A 3DLAA 4GW3A 3T94A 1M7BA 3DB2A 2RONA 3FNBA 3ZQKA 2LR0A 3QXXA 1B3BA 1Q0ZA 2WT9A 4FHCA 1IWBB 1TMGE 2OGUA 3BGVA 4X8LA 3O8CA 3NTVA 3WMEA 1XTRA 3LDFA 3W5BA 4B7AA 5KTTA 2AC2A 5AKKA 1N2JA 4RZIA 4NBWA 5JE8A 5FADA 1IIRA 3GXOA 3BILA 5D6OA 4CMHA 5L7TA 2HLDA 3D2BA 3VH2A 3QLUA 3BK2A 3QU5A 1AHPA 1VPWA 3IT0A 3E1GA 3MVEA 5IJZA 4HLQB 3OEYA 1P4AA 2QUIA 1W1UA 2HF8A 2QZZA 5DNVA 2FMFA 3BMCB 4LFCB 3B9PA 1IN7A 1IVYA 2IHKA 3V2IA 4B2PA 3LWNA 4YRNA 2BM9A 4OAPA 5CM8B 4A5SA 5MN5A 3WLSA 1AY0A 2C94A 2I1QA 3H8SA 5K0TA 5CBPA 1KSFX 2COKA 2TSYB 2XUQA 3OFKA 4ID3A 4DV1B 1AQUA 3K20A 1LI7A 2HPVA 3U7FB 1ORVA 4KR7A 4KV9A 3U3ZA 1SHTX 4ROTA 4JLSA 3GGSA 3BIJA 1ZD1A 3INNA 1PJTA 2YWGA 3WB0A 3H1EA 3IAAA 4R98A 4NONA 1IHXA 3KLOA 4MR7B 3G9TA 4YVFA 3TW4A 3BSSA 5B12A 4CF4A 4KPUA 4DA6A 5BVGA 1LWOA 1RRFA 4RM2A 4TUYF 4DCSA 2A0YA 4KN8A 3TQQA 1ZOIA 5KOHA 1VECA 2YXLA 3ODGA 2Z1MA 2NO7A 4LF7B 5TMBA 1G8AA 1VJRA 1RWPA 4M55A 2ZDGA 2AYYA 1B93A 4V1CB 4HO1X 1DKQA 1E1MA 1U1DA 3U09A 3A3KA 2V7XA 4R1NA 5CW2A 4TSFD 1NFFA 3I2HA 2IDKA 4CTNA 5KQGA 4HX5A 1TAQA 2JFHA 1GPLA 2Q3HA 5I7SA 2REQB 4QVIA 3NR2A 3T3HA 3IAEA 2B4RO 3D3JA 2BTOA 4KRXA 2QVXX 4M9UA 1NRJB 3TM5A 3BCSA 4HLCA 3GLIB 1YJBA 1OFGA 1P2TA 1ZM2A 5B55A 3U60B 1Y7PA 2PXXA 2H4ZA 1V71A 1YZNA 4WDRA 4ZQGA 4RKEA 5E1MA 5I8WA 1J8VA 2P2SA 1M2OA 4WKGA 1A8SA 2QENA 3BMOA 2DHEA 4GDFA 4P83A 4IIJA 2R2AA 3UQZA 1PJAA 5BR8B 1SEPA 4GQIA 4M8LA 4JV5B 4ITUA 1IXKA 1U0NA 1JEDA 2N47A 4NEGA 1RP1A 1GKUB 1SBYA 1KS2A 3LDUA 3UF0A 5LBTA 4UOEA 3ZXSA 3K2QA 4LZOA 4MVJI 2PNFA 3VJLA 3Q5DA 4JUAA 1ZOLA 2CZQA 2XYPA 1DBVO 2GILA 3DLPX 1EVLA 1VKNA 3U80A 2D7JA 4IH4A 4BX2A 5EWLA 3HVRA 1TKBA 3QHPA 3WIDA 3N3AC 4FYJA 4N3AA 5AK3A 3NWOA 4HAVA 5JYDA 3HCEA 1UMDA 2JD1A 3NEAA 1TO1E 2FPMA 5FIUA 1DDOA 3B7PA 4KYUA 2WHQA 5DCYA 5F77A 1DBWA 2DM6A 3AWDA 3NKLA 4FYIA 3DCYA 1MX5A 2FMIA 1NJ8A 3KS9A 4B9AA 5M29A 2ZE8A 4A10A 4D02A 2AT1A 3MWFA 2GZ2A 3UQYS 2DKOA 2ZRGA 4DZZA 4ZRDA 3MN1A 1OLOA 4LG1A 2H4WA 4B4KA 3BULA 1EK5A 3CS3A 4JOSA 2O2JA 1H2FA 4U7TB 4UE3S 4DWJA 3L93A 2WTBA 1DLIA 1LB1B 4ZVNA 1GCAA 4OQXA 2EKDA 2ONJA 3DD1A 5L3SA 1YONA 2FHSA 5EIOA 1T8TA 1PLLA 2CVFA 2EKPA 2HRBA 2VNSA 3UCXA 2Y1DA 4MLZA 2P6UA 4PZDA 421PA 3EWSA 1NVDA 5EIFA 1Y8QB 4KYVA 4D46A 4HQNA 1P4RA 1QX4A 2JHGA 2C9ZA 5JH7B 5FJJA 3PCXA 5CDFA 1O95C 1C7IA 5F4BA 2P41A 3T4XA 3H7IA 4TWRA 4BIMA 2HHHB 1NUTA 3LH5A 4GP6A 4Y6LA 1KHHA 1TRHA 1DDGA 1JQLB 1E6CA 1K3FA 3IO5A 3DDUA 4I55A 1KSJA 2PSEA 2YQZA 1KEPA 5K0ZA 4B74A 1XVVA 2C88A 3HA7A 4J4TA 3PYXA 3TLAA 4I4CA 3EZGA 1V4NA 3WLAA 2CJWA 1N8SA 3DA8A 3E8SA 1JNXX 2VDPB 3F78A 2G25A 1WXFA 4C4RA 1NW5A 1U5BA 3EULA 4Y2SA 2FXIA 4ZAXA 1N3BA 5DBEX 4R71A 1OU0A 2B4TO 5AM3A 3GJ6A 2QMQA 4ZO8A 1SU4A 2PA3A 4BVLA 1I30A 1OAOA 3O1IC 1C9NA 2DERA 1KI8A 3OT5A 3S28A 1MGOA 3W0LB 2CWDA 2O8DA 1FFSA 1U2ZA 4U3JB 3DKPA 4I4TF 1ZK0A 5AXAA 1WXEA 3UFBA 3VU3A 3MBIA 4RELA 4UHKA 1SVIA 5AW5A 4D79A 5EMLA 2DHRA 3RD5A 1KNXA 1OQAA 2IF2A 5JASA 3N7TA 1QHSA 1K6JA 1KH2A 5K3CA 3CLUD 2ZYTX 1WV0A 1GL7A 3EIQA 1MXHA 2AIRA 3EF3A 1KAEA 1JSCA 3C5VA 3D6FA 3HKBB 3N0VA 3O74A 3DZBA 2VAVA 4EEXA 1IJEA 3AHEA 4K2AA 4EHAA 4F86A 1M72A 3OE7A 4LRSB 1KBZA 4Z3DA 4N65A 3VBEA 4FMCB 5ES4B 4OMUA 4UULA 3U61B 3VHQA 2DGDA 4J0KA 4RPKA 4IRXA 3F7OA 1EBFA 1OX6A 3LPMA 3KZCA 4YT8A 1ZUHA 1LPAB 3TVDA 3V8RA 1LV7A 2YOGA 1VJTA 1V1MA 4KL8S 1D7OA 1ZINA 4ZZ3A 2PXCA 1QRRA 2V3VA 3DDCA 2AFVA 4RJ2A 4Z9XA 1EUDB 2EQAA 1SQ0A 3GJ0A 4YCAA 4A2PA 4M8IA 1XP5A 4NBRA 3QHQA 4OI1A 2CHQA 2YMPA 4DR7B 5EJAA 3HJAA 1NW7A 5NULA 3QBVA 2GPNA 4EFKA 4R7ZA 5CD1A 5HZHA 3VR4D 3AVTA 3HV0A 2BSAA 3UPUA 5AUOB 2CHUA 3O94A 1NP6A 2G7ZA 3QWFA 3V3KA 4DG8A 2X7JA 4QXOA 4JX9A 3L3BA 3MJSA 4IYJA 4HJRA 4IV8A 3VVLA 1J70A 2I2WA 4OOEA 4BE4A 4YHHB 4FSDA 1GFSA 1I7LA 1MJ5A 3KOZA 4FEGA 3HR4A 2A3NA 4OMCA 3VOTA 1USKA 3AVYA 2CW5A 2EX0A 1VJ5A 2C1EA 4HUQA 4Y6OA 3JWJA 1IJFA 3P94A 4JT8A 4UC0A 5J2UA 2OSVA 3TKYA 3OX2A 1FJ2A 2IUEA 1PZNA 4IVRA 5ICMA 9ATCA 2P30A 1U0FA 3UT5B 3OTQA 3A05A 3MCWA 1UODA 4O4HA 2XMRA 1OYWA 1HDXA 4QO7A 2E5FA 4YPFA 2Y77A 1E8DA 4WZZA 3MTIA 1Z56C 1H9BA 1PBNA 2E2WA 2HPAA 2QVYX 2ZRCA 3BJMA 3IBYA 3JWHA 3SHVA 5L3QB 4OX9Y 1Z0AA 4DG5A 4ZK6A 5U1PA 4F92B 4UHBA 3R8FA 1ZU5A 3PJFA 5JJLA 3E5NA 2XCTB 1DBSA 1T2NA 1XCOA 2Q1SA 1DEOA 3ENNA 4IJ5A 1SBQA 4OGLA 4DC1A 4E15A 5CEEA 1VRVA 3CNHA 3QFCA 1ZY2A 4RVOA 4JYBA 2A0UA 3AFIA 3HGQA 1UDBA 4L6AA 3WYFA 2HIMA 4PU0A 5FULA 5CLGA 3FGOA 3MMZA 1BX1A 1OT5A 2QNBA 2GJSA 4PLVA 4IXDA 2HSEA 2PL1A 3TGPA 4XWGA 3H1FA 3SSMA 3N05A 4ZK2A 3V8QA 3QOYA 3D6VA 4YT5A 4AVYA 3CPSA 4NE9A 4BLSA 2C5GA 1W6RA 2IHZA 3AY6A 3OOYA 4KP7A 5LYJA 3WNQA 2C7PA 1ORDA 4ND2A 1AKVA 4DCPA 2OSBA 3L4BC 2JKYA 5LC1A 2K7FA 1V8DA 4HWOA 1UM9B 3W6UA 1WKVA 1SD1A 3R8CA 1IHPA 4N3GA 4G1FA 1CRWG 1RYBA 4KXMA 5AKYA 5J23A 2A5YB 3N2KB 1ZZGA 2AN3A 1PJBA 5BQOA 3HBAA 2XCOA 3RYIB 3W8FA 1F7VA 2QV0A 3SF8A 5IZ4A 4GL2A 3FFXA 4AF7A 3BQNB 4Z4HA 3VKWA 3HZZA 4IG9A 3VGJA 3D54D 3P8ZA 1E2EA 2AVNA 5AK5A 2KQUA 1ELOA 4BDTA 2JIQA 1N36B 3N8DA 4FBGA 3P9IA 4BKPA 4DUZB 5I9BA 1MB0A 4Q3CA 2B20A 3KVRA 1I4DD 4M98A 4AY6A 3TZLA 2CVHA 1YZLA 3D7RA 4FOLA 4BO5A 1MB3A 1ZK4A 2E6KA 1NE7A 2P2ZA 2ZDQA 3AV3A 4D9EA 4DBLE 4ESEA 1O4VA 4H9GA 1B8NA 5FWXA 3B70A 3E8MA 4YCDA 1W85A 3K9GA 2VUTA 2QR2A 3R5HA 3IHTA 5LP6A 3DOFA 4DLSA 3ZZNA 2X4IA 5IT5A 4Q00A 3GXBA 3GJ4A 4MW0A 2VJNA 3DBLB 4R5MA 3PPVA 2C7QA 1M2GA 4I5EA 4R69A 3A28A 4FILA 3F6CA 1SVMA 4I1OA 2HH9A 3USZA 1UCFA 2ZS9A 1O0SA 3KKKA 2RBKA 1NDUA 2IYFA 3FDZA 3U4IA 5K0NA 3WGHA 4Y1GA 3NVKI 4WECA 4FHDA 1JYFA 3RJTA 4OI4A 1DKPA 1E2QA 4RF4A 3QVKA 1RFGE 2WHEA 3GZNB 5KJ6A 4WASA 4CDNA 2K6GA 1R9GA 2J7KA 5EQDA 4UATA 2HYDA 3JWEA 3LY9A 4G01B 4CTJA 4AWBA 4Y2TA 5BSFA 3WKBA 2I9PA 3VPHA 3OFNA 1XZIA 5BNWA 3BMNA 5GQSA 2FP4B 2IU3A 2W37A 4DA9A 1J0BA 1K7XB 5BT9A 1U28A 4ZYXA 5J2TA 1G8SA 1JR3D 1HEIA 5I6DA 5HWSA 2IKQA 5CTAA 2KX7A 2VNJA 1RI4A 3IP3A 1Z6GA 4WZBA 5EIHA 4AT1A 1WB4A 2QE6A 3ELDA 3ROPA 3WGYA 3EC7A 4FFPA 3KYDB 3X1JA 1G3QA 2EG9A 3L46A 4KKXB 5ILQA 1P2VA 3CLTD 5COAA 1WQ4A 2EEZA 3G2NA 1P3JA 4AM8A 1XROA 4Y9SA 1MW8X 4GO1A 1P17A 1GLVA 1JHYA 3QE4A 3O8OA 3W4IA 1MO5A 4MW6A 4DLXA 5AFSA 2JNWA 2OD2A 2QX4A 5HFNA 1DAGA 4BX9A 5KOIA 2CLCX 2JGDB 4ZJZA 4L5IA 1R0WA 1A9XB 2DE0X 5IHXA 5KWJA 3O84A 1VGVA 4P4LA 4CMEC 2EFYA 2ZI3A 1CQWA 3BA1A 4IWNA 4Q05A 3EDRA 3L84A 2PA0A 3MD0A 1GZHB 2VDQB 3F98A 4R3NA 3V8BA 4QWWA 4Z4QA 2JZOA 1GCUA 4ESHA 1CEYA 4A26A 1OXSC 3HXMA 1M1UA 2J7PD 2Y4NA 4IXNA 4QQ8A 4US1R 3WKAA 2L0XA 2Q6KA 3IFSA 5EKTA 1CUSA 4EHHA 1UXHA 2A1IA 4YO8A 3D0KA 3W5IA 3NT5A 4N03A 4UTOA 4YI3A 3AVUA 1DKUA 3WRXA 3LUJA 4GI5A 1G6HA 1GR0A 2OV1A 2WG1A 3QXSA 4LOIA 3HGTA 4YFVA 5KNDA 1KVUA 3T15A 3HUDA 3JASB 3PDIA 4AZWA 1NWCA 1JEAA 2CDCA 3I6BA 4LGMA 1V35A 1OUMA 1YKGA 2VQSA 3AFHA 3C3YA 3GQVA 3K73O 4I8IA 4ZT5A 1MAVA 4UCQA 4IVQA 2CFCA 4PLFA 2ZB4A 1ZEMA 2ORVA 5FOTA 1JXAA 2XOXA 1X7YA 4OBWA 5EPOA 3S2SA 3COJA 4TTPA 1XU7A 5FI5A 1VE3A 2HT1A 3L8ZA 1PUJA 2W8BB 3EVBA 3TJMA 2OBXA 1T36B 3QYJA 2WOJA 3O26A 3FH0A 4TM8A 4TS3A 3PLRA 1GL9B 3ZS9A 2DFDA 3Q7QA 4Z9BA 2ORED 4U7GA 4V3BA 2J07A 3KR2A 4QTXA 3PEEA 1SCQA 4JIMA 1GAEO 5D7BA 1Y5IA 3LA8A 4NARA 4BFUA 1ADJA 1UDCA 6AT1A 3G7UA 3IKTA 3QPDA 4BATA 2BZSA 4AY2A 4LGCA 3IXQA 1WXDA 2YX1A 3UMMA 4WFIA 1X7XA 5LKRA 1K9VF 1BE6A 1UQRA 4E0BA 1G5PA 1DUSA 2LD4A 2X8JA 1V8BA 1L5GB 4DW8A 5HGXA 1NNEA 1C9KA 1SC9A 1CKEA 4O0MA 1SKYE 3M2TA 2Z8ZA 2X19A 4ACAA 1SQ6A 1U1CA 3ND6A 3HP7A 1DAFA 1ODCA 1WMEA 4IO1A 4MQBA 4NAHA 4QBIA 4K6GA 4V0QA 2IOFK 1OW3B 2ZTMA 4ER3A 3ITDA 4DVJA 2O0MA 1N8TA 2HMWA 2XNJA 4LXUA 2OGTA 2P4EA 3VR0A 5K8CA 2IKSA 4TMFA 2VCYA 4YJHB 3HHPA 4MR9A 3RNOA 4C7VA 2IVFA 3G88A 2ZR9A 3EVDA 4WN3A 1FSGA 1R5OA 4FC7A 3HM9A 1TL7C 4LXXA 4KXVA 1Y5MA 4K9RA 4EPXA 2QTZA 2PO7A 1EWYA 3LHDA 2VJLA 2BR4A 1SXJB 5C5CA 1U4OA 3GLGE 1EK0A 5ECDA 4ZICA 3TE7A 2XUFA 2B6HA 2NIPA 3OH8A 2GB4A 4YROA 1DJNA 4OL0A 3DCIA 1N5JA 3LTEA 4EA8A 5KBYA 1XN4A 2WIBA 5G2OA 2VZLA 1TZKA 2F59A 4W1QA 1W0KD 4KNYA 3IQZA 1JB1A 3FIUA 3KPWA 1UWLA 3ROZA 1VL0A 3H84A 5A4JA 1A8PA 4Y2RA 2FLVA 5JS7A 1G9SA 3K8YA 3UV7A 2L19A 3W77A 2IH2A 1PWYE 2WICA 4HH0A 4CRWB 4JHLA 1A3CA 1MG0A 4PE5B 3VAYA 3ZHSA 1XQYA 3QY0A 3IE0A 4ZWNA 2OZLA 1J42A 4OQMA 4R2IA 3W06A 4NU8X 5KQMA 4QJ5A 4F4IA 3KYCA 2VHQA 4P38A 5CHEA 4AUNA 2WSIA 2G5TA 4M8NE 1U9IC 821PA 3EN0A 3P4YA 1L5LA 3RVMA 1WCWA 2A86A 3MNFA 3BS4A 3DHYA 1MO3A 3MTGA 2ODTX 4FDUA 4GGPA 4B48A 4E5KA 1CZNA 4MWZA 5BUSA 5LQNA 4QDOA 5JSQA 3NZEA 4MQFA 1X0VA 1D2CA 1DUVG 1KQFA 2FNAA 1K7EB 4R7GA 5A04A 2YCBA 3K0HA 5A3QA 1TQDA 4X8HA 1E2JA 2QRHA 1KA9H 4LISA 1HDCA 1TW3A 2WJZB 2X0RA 3CNQS 3L7OA 3ABRB 4S1OA 1N2EA 1O96B 3I42A 3X1WA 4UEQA 5LMCA 1XU9A 2DTDA 2X5OA 4LJ5A 1T15A 1JDBB 2V74B 2VUHB 2R0QC 4MKGA 4FR5A 4HNUA 3DDWA 4M6WA 4Y98A 1ZJ5A 2XT6A 3UATA 3C3JA 1ODFA 1HF3A 1T3GA 3BIXA 1U7PA 4UBLA 4YLGA 2FPIB 1R6UA 1Z6ZA 1UBLS 4RIIA 2HXYA 2C77A 1CE8A 2H5EA 1W88A 1SBNE 4FMDF 4JLBA 2OMKA 4B3DA 1OIXA 4NBTA 2M6KA 3PRKE 1WDLA 3V7NA 1K86A 3CRZA 5EHNA 3FYCA 3OM0A 1M2EA 4B3JA 5EYPA 2X40A 3A6PC 4B85A 5JECA 2IBTA 3H2SA 4KO2S 2GVDC 3EXEA 2ZVJA 2QTFA 4N0MA 4EJMA 2BVNA 2HU7A 3BA6A 2PPVA 4RQUA 2HU8A 2Y71A 1MJGM 5B6IA 4K9QA 1FC0A 4G2TA 1ZGAA 2J5BA 2QW8A 1ANKA 1GCIA 4KWHA 4MYTA 2NUAB 3BD8A 2EZTA 5C1BA 1Y9ZA 1G21E 1WF3A 2ZR7A 3X1ZA 3I2YX 1EFAA 1ICIA 2ROQA 2IQIA 2O3QA 3SMVA 1N5LA 3L1UA 3LVFO 1I0LA 2FP3A 5LZ5A 3ROTA 2PUVA 4YAJA 5K6RA 3J80A 2Z2XA 3TQTA 3DULA 1FZTA 1OI4A 5B57C 2NP7A 4G1MB 2UYYA 3EF1A 4PPGA 4WZAE 5CP8A 5SZHB 3MELA 4IZHA 4AMUA 4V1CI 3ICQB 3GIWA 4UFNA 1ZQ9A 3IELA 1P4SA 1Z8NA 4FQ7A 3ZU2A 5EHQA 1YL7A 4I8XA 3HBLA 1G63A 4J91A 4ZMRA 2GKGA 4XWAA 3R3XA 1LQUA 2D7DA 2I67A 1GG5A 1PBTA 2AOTB 3EGEA 1E5XA 4FT2A 3C14C 1UQUA 1PFVA 4Z7QB 1N9GB 2PGXA 2WWRA 1HDRA 1LPSA 3LDGA 4AKHA 3P2YA 3OPYA 4TWAA 1Z12A 5A9SB 2C8LA 2IPOA 1GZUA 2IZ1A 3KEQA 3C8ZA 5CH5A 2D6FA 3TDNA 1L5WA 2JJMA 4Y6RA 4UBKA 1YZ3A 1EDBA 4IBOA 2C4VA 5IPFA 3KC2A 5B58C 2FDXA 2UVDA 2PN1A 2V5UA 3MJCA 1BE8A 1ADBA 5LQSA 4HWPA 4XGQA 3GJ5A 4JBWA 1ZN2A 4UNIA 3VDQA 2D2VA 4BMPB 3B3AA 3B7WA 4REMA 2ZG6A 1V96A 3ZIAA 5IBCA 1O2DA 2W83A 1IK4A 2P67A 1V8OA 1WB5A 4EYEA 3TVYA 4B47A 1U3GA 2C2YA 1E60A 1CBUA 1QFSA 2H6EA 3JZMA 3K70C 1ZRHA 3GU3A 1N3IA 3EZLA 3NG1A 4R6XA 2Z9BA 2NU9B 3WFIA 1Z2OX 5M3BA 4U6QA 1KFKB 5KIAA 3ICPA 3JTEA 3U4AA 3BHJA 3U48A 5GOZA 3CBQA 3AR7A 3HYSA 2QUBA 2NVBA 4DMCA 5EXDA 2HV9A 1OGJA 4R0NA 2XMGA 2GGSA 2O3JA 4PV7A 4L8VA 3UW3A 4EEKA 5AVOA 2JARA 2I2CA 4DLWA 3G49A 2C3MA 2O5EA 4UVGA 1QYWA 3HXLA 1TYBE 3ML1A 1EVJA 1MABA 3Q6MA 4XB1A 3TIXB 3PA8A 4BQRA 3SHWA 3IODA 3PJDA 4EDHA 4AJ9A 5C8DA 1Z29A 1ND6A 5JAHA 1JF8A 1QV6A 4Q9HA 5K6TA 1G20A 2GPAA 5HBRA 3Q9SA 4EY3A 2O0JA 5DWDA 3NRBA 5FDFA 1XK7A 3Q0EA 4GUAA 3AEQA 3B60A 3OZVA 1JMVA 3FROA 3GFRA 3UV3A 3W4KA 4EX6A 3W3AH 1FLAA 3WHIA 1LZLA 4QSMA 2QG4A 1RI1A 3QVUA 5TF4A 3NBZC 4XVUA 4ACBA 4F2DA 3EZNA 5IASA 2ZYIA 1TEXA 3OICA 3AINA 1JB9A 3MOIA 4I1VA 3IAXA 5HHTA 1Z6AA 5KX5A 3MTJA 5DHRA 2YRXA 3TB4A 4CV0A 2FRVA 1ZM4A 4Q1DA 3QHAA 5KSPA 1CDEA 3JQGB 1GEEA 4Y30A 1YQTA 2ERCA 1E77A 4PIPA 3GNTA 3CX3A 3ND5A 2VPZA 5LOVB 1KE2A 2OFFA 2H7VA 1XD2A 2OKCA 3KKNA 1JTVA 3A7DA 4ZVOA 3P5SA 1V7QA 2RGXA 1AK9A 1ECFA 3AUYA 4MUAA 4CKWB 4Q9KA 3SIPA 2BBTA 2CLDX 5FBRB 3S1SA 3EWIA 4CV2A 4TWIA 5CVTA 4P3NA 5T8KA 3EIUA 3SYLA 2NYRA 1FXWA 1K9SA 4L1KA 3OZCA 1GHTA 3P9NA 2OCYC 3C7KA 3OEWA 1Z0DA 4M0KA 4MEAA 2IXEA 1NSFA 5DULA 4QM6A 4EO9A 2OAP1 2QJFA 1SD5A 2Y1CA 3EQ9A 3OC6A 4HCJA 5AI8A 2Z8YA 3CF4G 4D56A 1ES9A 1GGJA 4L57A 5HJEA 3VOBA 3MS4A 1BDJA 3N53A 5B6JA 3PWZA 2J4FA 4OHFA 2F6RA 4HDCA 1C1XB 4U2KA 4NJMB 4D8TA 3C85A 3EG9B 3RLFA 5BNIA 1QIHA 2RAVA 5B36A 3X1XA 1VBKA 2R5NA 3VV3A 1RAFA 1JQ5A 1K06A 5FLKA 2E1PA 4DPKA 5ED4A 1P2BA 3OOHA 3RWBA 1R12A 4M53A 4C0JA 3T1TA 1NZJA 1ZMOA 3Q8KA 1PP4A 1QLWA 4OJNA 1E4VA 4H08A 4TKMA 4YP1A 1Y7LA 3TYXA 3PGXA 3DEFA 3HPQA 3HV2A 1QYVA 2G9VA 1RM0A 4HQLA 3HKCA 4KWTA 5D5QA 1G42A 3LCUA 3N59A 4FKBA 3IP7A 3NALA 4NTZA 3QKRA 4UOZA 1NBHA 4IDHA 1LX6A 1NV9A 4G07A 3KSDO 5JQGB 4JBGA 4PG4A 3RC2A 3KD2A 1CY8A 5DI3B 3N07A 1FUIA 4BCCA 4CMIA 1Z74A 2YFQA 3DDHA 4QULA 2PVPA 1RXWA 1UPAA 1DP4A 2D5BA 1A8QA 3GVCA 3IUMA 4AICA 1V43A 1UP7A 2J3EA 2QI9F 2WWTA 4GR4A 3WBBA 2WMOB 4F1KA 1X19A 2V6GA 3GRVA 2IIVA 3VKGA 3IUYA 4S04A 4RE5A 1FSSA 4WOCA 1M0TA 2H7YA 1ATIA 3JQBA 3MUOA 3QPCA 4A15A 4CHGA 1B74A 2J9ZB 1XX6A 3HFSA 3P71T 5FBQB 2PRZA 3E7FA 3PRJA 2IZ0A 3L1HA 5CLIA 3V7FA 4GEGA 4GX5A 4IH9A 3OF2A 4BNHA 3SSAA 3S2IA 3H42B 3VZCA 2VHZA 1U8EA 5KOYA 1CUCA 2CJXA 3GL9A 4J29A 5EQFA 3UGJA 4GMXA 1U63A 1K8XB 3NFYA 3K7EA 3VR2A 3FTNA 1LPMA 2O4UX 3GWZA 1LW6E 1C0EA 3M4XA 4MYCA 1BWPA 5BSUA 1CUGA 3ZK8A 2NM0A 4JT2A 4BP3A 5CCXA 3PF9A 2ZWOA 2HFKA 4MYRA 1KJ8A 4OHRA 4P4UA 3E7XA 5ELLA 2XYHA 3ZD8A 4F84A 1RACA 1YCFA 1OFHA 2O4CA 3RK4A 4E88A 1EXVA 2I87A 4U9UA 2M6RA 2HQBA 2FA9A 1GV1A 2I3DA 2BF7A 3ACCA 4I6JA 2YRWA 4AJ1A 2ZUCA 1TTHA 2WAOA 5KEIA 4I8DA 5K0GA 3Q3GE 2ZJYA 3GROA 3M9XA 4NMHA 3UJDA 1FYXA 4WY8A 1J1ZA 4BFVA 2RBEA 4PPNA 1QP8A 3I2KA 4C6HA 3R7LA 5BUCA 3HU2A 4BEJA 1W36C 3KU1A 4TZKA 1S8NA 1QDEA 3D8SA 3LW8A 4XOIA 3WNDA 2JBHA 3CZCA 5EMNA 1S2LA 3CRVA 3NM5A 1PR1A 4R9RA 5KTNA 3C8UA 3D6JA 4MH0R 4F3TA 3QVLA 3QPAA 1DC8A 3U7GA 4BTEA 3FCUB 3KUUA 1VL2A 4DIKA 2O23A 4NWIA 4ZEOA 3F4KA 4JI7B 2P4HX 1HDGO 1DTWB 1JSZA 3REQA 2HU2A 2WILA 3DHEA 3NYWA 2C2BA 4MUNA 2VDUE 5ICFA 4D9IA 3RUHA 4DIEA 4OAQA 3ZPXA 5F76A 4FQ8A 2ZB3A 2CGEA 2O50A 3EJ6A 3KBBA 3NV7A 3DTVD 4K9KA 1YI0A 4Q24A 2UZIR 3H6KA 3LLUA 4RK7A 4X3PA 4GR5A 3Q3JB 1M75A 1XQVA 3ZCUA 3RQIA 3TRJA 1VYTA 1W87A 2ABWA 5E7MA 4LYEA 1PX2A 5E95A 2ATCA 2PZAA 4GKVA 4HXFB 1RRPA 1GZSA 2OCPA 3IBCA 2Z2KA 4GOKA 1KQOA 2NVWA 2PMCA 4GYYA 4ETWA 1W19A 3GN2A 4RFVA 4GX2A 4P7BA 4RU1A 5AESA 3VTAA 2VRNA 4MROA 4EJ6A 5EHXA 4W4TA 5JSZB 3GRZA 1QV7A 4A8HA 1WZCA 3IV7A 4A27A 4DL9A 4LZLA 5KYTA 2L82A 5SYAA 1J20A 4KVFA 1COWA 1A7JA 2AG1A 1Q50A 4ASUA 1U0JA 1T9ZA 4JC0A 4M37A 4R8VA 5AJVB 5A05A 4EY5A 2CFOA 3GT0A 4DADA 2QTAA 3UCEA 4G24A 1NBWB 5D86A 2ZUFA 2PLFA 4YCNA 4MEJA 1SC6A 2AG8A 5CX4A 4K46A 1EYZA 3JD1A 4B7XA 3TEJA 2PZEA 3JQAD 3U4CA 2EV9A 3PGLA 1KF0A 3N0WA 4O2AA 4B5LA 3F8SA 3B1VA 5BSRA 3W3ZB 1KFBB 5BSTA 1BNCA 3AHCA 3KZKA 3GG2A 1L3BA 1A2OA 1XGKA 2XRMA 3TMYA 4BX0A 2ZZNA 3AY0A 1TMKA 3PC8A 4Z7OB 2R8PA 4BOYA 2O3UA 3P2OA 5G40A 5IYZF 3A4TA