1FQJA

Crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
317
structure length
317
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
total genus 126
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqjA01
1IXZA 2E9SA 2REBA 2VP9A 3LLMA 2EVWX 4KAXA 1F2UA 1I4TD 3CBQA 3UWKA 2YWGA 1JBKA 1ELOA 1HTWA 1KO5A 1N2CE 1NG1A 1R0WA 3AVOA 2WJGA 4JVSB 2O0KA 3SR0A 2MMGA 3NHBA 4KFTA 3FHCB 3R7WB 1YZUA 3WRXC 1JQJC 2IWHA 3WYFA 4QGAA 1N5IA 1SGWA 2IF0A 1YZKA 3Q85A 1CJMA 4JL8A 2NPFA 3WYAA 4Z1MD 2CL7X 2EFGA 3EA0A 2EWVA 5HCIA 2QAGC 2VF7A 4GI7A 1EGAA 1YR9A 1E2QA 2GF0A 2LWIA 4QOSA 1VG9B 1NG9A 3TSOA 1QHYA 2HCBA 2VEDA 3IPYA 3PXGA 2FMXA 2IUUA 1KI4A 4KVGA 1OXTA 4HLDA 1TAGA 2LKDA 1ZYUA 3DZ8A 4NCIA 5JBQA 3AP3A 3X1ZA 2GK7A 4DLYA 1XPOA 4G1UC 3RS3A 5G3YA 4MH0R 3U7GA 3BFKA 4Q4AB 4Z1MA 2HXYA 2O8BB 4RJLA 4TTRA 4LV6A 2BBSA 3RS2A 1GRNA 2GBLC 1HE1C 2NG1A 3KB2A 3WHLA 5CJ2A 1UM8A 4V0KA 3GFTA 3ZD7A 4HAZA 2O52A 3MLEA 5TVKA 3I5YA 4HLQB 5CLQA 3T35A 1SQ5A 4IOJA 3I61A 3L0PA 2CJWA 4URWR 2V4ZA 1S3SA 3EIEA 3PEVA 3W8RA 1QHSA 5DNYB 2JLYA 4I81A 1TF7A 2I3BA 3R8CA 1Q1BA 3RANA 4JLNA 1WDTA 3VHLB 1R7RA 3M6AA 1Z0FA 2WOOA 5E7JA 1G3UA 1PZNA 4XTRA 1Z07A 2FOLA 2OSBA 5CYPA 2ZR9A 3SN6A 2ZI6A 3P1JA 4ZDWA 3X1XA 5HR5A 1UEIA 1XRJA 1T3SA 3DPUA 1XTRA 2GEVA 4AY2A 4DLWA 3VX3A 1IN7A 1KNQA 2BM0A 3QF4B 3VQTA 4RZXA 3H86A 3CWZA 2JDIA 1CEEA 2GXSA 2XNSA 4OKSA 3WNBA 1Z0KA 2FGJA 5AK0A 1ZRHA 3PG5A 1VMAA 1RE0A 2DFLA 4RFSB 4P32A 4GMXA 2PCJA 1CXZA 3NG1A 4PPQA 3UKDA 4C0AC 5E4FA 3GJ4A 3I5XA 3UG7A 2XAUA 4TWZA 4ZCMA 1CS4C 1X1SA 5ELXA 2WVJA 4Q4HB 6Q21A 1G5RA 1S96A 3WYGA 3SJZA 2FN4A 1S1CA 2IYWA 2RGGA 2V1XA 3IHWA 4HAWA 1JAIA 4OL0A 1M6NA 1Q1QA 2KB0A 4TYQA 2ONKA 2EQBA 4DUGD 3C4JA 2G77B 3LXXA 2OESA 1MR3F 1UADA 1M7HA 1ZD9A 1N6NA 4DT1B 3A6PC 2F3RA 1KI2A 2BC9A 4PFSA 2WSSA 4FWIB 3VFDA 4Q4JA 4FI3C 2HT6A 4DXAA 1OH5A 1KAGA 1P2UA 2LKCA 3N2EA 1JPJA 4IVRA 1VYVA 4P4SA 4GOXA 2WTUA 1QHHB 3W3AA 4F38A 1FW6A 4V0LA 2CLSA 2YYZA 2QQ0A 121PA 4IVPA 3QPUA 4TSFD 1LF5A 4NYMQ 3P27A 2C95A 1SKYE 3FMPB 4AYWA 4IOKA 4QFMA 4ZV4A 3UK6A 3IO5A 3IIKA 3CRQA 1NLFA 1NJGA 1XEFA 2ZM5A 2XTZA 1QDEA 4ACBA 3Q3JB 1XDBA 2KE5A 5J4YA 3GP8A 1HYQA 1A1VA 1E2EA 2GEDA 3ZDQA 3CH5A 1D8TA 3PV0A 4WZAE 4B74A 2QENA 1KZGB 2DYKA 1W44A 1NRJB 3OAAD 2GBLA 2X2EA 2O5VA 3QEJA 4M1YA 3SBDA 1WRBA 2FFHA 5JECA 4QBGB 1GITA 1XEXB 1Z28A 1U0HC 1GL9B 2ZYVX 3ASZA 3SHFA 4D4LA 2IXEA 3R7WA 1W0KD 5KSZA 2K5UA 2HUPA 1KSJA 2NO6A 1Z06A 3SC3A 3UIEA 3VTKA 1N6HA 4OQXA 4QL3A 3KQUA 2GJ9A 3FMOB 2F43A 4HDOB 4Q19A 5TMPA 3A1SA 1OXVA 1G20E 4DDVA 2WJJA 821PA 4IHQA 1DAHA 4QBHA 4DBLC 3BK7A 2WIBA 4QJ4A 4ASUA 3MAAC 4LC0A 4Q9IA 3SYKA 4G5RA 2GK6A 3G0HA 2V7QA 5JCZA 1XXHA 3MCAA 1KY3A 1E9SA 4CDGA 1AZSC 3AF1A 1LB1B 2PZEA 4TZ0A 2C03A 2ODNA 1KOFA 4JVNA 4UNNA 2RGNC 2BWJA 4YXWD 3CR8A 4JMPA 2WJIA 4B3BA 2QU8A 3HPRA 1U8YA 3NH9A 1ZC3A 1E9CA 1KI9A 4WAUA 1RJ9B 1KMHB 1GOTA 3CPJB 3O47A 2EFEB 4UXHA 4U7DA 2NMVA 4HLUC 3RWMB 4MGZR 4GT1A 3BXZA 4Q4JB 1IHUA 2B8TA 3EPJA 3C14C 3C41J 1NI3A 4YONB 1XXHE 3CNNA 2O8FA 2OILA 4CEJA 5DO9A 2W6ID 1XEWY 4PZLA 4EUNA 3SJBA 3S1AA 5DHFA 1MKYA 2H8KA 3BGWA 2JGNA 3GLFE 2QPTA 1RYFA 4H9GA 4JLDA 1M7GA 3X2SA 4H1UA 3UATA 1K8RA 2NO0A 3LAWA 1E4VA 3MUFA 3FVQA 5FBWB 2NPIA 1X8LA 4Z54A 1DAGA 1TMKA 3EWSA 1OHHD 1EFTA 3PEWA 4UJ5A 1G3MA 5JHGB 4KFUA 4CT4B 3ADDA 5K8UA 1G3RA 2C9OA 5DH9A 2GCOB 2QTFA 3THXB 3LQRA 1FX0B 4QGHA 3TNFA 1EWRA 5KSPA 2FE4A 2AXPA 5HZHA 1X8KA 4JLAA 4TMZA 1DAMA 1HT1E 2QT1A 4GP7A 4BRWA 4TYYA 3WP0A 1AS0A 1Z0IA 4N3NA 3CZQA 5KSYA 1JEDA 3AKCA 1RC8A 4DUGA 1LS6A 8OHMA 1Y3AA 1PJRA 1T3LA 1JR3D 4D4MA 1U90A 1WE2A 2R6FA 2QP9X 2ZQ5A 4AC9A 1ZNXA 1DADA 1XMVA 4AD8A 3K9GA 1VG8A 1RW4A 3GJ5A 3GEHA 5C1BA 3REGA 1G64A 1FFHA 2FZLA 1N6OA 2JEOA 2QAGA 1IXRC 3QBTA 3GLGA 2Q6TA 1M2OB 2ZAOA 3DVLA 2AKAB 4TLCA 5JEDA 2J0VA 2UKDA 3ND9A 5TY0A 3EZ6A 5F9HA 1E98A 5B30A 5JJLA 4M53A 1ZM9A 3ZVMA 3GFOA 2OLKA 4K46A 4M4SA 4XOIA 5FUXA 3GLIE 3ECCA 1ZINA 3B13B 3BWDD 4A15A 3WRYC 1ONBA 1XEWX 2JDID 2XB4A 4Q1DA 4WZ6A 2Z0MA 2ZI3A 1G8YA 3HU1A 4HDCA 1NBMA 4EJSC 4ZDJA 2XXAA 3QXCA 4FW9A 4LCBA 1L4YA 1N6LA 2Z83A 1R8QA 2CDNA 1W36C 2AWOA 3C15C 1FMJA 1OYYA 1P5ZB 1ZVQA 3RHFA 2H57A 2XITA 2ZJ8A 3UXMA 3K0EA 4BLQA 3ZYCA 2CLDX 3S1AB 2RGCA 3E2IA 1JI0A 2VHCA 4L15A 2CK3A 3U7EB 4EDHA 2CVFA 2NO1A 2OFOA 4LYHA 4QXAA 4R2IA 3ZIAD 4LHZA 4WW0A 2AFIE 3MRSA 2W2TA 4DLXA 2FF7A 1FNMA 2V6JA 2GWHA 1Q21A 3RRMA 2B7BA 4A36A 2OAQ1 1MRSA 4O2RA 2ZR7A 3C8UA 2ZRMA 4HB2A 5BN4A 3QNUA 4V0ME 4LSGA 3HU2A 4LC1A 4DZZA 4L8GA 4FMBB 1FQJA 2OV2A 2JIZD 3QVUA 4Q7LA 2UVQA 3OIWA 4TSFA 4Q9KA 1KHTA 1I2MA 2E87A 3A1VA 1KK0A 3MJHA 2ORIA 3Q7QA 4BZXA 3O8CA 4TL7A 4FMDF 1SKQA 1T9HA 3KZ1E 4DSUA 1JJVA 4LWZA 3GFPA 4OHWA 2KBEA 5B2ZA 1SVMA 4ARZA 1W36D 2V54A 1YR6A 3B6EA 5GJCA 5HE9A 1UPTA 4MGIR 5JFGA 3DMNA 1Q57A 4HATA 4UNSA 4RFVA 3AKEA 4NCKA 2DWQA 2IYRA 4F91B 5JS7A 4L4UA 2FSFA 2F43B 3TBKA 3TQFA 3GLHB 4FN5A 4TYNA 2R8RA 1E69A 3TUIC 4A8JB 4JVLA 2GESA 3FE2A 2ODEA 2PZGA 4S2EA 1UAAA 1II8B 2RGDA 4IDHA 3QG1A 5TB5A 3WMFA 2FWRA 2QROA 4TLAA 1F60A 2F1JA 2F1IA 4LJ6A 2ZSBA 1S4QA 2ZI5A 4GPTA 1OHHA 2ZU0C 2REXB 3NEJA 5EP3A 1EG7A 5C4GB 3KL4A 4A2PA 3IILA 1ZM2A 4Q1BA 1AM4D 1M74A 2WZQA 4LX0A 4KYIB 3RC3A 1IJFA 3THWA 2AHOA 3B9QA 1EWQA 3M4YA 1DG3A 4LUCA 5EQTA 1GNPA 1T0HB 3BERA 3PENA 1JR3E 2PZFA 2W58A 3WMGA 4N0EA 1YZGA 2XTMA 3CUEF 1U9IC 2XEXA 3EXAA 2PX3A 2XTNA 3AF0A 5L3QB 2N42A 4N0DA 2HF9A 4QBIA 4JJZA 5CIQA 2JLWA 1E79D 3QUSA 4BECA 1BYIA 4KXFB 3JVUA 4DEYA 1F2TA 1PLKA 2XSZD 4HB0A 4PXAA 4U5XA 2WBLC 3THYB 2IW3A 3LVRE 5F2EA 3NEYA 4KLZA 4CT5A 4OK6A 1P4SA 1G7RA 1NMYA 2DFNA 4PO9A 2WWGA 3L82B 3R8FA 3ETLA 4ZO4A 1HY3A 3OFND 1VIAA 4QG7A 3ASYA 3EZ2A 1J7KA 4D82A 4B71A 4I99A 1XX6A 3TMKA 1GFIA 1YU9A 5EP2A 4TL9A 2D74A 2F9MA 1G7SA 1NVWQ 3QPVA 5JI3E 4B76A 1YE8A 4HUQB 1PLLA 2ZETA 3I62A 1NF3A 1G41A 3LD9A 1E79A 4KVAA 4DLRA 1ZD8A 3T34A 4ZKDA 3PVSA 2R6GA 2RAPA 4I1VA 3W6OA 4EPTA 2BJWA 4XD7D 4JJKA 2BHRA 5LB2A 3EPHA 2JJ2A 1P2VA 5AJYA 3FMIA 2P6RA 3AUXA 1R8SA 4OHXA 3B78A 1QG4A 4MGKR 1QVRA 4NCHA 1T8TA 3MWLA 2ZE8A 4W5JA 4YMVA 4Z8YA 2WJVA 2XOKD 5E3HA 3L8YA 3PFIA 4IDQA 4RKFA 5AJXA 5EUQB 4DCVA 3PITA 4UQOA 3KTAB 3OEHA 1E2GA 4NDZA 3VR4A 4FXPA 3W34A 4A4DA 2Z4RA 4FD2A 1GNQA 2C78A 2VRWA 3QF4A 2A5DA 3RWOA 3L0OA 4HLUA 4D25A 2CE2X 2A9KA 4QBFA 2WWWA 1Z83A 3K0AA 1F2TB 2JAQA 2RGAA 3QEOA 2EFHB 1QVAA 1GAJA 2EFCB 3GJ3A 3A58B 3W6NA 2WM9B 4B3CA 2BBWA 4JLPA 1GG2A 3SYLA 4URYR 2XOKA 3NVAA 3TUJC 3JZMA 4LY6A 5FUYA 1L2TA 2ZJBA 5GJBA 1M8PA 4PHHA 5FL3A 2R6DA 3EPKA 2OLJA 2QQEA 1XD2B 3WY9A 1W4AA 2BIFA 2P2LA 5KNBA 1W48A 5FPKA 2QGNA 2ZRNA 4MRNA 5DISB 4BASA 4B3FX 4DT1A 2YOGA 4RCYA 1MO6A 2D4HA 4JVMA 2IS6A 4UKDA 1VCOA 2IYQA 1YRAA 1WQ1R 3EZFA 2IYUA 3TE6A 5EXSA 5CJPA 5GVRA 4FMCB 1MO4A 3EW9A 1T4GA 5FOVA 2WKQA 2IYYA 3LRPA 1G8FA 4NCNA 2NIPA 3GLHA 4JKYA 4HUQA 2B8WA 4JYCA 4CZ2A 1NBMD 2EU8A 3DM5A 1S8FA 1XD2A 2P5SA 4JZKA 1SXJA 3VU9B 1O3YA 1M7BA 1E2NA 3ZIAA 5C2JB 3A1TA 4HB3A 4QKQA 1DTSA 2IYZA 4AG5A 1HQCA 1IXSB 4GMDA 3LBHA 2ZYUX 3KJHA 2NZ8A 1KDOA 1J8MF 5BN3A 1X6VA 1Z47A 1CTQA 2A5JA 2ZJ5A 4IXMA 5FFMA 2XZLA 2GZDA 1H8ED 4EJSA 5EE0A 5CITA 3OAAA 2C99A 2BBOA 1E9AA 4EQ6A 1W7AA 4NTZA 3ICQB 3CONA 1XFAA 2ANBA 1Z6YA 5F98A 4I1UA 4Q66C 4DDUA 5LD2C 2GCPA 5J5CA 4DHEA 2WWHA 3KFVA 4TTPA 4EQ6B 1R0YA 2YV5A 4G5OA 1N5JA 1ZNYA 4UXIA 1I4LD 2ZTSA 2PMDA 4M1MA 5FTNA 5FPSA 3ND8A 2BJVA 1XCMA 4LJYA 5DYGA 2IEZA 3QY0A 5KDOA 3DM9B 2IYVA 4D0GA 2J3EA 4HZUB 5FR1A 2P67A 2FX3A 4C7OB 2AWNA 2Z6VA 1XPRA 3T15A 1R5BA 3VX4A 2QBYB 3VR5A 1TQ6A 2IBMA 4QHSA 1RKBA 4YDHB 2VQSA 2W0SA 5JWOA 2OBMA 4PSAA 1N0UA 5EE5B 2GAOA 5EE9A 1E9EA 5HZKA 2VP0A 1G8HA 1W0JD 4PQFA 4XJXA 1S9DA 1UKEA 2XX3A 4BFWA 1W4BA 3LQQA 4GZMA 1U0LA 4A0HA 2JLUA 3BD9A 3E70C 4GZLA 4Q18A 3AP2A 5GJVC 5K8TA 3I92A 1CJVC 4NHOA 4AWXA 4YMWA 4W5HA 1US8B 4C0LA 2XSZA 3SJCA 4ZCIA 3L43A 4D4JA 3FPAA 3Q5EA 2Q21A 3FMFA 4NH0A 1E4YA 1F3OA 2CHGA 2GETA 3LW7A 1G21E 4KU4A 3U61B 4R71A 1NNEA 2H5EA 1IOZA 1XU4A 1ZUIA 4XSGA 4DLVA 3KJEA 4NYMR 3PUXA 3GLFB 1OF1A 2YOHA 1D6JA 2MSEB 2PX0A 5KO2A 1B23P 2GHIA 2Q9AA 1D2MA 3TJZA 4BEJA 4IOLA 4O3MA 3A8TA 1E2HA 2GF9A 4DVGA 1YR7A 2PMKA 1YKSA 1DAEA 4HZUA 2JCSA 4OI2A 1TNDA 4CF7A 3IBGA 4PSKA 4TQ9A 3CH4B 3AVWA 4KHZA 2QSYA 1AGRA 4BFYA 2D3WA 2NQ2C 1AQUA 4YLGA 4AURA 3CRW1 3D3QA 4URXR 1XF9A 1N5LA 2WPDD 3FGNA 4MUAA 1BOFA 2A5GA 2ZJOA 1NBME 1VHTA 2IS4A 3DKVA 4C9BA 2KBFA 5FTMA 1SULA 1F6BA 4NCJA 2H16A 2JIZA 3AQ4A 4LBVA 3GLFA 2QAJA 1ODFA 4GRAA 2QA5A 2WJYA 5FTJA 3GJXC 1GKIA 2CE7A 1KK2A 3WNDA 2RGNA 4DB4A 1ANKA 4MYHA 4C2TA 4CEIB 1EESA 1VIYA 5FOUA 3QQ5A 5B58C 1RRFA 1AZTA 1US8A 5G53C 3TVTA 4UNRA 4HB4A 4R9UC 2PT7A 1KI8A 1GKUB 4M1WA 3K9LA 3GPLA 4E22A 4A6XA 2BEKA 2XNDA 3MWKA 4DCUA 3EASA 1Q22A 3P20A 1VTKA 2HXSA 4NU0A 1ESNA 3Q5DA 5DN6A 4OHYA 1A82A 5F3WB 1CLUA 2PCLA 4IEEA 5DI3B 4ZPXA 2C9CA 2E1RA 3T1VA 4MRSA 4EFMA 4V03A 5D3QA 3X1WA 3I73A 2QY9A 1XWIA 3K09A 2WHXA 3U2QA 4KLNA 2I1VB 1KO8A 2TMKA 3BORA 2F1RA 4TLEA 4B2LA 1N0WA 3BB4A 3B82A 3AM1A 4RY2A 5JRZA 3RRYA 1QHXA 4KYUA 2CK3D 5JWHA 1SVKA 4XWKA 3QENA 4ZKEA 1NKTA 1OFUX 2QMUA 2P6NA 1SXJE 1ZMXA 2XNDD 1GTVA 2ZRLA 3NBZC 3QBVA 1I2DA 5KDLA 1LVGA 2AK2A 2QT0A 3CR7A 3KB1A 1T0JB 5FTKA 2FEOA 5DN6D 4OI1A 4PHTA 4BLPA 1P2TA 2HYIC 1SKYB 4YC7A 2H17A 1NSTA 4LHWA 3ZD6A 1NVXQ 1Z6AA 1AA9A 5CB8A 3N2IA 2DY1A 2IL1A 3MMPA 3CPEA 2I4IA 4L16A 2YWHA 3KUDA 1E2JA 4WXRA 1E94E 3RDPA 3AVUA 3FFBA 4XWOA 4Z51A 4FCWA 2QTHA 1XJQA 2QI9C 3OIUA 1OT3A 1R6BX 4BUJA 3BFXA 2GJ8A 2JLVA 2IS1A 2QG6A 4TTQA 3SNHA 5KDDA 2REOA 3IQXA 4RZ3A 3MWYW 1Z0DA 1QZXA 1RIFA 1OJLA 4NBSA 2ANCA 2IYSA 3TW4A 1R4AA 4RFSA 4DSNA 1BIFA 1OW3B 3D8BA 4C3ZA 5C4MA 1TL7C 1XBTA 4B34A 4L9SA 1XMIA 1P75A 3QVVA 2FFQA 2O8FB 3GJ6A 3HR8A 2H92A 2QM8A 4OJQA 3SJAA 2WV9A 4R98A 2BMFA 2O8CA 3V9PA 5DYIA 2PLFA 3A37A 3B1WA 4BWYA 3HPQA 4Q21A 5LD2B 2MSCB 3WMEA 4OK3A 1UDXA 2HV8A 1EFUA 2FSHA 3MD0A 4RZ2A 1GUAA 2RGBA 5J47A 3W3ZB 1GILA 4ZI3A 1LNZA 3F8TA 2V8OA 2HF8A 4ON9A 2O8DB 3LO5A 2DHRA 1W1WA 1ZM3A 4RD6A 2W0MA 1OYWA 4Q02A 3KQNA 3U4QA 4JSYA 4EKDA 3AB3A 4AG6A 1V43A 2ZXUA 4LGMA 4YQFA 3K53A 2RH5A 3BOSA 2IXGA 4IJMA 4OQNA 4AI6A 1N5KA 1NP6A 2OHFA 4MQBA 1NY5A 3BRWD 2CL0X 1IN8A 2ZI4A 4LJ7A 4P4SB 4DIDA 4QNMA 3A1WA 3CF0A 4TN1A 2OXCA 4Y0AA 2OM2A 4DCNA 2ZE7A 2IX3A 1ZU4A 3U3RA 4CEIA 4QHTA 1K6MA 3O8BA 1TUEA 1YZNA 3HYRA 2R6AA 1AJEA 1C9KA 2W2XA 1CJKC 1OKKA 5DHAA 1W47A 1FP6A 3BIFA 2QP4A 1TX4B 4G5QA 1CR4A 3UMFA 1Z6TA 4PC3A 4P33A 3ZQ6A 3RYTC 1DAFA 2CJWB 3MFYA 5FR2A 1QHHA 2OCYC 3FKQA 4W5WA 2XGJA 4ESHA 4B48A 4MKFA 1U8AA 1OH8A 1Z5ZA 3QKSA 4ZDKA 3LBIA 4CEHB 3I4LA 2F7SA 4TZ6A 1XZQA 1W2GA 1DAKA 4YMUA 1JR3A 4XSHA 1GL6A 4JIMA 2IHYA 2CHQA 3I1FA 3PR1A 4G5SA 2JLQA 1EFCA 4AKEA 2YHSA 2VL7A 3FFAA 2FGKA 2VSOA 4OQMA 2JLZA 1LTQA 3KJGA 1SXJD 4OQLA 1E2DA 1KDRA 2GJSA 3VKWA 2OFXA 2QRNA 3NBYC 5B57C 3GLGB 3DL0A 1A2KC 1ZCAA 3B2EA 3CRMA 3ZS8A 5SZIA 3KKOA 3L0SA 1R0XA 2QE7A 3M1IA 1AS3A 3R9IA 2RCNA 3VKHA 4K8OA 5L3SB 1XEXA 3NDBB 1FPMA 1HURA 4JBYA 5JRJA 2GAAA 4RCZA 3HP1A 3UMRA 1YR8A 2JLXA 4V0OA 1H8EA 1KZ7B 4HI0E 4JL6A 4B2PA 3KJIA 1A4RA 4IXNA 1F5NA 1KDPA 1KSHA 1ZAKA 1QHNA 3VHXA 3MGCA 1OB5A 3CRRA 4X8LA 1JR6A 4TT3A 2F9LA 2WSMA 2C77A 4QGGA 3GD7A 1OH6A 1UKZA 3I8SA 1WA5A 5CM9C 3LFUA 1DG1G 2VSFA 4I1OA 2IYTA 4ITRC 3ZQJA 3RS5A 1FX0A 2GZAA 4LHVA 4PC2A 2Q3FA 1E9FA 3B1XA 3TW8B 2ASEA 4X8HA 3PUVA 4D0LB 1XZPA 4PAOA 3BH7A 5FBRB 4D80A 3OHMA 4BFVA 2ZAMA 3IBYA 521PA 4NP6A 4PAQA 2VP4A 2B6HA 4KSCA 3WNCA 4PHFA 4URUR 1D5CA 5AJVB 1IM2A 2YJTD 3BJIC 1KJZA 5AUQA 3ICEA 1W49A 4B35A 3FYHA 3PEUA 1VG0B 4TT3D 3K9NA 4PPGA 2QSZA 4B75A 2O8EB 2P0EA 3T5DA 3DKPA 1LY1A 1AN0A 1LV7A 4Y0VA 4WVFA 4FIDA 1TQ4A 1Q20A 2ERXA 1KIMA 4IEIA 1Q12A 2ZEJA 2BV3A 3VNUA 3RS4A 4Q7MB 4KITB 2VA8A 4KSBA 4ACAA 2Z4SA 3FKSD 2ZRGA 2DPXA 4PZZA 4A0GA 4A92A 1KAOA 3K70B 2BMDA 2JLSA 1YZQA 3CLVA 3DZDA 4M21A 3SHWA 3U44A 3EG5A 4HEJA 5DE3A 4DC9A 4LJ4A 1Q3TA 2BCGY 4B6EA 3U4QB 1ZIPA 4PQYA 1OXXK 1E2FA 1DPFA 3CIOA 1KKLA 3IKJA 4G0NA 4B3DA 2VP6A 3AUYA 3LDAA 2DBYA 2GKSA 5FPYA 3H84A 2X77A 2IHBA 1XPUA 4CGZA 1FTNA 1LFDB 1ZJ6A 1IN5A 3TSWA 3CF6R 1IY1A 3FKSA 5KTYA 1S3GA 2IS2A 1SVIA 3QI2A 4GP6A 3DOEA 4EPVA 1LW7A 4ZIRB 1DS6A 1P9WA 3JZAA 1PUIA 3NTUA 4PC7A 4PTLA 4F92B 4RKEA 3FHTA 1KO4A 1MH1A 3PCRB 3TLXA 3TQCA 4OI4A 4F4CA 5JI2E 3AP1A 3THXA 4BRUA 4V0NA 2AX4A 4GFDA 3B60A 2GXAA 1BYUA 1DO2A 3K0CA 2Q9CA 2WWFA 1SVSA 1FMLA 3GMTA 4QM7A 4BLRA 4A9AA 4EJSB 1E1QD 2DFTA 1QHGA 2ZRPA 4M1SA 2VSXA 4E07A 2BKEA 3SE0A 3AF3A 1NMZA 2IT1A 4C0QC 2SHKA 1FL9A 5AUOB 1KI7A 3T06B 2JASA 5JSZA 1HT2E 3RSLA 2FDCA 3KDSE 3C7KA 3K8YA 4M22A 1I4DD 1VCNA 2GEUA 2OCBA 3T5GA 1E96A 5EZ6B 4C0KA 3L8ZA 5TV2A 2QPAA 5FOWA 1FZQA 4F4JA 2AD1A 1O87A 1WBBA 1KO1A 2GJAA 2NGRA 3K1JA 4F7WA 1CU1A 5M04A 3L2OB 4A1FA 2QBYA 4JBXA 3KTAA 3EA5A 3SFZA 2LCFA 5TARA 2CL6X 1TUIA 2J0UA 4XVUA 1ZP6A 2OCPA 5CK5A 1OFHA 3HJNA 1MABA 3P26A 3QG5A 2CCGA 2FPKA 2FU5C 3U3MA 5EXXA 4LV8B 5K8IA 5FOSA 1ZIOA 2F6RA 2A30A 1OV4A 2WPDA 2GA8A 4DDTA 2VIIA 2OO7A 4PPNA 1NLYA 1XD9A 1C1YA 2HT1A 2W6JD 2C9YA 5HPYB 5L3VA 2ZJAA 2EWWA 2EYQA 3BFVA 5CLLA 1E2KA 1PUJA 4EPWA 4FINA 4Q00A 1AKEA 1XD8A 5C46F 5BN5A 4FCVA 2G83A 5L3QA 1W36B 3U7FB 4NKRA 2XJ4A 1NIJA 2GVDC 5HE8A 5JSZB 3O8DA 2ZRDA 4W9MC 4E09A 5FOTA 1Z6XA 1Z3IX 1H65A 1X86B 2GXQA 4U00A 1P73A 1VHLA 2GJKA 3GLHE 5G40A 1W2HA 5J4HA 3K70D 3PUZA 3U3JA 1ZBDA 4DLSA 4YDSA 5B64A 3TGPA 1XTJA 2Q9BA 4R2HA 2HCJB 2VHTA 4LK2A 4OQFA 1MRNA 2QL6A 4JLMA 5HCNA 2IXFA 2QORA 2AFHE 2YOFA 3U3OA 2G0NA 1TF5A 1WB9A 3LNCA 4M2LA 5CYOA 2ZSFA 1CBUA 3OIYA 4OYHA 1P3JA 1MO5A 2L0XA 2IWRA 2V6IA 5HTKA 4AKGA 3Q8XB 4MGYR 3T12A 1TQDA 3U44B 1E3MA 1UF9A 1SHKA 1ZUNB 5GVSA 1J2JA 2D2FA 2UZIR 3ZGXA 1EFRD 4Z8XA 3B7GA 2C98A 1ZCBA 2GNOA 1XTKA 3ZZ0A 2C5LA 1EK0A 2J7PA 1RRCA 2CVHA 3P4XA 1OIXA 4BFTA 3EC1A 3SDZA 4RD0A 2VHUA 4JLKA 4TLDA 3SQXA 2BOVA 1DE0A 3LX8A 4CRWB 1E9BA 4TQAA 2ONJA 1E1RA 1JNYA 4Q01A 3ZH9B 1GDDA 2DCUA 1Z2AA 4I1SA 1TF2A 2JA1A 5F9FA 2VPPA 1OXSC 4JT4A 2OAP1 1XMSA 2G1KA 1NN1A 1EFRA 3AVXA 4B6FA 2N46A 3E5HA 4RZUA 3U3KA 3QKRB 2IYLD 3ADCA 4CEHA 1G16A 2ZRFA 4IW3B 2OE2A 1IONA 3PUWA 4A2WA 4WA7A 1ZD1A 2ZUDA 1Z22A 1IJEA 1N6PA 4N1AA 4MKGA 3K0SA 1E1RD 2UZ3A 2A5FA 3PUYA 1XTQA 4B44A 3EAQA 3B1VA 2BBTA 2XXAB 2O8DA 2PL3A 4RVCA 2AXNA 1B0UA 2CBZA 2FPLA 4MITA 3VAAA 4AYXA 5IT5A 4KV9A 2A7QA 3NBXX 4OBEA 5FI0B 1YHNA 2ZREA 4PC6A 5A5GA 4M8NE 2WKRA 3ZZTA 2G1JA 1TADA 1R5OA 4CYMA 2HYDA 3MG9A 4BZQA 1WP9A 5KU1A 3GCGA 4RD4A 4JYBA 4CW7A 2GTPA 3A4MA 1XTIA 1OH7A 2DFKB 1W4CA 1P62B 3W90A 2ZSEA 3GLIB 2YZ2A 2ZUBA 3ADKA 3ZS9A 3QJYA 1RVDA 1S9HA 1P2SA 1BMFD 4WXPA 3PEYA 1AS2A 2JJ2D 2ZJ2A 3RRZA 1E6CA 1E1QA 3CX6A 3GJ0A 1RFLA 4BFUA 1JXOA 5EE1A 1TEXA 1Q0UA 4X8MA 3I3SR 3QKUA 1YJ5A 4MYCA 1XXHB 2BKUA 2WWXA 3BE4A 3ZVLA 1S1MA 4D6PA 2CEAA 3OZXA 1U2RA 221PA 2BEJA 4BFSA 1DEKA 3KUCA 3OEHD 5C18A 3TSZA 4XVQA 3ADBA 4M1OA 4Q9LA 1IY2A 3J81k 3KQHA 1GWNA 1BKDR 3F3YA 1P72A 2OZEA 5KYKA 3QKSB 2ZE5A 1KI6B 5J4KA 2W00A 4C0BA 4A0FA 3QXXA 1J8YF 2ZYTX 4YMTA 1CJUC 2W83A 3BH0A 1AKYA 4TL6A 3BB3A 3QE0A 2GCOA 4D0NA 4LPKA 3SYNA 3O8RA 1YQTA 3U6KA 421PA 2QMOA 3TVDA 3I72A 1JEEA 2VHJA 1VKJA 1NIPA 1XCGB 3B9PA 1GSIA 3IPXA 4DCSA 1KTVA 2VHQA 2XZPA 3VNVA 2GCNA 1E2MA 1VYUA 5UKDA 4LOAA 4PQRA 2KWIA 4IDNA 1VG1A 1G9XA 4A82A 4MKHA 1QG2A 3QXSA 1LF0A 4NL4H 4LBZA 3LVQE 1E99A 4DRZA 2YC2C 2QE7D 2YINC 3THOA 2CMKA 3PIRA 4LBYA 2J45A 4AKHA 1SZPA 2HJGA 4XTCS 4Q1FA 3DO6A 1J90A 2C04A 5CDFA 1TEVA 2Z5FA 4IKEA 4PAMA 1ZNZA 3BS4A 5H8WA 3K0FB 1P6XA 2DWOA 3GLGE 1G4UR 3CPHA 2R9VA 3CWQA 4MA4A 4HUTA 5AWFC 1XP8A 2AD5A 2X19A 2PLRA 2VP5A 1J99A 1MO3A 4A8JC 4IVQA 1G3QA 3H1TA 1Z29A 3QKTA 3QPWA 3VR1A 2MSDB 1U8ZA 1G8PA 3GJ7A 4D26A 1N3BA 1G8GA 1IBRA 1PLJA 3KKPA 4B2IA 3DHWC 5L8VA 4YMSA 1KY2A 2F1HA 2Y8EA 4US1R 4WOPA 4DSTA 1KO7A 5CB6A 1ZU5A 3KKNA 2IA5A 4H1VA 3T1QA 5CDFE 4CVNA 4NYJQ 1KI1A 1QHIA 4C0HA 4QGFA 3IO3A 5KNCA 2ZRAA 3TR5A 1XNJA 3VU9A 2ZR0A 5FBVB 1OLOA 1AIPA 1SHZA 4ERNA 4LBWA 5L3SA 3CX7A 4PO1A 1CR1A 1K5GA 5KOYA 1FOEB 3V00A 1XCPA 2CCKA 2NOAA 4TMXA 3AKDA 3F0TA 1DBSA 1NN3A 2H7VA 3ZZUA 2J59A 4HAVA 2ZITA 3LH5A 3G82C 4JLJA 4Q4AA 4UNQA 4F4IA 3U7HB 4TMVA 3OEEA 5LB4A 2ZRIA 4DLTA 2O8EA 3EWAA 1GIAA 1RZ3A 4PHGA 5BQ5A 2DR3A 2ZS9A 4IFBA 4M9QA 3VR3A 1Z08A 2H18A 4OK5A 2ORVA 5DGXA 1XB2A 3A36A 4A0RA 5AUNB 4JKIA 3IHLA 4KJZA 4MYTA 3AGPA 2J87A 4KO8A 1G1MA 2YC4C 2WMNB 4M9SA 3LV8A 2AKYA 2IF2A 1M34E 3EIQA 3KKQA 2G88A 5IHPA 4Q48A 2GVZC 2RMKA 3B85A 1TPZA 1DO0A 1FTSA 1L4UA 4LDJA 1E2IA 1E0KA 2V3CC 2OXRA 2CCJA 4FCTA 2QZ4A 2QN6A 1W5TA 4QC2A 4LV5B 2CNWD 2YWFA 4HAUA 3TAHA 3IEVA 1DVRA 1Q44A 4RSGA 2QNRA 3ZJYA 1T5LA 2OFWA 1TTTA 2IC5A 2PH1A 2NTYC 3WBJA 3QXHA 3NC0C 2ZE6A 4PX9A 2YNMA 3QOFA 5FL7A 1ETUA 3QF7A 5FBQB 1G4AE 3BB1A 3OE7A 4KBFA 1GVNB 4AIIA 4EPXA 4GDFA 3SI7A 1R2QA 2YKGA 2QUZA 2AN9A 1E9RA 2PEYA 1AK2A 2JJ1D 2NO9A 5DI3A 4NYJR 2D2EA 4JLVA 4TMWA 1TU3A 2ZSAA 2W6JA 5EE3A 1UBGA 4Q47A 4EPYA 4TLBA 3HYTA 1N6KA 1W46A 1Z6GA 2IYXA 2ZPTX 1GZSA 4Q7JB 4C2UA 3H2YA 4BFXA 1OKKD 1UFQA 2BM1A 2RHMA 2CNWA 3DMDA 3SEAA 1T8UA 1A5TA 1KSGA 2QPOA 4EFNA 3IIJA 3K09C 2QMHA 1BO6A 4Q9HA 2XZOA 3I8XA 4DEXA 2CHVA 1UEJA 4POAA 2GDJA 4KFSA 2JATA 2O0HA 3Q72A 4MKIA 1WF3A 4J0QA 5KUTA 4C0JA 2IEYA 1ZNWA 2PJRA 2ZRJA 1OIVA 3RS0A 1OSNA 3BBPA 4US0R 3WP1B 3MWJA 2GZHA 3R20A 1JQLB 4I4LA 1VCMA 5A4JA 4US2R 2X1VA 1EX6A 1EXMA 5FI1B 3NXSA 3VMFA 1R10A 1NMXA 2A5YB 2RHDA 4GOKA 1RPZA 5CM8B 1Z0AA 3FB4A 4Q03A 5E7IA 1NVUQ 1OE0A 4MYUA 4BLTA 1NL3A 2ECKA 1U94A 3OESA 1BH2A 2NO7A 4DCTA 1PVOA 4A6PA 2J0SA 4BZPA 2FA9A 2ZSDA 1II0A 2D7CA 3PQCA 3W5IA 4GNKA 3CNLA 4DJTA 3AF4A 1AGPA 5J4VA 5AJZA 4ZIRA 1HEIA 4JL5A 4XH9B 3N70A 3TIFA 3Q7PA 3RNLA 4LZZA 5IK2D 1WCV1 3VKGA 5JLJA 5DI9A 3WHKA 5J4LA 3LW8A 3LA6A 2W2VA 5FPHA 2N1BA 4O25A 1Q1ZA 4XIGS 3AVQA 2D7DA 4URZR 1ZM7A 3EX7C 1ZC4A 4MDFA 4IFEA 2XB2A 4A8JA 2ODBA 2ODWA 1FUUA 5JEEA 2A78A 1H8HA 1JB1A 2FFAA 2X2FA 3CKLA 4ARZB 4HYYA 3RVBA 3MJRA 1NVVR 4KCGA 5EP1A 3SFVA 3OEED 4O2LA 3JVVA 1COWD 4MUBA 3NHAA 4PPFA 2PEZA 5IDVA 1ZM4A 3UANA 1UKVY 3DDCA 3W5JA 2J41A 5LBIA 4NYIQ 2ZJZA 1CULC 3HDTA 4B47A 1G17A 2FH5B 4KI0A 3W8NA 1T3HA 1A2BA 2Z43A 3EC2A 4C0SA 2RKOA 2B21A 4EAQA 2G6BA 1GKYA 2B7CA 2IK8A 1OFIA 5A0FA 621PA 5KNDA 1DARA 4EFLA 1WXQA 1GNRA 4NMMA 2P3SA 4Q1EA 2VF8A 1NSFA 4NYIR 3R9XA 1DELA 2PBRA 3T1TA 4DLUA 5H1YA 2WMOB 2J9RA 3DEFA 1SXJC 1E0SA 1P61B 3H0KA 4LHXA 4LYJA 4UJ3A 3RRNA 3X1DA 1COWA 2O0JA 3THYA 1IQPA 3NH6A 3AEZA 5G3ZA 5SZJA 2OBNA 1QF9A 3ZVRA 3IDQA 4BGDA 1JECA 4K81B 3FHOA 1MABB 4TMTA 4ZCLA 1YVDA 1XTSA 1J70A 2FNAA 3G5UA 5KPDA 2ZANA 4L9WA 3VR2A 2F3TA 4C4PA 2ZRCA 2ZYWX 1HQYE 2J7PD 1P9NA 2ZUCA 1G7CA 5GJWC 5BXQC 721PA 1JJ7A 2W6IA 1G18A 4P0TA 1DOAA 2J0QA 3TR0A 2QM7A 3UMSA 1MOZA 2WAYA 4G5GA 5EZ5A 5JHHB 2J1LA 5KHOC 2BVNA 4E03A 2CXXA 3A4LA 1K5DA 1R0ZA 4S35A 4AK9A 4LHYA 1Y63A 4C30A 3LY5A 1KMHA 4B33A 5CIWA 2ERYA 5EXTA 1KI3A 3SS8A 1RRPA 1XMJA 3U5ZB 1QRAA 2RGEA 1N6RA 4JT2A 2VYFA 4Q5IA 1N0VC 1IY0A 2ZI9A 2FPMA 3AV0B 1W5SA 4D4KA 3TUZC 1CP2A 2ZROA 5EXPA 1T91A 3K9HA 1WBDA 1T5IA 2PJZA 5EP4A 1VECA 1EX7A 1VDZA 3H4MA 3P4YA 3RSOA 1G6HA 1P9RA 2YWEA 4GSYA 2HLDD 1UBCA 1G291 2Q3MA 2OG2A 3KXLA 2FEMA 4BLSA 4G3XA 5DLQC 3K0AB 4PANA 4KFRA 2ZJYA 1CKEA 4MRPA 4P4TA 4F93B 2WWIA 4U02A 1GL7A 1VYTA 3NC1C 4B3XA 5ANRB 1G3IA 2IUTA 1N25A 3C16C 3HWSA 5JWRA 4XD7A 3OE7D 2FJUA 2ZS8A 1E2LA 3FTQA 5JJIA 1E2PA 1Q1EA 3T61A 3IQWA 5FTLA 2R6CA 3RC8A 1E0AA 3E1SA 4BE7B 3CB4A 5HKKD 4DWJA 4FMDB 1YRBA 2AK3A 3SBEA 1U98A 2HLDA 4QRHA 2AR7A 4HAYA 2YVUA 5LDDC 3AVTA 1Z0JA 3WXMA 3UG6A 1Z63A 3D6TB 1A7JA 4D2IA 5EJEA 4PSVA 2AL7A 4TYWA 4RD3A 3TAUA 1V5WA 5TXGA 4URVR 2VBCA 2F55A 1KYIA 5E7MA 1HV8A 4UXJA 1P7CA 4WBSA 3TH5A 3EZ9A 4LYFA 2GRJA 2QMEA 4L5BA 1HE8B 3RS7A 1CRPA 2V55B 2VH5R 3N5CA 1KKMA 5HKKA 1FP7A 5FH9A 1E0JA 2B92A 5D3MB 2IUSA 2VTKA 4DIEA 1LS1A 3GEIA 2KSQA 3Q9LA 2V1UA 2V9PA 1YZTA 3BH6A 3QXJA 2P6UA 1CIPA 2J46A 1CJTC 4BEBA 1KNXA 3B1YA 5JCPA 1HH4A 1S0UA 2NZJA 5JJKA 5BWMA 3CM0A 1TU4A 1DAIA 1SVOA 3NDPA 4BFZA 4M1TA 5KPJA 5FPTA 1ZW6A 4R7ZA 1R5NA 4M0LA 3AVPA 2WOJA 2FV8A 5TDHA 5FOXA 3THWB 2DWPA 4QNRA 5D3MA 2VO1A 2BCJQ 3ONWA 2HEIA 4JLOA 1E32A 1VPLA 1TQ2A 3LX5A 4FMCF 1WMSA 2PT5A 4IDOA 4OHVA 4WIAA 5EUMA 4DDWA 4ZDIA 1OB2A 4DKXA 2VLIA 2R2AA 1G7TA 1NY6A 3EIHA 3UPUA 3C5CA 1E9DA 4MRVA 4B32A 3U6BA 3CW2A 1GRRA 3CX8A 2OT3B 1ZUHA 4IRUB 3B5JA 4TYPA 4QJ5A 2O8CB 4V02A 4PR0A 1KJWA 3KFXA 3RLFA 2OUKA 4E5UA 2HJVA 3B1ZA 1FQKA 1H8HD 1Q3HA 2ZI7A 3TRFA 3ZVNA 3BAFA 2JLRA 3R9WA 3CF2A 4LRWA 4C7OA 1JPNA 2FFBA 5SZKB 1OIWA 3A4NA 3K0CC 4YXWA 3RAPR 4Q4HA 4DLZA 3LLUA 5JMTA 1XJCA 3LWNA 3GQBA 4W7SA 2EYUA 5E95A 3W6PA 2OBLA 2OCAA 2WAXA 1KJYA 1II8A 1U81A 1XJ0A 1U9IA 2QAGB 3P32A 1U0JA 3LXRA 4IOMA 4NPHA 2WWYA 4IDPA 2HDNB 4EIWA 5FL7D 2MMCA 1D9XA 3GJ8A 3VR6A 5CK4A 5L3RA 1RJ9A 2BMJA 3EZ7A 4BPBA 5AUPB 3C5HA 1HUQA 1OPXA 2P5TB 3NKVA 2Q3HA 4OI0A 3REFA 3IEUA 3X1YA 5H68A 1X8JA 1SXJB 4M9XA 4PZYA 3AH8A 4HAXA 2R44A 3FOZA 2D62A 1OFTA 1G5TA 3SQWA 3AF2A 1P60A 2FZ4A 2FG5A 1L7VC 1JAHA 1KGDA 4QJ3A 1IN4A 2J7KA 3HU3A 3KX2A 4QHYA 2A3RA 3GEEA 4Q1AA 5BYJA 3RABA 3V4RA 5DSZA 4D81A 3AKYA 4Q1CA 2J5XA 1T6NA 1HA3A 1F48A 4A2QA 2WICA 2EW1A 1YZLA 3OFNA 2J0UB 4ABYA 1W0JA 4WZBE 1SVLA 1RRGA 4ILEA 4CIDA 4GBMA 3D31A 4P4UA 1KK1A 5BYKA 3WBKA 3K70C 5JS8A 4BLOA 5G41A 3V4FA 3CRVA 4FWTA 3EARA 3KKMA 3HR7A 2ZRKA 3AGQA 3EPLA 2WJHA 2DB3A 3CZPA 2QEQA 4LJ9A 2CLCX 1QBKC 2OEPA 3AVVA 1NN0A 4LI0A 1CF4A 1NKSA 1FNNA 1UBEA 2GXUA 1KMQA 3DOFA 1Z2CA 1SVWA 4M1KA 4Q7KA 4TMKA 4UNPA 2R65A 1S2MA 5KSOA 3AVYA 4B43A 2FSGA 3KQKA 4HLCA 1KK3A 2KI5A 3MSXA 3T1OA 1L8QA 2ZRHA 1BMFA 1C4OA 2O8BA 4X8OA 4NZYA 1U99A 4DB2A 1G6OA 2FSIA 5LPNA 2C2HA 5IK2A 2JJ1A 1GP2A 2I1QA 4JLBA 1UDWA 4CEJB 1KDTA 1UKYA 1N6IA 4MRRA 3BC1A 5AJWA 3QKRA 3LBNA 3OIVA 1VCIA 1Z8FA 3FDIA 1UJ2A 2QP3A 2D06A 1G5PA 1NN5A 1X3SA 2ATVA 3NBFA 4MDEA 4TQUS 3TK1A 1RYHA 3FWYA 3PJRA 1ESMA 1MV5A 2A2ZA 4PO8A 3U60B 2C96A 5H70A 4OHZA 2VP2A 4LJAA 4OJKA 5FUVA 1CRQA 1BS1A 2WSSD 2WIAA 2ZS7A 3SZRA 3F5FA 2R62A 2G3YA 1II9A 4BQSA 3D7MA 4KBGA 1M1YE 5J40A 3NWJA 3KQLA 2QTVB 2EFDB 2P65A 4B73A 4JS0A 2BMEA 2KJQA 4LJ5A 4P3YA 4XVRA 4JSTA 4O0MA 5GADl 1G19A 3K0FA 4RD1A 5BW8A 5IRCD 1EFHA 3QSYA 1AQYA 3CNOA 5SZHB 1MT0A 4Q9JA 3L0IB 1KSFX 3M0EA 4NONA 4LPSA 4NE2A 1W0KA 2BDTA 4LJ8A 5P21A 1JXMA 3SOPA 3NIBA 1NJFA 3GLIA 1FUKA 5DIFA 3KXKA 4HSEA 1D2EA 1D9ZA 1W4RA 4TL8A 1GM5A 4PC1A 4JBWA 2QGZA 1X1RA 1PV4A 2ORWA 2ZU6A 4QM6A 3KXIA 5IF9A 2QRZA 1OXUA 4HZIA 2G0TA 2WKPA 4G01B 2C8VA 2G9NA 3UWOA 2V7QD 2ZVPX 5FUWA 4GL2A 3QIAA 1NVVQ 3IUYA 1CR0A 2Q0HA 4AKIA 2ATXA 3TKLA 4ESVA 4KODA 5JZVA 4B3GA 3IGFA 3OF5A 1D2NA 3SU8A 4LYAA 4ASUD 1CR2A 1IN6A 5AR1A 3A1UA 1IAQA 3I32A 4HDQB 4DSOA 3B8HA 2ZIAA 4V0MA 1GRQA 2ZRBA 4P31A 1KI6A 4II7A 4ZI2A 4AYTA 4EPRA 2ZVQX 5FBLB 1NLZA 3CO5A 4RD2A 5K8LA 4M9ZA 3W9YA 3ZLJA 2JJ8A 1UBFA 2RGXA 4XWAA 4GOJA 2X8AA 2XJ9A 1F2UB 2GILA 1JALA 2RB4A 3IIMA 4Q4LA 2H1LA
chains in the Genus database with same CATH superfamily
2VP9A 5LP6C 3LLMA 4HR7A 4QXQA 1Z4MA 5CR9A 1Z6ZA 2UUCB 4KAXA 1F2UA 4YCJA 2YWGA 5HYVA 3L5KA 4Q4HA 1N2CE 2QL7A 2VJAA 3MMNA 4KFTA 2FLVA 3OJWA 2V6FA 1JQJC 2IWHA 3RTEA 4B45A 3AFOA 3DO5A 1FC0A 1KPHA 3MCUA 4HEA1 1A71A 2NV0A 3H1AA 3FR7A 1U2QA 4IDAA 3GNTA 3O8LA 4JL8A 2NPFA 3HEAA 1KZ6A 4BV2A 3HVJA 5AH0A 1E66A 1V8PA 4LGVA 4TX1A 5DV9A 2P62A 1N77A 3NLLA 2GARA 3F6BX 2LWIA 1MX5A 3V2GA 1QHYA 4JSRA 3AR9A 2FMXA 1Y6RA 2Q4DA 1KI4A 1ZO8A 3QMWA 4N5IX 4KVGA 4HLDA 1TAGA 5ARCA 2LKDA 3HZHA 2GPYA 1PJCA 1JHXA 5JBQA 4TTJA 1BQ4A 4ZZ0A 5IUJC 4XFKA 4D0SA 2CFOA 2DHEA 3EMDA 5AYVA 2DKFA 2E37A 3BFKA 1M0EA 2FN7A 2K6GA 2HXYA 1TIPA 3C43A 4RWEA 3WX0A 1E58A 3PDUA 4KXQA 3DP9A 3VGJA 3RS2A 2OSVA 5HBGA 4GRIA 6ADHA 2NG1A 3WHLA 5BV2P 4RE6A 5DEOA 2RC6A 4V0KA 2BGKA 3E3LA 3ZD7A 4HAZA 1POXA 2O52A 1R0LA 2Q5CA 4LTNA 4WESA 4HLQB 5IM4F 3JQFC 1VL0A 1I3KA 3JARB 3ND7A 3SQOA 5IAOA 4URWR 2V4ZA 2WE8A 3W8RA 3PEVA 4MXDA 4ZVVA 3TSYA 2BFPA 1J0AA 2N0SA 3FOFC 2I3BA 2QLTA 1W581 4BNDB 4JLNA 3UAWA 1R12A 1D7AA 1K27A 4PYRA 3KOWA 3MPUA 3T9DA 3H11A 4ALKA 3PDWA 4HGQA 4XTRA 3H9QA 2FOLA 1PZGA 3DEKA 4J49A 5C8XA 5FWYA 1YZHA 1E5VA 1V4BA 2ZR9A 1KGSA 2G0AA 2ZI6A 3P1JA 4GM1A 3DBVO 1UEIA 4RMIA 4WN3A 3FZYA 4XIIA 4YLEA 1ZCJA 4NF2A 1XTRA 2DPLA 2ZIVB 3VX3A 4XGIA 4IUBS 3QF4B 3VQTA 1N2HA 1FYWA 3GRRA 4NMXB 1NR7A 5LFAA 2H52A 4OKSA 3MT7A 4DHWA 2WTNA 2FG6C 4BUCA 4EFDA 4OO3A 5AK0A 2VDQB 1ZVMA 3GRKA 2J5RA 1ZRHA 4QQFA 4DJ5X 3HVRA 4W99A 2Y4OA 4P32A 2PCJA 3NG1A 1M8JA 1PFVA 2XVZA 1JHYA 1WMAA 4QIHA 3DFUA 4RNCA 1CEQA 3UKDA 3I5XA 1GQYA 3PC7A 1GSOA 3QU7A 4K5QA 3HI6A 5E3JA 2R5NA 1X1SA 1M6VB 2GFIA 1DOHA 6Q21A 1XAJA 1ZOLA 4C08A 1JSZA 2O3UA 2FN4A 3IHWA 3KIPA 1D6MA 3LI2A 4OL0A 1Q1QA 3JS5A 1U3VA 2EQBA 3HEBA 1G8SA 2IEBA 3CVOA 3IQFA 3PUKA 5JAQA 5BSWA 2OESA 4BBZA 1MR3F 2VG8A 1ZD9A 2Q5QA 4YTEA 3T9BA 1DFGA 3A6PC 3I4CA 1ITZA 1GKKA 2F3RA 1KI2A 2W22A 3LLSA 4HRYA 3OSUA 4PFSA 1RCUA 4PBSA 4TKMA 5K6TA 2VQ6A 4EG3A 2HF2A 4WXYB 3NW9A 2HT6A 5HFAA 4F3KA 4YMHA 3LUKA 2LKCA 1UOOA 1JQDA 1NFFA 4JQSA 8MHTA 1PUXA 1KTIA 1UPAA 3QXGA 4FFSA 4AJKA 1FJXA 1QHHB 3W3AA 1HK7A 4V0LA 2YYZA 5HIIA 2ZB8A 121PA 1FA9A 1RKXA 4BV3A 3CKYA 4TSFD 4NYMQ 1RYDA 1VL5A 2C95A 3P27A 4ZQCB 1SKYE 5J23A 2R7KA 3FMPB 4G9BA 2DR0A 3CRQA 2VAMA 4MYDA 1XEFA 4KAFA 2GTIA 2XTZA 2ZDHA 4PBRA 4K05A 2XYHA 1M76A 3WWPA 1PSDA 1V3UA 3R41A 3V1YA 1PQPA 3ZKWB 1HYQA 4DY6A 4YAKA 4OUKX 1JG2A 2Q6VA 1FDRA 2JIRA 3CH5A 3ZDQA 4WZAE 3WLAA 2QENA 3HVUA 2DYKA 1W44A 3NC4A 3IUMA 5DP1A 4RL6A 4K9RA 4MLCA 1NUTA 4BTLA 1FS5A 4RLHA 1DKUA 1Y34E 2QVGA 3E18A 2HTEA 4EITA 1BG6A 3PKJA 4O4JA 1GL9B 1RRKA 3ASZA 3SHFA 1DLJA 3HA3A 4ZRDA 2NO6A 1KSJA 3SC3A 2AI3A 3VTKA 2NSLA 1FS6A 3ZCUA 3HSSA 1ODJA 1O5OA 4OQXA 1SXGA 3TTYA 3WL7A 4E94A 3FMOB 4IQ0A 3JQGB 2MYTA 5DM4A 3FPEA 1TJ5A 1YZFA 4G1VA 3T7IA 4BO5A 3BK7A 2WIBA 4QJ4A 1L4BA 4D0RA 1RI5A 3E5NA 2JCVA 4EO7A 3G0HA 1E92A 1JDSA 2I3ZA 3L18A 3FIJA 4DXDA 4YP9A 1SK9A 4ZAXA 2FCRA 1E9SA 2AMFA 1AZSC 3AF1A 4B40A 5IF3A 4FJ2A 2XMBA 2C03A 1NUSA 1KOFA 1YVRA 4JVNA 2RGNC 3OX1A 4ID3A 4J07A 4R1OA 1KH2A 1NWCA 4N6GA 4H7HA 4LRSB 3I9FA 3GDOA 3UENA 1GY8A 4MUYA 4C89A 3KYIB 1PT8A 2EV9A 3UK0A 2HWXA 2WAAA 3E6AA 1I6LA 1OLUB 3WGMA 2DOKA 3ZV5A 4P92A 5CNJA 1JLLA 1SM4A 2ZWVA 1X2BA 3GP5A 13PKA 4GPZA 1O5IA 2NMVA 1TRHA 4RK0A 4GQBA 2FUCA 4HLUC 1P1BA 1V5IA 4XB2A 1IFXA 4MGZR 2JLYA 1O96B 3DEIA 4Q4JB 1IHUA 1P31A 4R2WA 3PQEA 1ISMA 4Q7QA 3QVXA 2EHJA 2IYNA 1NI3A 2O8FA 3NQ41 4KK3A 4LAFA 2W6ID 4EUNA 1SWWA 1GCGA 2O57A 2X0RA 4OP2A 2BFEA 5DHFA 1ZK4A 1MKYA 4OG2A 1PK8A 1PEDA 1UIRA 4I46A 3L5OA 4X45A 5CLJA 3I01M 3TKAA 2B5OA 3BGWA 3UV6A 4BNDA 5HWSA 3THWA 3VPSA 1P1IA 1ABBA 1JH8A 1M7GA 3GT3A 2CSUA 4P38A 4RF5A 3JARA 1ICEA 5GONA 3AZOA 4RPCA 1NC3A 3F5SA 3HN6A 1DC7A 4EF5A 1WDMA 2CLFB 2LTAA 4YAEA 3V6LA 1RS0A 1LJLA 4QU8A 2G5TA 3CR3C 4GGPA 3EWSA 3BHNA 3A6KA 4GPIB 1OHHD 3PC3A 3SHTA 1HE2A 5LJIA 3F73A 4KFUA 3LYAA 3K1TA 3K15A 3TEFA 4UEKA 4TKVB 5DH9A 4WXMA 3TNFA 5KSPA 3ZY5A 3WLIA 1RQGA 4AJHA 2FE4A 4QOHA 2AXPA 5EI5A 5F5XA 3ZNNA 2VJOA 1X8KA 3L7BA 3M81A 5HZHA 1JRLA 3H13A 5A4KA 4ZI7A 4F4HA 1IOWA 1NYLA 4TMZA 5H9VA 1RXEA 4FYWA 4TYYA 1OFUA 1OU4A 2ZKLA 2A0YA 2UVPA 2H0QA 2W4IA 4I3FA 4LY3A 1A97A 2L18A 1NR1A 2PH5A 4EJ0A 1WUHS 4DUGA 2CL5A 1JU9A 3IOYA 3LFHA 3G7UA 3EZYA 3W79A 4WZBB 1A7UA 3TPFA 4XASA 3GGDA 3MERA 5FNVA 3UJ7A 4D4MA 1U90A 1WE2A 4YAIA 1AMUA 2QP9X 3CZRA 4G6ZA 1ZK2A 4AC9A 2PWPA 3AIIA 3CG4A 1DADA 1XMVA 1IEVA 1B6TA 4EATA 1P4AA 1RW4A 5C1BA 1IEXA 1E59A 1JXAA 4Y67A 1S5PA 1N34B 1OAOA 1E5DA 4GVLA 4HMQA 2QAGA 4AWAA 1Z33A 1EVQA 1XMQB 4MKXA 3PPWA 2Q6TA 3KSZO 1TMGE 4E3ZA 2HSDA 3LUPA 4NJOA 3G2OA 3P9YA 4FHEA 4RIGA 4LKOA 2OGSA 2ZAOA 2GAJA 1QGED 4BQPA 1DV1A 2UKDA 3TTVA 3BCUA 3ROFA 2J31A 2WWTA 5KYTA 5F9HA 5JJLA 5F1OA 2X0EA 4CQMD 3B20A 3H1EA 4WOJA 5T3UA 4XOIA 1CQXA 2P9YA 3BWDD 4X94A 4LISA 1IDOA 1AURA 2B1IA 4HMOA 2DZDA 2XB4A 4UD2A 3RM3A 3L8MA 4Q1DA 2Z0MA 2ZI3A 4YACA 4CODB 4F2HA 5K7SA 4HDCA 1BXZA 2GPNA 2XXAA 1UP6A 1BMDA 4FW9A 4OLHA 3EC7A 3G2LA 2Z83A 2BTQB 4EKYA 1E6EA 5SY4A 2PUEA 1N8KA 2CDNA 3GK3A 1NVFA 4H16A 3PE4A 4BRSA 1FMJA 1Q50A 3EGVA 3KR0A 3RHFA 2H57A 2XITA 2YWJA 1GEEA 4BLQA 2Z5LA 2CLDX 4Q37A 2VHCA 4WBNF 3LUCA 1P2GA 5C5IA 5JCXA 4KNYA 2R5WA 3BG5A 4P36A 4EDHA 1E3WA 1MAAA 2QZPA 2WC1A 3G5AA 5TQVA 3GARA 4X1KB 1T4CB 4QXAA 3TI9A 5AM2A 3IJ5A 1G5QA 3T3GA 1UXJA 3HP4A 2VDWB 1XZGA 2JAXA 4MTCA 3RRMA 4A36A 2FK8A 2E5FA 3C8UA 2BFDB 4HB2A 5J9FA 3DXZA 4ZV7A 3VBEA 1IBSA 3QNUA 3ZJ5A 5CDUA 5KYXB 1RQ2A 4LC1A 4DZZA 1ZAYA 3KZCA 3A06A 1PT5A 2PBZA 5E9WA 2A1IA 3JTEA 2ZYGA 1QS0A 1CG6A 3JY6A 4PVCA 2OV2A 5KYXA 1CZKA 2QLBA 4GR5A 2V97A 2WI8A 4Q9KA 2FPUA 4DV1B 2O05A 1TFUA 1XP5A 2E87A 1L3CA 1T9BA 1XMPA 2NUPA 3AY6A 1ST3A 4FMDF 1JJVA 3GFPA 2Q1SA 3PC2A 4C6HA 4DAEA 4YUZA 2Q6IA 1KJ9A 4Q3AA 1S8OA 5DTIA 5HE9A 5JFGA 3LZ6A 5DX8A 3JW8A 3WZMA 1QGDA 2GTHA 1AOXA 2NSHA 3BA1A 3LT0A 4IGIA 3BGSA 4NJEB 5CBPB 3SC2A 5AMXA 4F91B 5JS7A 4L4UA 2I2WA 2F43B 4BB5A 5JW6A 2A4MA 2P4QA 1LGYA 4BPRA 4REMA 2BTOA 2VXBA 4A8JB 1B73A 4JVLA 4EG0A 3FE2A 3PWZA 2PZGA 4S2EA 3LQ1A 3VU3A 2A1UA 3ZVKA 1H9BA 2FWRA 4D3DA 1CY2A 2XGGA 2E6KA 4BL5A 3VSAA 3CGGA 2EJVA 3DH0A 3RC2A 2PMBA 3TM4A 1U7TA 2OR3A 3G9ZA 3L6CA 1N5MA 3MLBA 3T4UA 2W8BA 2HN9A 2QX7A 3IILA 1DUIA 4FS8A 3OQBA 4LDAA 1KJ8A 4X95A 3WSVA 5IFLA 2WZQA 1ZHOA 3DTTA 2WF9A 2AKEA 4KYIB 4FR2A 1Q0LA 3LBAA 1A5AB 4KVFA 1AMNA 4EBFA 3AFMA 4ZYWA 5FFFA 4RY9A 3M4YA 3DBRA 1YMUA 1DG3A 2CZQA 1JGTA 5DWDA 2G72A 4EVSA 1T0HB 3ITKA 3P0FA 3A9RA 4LSZA 1M6EX 1BX0A 1SURA 2PZFA 1B3RA 4MV9A 1HDCA 1K7CA 2YJ4A 3ZYZA 4X3OA 4BO3A 4D74A 3A2MA 2H2GA 1ZLYA 3PVCA 4GWGA 1SHUX 4KTTE 5L3QB 4J7CA 4O02B 4DLLA 3K5WA 4QBIA 1RZRD 4YRLA 2EOAA 3ZJUA 1Y1LA 4QXOA 3JVUA 2XSZD 4AS3A 5DX1A 5AW1A 2WBLC 4N5LA 2AOXA 2G5GX 1BU5A 4OYLA 4M9RA 3LVRE 5FKJA 4WK4B 4TN5A 4DNXA 5HRAA 4NEHB 4IJUA 1G7RA 3OQ1A 4QARA 2G9UA 2ZTMA 1JHAA 4XCQA 1ZVJA 2H59A 2DM6A 2V7PA 4Q1VA 2UZ1B 2NNWB 2O2XA 1DHTA 3ASYA 4G81A 4QNNA 2IV7A 4J8PA 1DCFA 3H9EO 1QCDA 3EZ2A 2XNJA 3FMGA 3L93A 4OVKA 4PIVA 3VGPA 4D82A 4XXHA 1XX6A 5DHUA 3TMKA 1GFIA 2WJ4A 3UUFA 4DV3B 5EP2A 4GEKA 1QPBA 3NB0A 1FSSA 1XPJA 3L7OA 3Q0TA 4P4GA 5CVCA 4Y98A 3WIVA 4X54A 1NVWQ 4E51A 1YE8A 2D5CA 4C7BA 3JSAA 3FLEA 1AU9A 1NF3A 3KYCA 1G41A 3QOWA 3LD9A 4KVAA 4LE0A 3ZWKA 4CCYA 1L7AA 1AB6A 3M6LA 4DLRA 3W5DA 2RH9B 3HUEA 3I6MA 2R6GA 3M33A 3V4OA 3W6OA 1NUUA 4QREA 5LB2A 5JSFA 1X9IA 2JJ2A 1J1IA 2PZKA 1P2VA 4G9EA 3T5AA 3FMIA 2DERA 1YQWA 2OO5A 1QG4A 4GEGA 2W2PA 1QVRA 4NCHA 3W4KA 4PS0A 4HPWA 4YMVA 3LTNC 2PE5A 4B3RB 4AKSA 2D7JA 2E5WA 3I9KA 2XOKD 4M88A 5E3HA 4CCAA 1BD3A 4RKFA 1M2GA 4M8SA 4QUGA 5AJXA 1IUKA 4NC9A 1Q3KA 1SKAA 2C29D 1OLSA 3LX6A 1VIDA 2EGHA 2I91A 1OH5A 3J7AC 2DB3A 2WYOA 3W34A 5HRUA 4FZJA 5DM2A 3IVXA 4OSOA 3T9AA 1Z5PA 3VDXA 1KVRA 2WFLA 2YMPA 5BN4B 4UUNA 1TTQB 4P2BA 3C6KA 2H29A 3GJQA 1FFGA 3LK7A 4CR7A 1ZR4A 2CKDA 4RKWA 1Z83A 5BUSA 5KTPA 1FLNA 1STOA 3A6EA 2JAQA 2RGAA 4JR1A 2EFHB 4N40A 2EFCB 3BWMA 1JEJA 4CLRB 4B3CA 3U3DA 1QIMA 3GEBA 4IVNA 4ZQHA 5F33A 2FX2A 4URYR 1N5DA 4QOEA 2CVZA 3TUJC 4GQIA 3JZMA 1PEAA 2OCXA 2FR8A 1EE1A 2CNOA 3D43A 3C7CB 1UC9A 3GZNB 3NAGA 4HDKA 1P7ZA 1XTBA 2ZJBA 4MS3B 3PRJA 1F8XA 2DUNA 3EPKA 5GM1A 3SZ3A 2OB2A 1I9GA 1YH3A 4RHEA 4W7IA 4YCMA 2F64A 2AIRA 3OUZA 3FPHA 3QVOA 4JGIA 1SKBA 2YVLA 3PJFA 4E5DA 1B7GO 4B3SB 2BP7A 5DM0A 1JILA 1QIKA 4MRNA 1N2JA 1VB3A 4LE1A 1QZUA 4TZKA 4EMSA 4YAJA 2IS6A 3ZNPA 4UKDA 1HRDA 4WLVA 5I9MA 3FD8A 4BATA 5CBPA 5D01A 3DDUA 2FPIA 3S1SA 2QLLA 1MO4A 1T4GA 6YASA 3C6ZA 2HGSA 5KYVA 3P96A 2IYYA 3TGLA 2DLDA 1JFFB 4G41A 2NIPA 4NCNA 3GFGA 1AHNA 2RHRA 2B8WA 4CHTA 2HK8A 3M7IA 2DQYA 5BSTA 2OC4A 4EYEA 5JYCA 1NBMD 2GM9A 3K72B 1ADGA 1E3SA 2DTXA 1D2HA 3WLFA 5JXJA 3VU9B 5KNBD 1E2NA 4UBJA 4F2PA 3R5JA 3A1TA 2PZMA 4CMGA 2HRRA 1CQWA 2P7IA 3LIIA 4HB3A 4IIEA 1Q7EA 4M1QA 1WW3A 4CM8B 1ORRA 1VQ1A 2PT9A 4GMDA 5DYNA 3UWDA 2I4RA 1KYZA 1V41E 2ZYUX 3IALA 3KJHA 2NZ8A 3WSTA 2YYAA 4E1VA 1X7YA 2VQEB 2IP1A 1JIUA 1KDOA 1X13A 2ODTX 2VNIA 1QTQA 1DTEA 4KIUA 2IEAA 1YIOA 3OZFA 4IXMA 3LX4A 4JNKA 3S28A 2VJMB 2YWDA 5ALVA 2HHHB 2XZLA 1H8ED 2BKAA 5DRYA 5FQNA 3CVWA 2RDMA 3CLTD 2C99A 2Q4OA 2JFFA 3N9IA 1ZJWA 2UYOA 1O03A 3HB5X 3SZLA 1W7AA 1XFAA 2ANBA 1Z6YA 3RVNA 3TOXA 2Z58A 1Y5MA 1L5FA 4ZMSA 2H08A 4L28A 3L79A 5IZCA 1R0YA 1UFVA 4LJKA 3IKVA 7YASA 4OFWA 1N5JA 1ZNYA 2JLBA 3B1KA 3CTPA 4UXIA 2YZNA 1O94A 2PMDA 2VTVA 3AB7A 1KU6A 4M1MA 4EB8A 4OH7A 1U80A 1D2GA 3ND8A 2P5YA 1E18A 4LJYA 1JIIA 3BSFA 1XYVA 5ALQA 3MA0A 1ISFA 4KQ9A 3VXKA 5DSTA 4A23A 4TS4A 3RLIA 4C03A 5MFPA 1H66A 1BCRB 5JD4A 3P71T 4F12A 1IEWA 4XWWA 1P29A 1R5BA 1AD2A 4B6PA 4UTRA 2QBYB 1QUEA 1Q0PA 1W8IA 5ARDA 4QHSA 2IBMA 1V37A 3FLBA 3H6GA 2VQSA 4JJ7A 2ZOSA 2W0SA 1Z4LA 4N6OA 5JARA 4BVHA 3AFHA 3QU9A 2OBMA 1J6UA 4FOPA 4C6SA 1QVZA 2FKNA 3FYUB 3UCEA 1Q0QA 1T36A 4EI8A 5IARA 1PQUA 4PQFA 4HWKA 5CA1F 4NOJA 3N58A 1K8QA 3HFRA 2TECE 2E4YA 5J2UB 2PX8A 4BFWA 2AUMA 4Q3EA 2XQIA 1R0SA 4GZMA 1U0LA 3IE0A 4A0HA 2BSXA 5FP0A 4G1BA 3AP2A 5IUNC 1Q1NA 1QUFA 1FYDA 1RXIA 1Z38A 2IIBA 3DKRA 3E2MA 3I92A 3NM4A 3UUEA 2JG3A 4ROTA 4LDPA 1E6MA 4QTXA 4AWXA 1PNRA 1E1CB 3E4DA 3EMKA 3HJUA 3PXBA 4W5HA 3IVMA 4UTNA 1Y9AA 3A32A 1RRMA 4HDMA 1L5HB 1X39A 2AJ8A 2D00A 3FMFA 3K2QA 2JFYA 4FHCA 4TS1A 1FTQA 4BDSA 1NXVA 1W75A 4R2JA 2J9GA 1ZKDA 4CL8A 1G21E 3AOEA 3X1KA 5LQRA 2HDHA 2XUDA 4MKRA 3U61B 1NNEA 2H5EA 1IOZA 2JEYA 1ZUIA 3W06A 2OGWA 1E1LA 5BW4A 3B52X 4K3UA 3TIGA 4YFYA 1EDEA 3LPAA 4JEHA 1ZX1A 3KPWA 4RSMA 2MSEB 1OI2A 3DVAA 1P9OA 2AI1A 3TJZA 1A2OA 4M98A 1CK4A 1OT5A 4DUPA 5CCXA 1YUMA 1ZGCA 1WOYA 4PCLA 4WXEA 1R4MA 2PMKA 4WADA 4LZJA 4BQEA 1YKSA 4FFWA 5FV4A 5IJ9B 4HZUA 5F5NA 5IBCA 2JCSA 1TNDA 2Z3VA 5KSWB 1KQOA 1YB1A 3UB2A 2D3WA 4EHJA 5MF6A 2AEFA 2NT3A 2DWUA 1DQZA 1ML4A 4K9DA 4FHZA 4ZQBA 1N5LA 4Z0HO 4URXR 1BOFA 4PLGA 4MUGA 1IMJA 1QO7A 1W5FA 3MS2A 2IS4A 1DC3A 4C22A 3G9UA 2KBFA 1Z35A 1SULA 5FTMA 4NCJA 4WNYA 3OCVA 4F86A 5LQJA 2J8ZA 2BCEA 3IERA 3F7NA 1HKUA 4GRAA 2C2YA 1FSFA 2WJYA 1PS9A 3KYDB 4CMEA 1PR6A 4UMFA 1AK9A 1P18A 2ZJFA 3GJXC 1GKIA 2POQX 4M7PA 1PFGA 1PU2A 2DBRA 3OOSA 4P98A 3KUXA 4EYQA 5DBEX 1QPZA 2RGNA 4KWTA 1PYOA 4MYHA 4N3GA 4DB4A 4NAHA 5DRTA 1WNFA 1VIYA 3EUFA 1ORWA 2A86A 2ROQA 2Z8ZA 3MTJA 5B58C 1RRFA 1AZTA 2G8NA 2X5JO 5G53C 4WNAA 3FOEC 4G8CA 4FLMA 1L0BA 1V7PC 3RK0A 5JXHA 4J0FA 1KI8A 3WIDA 1NGSA 1T1EA 2X9QA 5D1NA 2AG1A 3L06A 4A6XA 4DIKA 3B6IA 1K7XB 2M98A 2YWCA 3I0MA 5C34B 3OH8A 2WHEA 4CCSA 4NU0A 3TKYA 1ESNA 5DN6A 4Z6KA 4WJLA 5K6AA 3SPXA 4MQUA 1Y5RA 3VBCA 2Y0CA 1H05A 2AHRA 2BFMA 2QRVB 4ZPXA 3T1VA 4B4WA 5IZ4A 1QQ5A 3EWNA 3X1WA 1DXQA 1Y8CA 1EFKA 3DOOA 4FOLA 3KS9A 1XKLA 4KLNA 4WLUA 4EI2A 3JALB 1YI1A 4MUHA 4D9JA 3HKCA 3DWEX 4L6AA 4BMDA 2CXQA 4NBUA 1FDWA 2PQ0A 5KYUA 4MUMA 4MVJA 3BB4A 1DI0A 4HNQA 1VA5A 2LDXA 1RXCA 3AERA 2Q28A 4UVHA 3RRYA 5HJ5A 4I9HA 3EB9A 5AXBA 1GTRA 1SVKA 3B7WA 3DEYX 3H1FA 4L4YA 1H2ZA 1W73A 2EATA 3QENA 4B5LA 2XNDD 2HD4A 1ZCZA 5INTA 2G67A 4M0PA 3NBZC 2NSYA 1IH8A 3QBVA 2AK2A 1U28C 3KB1A 3CR7A 4HDRA 1P77A 4D4GA 2FEOA 3UT5A 4OI1A 1EJBA 1CWUA 4PHTA 3GEPA 3GT7A 2HYIC 1Z4NA 1NRWA 3KEQA 2G08A 2ERCA 4X65B 2WF8A 1V11A 5IJAA 2B78A 1LH0A 4IP0A 3RDPA 4WXRA 4KJXA 1J24A 3JZDA 2XE6A 2QTHA 2HK9A 1KDVA 2PNJA 2C7RA 4V39A 1SUFA 5P8WA 2V4MA 2JLVA 1R4MB 3ZE0B 1LRJA 5KDDA 2REOA 3IQXA 1QYDA 2XQKA 1GPKA 1L7QA 4WKGA 1LPPA 4B82A 1XRRA 1YASA 3RYHB 2R5FA 1DPGA 1ISIA 3F5DA 3ZU4A 4RFSA 3BPSA 4DSNA 4C3ZA 1OREA 1XBTA 4JP5A 4B34A 1KY5A 4L9SA 1XZIA 1G8JA 3OMXA 3QVVA 1QRTA 3S55A 2XV1A 4UU7A 3CKMA 2O8FB 3HR8A 1MJGM 5LCXA 1KJNA 2QM8A 3BTUA 3SJAA 2IX9A 2HLPA 4R98A 2SCUB 3T52A 5AW8A 4Q82A 2O8CA 2OHGA 4N0MA 1G2QA 3A37A 3EEFA 4OK3A 1CDOA 2BRUC 2XAAA 4URFA 2FSHA 4I55A 5DU2A 4F8EA 2GASA 3MD0A 2RGBA 4EHIA 3WR5A 1UXKA 4X1YA 3F8TA 5IAEA 3AR4A 4CFZA 1P9LA 1MNQA 1XZ8A 2PGJA 2AC4A 1U02A 3FPCA 3RVOA 4HVAA 2GZ3A 2OCKA 3WLRA 1A72A 1W1WA 1JLRA 2A9VA 1PT7A 4RD6A 2QQFA 4Q02A 3AHCA 4HX9A 1DQNA 3AXTA 3C7TA 1XCBA 1G21B 5DNVA 4JSYA 3I64A 2GPBA 3MFQA 4YQFA 1IIRA 2H6EA 3JXEA 3LYLA 2IPOA 4R5MA 3BOSA 3IJRA 4WY8A 4H7PA 5CFPA 1MC8A 5IVKA 1QOZA 2PY6A 1N5KA 2OHFA 2W70A 4DG9A 5LZ5A 1N32B 2P2DA 3NVKI 2F62A 2Z95A 2QQ5A 2CL0X 1IN8A 4BVFA 3ORHA 3CF0A 5K0GA 1H3EA 4QE3A 3AXSA 3REQA 2ZE7A 1W1IA 4CEIA 1Q77A 1KBOA 1T4DA 2ID4A 3E7DA 2UZ0A 4RKQA 7ABPA 1DINA 3RYCB 3F47A 4Z9BA 4YV1A 4JJ6A 1QZ3A 4N76A 1FP6A 1Z3CA 2WJ6A 3LHKA 3ADOA 1QCYA 4MPJA 4G5QA 1CR4A 2CMGA 2PGIA 4NXNB 4NNJA 4AUMA 3PQDA 2PSDA 1KY4A 3OOJA 4EUEA 1KVUA 4TRJA 3RYTC 3FVTA 3DJYA 4ZCPA 4AS1A 2I2AA 3H5NA 4G8BA 4RK1A 1QLWA 1V7QA 2ZTHA 2RC5A 4B48A 4MKFA 4U9UA 5TF4A 1U8AA 1WUIS 4DR6B 1ZS9A 3I4LA 1A9TA 4DA4A 3JWPA 1VI5A 4ZVLA 1ZHFA 3T41A 4YMUA 3MOGA 1EJ6A 4ZO8A 2OYSA 2RHLA 1JDZA 3ANTA 1GVHA 4JIMA 1XYYA 3R6GA 5CA0A 1V9SA 2IHYA 4KPFC 5B6JA 2C5AA 4K6GA 1EFCA 4CMIA 3T1YB 2YHSA 2JPDA 2QRMA 2VL7A 1QP7A 3FFAA 2VSOA 2XNCA 1QJCA 5CCBA 3KJGA 1SXJD 4OQLA 4I5GA 1E2DA 2QRNA 3GLGB 3CRMA 1C5KA 1QYIA 1TC2A 3L0SA 3O90A 3OMWA 2WY2D 1NW3A 1AS3A 3R9IA 3WO1A 2O06A 4EUHA 3VKHA 2F00A 2P68A 1FPMA 2V7EA 2VF4X 4UHCA 1R4ZA 2Q7XA 3NJ8A 4JDPA 5JRJA 3DHNA 2I62A 5K5EA 1X14A 2ZBUA 4JJAA 1A5BB 3NOOA 3KVYA 2I2CA 1QXSA 4G1EB 3TL3A 1A4RA 2VUHB 4X0EA 3WK5A 1EP2B 2QUIA 4UE2A 2NTEA 3ZGVA 2ZT7A 1OAOC 3EIUA 5HOEA 3R7LA 1TKBA 3ROEA 1JVBA 1LRKA 2C77A 1HLPA 1UKZA 2P8JA 4PXSA 3L7MA 3RW9A 1TM4E 4KQIA 5DXFA 4E08A 1SELA 2JAHA 2VSFA 5FRDA 5CW1A 2IYTA 2YN2A 4A0SA 5LWQA 3DLBA 2Y1OA 5EPEA 5KOIA 2BH9A 2GZAA 2I55A 3M5PA 3MQ4A 4NPCA 1CZRA 3BTOA 1WEHA 2JCYA 4LMBA 3OCWA 5T4EA 2A0FA 3OHMA 4F5ZA 3EXFA 2JFGA 3C39A 2ZYSA 4PAQA 1PYGA 2B6HA 2YUTA 3IAEA 2FWJA 4KSCA 1JKJB 4C88A 4HEQA 4ZK2A 5J2UF 5EFOA 3PTLA 1E8NA 1Y3CE 2GEJA 2GBFA 3O2NA 4CTNA 9ATCA 1SCKA 2P75A 2N1MA 4B35A 3WWCA 1VM6A 1ZH8A 4PPGA 4N3CA 1UEXC 4PSDA 3LUGA 2BTQA 2O8EB 1EDBA 2P0EA 1HL3A 3DKPA 1LY1A 4F6LA 2P9FA 1TQHA 1LV7A 3KVNA 3MGAA 4FIDA 3OE4A 4WVFA 2MJLA 3VOAA 4ZYXA 2AC2A 1Q20A 3O4RA 2H65A 1NI4A 1SC1A 3HDYA 4NU8X 1IBKB 1ZUNA 3RAGA 3SJ7A 1XV5A 1WEKA 2ZBVA 3JWHA 4PM4A 1ZITA 1PL7A 1Q12A 4GI3A 4I14A 4ZVPA 2C5GA 3VI4B 1PYDA 2WYHA 1W9MA 1XDGA 5DP2A 1UWLA 4Q7MB 4DBVO 4JH0A 2ZCUA 3OOYA 2NUTA 4BP3A 2MU1A 3R75A 4MUEA 1JDBB 2Z4SA 3FKSD 1K63A 3T7JA 1ZICA 2DPXA 3KEOA 4PZZA 4A92A 2PGDA 2XYGA 1KS2A 3KQVA 3CLVA 3F7MA 2ENUA 2QZZA 1KVTA 3PK0A 5JXGA 4HEJA 4UUOA 4DC9A 2VI5A 1Q3TA 4B6EA 2VDJA 3SIPA 1ZIPA 3X1JA 2YZGA 4L8YA 4R68A 1OXXK 4B2YA 1PGPA 2IPNA 2IE8A 4GQAA 3IKJA 5THQA 1KKLA 2YASA 4OOFA 4W4TA 4AJIA 1VLZA 1YDFA 3WQBA 2VP6A 3ZGOA 2VYVA 3O31A 3DOHA 3F90A 4YT4A 2OORC 2X77A 1IJBA 2JJQA 5EHQA 4CGZA 1MB4A 1PX0A 3K1YA 4K6MA 1F06A 3TSWA 3VNBA 4U7JA 1TTPB 5DM60 3B36A 3QI2A 4GP6A 2Z8YM 3DOEA 2DLNA 4WEQA 3PXUA 4XWTA 4ZIRB 1PUIA 4GKJB 2GHRA 4RKEA 1OWNA 1UOPA 3I5AA 1KO4A 4OI4A 5EG5A 4EELA 5JI2E 4S1PA 1IZ8A 3V8VA 1UK6A 2IHKA 3AP1A 3DVSX 1FRNA 5HJEA 3THXA 3L6EA 2WLTA 1DO2A 1MJNA 3A70A 5CFMA 1FU8A 5BVGA 2WWFA 3VDMA 4UHJA 1EVJA 2I7DA 1WXXA 1UBHS 1U4SA 4MWGA 1SAYA 1DCKA 3GMTA 5DSZA 3QTLA 1JHVA 4EO9A 2OQ2A 3EXEB 2C5BA 1CUXA 3N59A 4H4CA 4MWCA 1FRFS 2DFTA 1AC5A 3ZDBA 4IYRA 4X84A 4FM9A 2Q4TA 5JC8A 4BY9E 2BYTA 1TVMA 2Q2OA 1SIUA 1IHPA 2IT1A 2RARA 1NURA 1FL9A 3AIMA 2AGVA 3EXIB 2GAIA 2R8EA 1V8ZA 3UEOA 5HOQA 4YRPA 1YB2A 2JASA 5JSZA 2V6GA 1QFJA 1OZHA 3LP6A 2BPOA 3C7KA 4HNRA 4M22A 4JLSA 3IP9A 5EHNA 1DMSA 3V7NA 2F9FA 3DUFB 1E96A 3EDCA 4BBJA 1HFKA 1CJBA 3JWJA 5TV2A 1J06A 3MXOA 1JNXX 5COQA 5FI3A 5FOWA 3IUSA 1FFDA 1W52X 3ZWMA 4C4AA 2AD1A 3H1GA 4WECA 2ZIZA 3NHSA 2GJAA 3G89A 4DMKA 3K1JA 1NMQA 4CI9A 2P78A 5EA2A 4DIUA 1WD5A 2O19A 2QBYA 2VRBA 3CXUA 4KZPA 4F5EA 4Y2UA 1M5TA 3CRNA 3QI7A 3KTAA 1CEYA 3QU4A 1BWQA 1MGOA 3NATA 4CF6A 3E22A 4ZZ1A 4IIDA 2HADA 4AXBA 4V2UA 1JYEA 2J0UA 2P6MA 4GI2A 3TTWA 4TWIA 4HJRA 1ZP6A 4FYPA 3TW6A 2L42A 1OZ0A 1OFHA 3P26A 1B0PA 3G0IA 5BVHA 2IU6A 2QV0A 2FR8C 3RGWS 5BNWA 3GO4A 3BX1A 5EXXA 1T2UA 4LV8B 3R0IA 4BB0A 3VYTB 5K8IA 4HTFB 1RBMA 2IYOA 1B8UA 1H6DA 1ZIOA 3E15A 1QS0B 2WPDA 5FA8A 1TXGA 1FNDA 4HGYA 4UU8A 4BNTA 2VIIA 4PPNA 4JDUA 2X6RA 3AI3A 2RHHA 4DM4A 1AT1A 1C1YA 2HT1A 5IWCA 1Y6QA 2XUPA 4JR2A 2C9YA 1KE1A 1P5FA 5HPYB 5KNDH 1UMDB 2ZJAA 4RTJA 2HBYA 3AMVA 4MR8B 4PYOA 1RR6A 3K6JA 3ELYA 4TRRA 4EHNA 1UAGA 1V4NA 4QOIA 2G83A 1GG5A 1JP7A 3SCZA 2XJ4A 3O8OB 5HE8A 3O8DA 1P74A 2MYUA 3L6BA 1XQVA 3FVRA 3HGMA 4J7UA 2ZRDA 1HBJA 5IAGA 3W9SA 3EY4A 1KYWA 3GHHA 4O29A 3EXG1 1DKOA 2B3TA 2MINB 3R3SA 4E09A 5KNCD 1M6YA 2GXQA 1X86B 2UYQA 3GEDA 3TLYA 1PJ3A 4LXIA 1K1EA 3FUUA 1RYBA 1RYZA 5IKPA 1ZBDA 2VRCA 4COKA 3OBBA 2RG1A 3GGCA 5B64A 3TGPA 1XQWA 2X4DA 1M1NA 3LK6A 1HFJA 4FW8A 4O5OA 4RA6A 1T8WA 4OQFA 1MRNA 2QXYA 4G84A 3ZZMA 3JWEA 2QORA 3MN1A 3T7RA 5DNWA 3DBRB 4FDTA 3T99A 2JFUA 3LNCA 3OCCA 3A4TA 4BGIA 1GGHA 1V26A 2YW2A 2RGYA 4JJGA 4OYHA 1KRWA 3KT6A 2YS7A 1K5PA 2L0XA 4H6XA 2Q5OA 2OTCA 2YMLA 2PUGA 2IVFA 3ORYA 4BTEA 1EKXA 3MGGA 1V4VA 2CD7A 4MGYR 3T12A 5ICGA 4LRXA 4JR0A 1C9DB 4UCWA 2P1RA 2PKCA 2V7TA 4TKUB 5EQJB 1H3NA 3U44B 1YJXA 1AUPA 1C81A 1L1RA 4MAMA 2ZDQA 1SHKA 3ITDA 4BNXA 1OXMA 1K68A 1VJRA 3VNSA 5GVSA 3ZGXA 1EFRD 1XC7A 3C74A 4JWKA