1FQJA

Crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
317
structure length
317
Chain Sequence
b'RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 126
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqjA01
1QHYA 1NG9A 3GMTA 2ORWA 4IVPA 2GXAA 1TEVA 1NI3A 2EYUA 3DL0A 2ZE5A 1GNRA 5EP3A 3PFIA 4DDVA 1XXHB 5LDDC 4TMVA 1KKMA 1TQ6A 4HUQA 1G7TA 1XP8A 1N6KA 2IXFA 5JEDA 4C2UA 4AYWA 4TYWA 2PT5A 2G9NA 4A9AA 2ATXA 3K70C 2CL7X 1T5IA 2FH5B 1KJYA 2GF9A 3MSXA 4G0NA 1OFIA 2IXGA 1RPZA 3A1SA 1FTNA 4OKSA 4UXIA 1SVOA 4F4JA 2WJVA 2OEPA 2IUTA 5TMPA 2PBRA 2ZPTX 2JLYA 1GG2A 2QL6A 3HR7A 1KMHB 1A2KC 4EPVA 3EAQA 3QXHA 1W0JA 4LJ6A 5EZ5A 2D7CA 2ZTSA 1YU9A 5B2ZA 4DJTA 2IYWA 4JT2A 5G3YA 3U44B 1XCGB 3QG5A 2R6AA 2WZQA 5IT5A 2A7QA 1MABA 2VHJA 3SR0A 2QAGA 4HLUC 2R6FA 2W00A 3QKRA 3W6NA 3FOZA 4D25A 1NBME 4NCJA 3L8YA 1E99A 2QE7D 1ZD1A 2ZRIA 3O47A 3ZVNA 1ZM9A 3RC3A 5F2EA 2EFDB 2A5FA 3NTUA 2CJWA 3VFDA 5KNDA 3FE2A 5G40A 4BEBA 1N0VC 4WIAA 1G4UR 1MRNA 2F1IA 3QPUA 2YOFA 3Q85A 1ZD8A 4E5UA 3SC3A 4KITB 3T35A 3B9QA 1F5NA 1AIPA 1UDWA 5C4GB 3GLIA 1CR1A 1W46A 4BECA 2Z83A 2C2HA 2F3TA 3MD0A 2P65A 4HAVA 5H70A 2GJ9A 2IYYA 3L2OB 2ERXA 3LLMA 1KK3A 5JWRA 3HYTA 4LC1A 1Y3AA 1NBMD 4G5SA 2DCUA 4KODA 3LX8A 1R0WA 3MGCA 4R7ZA 1RRFA 4K46A 4M1YA 1WQ1R 1MR3F 3ND8A 1S0UA 3WP1B 4FW9A 4DLXA 4GP7A 1H8HD 4B75A 3MWYW 1TUEA 1DARA 2QSYA 4V0NA 2X8AA 3TQFA 1G21E 2YNMA 2CE2X 1N6HA 2JIZD 3DKPA 2DY1A 2X1VA 3GJ0A 2GNOA 5FUYA 2IX3A 3A1UA 4XSGA 4BFSA 2ZAOA 5FTLA 4DT1A 3IO5A 5BYJA 1II9A 1MOZA 2IYUA 2JLUA 1R4AA 3RDPA 4P4SA 3I4LA 4LJ8A 721PA 5KSYA 3EPKA 4L9WA 5HTKA 3IEVA 4YXWA 1KI3A 3T5GA 3PG5A 2VP4A 5P21A 4NCKA 1G20E 1KAGA 2JLZA 1SXJE 1W4AA 3CPJB 1EWQA 5AJVB 4DDUA 4AI6A 4LYAA 3SHFA 4FCTA 1MH1A 3R8CA 4ASUD 5FL7D 3TIFA 5KO2A 2YWGA 1ZCBA 1IY1A 5DLQC 1WXQA 5DNYB 2H18A 1N6LA 2ZI5A 4D0LB 2XJ9A 2JLXA 2DFLA 3MWJA 3QBVA 3SYLA 4UXHA 2O0KA 1OXSC 4Q02A 5FTMA 3GLGE 3MRSA 1SQ5A 4PANA 2ZRGA 2IWHA 1Z3IX 2VP5A 5DI3B 2FX3A 3QVVA 1JB1A 4QBFA 2C03A 1LF5A 1SXJD 1SVSA 5J4YA 3C15C 3AGQA 3X1ZA 1TQ4A 1NVUQ 2H8KA 4ACAA 4ZIRB 3THXA 1TUIA 2B92A 2YHSA 5G3ZA 4DIDA 2VP9A 1CRQA 2ZJ5A 1HE1C 2B7BA 4B3GA 1OFUX 3QIAA 5LD2C 3IDQA 3GFTA 1IQPA 3CBQA 5TXGA 1Q1ZA 3LDAA 3EA0A 2AK2A 2GAAA 1MRSA 5EE9A 2CCKA 1SHZA 1QHSA 2V4ZA 3LH5A 4M53A 1EFUA 3EW9A 5FR2A 3RSOA 3EASA 1M2OB 3KKPA 1UKVY 4DLZA 3CRQA 5F9FA 1CKEA 1AN0A 1U81A 6Q21A 1E94E 4IDPA 2O5VA 1S1CA 2XB4A 4LYFA 1S1MA 4WZAE 1N2CE 1E9BA 4LHXA 3F3YA 2GESA 1AQYA 2ANCA 1YE8A 3CM0A 1KHTA 1N5JA 1S9HA 2OAP1 1Q12A 4TQUS 2DHRA 4IDOA 1VG9B 1V5WA 3K0AA 2AN9A 1OHHA 3WRXC 3FFBA 2X2FA 2ANBA 3V9PA 1R0YA 3CWZA 4KYIB 3SYKA 3W90A 4D26A 1GWNA 1E9FA 4I1VA 2FN4A 2OESA 3QI2A 3AQ4A 3TJZA 4C4PA 3QBTA 5L3QB 1KYIA 4HLQB 2BEJA 2OAQ1 1Z6XA 3A6PC 1ZW6A 1RZ3A 2RB4A 2ZR0A 3DKVA 4KO8A 4LC0A 3RNLA 4TLCA 3HU3A 1E2GA 3MG9A 5FOXA 1BS1A 3M6AA 4E09A 2CHGA 4DEXA 2ZI7A 3OEHD 2WOOA 4WBSA 2O8FA 1NVXQ 2A78A 3DM9B 5CLQA 3TMKA 4PO1A 4PXAA 1LTQA 4EJSB 4QM6A 3BXZA 5J40A 1HURA 2GZDA 2ZIAA 4JMPA 4TN1A 1HTWA 5J4VA 1LY1A 3FTQA 1XNJA 1NLFA 1YRBA 1ZUNB 2WWHA 3SN6A 1BO6A 3WMEA 2NPFA 2IYLD 4PPGA 5EUMA 2CDNA 1OB2A 1E2HA 4GMDA 4QBGB 5TY0A 1ZM2A 1LF0A 1W44A 3REGA 3GLHE 1VECA 1T3LA 2QENA 1E79D 5KNBA 4LBZA 3TSZA 3CR8A 4B2IA 4CEIA 4QJ3A 1F2TA 1Z22A 1QDEA 3CRW1 4W5HA 2RGNC 3KX2A 4PAQA 1EGAA 2OCYC 3I72A 3WNDA 5HZKA 3TUJC 2QU8A 1G3QA 4NU0A 4OBEA 2WJYA 2GBLA 1Q20A 2FF7A 1Z5ZA 3VKWA 2FOLA 2GHIA 2JAQA 4F93B 2JATA 5JI3E 4BLQA 1E2NA 2FZ4A 2ZRPA 4NL4H 1WP9A 1Z6GA 2F9MA 4FWTA 4LJYA 3U5ZB 5FPYA 4NMMA 4XOIA 3UMFA 4DDWA 1R0XA 3FHTA 3C5HA 2W0MA 2ZRJA 1AS2A 2AKYA 4V0KA 2V1UA 1VCOA 2OXRA 1G3IA 4DLVA 2IYSA 2NO7A 1XX6A 2TMKA 2QGZA 4WXPA 3T1VA 5ELXA 2XB2A 4NYMQ 2QE7A 4JBXA 1VHLA 1SXJC 3UMSA 1EFCA 3AVUA 4M9XA 1HV8A 1E2LA 3IBGA 2ECKA 2F43A 3QJYA 4Q7JB 1X8KA 2R6GA 4Q7KA 2VPPA 1A5TA 2BM1A 3TH5A 3EZ6A 4IW3B 2CVFA 4MQBA 4PPQA 2AR7A 4RZ2A 2IS4A 4POAA 2D74A 4ZV4A 1Z0KA 2N46A 1G7CA 1R2QA 3KJHA 4V0OA 4F38A 3T34A 4NH0A 1UADA 4Q03A 3I92A 1MO5A 3IPXA 3GFPA 3RS0A 4B3CA 1KO1A 1MKYA 3CR7A 4MYHA 1NBMA 1CU1A 1R5BA 3GJ8A 3JZMA 1KDPA 2QNRA 1G3RA 3N2EA 1XJCA 3KTAB 1OV4A 3Q7PA 1E2DA 4B35A 2HJVA 4ARZA 3DEFA 3QPVA 3SE0A 2J0UB 1HUQA 3K0EA 4M1MA 3E1SA 1GNPA 1M7BA 3UXMA 3QKTA 4YMSA 2VA8A 4TWZA 4IXMA 4XJXA 1H8HA 5AJYA 4HB2A 3LRPA 5EE3A 2AXPA 4HUQB 4F92B 3I62A 5DO9A 1G7RA 2JIZA 2WM9B 1N6OA 4RD2A 1U0LA 3K09C 4PPNA 5KUTA 1IN5A 4PQYA 1IXZA 2QRNA 3HR8A 2OFOA 1QBKC 4PC6A 2YC2C 4LHWA 3DO6A 2FGJA 5DN6D 4NP6A 1KNXA 3BK7A 1OH8A 3U7GA 3U7EB 1XRJA 4IOJA 4LX0A 2VP0A 1U8AA 2UZIR 3CF2A 3NDBB 1KI2A 1XBTA 1YR8A 4TT3D 1NN3A 4XTCS 4CRWB 1VIAA 1AKYA 5GJBA 4LYHA 1J8MF 3AP2A 3E5HA 4Q7LA 4IDHA 3L43A 5FL7A 2QAGB 3BB4A 3QKRB 2WSMA 1W4CA 1ZIOA 4OI4A 5SZKB 1KI4A 5AK0A 4Q1EA 2WTUA 4BFZA 2L0XA 4LJ7A 5KHOC 2HT1A 3NBZC 1TF7A 1FMLA 2NO1A 3BJIC 3REFA 2JEOA 2O52A 3H2YA 4Q21A 5G41A 2CJWB 1P2SA 3RANA 1Z06A 2Q6TA 3K0FA 2YWHA 5C2JB 5CDFE 3RYTC 3GLFE 4URXR 1Q21A 3CRMA 4B76A 4UKDA 3EPJA 1KSFX 4CYMA 1J90A 3AKCA 2JLWA 2HT6A 4NYIR 3CONA 3GLIB 1XZPA 3BOSA 4Q9JA 2W2XA 2FPKA 3TAHA 4HB0A 2CEAA 3SEAA 1KTVA 2ZS8A 1R6BX 3RRNA 4RVCA 4HAUA 5DHAA 5FI1B 3T06B 4BRWA 2ZRHA 2OV2A 1KO5A 2QMHA 4R2HA 3L82B 4WA7A 5FOWA 4GPTA 2EFGA 4MRSA 2GRJA 3GLGA 3Q5DA 5E7JA 2ATVA 1E9RA 2BHRA 2D4HA 2ZE7A 2ZU6A 3B8HA 5JJIA 3R7WA 3UANA 5C4MA 5FBVB 2JLQA 2R6DA 3P26A 3AF1A 3D8BA 2WIAA 4GOXA 4C9BA 1G8YA 4DT1B 4XVQA 1BKDR 1IAQA 2XGJA 2Q9AA 1RRPA 1I4LD 1XEWX 4Q4AA 4W5JA 4YMVA 1U94A 1AZSC 5FBLB 3B13B 4A0RA 5B30A 1XPUA 2IHYA 1R7RA 4C0AC 2O8CA 3IQWA 3AF2A 1W5SA 4UJ3A 3OZXA 5LB2A 2F1HA 4AYXA 4LHZA 4XH9B 2HV8A 4KBGA 2B7CA 2VIIA 3GJXC 2A5YB 4P3YA 4P33A 1ZM4A 5LPNA 1EFRD 4RD6A 3WY9A 3TUIC 3O8RA 4DB2A 4AURA 5AUNB 4Q1DA 2VEDA 2VRWA 2OCPA 4MGZR 1CEEA 4TZ0A 4GMXA 3BERA 5D3MA 1F48A 2XSZD 2XOKD 4G1UC 1AS3A 3GD7A 3ZQJA 4P32A 2DFTA 3VR2A 1W4RA 1YKSA 2IYTA 2A5DA 3JZAA 2C96A 2VLIA 4Q18A 2MMCA 4Q01A 1GIAA 1S4QA 4XTRA 3QF4A 1NY6A 1XD2A 3KXIA 1RJ9A 2ZREA 3KKOA 3AF4A 4KLZA 2J46A 3TVDA 2KBEA 5BQ5A 5DYGA 8OHMA 1N6NA 4PTLA 3THXB 3FB4A 4ZCIA 4IOMA 1G1MA 1OFTA 2VBCA 2ZRAA 4LGMA 4PHTA 1P9RA 3O8DA 1ZVQA 4QJ4A 1E79A 1UEIA 4AKGA 1YZQA 5TV2A 3ADDA 4B34A 3PEYA 3K70D 1YZTA 4JSTA 3VU9A 1P72A 4TSFD 5K8TA 4CGZA 2F55A 2OCBA 2ZAMA 1M34E 2ZRKA 3K0CC 4HDCA 1QHNA 3RS3A 2FA9A 1A1VA 1YZGA 5FPSA 1LS1A 2WSSD 4NPHA 3U61B 1W49A 3RS4A 1A7JA 3I8XA 4Z1MD 1M74A 3GEEA 4ERNA 4TL6A 2NTYC 4TMTA 1TEXA 2JJ8A 3X2SA 4GOKA 1NMYA 3MCAA 5CM8B 4K8OA 4H1UA 4UNNA 1DO0A 5F3WB 2Q21A 2AWNA 3QOFA 1KY2A 4KAXA 3UIEA 3GQBA 2YKGA 1E3MA 4LRWA 1AGPA 2OE2A 1YHNA 2WWXA 3CH5A 4OQLA 1EK0A 4D2IA 2J7PD 1C1YA 1XZQA 3T1OA 5GADl 3KJGA 5HPYB 3B1ZA 4NTZA 3B1VA 1GTVA 2IS2A 2ZJOA 1FMJA 1VYVA 5K8UA 4LY6A 1GDDA 4E03A 1PUIA 3KB2A 2VSXA 4Q1CA 4XWAA 3TBKA 2AX4A 2C9OA 3GEIA 2GEUA 3VNVA 1IJEA 5M04A 3SBEA 2GXQA 4ZDWA 4P4TA 2QQEA 2ZYTX 1PV4A 2C9CA 3PQCA 4DCSA 1CIPA 2QM7A 4LJ5A 3QKSA 2NG1A 1U9IC 3EZFA 4TMWA 4CW7A 2DFNA 2OSBA 4LDJA 2A3RA 2D62A 2OUKA 3I32A 5B58C 4B43A 5JRZA 3U7FB 4C0SA 3DPUA 4MUAA 2IT1A 4YDHB 4B6FA 1Q3HA 3CRRA 3Q7QA 2O8FB 4PSKA 5JJKA 4PHHA 1AJEA 4JVNA 4XD7A 1E0KA 5E95A 4TQAA 3F5FA 5F98A 5FPHA 4E22A 4JVMA 5EXSA 3LX5A 4V0MA 1KI1A 4V03A 4O0MA 5KDDA 3VR4A 2W6JD 1P2TA 4HZUA 4FMCB 4MRNA 4US0R 2ZI4A 1GP2A 2BMFA 1M7HA 2V7QD 2QAJA 5KPJA 4KSBA 1Z2AA 2IUUA 4QM7A 4CEIB 4TZ6A 1F2TB 2O8DA 2WWWA 1HQYE 3HU2A 2QTFA 1ESNA 1NRJB 4IKEA 2KWIA 4JBYA 4UQOA 5DN6A 2R6CA 2RGCA 2IS6A 4Z8XA 1SKYE 2C8VA 5BWMA 3ETLA 1IM2A 3PV0A 1QHHB 4PC2A 4TT3A 5JWOA 3NXSA 1JBKA 3CX6A 2G6BA 3I5YA 2BMJA 3NBFA 4HI0E 1BH2A 2R2AA 1XMIA 3A36A 4GSYA 2ZSAA 4HAWA 1F2UA 2A5JA 2PCLA 1QVAA 4S35A 1PZNA 4NYJQ 4DCTA 4G5OA 3TW8B 4YMUA 4TMKA 3FKSA 4JT4A 3TR0A 2D06A 4TMXA 3DZDA 4M9SA 5FTJA 1A2BA 1KK0A 4RD0A 1J2JA 4GZMA 1W36C 2OLKA 1Z63A 4RZ3A 1W2GA 5IK2D 2F43B 4PAMA 4M1TA 3KFVA 1P2UA 1NJGA 4ACBA 4FIDA 4RY2A 2ZJZA 1XCPA 2HDNB 3KZ1E 1GUAA 2VF8A 3BRWD 2HXSA 1J7KA 4I1SA 4EPWA 2RMKA 4I1OA 2KI5A 3S1AA 4OYHA 2A5GA 1X6VA 3CPHA 4AY2A 1WB9A 3IILA 3ASZA 3J81k 3NH9A 3M4YA 3X1XA 1VIYA 4ARZB 3ZJYA 1KO8A 5E7MA 3Q72A 1UEJA 4DCUA 1CJMA 2VSOA 4PHGA 4BFWA 2OXCA 5CDFA 3BS4A 3GLFA 2FMXA 4KHZA 1HT1E 1E2QA 2CLCX 2RGGA 3SYNA 3OEED 2DYKA 2GJAA 3ZZUA 5EJEA 4A0GA 2BKEA 2GCNA 2P5SA 1EFTA 1HT2E 4GRAA 4HAXA 2H5EA 4B33A 2QMUA 1TU4A 1X1SA 1OW3B 5FUWA 2RGBA 4GDFA 4KVGA 3AKYA 4C2TA 2QSZA 2DWPA 3EC1A 1Z0JA 3M0EA 2FG5A 4A6PA 2CMKA 2XEXA 2ZSFA 1RYHA 1S3GA 4BLRA 4L5BA 1JXMA 3PUWA 4TYYA 1ODFA 2RH5A 2WHXA 4RKEA 2AK3A 4YC7A 1NN0A 3K8YA 1LW7A 1IN7A 1E2KA 4OHWA 1OJLA 3B6EA 1FX0B 5E4FA 4A8JC 5AUOB 3VKGA 1XWIA 2REOA 1NMXA 4BWYA 4C0BA 2ZRBA 3K9GA 1NF3A 3ZS8A 1XTSA 1Z29A 2CLDX 4OQFA 4OQNA 1DOAA 1N6PA 1XD8A 4US2R 1Q22A 1IXSB 1G18A 1IHUA 2XSZA 4JKIA 2XOKA 3K0FB 2KJQA 2P6RA 2DBYA 4JVSB 3ND9A 4DKXA 2FPMA 4HAYA 1MT0A 3VR5A 3W34A 1JECA 3CZPA 1AZTA 1UDXA 4XIGS 5KU1A 1YR7A 3UWOA 1DAEA 3NIBA 2FSHA 2IYVA 1G9XA 3SQWA 1ZJ6A 4U02A 4QBIA 4C30A 3ICEA 2R65A 2IBMA 4M0LA 2O0HA 4LPKA 3SU8A 2GJSA 4IJMA 4PC7A 1II8A 2P5TB 1KOFA 3GCGA 3OE7D 1K8RA 2YC4C 4DBLC 4DLSA 3ZVRA 1DAKA 1GVNB 2Z0MA 1QG2A 2VQSA 3EX7C 1OPXA 3THOA 2H1LA 1MV5A 2ZE6A 3RRMA 3VR6A 3GLGB 4A15A 3MAAC 2WKPA 4TSFA 1ZNZA 4EPRA 2W2TA 4Q9HA 4HZIA 1N0UA 1TNDA 3SHWA 3NC0C 3R7WB 2B8TA 1G8HA 4PPFA 2BMDA 1UAAA 3KQKA 2WSSA 3NHAA 5CITA 3HJNA 1NVWQ 1TAGA 2AHOA 3IPYA 4QNRA 1JR3E 3EWAA 2Q9CA 4Z1MA 1Z6AA 3EPHA 3I1FA 3ONWA 3FWYA 3P32A 4QBHA 1GILA 2BWJA 1YZUA 2CLSA 1D8TA 4TL7A 1UKZA 3SJBA 4RZXA 4BZXA 2HXYA 1LFDB 2QN6A 3CX7A 4Q4AB 1U99A 4WXRA 3T61A 2O0JA 4HLUA 1I4TD 1R5NA 2R62A 2J7PA 2O8CB 2G77B 2ZRCA 1ZD9A 2AWOA 2E87A 2OCAA 3FVQA 1EX6A 1VDZA 3AUYA 2EFEB 3QENA 2QG6A 2O8EA 2O8BA 1E9DA 1CJKC 5IF9A 3WNBA 3BGWA 4JLKA 2V55B 5JMTA 2OFWA 3RRYA 1QHIA 1NSTA 4LBWA 1NLZA 2Z4RA 1JR3D 5AWFC 1KJZA 2ZI3A 1OKKD 2W2VA 3KDSE 1AA9A 1JQLB 1BYUA 4MGKR 4XVRA 2HCBA 3RWOA 1B23P 4DWJA 1J70A 2LKCA 1DS6A 1G8PA 3DZ8A 2J5XA 5D3MB 1AM4D 1N5IA 2IEYA 4MRRA 4BGDA 1US8A 1OFHA 4BLSA 1YR6A 4LPSA 2FE4A 4E07A 1CJTC 1IY2A 1SVWA 2BBWA 2NIPA 3QF4B 1XD2B 3BB3A 1RJ9B 1U8YA 1IN4A 1UKYA 2WJJA 3DOEA 2PH1A 4M1SA 5DHFA 4O25A 1CF4A 2B21A 2W6JA 5C1BA 3K1JA 1DAIA 3L0OA 2PCJA 4OHVA 2XX3A 2VP2A 5TARA 2EWVA 1T9HA 1OXTA 5HE9A 4ZCMA 5B64A 4L4UA 1ZBDA 1A82A 3H84A 3CUEF 3BFXA 3UWKA 1K5GA 3VU9B 3I61A 4EIWA 3OF5A 4OK3A 4O2RA 1OYYA 2XNDD 1I2DA 1ZNWA 2FFBA 3EZ9A 3P27A 4YMTA 521PA 1KO4A 1COWD 2WWGA 2JJ2D 2IC5A 1GRRA 1GKIA 1E9CA 3WHKA 3R9IA 4NE2A 4URZR 1PVOA 2WPDD 1V43A 2BEKA 2Z4SA 1KAOA 3QPWA 1DE0A 1T8UA 1KIMA 4Q4LA 5JWHA 3IO3A 2ZRDA 3PITA 3TRFA 4Q9KA 2AXNA 2OM2A 2D2FA 2QP9X 4W9MC 1NSFA 2QP3A 4KFUA 5IK2A 5AJWA 3NBXX 2ZRMA 5K8LA 3QG1A 3SJAA 1GZSA 3SI7A 4PO8A 1E2FA 1JALA 4NZYA 3ZVMA 4B74A 4MITA 4QHYA 4FI3C 1WF3A 4WZ6A 4BLTA 3D6TB 1G41A 1ZCAA 1Q1EA 3TAUA 1M1YE 2MSCB 3QKSB 4TLBA 1EWRA 4B3FX 2DR3A 2CNWD 1P61B 1E69A 4RCZA 1FL9A 2WICA 1NVVQ 4D4LA 4F7WA 4EAQA 1GL9B 1S9DA 3NH6A 3Q8XB 2CHVA 4AKEA 5A5GA 3H4MA 3LQRA 2WWIA 5D3QA 2ONKA 2HF8A 3B2EA 5HCNA 3KUCA 4PR0A 4QL3A 2R9VA 1TQDA 3BE4A 4LI0A 1G3MA 3PCRB 3RWMB 4EDHA 1K5DA 1G3UA 3NWJA 4HZUB 1PLLA 3OEEA 1PJRA 4KFSA 5HKKD 3LV8A 4PZLA 1Z28A 4PO9A 4MRPA 1WE2A 1U0HC 4IVQA 4PQFA 1E0AA 4IDNA 4BLPA 2YVUA 4D0GA 2O8DB 2NO6A 4AC9A 2BC9A 3BAFA 4FWIB 2H16A 5G53C 1QRAA 3OAAD 1NG1A 1NIJA 1CXZA 2LKDA 3TR5A 1GL6A 2BJVA 4TLAA 2B8WA 2XJ4A 621PA 3AM1A 2QM8A 1HYQA 3W3AA 4JL6A 3LVQE 3H0KA 4Q9IA 4BFVA 4TMZA 2EW1A 1G5PA 1I4DD 2G83A 5JS8A 3AVVA 5L8VA 3A8TA 1F2UB 3F8TA 3QEOA 1G4AE 121PA 4GL2A 3LVRE 1Z0DA 2PZGA 2IWRA 2FSFA 4CEHA 1GSIA 4U5XA 1DPFA 1UM8A 2QRZA 4M1OA 1OSNA 3SOPA 3TLXA 4DSTA 3W6PA 1XMVA 2ZM5A 2AL7A 5EE0A 5EXXA 2E1RA 1FQJA 2D3WA 3HU1A 4C0QC 5JHHB 2Z5FA 1XFAA 2WWFA 3H1TA 4HYYA 4L9SA 1D2EA 4P4UA 2Z43A 4Q1BA 2ZVPX 3B9PA 1RFLA 2FSIA 2G88A 3MWKA 2I1QA 3HWSA 4KU4A 1Z0FA 1ZRHA 2ZJ2A 3AUXA 3B1WA 4MKIA 2WAXA 4LJ4A 2JJ1D 3S1AB 1CR4A 4AG6A 1QVRA 3QE0A 4MH0R 4KXFB 1E4VA 4PFSA 1KGDA 1UBEA 2QT0A 3OE7A 4IFEA 4OQXA 4OI1A 3VAAA 4MDEA 2GZAA 2K5UA 4N0EA 1XEXA 3OIVA 4YONB 4ZDJA 2CHQA 2NGRA 4JS0A 1OE0A 4AYTA 1RYFA 2B6HA 2RGNA 5KOYA 4KCGA 2QA5A 3CPEA 3N5CA 3SDZA 3KKQA 1H65A 3IBYA 1WBBA 2AD1A 5CLLA 2QPOA 1GRNA 2GCPA 2XTMA 2ZSBA 1OIXA 2Q3FA 4IRUB 4ASUA 1Z07A 1MABB 2ZANA 1Z8FA 2NZ8A 2PZEA 4Q47A 3X1YA 4N3NA 3QSYA 3X1DA 4KV9A 1GNQA 5DIFA 4MKFA 3AVPA 5TVKA 3NHBA 4FXPA 2BV3A 3LAWA 4A82A 1XTIA 4I1UA 1TPZA 4ILEA 5JFGA 1SULA 5HE8A 2N42A 1FNMA 4OI2A 5JS7A 2I4IA 2P3SA 1HE8B 4HDOB 4EFLA 1II0A 4Y0AA 4NBSA 1SXJA 2IK8A 4AKHA 4QRHA 2ORIA 1U90A 2N1BA 1QF9A 3W5JA 1D2NA 3KUDA 2BCGY 3EA5A 5FTKA 5JSZA 2CE7A 2G1JA 2RGXA 1JR3A 3ZD7A 1JNYA 3CNOA 1N0WA 1KDRA 5EE5B 3ZZ0A 1ANKA 4FD2A 4A92A 4OJKA 1G291 3U3JA 2GK7A 4DSUA 1W7AA 4NHOA 3CB4A 5EUQB 1LS6A 3AKEA 5CIQA 3A4NA 3EZ2A 4UNQA 2UVQA 4JYBA 3TW4A 3TVTA 4C7OA 2EQBA 3EC2A 4IXNA 2GVZC 2JA1A 4TTPA 3K9LA 4BZQA 1NY5A 2Q9BA 4R2IA 5KSOA 2IF2A 3LBHA 4BUJA 4ZDKA 4FMDB 1E2IA 3IGFA 1W5TA 1R10A 3LO5A 1BOFA 2QT1A 1G5RA 5JJLA 1W0KD 2BBOA 1X3SA 2VHTA 4RFSA 1DBSA 4PAOA 3QKUA 1II8B 4P4SB 3AVOA 3RLFA 2QBYA 1G5TA 3K09A 4C3ZA 2OZEA 1M7GA 2DB3A 3QUSA 3GFOA 4HUTA 3SBDA 3K70B 3VX3A 2P6NA 2IF0A 4Y0VA 3SQXA 2GEVA 2XNDA 4GZLA 5FL3A 3FHCB 2WAYA 1COWA 4ZCLA 2CK3D 2JJ2A 4EJSC 5FBQB 5JHGB 1W2HA 3WP0A 3KJEA 4Z8YA 2FSGA 2WJIA 1M8PA 1RVDA 3W8RA 3LQQA 2BMEA 3FMPB 2VL7A 1MO4A 2BCJQ 4DSOA 821PA 2WPDA 3TE6A 3WBKA 3I8SA 1AK2A 2OO7A 4D4KA 3OEHA 2F7SA 5J4HA 3I3SR 1XDBA 1DEKA 1C4OA 4RD4A 4X8LA 4LV6A 4G5RA 2VHCA 2O8EB 2O8BB 4V02A 2GA8A 1W36D 2YYZA 2RHMA 4OJQA 1KDOA 2DFKB 2V9PA 4M4SA 2REXB 3ZGXA 3QXJA 4L8GA 1ZP6A 3AF3A 4A4DA 1Z2CA 3RRZA 4L16A 4KFRA 3IUYA 4EFNA 2H92A 1G19A 3LBIA 3WNCA 2ERYA 3BH6A 3IIJA 3VR3A 3THWA 1A4RA 2CNWA 2ZYVX 2V54A 4CEJA 2EFCB 4AG5A 3KKMA 4TYQA 2VSFA 3UK6A 4URVR 1XPRA 4BFXA 1E0SA 1US8B 3ICQB 5BN4A 2ORVA 3FMOB 3TKLA 3P1JA 3LD9A 4B3BA 3IQXA 3V4RA 5H1YA 3Q9LA 2WJGA 1ZM3A 2JASA 4JZKA 1RRCA 1B0UA 2QTVB 1ZIPA 2WVJA 4DB4A 1Z6TA 1AQUA 5HKKA 3GLHA 2NZJA 1E9EA 1HH4A 2YINC 5FPTA 1KZGB 1VG1A 4PC3A 3A4MA 3C16C 3K0AB 5FOTA 3QF7A 3RAPR 1ZINA 2FEOA 1DO2A 1YVDA 3PUVA 3NBYC 4HEJA 4BZPA 3BH0A 1ESMA 4UNSA 3OAAA 4ABYA 3THYA 4JLJA 3BORA 3GPLA 4XVUA 4V0LA 2EVWX 2F1RA 4A6XA 3CRVA 3CZQA 4Q1AA 3PUZA 5JZVA 5FBRB 3D3QA 1P60A 3QY0A 1Z47A 1R0ZA 4WVFA 1XMSA 2VP6A 3FGNA 1F3OA 4OHZA 2PJRA 2IHBA 2XNSA 2OBLA 4M2LA 4UJ5A 4JLNA 1ZYUA 3OIWA 4LOAA 4QGHA 1OF1A 1GKYA 4YQFA 4US1R 4M21A 1KI8A 3TUZC 2EU8A 3NEJA 3R8FA 3BB1A 2IUSA 3EIQA 1Q1QA 5L3SA 4TLDA 3B60A 3R9XA 4GOJA 4MYCA 2Q3HA 4M1KA 5C46F 4Q4HA 1D9XA 4MGYR 2GJKA 3U3KA 1CP2A 1E2EA 3EIHA 3X1WA 4DSNA 2XZOA 1KO7A 3DDCA 2JJ1A 4RJLA 4XSHA 2OBNA 3RS2A 3SNHA 3B82A 4NCIA 4JSYA 1VG0B 2QAGC 1W48A 3GJ3A 4Q00A 1FNNA 4X8MA 2ZJ8A 5LD2B 5TDHA 2IA5A 3AP3A 2PEYA 4NYMR 2NO0A 1NIPA 3AKDA 5GJCA 1VCMA 3E2IA 3KFXA 2ZEJA 4YLGA 4AK9A 1E9AA 4JLAA 1KZ7B 4B48A 3VX4A 2ZRFA 4B3DA 1Q3TA 3SZRA 4A1FA 2ZYWX 2VYFA 2DWQA 3K0CA 2GILA 2WMNB 3AEZA 3LFUA 2J0SA 2G0TA 4M8NE 5BYKA 4Z51A 2KBFA 2A30A 4B6EA 3T1TA 1SKQA 4FN5A 1P3JA 1EG7A 2VHUA 2WJHA 1Z6YA 2H17A 3IHLA 3AB3A 1EXMA 1UKEA 1N6RA 3VHXA 2J87A 2MSDB 3F0TA 3FDIA 2QY9A 1XF9A 4QFMA 3AVYA 2ONJA 1TTTA 1SZPA 3LY5A 3BH7A 1G64A 2GJ8A 3U7HB 2WKRA 4FMBB 4DLRA 4N0DA 3MLEA 3UMRA 1OXXK 1NKTA 2OFXA 4PSVA 5LB4A 1NN1A 1RRGA 2GDJA 3VKHA 4NCHA 3WHLA 5JECA 1P7CA 1VYUA 2BJWA 5KNCA 5IRCD 2J7KA 3DVLA 1E0JA 2LCFA 3ZH9B 3HPRA 4CEHB 2OLJA 2JLVA 3MUFA 3ASYA 1U9IA 1CBUA 1G17A 1JI0A 1XTJA 1DELA 1G7SA 1ONBA 2IYRA 1JPNA 1E1QD 2WBLC 3MMPA 1DG1G 3SFVA 1GKUB 1P5ZB 221PA 2P0EA 1VPLA 4C0JA 4H9GA 1RE0A 5GJWC 2ZJBA 3KB1A 3CO5A 1SHKA 4MRVA 1XB2A 5SZJA 2FV8A 2CVHA 3KXKA 1KKLA 4J0QA 2OBMA 1FPMA 2GEDA 1PUJA 1W0KA 2PJZA 1JJ7A 2AFIE 5FBWB 5KSZA 1SVLA 2EFHB 2F9LA 2FJUA 3LW8A 4Q1FA 5CK5A 3Q3JB 1XXHE 1KK2A 4QOSA 1T8TA 2PX0A 1XEXB 4QG7A 1JR6A 4LV8B 4M1WA 5CYPA 1JEDA 1H8ED 4KSCA 2PZFA 3WYFA 5EXTA 1MO3A 2RCNA 2Z6VA 2CK3A 2W6ID 3ZQ6A 1VTKA 3WMGA 2GAOA 5EP2A 1FP7A 5JCZA 1EFRA 4QKQA 2W83A 4FCVA 4ZI2A 4OHXA 2OHFA 4ZPXA 1KJWA 4B71A 5J47A 2QI9C 1TX4B 4CF7A 1FQKA 3WBJA 4GNKA 2V6JA 3BD9A 3QXXA 5K8IA 2J0QA 4BFTA 3MWLA 3TQCA 1G6OA 1XD9A 2IEZA 2FPLA 3P20A 5ANRB 4JKYA 1KDTA 2C04A 1IN6A 4JLVA 2KB0A 1E32A 1SXJB 4W7SA 4RD1A 1U2RA 4BRUA 2F3RA 4PX9A 4DIEA 3B1XA 3K53A 1BIFA 3WYGA 3W9YA 1DVRA 2H7VA 3EIEA 4IHQA 4TLEA 3W6OA 2EYQA 4G01B 5BN5A 5JSZB 1IXRC 4AIIA 3WRYC 3EPLA 4OHYA 2WMOB 2D7DA 3GJ4A 2NOAA 2P6UA 3VQTA 1CR2A 4EPYA 4NYIQ 1QHGA 3WYAA 4FMCF 1ZU4A 1G8FA 3KXLA 5DSZA 1E1RD 1IOZA 5HCIA 3L0PA 4N1AA 3WXMA 2GZHA 4HAZA 1UFQA 2BKUA 1UPTA 2DWOA 4C7OB 3RSLA 3BFVA 3JVUA 2A2ZA 4IOKA 5B57C 4JVLA 3U3RA 1T3SA 4M22A 2ZSEA 3SJZA 2FU5C 2IL1A 4EPTA 3LWNA 1J8YF 4DUGD 1KNQA 1T3HA 4NDZA 3UG6A 3VTKA 4LHVA 2REBA 4DC9A 4RFSB 4JL8A 4R71A 1JXOA 1HA3A 5FTNA 1FW6A 5EQTA 3K9HA 2PT7A 1X1RA 4DDTA 3LA6A 2QBYB 3B5JA 1Q57A 4CT4B 1DG3A 1TU3A 2XXAA 2H57A 1OLOA 4NCNA 3TGPA 4MYTA 4GBMA 5KPDA 1GOTA 4DCVA 1O3YA 2GKSA 3U3OA 3U6BA 3RC8A 4LV5B 3ZDQA 3CX8A 3C41J 4JL5A 2F1JA 2QQ0A 5H68A 3SJCA 3R9WA 4RKFA 2HLDD 2QUZA 1NL3A 1F60A 2NO9A 3UG7A 4DLUA 1L8QA 1P2VA 3DOFA 3L0IB 4JJKA 4FCWA 4URWR 2C78A 3RHFA 5FR1A 1QG4A 4A8JA 4QHTA 2ZYUX 5HR5A 1F6BA 3MFYA 2XTZA 4JIMA 4YDSA 2XTNA 3U3MA 2VO1A 4JLBA 3U4QA 2V3CC 3EXAA 3KJIA 1E98A 4C0LA 1VG8A 1WDTA 1N3BA 1UJ2A 2KSQA 3DM5A 4OK5A 4YMWA 1WA5A 2G0NA 4DLTA 2QMOA 2YOGA 4JLOA 5HZHA 2GBLC 2V7QA 3LXRA 3AH8A 5A4JA 4F91B 1ZAKA 4TTRA 2JLRA 2ZRLA 2ZR7A 2J59A 1DAGA 1P62B 3OFND 2QTHA 4QHSA 4Q4JA 4B32A 3THWB 4CEJB 4DHEA 4UNRA 1CJVC 1L4YA 4EUNA 1KK1A 3D31A 4D81A 1KI9A 2C95A 3BFKA 4LK2A 5JI2E 1YZLA 3CLVA 3O8BA 3G0HA 4XWOA 3LNCA 3GJ6A 4H1VA 4B44A 1U8ZA 1NNEA 1AGRA 4OK6A 2ZUDA 5GVRA 4Q66C 5KYKA 2ZXUA 1YZKA 4EQ6A 2GWHA 3PR1A 4ZI3A 1TQ2A 4MA4A 1N25A 3GLHB 3ZLJA 1VYTA 3AVWA 3KKNA 1XMJA 2VH5R 1EX7A 1T6NA 2JDID 3PXGA 2GETA 2FDCA 5KTYA 3PIRA 3DHWC 2RAPA 5IHPA 4LJ9A 1JEEA 3PENA 1BMFD 4L15A 3WMFA 1FZQA 5GJVC 3THYB 1ZU5A 2QP4A 1NN5A 2E9SA 5GVSA 5DE3A 2MMGA 4A36A 1OH6A 2NPIA 5BN3A 4URUR 1MO6A 1SVKA 3EARA 2YJTD 2YZ2A 4JYCA 4KBFA 3T1QA 4PC1A 5E3HA 1I2MA 2HJGA 2C98A 1OXUA 4EKDA 4LYJA 2X77A 1YR9A 3OIYA 1XTQA 1CLUA 1E1QA 2QORA 5J4KA 2D2EA 2V1XA 2ZU0C 5L3SB 4HLDA 4DLYA 3G82C 1P75A 2J0VA 2ZUCA 2CL6X 3B7GA 2J9RA 2ZI9A 3CNLA 4Q4HB 3AGPA 4QGAA 1KI7A 4TYPA 1U0JA 3SFZA 2WV9A 3E70C 2NQ2C 4TQ9A 4IEIA 5CIWA 1WRBA 1TF2A 2RHDA 4BE7B 1E4YA 1KI6A 5F9HA 4BFUA 3B1YA 2F6RA 2X2EA 4NYJR 1QHHA 2VTKA 5E7IA 3TSOA 1AKEA 2HYDA 3ZIAD 1TADA 4P31A 2GCOA 4X8OA 4A2QA 3Q5EA 3OIUA 3C14C 1GRQA 1H8EA 4JJZA 4NKRA 3UATA 3N70A 4MKHA 2ZS9A 3MJRA 3V4FA 1GM5A 1JAHA 2PMDA 3KL4A 5SZHB 2W6IA 1AS0A 1ZC3A 1FP6A 4XWKA 4B47A 1DAHA 1QHXA 4U7DA 4BASA 4CZ2A 1LNZA 1OIWA 1L7VC 1Z0AA 2CL0X 3ADCA 1E96A 1LV7A 4V0ME 1W4BA 2LWIA 1XXHA 4LZZA 4OI0A 2ZI6A 2BBTA 3VNUA 1CJUC 2G3YA 1CS4C 2ASEA 2WKQA 1ZMXA 3T12A 4AD8A 3K0SA 5EZ6B 3ECCA 4R98A 1XJQA 4G5QA 4RD3A 3HYRA 5BXQC 5DI9A 4B2PA 5KDOA 1PLJA 3BBPA 1IJFA 1L2TA 1IBRA 2P2LA 3W8NA 4D6PA 1OT3A 5KSPA 4WOPA 2QPTA 3HP1A 5AJXA 2C99A 3GJ5A 3TK1A 1KMQA 1VKJA 2YOHA 4LCBA 4MKGA 4XD7D 3EG5A 4EFMA 4LJAA 1KMHA 1K6MA 4LUCA 4Q9LA 5JRJA 2J45A 1T0JB 1E1RA 5EP4A 1SVMA 4DRZA 1N5LA 3QVUA 3U44A 2QGNA 4I99A 2I3BA 4M9QA 4URYR 1GITA 4ESVA 3H86A 1Q44A 2P67A 3GLFB 4CT5A 3CKLA 3A1TA 4MDFA 3EZ7A 1N6IA 1SGWA 4HSEA 5AJZA 3KQHA 3C5CA 5LBIA 4BQSA 2FFAA 1Q0UA 1GAJA 2CCJA 1GFIA 2V8OA 3FFAA 3QEJA 4D4MA 2BM0A 2MSEB 3N2IA 4DUGA 4A2PA 3PEWA 3R20A 2DPXA 1Y63A 4M9ZA 3A37A 1S8FA 1ZUIA 4A2WA 1N5KA 2ZUBA 4NONA 2R8RA 4B73A 4OQMA 4O3MA 1D9ZA 1S2MA 5J4LA 2FGKA 3QQ5A 1G6HA 1M6NA 1S96A 4HB4A 4LSGA 5AUQA 1VMAA 3I5XA 1E2MA 1JAIA 1NKSA 2ZJYA 1XTKA 4IEEA 3LLUA 3FYHA 4BPBA 2AD5A 2I1VB 1C9KA 5J5CA 1E9SA 1FX0A 3JVVA 2NMVA 1FFHA 2UZ3A 2FWRA 1RW4A 2KE5A 4A0FA 3FKSD 3FKQA 4GFDA 2YV5A 4HLCA 3RS7A 4HATA 2C5LA 3NVAA 4O2LA 1DAFA 5L3VA 4QC2A 4GT1A 1OKKA 1ELOA 3BC1A 1T5LA 1D5CA 4TTQA 3MJHA 2HLDA 2SHKA 3ZS9A 3ZVLA 4QXAA 1ZUHA 4GI7A 3CIOA 2GTPA 2ZSDA 2GVDC 3ADBA 4BLOA 3A1WA 3C8UA 4ZO4A 4Q19A 2ODEA 3GJ7A 4OL0A 3FMIA 4KFTA 2FFHA 5DGXA 3VMFA 2GXSA 1UBFA 4D4JA 3IEUA 4G5GA 1T91A 4WAUA 1D6JA 5L3RA 4CVNA 3D7MA 4QNMA 3A1VA 1W36B 3LW7A 1S3SA 3K9NA 4PHFA 3NC1C 4MGIR 2YWEA 1P9NA 2GK6A 2AFHE 2ODBA 4HDQB 1LB1B 2RGAA 1OXVA 2W0SA 3IIKA 3AVQA 4IDQA 3DMNA 1RKBA 3QXSA 4FINA 1YJ5A 4KYUA 1Z0IA 5EE1A 1W0JD 1JJVA 5DH9A 5IDVA 3OFNA 2IYZA 4II7A 5CB8A 4I81A 3GLIE 1G16A 2HF9A 2G1KA 2UKDA 4CDGA 3PVSA 4WZBE 2QMEA 1FUKA 4W5WA 5FUVA 2BBSA 3T15A 3L0SA 5AUPB 2CCGA 4QGFA 4X8HA 3ZD6A 2IXEA 2ZQ5A 2Q0HA 4K81B 2FEMA 4DVGA 4KI0A 2JGNA 4QJ5A 3RVBA 2Q3MA 2HYIC 421PA 4F4CA 3DMDA 4Q48A 4IVRA 1L4UA 4TL9A 1VCIA 2FNAA 4Z54A 5JCPA 3KQUA 5DI3A 1ETUA 3W5IA 2JDIA 2A9KA 1WCV1 3OESA 1W1WA 5EP1A 4DXAA 1XTRA 1RIFA 2XAUA 2XXAB 4ZIRA 1HY3A 1CRPA 1TF5A 1BMFA 3A4LA 1UBGA 3BIFA 3QXCA 3RABA 2XZPA 3CNNA 2PLFA 3OHMA 1XJ0A 3FHOA 4ON9A 3GP8A 1NLYA 1XPOA 2WOJA 2YWFA 2FZLA 2RGDA 2AKAB 2HCJB 4AKIA 3TNFA 1R8SA 1U98A 4I4LA 4DCNA 5CYOA 4HB3A 3AP1A 4MUBA 4BEJA 2PMKA 2IYQA 4EPXA 4ZKDA 3EWSA 5CJPA 1UBCA 2CBZA 3U60B 1IY0A 2QEQA 3UPUA 3NG1A 4A8JB 2OG2A 3NKVA 2BIFA 4DZZA 4AWXA 2VHQA 4KLNA 2W58A 1T0HB 3U4QB 2GXUA 3QNUA 1P9WA 1Z08A 3C4JA 4S2EA 1ZNXA 1YQTA 5BW8A 2ODNA 1E6CA 4LHYA 3AVXA 3GEHA 1BYIA 4PQRA 5DYIA 1FOEB 1X8JA 4YXWD 1UF9A 3B78A 5SZIA 1IONA 2PLRA 3PUXA 5CM9C 4C0KA 1D2MA 4JLMA 5FI0B 1P6XA 5KDLA 2CXXA 4Q4JB 1KSJA 1ZNYA 3LBNA 4U00A 5L3QA 5FOUA 5JEEA 3NDPA 3CF0A 2ZRNA 4JLPA 3PJRA 3HPQA 3G5UA 5TB5A 2IS1A 5CJ2A 1E2PA 3W3ZB 1DAMA 1J99A 5UKDA 3ZIAA 1R8QA 2ZE8A 1XEWY 3I73A 1CR0A 2Y8EA 2ODWA 5AR1A 4KJZA 4D82A 1XCMA 3A58B 2R44A 2OT3B 2HEIA 3CW2A 3ZZTA 2IW3A 4A0HA 5JBQA 3O8CA 4EQ6B 2WIBA 4RFVA 4WW0A 4LBYA 4EJSA 3KQNA 5CK4A 4DEYA 2WWYA 1EFHA 3CF6R 4F4IA 4GP6A 1VHTA 4UNPA 3B85A 1JPJA 1HQCA 5FPKA 1TL7C 2JCSA 4MYUA 5DISB 2ZR9A 3P4YA 3LXXA 3M1IA 2QPAA 1HEIA 5A0FA 2QZ4A 4KVAA 2ZS7A 1NVVR 1YRAA 4Q5IA 1SKYB 1X86B 3VR1A 1G8GA 4G3XA 3IKJA 1QZXA 4ITRC 1O87A 1ZC4A 1KSHA 4IFBA 3U6KA 3PEUA 1TMKA 4JLDA 3UKDA 2VF7A 1P4SA 1NJFA 2ZETA 2IYXA 4RZUA 4PZZA 4TYNA 1CULC 3CH4B 1CTQA 3NEYA 1DTSA 4CIDA 2PEZA 1VCNA 1Z83A 1OYWA 4TL8A 1KY3A 3ADKA 2X19A 2FFQA 2XITA 2EWWA 1YZNA 4FMDF 4JBWA 1XEFA 4UXJA 4DLWA 1OH7A 1IN8A 2GF0A 2ZVQX 5CB6A 2PL3A 2BDTA 3ZYCA 2BOVA 4PZYA 1W47A 1E2JA 2J3EA 2RKOA 2HUPA 1RC8A 2JLSA 5C18A 1OH5A 1EESA 4RCYA 4PSAA 1OIVA 1OB5A 1R5OA 4P0TA 3PEVA 4QGGA 3AF0A 2BVNA 4B3XA 4LBVA 1XU4A 3SS8A 2C9YA 4C0HA 1WMSA 1GL7A 2ZJAA 2QROA 1OHHD 3TSWA 1PLKA 5FUXA 1X8LA 3C7KA 4ZKEA 3T5DA 4B2LA 5FH9A 2ZITA 2ZROA 1DADA 2RGEA 4R9UC 2PX3A 3HDTA 3RS5A 4LWZA 3L8ZA 1ZM7A 1T4GA 1KI6B 2V6IA 3PUYA 1FUUA 3VHLB 3V00A 1JQJC 4D0NA 2XZLA 3P4XA 3IHWA 1NMZA 1KSGA 2GCOB 4BFYA 2OILA 1P73A 2J1LA 5EXPA 5FOSA 4ESHA 4ZDIA 5FFMA 4IOLA 1LVGA 3AVTA 1SVIA 3BWDD 3IIMA 3FMFA 5FOVA 1Q1BA 1FTSA 4RSGA 4Q7MB 2C77A 4D80A 3KTAA 3KQLA 5H8WA 3FPAA 3U2QA 2J41A 5JLJA 1WBDA 1NP6A 3CWQA 3AV0B 2J0UA
chains in the Genus database with same CATH superfamily
3SR4A 3BWMA 3H13A 1FNCA 2VSQA 3GMTA 3PFBA 4NEHB 4QRIA 1VLMA 1TEVA 1Y1KE 5AHWA 1LDGA 1HXHA 5FQOA 2ZE5A 3NGXA 3PFIA 3C98A 3HLTA 1KEKA 1Z38A 3KR1A 4TVOA 1KKMA 1U2SA 2QUBA 1FZTA 2MINB 1N6KA 2IXFA 2J09A 1MGOA 3EEFA 3UMJA 2ZBGA 3DOOA 3FFTA 4AYWA 3SBXA 2Q1SA 4PR3A 4TYWA 1MQ8B 5SYNA 3ISVA 3WLOA 2G9NA 3HMKA 2DM6A 1LLQA 2A14A 3KO8A 3MSXA 3MD9A 1QJCA 3GMSA 3CXRA 1V9SA 4HDSB 1JB9A 2IXGA 5D3ZA 2LR0A 3NHKA 4OKSA 1O6BA 1P45A 1SVOA 3AUKA 2WJVA 4BMYA 4F4JA 2JLYA 4U39A 2QL6A 3H7IA 4B09A 2PGLA 3CT6A 2VWHA 1W0JA 2X7JA 3GOQA 1GPDG 1TE2A 2D7CA 3F49S 3K5HA 5E9JA 5EZ5A 3RTBA 1YU9A 4RA6A 2Z95A 4D44A 5A6SA 3U44B 5BR1A 2XT6A 3TPZA 4ITUA 4DE5A 1MZVA 1R9GA 1F14A 1XCGB 3UFXA 2JHCA 2OXFA 5IJ9A 1HWYA 1HE3A 1NBEA 1MABA 2GBIA 2PK3A 1EEXB 2VHJA 4RXTA 2R6FA 3QKRA 1P4JA 4X1YB 2YCLA 5H82A 4H6PA 3W6NA 3FOZA 3WLFA 3W05A 4UPDA 3L8YA 5C53B 3DE2X 4AUMA 4BAGA 4O2AB 3DQZA 2JFQA 2QE7D 3ANNA 4QUEA 4U9HS 4HDRB 5AJHA 3FLEA 5BOSA 5C80A 3AZOA 3VFDA 2A5FA 1A8SA 2Q4OA 3KQPA 3Q0TA 5TPWB 5G40A 1UZAA 1PFYA 1ESZA 2YWJA 3EZYA 4ALIA 2F1IA 3QPUA 3C8DA 4O5AA 5A9RA 1L4KA 2IE8A 4R2WA 1ZD8A 4ARUA 2PUEA 2YHIB 4HQRA 3IP3A 1NBWB 2Q07A 2FMHA 1LPMA 1AIPA 4MWZA 5C4GB 2W48A 1POXA 1CR1A 2IDKA 4BECA 1P7VA 2C2HA 1X1CA 3BHJA 1MB3A 3HYSA 4HNQA 5FWAA 1KK3A 1NXVA 1NI5A 1WB6A 2IFTA 1FPQA 3HYTA 1QIEA 1VMDA 5ALLA 3ZX5A 3HCFA 4G0WA 1YUNA 1KOJA 4ILKA 2PT6A 3V7FA 5K6AA 3PFWO 3SXPA 3PB3A 3K20A 1WQ1R 4P8RA 2B3DA 4CQLA 5D01A 3LY8A 1UODA 2G72A 3DTYA 4IMIB 1ID1A 4W99A 3EXFA 3IMFA 4E5VA 3QX9A 4DLXA 3EPPA 2GM4A 3IH5A 3GI1A 1NJ8A 3WLRA 1JG4A 3MWYW 1TM4E 4GMHA 2QHXA 4KN5A 4HUJA 1E0DA 1G21E 2G67A 4K88A 5IP5A 1MNQA 3RPEA 5CEFA 3AT1A 6ABPA 1T3GA 3P9QA 4GO1A 1FFGA 3DKPA 2F9FA 3GJ0A 1DIGA 2ENUA 2OQRA 5FJIA 3A1UA 2BAGA 2VOEA 4XSGA 2R8PA 3TLGB 3TLMA 4EENA 2Z08A 3BDAA 3E3LA 1DMSA 1EAYA 4F2DA 4DT1A 3IO5A 3R7LA 5I45A 3QFHA 1Q0QA 1MXFA 1QZTA 5F33A 3AEXA 2VYND 1WXGA 4ETMA 2B61A 1KI3A 3RLIA 2FPUA 3N53A 4E33A 1DIAA 1G20E 1KAGA 3TXVA 3JALA 1W4AA 3CPJB 3ZBTA 3OLXA 4Z0PA 1EWQA 2GPTA 1QQAA 3VR6H 2CD7A 1CK4A 3L7AA 2NUPA 4W9NA 5KCMA 5HFJA 2IODA 3PC8A 4FCTA 4U3JB 3VNSA 3PU6A 3A9RA 3I09A 4QIHA 2I4TA 1O6GA 1SUWA 1JLMA 2EJWA 5KO2A 1E1CB 1V5GA 4PYMA 5DLQC 1WXQA 3THSA 5F7OA 5LMCA 1M6VB 3G8CA 1N6LA 1IVNA 1O5OA 4KC0A 2ZWOA 5C7LO 3LCVB 1WHSA 2I2FA 3MWJA 3QBVA 1C7QA 2B94A 3W4IA 4BC1A 2UUAB 4R81A 1PFKA 4KGXA 3C1OA 1OXSC 2B2XA 2C3MA 5F5XA 1EAMA 1U65A 4PANA 3ZEIA 1OBHA 3OF2A 2OYSA 1X38A 2JBWA 1L3IA 2VP5A 4QBFA 4QXRA 1DWPA 1SXJD 4FPXA 3NUQA 2OVFA 3GRUA 5D8DA 1B2RA 1CUXA 4UVEA 1J20A 3BRSA 1GCIA 3AGQA 4XYLA 3N2YA 2R6HA 2R751 1V9CA 4XUCA 4XRGA 2QX7A 3DEHA 1DPGA 4GL4A 1HE1C 2TMYA 4ERXA 5HIKA 4MK4A 3PDIB 3I0NA 4F4FA 5LD2C 5FYQA 1JYEA 3F78A 1NKVA 4D9FA 2QJOA 4GLBA 4TQGA 2EX1A 3CBQA 5TXGA 2AK2A 2EXXA 4C4XA 2CCKA 4D98A 2V4ZA 5C51B 3LH5A 4O33A 4EY8A 3EASA 1AZWA 1CCWA 2PA0A 3KKPA 5JY1A 1UKVY 3CRQA 2PD4A 4X7PA 1CKEA 1AN0A 3ZY2A 1CR6A 5CFZA 1SWVA 6Q21A 2R1VA 1E94E 3K1YA 4NAUA 4M8IA 3U48A 1E5DA 3HA7A 3KR0A 4IIEA 2W6ZA 5B1HA 1AT1A 3VVLA 1S1CA 1Z6QA 5K3EA 1QGED 1S1MA 5G0WA 4E7PA 1C1XB 1N2CE 1E9BA 4RTSA 4ZFNA 2ANCA 1YE8A 4LZJA 1N5JA 1S9HA 1E8MA 4ZANA 1Q12A 4KQ6A 1Y5NA 3STXA 5A62A 3SP1A 2DHRA 3I3OA 2QK4A 3TFWA 1VG9B 1XJ5A 4DM7A 3CRNA 3MMSA 3A2MA 2AN9A 1TK3A 3U13A 3WRXC 3FFBA 4X64B 2ANBA 3KVNA 4QDTA 3W90A 3SYKA 4ZALA 4ZAWA 1YDGA 4M0PA 1GWNA 1VJRA 2OESA 3KOUA 4NZNA 4IHJB 3GRKA 3R3YA 3GCXA 1U2QA 3ABIA 3FYDA 4Y9RA 5EIHA 3WBBA 4WBNB 5KYXB 5IKXA 3H11B 1CQWA 1QP7A 1ENZA 2OBXA 2HL6A 4IJ6A 4V24A 2OAQ1 4B0OA 1THGA 1JU3A 4TVBA 1Z6XA 1B8VA 2VDQB 2QD3A 1USKA 1EQUA 1RZ3A 4KO8A 2RG7A 1KAEA 3JYQA 3ETNA 4G1FA 4LC0A 1XA0A 3SX4A 4EMSA 3KV3O 4FT2A 3FCYA 3S2SA 1WDWB 3HU3A 4RH3A 2OOKA 1UANA 4O29A 3X1MA 4UBOA 4PGAA 3DE6X 2CHGA 1LPBB 3IS3A 4MWDA 5B7QA 2G6TA 2ZPUA 5DB4A 3KSDO 1MA0A 3V5NA 1GUFA 1WCXA 1ISSA 4AWAA 5KJ6A 2O8FA 5AKEA 5LNK1 1COZA 4ARCA 5IDQA 3IAUA 2A78A 3DM9B 2NZWA 5F1PA 5FWYA 4PO1A 2C9DA 1LTQA 1TZKA 4QM6A 5J40A 1IG0A 1CS0B 3KEMA 3U3XA 1UKBA 4MVJA 1XNJA 3ECSA 1SOUA 2L69A 1QG6A 1V16A 1OB2A 3B89A 2JPDA 1GSAA 4MMZB 3RTEA 1GXSB 4G0XA 4GMDA 1Y6GA 4LF7B 3K73O 2QL7A 4QBGB 4UNIA 2XYQA 4FJ2A 4QDJA 1W44A 1GPH1 2JG3A 1WCYA 3TLYA 4WASA 4RK0A 2B5VA 1E79D 2QENA 3CY6A 5KNBA 2ZCJA 4OGGA 1EVKA 4MB0A 1D1SA 3CRW1 2JA2A 1MJGA 2RGNC 1EK5A 4DGQA 2Y0BA 4A5OA 1GTG1 1N1EA 2H1SA 4CL2A 3O94A 2X22A 2KX7A 1T15A 3MTEA 2WJYA 1G0NA 3HM2A 4MX8A 3WIOA 5HKOA 2FF7A 4UHBA 4WOCA 3OC6A 2JATA 4X3PA 3RF6A 3N8NA 4MB2A 4BB9A 2V97A 1KYYA 3H5IA 3SZ3A 3PRJA 4JEUA 1UMCB 1WP9A 2F9MA 4L2IB 2IDJA 4H3VA 4LJYA 1ODJA 4UHCA 4B81A 2C7OA 3GZ4A 1CQZA 4WERA 1DXOA 2ZRJA 2OAGA 4AICA 3H1PA 3GP5A 1A5ZA 4RKRA 3ZCTA 3WTBA 1NX9A 5K8CA 1Q19A 1QZZA 2IYSA 3T1VA 1DV1A 4AM8A 5JBIA 5ELXA 2XB2A 4ZK2A 2IUEA 4ETWA 1VHLA 2G0AA 2Y6VA 2YX1A 3AWIA 4OHUA 5I8ZA 2C2KA 4AO6A 1PGOA 1QGZA 3DHNA 1I9GA 1Y42X 3A6EA 4PBTA 2PL5A 4QEZA 1A69A 3IBGA 4PNZA 2ECKA 4Q7JB 5FADA 5EJ9A 3X0DA 2W8BA 4K28A 4P4LA 4EW1A 5DHPA 1A5TA 1VE3A 4NJMA 2BM1A 5EIAA 3EZ6A 4J0KA 5E3IA 4AAYA 2FG6C 3IUSA 3N0WA 4POAA 5E3JA 2JHGA 3X1KA 4RTRA 5DXJA 1Z0KA 4BXOA 4V0OA 3RQIA 1HQKA 1XZJA 1I10A 2IYNA 4C78A 5ICSA 3IPXA 3GFPA 2YXLA 1KO1A 4CCYB 2DXIA 3HABA 3JQ6A 1PK9A 1CU1A 1R5BA 3GJ8A 1QANA 4DEVA 1E6MA 1WG8A 4JDUA 4X7BA 4LECA 4AG3A 1G3RA 5DHUA 1OV4A 2CKDA 2DKOA 4EQZA 5KNCH 3R3HA 4ARZA 3G2QA 2O2ZA 1TO2E 3E5NA 3H9EO 1U0BB 5IBRA 4ZPJA 3RU7A 4PAGA 3K0EA 3RTAA 4I2NA 1GNPA 3UXMA 3WZ2A 3QKTA 4ND3A 4YMSA 2VA8A 4CR6A 3F4KA 4TWZA 8ATCA 3JWHA 2ZZMA 1GV0A 4XJXA 3IR7A 1JFFA 1FXWF 3VR4D 3IJRA 4O8CA 2I6TA 3KT3A 4QULA 3PFFA 5EE3A 1UMBA 2AXPA 1A88A 2FWBA 3BWBA 4PYNA 4RESA 3TIIA 1GAEO 1N6OA 4M7OA 4RD2A 5EVCA 3GLQA 1U0LA 3RYFA 4D3DA 4DQXA 1IN5A 1M54A 2HCFA 1FDTA 2HMTA 1E7QA 3PZBA 4JJFA 4PQYA 4CKYA 3COVA 2P68A 3HJGA 1ML4A 1S7GA 3HR8A 2OFOA 3RVKA 1QBKC 4MIKA 1ZY2A 5LOVB 3DO6A 1P0MA 4MW7A 1A2OA 1T1RA 3CLKA 2IHVA 2FGJA 1TYCA 4HGOA 3TQTA 1QTQA 1HFWA 3PHJA 4IV8A 3IAM6 2B0CA 3ZWVA 3H75A 4B6QA 1VSVA 1XRJA 3BN3A 1JLSA 2VP0A 3FWNA 1MC5A 2PGIA 4I4NA 1LQTA 1QHFA 1XBTA 1O57A 4B87A 4ZEVA 1YR8A 4TT3D 2EJTA 4A27A 1NN3A 2QSUA 5A6SB 1AKYA 5GJBA 4HBGA 3UFXB 3ND6A 4WKOA 2FB9A 1EQAA 3E5HA 1KVUA 4IHJF 1JE0A 4HJXA 3KYIB 5K1ZA 2VPIA 3QKRB 4LFCB 2WSMA 4HX9A 1W4CA 4RL6A 1DCTA 3MELA 1ZSNA 4UZSA 4BFZA 2GEFA 3EAGA 2WTUA 1CNFA 4D9BA 5KHOC 2I4LA 3H5RA 4B3MB 2NO1A 3OMLA 4UE6A 5BOSB 2JEOA 3G5MA 4CMAA 3O4IA 4KWHA 1XKXA 1I4OA 4Q21A 1QK5A 4ARSA 1L5RA 1UBTS 2NAFA 4QDOA 2XKBA 3N0VA 2V7WA 1B2LA 5HS6A 1QP4A 4GHWA 1EWYA 4HWKA 4LQCA 1YBFA 1T2FA 4X95A 1KSFX 3EPJA 2I8AA 1D0IA 3AKCA 3GAMA 2Q7OE 1LRJA 4NYIR 4H3SA 1BWQA 1LTHR 4HB0A 1VJ1A 1Z0ZA 2WAMA 2XVXA 3C3EA 3SEAA 3JAKA 4GE3A 3D8NA 3KE8A 3R3UA 1LRLA 1YA8A 1R6BX 2IIPA 3WYCA 3T0IA 4Z4HA 4BVGA 3T06B 3OCWA 1U8UA 1FLVA 3JVEA 1CUVA 1E4EA 3CLTC 4PLTA 1KO5A 3E3OA 4MPDA 3W5VA 3QYJA 3DD1A 1DQSA 3EQ2A 1OYOA 4R5HA 4CQLB 1GYQA 2EFGA 2WU8A 2XCUA 2GRJA 3PXBA 4MRSA 4PSDA 3FIUA 3EXFB 2ATVA 2I6XA 2D4HA 3B8HA 1DHTA 4RORA 1TC1A 2CJPA 4ZQEA 5JJIA 3E1KA 3GLTA 1Q91A 3LF1A 4IY1A 1VA5A 4HGNA 3UANA 5C4MA 3S3TA 4NIMA 2P30A 4D45A 4PLFA 5FEMA 3UBTA 4JC4A 1XVAA 3ID6C 3ZU3A 1UAYA 4NHEA 1G8YA 1Y8QA 2CLEB 4DT1B 3S2FA 4Y30A 3ZQUA 1IAQA 2W6CX 2ZIEA 2HDOA 4HSGA 3DW1X 5AM1A 4LF9B 6NULA 1RWXA 2I78A 3NWEA 3B13B 1R7RA 5K4HA 2HC9A 2Q41A 1EK6A 3IQWA 3B2QA 2KMLA 3SHVA 3TVYA 1W5SA 1NV8A 3OZXA 4AQ7A 5LB2A 1Z25A 4DMRA 4WLOA 4AYXA 2Q5OA 4LHZA 3JALB 1O0CA 4KHPB 3EGIA 2HV8A 2QM0A 1Y8CA 2WK1A 1KR5A 1JFVA 2NUPB 4O2BF 1JHYA 2O50A 2YUIA 2A5YB 2JGMA 4LF6B 1IJKA 5KYUA 2CYBA 1ZM4A 4G85A 5LPNA 1EFRD 4RD6A 2Q1UA 2GB4A 4TZKA 3WY9A 2WF6A 5AVJA 3PYLA 4Q1DA 2QLNA 2R6JA 5U9CA 4R1MA 1Z7YA 1QF7A 2WINI 4MGZR 4XQCA 1RXWA 4GMXA 4II3A 3AX6A 2B2NA 4BMDA 1AS3A 1LK5A 4F04A 2XVZA 3EJWA 3OTHA 3VR2A 4J76A 4D4HA 2JZNA 2A5DA 3JZAA 2C96A 4Q18A 1RWQA 4RJJA 4G1MB 4MLDA 4YRDA 5AW7A 1MOSA 3LSTA 1XD2A 2L2QA 1RJ9A 3AF4A 3M89A 4U6NA 5FBHA 2CV1A 2C5HA 1N6NA 3OQHA 4PTLA 5IABA 3FB4A 3OPMA 4ML3A 4WRRA 1G1MA 2H4WA 1TK9A 4WCFC 3QBDA 4OXNA 1QIHA 1V4VA 3O8DA 4JAVC 3B3JA 4OYRA 4PHTA 1BMDA 3PTLA 4Q9NA 5IKPA 2WUWE 1JAZA 1J1IA 3A3NA 3DBHA 3UKOA 1YZQA 3D7KA 5TV2A 1SG9A 3RFXA 3ADDA 3ZWYA 1YZTA 2ZR8A 3Q6NA 2NVUA 4OAPA 1P72A 1R64A 4QLBA 4CGZA 2PPVA 2WUEA 3FY4A 2Y1LA 3L7KA 4IJKA 3UVEA 1M34E 1SPBS 2Q29A 2ZRKA 5K0BA 1QHNA 2QLBA 4X84A 4ZOLF 1RM4A 2FA9A 2R1VB 3QM1A 5K0LA 3PNBA 5LOVF 1MIHA 1A1VA 5FPSA 1LS1A 2WSSD 4UQLA 5EMMA 5AVWA 5AVYA 3I8XA 1M74A 3K8QA 3AHHA 5I7FA 2JC3A 4ECAA 4IIXA 1GTJ1 4MQ5A 4MHTA 1PDOA 4YEDA 4K8OA 4YCSA 3HFRA 3RREA 2BCEA 1H93A 2YKGA 1GYRA 1LVUA 3GQBA 1AGPA 4FC6A 4F2GA 4IQ0A 1YBMA 2V45A 3CH5A 3HO8A 1EK0A 4L5CA 2LUOA 2J7PD 1C1YA 1XZQA 2BY4A 2JGIA 3T1OA 3KJGA 1Q7CA 3UHJA 3MERA 2PKYX 3B1VA 3TX2A 5MGNA 2GARA 3WZMA 1VYVA 3BD8A 1D0VA 4LY6A 4QD3A 4ZVMA 1CZLA 1GDDA 4E03A 3WL8A 4HH4A 3Q8MA 2VSXA 1ZK3A 1KEVA 1PDVA 2C9OA 3ZNPA 2GEUA 4TS1A 5M04A 3FUXA 3I1YA 1DBQA 2GXQA 2BN4A 1PT8A 4HTFA 4FEGA 2QQEA 3ZWPA 2W43A 1PV4A 1SBCA 2C9CA 4DCSA 1AF4A 1XSEA 1JDSA 5BNTA 1OUMA 1T9AA 3QKSA 2NG1A 4F2WA 4NNPA 3L05A 2DFNA 1L5KA 5MFZA 5IWCA 1D1QA 2OO5A 4M49A 5SY9A 1Q0HA 2BZ1A 4RMNA 2OCXA 3Q7QA 2O8FB 3A0UA 1U0TA 2COKA 3GH3A 4UW9A 4JVNA 1SELA 1NQTA 1B6GA 3MA0A 5FWYB 4I1PA 1OWPA 5E95A 3E18A 4CKCA 2HLNA 4FYJA 4TQAA 5IBQA 3OZGA 3RARA 1Z4NA 4J0JA 1N75A 1UOQA 2F48A 1KI1A 1V16B 4JJEA 5KDDA 3FYUA 4FHEA 3CT4A 2W6JD 2FLKA 4US0R 1XTVA 1I7SB 4HO1X 4FMPA 1IDOA 1GP2A 1N8SA 2XY4A 3COYA 1V35A 3VKVA 1Z0SA 1M7HA 1TKRA 1PR0A 3OCVA 1TO6A 1G63A 4RHEA 3ZY6A 1Z2AA 2C97A 1I4EB 2IUUA 1ZR2A 2KLHA 4I36A 4TZ6A 3ORSA 3HU2A 1B6TA 3EIFA 1NRJB 4MVYA 2KWIA 4UQOA 4ZYTA 2B20A 3KZXA 3P0FA 3BSSA 5HTOA 4L0MA 4XRRA 1U7XA 2C8VA 4PM4A 5TEWA 4RCVA 3WLLA 4A10A 1QHHB 2H59A 2G25A 4EHDA 1I6MA 3CX6A 2G6BA 3DAPA 3P9IA 2BMJA 5CDTA 3A10A 5JRDS 4DR3B 3NBFA 3KLNA 2XCOA 4O4JF 4HN2A 2JCXA 5L6LB 2TS1A 1BH2A 1XMIA 4G1CA 1GPMA 4OG2A 1M76A 2ZSAA 3KWFA 4I4TA 5CXQA 2OHIA 1UJ6A 1PW5A 2Y1FA 3O2NA 4YMUA 1KC1A 3TR0A 1HOTA 2ZJ0A 4Y2XA 4TMXA 4MUGA 3LBYA 4D9MA 1YE5A 3D2CA 1CFJA 4MI1A 1YDWA 4GZMA 4PZUA 3TRHA 1L1EA 1RQRA 1Z2OX 3EQZA 5AKXA 1PQYA 3WFIA 4GM1A 1C2TA 2W8BB 4ACBA 2JL1A 1X39A 1DLIA 1E3QA 1YVUA 2GS9A 1IMOA 3IJEB 4NJMB 1WO8A 3LK6A 1H2BA 4C4OA 5ITWA 3JR3A 1RIIA 4BXOB 4XI9A 4NOLA 1JKMA 5KTKA 1WXEA 2VYVA 4UTVA 1HL3A 3TMYA 3V6MA 3LE8A 2HKIA 4E30A 3C1AA 4MLZA 4ZYZA 4BQIA 1IEVA 3IQZA 2PL1A 2A5GA 4XLTA 4Q3AA 5BSTA 1DWUA 1VHDA 1PV1A 3AR3A 3DNFA 3ZWDA 2RKWA 3HEMA 3M4YA 1UC4B 3X1XA 2OGSA 3IKTA 1VIYA 1BD4A 2Z2ZA 4ARZB 2MSLA 4N65A 5LZ8A 3BTVA 2OL4A 4CL8A 4ZYVA 2WSLA 3G0OA 4PHGA 1BH6A 2OXCA 5CDFA 4AMZA 4QQNA 4XXHA 2ZJ7A 2YFQA 3AWDA 5I5GA 2BFAA 2UZ4A 1XKQA 1JFFB 3M8KA 4Q3BA 2BUCA 2O48X 2CLCX 5DMHA 2RGGA 3BL5A 4DCGA 4BEWA 3OEED 1MV8A 3DONA 1OBVA 1UMBB 3KQQA 5TF0A 3KT0A 3UWPA 2OUIA 2BKEA 5MGBA 1OVMA 5GMOA 3RYFB 1QWOA 3N8DA 3F7NA 4WSOA 1HT2E 2PR2A 4GRAA 1LBEA 2R79A 1J97A 3HN7A 3F5SA 3SZGA 5LKAA 3UHOA 1TU4A 4LS3A 3ZU2A 2O2DA 4GDFA 2RGBA 2O14A 1RU3A 3HVIA 4JT9A 4IX1A 4N5HX 4KVGA 3H99A 3AKYA 2PIAA 2DWPA 3R5TA 3NUZA 3M0EA 5L7TA 2VCHA 3FPKA 4H1HA 4A6PA 1ZN2A 5FLXA 1KQFA 1WOYA 2P5UA 5E0KB 5A3SA 3L7JA 4RLQA 1RYHA 1JILA 4INZA 1DBRA 4O5OA 3KC2A 3MIIA 4LDAA 2M98A 1N0HA 1ZISA 1NDQA 3TIXB 1G1AA 1FNDA 1IBCA 2RH5A 3GYGA 2NSLA 5E6RA 1JNXX 3W8EA 2O0MA 2GZMA 3CNEA 3JXEA 5E4FA 1OJLA 3B6EA 4A8JC 4RJIA 4I9GA 1J0AA 4B6RA 4C6HA 5LIPA 2FW0A 1NMXA 4MRAA 3T8YA 1AUQA 4YV1A 3PQ6A 5BV2P 2P4SA 3MQFA 5LZ7A 3W7AA 4OQNA 1EBUA 1DOAA 2CN1A 3T5TA 4US2R 1IHUA 2HRDA 5I8WA 1YI0A 1CUFA 2AW3A 2O3UA 2VOJA 2W4IA 4FSDA 5JDCA 1I51A 3DG9A 2P6RA 3HDJA 1V8OA 2BI7A 2LXNA 1MT0A 4XYBA 4L02A 3IDSA 1ZMOA 3VR5A 3W34A 1J24A 1AZTA 5CVEA 4FXOA 1HR0B 1PL0A 2O2JA 4LJKA 1O03A 2BD0A 1ZMRA 3ZGYA 3L1UA 1RWVA 4DA7A 3SQWA 2I2XB 4I2VA 4U02A 4C30A 3GR6A 4J90A 5H16A 2R65A 2VZLA 4CTKA 3JAKB 4RIFA 2O0HA 3CJTA 1P80A 4UMDA 2GJSA 2PUFA 4JP1A 2XEDA 2ZKLA 4Q9AA 2AJDA 2B98A 1IFXA 4CN9A 1C3EA 1KWGA 1E4EB 2EIHA 2ZB2A 1DAKA 2J5RA 1XN4A 4MUMA 4UEOA 3ZVRA 4LFBB 2Z0MA 1XRLA 2C07A 4DW8A 1JHAA 3THOA 1AA6A 2PUCA 2H1LA 5JYEA 3RRMA 2VI5A 2QV0A 3W77A 3QUCA 3MAAC 5LFAA 1MC8A 2XWJI 1BSVA 2ZRQA 5ELMA 1QJ4A 2BHLA 2W2TA 4D0RA 5AXAA 5KQMA 2GD6A 1N0UA 3P2MA 3ROZA 3SHWA 4F5EA 5I4BA 2B8TA 1G8HA 3MWFA 4AN4A 1F0YA 2A9VA 1KEZA 4CODB 4YK7A 3QWIA 4WXMA 3SD7A 2JFGA 2BMAA 2C0QA 1NVWQ 3BFPA 1TAGA 3CMCO 3IPYA 3KZNA 5CLGA 1GTSA 4I8XA 2PWPA 3GU3A 3ONWA 3CUTA 4BNUA 5CGQB 4DMFA 1GILA 1Y8QB 1YZUA 1D8TA 1IDN1 2QN6A 1Z74A 1UQTA 2XVMA 4YMHA 1GTRA 4WXRA 4KN8A 2IU6A 2O0JA 1I4TD 1NT2A 1X7WB 1XQWA 1NOKA 1X80A 2ZT8A 2ZRCA 5F1YA 4OLAA 2E87A 4X3OA 4DPKA 1H6AA 3FVQA 5A3RA 2EFEB 3A9WA 3K2IA 3Q2OA 4KE7A 3WVNA 2B3TA 5SY4A 3BGWA 3PX2A 4JLKA 1B8OA 3EVFA 3NHZA 2X0IA 2B1JA 2V55B 4FEEA 2GLXA 3F73A 1PZEA 1QHIA 4RMJA 3CZCA 1NSTA 1C9JA 2JFYA 1NLZA 3EJ6A 3MJCA 1KJZA 1B93A 1WZIA 1ODKA 3G2LA 3LLVA 1EP9A 2W2VA 4HDNA 4P2BA 1AXRA 3KDSE 1WLSA 1AA9A 1JQLB 4MGKR 4P36A 4C1NA 5J2UF 2BKLA 4JYMA 2CXPA 3KOOA 1B23P 1BMQA 3WZLA 3HSKA 4TTSA 4YMGA 3W4KA 2X76A 1VMEA 1J70A 4YRZA 3H3XA 1N3YA 3CMMA 5JADA 1ZLYA 1B0AA 1YJXA 1AM4D 1R37A 1YIAA 1YKFA 1WKBA 2IXBA 4MRRA 2PYDA 1ZH6A 4M60A 2P3QA 4XFDA 1YJCA 4BGDA 3UGJA 1QCDA 1RKQA 2CZGA 4JQYA 3D5TA 4LPSA 2B7LA 2E4AA 2FE4A 3ON5A 4G67A 1KORA 4JMLA 4PYKA 4PCUA 5TGZA 3SX0A 2BBWA 1ULSA 1XD2B 2HRBA 1RJ9B 1Y7PA 1V7CA 4WXPA 5DHFA 4X94A 3RHTA 1NE2A 1Y1TA 1R66A 4S1OA 3T4XA 4CXMA 4BMOB 4F8YA 3L0OA 3R5JA 1NVBA 1G8SA 1B26A 4CDNA 3CF4A 2C3YA 2YFKA 3IQGX 2UUBB 2R8YA 4O4HF 4RAOA 5FPQA 1CJCA 4ZC8A 3DBHB 2FVXA 1LPOA 1SK8A 1USVA 1T9HA 1OXTA 4QFCA 2Y9PB 3LZDA 2YXPX 5DGDA 1MB9A 4U1RA 5HCUA 4E3WA 2HMVA 4Q4CA 3DF9A 4C01A 5INTA 1PL6A 3BFXA 3VTAA 4XX0A 3OF5A 3OZBA 4S2UA 4O2RA 2GYYA 3Q7EA 2OHXA 4NBKA 5I4CA 3RU3A 1TM7E 4YMTA 4ZEOA 1GZ5A 1JU9A 3FUCA 2PJDA 3PD7A 2MR5A 3G2NA 5CT9A 1DJLA 1GKIA 1P5FA 2B34A 3L7NA 3L8MA 3QMVA 1EGHA 3EOBI 4QUKA 3SG0A 1TUBA 1PVOA 1E6KA 4H7HA 1V43A 4YVFA 4YO7A 1W34A 2LD4A 4JC8A 4WOKA 4CMHA 4DMHA 1JRLA 4WA8A 3T5MA 3HZOA 3QKWA 1T8UA 2P4EA 4MYSA 4Q4LA 3FSGA 3HN2A 3VYVA 2ZRDA 4JA0A 5B12A 5ECYA 2B4RO 2DMRA 2O4CA 4QELA 4DA6A 1BHQ1 4W9MC 1D2CA 2RGWA 2YBEA 2WPNA 1JLHA 4BWFB 4K9PA 5AM0A 1BVHA 4PZPA 1PUXA 2Q27A 3GRPA 1EFDN 4H2DA 2HJHA 1K08A 1U8CB 3SI7A 4JJIA 1NYLA 1I3OA 2JFUA 2FFJA 4HWSA 4O02B 5LDHA 3OT1A 4L5YA 1UC5B 3MHPA 1NV9A 3GP3A 2E55A 1WF3A 2OFPA 3K4HA 4WZ6A 3BJEA 4HTFB 4BLTA 2H0QA 4N9QA 1VL1A 1ZCAA 2EARA 1PJ3A 1HORA 1M1YE 2GBCA 3JQ7A 3QKSB 4TLBA 3SE7A 3S2GA 1I5OA 1PE0A 4HXEB 2CNWD 3VR3D 1P61B 1E69A 4JB3A 2K7FA 2WICA 4JELA 1NVVQ 5EINA 5BSWA 5C35A 2C61A 3IEXA 3U4IA 4YRKA 3LRTA 1QYRA 3NH6A 2CHVA 2H7CA 3N76A 4I19A 4XYEA 3VH4A 3O7WA 4CKCB 1DGQA 2IZOA 5D3QA 3ROXA 2HF8A 3LGSA 3IXLA 1MXHA 1TQDA 3GZTB 4XR4A 3FYUB 1G3MA 3PCRB 4HNSA 4NMXB 3TD6A 4AMBA 1BFUA 1I6WA 1JWAB 1F1BA 2W6NA 1NRWA 4DGSA 3DV9A 2PSHA 3JQ8A 3O0TA 3OHSX 1MQ9A 2X6QA 4PZLA 4QTXA 4MRPA 4P54A 4TXHA 1U0HC 3LKZA 4PQFA 5EFZA 1Y1LA 4JJAA 5AVKA 2V7EA 5AP9A 4EYEA 3MJEA 2YVUA 4KQ9A 4L9AA 4D0GA 4B3HA 3OE1A 3BAFA 4FWIB 4NK5A 4IUYA 3PWTA 5G53C 3WB2A 5IC4A 4R0NA 4E13A 2VT7A 2LKDA 3NHFA 3CZ4A 3TR5A 2V0NA 3EFOA 4OLFA 3WRXA 5AVSA 2B8WA 5AHXA 5F9MA 3W3AA 4MJLA 3CE9A 3AHCA 4JL6A 3CLHA 3LVQE 5ILOA 5F3DA 4ZOEA 3TN7A 3TWOA 1IRIA 3SEFA 3UK7A 3WHPA 4TMZA 2R6ZA 2BISA 3VO8A 4CNBA 3IX7A 4KFCA 2HY7A 1QQBA 3UH0A 4I4TB 3F8TA 3S27A 4GL2A 1JHVA 4MI3A 1GUDA 3LVRE 1QAOA 1Z0DA 4PIVA 3QJ5A 4ARAA 1GSIA 4U5XA 4DZTA 4GOOD 5CXXA 5G0UA 1UM8A 2D4AA 2QRZA 2QLMA 1SC1A 1OSNA 5I7RA 4K40A 4MAAA 4BEVA 4XOUA 3S99A 1V2HE 5EVJA 4BZQA 5EXXA 2D3WA 2PH3A 3HU1A 5JHHB 2Z5FA 4EPTA 4L9SA 1JHZA 4KWEA 3RVQA 1JHUA 5EIXA 2Z43A 1XRRA 3B9PA 1RFLA 1VZ2A 4PN7A 1ZRHA 2XUFA 2Y9MB 4KTVE 1G55A 2Q8QA 3QE0A 3D81A 3IOBA 4JQZA 1PR1A 4R8MA 3DOJA 2FPIA 2XCRB 1DZIA 3OE7A 4EKGA 4V1CA 2RJ3A 2PRKA 2K5UA 4NI5A 3DXYA 1A96A 1XEXA 1YULA 3I5UA 4RPHA 4DCCA 2NGRA 2OVBA 2LV8A 2JFWA 3DAHA 1P39A 4LMAA 1RAGA 5KOYA 2RGNA 1EVIA 3LHSA 2QA5A 3CPEA 2YN4A 4TVSA 1PJQA 4CV3A 4DUPA 1BOOA 2H2WA 1WBBA 1BKSB 4I14A 5CLLA 2QPOA 1GY8A 1G21A 2GCPA 3KPJA 1ECPA 2BFCA 4Y0NA 3HK2A 4ASUA 4IRUB 4FFRA 4KRGA 4LDRA 2CKMA 4MW6A 4L4ZA 5AXCA 1BVRA 3QA3E 4QWMA 4RETA 3X1DA 3PDWA 5DIFA 2BLLA 1ADJA 3AHGA 3ZNQA 4KQ2A 3NHBA 3DWIA 2O5CA 2BV3A 2YYAA 4OHCA 4A82A 7ADHA 1XTIA 2Z09A 4I1UA 4N54A 3A1EA 3OX3A 1RYYA 1SULA 1DDIA 1V25A 2JD2A 4UBIA 4DMCA 2ECFA 4KIJA 1PL8A 3I12A 3I53A 4NENA 1XHEA 3FUTA 5JS7A 1IHOA 2P3SA 1HE8B 5IF3A 4EFLA 2H4JA 3HUDA 3V3TA 1WR8A 4Y0AA 4NBSA 3BCSA 2IK8A 4AKHA 2ORIA 1NTRA 3QV1A 4GQBA 1QF9A 4FDLA 2CF6A 3O95A 4IAOA 4NFYA 1J9EA 3D3EA 2FX2A 2A4KA 4C4ZA 4DLKA 5KC9A 2IH5A 1ATIA 5AW9A 3OY7A 4KIFA 5E6RB 2WZDA 1UCFA 5CR9A 1JR3A 1JNYA 1YNSA 2QJRA 3KDAA 4OMUA 1Y0BA 4KK3A 4QASA 4FYIA 4ZGBA 3NHJA 4JODA 1ANKA 3R3VA 3ANXA 3GUHA 4A92A 1TVKA 5TVGA 5AVRA 2AEEA 2ZUWA 2PQ0A 3UJ6A 1HK7A 1UBRS 2C29D 3OE4A 4F5DA 5IPFA 1W7AA 1TJPB 1DDOA 1LS6A 2GN0A 4IO0A 3AFIA 5ALFA 3A4NA 3SY8A 4YV2A 2UVQA 4DM4A 3TW4A 4C7OA 3NBKA 3RV4A 3SM3A 2XB8A 4X7MA 4JBGA 1GG5A 1CF9A 2JFOA 2AFVA 4TTPA 5EESA 3R0ZA 4G0ZA 2WDPA 3EVGA 3GF4A 1NY5A 2Q9BA 2YHAA 4WE3A 4R2IA 4WKNA 3NFRA 4D96A 3VU0A 3K1TA 2V6FA 1HETA 2NXNA 4W63A 4ZDKA 9GPBA 1E2IA 1LK7A 4IUDS 3IGFA 4AJKA 4AXXA 4BN4A 4PZDA 1BOFA 2EQ5A 2GASA 5KYYB 1BWSA 2WM3A 4YB8A 1DBSA 3FTPA 3P9RA 2ZCVA 2WDZA 1YQGA 1ZPDA 2XMDA 3QKUA 4P4SB 5DDIP 1MAVA 2VK2A 4ENVA 2D1SA 1G5TA 5BQXA 1YQ9A 1K8ZB 2OZEA 4C1BA 2VDRB 1HDOA 4F3CA 2QVCA 3ROGA 3VX3A 2IF0A 2WIDA 2QVBA 3R5XA 3PC3A 4ZT3A 2C7BA 2GEVA 1VI2A 2I2AA 4C87A 1JHPA 5EN4A 1O8BA 3AG5A 1NXSA 4MQ4A 4N5LA 3WL6A 3ZD8A 1COWA 2QTRA 5FULA 3VH2A 2XMRA 5FBQB 2NTJA 5JANA 2I6GA 3RIHA 1TA9A 3M3DA 2Q0QA 1SZDA 1RWPA 3PPVA 3RAEC 3NFYA 3MBIA 4AL4A 1RVDA 3W8RA 3LQQA 4Q3LA 2IPOA 3OTIA 4XGQA 4WLNA 4EYQA 2W2LD 4RXMA 4WK0B 5FORA 3VU1A 2WPDA 4DSOA 821PA 4LOIA 3Q10A 4D3YA 3MTBA 1VPTA 2H1WA 3NVMB 1PU2A 2PTGA 4ENUA 3ZKAA 4D4KA 2F7SA 5J4HA 1CZHA 3PQ3A 2ZUVA 4KKXB 4TRRA 2PKQO 1X80B 2ON6A 3L1HA 1V8DA 1G9TA 1O2DA 2XB9A 1M1XB 1CUYA 4G5RA 4RGVA 1JHDA 4Q3NA 4V02A 4LSZA