1FQJA

Crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
317
structure length
317
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
total genus 126
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqjA01
1KNQA 1T91A 3OEED 4BFXA 1QHHA 4HAXA 3BERA 5C46F 3GMTA 1XXHE 3WMGA 1NN5A 2XSZD 4L8GA 5JLJA 3MCAA 4UQOA 5EP4A 4CEHA 4TZ6A 1Q21A 2V8OA 4JT4A 1X3SA 4A36A 1P4SA 1VYTA 2FSGA 3AF1A 4KSCA 5GVRA 5KSPA 1UBGA 3D6TB 4AK9A 3RS5A 1VG8A 2EQBA 4KJZA 4TLBA 1SHKA 3THXA 2FF7A 3CONA 5ELXA 1G7TA 3QKRB 1OXVA 3BD9A 3GLIB 4G0NA 1LS6A 1CULC 5BN3A 4M8NE 3TRFA 1J70A 421PA 3BOSA 1VCNA 4IVQA 2CNWA 4DLVA 4B47A 2NPFA 2O8DB 2CXXA 4A0FA 2A78A 2F1HA 4IFEA 2ZRLA 1TQDA 2WPDD 4CIDA 3P26A 3ZQJA 3NDPA 4EKDA 1T3SA 1EWQA 4LX0A 2WJJA 2HXYA 2REBA 4L15A 1HT2E 1ZD8A 1E32A 3E70C 1A2BA 5JJIA 3BFVA 1DE0A 1Z3IX 3FFBA 1XTSA 2HYDA 3K09C 1KTVA 5IK2D 4MYCA 3W5IA 3ICEA 3KFXA 1YR6A 3T1TA 2JLUA 2DB3A 1VHLA 4BFZA 3AP1A 4RFVA 4C0LA 5FBRB 4ZDKA 4RCZA 2ZJ8A 2ZRNA 1CKEA 2QMUA 2WWHA 2VP2A 3U7HB 3X1WA 5FPSA 3OHMA 4URZR 1DAMA 3OIUA 1XZQA 2ZSDA 3B8HA 1G8YA 4NU0A 1LVGA 1IJEA 5EE9A 1AN0A 3FTQA 3UG6A 2XTZA 3HYRA 2GXSA 1FP6A 3IEVA 1U90A 1W48A 5FUWA 5AJYA 4FWTA 2D74A 4P31A 1E99A 4IVPA 4NONA 1RRGA 1NVVQ 3Q72A 3AVPA 3ZDQA 2NO7A 3EA0A 4A2WA 4DUGD 2Z4SA 2JIZD 3GJ6A 4A6XA 5JCPA 3OFNA 4KVAA 1G3IA 4X8LA 1KJWA 3HU1A 1NLZA 4JLPA 5LB4A 4PAQA 3AKEA 3AKDA 4I1OA 1NG9A 3I62A 4M1OA 3AH8A 3UIEA 4A1FA 1CEEA 5IRCD 5M04A 1XCMA 3NBZC 4GFDA 1CP2A 2OAQ1 2OO7A 2R8RA 3L8YA 3VR3A 4RFSB 2KWIA 3MAAC 2IYRA 5IHPA 4DT1A 1M6NA 4HATA 2XZOA 4PANA 4MRNA 5EE5B 5C1BA 4CEIA 4LBYA 2E87A 2X8AA 4U7DA 2QE7D 2BJWA 4B33A 1F2UA 5TV2A 3AKYA 5FTJA 1COWD 4HLCA 2CHGA 3HU3A 3KQHA 4Q1BA 2NMVA 3B7GA 3RWOA 3B6EA 3UXMA 1ZP6A 5C4MA 1KAGA 1GRNA 2FGJA 4JT2A 3NBXX 5K8LA 4LSGA 3D8BA 4PXAA 5H70A 3REFA 4A92A 1OH7A 2GRJA 1XTKA 4US2R 3B13B 4P0TA 3CW2A 3KKPA 1U98A 3FMIA 3QPWA 2QTHA 1J99A 1ZNWA 2WAXA 2XB4A 2O8EB 2QAGC 2W2TA 1E2NA 2ZEJA 2ZVQX 5KOYA 3VKHA 2PZFA 2CE7A 3FWYA 2H57A 1WMSA 2QL6A 1IONA 4BRUA 4LPSA 5CYPA 3U3OA 3ZH9B 2YOGA 4NDZA 3SI7A 3GLHB 4A8JA 1N0WA 4IDNA 4DLZA 4HZUB 3ZD6A 4TSFD 1KI9A 1Q44A 3WNBA 4QM6A 1E2IA 4TT3D 2IUUA 3PJRA 2IYLD 3ADBA 4ASUD 2B7CA 3B5JA 1XZPA 2BDTA 4MRVA 1SULA 2AK3A 1SKYE 4XVUA 5FPKA 3FKSA 4OKSA 2V3CC 1GITA 1E6CA 2FE4A 2GCPA 2OV2A 2YWFA 4CGZA 2QG6A 5A5GA 3GJ8A 1G7RA 2WWIA 4FCVA 3IHLA 3H2YA 1CJUC 1KSHA 2J45A 1RYHA 4G01B 2DY1A 1NIPA 3IILA 3QKSB 5FUVA 2QUZA 2BEKA 3ONWA 5FTKA 1IOZA 2QTVB 2BKEA 3QXXA 3LRPA 5AUNB 3IKJA 2VTKA 3GFPA 1JI0A 1NIJA 1G8GA 4Q47A 2PJRA 2W6JA 4E07A 1T6NA 4DEYA 2NO1A 3EA5A 2DFKB 1PVOA 2GCNA 2VRWA 2IYWA 3RWMB 5JEEA 1F2TA 2KB0A 2G9NA 1NG1A 1DAFA 3RRNA 4Z1MD 2GEUA 1XXHB 1HA3A 2L0XA 4LWZA 3U7GA 4M1MA 3ADKA 1AM4D 4OK5A 2ZQ5A 3QXHA 1ZM7A 2IYSA 2RGXA 3K70C 1EG7A 3AP2A 4ZI2A 5TXGA 1OW3B 2ZANA 4D82A 4JBXA 3P32A 1P75A 3MWJA 5D3QA 4ABYA 5FTMA 3NTUA 1G1MA 4FCTA 4EQ6A 2F1RA 3RDPA 1W4RA 4RD0A 3AQ4A 4EPXA 1XEXA 2P2LA 4NCNA 5AJVB 5DI9A 4ACAA 4DSNA 2YYZA 3L0OA 4BFYA 1R10A 1G5TA 1N6LA 4ESVA 2WJGA 1S3SA 4JLBA 3LXXA 4KU4A 3KKOA 2J5XA 4M9XA 5FR1A 1FNNA 1Z06A 2YINC 2AWNA 1G17A 2ZM5A 1W4AA 2QMHA 1OXUA 1J8MF 1W5SA 1G3QA 1SVMA 1Z0DA 2G3YA 4BE7B 4LUCA 3W9YA 2WWWA 3EIQA 3K70B 3A6PC 4LBWA 4QJ3A 1R5NA 2PT5A 3T35A 1W36C 5J47A 1CS4C 1YVDA 2YC4C 3B1ZA 1QG2A 2JLSA 1AGPA 1JAHA 2K5UA 2VHUA 2XXAB 2ASEA 1X86B 1MH1A 3B78A 1TF5A 1YZNA 2CNWD 1EX6A 1OE0A 4TYQA 3SBDA 1SKQA 1D9ZA 2I1QA 3K9GA 5JHHB 4NZYA 3CF2A 1A7JA 4OI4A 1XX6A 2D62A 4RKEA 4UNQA 1KMHA 1S8FA 2OCPA 4JYCA 3ZLJA 3B1WA 4BFUA 3NWJA 1Z8FA 4IJMA 1YZKA 1AS3A 4JLNA 4I81A 2F43B 3MFYA 1ZM9A 3AF0A 1SXJE 4GZMA 4JKYA 1S9DA 1II8B 1V5WA 3CX6A 4LV8B 4C0BA 3SDZA 4BFTA 3VKGA 3VR1A 3X2SA 3TBKA 4CW7A 1W36B 4TMTA 2RGGA 1W2HA 2FFHA 3QXSA 2HF9A 5HCNA 2VPPA 4HAVA 2QP4A 3LW8A 3K8YA 1VG1A 1AGRA 1EFCA 2QTFA 3GJ4A 4H1VA 5TY0A 3W6PA 4LYHA 3ETLA 4NMMA 1OYYA 3RNLA 3H84A 5G53C 5CK5A 5C4GB 2YOFA 4A82A 2EFGA 3CB4A 2RB4A 1XPOA 1QHGA 4AKEA 1DAHA 2GJSA 4XIGS 1UFQA 2NG1A 3KTAA 4A9AA 1ZNZA 4TMKA 2C99A 5A4JA 1XD2A 3OFND 4MYUA 1P3JA 1KI6A 2ZS8A 3SC3A 1IAQA 1GG2A 4UNRA 2ERYA 2ERXA 2JDIA 3SYKA 1UJ2A 5K8IA 3O8CA 1OYWA 2C98A 1OLOA 5SZJA 3PUYA 1W0JD 1YR9A 1E2QA 2ZSAA 3NEYA 2LWIA 4WIAA 5UKDA 4CEHB 2PEZA 5DHAA 1RE0A 4ZCLA 2H16A 4TWZA 3VMFA 1OH8A 2J1LA 1GVNB 1WDTA 3OAAA 1P7CA 3QG5A 4XTCS 4O3MA 2LCFA 1J90A 1E1RA 3LQQA 4HEJA 1F6BA 4YMWA 3TKLA 4LHZA 1X6VA 1D8TA 4YMVA 3HU2A 4L9SA 2GK6A 4UNPA 3L8ZA 4BWYA 4BZPA 1LTQA 3B1VA 1NBMD 1U0LA 1Z83A 4M1YA 2W00A 4QGAA 4GOXA 3DM9B 4GNKA 4E22A 2KBFA 1SKYB 2N46A 3P4XA 3KB2A 4MGZR 1WA5A 1FL9A 4QJ5A 1P9WA 1IY1A 2XJ9A 2C03A 4CF7A 1Y3AA 3DDCA 2O8FB 4JLKA 4L16A 5CIQA 2FJUA 5JRZA 4MQBA 3CZQA 4C0KA 4FW9A 4DCSA 2GJ8A 5JSZA 3IPXA 2D06A 2ONKA 2BVNA 3C7KA 2WKRA 1YZGA 1FMJA 3JVUA 4JYBA 2XTMA 4I1UA 5GVSA 4Q9HA 3WRYC 5KNCA 3EZFA 2REXB 2ZUCA 3C5CA 3L0PA 2ZRIA 4N1AA 3AVTA 4HB0A 4DLUA 4HAWA 4Q7JB 3D7MA 3O8DA 3QBVA 5JEDA 1CF4A 1M34E 1G9XA 1K6MA 1KY3A 1U2RA 4RY2A 1OHHD 3FKSD 3FPAA 1P5ZB 2GXQA 2PL3A 1N25A 1UEIA 4XSHA 2AN9A 3ASZA 4KAXA 2A5JA 1D9XA 2JA1A 3V4RA 2NTYC 2FOLA 3OIVA 3GJ7A 2XNDA 1XMJA 4MKHA 5EQTA 1DAEA 2WWGA 1EX7A 2IEZA 4F4IA 2ANBA 4QGFA 1C4OA 3KXKA 4ACBA 2HYIC 3RS3A 4YQFA 1YE8A 1E4VA 5KDDA 4EUNA 2WJIA 1G5RA 4QBHA 4LC0A 2W6JD 3FHTA 3CPHA 2GNOA 1NVVR 3OEEA 3BE4A 5DYGA 3RRMA 2BBSA 1T5LA 1HH4A 2XSZA 5EXXA 2YZ2A 4Q00A 821PA 3AF2A 4ZIRB 4DT1B 4MUBA 2IL1A 1U9IA 3RABA 5GJWC 1YZTA 8OHMA 4IVRA 3WP0A 4DLWA 1AKEA 2R6AA 1KI8A 4A8JC 2PX3A 3HPRA 2IYTA 4GI7A 4LCBA 1Q1ZA 3TVTA 4Q7MB 2A30A 3ZVRA 1KYIA 2RGAA 3CRMA 4MKIA 4A2PA 4PQYA 3HJNA 3WMFA 3MJRA 1TQ4A 1N5KA 4JIMA 1PLKA 4JVMA 1WBBA 1XTIA 4XJXA 1VPLA 5CITA 3MGCA 4TMVA 1NY6A 4NYJR 4YLGA 1EFRA 3DOEA 1X8JA 2YWGA 3I3SR 4JBWA 3B82A 3CNLA 3Q5EA 3ICQB 2WPDA 1X8LA 1Z6TA 2A7QA 2GJ9A 1Z6YA 2WJHA 4LJ7A 5JJLA 4LJYA 1FFHA 3MJHA 5FFMA 4Q5IA 5HTKA 1K5DA 1MABB 1TUIA 4IDPA 1TU3A 2PLRA 1XEWY 4BLQA 4KXFB 2VSXA 3PVSA 3T15A 2P67A 1NMYA 1M74A 2VF7A 2WWYA 5IK2A 4YXWA 1UBFA 2OXCA 1Z0KA 4OHWA 2G1KA 3U2QA 1Z0AA 1SXJB 4CEJB 2G1JA 2Z0MA 4OI1A 4AG5A 2QU8A 2ZJBA 2W2VA 4D4JA 4V0OA 1FTSA 1MO4A 2FPMA 2VQSA 2WSMA 1FW6A 3GLGE 3I5YA 2Z43A 2CJWA 2PT7A 2VBCA 1AZSC 2I3BA 3QE0A 1KO4A 5HR5A 4YMUA 5J40A 3N5CA 1TPZA 2H17A 2D3WA 1YZLA 3TE6A 4XVQA 2Q21A 1U99A 4R71A 4C7OB 4OJQA 4RD2A 3W3ZB 1S96A 5F3WB 3A1UA 1Q1BA 4PX9A 4Y0AA 4X8HA 2DYKA 3V4FA 1BMFD 5B2ZA 2PCLA 3EZ6A 3QG1A 3VR2A 1TTTA 4JLMA 1VDZA 2R6CA 1JECA 1Z29A 4ZCIA 4W7SA 1AS2A 3AVQA 3W3AA 4JL5A 1TADA 5JECA 2FN4A 3RC8A 1L8QA 4OHXA 1ODFA 1W7AA 2VA8A 4PO9A 5KNBA 4EQ6B 4B6EA 5IF9A 1G4UR 1F5NA 1F3OA 2FFBA 1VIYA 4TQAA 1XEXB 3AP3A 5DYIA 1U8AA 3RLFA 2V4ZA 5CIWA 4M9SA 2O8BA 2G0TA 2O0KA 4LOAA 4RD6A 2QENA 3FVQA 3TW8B 3FMFA 3EZ2A 2PMKA 4GRAA 1AJEA 3LAWA 1PJRA 2OT3B 1KSJA 1C9KA 4R98A 1Q3HA 4JVLA 2DWPA 1X1RA 3BH7A 4F4JA 4MGKR 1RRFA 3BH0A 2GF0A 1SQ5A 3S1AB 1L2TA 4WAUA 1E2GA 4A15A 3IEUA 1HQYE 3OIWA 1DAKA 3OAAD 2BOVA 1P9RA 3AEZA 1WXQA 1E1RD 1D2MA 3PENA 4WBSA 3IDQA 3IBYA 5GJBA 1FX0B 3QNUA 2QQ0A 2CCGA 4DC9A 4YDHB 2F9MA 1LB1B 1KKMA 4TT3A 5E3HA 3SZRA 2IW3A 5FH9A 4RD3A 2EYUA 2X1VA 3E2IA 1KO5A 3TR5A 4PC1A 3C8UA 5F9HA 1AS0A 3PXGA 2J59A 4OQFA 3X1YA 3ZVMA 5SZIA 2CDNA 4YONB 1T8UA 1Z6XA 4TYNA 4HZIA 2VP0A 4BASA 2FPKA 1CR1A 4XD7A 4W5WA 5LPNA 3OE7D 1SVOA 4R7ZA 4PAMA 4B2IA 3KFVA 1VIAA 1U94A 1TEVA 3CUEF 4V0LA 2VYFA 4G5GA 4FCWA 4QBGB 3WNDA 2IEYA 1JXMA 4YC7A 4LBZA 4PZYA 4PC3A 2REOA 3FFAA 1VECA 4QG7A 3NH6A 4Q4LA 2IUTA 4C0AC 4LV6A 4PR0A 3U3MA 2XEXA 2FFQA 2P5SA 1G21E 4OBEA 2ZR7A 4LJ9A 5TARA 2RHDA 1XWIA 2ZRKA 2ZTSA 4JL6A 3X1ZA 4EPRA 4LYJA 4M1WA 2ZJ2A 1IQPA 2V54A 1U0JA 2E9SA 1BYUA 5JCZA 4B34A 5TDHA 4DLRA 2JLZA 3KJGA 4OJKA 1KIMA 3OZXA 2XNDD 3NXSA 1BH2A 5DHFA 4UXJA 3RHFA 3A4LA 2GK7A 5B57C 4QHTA 2RGBA 1NJFA 1E0JA 2ZI4A 2CL6X 3VHXA 1G3MA 3LV8A 4PPGA 5CLLA 4DWJA 3K0CA 4F4CA 2ZI9A 3KKNA 4MYTA 4IRUB 1EESA 1N2CE 2RGDA 1G41A 2NO9A 4Q4AA 1TU4A 2FNAA 4PSAA 4JKIA 2ZYUX 2YC2C 2QRNA 2WOOA 2G77B 3K0AA 4DLXA 3MMPA 1E79D 4M1SA 2O0JA 2ZSBA 4IHQA 2WTUA 1P9NA 2FZLA 4P4SB 4QM7A 4A0HA 2JLRA 3PEWA 2VP5A 3Q3JB 1DO0A 1OXTA 2FWRA 5AK0A 3FYHA 2P6RA 4GP7A 1B23P 4QGHA 1KI2A 2WWXA 4KLZA 1VYUA 1AZTA 2YWHA 1EFRD 1UF9A 3F3YA 3GLGB 2ZXUA 3N2EA 4B43A 4EJSB 4R9UC 2V1UA 2AWOA 1EFTA 4C9BA 2AXNA 1UDXA 3VU9B 3LX8A 3R9XA 4A6PA 3FOZA 2QEQA 1S1MA 1KK3A 4PFSA 4HDCA 2XNSA 1RJ9B 4C4PA 4OHZA 1A82A 4KV9A 4PHGA 1EFHA 4E03A 2ZJYA 2Q0HA 1NI3A 4U02A 4WXRA 3ZZTA 2MMCA 5JSZB 3K0EA 4YXWD 5E95A 3AGQA 3HPQA 2W83A 3EWSA 2XB2A 521PA 2FSFA 3B9QA 2OFXA 3G5UA 2ODWA 4I1VA 3BWDD 4URXR 1U9IC 3I92A 4M1TA 4LJ5A 4PO1A 1EXMA 1FZQA 2EYQA 1G3UA 4AYWA 4FMDB 4L5BA 2DBYA 1G64A 1DVRA 1KZGB 1K8RA 1ZJ6A 3RVBA 3SU8A 4OI2A 3NC0C 4OK6A 4UJ5A 1AIPA 1VG9B 2NGRA 1NKSA 2FMXA 5KSYA 2QBYA 2V7QA 1L4UA 1VHTA 1Z22A 4QNMA 4BZXA 5KO2A 1PUIA 4OYHA 5AJWA 4M2LA 3BS4A 1YZQA 3PEVA 3SN6A 2J0UB 3FDIA 5KSOA 1UKYA 4TQUS 1US8B 1RFLA 2VIIA 1TX4B 4PC7A 1W0JA 5H8WA 2WHXA 2OESA 1E9CA 3KQLA 2GEDA 1E2DA 3A1VA 2IX3A 2Q9BA 3TQFA 2QP9X 2V6JA 2Q9AA 1GL6A 2GVDC 2B92A 2QSZA 3K0FA 3SBEA 5G41A 3G0HA 2GJAA 5KDLA 1T0JB 4DXAA 2DWOA 1VCOA 2NIPA 4JLDA 4NTZA 3QOFA 5L3RA 2IYXA 4IEEA 4Q4HA 3R8FA 4NYIQ 1J8YF 1S4QA 3ZVLA 1NBMA 2DPXA 3WBJA 3WNCA 1LNZA 5EP3A 1ZRHA 3F5FA 4M21A 1TL7C 3L0IB 4O25A 1JQJC 1N6NA 4WZBE 2O8CA 4E5UA 5DSZA 4MDFA 5TMPA 1IJFA 1WBDA 2J0VA 2YVUA 4XH9B 1XEFA 4A4DA 5L3VA 2RGNA 2YV5A 4TL6A 4TL9A 1IHUA 5SZKB 4E09A 1CJKC 2EU8A 3QBTA 4P3YA 1JALA 3IHWA 3W8RA 4BPBA 1AQUA 4MUAA 5BN4A 1RRCA 5KDOA 1WCV1 5L3SB 4FMCF 5EE1A 3T5DA 1DAGA 1YU9A 4LHWA 3M0EA 4K46A 3U4QA 4IW3B 5JHGB 1YKSA 2KBEA 2BIFA 4NYMR 1KHTA 1ESMA 2QGZA 2GCOB 4GDFA 2J46A 4IKEA 2B8TA 1P61B 5J4HA 3L43A 3CNNA 3W34A 2VL7A 5EUMA 2W0MA 1EK0A 1IN5A 1OHHA 2JLWA 3QXCA 5AJZA 2WSSD 2P6NA 3WYAA 5DNYB 1DEKA 4K8OA 4L9WA 1JBKA 1XNJA 1JPNA 3RS4A 4HUTA 3LBHA 4ON9A 4JZKA 5L3QB 2YWEA 3JZAA 3U3KA 4XD7D 3AVXA 4CZ2A 4LGMA 2XOKA 3CBQA 4GZLA 4LPKA 4MA4A 1OPXA 3U7FB 4QRHA 1LS1A 2QAGB 4LJ8A 4D81A 2B6HA 2XZPA 4HUQB 5D3MA 2IHBA 4TL8A 3W5JA 2HLDA 3Q85A 3G82C 1JB1A 3CR8A 4UNNA 5FBVB 3THWB 4YMTA 3W6OA 4HB3A 3EZ7A 3FHOA 4XWOA 4QC2A 4IOLA 4DB4A 3E1SA 1Y63A 3Q5DA 4OI0A 1Q57A 1Z08A 4GP6A 1ZUNB 3AVOA 4B74A 2C96A 1N5IA 3IQXA 2KI5A 4XVRA 4EIWA 3UG7A 3EPLA 4J0QA 3GLFA 2B8WA 2DR3A 3B1YA 3VX4A 1CR4A 4C0QC 1TEXA 2WOJA 3AUYA 4V0KA 3ADDA 2R2AA 2R6GA 4MRPA 4GMXA 3X1XA 3ZJYA 4Q18A 2QZ4A 2ORIA 1SGWA 1XD9A 3MWKA 4Q7LA 4Q01A 4Q1CA 1P2SA 3U44B 4Q1EA 5K8UA 4TMZA 2BMEA 1P73A 2ZRGA 1T4GA 4PAOA 2JGNA 3EX7C 4UXIA 2G83A 2CE2X 3O8BA 3I5XA 3ZD7A 2GAOA 3NC1C 3CRQA 2IS6A 3KB1A 5E7MA 3KDSE 2VP6A 1IXSB 3QUSA 2C95A 2ZS9A 3DO6A 2A5GA 621PA 1Z2AA 5KYKA 2F1IA 3THYA 2O5VA 3BBPA 3TAHA 4DZZA 4M9QA 3TQCA 1ZU4A 2ZPTX 3KJEA 1G16A 4Q4JA 5KNDA 5FPHA 2AFIE 3KXLA 4PSKA 1LF5A 1ZINA 3UK6A 2D7DA 2AHOA 3RAPR 1NBME 2VH5R 1KI3A 1MRNA 2PEYA 3IIMA 2IK8A 2VF8A 2VSOA 3OESA 4DRZA 1HYQA 2QNRA 5DISB 5F9FA 4P4TA 1L7VC 3FHCB 1GFIA 4V0MA 1XTRA 4Y0VA 3EASA 4WW0A 3AB3A 2XTNA 3ZQ6A 3VNUA 2ZRMA 3PUXA 3QPUA 3QY0A 4ZV4A 1IM2A 3K0CC 1OH5A 4KYIB 4DDWA 3I72A 4QHYA 1E2KA 4M0LA 3UMSA 2IS1A 3NEJA 3QSYA 1BMFA 3H86A 2GETA 2HJGA 3CPJB 2OHFA 5JI3E 4TYYA 4TTQA 2IYYA 1T3HA 3PCRB 5LB2A 1VKJA 2HT6A 4AKGA 3I4LA 2E1RA 3KJIA 3SOPA 4A0GA 1ZUIA 1KSFX 2PLFA 3K9NA 3KKMA 3C15C 4MGIR 5EZ5A 1E0SA 1KO8A 2PBRA 3TSOA 3EWAA 2XGJA 1JR6A 1N5JA 3HR8A 3LLUA 5LDDC 4QNRA 1VTKA 1OJLA 1G7SA 2I4IA 3LNCA 1NMXA 1R5OA 1MR3F 3DPUA 5HPYB 3EC2A 2V7QD 1H65A 2RHMA 1MRSA 4PPFA 4D4KA 3DM5A 3MRSA 4RZXA 5LD2C 1Q22A 4WXPA 3V00A 1QHHB 3HDTA 4C0HA 1OSNA 4II7A 2W2XA 3IIJA 3MUFA 2VHCA 5FTLA 1AKYA 5DI3A 2ZVPX 3AV0B 4YDSA 1O3YA 3U61B 2OXRA 2R9VA 3SJBA 1Q20A 3K0SA 1M2OB 2WAYA 4LZZA 5HKKD 3BC1A 1FP7A 2ZYWX 2ZRBA 3GJ0A 3THXB 2EWVA 4ILEA 4EPYA 1NLFA 4ERNA 4DHEA 4PPNA 3NKVA 1XD8A 4TMWA 4DEXA 3R8CA 1A2KC 3ECCA 2WICA 4ZDWA 4BZQA 4JLAA 1LFDB 2ONJA 1IXZA 3MWLA 4GMDA 3SJZA 4HAYA 1Z07A 1ZAKA 4LBVA 1GILA 3BJIC 2HT1A 1RPZA 3BFXA 4JJZA 4M9ZA 4O2RA 2CLCX 3OE7A 2C2HA 2F3TA 2ZROA 3GQBA 3UMFA 3GEEA 3LFUA 2ODBA 1FUKA 4HAUA 2Q3FA 1CJTC 4B3GA 4TLCA 1DG1G 3QKRA 3VR6A 3GLIA 4Q9KA 3OF5A 1YRAA 2VHJA 2Z5FA 1DARA 4HB4A 1BOFA 4DIEA 3LD9A 1OKKD 2O8DA 3CNOA 4HAZA 2BBOA 2VSFA 5FOXA 1I4LD 2X2FA 3NIBA 4DJTA 1FPMA 3SNHA 4HYYA 3VKWA 4V0ME 2AXPA 2DFLA 1ZCAA 4G5RA 4IXMA 3LX5A 1TF7A 4I1SA 2IHYA 5CM8B 1VYVA 1GSIA 1YR7A 3BB1A 3IO5A 2ATXA 1G8FA 3M4YA 4OHVA 1KK0A 2EFDB 2QBYB 2XOKD 4A2QA 2ZE7A 2F6RA 5KU1A 4TYPA 1KSGA 3I61A 5GJVC 2GKSA 1TQ6A 4B3BA 5DO9A 1FQKA 2CHQA 3EC1A 2HLDD 3NG1A 1J7KA 2GHIA 2RGNC 3TNFA 1G7CA 2HCJB 4B76A 1GNPA 1FTNA 1HEIA 1QVRA 1UEJA 2H7VA 3DMNA 5DN6A 4UNSA 4GOKA 3IIKA 3DZDA 1NN0A 4K81B 4MGYR 4P4UA 3CRW1 4KBFA 1OFIA 1RC8A 1E79A 4M22A 4CEIB 2ZRFA 1QRAA 3K0FB 2AFHE 2OLJA 1E3MA 1F2UB 5B58C 2Q3MA 4DBLC 2ZUBA 4P33A 3PUVA 4XTRA 3PFIA 1WB9A 4GL2A 5CYOA 4D4LA 4ZDIA 3WYGA 1IN7A 4MRSA 721PA 2VO1A 5FUXA 1U81A 4MYHA 1N0VC 3A36A 3EAQA 4MKGA 4C2TA 1E1QA 3A1SA 2ZRHA 4RFSA 2HXSA 2OSBA 4GOJA 5KPJA 4XWKA 3AF3A 2O52A 2CLSA 3TK1A 1U8YA 1MO6A 2W58A 3TSZA 4C0SA 4HLUA 2WM9B 5TB5A 1XBTA 2C8VA 4NYIR 4EPVA 1BKDR 1W5TA 1E2LA 1DPFA 1LW7A 2WMOB 4URVR 3ND9A 3TJZA 1E2PA 2GXUA 1ZM3A 1KNXA 1SVKA 2UKDA 4BEJA 4A8JB 1FOEB 2OAP1 1PV4A 4HLQB 2QRZA 1IY2A 4DSTA 4LYAA 1DO2A 5EE3A 1II9A 3PG5A 1NKTA 2CCKA 5C2JB 1DELA 2AD5A 3H1TA 5FTNA 2KJQA 4OL0A 4TLDA 3B85A 1F48A 2HCBA 3EZ9A 3C14C 2IF0A 2OCBA 1XTJA 2XITA 2Z4RA 3KL4A 3CZPA 2UZ3A 3QF4A 4LJ4A 4UKDA 2HV8A 2G0NA 1M7HA 1U0HC 2JCSA 2JLYA 2JLVA 2QAJA 2ZE6A 3SHWA 2VHTA 3GLHA 2H1LA 3I8XA 2DFTA 1Z47A 2OLKA 3DOFA 4QKQA 4HZUA 4QHSA 5D3MB 2V1XA 2ZYTX 2ZAOA 4NH0A 2NQ2C 2R62A 5C18A 4BLOA 2AR7A 3KX2A 3DMDA 4OQNA 4BQSA 1F2TB 4ZPXA 5EXPA 4Q66C 1KAOA 1JR3A 3B60A 5FI0B 1VCMA 1HURA 2JJ2A 4FWIB 4KYUA 2IF2A 3WY9A 2ZETA 1SVIA 2YHSA 3QKSA 5CLQA 4JLJA 1KI1A 3QXJA 3BB3A 4W9MC 1DOAA 2IUSA 4ARZA 2J41A 4EFLA 3EIHA 4CDGA 3T34A 3U6KA 5CDFA 5HCIA 1E69A 3KZ1E 1NY5A 2JAQA 2FX3A 5KPDA 2IS4A 2H5EA 5E7JA 1W2GA 4C2UA 1XXHA 2BHRA 3UWOA 1QHNA 1E0AA 4PQFA 2ZI6A 1MKYA 2OFWA 1ZNXA 1SVSA 1E2JA 1R2QA 3P4YA 2JATA 3IUYA 4HDOB 1JEEA 1QG4A 5JWHA 1HTWA 2DHRA 1E98A 3AVYA 3VX3A 1N6RA 4O2LA 2ODEA 1G6OA 3EW9A 4HI0E 1XP8A 2PJZA 1Z6GA 5FL7D 1W44A 2DFNA 2WZQA 4PZZA 4Z51A 1ELOA 1IBRA 3PUWA 3PEYA 3CH4B 1W4BA 3KJHA 2A5FA 4NP6A 4O0MA 1XB2A 4BFWA 3FKQA 3BH6A 2FEOA 2WSSA 2CBZA 3TAUA 3BORA 3ASYA 3EARA 3QVUA 1KMHB 3ZZ0A 2EVWX 4PQRA 3T1QA 2CK3A 5JRJA 4KFTA 1JNYA 4D25A 5DGXA 2QMOA 4LJ6A 3NBFA 1ZD1A 2WKQA 3WBKA 2ZSFA 2X19A 4BLPA 5J5CA 5KHOC 3RRZA 1E0KA 4LI0A 2XXAA 1W0KD 1NVWQ 1GWNA 5AR1A 1NRJB 3CWZA 4QOSA 2WJVA 3KQNA 1YQTA 4LJAA 2NZ8A 1JEDA 2QPTA 1OB2A 1N6HA 4ZO4A 2QPAA 3VR4A 1GNQA 2EW1A 1HE8B 3X1DA 3KUCA 4URYR 1MOZA 4I4LA 4ZI3A 2H92A 2C5LA 2GVZC 4JS0A 3ADCA 1G291 1E2HA 3LVRE 5SZHB 5J4KA 1XDBA 4Q9LA 3RS2A 1KDOA 2N1BA 2ZUDA 4DB2A 3CF0A 1II8A 1Q0UA 5FOUA 3KTAB 1RKBA 4B48A 1XD2B 1R0YA 2ZJ5A 3D31A 1KI6B 3Q9LA 1BYIA 3AUXA 1E4YA 1ONBA 1ZC4A 1KDRA 4GPTA 1YJ5A 1G8HA 5EP1A 4D6PA 1JR3E 1P2TA 1PLJA 5BW8A 1UKEA 3QI2A 1W4CA 1ETUA 4RJLA 4W5HA 2VHQA 1W1WA 3A1WA 1JJ7A 3L82B 1I2DA 1ZUHA 2EFEB 2R6DA 4I99A 3GJ5A 4KI0A 4DLSA 1TNDA 1YHNA 2QROA 1P6XA 5DN6D 1XJ0A 1CR0A 1Q1EA 3ZS8A 1RYFA 1KK1A 2XAUA 3FMOB 4PSVA 1ESNA 1NMZA 3FMPB 3SYLA 4DDTA 5CDFE 1KDTA 2NZJA 5L8VA 1D2NA 3B9PA 1N6PA 1O87A 2Q6TA 2BBTA 4HSEA 2J7PD 2RGCA 1KMQA 1ZIPA 1OIWA 2R6FA 3RSLA 4Q1DA 4PHFA 5CM9C 1XPUA 4B35A 5FOVA 1EFUA 3REGA 1UKVY 3RANA 2OFOA 4EPWA 1E1QD 2BMFA 3LLMA 4JMPA 1Q1QA 3BB4A 4US1R 2A9KA 2PMDA 2ZAMA 4PO8A 2ZRJA 1X8KA 1MO3A 1ZBDA 1MO5A 2CL7X 2ZU0C 2D4HA 3A8TA 4Q21A 1AQYA 2B7BA 2FEMA 1R8SA 2O0HA 5FBQB 4KITB 4TYWA 1CTQA 3F0TA 1H8HA 1UBCA 1T9HA 2DCUA 2GZHA 2ZJAA 2B21A 4PC6A 4UJ3A 4F92B 5FR2A 4DKXA 2VP4A 1E9AA 5GADl 2QA5A 3SJAA 2KE5A 2GTPA 2OCYC 1R8QA 2WVJA 1Q3TA 3MWYW 4KO8A 4AWXA 1CLUA 1MV5A 2AKYA 2X2EA 4PTLA 1E9EA 1Z63A 2BV3A 4EAQA 2KSQA 4ESHA 2JJ1D 3LO5A 3TUIC 3WHLA 2HUPA 1CIPA 3DVLA 1HY3A 2O8FA 3GD7A 4M1KA 4TN1A 4MKFA 3VFDA 5JFGA 1XF9A 4Q19A 3RRYA 1SZPA 5H68A 4DCNA 2R44A 3FB4A 3LY5A 2BMDA 2J7KA 3DZ8A 2W0SA 2PX0A 1E9FA 3U5ZB 1OB5A 2D2FA 1CR2A 4X8MA 3JZMA 2FZ4A 4XOIA 6Q21A 1Z0JA 3K9LA 1RVDA 1XU4A 1IN4A 1OXXK 1QF9A 3L2OB 1QDEA 4LY6A 3VHLB 1OT3A 4ZKEA 3ZGXA 5A0FA 4MH0R 4HLUC 1GL9B 4F93B 3TH5A 3VQTA 4XSGA 4LHXA 4MDEA 5FBWB 1JR3D 1JPJA 2GBLA 1E2FA 2WMNB 3H4MA 2JJ2D 4BECA 1G20E 5HKKA 4PC2A 2FU5C 2ZS7A 4NKRA 2P65A 5EUQB 3A37A 2GDJA 2IWRA 2BBWA 4B75A 4BUJA 2ZR0A 2WJYA 2BEJA 3PV0A 2JLQA 4F7WA 1CXZA 3RS0A 4POAA 3P20A 3UPUA 4DSOA 1UDWA 4F91B 3QKUA 4D0GA 1HV8A 5F2EA 3FGNA 2FDCA 3I32A 3WYFA 4KVGA 4FD2A 3J81k 5FPTA 3GFTA 4CT4B 3PITA 4ZIRA 2QGNA 4Q1AA 1OH6A 4NYJQ 3ZZUA 2IYQA 4S35A 4QL3A 3CX7A 3RSOA 2F9LA 3B2EA 3TMKA 4DDUA 2ORWA 5EE0A 5FOSA 3BAFA 5AWFC 4DCUA 2TMKA 3AM1A 5CJ2A 2A2ZA 1GKUB 1AK2A 3SQWA 2LKCA 4M4SA 4B3CA 3NHAA 1OKKA 2Q3HA 1NVUQ 2MSEB 4LYFA 2GILA 4EFMA 1XJQA 1JQLB 5BYKA 4IOJA 4IOKA 3UWKA 1GM5A 2UZIR 2ZJZA 4RZ3A 1YR8A 2CJWB 3N2IA 1GUAA 5EXSA 2IYZA 4BRWA 5JWRA 2P5TB 3DKVA 4RKFA 4MRRA 1MABA 5B64A 3QF4B 1DTSA 1ZCBA 4FI3C 1XMVA 1OIXA 3NH9A 5EXTA 4LV5B 1ZNYA 5BYJA 4ZCMA 4FMBB 4V03A 3IBGA 2CK3D 1Z5ZA 1WQ1R 3W8NA 3LDAA 1GNRA 3CPEA 3KXIA 1RIFA 1SXJA 4GSYA 2YJTD 3K70D 3GPLA 4CEJA 1H8ED 2GEVA 2J3EA 2JASA 4YMSA 5IT5A 1WRBA 3LH5A 2OEPA 5IDVA 3TVDA 4A0RA 5F98A 1ZMXA 5DIFA 3TUJC 2CLDX 1GZSA 3B1XA 1G8PA 4RVCA 4M53A 1GL7A 3DL0A 2NPIA 1TF2A 1II0A 2DWQA 3N70A 2WKPA 3JVVA 1QHYA 3SE0A 1SHZA 1KKLA 4C7OA 1OIVA 3O47A 3U3RA 3W6NA 2FSHA 2J0SA 2IA5A 4ARZB 2OILA 5G3YA 1HQCA 3IGFA 5FL3A 2V9PA 3KQKA 3CH5A 1GOTA 4FINA 1G6HA 5K8TA 1KI4A 1PZNA 1T0HB 3BGWA 3CIOA 2O8BB 3LWNA 2XX3A 1BO6A 2QSYA 1QHIA 1W36D 2C04A 4HDQB 2ZRAA 2GWHA 1UM8A 1E2MA 3CR7A 1NL3A 2QM7A 2IXGA 4AYTA 4RD4A 4NCIA 2ZYVX 1GKYA 2Q9CA 3EG5A 5G3ZA 4B71A 1B0UA 4AG6A 2N42A 4N0EA 3HP1A 3TUZC 4HB2A 4WOPA 4QBFA 1E2EA 4D2IA 3NDBB 2ZITA 3SEAA 3OEHA 4FIDA 5J4VA 2FG5A 2QI9C 2Z83A 3UANA 4B2LA 2ZJOA 2VP9A 2AX4A 2D7CA 3GJXC 1KZ7B 1CBUA 1KO1A 3GCGA 4AIIA 2Y8EA 3CF6R 5BWMA 1EWRA 1FUUA 5JS7A 2F3RA 2RKOA 4F38A 1RZ3A 1FQJA 1GRRA 2WBLC 4P32A 3WXMA 3LQRA 1CRQA 1XMIA 3SS8A 3S1AA 4KCGA 1PLLA 3SR0A 1ZC3A 1NF3A 2CEAA 2FFAA 3QPVA 4FMCB 5J4YA 1DG3A 2NO0A 3GEHA 1DADA 3H0KA 3CKLA 3M6AA 4V02A 5DE3A 3NBYC 1KOFA 4LC1A 3KQUA 1GIAA 3QENA 4JSTA 1FX0A 4JLVA 2IS2A 2ODNA 2EFHB 2GESA 4TLEA 1A1VA 1XCPA 4U5XA 2QN6A 1P62B 2MSCB 1H8HD 1S3GA 2IXFA 5EZ6B 1WF3A 5LBIA 1CRPA 3ZVNA 4C30A 2ATVA 2H18A 3E5HA 4LRWA 5E4FA 2P3SA 1KK2A 2QT1A 4AI6A 1P2VA 1M7GA 3SHFA 4EPTA 1ZM2A 1WE2A 3PUZA 4FN5A 3OIYA 5BN5A 4L4UA 4H9GA 4QGGA 3WRXC 1JJVA 1U8ZA 3BK7A 1OXSC 1NP6A 1S9HA 2IBMA 3PR1A 4GT1A 4TQ9A 2QM8A 3DEFA 3SYNA 1A4RA 2ZE5A 5AUQA 4TZ0A 1EGAA 1N5LA 4NHOA 2GXAA 1G19A 3QJYA 3TIFA 1G5PA 1R6BX 4EDHA 1G4AE 3PQCA 3R7WA 1E9SA 4G5OA 2HDNB 2Z6VA 3C4JA 2IT1A 4UXHA 1UKZA 2OG2A 3DHWC 1PUJA 4KODA 3ZIAA 1VMAA 4LHYA 1DBSA 4Q4AB 2BMJA 4DIDA 4IOMA 1R0ZA 4BEBA 2RAPA 1E9RA 4TTPA 5CB6A 4D0LB 4OHYA 1A5TA 2H8KA 2BKUA 4CT5A 4HLDA 1CJMA 1E9DA 3TGPA 3K0AB 3GLFE 121PA 4PHTA 3UKDA 3SJCA 2ZE8A 3MD0A 4W5JA 3EPKA 4BLSA 3R9WA 2P0EA 1ANKA 1ZW6A 4IDHA 4PZLA 3A4NA 1NSFA 2BCGY 2QPOA 4RZ2A 1KJYA 2YKGA 3THOA 2IYVA 4BGDA 1ZM4A 5FL7A 5KTYA 1WP9A 1Z0IA 3A4MA 2J0QA 4Q48A 4DLTA 1ZU5A 4D80A 3WMEA 1CU1A 3CWQA 5GJCA 4EFNA 4ITRC 1J2JA 1L4YA 2J9RA 4US0R 4V0NA 1KY2A 3TR0A 3BIFA 3D3QA 3QKTA 5LD2B 4B2PA 1E96A 3T12A 1NN1A 3SFZA 1QVAA 2C9OA 4RD1A 4AKIA 3IPYA 3AF4A 4P4SA 2WV9A 1M8PA 1KJZA 2ZSEA 1IN8A 3V9PA 3NHBA 5H1YA 4DCVA 1W0KA 4BLRA 4N0DA 4B6FA 3CO5A 1XPRA 3DKPA 3BRWD 2ECKA 1RW4A 4DCTA 5E7IA 3TW4A 1QHXA 2ZU6A 3EXAA 4WZ6A 3T1VA 3GLGA 2GBLC 3U60B 1UAAA 4EJSA 2X77A 2A3RA 4NBSA 4N3NA 4FXPA 3VU9A 5FOTA 4URWR 1Z28A 4IDOA 5JJKA 1HT1E 1S0UA 2YOHA 1RJ9A 2IXEA 2OUKA 5BXQC 1VG0B 1SVLA 3A58B 2QP3A 3FE2A 4H1UA 2C9CA 1N6OA 2CVFA 3HR7A 3AVUA 4LK2A 5EJEA 3QVVA 4TMXA 1SXJD 3C41J 3ZYCA 4U00A 1KDPA 2SHKA 1IXRC 2FA9A 1HE1C 1N0UA 4JSYA 3K9HA 4ZKDA 3MG9A 4LDJA 3EIEA 1NJGA 1XFAA 3Q8XB 1I2MA 3WP1B 4NE2A 4AYXA 2GA8A 2QMEA 1SVWA 2V55B 2FSIA 2WIAA 2PH1A 3BFKA 3PEUA 4JBYA 3RC3A 3EPHA 5BQ5A 3ZS9A 1FNMA 4Q9IA 1XRJA 1F60A 2W6IA 1LF0A 4PPQA 4Q1FA 4Z54A 3GP8A 2FGKA 3QIAA 4Q7KA 4RZUA 4URUR 4AY2A 1LV7A 4KSBA 1GP2A 5DH9A 1KI7A 4QBIA 3UMRA 2J7PA 4R2IA 3K09A 1D2EA 1OV4A 2J0UA 1MT0A 4WA7A 4NCJA 4Q4HB 5DLQC 5AUPB 3HYTA 1US8A 4AKHA 3QEOA 1IY0A 1C1YA 1QZXA 5TVKA 1UPTA 2XZLA 2J87A 2V6IA 2O8CB 2R65A 1LY1A 2ZIAA 1R0WA 1XJCA 2IYUA 2JLXA 2GAAA 1GKIA 2BJVA 2ORVA 4MITA 1W49A 2IWHA 1V43A 4NCKA 5JS8A 1SXJC 4OQMA 1BS1A 2WIBA 3AKCA 2ZR9A 5CB8A 3VAAA 1GTVA 1RRPA 3CRRA 3RS7A 2FV8A 5HE8A 1TUEA 4WVFA 1NN3A 3VTKA 1W47A 3OEHD 3Q7PA 3U4QB 3U3JA 1NLYA 2OBLA 3T06B 5KUTA 3EPJA 3VNVA 2QQEA 1Q12A 1OF1A 1CJVC 2GF9A 4B3DA 1X1SA 2CHVA 4IDQA 4C3ZA 2JJ1A 1OFTA 4G1UC 3K53A 4NYMQ 5FPYA 4B32A 1E94E 2O8EA 2QORA 4RSGA 4NPHA 1OFHA 2C9YA 4Q02A 1XMSA 3AVVA 4JVNA 3NVAA 2D2EA 4CVNA 5L3SA 4R2HA 4Z8XA 3GLIE 2GJKA 4B73A 2OBMA 4XWAA 2P6UA 3CRVA 5HE9A 4KFRA 3AVWA 1ZVQA 4NCHA 2QY9A 2GCOA 4QXAA 2BCJQ 4OK3A 4BFSA 3T1OA 3AGPA 3L0SA 2HF8A 2OCAA 1D5CA 1R0XA 2FH5B 3U7EB 3U6BA 1KGDA 2NOAA 4JLOA 1GDDA 2JJ8A 3I1FA 4PHHA 4JL8A 2ZRPA 1Z6AA 2A5DA 1S1CA 2XJ4A 4B3FX 2HEIA 5L3QA 5FI1B 3ND8A 3GLFB 4DUGA 1TMKA 1K5GA 4Q03A 2JIZA 2AK2A 2AKAB 1ZYUA 4Q9JA 2QAGA 2CCJA 3QF7A 2BM0A 1UBEA 4B44A 5AUOB 4HUQA 5KSZA 1R7RA 1N6KA 5JWOA 3UATA 1N6IA 1P2UA 2F1JA 2ZREA 1T5IA 4D4MA 4AC9A 3THWA 2FPLA 1GAJA 5EP2A 4LHVA 4CYMA 3BXZA 5B30A 1VCIA 2A5YB 4IFBA 3GJ3A 2CMKA 2I1VB 1FMLA 3ZIAD 1NVXQ 4QFMA 3I8SA 1P72A 4NL4H 2QE7A 1UADA 3CLVA 3LA6A 1XEWX 2AD1A 4JJKA 5CJPA 5JBQA 1COWA 1HUQA 4AURA 4OQXA 4BFVA 3THYB 3VR5A 5CK4A 1T3LA 3M1IA 4Q4JB 3LW7A 2VEDA 3TLXA 2VLIA 1JXOA 4Z8YA 2OE2A 5AJXA 2RCNA 2ZRCA 4IXNA 3U44A 2JDID 3SQXA 2GZDA 3HWSA 2UVQA 5ANRB 4QJ4A 2RH5A 1R4AA 5JMTA 2G6BA 3C16C 2IC5A 1GRQA 2NO6A 5HZHA 2BC9A 2ANCA 3LBNA 1P60A 3A1TA 2PZGA 2RGEA 4AD8A 4TLAA 4G3XA 1T8TA 221PA 1M1YE 3MSXA 3C5HA 5FUYA 4IEIA 2CL0X 4B3XA 4KFUA 3SFVA 1H8EA 2AL7A 2G88A 4S2EA 4TSFA 4BLTA 4C0JA 3W90A 3F8TA 1XCGB 2ZI3A 4DDVA 3P27A 4KFSA 2ZI7A 4JVSB 1DS6A 5FBLB 3T5GA 2PCJA 2CVHA 4ASUA 4D26A 4D0NA 5JI2E 4DLYA 4G5QA 4OQLA 4DSUA 3GFOA 4X8OA 2C77A 5P21A 1DAIA 1N3BA 1QBKC 4DVGA 1G18A 2PZEA 4ZDJA 2F7SA 5HZKA 1W46A 1I4DD 2RMKA 3QEJA 1Z0FA 2BM1A 2JEOA 1BIFA 3LBIA 2OBNA 3LXRA 4FMDF 1TAGA 3GEIA 5FOWA 1S2MA 3O8RA 1NSTA 1AA9A 3WHKA 3P1JA 4TTRA 3IQWA 1YRBA 2OM2A 1QHSA 3CM0A 2F43A 3GLHE 2GZAA 4RCYA 1NNEA 3R9IA 1G3RA 3PIRA 1R5BA 4KHZA 1IN6A 2HJVA 1ZIOA 3Q7QA 2MSDB 2WWFA 1YZUA 3R7WB 4CRWB 3T61A 4G5SA 1KO7A 4Z1MA 1XTQA 1M7BA 1Z2CA 3KKQA 3TSWA 1E9BA 2YNMA 4TL7A 1ZD9A 3K1JA 3LVQE 2EFCB 4KBGA 3CX8A 5DI3B 3IO3A 5G40A 1TQ2A 3RYTC 1D6JA 3MLEA 4WZAE 1JAIA 3R20A 1I4TD 2BWJA 2F55A 2W6ID 4KLNA 2ZRDA 2C78A 5JZVA 2EWWA 3I73A 2OZEA 1OFUX 2ZI5A 4GBMA 4EJSC 3QQ5A 2LKDA 5J4LA 2MMGA 3KUDA 2QT0A
chains in the Genus database with same CATH superfamily
5JD5A 1YCHA 4PVCA 3EGOA 2YHBA 4OQQA 1V8PA 1YFKA 1QHHA 3DE7X 4L8YA 4N6GA 5JU6A 1CIVA 3GMTA 3IODA 3PRJA 1QAMA 3LGAA 1NN5A 1XLWA 4OCZA 4PGMA 1LU9A 3W2HA 1HPLA 1WV0A 1F7UA 1Q21A 4JT4A 3KQQA 2JHGA 4DMHA 2JH8A 2QAIA 3QU4A 3D7KA 1GZHB 3SC2A 4KSCA 3ZV7A 3ND7A 5K3CA 1E8DA 3SLGA 1O9GA 4AK9A 3RS5A 1JFFA 3EXHB 4FYWA 5HDBB 1SHKA 3M81A 5ARBA 3CONA 5ELXA 2V96A 1G7TA 2ZFUA 3LRXA 3E27A 2Q6IA 4F4UA 3ZDDA 3WLKX 4ZVNA 5BOSB 1A2QA 3TQQA 3E53A 2PJUA 3BOSA 3BMNB 2QM0A 1ADYA 3QEKA 5KIAA 3NORA 1MAUA 2PSFA 3PT5A 3RSHA 5I8ZA 3L1IA 2R96A 2V45A 2ZRLA 3QX8A 2I2FA 4MVJM 2OVFA 4MVCA 2NNLD 3UH1A 3DWEX 5JMOA 4BKPA 2W2PA 1P5RA 1UINA 3O1LA 4BJ6A 4REQB 3HBMA 3X2EA 4EHIA 1PF7E 3NRCA 5FCDA 1A2BA 3V2GA 2J4CA 1Z3IX 2K7FA 2ADFA 1XTSA 2HYDA 2WSLA 2FEAA 2ZPUA 3L4EA 2PGDA 3MCTA 1TM5E 3ANSA 2KS6A 3K92A 2R4TA 3MNFA 5CB4A 4RFVA 4U7WA 3TSAA 4GGMX 1C0LA 5L45A 4MEJA 2WWHA 3GAFA 5BT8A 1L5OA 1CY0A 5A9TA 5IKXA 4FXOA 3RK4A 3OHMA 1T0UA 3QEMB 1GGEA 4J0IA 3B8HA 4URZR 4KAJA 1LVGA 1MQ9A 1AN0A 1U7HA 3ZTTA 4D44A 1RMYA 3TZHA 5BSUA 5FUWA 5KINB 2D74A 1MO2A 3LZ6A 4P31A 4CIBA 4NEHB 4JENA 4UVIA 1NVVQ 4EVIA 4RDXA 3AVPA 4JA2A 2B5WA 3QFHA 3UUGA 1NW5A 1VL0A 4TS3A 3WBFA 3T9CA 2LTAA 4P92A 2BGTA 5BSKA 3OD1A 1U6KA 1RMTA 3EEYA 5EJ5A 2ONCA 3LC7O 1B42A 1KJWA 3HU1A 1NLZA 3ANMA 3JRWA 4MTLA 4PZCA 4X8LA 5LB4A 4UDNA 4I1OA 4WE3A 1KEEB 4X7MA 4HDRB 3K2QA 4F56A 1JE0A 1PJ4A 5DNEA 2A0FA 2UXBB 5M04A 2XBMA 5DIZA 5I9TA 2CZQA 3KEGA 1CP2A 1W75A 2OAQ1 2VQ3A 3DTNA 3L8YA 1E4EB 3NGXA 4RFSB 3NHYA 3MAAC 3A27A 4A91A 4C89A 5IHPA 2V58A 4DT1A 3O3CA 4W5RA 3UOWA 1BXZA 1GUFA 3LHKA 2ZJ0A 3P9CA 3T9DA 4CEIA 3UUWA 1MMFB 4LBYA 4DC1A 2HY7A 3FPGA 4DR3B 4ZVOA 3RHTA 2BJWA 1J9EA 2VJCA 4PE5B 2PWPA 5TV2A 3AKYA 5FTJA 1COWD 2FK7A 1ND5A 1P6UA 3OZBA 3WYEA 3HJBA 2GZMA 3AEQA 3A3KA 3KQHA 5JSUA 2JAWA 1K6EA 1K3TA 3VR5D 3PPYA 4DIOA 4UFNA 1CUJA 2O3TA 1KAGA 4OPMA 4HTAA 4BO1A 2FEXA 2FGJA 3MB8A 2JLBA 5G4KB 1X7YB 3K35A 4YCJA 3OUTA 3NBXX 3OTOB 3TCKA 1FYWA 1HDYA 4CT0A 4EW6A 1GFSA 3A3YA 4UHHA 3V1MA 1I3NA 4PXAA 4A92A 2F1KA 1FLDA 2W8ZA 2A9RA 2YXLA 3KQPA 4P0TA 2J3KA 1U98A 2H1CA 3FMIA 2HMSA 4FVTA 1IVYA 4MO2A 3SSMA 2HRCA 2XB4A 1ZRMA 3GRYA 3JQBA 3N7UA 4FFDA 4NOKA 4LZNA 5HDQA 4EO4A 1YHZA 3DQQA 3ESRA 4TRJA 3E5NA 5JQWA 1OZHA 5EHNA 5JQGB 1UOEA 5KOYA 4CCSA 2WTXA 1N77A 3VKHA 2CE7A 1R0RE 1WMSA 2H57A 2XUIA 4UARA 1IONA 4YPOA 1CE8B 5CYPA 1OPRA 2DZDA 3IPRA 1UBNA 4NDZA 4NR0A 2ZB3A 3EVAA 3GLHB 4AJPA 3ZQUA 4I9NA 3ZD6A 4HZUB 5CBPA 3V42A 2X8WA 2OWDA 1RKVA 3RVMA 2ZIFA 1KVRA 3CIFA 3WNBA 2PXXA 1Z12A 2IUUA 5IG2A 3PJRA 4Y2HA 1QNFA 2IYLD 1D6MA 4HMPA 2C1XA 1V7QA 4AMZA 2AK3A 1SKYE 4IQFA 4XVUA 3M6FA 2CLOB 3FTPA 4NZ9A 1E6CA 1PWXA 2GJ4A 2NZXA 3Q15C 2OV2A 4CGZA 2QG6A 3RT9A 2XCLA 1G7RA 2WWIA 4DR4B 3IHLA 4QDUA 1WKCA 4G01B 4PLGA 4XB6B 1BG6A 4ABTA 3QKSB 3UVEA 2QUZA 5C53B 4WZAB 2POCA 5DGCA 3ZHRA 3OM1A 4G25A 1GXSB 4AO6A 2Y05A 2NUPB 5FTKA 4NU8X 3T7SA 4NENB 4ZEVA 5IAJA 3RE1A 2RC5A 2BKEA 3QXXA 4L76A 4YCMA 2EGUA 3FR7A 1JI0A 3SXJA 2PJRA 1A97A 1OU4A 1HLPA 1SC4A 2W6JA 1ONSA 3SZGA 3MJEA 3OY7A 2FG6C 2P2CA 4BP3A 4FT2A 2XIJA 2YHIA 4XGQA 5B3AA 1PVOA 5K0TA 3RWMB 3ACDA 1GHTA 1R6TA 1MX9A 2PG3A 4RHUA 1NG1A 1KL7A 1X7GA 4UMFA 5EGSA 3KQWA 2C94A 3SVTA 2VZLA 3E7DA 2L0XA 1D09A 4FUTA 4M1MA 5F4BA 1CF2O 2YZKA 2I4TA 1JEJA 3UJPA 2CF5A 2CFRA 2ZQ5A 2CZCA 3VZPA 4X65B 2AEFA 2Z8YA 5JDCC 3FX2A 4ZI2A 2YJNA 2JFXA 5TXGA 1OW3B 4P3NA 4O4JA 5AI6A 4D82A 1M1UA 2GUWA 1E3TA 5D3QA 4X94A 3VH3A 3VI3B 3JQRA 5FTMA 3NTUA 4ENWA 3WZLA 3GJZA 3O1IC 4G4SP 4RVDA 3FPCA 1FP1D 1FXWA 1BOOA 1KVQA 4HGZA 1YB5A 4R8LA 4ACAA 2P2LA 5JV5A 2YUTA 4JR2A 3Q3HA 1DHRA 2AMLA 2ZYSA 2P5YA 4DLKA 1R10A 2RGWA 1PSWA 1YO6A 1G5TA 2I03A 3LBAA 5DNDA 4ZA2A 3HSSA 1M1ZA 5CD9A 5ALQA 2K7ZA 4BNNA 1RI1A 1KEKA 3OT5A 5FR1A 1FNNA 2Z9BA 3E23A 3KBBA 3GB9A 1G1AA 2X2OA 5H02A 3X43A 1RXWA 1W5SA 1K6IA 1G3QA 1SVMA 1Q0LA 1Z0DA 2HNAA 1LI5A 3WQBA 4KO4S 4LUCA 5I9NA 4MR8B 3C87A 3W9YA 1A76A 1Y9DA 2WVGA 3WGUA 2WWWA 1Q7RA 1KFBB 4PG4A 3P9KA 4HRAA 1UPCA 5JT1A 3A6PC 4LBWA 4QJ3A 2JGLA 1R5NA 3HZOA 1N33B 3EQ6A 4KRXA 1MUUA 3D5EA 3ZKWA 3ZYZA 2R5NA 5FIUA 2VHUA 1RAIA 3LCUA 2EG9A 3H6KA 4JEIA 2QLBA 5ALYA 4IIXA 3RC7A 4ARUA 3U39A 1X86B 1XL1A 3W8DA 5AW7A 1G5FA 1RBYA 1TF5A 2CNWD 2E4UA 2H4JA 5D6OA 4V39A 3GVCA 4WXMA 2IU0A 5B37A 5IH7A 4N8SA 1D9ZA 1ID8A 3VO1A 4KQGA 4JWTA 3K9GA 4WWHA 1Y3BE 1A7JA 1GZ7A 1R50A 4N6NA 2NYUA 5JVDA 3ZGLA 4KXLA 1YJ8A 1XCJA 4PQEA 2PZBA 2O14A 1TVMA 4IR7A 2FUG6 4ZODA 1FZTA 1Z8FA 4IJMA 5HJ2A 1ATZA 5KAPA 1AS3A 3JYNA 4R54A 2C1ZA 1JEYB 5IT4A 1YL6A 1EPUA 3HE3A 3MFYA 4WT7A 1QYXA 1LDEA 3AF0A 2CFCA 4JP5A 3DZIA 4LQDA 1BGWA 1W59A 3SF8B 4R2KA 1ZFNA 2XXAA 2QZ9A 3EISA 5BWNA 5ICMA 4PSUA 3S6JA 1YGYA 1A8QA 1ECJA 3SDZA 3GRAA 4M0PA 3VR1A 4CW7A 4K3VA 1W36B 4KR2A 5IAOA 1YI0A 4CMHA 5KNDH 3D6NB 5JARA 2OYSA 3KPJA 2QP4A 1ENPA 4I4TB 5AD1A 5IBPA 2PZLA 4LY9A 1PR2A 4E46A 4H1VA 5TY0A 3AM5A 3TNLA 5A9SA 3ZHQA 4PNEA 3JASA 4NMMA 5D3ZA 4QPCA 1Z5WA 5C4GB 1SBHA 2PKYX 1W1IA 2YOFA 4GPBA 4LS3A 4A82A 4D9FA 2OHHA 3RU2A 2H8GA 4UHJA 2HWWA 3B2QA 2AFHA 3D2CA 1YNOA 4JUCA 3U17A 2G04A 3VJMA 4DADA 2EEPA 1T2EA 2OXEA 5J23A 4KZKA 4OXXA 3TOCA 4KR7A 1F38A 4HT3B 1UFQA 2NG1A 2CNOA 3D2BA 4B80A 5C1BA 5JZBA 1ARZA 2PYDA 1DTEA 2HJSA 2ZS8A 1NVMB 2Q3CA 4UNRA 4YMHA 2DGDA 3F6RA 3SYKA 1DBVO 2X0JA 4BJ5A 5K8IA 3CZRA 1IRXA 2A0YA 4K9RA 5SZJA 1VMIA 1QPBA 3CS3A 3HY3A 3QU5A 4LF5B 1W0JD 2DUUA 4NEQA 5UKDA 3KBOA 2LWIA 3NEYA 1NOJA 2GPBA 4DCJA 1ZONA 2ZCJA 3ASVA 4X1YB 2IV2X 2DBRA 3FWNA 3NI2A 3JAMA 3QHPA 4RO0A 4DDKA 1GVNB 3ZWKA 1M6VA 1OH8A 2AEMA 3COVA 3GRCA 4O3MA 1M2FA 2LCFA 3K5HA 3PLNA 2AOXA 1ZITA 4HEJA 4YMWA 2JCGA 2EKPA 3BYZA 3DAOA 1EINA 4PZUA 4LG1A 4TOIA 1L8LA 4CLHA 3I04A 5AKGA 2HHLA 1U5CA 3UXHA 4JBLA 2LIVA 3O75A 2BEUA 1MGPA 5CCDA 3LUAA 4EB0A 3L8ZA 4X84A 3BREA 1Z4QA 1ZRSA 3AEUA 5FB3A 3R4VA 1SFRA 2ACWA 2ZSIA 3Q3IA 2GBFA 4GNKA 3DVSX 2FTKE 1M75A 2N46A 2XBUA 3HB4X 3P4XA 1BMQA 4RHEA 2PSJA 3P2JA 1V6SA 1DRWA 1P9WA 1IY1A 1Y1LA 2XJ9A 3K96A 1ZXBA 3ZY3A 4BVEA 5IW8A 4M7OA 1KZYC 2YWRA 2Y0PA 4MB0A 3MPOA 3DLTA 2H85A 5E6UA 1ZL0A 3UY4A 4BMNA 1GCGA 2FPIB 2Z09A 3M8KA 4RTPA 2GNPA 1S3IA 3FNFA 3C7KA 3ET4A 4QQNA 1U3CA 2BJHA 2XTMA 3ODGA 4OP1A 1GUZA 4BV9A 3L77A 1PKEA 4NV3A 4Q9HA 4XB2A 3WRYC 5GVSA 3OE5A 1HYHA 1UWCA 2ZUCA 3EZFA 4HPXB 5I6DA 3AVTA 2PFGA 4DLUA 5JEDA 3M6UA 4KNVA 2FN7A 1T15A 3OF3A 3QBVA 4Q05A 4ZRNA 4MULA 2WFAA 3FKSD 4FD3A 1ML4A 4P0PB 1PEKE 1MHPA 1N25A 2OB1A 4XSHA 4FLFA 4KAXA 4YROA 3EWNA 1Y80A 4LTMA 2FOLA 5KS2A 1QQAA 2XNDA 1PG0A 4QYXA 5HUJA 4BO6A 1R4MA 2IEZA 1VL8A 2X0DA 3V1NA 1F4PA 2ANBA 5LJIA 4QGFA 4PN7A 4FJ0A 3EIFA 3KXKA 4NWIA 2VPQA 1NX6A 2Q6VA 2HYIC 4PWYA 5KDDA 1CR6A 3MWGA 2WJIA 3FYUB 3ZE6A 4ETWA 4YMLA 1JBEA 2GNOA 3I53A 3N0XA 3BE4A 2B37A 5DWDA 2QL9A 2E4XA 5DYGA 2GLXA 4MW1A 4Y6SA 4X64B 3KYJB 2XSZA 3PEEA 2PZMA 3VU1A 2IEDA 4MUBA 5K4GA 1BCRB 8OHMA 1P4GA 1YZTA 4MZXA 3WP0A 4BYGA 4DLWA 1R6DA 3QVKA 5B55A 3DTVD 2X4LA 4DUZB 4Q34A 4QE3A 3G9ZA 3HCFA 4WUTA 3OU7A 4IGKA 5DHTA 4AJ9A 3O8LA 2WWTA 2QXTA 3OEYA 4GI7A 1EP9A 2PKCA 3T6KA 3TVTA 5CFOA 3B52X 1SIUA 3OPYI 4MKIA 4BXOB 4A2PA 4Y8VA 2AXEA 3WMFA 4XCXA 1AUXA 2IP1A 2PXHA 2IXAA 4JVMA 2OO5C 4R3UC 1VSUA 3HJAA 4MNTA 1XTIA 2OP1A 4YA6A 4XJXA 5E9QA 3W0LB 1U5BB 2AJBA 4OJYA 5CITA 3DOEA 8ABPA 3BK2A 5TIIA 1X8JA 5ARCA 2IYOA 3IDFA 5ILQA 2FW6A 3CJRA 5CU7A 3CNLA 3Q5EA 1E5TA 4J4HA 1HI9A 1D1PA 3O83A 1M83A 3HCDA 2GJ9A 1Z6YA 3RSSA 2O3RA 5HGXA 4FKZA 1Y6JA 1QH1A 1W9HA 2Q1UA 4JUAA 4Q5IA 2NUTA 4AUKA 4RPIA 5I7OA 2ASVA 5K7SA 1K5DA 4IBOA 2VUIB 1JQ3A 2PLRA 4J0CA 2HRZA 4EGAA 2BL4A 3T15A 1QRDA 1A69A 3AI1A 1NMYA 5EMLA 2XYGA 2VF7A 3FSGA 3TLZA 1X7WB 3PUIA 3A3OA 4OHWA 4A0SA 5HF8A 2H9YA 3AI7A 3U2QA 1SXJB 3DMGA 1O0CA 3VHRA 4OI1A 4Q3EA 2QU8A 3T4UA 2W2VA 3EJ6A 4AG5A 1K88A 1H93A 3WB1A 1WB5A 4CTJA 5FI3A 3AL3A 4V0OA 4GH5A 5SY9A 2ZBFA 1TAHA 3DMTC 4RCVA 3ZCTA 1FW6A 1LKZA 3GLGE 3I5YA 5CT9A 2CJWA 1VRVA 4IHAA 3NHZA 4LNHA 2I3BA 3HHPA 1UMDB 4IQGA 5IVIA 4EY8A 1KO4A 3DAPA 1G21A 1TT7A 2CFIA 2XHEA 1J9ZA 4HC4A 1IZ9A 4HLNA 1M66A 4LX8A 5ECGC 2DHCA 3V8NA 4RMNA 2TMDA 3L01A 4DNXA 4R71A 1WETA 3GGJA 3LMKA 4I50B 2P9FA 3UAGA 4RD2A 2XMRA 3IE0A 1V9CA 1YDHA 3WKAA 3L7BA 3JARB 2YIVX 4EY3A 1X0XA 4KRGA 1XMQB 3IV7A 2GB4A 4P4NA 2V7BA 4PAWA 1VLMA 4BX8A 1Q1BA 1BRTA 4PX9A 1N2JA 3S29A 2XIQA 4B4OA 2DYKA 2F90A 2DJIA 1TK3A 3OBBA 1BMFD 5JAUA 1ETHA 3EZ6A 3KB6A 4QXQA 3BX1A 3ES9A 3VR2A 1TKBA 3U4AA 5AH0A 4IIJF 3HKDB 4NK5A 4JLMA 3ORYA 4HWSA 2R6CA 2C8JA 1JECA 4RVFA 5CFQA 2BFDB 1T9AA 4M8LA 1LJUA 5REQA 4BVBA 3URKA 3V6LA 4BNWA 1KEWA 4EP1A 3W3AA 4L0QA 3IHKA 5FFFA 2DPLA 5FPQA 5B3KA 2DXIA 3RC8A 1Z45A 3N5KA 4OHXA 3Q1LA 1W7AA 4PO3X 3H4VA 2IIVA 1C7EA 2BGRA 5PNTA 5IF9A 1G4UR 2IH4A 2DKOA 3CPSA 4YFYA 3CZ5A 4TPKA 5K3EA 4DUPA 3ORQA 3HR4A 1QYIA 3Q3GE 4LOHA 3RLFA 1TFUA 2OYCA 2G0TA 2O0KA 4ND1A 4RD6A 3I01A 3OZ7A 4EHDA 3FVQA 3O2NA 3EZ2A 1AJEA 1L7BA 4QLBA 4YJFA 1MPTA 2G08A 1PJRA 2OT3B 4ALNA 4J7UA 3PF9A 5CFZA 1XZFA 1WW3A 3QFFA 1C9KA 2BGUA 3QFRA 4JVLA 4RF3A 4C6SA 5DNAA 2P6PA 4M1ZA 3REQA 1EVYA 1SQ5A 1L2TA 1O57A 1CS0A 1E2GA 4EEZA 3T5PA 1CF9A 3H19A 2IUEA 3OIWA 3PVZA 5LA6F 4AECA 4BJ1A 2IU4A 1E1RD 3HB7A 3IBYA 5GJBA 3CLSC 4G1FA 1FX0B 3BWVA 2QQ0A 2IW1A 2WNSA 2AI3A 3MQ2A 4GVXA 4XQEA 4DC9A 4JROA 1U3TA 3R2JA 2I6FA 5E3HA 1ULBA 5K03A 2IW3A 1QWSA 4HDNA 4M87A 2EYUA 3TKYA 3ZJTA 1KO5A 3TR5A 4LE1A 1I3LA 3BGIA 4KWTA 1AS0A 2WP0A 2B1RA 1E9VA 3EZLA 2CDNA 5TPWA 2X9QA 3BGVA 3JW8A 2WKSA 1ZJ4A 4TYNA 2I2BA 1EE9A 1K9VF 1O89A 3VAYA 3DV0A 5EA2A 5DYYA 1CR1A 5FULA 4RBNA 2A4KA 3SX4A 1V1MB 3IESA 4W5WA 2Y66A 3FYSA 4PAMA 1N3YA 1DMRA 4Y2XA 3PXCX 1AXRA 4B2IA 1IYZA 1TEVA 3FR8A 4V0LA 3GJTA 3X2FA 2ZKLA 1SOAA 3DVQX 1BROA 1Z7GA 2OL4A 4UBJA 3VR6D 1IMOA 3WNDA 3CINA 3AHGA 2E4WA 1NNLA 3I2YX 4FZRA 2LIPA 4PZYA 1E5VA 2PH5A 3NH6A 4HYEA 1HMPA 4M99A 4MJ3A 4EYEA 3G0BA 5KVVA 1JLSA 1M8FA 4LV6A 1GEGA 1PEAA 3AI2A 2FKAA 1DGQA 5KNCD 2XEXA 1JZSA 3EY4A 4MCJA 1IUPA 4ZD6A 1G21E 4LY0A 3KZVA 5ITZB 2P3OA 1OROA 4JL6A 4EPRA 1MH9A 4NAVA 4M1WA 4U2FA 1VM6A 2WLSA 3WSWA 3RARA 5FUMA 2F3SA 5JCZA 4GUDA 3A10A 3NUQA 3JQFC 4KIWA 4JR0A 1AB6A 2FB9A 3OZXA 2PFSA 1QTQA 2ZRQA 3F6PA 2VR1A 1DL5A 5FHRA 1BD4A 1C9NA 3NT5A 1B8NA 5DW3A 2DULA 4HSGA 1RPTA 5B57C 2V0CA 2R7MA 2ZI4A 4J6FA 4RPCA 2PD6A 3S1SA 4YJKA 1WPRA 4DWJA 2X8JB 1IEXA 3GCWA 1V8DA 1KEPA 2AS0A 2GZ1A 1BQEA 3ENWA 1RBZA 3LT0A 3GVHA 4KQHA 4TV9B 1JHRA 1RHJA 1D1TA 2RH4A 4EITA 5ERYA 1U7PA 1UMBA 2JGKA 2YY7A 4QG3A 4IIYA 2FNAA 1TCBA 3I9OA 4JKIA 2A1TS 4HVAA 3JQ9A 3R3ZA 3X1XA 2G77B 3K0AA 2XPCA 4J9UE 1I9CA 2XVXA 4WDQA 3MMPA 3RB8A 3N2YA 3TEMA 4YEDA 1S01A 4M1SA 1H2FA 5D1NA 5TC4A 1P9NA 2FZLA 3WGTA 3HBFA 2JLRA 2VP5A 3Q3JB 1DO0A 1B23P 2J48A 1EFVA 4GP7A 3M3HA 2H7CA 3N0RA 1YA6A 5KJ6A 4ZOBA 2JB9A 2M32A 3NHLA 1T6XA 1REQA 1AZTA 4IH1A 4F6RA 4RQUA 2GBCA 4L6CA 4TKUB 4AAYA 3CNQS 3D8HA 3KYCA 3QVGB 2OVBA 4OATA 3D0QA 2V7XA 1VKHA 1LZKA 2VOEA 4R9UC 5TS3A 2W98A 5D86A 4GXQA 1UDXA 2QRJA 3VU9B 3O8QB 3NWPA 4CFSA 1BN6A 4E0BA 1QFZA 3H1AA 1WHSA 2XNSA 1RJ9B 3FY4A 5A05A 3UK1A 3VPBA 4ILKA 3WFIA 3KOYA 2Q50A 2OGTA 1EFHA 4S1PA 4UEKA 3L8FA 4B6OA 2ZJYA 2Q0HA 4UTRA 4WXRA 5ICFA 3NAQA 1HLDA 4YXWD 5E95A 1SH7A 1NJ2A 2W2LD 4W7HA 4UE3S 3UTDA 2VUTA 3V3KA 4B7ZA 2OFXA 2VSYA 2P2YA 4G4JA 3EBPA 4GKAA 3BWDD 3DZJA 4BBPA 5CEEA 4UUAA 4M1TA 4URXR 3GUVA 4LJ5A 4ZOLB 4LCEA 3IDOA 1X7ZA 2J4FA 4J16C 3PQ5A 1FZQA 2EYQA 2R97A 4AYWA 1H2ZA 4FMDB 3CHYA 4L5BA 1OILA 2DBYA 3GXBA 2YCBA 1PZHA 4GWLA 4KN6A 4K9PA 4MR9A 1B26A 3LRTA 4WKPA 1XKTA 2H2DA 4XDYA 3A2MA 2J6BA 4HS9A 3MMZA 1VG9B 1NKSA 3AEKA 1GQQA 1MEOA 3PDIA 1RHRA 1L4UA 1Z22A 2V7QA 2PGLA 3I2HA 2HMTA 4O4HF 4QNMA 5AW6A 5AK4A 5KO2A 3VH2A 2Z6QA 4M2LA 1P1CA 2G36A 1S6YA 4Z9AA 1YZQA 3PEVA 4C6TB 1Q7CA 4IICA 4FI3F 4H35A 2YQ5A 3NT4A 1M2JA 3NJRA 3KQVA 1UKYA 1NASA 1US8B 1RFLA 4TQUS 3MOSA 5E2BA 2AB0A 3BIJA 3SDSA 1KRXA 3HVRA 3EEQA 2ECPA 1TJ5A 2PFKA 4L3VA 5C37A 1IN1A 1CEYA 5JPDA 1N1GA 2QR3A 3UXEA 3FAZA 1A5SB 1E9CA 3KQLA 3G02A 5IABA 1H2HA 4BTLA 2Q9BA 1PV1A 2V6JA 3D59A 5AK3A 3G2KA 2QSZA 2NT4A 1CV2A 1QKIA 1RTTA 5G4LA 4BRZA 4TVSA 4J2HA 5KDLA 1PCXA 5DWQA 2VXBA 2LRHA 3FYDA 3S7TA 2DWOA 2QNBA 4MS3A 5KNBD 4O2AB 2NIPA 4JLDA 1H9AA 4NTZA 1KOLA 3UB3A 3QOFA 3EEFA 1U80A 1ND6A 2XMGA 2YN0A 3QVOA 2G09A 1ZJZA 4QYSA 4YCBA 5E6SA 1OXKB 3R8FA 3GIDA 2ARKA 4ZGBA 2G5TA 1LNZA 5ALXA 3L0IB 1N6NA 4IILA 4E5UA 4WINA 4B3GA 4WNAB 2EERA 1LVHA 1IY8A 1IJFA 1CUGA 4BVFA 1EZZA 2ZWIA 2YVUA 2PK3A 3HC7A 1AKWA 4CV0A 4DRXA 2W6OA 1KZ4A 5AK5A 4ZU6X 4Z4FA 5CDYA 2YV5A 5SZKB 4HQ0A 2XLCA 2XUOA 3QA9A 1EUDB 4P3YA 3W04A 3BTSA 3PC8C 3SBOA 1V3VA 3W8RA 2H1RA 2H52A 4MUAA 2R86A 4XFKA 3ZZNA 4D4GA 5L3SB 4JJ6A 2AG1A 2AUNA 4CR7A 1L5ZA 1YU9A 2JHCA 2A1IA 2B69A 4K46A 4HNUA 4EB6B 3N28A 4DBVO 4IW3B 5JHGB 1YKSA 4U0JA 4BP1A 1RWVA 4P81A 4GDFA 2GCOB 2NU6A 1KMNA 3DE2X 1JB9A 3HBJA 3BIWA 2B8TA 3R6TA 4HJXA 4IKEA 1QU2A 2KHZA 3KD2A 3AK4A 4ZQFA 3TIGA 4V24A 4DNOA 2D13A 5J43A 4E2YA 2VL7A 2AC4A 2JI4A 2J5QA 5HQ3A 1USKA 5AJZA 2WSSD 4NZOA 4M88A 2ILTA 1IIRA 2P6NA 2QX7A 3L7MA 4K8OA 4L9WA 3RS4A 4AULA 3U3KA 1D0IA 1P4AA 4XD7D 4B40A 3AVXA 4QELA 2PX6A 3G9XA 1IDOA 1VIVA 4LPKA 4YIKA 4LJ8A 1PIWA 1IDN1 4XPIB 4CKEB 3UGTA 2E5LB 2B6HA 4UU7A 2XZPA 4HUQB 4LMBA 1TO6A 1GQOA 3AFIA 4CU5A 5I3ZA 2HLDA 2F8LA 3WJ7A 4PX5A 1SO8A 3KV1A 3EXG1 3PFKA 5JFOA 1FJHA 2CV1A 1BHJA 1A3CA 3HACA 1LJ8A 3KEMA 1GSOA 4GYJA 2XNHA 1BCSA 4QC2A 3ZHZA 3ZDYB 4AQDA 2XNCA 4EMUA 3CVVA 3Q5DA 2JIPA 4L08A 1KQPA 1GGKA 1TD9A 4JODA 5MN6A 1ZUNB 3LK7A 1BNCA 3AVOA 4EH1A 2Z5LA 1NX9A 3I2JA 3MTIA 2QYSA 3GJSA 3OJCA 1T5BA 2HB6A 1R9NA 1WJGA 1NVEA 2WJ6A 3OZDA 2HJRA 2WINI 4CN9A 5LZ2A 3B1YA 4C0QC 2X58A 4FT4A 3T3PB 4DTCA 4V0KA 1HTBA 4F9GA 1Q0PA 4MIOA 4MRPA 2WG0A 3ZXIA 3ADDA 2XWSA 4G5FA 2Q6KA 4OUDB 5EMJA 1PL6A 1UBMS 4GMXA 1LRLA 4H7HA 2VYVD 4OLJA 1JA0A 2L69A 1Q2UA 2HA7A 1QG6A 2QZ4A 4KN8A 4Y2JA 3V8EA 3ZJYA 3MWKA 2NU9A 1M54A 4HGRA 4OXYA 5ELLA 4E4TA 5IZ4A 1BE1A 2CLLB 5K8UA 3KKEA 1QR2A 4EDFA 4K6HA 1M1NB 2W6QA 4FGUA 3V2UA 3W5VA 1JZTA 3T4PA 2GAOA 3KJNA 3NC1C 3ZLVA 5IJ0B 4IMJB 1AD2A 2IS6A 3KB1A 1CT9A 2FR8A 4HL6A 2OMEA 1N7IA 5EC8A 2HZBA 3QUSA 4ZYZA 1RM4A 2ZS9A 2ODPA 4B6GA 1FK8A 3DO6A 2A5GA 3EGDA 4RTMA 3HJCA 2W4IA 3BBPA 3KB8A 3QQPA 3M6LA 4K05A 4RHCA 5KI6A 1ZU4A 3C3EA 2WM3A 3KJEA 1KBOA 4U7TB 2AFIE 3LTNC 5KWIA 3FRHA 2GCIA 3PQDA 3A6HA 3UK6A 3OA2A 3HUEA 2D7DA 4XYMA 3RAPR 2VH5R 1KI3A 3KLOA 2XB9A 3S2YA 3UXYA 2J09A 1T4BA 2OCLA 4KPEC 2IK8A 1O5OA 1OYOA 1GDHA 2VSOA 3GD5A 5BV1A 3OESA 5A3RA 5BV2P 3TF5A 3QKWA 3HWWA 3SS7X 4XGRA 2JBAB 3I34X 4XDGA 1GFIA 1A9ZA 2FPXA 2R25B 3NTLA 3EG9B 3K5IA 3QWAA 5ECYA 2OHOA 2MINB 1ZVMA 4M1QA 3TLGA 1FRVA 4FM9A 4TXHA 3GEDA 4OEHA 3RREA 1U2SA 3BZWA 1X74A 1GYPA 2R6HA 2ZRMA 3PUXA 1Z26A 3SLKA 4MV0A 3QY0A 4RF4A 2VAMA 4FU0A 3WC4A 2CVQA 1OH5A 4KYIB 2M98A 4CKBB 3FI9A 2Q5CA 1E2KA 1QGZA 2RAUA 1PG2A 5DBIA 3JRXA 2WNHA 3H86A 3CLRD 5IJZA 1YQGA 1YBFA 5JI3E 3JV7A 4UHCA 1J07A 4JX8A 4H4DA 3HZHA 1C7ZA 3I4LA 4P4GA 5AVQA 1TZBA 4R2JA 5BQOA 3R6DA 2QM3A 3CNHA 5EZ5A 3C15C 4ECAA 4GXRA 1CUAA 1E0SA 1KO8A 2BMWA 2BGNA 4I6EA 4OLFA 4RH1A 1N5JA 3LLUA 3URMA 2PM8A 2QWXA 4ARAA 5B2EA 2XWQA 1JH9A 4MKRA 2VKQA 4WESA 1OY1A 4EBBA 2VNKA 1TIPA 1TLLA 4QT0A 2OD2A 4A7PA 4B45A 5IM4F 1MR3F 4P22A 4TLMB 2JAHA 3EOBI 2APJA 2RI1A 2Q9UA 1TYEB 2BRUC 2NXNA 3BD6A 3O82A 4WOJA 5HUQA 3WDLA 1CW2B 2OFPA 1UZNA 2ATEA 4AMYA 3ZX4A 4QDJA 3H2JA 5KVAA 3ILVA 4GX2A 1GT6A 1ZQ1A 5H0IA 3WGKA 3V00A 2VJKA 3IP8A 2C7GA 1V7ZA 2W2XA 4HDMB 4MLZA 1WXWA 4MKZA 4MICA 3RC1A 3ZV4A 5IC5A 5BMVA 3UJCA 3WGZA 5F77A 3PNBA 2QQ5A 5DI3A 4FDMA 5FTLA 4KO3S 3VUFA 4YDSA 1O3YA 1X1QA 2OXRA 2R9VA 3E7PA 3SJBA 1Q20A 4YMIA 3K0SA 1Z2DA 1M2OB 3OKFA 1SU8A 4JB8A 4YCCA 1EDBA 1MC8A 3BC1A 3ILHA 3IBTA 3SLRA 4Z99A 2J9YB 4HGOA 4ND6A 2GO1A 3THXB 2EWVA 5CA0F 3SOZA 1BDMA 2H1IA 2QLLA 3DT6A 1UKAA 3EXIB 2CL5A 3GQVA 3O8NA 3LQ2A 5EWJA 3AL0C 1ULSA 1IVNA 4ZQEA 4RJ2A 1U2GC 3WYNA 3TG8A 4EAAA 3IP6A 2ISQA 3NV7A 4P3OA 4BZQA 2OKCA 4JLAA 3FETA 1M76A 3SYRA 3LBFA 3RVJA 2XD4A 1ZAKA 2CBXA 5A7GA 1ICEA 2V7EA 4Y6QA 4M7WA 1AQLA 3FJOA 3Q87B 3ETGA 1D0VA 3C6QA 5T5QA 5DLEA 4M9ZA 4O2RA 2CLCX 3OE7A 1JDBC 2ZROA 4KLCA 4RL6A 3W9UA 3WTBA 1Z73A 4CMJA 3LFUA 4HAUA 1BW9A 2ODBA 1FRQA 4WOCA 4EG4A 2VJOA 3T7IA 2XMDA 4YASA 1IG3A 4HQNA 3ZE0B 3RIGA 1MPXA 4HHEA 1V71A 2R7KA 5TPZD 3ZWCA 5AM3A 5BOSA 4WY2A 3GELA 2Z5FA 1DARA 4FYHA 3KRTA 4I36A 1L7PA 3BMNA 2GM3A 1QV6A 1V3UA 2X41A 3RTDA 3T0FA 4S04A 5EJGA 2A9JA 3CNOA 3QKIA 1FPQA 3A2LA 5DCUA 3KZXA 1I4LD 1XR3A 1RI4A 3HP4A 1H5QA 3NIBA 3SM3A 4DJTA 3A9TA 4GRDA 4QWWA 2JGEA 5ADHA 3V8BA 4R84A 4Q7QA 1V9LA 1HNNA 2H7XA 3LCCA 2AXPA 2DFLA 4YV7A 2VH2A 3EFHA 2IHYA 3OPQA 4REQA 1RYYA 5EZSA 4MW5A 1I7LA 3GAZA 3R75A 3M4YA 1Y5IA 4ENTA 3LZDA 1KK0A 1C8BA 1DG9A 1TCUA 3IALA 2PQ2A 1BJTA 3D0KA 1YACA 1DP4A 4WGGA 1AMOA 3CR3C 1DJOA 1CUZA 1QR6A 2FZ5A 4J29A 5KYVA 5NLLA 1KSGA 3V8PA 5GGYA 5B1EA 2IEAA 4MMXB 2GKSA 1COZA 1TQ6A 4OP2A 2NSDA 4B3BA 4BX2A 2CHQA 3CA8A 4QQRA 3VOAA 3MIIA 3DL7A 4JASB 4MGEA 5EUCA 5TGZA 3OCCA 4ERXA 5GV7A 1XDGA 1N34B 2Q49A 3FRIA 1VC2A 5F4ZA 2PUTA 3DEJA 1HEIA 1QVRA 1B6SA 2X1HA 3NKFA 4CG0A 4QO7A 5MFZA 4GOKA 3DZDA 3AHEA 3JZIA 3MF4A 4MGYR 3RYIB 4W99A 4KBFA 3DBLB 1IVSA 1E79A 4DANA 1QRAA 2IDZA 4W1SA 4P53A 5FD8A 1I01A 1ZKDA 4II2A 1MOSA 4RACA 4DBLC 4EQZA 2ZUBA 5B58C 1Y5NA 2UYQA 4K2HA 4P33A 2XGJA 2P68A 1DC8A 3B3GA 1NE7A 5CG2A 3RYHB 4K6CA 1Z74A 3PFIA 1W29A 2H63A 1OGIA 3A6LA 3A1CA 3LS2A 4D4LA 4ZDIA 1WB9A 4KYTA 4FGLA 1KEEA 3IP1A 3OIGA 3FTEA 2RJNA 1QVZA 2FZKA 2HU7A 3A36A 3GRRA 4INAA 1OGYA 1E4EA 2WC1A 3A1SA 3F9CA 2HXSA 3M9LA 4RFSA 4X0EA 3OQVA 4LOLA 4RDIA 3L7CA 1EBBA 1JTFA 5A3SA 1QWOA 4LJKA 1ESEA 3FUTA 4CV2A 2CLSA 3TK1A 1XCBA 1Z2NX 2W58A 3TSZA 1MHTA 4R8VA 4HLUA 4DMRA 1P91A 1EK6A 3O5AA 5IDQA 3ETEA 2C8VA 3OLXA 3DC2A 3WMRA 4GUAA 1E2LA 4URVR 1U2EA 1YMQA 3ND9A 3TJZA 1E2PA 4JITA 3VO9A 1J5XA 4ZYUA 1OZAA 1ZM3A 2UKDA 3AYXB 2QLJA 4GLJA 4CR8A 4PG8A 1H9CA 3NBAA 2OAP1 5SYAA 3E7WA 3JQ6A 4YP9A 5KQPA 4HYTA 5G4KA 1X7YA 1EBFA 3PYLA 1HZZA 2JAOA 2QRZA 2VDPB 4LYAA 3M1LA 5LOVF 3QX3A 1II9A 5DK6A 1NUPA 3UJ9A 4YRPA 1B41A 1VBKA 5AVKA 2KJQA 3LXMA 2ATCA 4H7IA