4QARA

1.45 a resolution structure of ct263 (mtan) from chlamydia trachomatis bound to adenine
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
195
structure length
195
Chain Sequence
MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVLKTWGYRGVVQALSPPPSGYDLWINAGFAGAANPNIPLLKTYTITSVKELTPTTSVEEELEVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYTTREGQDFLKNNKVKLSQKLAEAIFPIYSSFID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CT263
publication title Structural and Biochemical Characterization of Chlamydia trachomatis Hypothetical Protein CT263 Supports That Menaquinone Synthesis Occurs through the Futalosine Pathway.
pubmed doi rcsb
source organism Chlamydia trachomatis
total genus 55
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qarA00
1RYZA 1V4NA 3EUEA 3E9ZA 1Z35A 1V41E 3LBAA 4R2WA 4JOSA 1JDTA 3E0QA 4OEHA 4EARA 4TS3A 3EEIA 1K9SA 5CXQA 1NW4A 1RXYA 2A0WA 1JYSA 4M3NA 1RXCA 3FWPA 2HSWA 1CG6A 3OZEA 4KN5A 4M1EA 1JDZA 1LX7A 3EUFA 1V2HE 4LZWA 4GLJA 3LA8A 3KVRA 1Z5PA 1SD2A 1VHJA 4TTIA 3FB1A 1JP7A 3UAVA 3P0EA 4QAQA 1Y6RA 1ZL2A 3KHSA 1A9SA 5CYFA 1T8WA 1Y6QA 4R2XA 2H8GA 1OVGA 1VHWA 1JDUA 4TTJA 4QASA 4QFBA 3QPBA 3KUKA 3DDOA 2PGAA 1QE5A 5EFOA 4OY3A 3OZCA 1PBNA 4E1VA 3OOHA 1Z5NA 4NSNA 1PK9A 1G2OA 1Z33A 5F7ZA 1JE0A 1Z38A 3OZBA 5CCEA 3OOEA 1OU4A 1PKEA 3FOWA 3UAZA 4MCHA 5CYGA 4TXMA 1V3QE 4WKCA 1TCUA 1A9PA 4DAEA 1B8NA 1FXUA 4R31A 4TXLA 4RJ2A 1RXSA 3UAYA 1CB0A 1Z39A 4WKBA 1A9QA 1B8OA 1SJ9A 3GB9A 3OF3A 3DPSA 3BL6A 1TCVA 2I4TA 1U1CA 5ETJA 1T8YA 4TTAA 4NS1A 3PNSA 2OC4A 4H1TA 4F2PA 1RR6A 3P0FA 2AI1A 4U2KA 4TYMA 1ZOSA 4D98A 1RFGE 3ODGA 4F2WA 1PK7A 5F7JA 4TXJA 4WKNA 1JDVA 4QEZA 3NBQA 5DK6A 5F7OA 1A9TA 2BSXA 3O6VA 4F1WA 1ODLA 1T8RA 4F3KA 2QTGA 1K27A 4L0MA 3BJEA 5F7XA 4NY1A 1NC3A 3PNPA 4JWTA 4YNBA 5CXSA 4BMYA 4D8VA 1SD1A 4LNHA 3OCCA 2ON6A 2A0XA 1C3XA 1YRYE 4GKAA 1A69A 5F78A 3DF9A 2OXFA 5IU6A 1LV8A 1A9RA 1SQ6A 3U40A 3FAZA 4PR3A 3GGSA 1TGVA 4I2VA 1JE1A 4DA7A 4DANA 3F8WA 1WTAA 2AI2A 4LKRA 4OJTA 2I8AA 4DARA 1TGYA 5EUBA 1Z34A 3BGSA 3E9RA 1RXUA 1Y1RA 4F3CA 4LDNA 2A0YA 1Y1SA 3IEXA 3MB8A 4DAOA 1OTXA 4PNPA 3K8OE 3NM4A 1ECPA 1PWYE 4BN0A 1N3IA 3OPVA 1ULAA 4QARA 4WKPA 2A8YA 4EB8A 4K6OA 5F77A 1RT9A 2AC7A 2HWUA 3PHCA 4YJKA 2B94A 1RSZA 5FAKA 1XE3A 1T0UA 4OF4A 1V48A 3FUCA 2OC9A 1LVUA 1YQQA 3BSFA 2AI3A 4L5AA 3INYA 5B7NA 1ULBA 2OECA 4QATA 3KU4A 2QPLA 3UT6A 1ODKA 2XRFA 4D8YA 4JP5A 4ECEA 3NM5A 2QTTA 1U1DA 1PF7E 3SCZA 1Y1TA 5CCDA 4DA0A 1PR6A 4P54A 5F76A 1JPVA 1I80A 1T8SA 4G41A 1PR0A 1TD1A 4D9HA 3MMSA 3T94A 4OGKA 5B7PA 1OTYA 2ISCA 4YO8A 3IOMA 1PR2A 3ONVA 4G89A 4D8XA 1Z5OA 1V45E 4TS9A 1ODIA 1YR3A 4DABA 2Q7OE 4DA8A 3EMVA 4UC0A 3KVVA 1YBFA 4OGLA 4L5YA 2QDKA 1PR4A 3UAXA 5C80A 1Y1QA 5IFKA 4L5CA 5JPCA 1PR5A 3D1VA 4MARA 4M7WA 1Z37A 5K1ZA 4TXNA 4GMHA 1Z36A 4WKOA 5B7GA 4TXHA 1VMKA 1Q1GA 4DA6A 4LNAA 5KB3A 1A9OA 4FFSA 4G8JA 4GLFA 3PHBE 3OZDA 1U1FA 3NM6B 1U1GA 4YMLA 3UAWA 2IQ5A 3DJFA 1K3FA 3LGSA 5F73A 5B7QA 1RCTE 2HN9A 2P4SA 3ENZA 3DP9A 2HRDA 1U1EA 4X24A 3KVYA 1PR1A 1OV6A 5EPUA 1M73E 3K8QA 1JDSA 4BMZA 4IP0A 3O4VA 4L6IA 4BMXA 1YQUA 1VFNA 2GUWA 3FNQA 4MCIA 5I3CA 1OUMA 3TL6A 3C74A 1NC1A 1ODJA 2QSUA 2RJ3A 1PW7A
chains in the Genus database with same CATH superfamily
3A70A 1P80A 3ZHUA 1ZIPA 4G1EB 3DD1A 3FH0A 2PRKA 3BMQB 1XNJA 5DI3B 4ZCIA 3OMWA 1SWVA 2JFYA 1CRPA 2QN3A 4QGHA 3T5GA 1G0OA 1W19A 2I1WA 4NBLA 4ZOLF 2VJLA 4EQZA 2ZRJA 2C5LA 5KYNA 2E5LB 1UP4A 1XLWA 3IL2A 3IVCA 5I7WA 2PS0A 4B47A 1S8AA 3E8SA 5C3UA 3CIFA 4O5AA 2YOGA 5ABPA 5H0IA 3ORHA 3EEIA 2OFXA 1UKAA 1C9NA 4BC0A 2UVDA 5I9BA 1YXMA 1IJFA 2QLBA 4INPA 4IZHA 1L4KA 4XFDA 3ADBA 1E2EA 4QZVA 2C5BA 1BN6A 3IALA 5I5GA 1JXMA 1KSHA 2HPHA 3G7UA 2FVYA 3FPFA 5EJGA 1SVIA 4YMVA 4ZXPA 4LNUA 1QHNA 2UAGA 2RH4A 4PEVA 5T4EA 1Q1AA 3OUTA 5GADl 4FKBA 4LZPA 1LGYA 2FZCA 1CY2A 3C2QA 4KKVA 2HA2A 2JHCA 2R6R1 3VDNB 2YIDA 1V2HE 2QORA 1KAMA 3LP6A 4MTCA 1Q0SA 1H6AA 2JFVA 1IG0A 4M83A 4KSCA 1ZNXA 4BJ1A 1J25A 4QYIB 4KQ1A 2JFHA 4FYIA 2F3QA 3A6KA 4BZPA 1GO2A 1ZH8A 2P2DA 2Z2XA 3K1YA 1QQ5A 4LYHA 2C96A 3JQ8B 4FKZA 4MO2A 4EQ6B 1JP7A 4HTAA 4IDQA 4BVLA 2PN1A 6ADHA 1JX6A 4KMRA 3SSAA 1EFPA 4OBEA 2DKOA 3WHIA 3IAM6 1NUSA 1Q3TA 1Q92A 2Y77A 2ZW9A 1DP4A 1OGIA 1PR9A 1ZLYA 3EODA 3ESQA 3QFSA 4Q3AA 5DF1A 3ZQ4A 3LW8A 1PP4A 4BGEA 5TB5A 4DFDA 4JJEA 2YZ2A 5JAIA 3ZH9B 3L4JA 2FRVA 1B42A 1VHWA 2WF8A 1Z26A 1PLKA 4KIGA 3PWZA 5HXAA 2G7ZA 2A67A 3KAQA 1E6EA 4CQMA 4QFBA 5IK2A 1O08A 3SYNA 2ZZMA 3FPEA 5U4QA 4AUEA 4DVGA 2QI9F 4V1CI 1IWPB 5JQGB 2GEVA 2GF9A 2JGNA 2O7RA 2VWGA 2F3PA 5HG0A 2JLBA 5D00A 4QA9A 4F8YA 2JGJA 2NSDA 3B8EA 1GPLA 3BWBA 1Y33E 3GPDG 4M60A 4OY3A 3MLAA 2CUZA 2OO3A 5FNVB 3HQ4O 1QRTA 2D13A 2IHJA 1X87A 5MFPA 3HO1A 1KI6A 2QQGA 3A6LA 1G6OA 3CY6A 3GWGA 4G5XA 4PHFA 3ZIUA 1LSOA 4K86A 4JAVC 2PWZA 3GHHA 5MFZA 2FXVA 3WZ2A 3DD5A 4ND8B 4ZV4A 3NTLA 3FCYA 5KQPA 3B7WA 1ICEA 2VL7A 5C35A 1I8TA 2FZWA 4P83A 3VZQA 2O19A 2OOKA 2R7KA 1PKEA 3KU1A 4IOJA 3FDXA 2O2IA 3K2EA 2WWRA 4HTFB 2CK3A 1FJHA 3FFBA 3BMXA 5EIBC 3UAZA 5JBQA 2YJNA 2WPDD 4YV2A 2G5GX 1IEQA 3T1VA 1JECA 2L18A 4W7SA 4EKGA 4TXMA 4A92A 3O95A 4JVLA 2P9JA 2DU8A 3DAYA 2PXAA 1L4YA 3P2IA 2ACWA 3GLRA 4BZXA 3ZJTA 4DJFC 4QQRA 3B6JA 3R5SA 5EQTA 1T8UA 3KE8A 3LH5A 1LZKA 1U0FA 4YJ2B 5DNAA 3WA6A 4KUEA 3WK5A 1XDUA 3CRRA 1EI9A 4PE5B 3HBJA 4G4JA 2TYSB 5J47A 2GH1A 2X9GA 1Z0KA 1NVXQ 2EGUA 3UAYA 1G3RA 2EBHX 2GRAA 3F1KA 3L6RA 1XCBA 1XRMA 3DM5A 1CEYA 3BK7A 4MYRA 4NS4A 2WWGA 4RUKA 2B8NA 3RWOA 1XF1A 2QLFA 1SKBA 2QN2A 2PLRA 1KL7A 1EDBA 1HK7A 2X8BA 4R9RA 3ZWMA 2YWHA 3O1IC 3ZCUA 1S0UA 2JZNA 4YUXA 2JGMA 1HDZA 1YCGA 4D4HA 2J3LA 3JZMA 1XDSA 3DE5X 4ZIRB 2KJQA 4WAUA 4KSBA 3NOVA 1QORA 5K8TA 2DGDA 2ZI5A 1M0EA 2HJ9A 5CT8A 2OENG 5I4BA 2NZUG 4RXUA 2AFIB 1RI3A 4KXYA 5HRCA 3OEWA 1N5MA 2HQOA 2IC5A 4U63A 4I7EA 2AFHA 1WPGA 3PHIA 4G25A 5TLSA 2RAPA 4RH3A 2XBUA 3JAMA 4C22A 4MW2A 2C92A 3AL0C 4A73A 3HU5A 3A9RA 5EP4A 2G8LA 1OFTA 2FGJA 4R41A 3F8TA 3RLIA 5I7VA 2QT1A 1EX7A 1ADYA 4MW4A 7MHTA 1XEXB 3CWQA 3IRVA 4I5DA 1EBFA 4ZV7A 4CFSA 4R1LA 4UPVA 3NBQA 4NHOA 3TPFA 2NXWA 4ISBA 2P1ZA 1QXSA 1ETUA 4WXYB 1SK9A 1U0LA 1JFRA 5GZ1A 5FOSA 3EB9A 1QVWA 1KNQA 2QTGA 4PPGA 4OPMA 3OO0A 4HFMA 1OFGA 2DWCA 4QWMA 4DNXA 1QAMA 3E7DA 4JITA 5CK4A 2I55A 2X86A 3KPWA 1RRFA 2Z0MA 1T3TA 4UEOA 4X8LA 1ECLA 4TKLA 4MTLA 2DP4E 3R0VA 3AI2A 4RTJA 4CF4A 4DMHA 2PIDA 3PNPA 1EE2A 5BN5B 4DZRA 4YNBA 4DCSA 3H7IA 3JQBA 1T29A 4Y30A 4O2RA 4BU1A 5J5CA 1IDN1 1WXQA 1XC7A 3U3RA 3NHRA 3N2NA 3E9NA 4B34A 2VXCA 3H42B 5CFQA 4B44A 1U2QA 4LYDA 2O0KA 2UU9B 5J5VA 3ZIDA 3NVKI 1E32A 1Q6YA 2RH9B 3GX1A 2ZBPA 1FTQA 3S8EA 2OM6A 1B73A 1WCIB 2AJBA 2VDRB 3DF9A 3K9GA 4I4TB 4WV3A 4NH4A 4ZVUA 1FXSA 3GJRA 5AJTA 1ULSA 2Z8YA 2BGLA 3TRFA 4RPJA 1UAAA 4YTEA 5DNCA 2BFDB 1K6JA 1RTTA 3MWEB 4D26A 1YR1A 1XRJA 3RYCA 3V34A 4D4IA 4MDYA 4WE3A 2W11A 5BUZA 5IJ9A 2MR5A 3BJZA 2CE7A 3F4LA 3QX8A 4FFBB 1N0HA 1HDXA 2I4LA 4TKUB 4E6EA 3LL4A 2R6CA 4FBGA 2DR0A 4KXNA 4CEHB 5EZYF 1LSJA 1A97A 3M82A 3IBGA 2ZSFA 4ILKA 1RW4A 3RC1A 2LIVA 3GJYA 4UU7A 2I6QA 2KQUA 3CB4A 2WNSA 5EYPB 3EOZA 2PZMA 3V1LA 4REOA 2WIDA 2OLEA 3HG7A 5D1NA 2QN7A 2A33A 1P5FA 3I6IA 5KMGB 3ZDDA 1UM8A 4GVPA 1YOBA 2XBMA 1DWQA 3B3AA 2DETA 3RB8A 4MQ5A 3D0OA 2PZAA 3USZA 1IWBB 3MQ4A 4WNAA 5ISMA 4GW3A 2AMJA 3LDAA 2XYHA 4RELA 4TLDA 4UVEA 2OZLB 2XPCA 4IXMA 2UVPA 1DQZA 1R0SA 1L3IA 4UDOA 4CM4B 1U7XA 4HGQA 1I24A 2CXSA 1HE8B 1JJFA 1JMKC 3O9ZA 4IMPA 3BQ9A 4GBED 4WFKA 5GGYA 1TLFA 2BR5A 3SIRA 3AQIA 4ID3A 1PCXA 1XJQA 1KERA 2IPNA 3HBLA 5FPYA 2GAAA 4D6YA 1SA0B 4FYMA 3JALB 3LL7A 4FZVA 3PD7A 1IZ9A 5HJ2A 5E4FA 5L40A 4P92A 3GPBA 5FAKA 5BVHB 5F21A 3WK8A 3RVPA 4MS4B 2G9RA 4RM2A 3WRYC 4DQ0A 4D99A 1XK7A 2YHIB 1V6SA 2AJ8A 2B99A 2FVXA 2GASA 4GBJA 2OC9A 3EMBA 4ZVRA 3AY0A 1NOIA 2J46A 4RLHA 1TFRA 2ZJZA 4ZO6A 3UWOA 5C1OA 1NMSA 1YIAA 5K0CA 3PGXA 4B71A 2ERXA 4X92A 5BT9A 1GDDA 2PS3A 2PSJA 5J2UB 4MJ7A 1WZ2A 5FYQA 4QRDA 1THMA 2GERA 3SS9X 2IEAA 2B83A 3JASB 3T3DA 3T7KA 3KU4A 3B5IA 4XWTA 3PDWA 1K68A 3CCBA 4JLNA 5BO5A 3T7EA 1DE0A 5KREA 1MDBA 3GA7A 4JP5A 2AOWA 2XKJE 3C3KA 3MS4A 5IJ0A 5JD4A 1ETHA 1W5TA 4UOZA 2G9UA 2H2WA 1WMAA 3CEPB 3IV7A 4G01B 4Q7QA 3ZJVA 3WOVA 4Y2QA 1A7JA 3FNIA 2MYNA 1FSGA 2C7VA 2MYPA 2BHNA 1JHMA 1LPAB 2AFHE 2G04A 2FZLA 1GZHB 1IMOA 2GNPA 5EGSA 5KOHA 3IQZA 4K6HA 4ZQCB 4XX1A 3WSTA 4RPGA 4EHNA 3CH5A 4L7VA 2ECKA 3HKBA 5DM4A 5AJYA 3NZEA 5TX7A 4H7IA 2XXAA 2ZR9A 1V6AA 1W36D 2X5XA 2Y66A 1UZNA 1Y80A 2PVCA 4JT2A 4ND7A 1XXHA 3CR7A 3I0MA 3V4PB 5T6MA 5H3LA 4RY2A 1DC3A 4RORA 4JKOA 1LPPA 1UIRA 4CG3A 4I3FA 2JIZD 4XUEA 1PJTA 1NVFA 1W0CA 5C8YF 2NYAA 3EVCA 3LMKA 4BLPA 4DWVA 2JK1A 3QENA 1N3YA 3S99A 1PGJA 4GBMA 5KYGA 5TMEA 1GUYA 3MA0A 1Z4MA 3OBBA 4M88A 4U7GA 1WSDA 5A9RA 3NHBA 1K3UB 1H5QA 5CHYA 2CVZA 1Q0PA 4H35A 1CZNA 4PLVA 4PZZA 2EX0A 2IZ1A 5BYKA 1ODTC 3KKOA 4LBWA 3IURA 4QQFA 3LCVB 2IBMA 4RTQA 4QJBA 1W29A 3UJCA 4PNHA 4CDRA 1AN9A 4UCQA 5CRIA 5BSHA 2WKWA 5HGXA 3KZKA 4C14A 5G41A 3DMPA 4D7AA 5BR8B 1KI3A 1E99A 2ZOSA 2EZ8A 1YL5A 1RWXA 1A98A 1F7VA 1V45E 4NPCA 2EP8A 5CLJA 1ZI8A 1MOQA 3PL5A 4NZYA 5AHKA 4EBBA 1UFRA 4XCQA 2HEIA 3D8RA 1YDGA 3IIIA 3HN7A 4BLUA 3KYDB 3QXCA 3OY7A 4L8VA 2LE0A 3TO5A 5BY2A 4IICA 4EFDA 3WNCA 1USUA 1A5SB 4DCVA 2QRJA 1SXIA 1ULUA 3WL7A 1P5RA 1Y6JA 4EI7A 1D6MA 1MJNA 2IOHA 5REQA 3S81A 5I8ZA 1XNRB 4C7JA 2BHLA 4PNZA 4KPGA 1XWFA 1UM9A 3V2GA 3CH7A 3UAXA 4CLEA 2ENWA 1IVSA 3DDUA 1ULHA 1W1IA 3FZEA 1P74A 3NJ8A 2IXAA 2W0SA 3PD1A 4U3JA 2GVDC 4U39A 3DNPA 2Q7DA 3LX4A 5IFKA 3PQEA 1B26A 2W2KB 4C4AA 3BIOA 2QG6A 3CWZA 1KO8A 4NC9A 3JQ9C 4MARA 5FWYA 3MSXA 1QIMA 5E6SA 5EKXA 3ZW7A 2FEXA 4FK8A 1ZM4A 5LDHA 3L92A 4HGPA 3TTYA 1K5GA 1CZHA 4DRXA 5K1ZA 1W5AA 3ZD6A 3LBFA 2Q5FA 3HXPA 3ZNQA 1K5PA 4M2LA 4NCHA 2JI7A 2C7OA 1IAVA 2XYGA 3U3MA 3OURA 3WK6A 2HDNB 3BC1A 4ETIA 4INZA 3QKSB 4Y1RA 3IP9A 5F35A 2IXGA 2PQMA 3R7FA 2QE7D 4HOYA 3UJBA 3VNBA 4ANFA 3R9XA 3QELA 2QUZA 3IHLA 5CW2A 2LWIA 2CZQA 5CBPB 1IBRA 3E9MA 2PSHA 4XWYA 4JC5A 4GLFA 4N5LA 1PJQA 1JG6A 3P0RA 3I39X 3S7TA 3H5IA 1NUHA 1RQRA 1PW5A 5JS8A 1K75A 3AU8A 5C7OO 3ELUA 1DWUA 5JWRA 4TOIA 3P97A 4HX2A 2ZI7A 3K4QA 4JJAA 1W88A 5HUQA 3NLLA 5I4KA 4F92B 1PWXA 4BXOA 2A1IA 1G17A 3TFQA 3LQ2A 3ZY5A 4DLSA 4O4LF 3BWDD 3R6WA 2BD0A 1Z08A 4M98A 3ORQA 1N9GB 3BICA 3S7ZA 2QM8A 1BD4A 1A1SA 1TM1E 1GFIA 1E2HA 4G0YA 3WBFA 5IKEA 3H5RA 4M0CA 5ITSA 1C14A 1RKVA 4DLRA 2ZS7A 4MYCA 4BCDA 1V8FA 2VYVD 5I7EA 4F4FA 5GIPE 4MIEA 3ZWXA 2PQ6A 3O4VA 4DMCA 4UARA 4ZYTA 1YTLA 3WV5A 3REQA 1NXXA 2HNBA 3NKVA 3BWVA 3WKAA 2C8LA 3F98A 1EUDB 1IBSA 1MH9A 1QGYA 2W6JD 2PUVA 5E4YA 3RUEA 3VU8A 5AVQA 4NXMB 2I2WA 2XMDA 5EKDA 2C4MA 4MQMA 5TDHA 3H13A 1R0RE 3PL1A 4MGYR 4PHTA 1V96A 5FWAA 3UJ7A 5AW1A 5EJ2A 1P4AA 2FQ1A 3U61B 4JQYA 4L2IB 1SBYA 3HFGA 3UXHA 3CLUC 3HVUA 2OGUA 4M9ZA 2O2SA 2RJ3A 1RYZA 4RHXA 5JLAA 3W2GA 1V4NA 4Q15A 3NP9A 4XE5A 3TLYA 2ANCA 4BBZA 1GDHA 5BSFA 1Y5MA 3ZJ4A 1MGOA 3E9ZA 821PA 1XXHE 1X7YB 4R16A 3NGXA 3NT4A 2RG1A 4RIIA 3H75A 2PEZA 2IXFA 1CB7A 5HZKA 2A9FA 3BFVA 1I10A 2ZBEA 4AICA 1ZM3A 4BP9A 3AY7A 2Y0BA 2ZYAA 5ERGB 4P3OA 3VM6A 1RMQA 5BNWA 2D0DA 4BP8A 3BK2A 4BU0A 4G24A 1NW4A 1K2VN 5G3ZA 3I05A 5AVSA 5FBRB 1P9LA 1RPTA 3ASYA 3ECSA 1YUNA 1Z5UA 2W58A 3L8MA 3MN1A 3DMTC 4WINA 5EGNA 4JI5B 2VP9A 3GJTA 3SICE 1PFGA 3UENA 2YN4A 4DEVA 5D7BA 3RV4A 2VTVA 1Z88A 3EXG1 1G291 3TN7A 4N65A 1KHTA 3F6BX 3I73A 3EGEA 3RK1A 5JDCA 4GP6A 3EN0A 4YAEA 1DRVA 3S6JA 4NVRA 4UNPA 4G5QA 5DLPA 2HQRA 3O3CA 3ONNA 1V37A 2W2TA 2O0JA 3KLNA 3EUFA 1XAIA 1SCBA 2P2NA 4PR0A 2FXIA 4FMDB 4NL4H 1INLA 4K46A 1SD2A 2WHEA 2VQEB 1EM8A 3LC0A 1E9EA 2Q2WA 3R41A 3CG0A 4FGJA 2VJAA 3IDSA 4NYJR 4PBRA 4R2HA 4WK0B 4CF5A 1TU4A 3UICA 3FB1A 1JQBA 3ZE8A 1G4UR 3OOYA 4TLLB 1N2HA 1V7PC 1XALA 4L4ZA 4XTCS 4E08A 3R8FA 3ORSA 1WUJS 4ENTA 5FUVA 5CYFA 2LKCA 2O2DA 5K0EA 2VAPA 1GRRA 3VSAA 3TD6A 3B1JA 2R1VA 3RVOA 5F5XA 1P6UA 4WLUA 4RTOA 4MINA 3PEEA 1LK0A 5DEOA 5KNDD 3O90A 4BGDA 1QRUA 1NV8A 2DOKA 1JDUA 3DQPA 2D0PB 2FR1A 3A4MA 3LHIA 2CHGA 3QUTA 3F67A 3UAOA 2FMIA 5KINB 3TE7A 1C3VA 4FDVA 1QGUB 1UMCA 2F43B 3NBAA 3KKNA 4BBJA 1WSWA 3V2HA 2R96A 4WIAA 4RIFA 1GPBA 2AHOA 5ALYA 3RVLA 3NYWA 3NKFA 4AM8A 3IEMA 4YRFA 1K5DA 1O95D 3DUFA 4LOJA 4O4HA 3DVRX 2R6FA 2JLWA 1A4IA 3C6QA 3SC3A 3U9LA 2F62A 4DY4A 3Q3CA 3UV6A 3DAPA 6REQB 4C03A 5H70A 4E1VA 1TAGA 1Z5NA 1WW3A 1XK6A 2JA1A 1DL5A 2HIMA 4JLOA 4XUDA 5EQDA 5HTOA 3DEHA 4WW0A 5HIKA 5LOVF 4XQCA 1STOA 1V8ZA 3OQVA 4EG3A 3DZCA 3BMOA 3PQDA 1OWLA 3C4JA 3KV3O 1N2XA 3OZBA 3OOEA 4ZQBA 3VH2A 1XRPA 5CCEA 2YWXA 1P3JA 8LDHA 1EWYA 5I45A 3N87A 3V00A 3KTDA 2VJKA 2EVWX 3ZDFA 3G0OA 1I5OA 3LFHA 4G1BA 2BFAA 4LXQA 4NBVA 7MDHA 5FV4A 4RKFA 5HUHA 1G5IA 3ZWNA 3K0BA 1P2GA 1PJZA 5ALOA 2PQ0A 4JT4A 1T1IA 1BQEA 5DCUA 2NM0A 1SHJA 4CV3A 1NPTO 1Q21A 3MVEA 2K87A 3OE7A 1K6MA 5T5QA 3O0TA 2BTEA 3EGDB 1N2CA 1QTNA 4LDQA 3RROA 1SQSA 3HB1A 1OAAA 2RHTA 4GI7A 3QEAZ 4BP3A 2PSEA 2O52A 4B3XA 4OMUA 4X94A 3ZWYA 3NTXA 4KXVA 3IB6A 2AJDA 3OF3A 3C3DA 5AVOA 5IM4A 1YR6A 4QTXA 3C98A 5ARCA 4OJNA 4ZI5A 3ADCA 2XY4A 2RHOA 1YU9A 2EKQA 1B6TA 2R7AA 2QY9A 2DSNA 3SY8A 3TLXA 4A16A 1BQ3A 2Q0SA 3RYHA 5A3SA 2WP0A 3TLMA 5DNYB 4TTVA 3TEMA 1N0WA 3RODA 4H1TA 3IVXA 5BV1A 3PEVA 4QOHA 4JLWA 4B45A 1BEZA 4JJFA 4Q12A 2XHZA 4TX1A 2JGDB 3N05A 3D7MA 3AEYA 4KWEA 4WLEA 1PN3A 2PKQP 4NZOA 2EW8A 2Y92A 1MJGA 2QP3A 3MS7A 3EXEB 4F3NA 2P4UA 3MINB 4O08A 1W47A 5JUWA 4I1YA 3QF4A 4R7ZA 4DLZA 1X1SA 5F7JA 4EF4A 2GYYA 2Z95A 4NOKA 1WNTA 1FUKA 1L8QA 5C4MA 4AULA 2DERA 2XWQA 1AHNA 4ZN6A 2GEDA 4RM3A 1Y6FA 3BREA 1RQXA 3UT0A 3NT5A 2QVZX 1SOUA 3ODPA 3PC8C 3QNMA 4G9GA 3COWA 3O6VA 4MAFA 4EGQA 3DV2A 1FNNA 4B3MB 4DV6B 1KY4A 4BNUA 2C98A 4QUKA 1AQIA 4IDAA 3CPEA 3FYHA 4B43A 1T4DA 4YP9A 3KS9A 3IAM1 2X0EA 3OTHA 4TT3D 1RACA 3SJBA 4WY8A 1P2VA 4P7JA 4RVUA 4F3RA 4Y2YA 4ENPA 3W5CA 5E7JA 5F52A 2VTKA 3PIIA 3ZE0B 4RF2A 3BX1A 3KT3A 1HFKA 2YXDA 3HEMA 3RFCA 5A3RA 1VJCA 2F3RA 4BFYA 1M66A 3N75A 2DHDA 1C3XA 1P77A 1C1XA 1V0JA 3B9QA 4Y98A 4ZT7A 5TEVA 4BNIA 1L5SA 1NP6A 2HMWA 3CNNA 3RM3A 2A14A 2ARKA 2G1JA 2AJCA 3GU3A 4OLBA 2GD6A 2YINC 4HQRA 4KBGA 4XX0A 2IS4A 1OZFA 1UBHS 2D2VA 2YZNA 2H7CA 4ZYLA 1I2AA 3ZGOA 4Z7JA 4FN4A 4PQYA 2KSQA 1AD2A 2B69A 3EPLA 2AZXA 4DIUA 2DQZA 2ILTA 3F74A 3AY3A 3KALA 3DTVD 3Q2KA 2WOOA 5CK5A 5F33A 3S5JA 5KHLB 1WZCA 3QG5A 1WHSA 5FQNA 1J1UA 5E38A 6ABPA 2EX4A 4URHA 4O2AA 4M49A 4Q00A 1WQ1R 1KKUA 3JRNA 4ZK2A 1W8IA 2O8CA 1ML3A 2EKZA 2GEFA 3RYTC 1WVIA 2PHZA 3N39C 4FZRA 3T5BA 2QGZA 4I4LA 3WFJA 2IHUA 2J0EA 4IEEA 4KWIA 4QUEA 2DT8A 4P38A 1FFXB 1PS9A 2W9XA 3BGSA 3G8AA 4RHFA 1SIOA 4Y9RA 4EO9A 2GM5A 5KNCH 1ZN8A 1XTJA 4TL6A 5DHQA 2AMLA 1SCNE 1FU7A 1FTWA 2FDCA 1JR3A 2B92A 5SY9A 3PC7A 1FSZA 3WWDA 2XDQB 3PQ8A 1L8AA 5SYNA 3OICA 4DBLC 2IY9A 3T7RA 4AJHA 4B35A 2J5BA 4N18A 4MMYB 1SEPA 1TUGA 1AUOA 4MWCA 1DIAA 3MS2A 3WHPA 3WISA 3D1LA 4OVKA 2F67A 4A6XA 3KJFA 4HQNA 3OQIA 4OHOA 4P86A 1SU8A 2OQIA 2ODTX 4N9WA 1L4HA 1QK3A 2FPLA 3K6JA 2QYOA 4JFAA 3N76A 4P08A 1LA2A 3TB4A 1LQ2A 3OOSA 4MW5A 4F1JA 4HDRA 4YJ3B 3IVMA 4CR6A 4E14A 2EKPA 3HCRA 4BZQA 3LPMA 4R9SA 3LC2O 3K31A 1BDHA 3O1LA 2HBYA 1R64A 2XVYA 5FUYA 2W5UA 2BFMA 1L5KA 2L42A 2BEUB 4XIJA 1XHEA 3S1LA 4B3DA 3CSUA 3MCUA 3TLBA 4BYMA 2VDJA 4YJKA 2B94A 4MP6A 3AM4A 5FD8A 3U1TA 2NTNA 5EWMA 1T2FA 3R9WA 2DSTA 3KWLA 4NENB 5JZ9A 2JLZA 4D4LA 1LVGA 1DAHA 1N2CE 2BTQA 2VF5X 4YDRA 4UPEA 3EGIA 2PVPA 1MH1A 2H51A 4M1YA 4GWGA 4AWXA 2QVLA 3V8VA 3AUKA 3UCXA 5KOYA 3IVAA 5B7NA 3WS7A 2IGTA 3QKTA 3AHJA 3CLHA 4HNUA 2ZT7A 1RWOA 3WC4A 1HTBA 4MV9A 4WT7A 2MOKA 3LXMA 4TSFD 3BQNB 1Y4DE 1EVKA 4L72A 4PC2A 4E5KA 2HA3A 1X3LA 2QD4A 2C03A 3T3EA 2D2EA 5BW6B 1O5TA 4FD3A 2J1LA 1MEEA 3TG8A 1EFUA 3C6BA 2ZS9A 1EXVA 5FLKA 2WZBA 1D2AA 2C0CA 4XOUA 5F1OA 2O4CA 1SH7A 2R7MA 3FVVA 5LD2B 2P9BA 4OX9B 1XPJA 1P8JA 2K2WA 3AKDA 4GI5A 3KQLA 2AOUB 3HYSA 3N2IA 1VLMA 2VZLA 4BTVA 1HPLA 2O5RA 2OCGA 1AV7A 5L3QA 2OZEA 5GVSA 5JH7A 2Q6LA 1JJVA 3AEUB 1T24A 4HLUC 4UD2A 3H2KA 3OFVA 4HP8A 5CG1A 4DQLA 2JW5A 1TQ2A 1SHZA 4OQYA 2BFFB 3FBWA 1AGRA 3TH5A 2A1TS 3BCUA 4KMMA 1S4QA 3LVQE 4F2DA 3SZ3A 1GQRA 4BLSA 1S7CA 1M2JA 1ONSA 1Z12A 3WRWA 4CM9D 4WQMA 2HA6A 1ARZA 3HBMA 2ZUTA 3O8LA 4Y6SA 5KO2A 4MPRA 3G0IA 1B6GA 1J2YA 1CQZA 2KLBA 2ZU0C 4OGWA 4C4XA 3IAFA 1Z4QA 1GN9A 2NPOA 3P19A 4IPTA 4LIPD 2BKXA 1NW6A 1XI2A 4HB4A 4QUAA 4HX5A 5H7XA 3WGLA 1GG8A 4JBGA 1J8VA 1RMTA 3B38A 1SC3A 3ND9A 4YPOA 3FGNA 1KFBB 2X2OA 4MQUA 3IT2A 3PQ7A 5AW0A 1UL1X 4G89A 4PZDA 1N5KA 1IONA 1B00A 3QM1A 3QTLA 4YIKA 1HI9A 2GEUA 4GZ3A 3A9SA 1V25A 1W76A 1K86A 3BJIC 3EYWA 4HPJB 3T38A 2VHQA 2OORC 1Q15A 3PXUA 3PX2A 4MEJA 3SR3A 4DABA 2ADOA 2ZT5A 1K3TA 5CNMA 4MR7A 2AW5A 4I55A 5JFOA 5IXYA 3THYA 1II8B 3K3PA 4OHCA 4OM8A 4DA8A 4ZMSA 3GMIA 1KOJA 1UOOA 3H9BA 1T1SA 3LHDA 4V1CA 4U8GA 4Q4HB 2HTEA 4PO3X 4LWOA 2HSEA 4I36A 3NG1A 3ZEAA 4GP7A 4YI5A 2WTNA 4ENVA 3R3JA 1M3SA 2V7QD 5KJ1A 5AMXA 2NUTA 2WM9B 2Z2JA 3MFQA 1FJGB 3PNLA 3GLGA 4HEJA 2VF7A 3D3NA 3GLFA 4WNCA 1DS6A 4F5WA 1EKXA 1OASA 1QR6A 2ECFA 3NDIA 2ZSIA 4YFVA 3TZHA 5LD2C 2JASA 2WKRA 2BLNA 4R54A 2BIFA 2B0CA 4N41A 4C3OB 2F3TA 1DKRA 4K03A 3G5TA 4QUJA 4J29A 1JR3E 4YHHB 4TSKA 1ESMA 5JE8A 4HH3C 3W7AA 2W6ID 2NQ2C 5CDUA 3MT8A 4IWYA 1U0RA 2JI9A 5K3FB 2HA5A 3LYLA 3EBLA 5FL7D 4ARZA 4WKOA 4N5DA 4I8IA 1T4BA 2PZ8A 1KYXA 2RHBA 3CKKA 1I0ZA 4QNNA 1QBKC 1I3CA 2CDRA 3GLSA 4ZOCA 5ERYA 1HH4A 4CMIA 4DA6A 1D4ZA 4CJXA 4BIIA 1E6LA 3I64A 5T8KA 3NBKA 1GAEO 5EWLB 1YMQA 4U7JA 2JJ2A 4S24A 5I7AA 4ZEXA 5B1EA 2EGGA 4MVCA 2GN0A 1JFFB 4IOLA 5TQJA 1KQOA 4TYPA 1OSNA 1YS6A 3T5MA 4FYJA 2W37A 2ID4A 4Z0NA 3JU3A 1AH2A 1N2ZA 1OYOA 2BEJA 4FYPA 5CA1A 4YMLA 2OILA 2P6UA 3DH0A 3KL2A 3THXA 4I6GA 3V7NA 3ENVA 4NAVA 3C3PA 4F96A 4KGVA 2YV4A 1YS4A 1Z4NA 2CXHA 3KOMA 1WSAA 2EYUA 3GZNB 3R76A 3ZGYA 1QGDA 4HZUB 1N34B 4X8MA 2JAUA 1CJTC 1GG5A 2HRDA 5BN1A 3TG2A 3RSFA 2IP4A 2J48A 3IE2A 3OZXA 4JLDA 3PFIA 3VNAA 1MQ8B 1Z75A 3P2MA 1WWKA 2DT5A 3GJ5A 5SZHB 5BV8A 3ZY2A 2QL9A 2Y1DA 2AOTA 2VDMB 2ZSBA 3BKWA 3HR4A 3QJYA 4R2IA 4DIOA 3ENQA 4RULA 4DV5B 4JOBA 5IBQA 1ZK3A 3G79A 4UCWA 3WZLA 3U4MA 3HUEA 2RGWA 3KQVA 3VOTA 4D44A 1MXHA 3GUYA 3EC2A 3ZS8A 3HWSA 3LDFA 4F3TA 2LCFA 1AU9A 4K6GA 4LQCA 1UDAA 2BBOA 3L84A 3RHFA 1CYDA 3PHLA 3NGLA 1IWOA 3OZIA 4EY4A 1G3UA 2MDTA 5DYGA 5CYPA 2PZLA 3LGAA 4JJ4A 3H9EO 3LO8A 1ODJA 1SXQA 2OVBA 1IZYA 1PW7A 4NESA 1G3IA 4RGVA 2EZ4A 2FPUA 3EXFB 2B20A 2ID7A 3F90A 4UTXA 4MYHA 4YCBA 3VNVA 3R6TA 5B1YA 2G0AA 2OQRA 4UE6A 1G59A 1H2FA 1YA6A 2EWMA 2ZB8A 3O8BA 3U37A 3UWSA 2GEKA 2VAMA 5D8DA 5ALUA 1JT2A 3CRW1 1ESZA 5EHGA 2IE8A 2NXJA 1Q3HA 3BIXA 4PZPA 4EFMA 4XWGA 4HDSA 1XRSB 1M6VB 4WL0A 2OXEA 3RJ9A 1UXGA 3R6LA 3NALA 1DJQA 5K03A 3NDJA 1XG5A 1Z82A 4LYJA 3H0CA 2CCGA 2QX7A 1EG2A 1XTPA 1P5HA 1TJ4A 3B5EA 3ZZTA 4BNKA 4I6EA 2A0WA 1T9GR 1MB0A 2BGKA 4GM0A 5CVJA 5D01A 3ROQA 1SK8A 3KXIA 1KY3A 1M0WA 2PKCA 2PRJA 1OJLA 1S2OA 1H8EA 2YHBA 4M9CA 3AXTA 2QUBA 1MIOB 3KM0A 5LA6B 5JCXA 1ORTA 4OK5A 3H9CA 1VG9B 3D2CA 1DAFA 3U7JA 1T9DA 1Q11A 1QG4A 4EDHA 2KM1A 3WMFA 4KE6A 3BJRA 1W36B 3S28A 5AHWA 1BHSA 1SR8A 2JJQA 1MX5A 2O2EA 1DUSA 3BA6A 2E5WA 1V6CA 4O2BF 4OP1A 5FADA 3B1YA 3UWKA 1ZW6A 1PYGA 3KFVA 4KO3S 4O2AF 4NNJA 5I4CA 1V1RA 2IOFA 2JI8A 1PQ4A 3OFKA 3R0IA 4C1NA 3X44A 2XOKA 3RUFA 3THRA 1E8MA 2JJ1D 4HDKA 4XB1A 1EMDA 1DPGA 2I7DA 2F17A 5KYXB 2BM9A 9MHTA 2O6LA 2XUHA 3T35A 5KQGA 1JJ7A 2EC5A 2GJSA 5JNWA 1BD3A 4G0NA 3B7GA 1Q91A 3JZDA 1K92A 2GXQA 1SC4A 1NQ5A 1QAOA 1JVNA 1DEHA 1I4OA 5TQ0A 3UJ6A 3JQFA 3UG7A 5HX7A 1KZ9A 3BRWA 5BSKA 3O3NB 3GLGE 1X39A 1YMUA 2RIRA 2DHRA 1MQ9A 3HXTA 2REXB 3MTDA 2WHPB 4D3SA 1XQ1A 4EEXA 3CF4A 3GRAA 1NJGA 4CMAA 3WLHA 2O5EA 3P2EA 4AU1A 4L3VA 1GGJA 3DFKA 5A9SA 2P27A 4UZFA 1Z68A 1XU4A 3OJ0A 2BH9A 3COJA 1CT9A 4G1UC 4X95A 7AT1A 2I4MA 3GT3A 2VPZA 1NVTA 2CBGA 3AF6A 3B8HA 2X2EA 1UF9A 3K2BA 1PBNA 4ZODA 1E1CA 1LTKA 5LYJF 5E9JA 2ATXA 3M2TA 4ND1A 1O8BA 1CY8A 3GCZA 1PK9A 3MK31 2NV0A 4IQ0A 3N8IA 4R2KA 4QSHA 3VU3A 1A5BB 1CUAA 3IE1A 1UDRA 3P9ZA 5F7ZA 1NBMD 2ALJA 2O2ZA 4EFLA 5ECWA 3P9NA 4M9UA 5JSZB 1JWLA 3ZV5A 1R4ZA 1QH1A 1WV1A 2DMRA 3OWHA 5DXJA 3UANA 1KY5A 1H6BA 3ZDXB 4YLGA 4EELA 4ZZ1A 4DR7B 3FHJA 2QPTA 1WE2A 3C85A 1XP5A 3M83A 1GU7A 1T0HB 5KTTA 3ZGNA 1JKXA 1JG1A 2ERCA 2ZQYA 1KBZA 3BIJA 4RH0A 4U7WA 2AR0A 4Y9UA 3DS8A 1O4VA 2EIHA 4E03A 1NA5A 4MRNA 3S5UA 2XMQA 1YOVA 4W1SA 5FOTA 1S8NA 2P0EA 2C1EA 1OFIA 4HRAA 1EUCB 4NEQA 3USCS 3GMTA 4K6FA 4LSWA 1CUFA 4H1HA 1KFCB 3PNYA 3TD9A 4Q1AA 4B4OA 4DAEA 4DMRA 2X0DA 4V0KA 2Z83A 5KU7A 2GDJA 5K8LA 3ZUPA 1RXSA 5KWEA 2FSIA 4CEJB 4MDHA 3ZQUA 1LK7A 5TIIA 2R1UA 4LE2A 1FDSA 4K6MA 4BTLA 2JF0A 5KJ6A 4JJIA 3U7GA 5DYNA 3DPSA 3VX4A 1DAPA 1OIXA 3CUSA 3OLWA 2QSJA 5AIBA 4J4BA 1KVRA 4F9FA 4GPAA 3OMXA 3IQEA 1E1RD 1YKFA 4N03A 4FGWA 3SQLA 4TTAA 3L9WA 3FI9A 4K6KA 1HLPA 4RL6A 4DYDA 4NS1A 4NMHA 1A77A 1EU1A 4BMVA 1SBIA 2FWRA 2RKOA 4LPKA 2QUAA 3N2YA 3QEMA 3QE0A 4EUHA 5I7HA 1KDTA 4K1XA 2W0MA 4YT8A 1FP4A 1WHTA 2A9RA 5KYWB 1JIVA 2AI1A 2C77A 2EF0A 2BRUA 2P4EA 2FWBA 3EEOA 3BXOA 4YBZA 5MDHA 4ZYVA 1L4FA 2NQ8A 2H5JA 3KB1A 3HGQA 1A95A 5EJ8A 3OX4A 3NR2A 4YRCA 2TS1A 3T0GA 3FOEC 4AB1A 3BHJA 2BZ0A 3B6IA 3H1GA 2G9VA 1QIEA 3QIVA 4JFRA 3RIXA 3TBHA 1QQAA 1L5HA 2Z6QA 4RZQA 1X1TA 2WTAA 4YC7A 1A5TA 3IFSA 1YR9A 1EK1A 1OB2A 2WWHA 4RFLA 2VP4A 3DAGA 4QIHA 2X0FA 3UN1A 4CMGA 3RUDA 4GUDA 1LKZA 2BFCA 2FLVA 1SBTA 3O75A 4HYTA 3K70B 2HK6A 5KYVA 1ZAYA 4QPJC 3ZXIA 4BKPA 1O96A 3SBDA 5JMTA 4CFZA 3KSUA 3H6KA 3QVTA 4V39A 3AERA 3VA7A 2Z56A 3P0IA 4WDRA 3ETGA 4LDAA 1BMQA 2WAYA 4M1KA 4YXWD 4KVGA 1NR1A 2JLSA 5AM3A 1Q14A 3PWTA 3ZNNA 3N6XA 4GH5A 3LUDA 5M7EA 3MGAA 1TA0A 1ADGA 2F3SA 4JT9A 5IJXA 4XWKA 1Y63A 5M04A 1FS6A 2X40A 4KQ6A 4H7HA 1DAOA 1EFVA 4WN9A 4BVJA 3ORYA 2RJNA 2QKYA 3C16C 4N40A 2ZUSA 5DNEA 4BLWA 1H0HA 3GCXA 2ZIEA 3A37A 1YRLA 4PN7A 4DWJA 2J4CA 1Q7EA 4GYJA 1XQYA 1G21B 4Q4JB 1DC5A 5DTMA 2RK3A 3LYAA 2H1HA 4LBVA 3MTBA 2V55B 4NV1A 1ZFNA 2DG2A 5JI3E 2R5WA 3FHLA 1ATZA 3DMFA 4AUNA 4CV0A 3MWLA 2FR0A 3HCDA 3FMOB 1JEYB 1T34A 3PENA 1JE1A 1YZLA 2O2JA 4M6WB 1R0BA 3EXIA 3IP3A 2JS7A 3F8WA 2HHJA 5TMPA 5DM60 4B32A 1BYUA 2E4VA 3LP5A 4LKRA 3BRCA 3I2KA 1Y5RA 2C83A 2YXPX 3EEFA 4HEA1 4MOWA 3KJXA 1TGYA 1N1GA 1ZDMA 2BMVA 2FSPA 2ZB7A 3AHIA 5DPMA 4E32A 3DBIA 3Q9LA 2QJOA 1YFKA 3RJ5A 3QXXA 4LMAA 1Y1RA 2BT4A 4L4RA 4D92A 3L4BA 2P1DA 2Z4SA 4JBLA 3E61A 3UH0A 4DDTA 3FHCB 3LY5A 3ZNPA 4JLJA 3TSCA 1FU8A 2V96A 4D79A 4NU6A 3N8GA 3QPVA 2UUCB 4C3UA 2ZAMA 2HRZA 5D3KA 1LZLA 4IIUA 3SDSA 1EVIA 5G1OA 2RH5A 2NAFA 4Y3UA 1NPYA 5EEGA 5A1TA 1LLFA 1US8B 2CVFA 3LSYA 1Y82A 3PYMA 3K70C 2QDXA 3A1TA 4MVJD 3KTFA 1QO0D 1XMJA 3AO0B 4HQKA 4GHWA 4BVBA 4LCJA 4E2XA 1SAYA 3RBZA 4U2GA 3BCSA 4DV3B 2BP7B 1GTSA 5FWXA 4EPWA 3KP1A 2HPVA 4IJUA 4D80A 5LP1A 2CLOB 2WYIA 3I34X 1O54A 3PLRA 2AC7A 5HKKD 5A3VA 4DXAA 2PH7A 2HWUA 1X74A 5BMVB 4B6SA 7GPBA 4UHKA 4D9CA 1SHUX 3RNOA 3LM8A 4X90A 1I0IA 2YIJA 3D8SA 3L02A 2BE9A 4EPTA 4DA4A 1AG9A 1NJ5A 4G97A 2JCYA 2XIJA 2DLDA 2FPPB 1XTRA 2D74A 3LX6A 3G2JA 4WI1A 4ZT6A 4PIMA 1IZZA 3BN3A 2FUG6 3CONA 4FYXA 3W3AH 1FA9A 1BNCA 2ZJ7A 2KB0A 3K5HA 1M33A 1L5WA 1O7JA 1FFCA 1OBVA 1KR2A 5IUJC 1GGHA 2XJ9A 3CZMA 3FRHA 5D84A 3DHWC 4TROA 1UIMA 1HDOA 3DE2X 3L6CA 3ZQKA 4C21A 3Q7QA 3LHFA 2G07A 4D5EA 3D8BA 1IZ8A 3BH0A 5EPEA 1SZJG 5JDIC 1J07A 1XMVA 3I3SR 5AKXA 2XOEA 3TPZA 2ZXFA 4JB2A 5K9ZA 5CDYA 3Q7TA 1SU6A 1COWD 4YH1A 2PMDA 2ZRCA 2ZYRA 6AT1A 1Y5LA 1X92A 2Q1UA 2FPGB 2IUTA 3RT1A 1Y1KE 1OAOA 2P3SA 4FFRA 3AF5A 2B98A 3I3OA 1Z0UA 2ZAGA 4TL7A 2PT9A 3MWJA 1L9XA 1MO6A 2EJBA 3DW1X 4FDUA 4W5QA 3GEDA 4YV0A 3I2IA 2J3HA 4YRQA 4L5IA 4Z3OA 4QJIA 5AVVA 1I2BA 4KN6A 5TR9A 5E7IA 2H57A 3M4ZA 5C9ZA 2C07A 1MW8X 3PR3A 3T61A 1WL8A 2HTFA 4ZVLA 4ZYXA 3W79A 1UAGA 2LRHA 3NW9A 1GPYA 4V38A 4DADA 2VEOA 2YBDA 1Y9JA 1OU0A 4JGIA 3N86A 1XCMA 1H4QA 1GPH1 1PQUA 1LXCA 1J99A 4DC0A 4C6TB 2V45A 1BS9A 2I3ZA 4FU0A 5I7RA 2SBTA 5ESWA 5CB6A 2NO7A 1RLTA 5LYYA 3I72A 3IIEA 4HZIA 3ROKA 5KQLA 3I2GA 4ZGGA 2RK4A 4D0SA 1OBHA 4KX3A 4KTVE 4INJA 4OA5A 2C4TA 3SBEA 1ORRA 5I9TA 1PUXA 2R8PA 2J9RA 2F48A 1PJAA 2J0UB 2PZEA 1OTYA 1Z8FA 4I9GA 4XEHA 2ZUEA 1IK4A 1NXTA 4D1YA 5IHXA 3MSCA 3PDIA 5CX1A 1Q2UA 2L2QA 2GKGA 3DNFA 3TX6A 3E5RA 1VBNA 4X6XA 5JO0A 3URMA 4XIGS 2DXIA 5FXMA 5JFGA 1IOZA 2RI6A 2NZWA 2WWWA 3NCTA 2N42A 2O4UX 1Y8ZA 3SZMA 1ISIA 5DWQA 5KVAA 4KAXA 5B3JA 4CTOA 3ET5A 2XW6A 2PL3A 4PVCA 3GT0A 3G68A 3NHJA 3SC6A 4BX0A 4ESEA 1YRHA 2YS7A 1E8NA 3KYCA 3AT1A 3M3DA 1GRNA 1LS1A 2FDXA 4JUIA 3PSAA 2NZXA 3GLHA 1IY8A 5AI8A 2PGXA 1EK0A 4AXXA 4D9MA 4ZEMA 2ZR7A 3GAAA 4FMPA 2GAIA 5ARBA 2PMWB 2VRBA 3PUWA 5LL6P 1C3EA 4X3PA 1TIKA 2IEIA 5JBIA 4XCVA 2XGSA 1RXEA 3H0KA 1CUUA 4F8EA 2XLBA 3BUSA 3GEMA 3WL4A 2OBNA 2ZEJA 4N5HX 5AWFC 3VR6D 1SXJD 1TAUA 3GIWA 1XDZA 2KMLA 1GL7A 3W78A 5H59A 5BMVA 2O1EA 2YRXA 1W9MA 1XAHA 4IHAA 4HB2A 2D1FA 1GCOA 2RB5A 3IUYA 4H27A 3TVDA 1ZI6A 2OXCA 2QBYB 1BE0A 3O9VA 4GF5A 4K7JA 4LTMA 4QU0A 2XZLA 2ZWVA 4TWBA 3OMLA 3OM0A 4I5GA 5JS1A 2W00A 3OT5A 2XSZD 5CT9A 2ZB3A 3H8VA 4PTYA 3TOZA 1OZAA 3HN2A 3RSSA 2R65A 3V7FA 2VTBB 3OESA 1AKYA 1FUUA 3ZZ0A 3OX3A 4XW2A 2UVQA 4DN6A 3KB8A 4H6PA 1AQUA 2ZAYA 3EVTA 3PICA 4RHEA 4W1RA 4QDJA 5EJIA 3W9UA 3WGNA 5KTOA 3PNBA 4RIHA 3OZDA 3QG1A 2CNDA 6CHYA 2OMKA 2VS1A 1SHKA 4PZUA 3MYYA 3EW7A 4KUGA 4Q9AA 3GNLA 1FFSA 3ZK8A 5DLYA 4GKJB 3UAWA 2HK7A 2FV8A 2RHRA 3AF0A 3FD8A 2J5XA 4IV0A 2Q3BA 4S35A 4HDNA 4A82A 4QSMA 2D5IA 3VGJA 3ENZA 5J4KA 1E0DA 3W6OA 4P3NA 4F9GA 5G02A 5CEFA 4LXGA 3WJ7A 1GGNA 2JG3A 4MJ3A 3U80A 1LUAA 1R37A 4X91A 1RYHA 1POWA 4NABA 2I76A 5JD6A 2G4VA 3G02A 4G0PA 1JHOA 1Z25A 2V6IA 1EFCA 1ZNZA 4KO8A 2VDWA 3PBKA 3DYBA 3AUFA 1J9GA 2LBPA 4CMCA 3ZWBA 4PRLA 3RYIB 1T3LA 1VOTA 4LGMA 1PQWA 3RS8A 2XGMA 2IWHA 4C29A 1AGPA 5IJZA 1CQPA 3OE5A 2IYOA 2Q9BA 2ZREA 4Q3KA 1G63A 1WDWB 1OY1A 2ZJBA 4REQB 3H8SA 3RFVA 3T12A 1C0EA 4EY6A 2P9TA 1HX7A 4EMBA 2ZYIA 2ZWAA 3GJXC 2JBWA 3QKRA 1A04A 3TB6A 3P5BA 4MWDA 3PDCA 4C5CA 1J0AA 1EFHA 4J3JA 1W5SA 2Z6AA 3FPGA 4NATA 4RA9B 2GLXA 1FLNA 5FPTA 2TSYB 5I9NA 2I8LA 1I3KA 4P22A 1DG9A 1X15A 3D6FA 1PX0A 1L5LA 5TJHA 3I53A 1JTVA 1N5LA 1F48A 2C59A 1N57A 3EGCA 3EXHB 1AF7A 2A1UB 1TK3A 1DFIA 3HRHA 4G67A 5C34B 4S05A 2XITA 5IH7A 2BR3A 2BV3A 2X7XA 1RWBA 5THXA 3EOAI 4XARA 1SVWA 2P2LA 1AY0A 3MMXA 3A0UA 2OHJA 5CJJA 1CW2B 4B2IA 2R97A 3PDJA 5ER9A 4B31A 3CKMA 4V2UA 1TJNA 2RGYA 4CKWB 4MAMA 4H9GA 1G2PA 1O94D 4LV5B 2AEJA 4XR9A 2YJ5A 1QSGA 4LS3A 4DMMA 1YSCA 2PGNA 2EZTA 2DEUA 3FF1A 4RY9A 3WLQA 1E2UA 4W6ZA 3KLBA 4J0KA 3QEJA 3R44A 3H4IA 1JIKA 2ZSUA 4M87A 4B0OA 4B1FA 5J4YA 1Z3IX 1TADA 4HWGA 1M2VB 1LJ8A 1DEOA 2JFGA 3ADKA 2VT6A 1C0PA 3T41A 1YAJA 3G6WA 4EM6A 1YA8A 3OT1B 4NYIQ 1CUVA 2P6OA 1N6PA 5HQ3A 3GYBA 3D02A 3P9RA 3DVSX 4P80A 1PI3A 5J2TA 1CPYA 2X22A 2OZVA 4P0QB 4E0BA 2RGBA 2G1PA 4JLBA 5ICFA 1XEAA 3V8NA 2WSYB 4G0MA 2JBAA 5H82A 3MTEA 2ZBQA 1V47A 3N3BC 1FLDA 3KBOA 4MVJI 3EF3A 5KIAA 1JR6A 2JFNA 1CE8A 4V3CA 4NOJA 10MHA 3LZDA 3AP3A 3NWPA 1UBGA 1S9HA 2C84A 4H16A 3L4SO 5J40A 1OTHA 4IKPA 3TOVA 1DX4A 5BSRA 2ZUFA 4P31A 4TV9B 2YC4C 3GLHE 4NYMR 3KYIB 4P7KA 1UPUA 4REMA 2QUJA 2XDWA 2AEFA 1D2CA 3BGIA 4KFRA 2RMKA 3KEOA 4MA4A 1P9RA 2VYVA 2XRYA 4JR2A 3FNEA 3GJ4A 4L07A 2C2OA 5CMLA 4AS2A 4EPYA 2E6KA 2W6PA 1ZCBA 5DXAA 5CA0A 4PLPA 3TR6A 3K0CC 4CQLA 2X0RA 1P2FA 1E92A 5EE5B 3VAZA 2W6JA 1L7DA 1DNPA 2PAFA 4HH1A 1QE5A 1A8QA 3DMDA 1NYTA 3EXHC 4OBBA 1YHYA 4RH1A 4AZTA 1ZD1A 4BZWA 4NBKA 1G5QA 4LMRA 4R01A 3MC1A 3KZXA 4NDNE 1YR7A 4YJFB 2GD1O 2GM3A 3EDQA 2O20A 2A0FA 5T3YA 3KLPX 5CB4B 3E3NA 5JRZA 5LKAA 1A2BA 2OCIA 3GRPA 3MMNA 1A9ZA 1F4LA 4C0KA 5ITZA 5KWSA 4GRAA 4Z4IA 1EGAA 1GEGA 2CL7X 1QLJA 1KO5A 3N7UA 5EOVA 2VYCA 3N6VA 3UGQA 4BAUA 4ZHQF 1KDRA 1C8LA 2H4FA 1B6RA 1U4SA 3JQ7B 3OBIA 2OCKA 4FHEA 4H3SA 4NP6A 2IOYA 3SPXA 5IANA 2BZGA 3VPFA 1FMTA 1ZJ4A 1IY1A 2ONKA 1EQ2A 3BJMA 4B8ZA 2SHKA 3HCAA 4B48A 5FFFA 1R4NA 4ZVMA 2Q3EA 5FUWA 3HK2A 2ZUCA 4E31A 1KQPA 1T5OA 1YS9A 4DF3A 4DJDC 1XCLA 2H08A 1PBTA 3MWYW 3HE3A 4BN0A 2ZFUA 5JXWA 3F0TA 2QTVA 3NIFB 1U8UA 4Q3EA 3WYFA 3H5WA 2JARA 4TLCA 3A36A 4XJXA 4FWIB 3OPYB 3SQNA 4IHJB 1H9AA 4KQXA 2PNJA 3ZHRA 1DXOA 1OFHA 1T6YA 2W8BA 2YFHA 1QTRA 3IOYA 4IIDA 3VUEA 4KL8S 4TUYA 4Y2HA 1FFGA 4KR0A 3JY6A 5JARA 3E18A 3RUHA 1L4GA 1GYQA 3EA5A 4P4UA 4X6LA 1JIXA 1O0BA 2R00C 3CTMA 1MB4A 3L0BA 4TWRA 2C2WA 2O2HA 1CCWA 1GRCA 1K6XA 1QIIA 1CFZA 3BB4A 1JEQA 3MW8A 4OHWA 3AL2A 5HR5A 2JIBA 1FQJA 2JFPA 1AS3A 1AOXA 2AN1A 2J9FB 5JSKA 1XU9A 3GRKA 4IDGA 4KC0A 2CT8A 3N7AA 3PQ2A 4QPCA 3OU7A 2XUIA 2ZJ3A 3H2HA 3V4ZA 4KB5A 5E6UB 4KN8A 1W2WB 4NK4A 3PV0A 2LZ0A 3HCBA 3RRMA 4ZEOA 4WTOA 1WD5A 1M2WA 4FLFA 3CCFA 1H2AS 3T3PB 1X1AA 1P0MA 3AW9A 3TIIA 3TIVA 2JD0A 4B6QA 4Q34A 1FW6A 1IFXA 2YUTA 3UZUA 3WXMA 5JVDA 3SF0A 3C5HA 1KJQA 5KNDA 2HT1A 3EYAA 5B36A 4ZTZB 3T15A 3TCXB 3K9HA 1QKKA 1AX9A 2GLUA 4AUKA 3UJ8A 3CBQA 1I5EA 1VMIA 2IW3A 1KA9H 3TBFA 1CRLA 4B09A 2ZCJA 1QVAA 3GCGA 3GJSA 3KJHA 4YQYA 4EKEA 5A6SA 1GRVA 5F7OA 4A27A 2XCSB 2V7PA 1W93A 1O95A 1KRXA 2Q29A 3UVEA 1OWMA 3I01M 3O8OA 4U2BA 1FX0B 2V74B 2Y6UA 5ECGC 4IY1A 1ZI9A 2YNMD 4D9NA 2HV9A 5C4IA 3O74A 2Q1YA 1FOEB 4QGAA 2OESA 2Y4OA 3WQBA 5K51A 2RE8A 2XNDD 1G20B 4GLBA 2OEPA 2IK8A 3AZOA 3EA0A 1TPYA 1RDFA 3K72B 1BG6A 3IMEA 3PR1A 4NY1A 4XSHA 3IUBA 3UHAA 4ZEVA 4Z9AA 1KEEA 3WTBA 1OA1A 3NHMA 3RS4A 1N2SA 3L0OA 4BFVA 4L57A 1TMGE 4G0QA 3WYGA 4KVFA 2AFRA 4YI3A 3PJRA 13PKA 5AO9A 3IP8A 4RQBA 1DQYA 2V4MA 4DJEC 3T0FA 3NNSA 3TLZA 1OWNA 2VYNA 3GOHA 2CXTA 3QU4A 3BMQA 4HI0E 1MTOA 1TTQB 1ZNQO 1MJHA 1P4SA 1NZJA 1WB4A 4IDPA 1XJCA 3CLKA 4QREA 4BLVA 1TJ3A 5I51A 3FJYA 4BZZA 4G2TA 4RMHA 2Y93A 1EWKA 3TFOA 4N48A 2CLMB 2R8YA 1VRWA 2AR7A 4RU1A 5G4KA 1XU7A 1A9RA 4NOMA 2FE1A 3X1KA 1RRCA 2REQA 3I2JA 1CZKA 3PWSA 4KIFA 1RAGA 1T43A 4KLRA 3WLKX 1ORVA 3EZNA 3OZVA 1PZXA 3ETEA 4YHBA 1ZEJA 1KJIA 1E5LA 3RWBA 4ZI7B 1UINA 2R62A 3KQOA 3TOSA 1SVOA 2UUOA 3ZZ1A 2JH8A 1Y9DA 5EIXA 1H2RS 4EHIA 5TS2A 1Z2CA 1U6IA 3G1WA 3Q8MA 3E53A 4RF3A 1RXIA 4KX5A 1AMNA 4BPBA 3K32A 2ZPAA 4I5IA 1RM4A 2H4XA 3WGZA 1S3FA 4MUBA 5DN9A 2FSVA 2ZITA 4EI2A 4NPAA 5FPHA 1EE9A 2GJKA 1IN4A 1RQ7A 3E23A 1DEXA 5G53C 4D25A 4IEIA 5K0FA 2EDCA 2G7MC 1G3QA 5B2ZA 4U9IS 1O3YA 5JCOA 1BXKA 1CP2A 1RLUA 2PBRA 4HYYA 4K87A 1CYEA 1VPVA 1NVBA 4G9BA 2X42A 4WXMA 4OLAA 2VAWA 3LD9A 3HV2A 4LYAA 1W4RA 2FMTA 5F9FA 4CG0A 4HWTA 1OBCA 3ZV7A 1LW7A 3NJRA 5H3CA 3CH4B 3P96A 3HP4A 4OL9A 3VKHA 1H6DA 4L4YA 3N2KB 1Q0HA 4OMDA 2VP5A 3EW9A 1NY6A 2ZRPA 4D5GA 3QUSA 4CGZA 2A5DA 1FMFA 4WZBB 5AM4A 1T9HA 1QS0B 3HDHA 2LXNA 5LWHA 1XZNA 3B13B 4FBLA 1SULA 2QHXA 3HCPA 3QMMA 4OYLA 1LU9A 5KCZA 3IXLA 4URFA 1DG3A 2A7QA 1PUIA 1OHHD 2D62A 3F6EX 5HKOA 4OYYA 1Z7EA 1JKMA 3RWMB 2AE2A 1QWSA 5L3ZA 3V4VB 2DFKB 4LXTA 4AJPA 1DAGA 3PXDA 4KAFA 3W5HA 2CB9A 4CTNA 2WFLA 4QEDA 5F1YA 4UHCA 2W2QA 4MKXA 5KNLA 4R83A 2HPZA 4G07A 1E9DA 1UR5A 2GCOB 4D02A 1K98A 4NU5A 2H54A 4RZ3A 1DJMA 3LP8A 4LVNA 3A9WA 2G88A 3LHKA 5ED0A 3U9SA 1TO2E 4JV5B 1X0XA 3GN1A 1XZKA 4DR3B 4TLBA 2WKQA 3BFKA 1XKXA 4NOLA 1FRNA 3W34A 3VR0A 2W4MA 4E5UA 1NVGA 4IIJA 3W5VA 3PPYA 3R4CA 4PHHA 3OUZA 2ST1A 1EX1A 1ZMRA 2PPVA 4GS5A 4WESA 2ODWA 3QYFA 3SZLA 3TMYA 3VR5H 3I5YA 1UMDB 2R44A 3MJEA 3E8XA 1QPGA 2B82A 2MIIA 2W4QA 1CZUA 1JWAB 3WDMA 621PA 1PGOA 4RKWA 4LKOA 4GPD1 5CCDA 5KPDA 1H2XA 1ATIA 1TTPB 2I71A 1I4TD 4C20A 2ZS8A 4GYKA 3AB7A 1DV2A 4MV7A 1XMIA 1KZHA 4DR2B 5DIZA 2Z08A 1LVHA 1SPBS 3IDAA 1Z6PA 4IJ5A 5CVVA 3AI1A 3G1UA 3ELDA 1NQTA 3BG5A 4FFLA 1GSOA 3MUNA 1JQLB 5TPWB 3N8KA 4G41A 4OQQA 5JMPA 1ZCJA 3SQOA 3KXKA 3LT1A 4R1UA 4WCVA 5EIOA 4DHWA 3AR8A 1HY3A 1KORA 4BEVA 4PIPA 5JV5A 4GU5A 1AK1A 4HDOB 4ILEA 3ST7A 3QY9A 1CLUA 4V0NA 3K30A 2FW0A 2PXCA 1QZTA 1JDJA 3ETNA 4C2BA 2ZT8A 1NQUA 4Q4CA 3I5XA 5CB8A 1EBBA 2FP4B 3H8JA 5DX8A 5FFMA 3RYFB 1F2DA 5KZMB 5DHSA 4NU8X 2UYGA 3LF2A 3KWFA 4HMQA 4P35A 4F91B 3KOOA 2QYSA 3AESB 4AD8A 1L4BA 3QBTA 1EUQA 1GVNB 1AVTA 2Q5IA 4U00A 1U2RA 1QIJA 3H97A 3PUVA 3IMCA 1XNQB 1Z5OA 2FEAA 1CF4A 2A5JA 1SCQA 1BXGA 4GR5A 3GOQA 3B1KA 2IPLA 2B9VA 5HOEA 1Y7HA 4JI2B 2YV2A 2XCQA 2IHTA 2CMKA 1D2RA 3N59A 4QDZA 3O4JA 3IVRA 1DU4A 3F4BA 1E59A 5IVDA 5EMKA 1NUQA 4DV1B 4Q01A 2WHQA 4BO3A 1YBVA 3DZDA 2PLNA 4N3NA 3ONDA 1BX3A 4EUFA 3CLSC 5DLDA 2AC4A 3GRVA 3U81A 1UZLA 4ARBA 4RPLA 2ZETA 4TSFA 2Q49A 4Y9SA 1X80B 4I4CA 4N3AA 1FU4A 3ZJYA 4EHHA 2JFXA 3CLRC 4J75A 4U2EA 3T3OA 3M1IA 1LI5A 2G83A 1KVQA 3N0WA 2CLSA 4H7PA 4J7XA 4PYLA 2CMHA 5D3ZA 3UJHA 3TAUA 3KAPA 2CY0A 1CIPA 3PGA1 1QGAA 2GAOA 3GNSA 4CRWB 3TW4A 4M7WA 1O0SA 3AJ8A 5I5EA 4XCXA 4JLVA 4IYJA 5H9WA 5LOVB 3QEKA 5GJVC 3UT5A 3DVQX 1DCMA 1KKLA 1P2TA 4TXNA 3DL4A 4CU5A 5BRAA 4L76A 1N25A 2VQFB 5KNCA 1VJ1A 3TXXA 4FTWA 3C39A 2IW1A 3N0VA 4WFIA 4BMDA 4CM8A 3ECCA 3ZGZA 1XQVA 3LVFO 5IULC 3TKLA 3A4LA 3TW0A 3T1QA 5IWAB 3OQNA 3CO0S 5BXYA 4UBNA 1BE6A 2OV2A 4IJWA 4YP6A 1VL1A 2R4QA 4CTKA 4XYBA 2Y1WA 5FULA 5SZJA 3REFA 2P30A 1HG0A 3OE1A 3PJEA 1CX9B 2H6EA 3PDUA 4EPXA 1HRDA 4UPDA 4XQGA 5GINE 1U02A 1G16A 1P62B 1QR2A 1E4OA 2BCGY 2OUKA 2VJBA 3DMHA 3I37X 3D8TA 3D2LA 4M1SA 4FHDA 4UQLA 4BS9A 4CM9A 1CUEA 5FPQA 2HF2A 2IS6A 3HJCA 1YQEA 4R9NA 5IM4F 2HJVA 2Q0XA 3UBMA 2FSHA 1THZA 2NVBA 9ABPA 4G5SA 3T7DA 4RIEA 3KXDA 2B4YA 4AUMA 2NU7B 3D9QX 3OD5A 3W9SA 5IAKA 2I9PA 2B8TA 4KTTE 2GD0A 4AYXA 1NONA 1KKMA 1MO4A 2D2XA 4OH1A 3OSZA 4JLKA 2FFRA 3ZD8A 4RK6A 4G1FA 4YDHB 4EB6B 2VDUE 1KMNA 3JVDA 2GFHA 4H18A 1JEJA 2VJDA 2QJTA 2ATEA 3EGOA 3VJLA 1U28A 3AVXA 3TTSA 4HK4A 3RRJA 3NAQA 5CT6A 5BMOA 2XD9A 3TI9A 2DWQA 2QX6A 1ZGJA 1NJSA 1HOTA 1WY5A 2SKEA 1LDNA 1XO1A 3KJIA 3L1UA 3PG5A 4R84A 1F1JA 4WOKA 4YPFA 1PJ8A 3VVLA 1BO6A 5BP7A 1DVRA 4YP0A 4OB7A 3FCCA 5FA5A 4IO0A 4YIHA 5JEDA 1FRZA 2DPMA 1GGFA 1FS5A 1ZD5A 4Q0MA 3KKQA 1A2KC 3DWFA 3LUKA 1W87A 4JB3A 4K8RB 3RTAA 4PNEA 3MAAC 4YN3A 1S6YA 3RARA 1PJ3A 4L15A 2V7QA 1YC5A 2ZJFA 2VHEA 1C30A 1TF5A 3PS9A 5BVHA 2B35A 2BGRA 3A27A 1BROA 4IS2A 3LKVA 4QVKA 2QJWA 5F4BA 1XTKA 3IR5A 4WZZA 1JQ3A 3BCHA 5JAUA 3ITEA 1LSSA 2OK8A 2R8OA 1FUIA 4CMJA 2PT5A 4S2UA 5DB4A 3A3NA 2G5CA 4P5EA 1DBWA 5LWQA 3DCNA 3JXEA 1RWQA 1W96A 2A9VA 1RJ9B 3HSYA 4EIWA 2HYIC 1BGVA 3G5MA 3DKIA 4KR3A 4Z4EA 2GNOA 2PH3A 3BK1A 1OLXA 5FL7A 1DRJA 3IAS1 4YWHA 1U99A 1X86B 3SYRA 4RABA 4LWPA 5A5FA 3FZGA 1H5NA 3GEIA 4QHSA 3D3WA 1Y8QB 2OE2A 3DLPX 4MVXA 1SUIA 1TW2A 1YZFA 3L05A 4BKUA 1UODA 2KBEA 4H4CA 2XWPA 2K4MA 3H5AA 3OZEA 1C0KA 4PG7A 4DS3A 5LQRA 3EFOB 4AKEA 1GKUB 3CSSA 3DSRA 5AVJA 5B6PA 3LA8A 1GGMA 3D6JA 3QVSA 1D4FA 2YWCA 4WXRA 5IZCA 4QXAA 5IDXA 4A8PA 3EUWA 2Z3VA 1Y9AA 1BCRB 4RJJA 1JSZA 1ZLXA 4BV8A 4IGFA 4YQFA 1I1NA 2ZUWA 1UBEA 1U8CB 3KQTA 5LP6A 3KYJB 3NNDA 3PE6A 3GJ7A 1FNSA 1C80A 1MTZA 3OE4A 1QRAA 5I47A 1SQ0A 1ZXLA 2FX3A 4LFAB 3J7TA 4L78A 3UAVA 1Q6ZA 3ABIA 4DQDA 5JTTA 2R5NA 2CWDA 4JBXA 3SR0A 3OQMA 2VLBA 2VO1A 3NHAA 1A9SA 2RHLA 4PO1A 3U6KA 5JSFA 2I6TA 4RNDB 2BKUA 1ID8A 4FFDA 3DT9A 3WJ2A 3BGDA 4G0UA 1UMBA 1KEWA 3X1DA 2GN8A 5IF3A 2GK6A 2WUWE 3BCRA 1ODFA 3D54D 4QASA 5AKJA 4BE9A 2R2AA 3L5KA 4YYEA 4ENUA 2D1RA 1QMPA 3EG5A 1N6LA 2BF7A 5AESA 5L6LB 3MAGA 1GAQA 3C7KA 4GO1A 4LQLA 1PEKE 1P4HA 2ZI9A 4MVJP 4NDAA 3M9XA 4PXAA 4RDCA 3SFTA 3LUFA 4LXIA 1CUIA 1KYYA 3B1ZA 3MXOA 3SIPA 4MKFA 4CXMA 2DUNA 3BE4A 1D1QA 4X0EA 2AQKA 3KAJA 2HLNA 1C0IA 2FFAA 1C9EA 2MSKA 3E1SA 1CUHA 5JQGF 1E9FA 2PX2A 2ZVJA 5F5NA 3NUZA 5FOUA 5B6IA 5LU9A 1NURA 3U44B 1W5BA 3ZXSA 4E1AA 3HJFA 1Z38A 5CFOA 4CN9A 3RDPA 4YRTA 4OHMA 5AVKA 1N9ZA 1J1IA 1V39A 1LRLA 4JX9A 5FNVF 1RAAA 2ZIWB 4CMEA 4EJ0A 1UC8A 3EFHA 1V7CA 3FLEA 2VF2A 3WGKA 5BVGA 3OLZA 2OQVA 1B0PA 1SXJB 1XZLA 4Y18A 3KUCA 4ZAYA 4EATA 1BMFD 4CI9A 4R8RA 1BJKA 1WCYA 3CPSA 4JIMA 4W99A 1JUDA 5CVEA 1TUBA 4J94A 1YQGA 2W2KA 3UNXA 4QQNA 3AUYA 3CNLA 3F5DA 3GVXA 4ENSA 4HFRA 3VKGA 4NMMA 1P0CA 3B1XA 2GBGA 2YMPA 4UATA 3PK0A 1ZKDA 1GPUA 2BDUA 1HWYA 3N0XA 5TGZA 1P1CA 3TX2A 5IVHA 1JVBA 4TV8B 2G36A 2VOJA 3U2QA 3AEKA 2QIOA 1V8OA 3CS3A 1E20A 2IYRA 4YALA 1S8OA 1V3UA 3FNBA 2I4TA 4EY8A 4YJ2F 5FEUA 3B3JA 3UJPA 2JJ1A 3T7SA 3W1EA 4M99A 3WNQA 3E0XA 5GM1A 5JS6A 4BQOA 2HDWA 3CX8A 5DSTA 1ULZA 3IPYA 3A6ZA 1MX9A 3DDZX 3RU2A 5LFAA 1NX9A 4CKCA 1ND5A 2FRDC 1CUSA 1FXWF 1ZXXA 4C6HA 2NP6A 2FETA 2XA9A 1Q7GA 3ILYA 4HNRA 1P73A 1RKBA 2F1HA 2D8AA 3QKUA 4Y2TA 4LYYA 1PL7A 3C5VA 1ZD3A 1VLZA 4KNVA 3ZCRA 5A5EA 1Z9BA 2IHVA 1WY7A 1EJ0A 1YK1A 3S44A 5AI5A 2KLHA 4B82A 4D9EA 3I9KA 5KTRA 3NV9A 1UPAA 1BN7A 1IBKB 1CJMA 2DQYA 3IT1A 1IM8A 2FWMX 2PKYX 3IBFA 1H42A 4O0MA 3I32A 4AX8A 2V9ZA 2JJ8A 2P5UA 4GE3A 4GOXA 4TXJA 1NP7A 3FAKA 3FVWA 3BWYA 5EAIA 4FMCB 1P5ZB 4LBYA 4YCCA 3WLSA 2PS1A 4EL5A 2DCUA 2PXHA 3TAHA 5CTJA 3ESDA 1U04A 4BJ6A 1LI7A 4TN5A 1T35A 1NRJB 2DFDA 4L5JA 4AMUA 1DZIA 1SG6A 2IIQA 2DM6A 4EW1A 1FVXA 4DMGA 1Q7BA 2Y2UA 3KKMA 2Y1CA 5AJVB 1K27A 1L7AA 3IYLW 2B21A 3Q9NA 1OGJA 3DE6X 3QE3A 4TSRA 1YB1A 1P7PA 3KETA 2P9CA 3E05A 3EWNA 4QVGA 1NBMA 2D7DA 4F46A 1BCSB 4MZXA 4MYTA 3EF0A 4KOAA 3IQFA 4G09A 3DE7X 2JJYA 3RT9A 1FTNA 3TMAA 2HI0A 1N36B 2WV7A 4LE0A 4D8VA 3RK4A 3OETA 3UMBA 4ICIA 4O4IB 3EAQA 1XD2B 5AKIA 1M0TA 3GFQA 5JPIA 1FSPA 1E2NA 1MD9A 1UDXA 2ZRIA 1R5OA 1ZQ9A 2OHFA 3DOIA 2A0KA 4AROA 3HDQA 2NIPA 3I1JA 1E2GA 5H68A 4UAJA 1AHIA 1HZZC 1X7YA 1NQVA 2CJWA 2BH2A 5C5DA 1RD4A 2BI7A 4EPVA 4ZICA 1UJCA 3IBYA 4X7RA 3WTCA 3DZFA 1X8LA 5EQFA 1F20A 2Q45A 1TD9A 2XWJI 3AOGA 5F51A 3QLEA 1F38A 4PC6A 1GFSA 4DZTA 3RAEC 1P1KA 3FAZA 1QU2A 4NZZA 2ZIUB 5E9QA 1MT3A 5KI6A 3S8YA 1JIIA 3IHWA 2IEDA 3MF4A 1PD0A 1X6VA 4ME6A 1NM5C 4RTMA 4EEKA 5E4TA 1L3BA 1IBMB 2FGKA 3ZHQA 1ZPDA 4B76A 3T1HB 1YQTA 2JAWA 1L7QA 2D1YA 4I4TF 4MV0A 3AH8A 1USGA 3AKEA 1TQHA 1MUUA 2FDRA 3M34A 5DGDA 3DWGA 4Y1EA 3V3KA 3SMQA 3ZUGA 3VU9B 3ND5A 1JLLB 3R3YA 3M6IA 3Q8KA 4PWZA 1O77A 5KX5B 3OLVA 4AF7A 5BSGA 1KF0A 1WUYA 3FCXA 4PCLA 1N2BA 3P9IA 2JAOA 1EM6A 2FG7C 4YYZA 4DR1B 4GKKB 1F0PA 1UK7A 5DW3A 3KQPA 4IGEA 2QAIA 1JIUA 3N3AC 4IGAA 2CNBA 3ZXXA 3MD0A 4QEKA 4BO4A 2B3DA 4EI9A 3WRXA 1SUCA 1FYXA 5KYKA 1UMKA 1PT8A 3OF5A 1U8ZA 3NPMA 3PU6A 4BNWA 1DV1A 4F7WA 3NYRA 3OFJA 3BULA 1A4UA 2OG2A 5F2NA 1ZW1A 4Z54A 2VRCD 3I04M 1B3BA 3UXMA 3FYTA 3JYPA 2QP4A 4M9XA 5MF6A 4GM4A 3NCHA 1G5PA 2Q27A 3QOFA 4PTLA 4Z9FA 3BAFA 3QLTA 3R3SA 1UQUA 4GI3A 1JJBA 5ALZA 3HMKA 5C18A 1XFAA 1F51E 3K1AB 2CXOA 4BB5A 1DAIA 4OI2A 4KVZA 5FF9A 3A31A 2P9GA 4CZ2A 1O0CA 5ALTA 3SYTA 3KB6A 2OZPA 2X1VA 2GA9A 3WYCA 4CKBB 3SQWA 2F43A 4YXWA 2BSAA 2UXCB 2FG5A 1PHPA 1ZMXA 4DQVA 4Z4FA 3EZ2A 1YB2A 4RKQA 1R0CA 4L5AA 4YRPA 4EHJA 3NRBA 5CFRA 1MRNA 2B8JA 1XTZA 1EWRA 4OU4A 3AFHA 3DV9A 3K2QA 1N6OA 2WC1A 3RIEA 4B7CA 4BAZA 1E63A 3CRVA 2JLQA 3DZBA 4QBFA 1L5GB 5KVVA 2Q3DA 1N5JA 3H1TA 5ELXA 2XGGA 4QM6A 3I83A 1AS0A 5JTUA 3TUJC 4AZVA 4F4UA 1DBRA 4KRYA 2GF0A 1MV5A 5IKMA 3DHVA 3OA2A 4S1NA 3N6RA 1I4WA 3IR6A 1N5DA 2A2ZA 1NLUA 3CPHA 2BDTA 4RANA 4CQMD 3OECA 5IK2D 1ZUNB 5J2UF 3V4RA 4F45A 1E79D 2A35A 2V7VA 1L7RA 2YJTD 3U7QB 4NFHA 5HVNA 3G0BA 2P2GA 3QLUC 4QELA 1CNFA 4UUQA 1CJBA 1U7TA 3ELYA 4X6UA 4DC9A 2YFKA 3UHPA 3BXXA 5ESXA 3WB1A 1QP0A 1QRSA 1Y8RA 2WTUA 4LZOA 5HE9A 3TK1A 4JT8A 3BH6A 5BW8A 3ZU4A 2Q28A 4TTSA 1M1YB 3CEAA 2VG8A 3HWWA 4II3A 4NMXB 5IYZA 1ADBA 5JS7A 1XV5A 3FSEA 5JSYA 3Q3HA 1ZCZA 1NATA 2BMAA 4LZJA 1D2GA 3FVQA 3TQHA 2IDMA 1I6WA 2Q2QA 1TZ2A 3FNGA 5AJHA 2ZK7A 1TD1A 4R6XA 1GWNA 1NBME 3SF8B 2D3TA 3IEVA 5B7PA 3I6MA 4PRYA 1HLGA 2VAVA 3VMFA 1QO0A 4HDAA 1O6BA 3MWFA 4MUMA 4PYNA 1J33A 3H5VA 1ISSA 2E82A 2GVZC 3MZ0A 3DKRA 2NNLD 3EPRA 4FB4A 1UJ4A 5EIEA 2Z5VA 3DVAB 1NTOA 1OXVA 2X15A 2X8WA 4CODB 1RZ3A 1OX4B 4ZOEA 4Z7NB 2JLXA 3V8QA 1RU3A 4KODA 1T5IA 4PGFA 5ITWA 5HKKA 2PH5A 2Q5HA 4R68A 4DV7B 3RSGA 4HMPA 1VI5A 4DB4A 1EDDA 3EQ8A 4B7AA 2I87A 3UXEA 4ID9A 2B1RA 2H65A 2Q7OE 1ZHHA 1MDFA 4L7QA 5DXFA 2Z2ZA 4EG1A 3IUNA 3A1UA 4RDHA 5HBRA 3LTEA 3TMKA 5LMUB 2G6TA 4E88A 1DKQA 4PZLA 3EDOA 3C24A 3EIEA 1KYQA 5IN4A 3J80A 3AFNA 5ES4B 3ETCA 4XVHA 1ZWLA 1V35A 1KZ7B 1Z4PX 5ILOA 2I22A 2Q3FA 4MEBA 3GJ0A 1KETA 2OBBA 2PJZA 2VN8A 4RVOA 1P9WA 1Y1QA 5EQJB 5HA5A 1LDEA 5TF0A 4IJQA 2QX9A 3IC5A 1TEVA 2Y1OA 1HSOA 3FF4A 1D4OA 3OZSA 1D0IA 2VCYA 1Y1PA 5E2AA 2IH4A 2C88A 3D1VA 1RAEA 1YT5A 2QTRA 4HNAB 1UZUA 1ZC4A 4LJ9A 1COWA 3UOAB 5J1SB 4W9NC 3WGTA 2OWDA 3RE1A 3ICOA 1N5IA 3ETLA 5FUXA 2PFKA 2X13A 1QDLB 2QN8A 5M3BA 1YMVA 3AWIA 1BGWA 2NW6A 4Q5IA 4M86A 3MJCA 3D4LA 4I5EA 3CT6A 5IM5A 3KTAA 3W8DA 5AP9A 3GFGA 3R3WA 1KI8A 3VR4H 1T2DA 1QKJA 2ANBA 3RNLA 3UTDA 4BRSA 4BRZA 3OKAA 2VBGA 1DKOA 1UBSB 4WBNB 3PNKA 4OATA 5L7YA 4RD4A 3DAOA 2ZJ1A 4DSAA 1K7EB 2QW8A 3HKEA 5E2IA 3NMUF 2BFBB 2G71A 3C0KA 2VPPA 3H1EA 5EXPA 1ORHA 2HMYB 3V1KA 1OGYA 3L0SA 3C70A 1VXRA 1SUSA 3A6DA 5A7HA 4CVNA 4JX8A 3S27A 2OAGA 3RJZA 4MUKA 3GLIB 3AEQA 1KFEB 2ZBUA 4JI4B 3VTAA 1HFWA 5JFTA 4UVGA 1IXKA 4M22A 3VHXA 1FFAA 4YQZA 2PQ2A 2OD7A 4YJHB 1RJGA 1C4OA 1G64A 4PBSA 4WCDA 5I9LA 1PRYA 1QHYA 1UT8A 3VPCA 1IN7A 4UM7A 2PL1A 3QBDA 2W6CX 1RWPA 4RLSA 4XR4A 1W34A 1J2JA 4DJAA 2P6NA 3CVXA 1MQAA 1JDSA 2R1TA 3M8KA 2NZ8A 4BVFA 1YNSA 2FEMA 5TEWA 1QX3A 2IVZA 1EGVB 1ISPA 1QP8A 1VKJA 2VXYA 3KPUA 3QXHA 1APBA 4MQFB 3SD7A 4FXOA 4UEQA 3V4SA 2VJMB 3ZDQA 1P0QA 2PKWA 2GARA 4HMOA 2P4HX 1N0VC 1GTL1 2C9OA 4XPIB 4M0UA 5AVTA 1T9CA 3A6FA 1P75A 2NXNA 3TXYA 3LUAA 3RTCA 4A26A 4E21A 3A4TA 1REQB 2VHYA 1T3ZA 3NAMA 4WNIA 4F12A 1PLJA 3O82A 3JYQA 3HNRA 3RSOA 3GBPA 4O3FA 1YI1A 1ZK2A 1QH9A 5A5DA 4OYHA 4I50A 5E3IA 1QV9A 3D0RA 4TKVB 1I3MA 1HC7A 4OQNA 2QNIA 1IQRA 5FR1A 5JAZA 1H65A 3PXCX 1CNMA 4NENA 1PD1A 1O9GA 4LRYA 4UREA 1MG0A 4CCWA 3W5AA 2PKRA 2V1UA 1G2IA 3PX3A 1E94E 3DVLA 2BELA 4JOSA 1W581 4AG5A 4Z8XA 3VR6A 4BNNA 5IASA 2BUCA 2EW1A 4PLFA 5CNKA 5CFNA 2PWBA 4YRDA 5KJCA 4ZRNA 5CR9A 3I4LA 5IXJA 1X7WA 2JL1A 2IIBA 2OHOA 3VV2A 4JS0A 5KOJB 1BEEA 2QM7A 2YXNA 3CLTD 3JYOA 3LLSA 4WY2A 2XSZA 3K8YA 2EBWA 2H4YA 1IBLB 3IGFA 1AKEA