1FQJA

Crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
317
structure length
317
Chain Sequence
RTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1,Guan
publication title Structural determinants for regulation of phosphodiesterase by a G protein at 2.0 A.
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 126
structure length 317
sequence length 317
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 1fqjA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1fqjA01
5C18A 3V4FA 1KAOA 1A4RA 2BBOA 3U5ZB 2GCNA 2RGCA 1TMKA 1KDPA 3CH5A 3LW7A 5SZIA 1KI7A 1J99A 2F43A 4TYYA 2O8BA 1I2MA 1L4UA 4W5WA 3SQXA 2CHGA 2D3WA 4DLRA 4WW0A 1ZC3A 3LXRA 4AYWA 4KI0A 4JVLA 2GZHA 3I61A 1E79D 4FI3C 3EZ2A 1F48A 1EFTA 1ONBA 3WXMA 4TT3A 2ZR9A 1XXHB 2ZR0A 2FWRA 4HZUB 4NCHA 1GITA 3MAAC 5E4FA 2MMCA 3RWOA 2VH5R 1DAEA 2ONKA 3GLHE 2OV2A 2YWFA 4M9QA 3AM1A 3MWJA 4JIMA 2C03A 2ZJBA 4DLWA 1XMSA 4B2PA 1GTVA 2GILA 4R2HA 1R0YA 2J0UA 4HAWA 1HT2E 4Z8XA 4C3ZA 4TMKA 3I3SR 4TSFD 2IXGA 1XEFA 2IEYA 4BFWA 4URWR 1KNXA 4JSTA 2CVHA 3LLUA 4M1SA 4G3XA 3RRYA 3X1ZA 2GEDA 5FBQB 5DI3B 2EW1A 1Z47A 2QPOA 1WA5A 1CR1A 2G83A 2ERYA 4XWAA 3DOEA 4DEYA 3UMRA 4JLAA 3T5GA 2Q3HA 1XCGB 4PFSA 4E03A 3CZQA 3TMKA 3EWAA 1Y3AA 4JLDA 4QG7A 4EPWA 4R98A 1S1CA 4LPKA 4PZZA 4F93B 1ZNXA 1S96A 4EQ6B 2JDID 2LKDA 3OIVA 1ZBDA 4PTLA 1P60A 2V7QD 4NZYA 3FKSD 5JCPA 3K70B 3B1WA 3D3QA 2V4ZA 1ZM2A 2VYFA 4L9SA 3RSOA 1G9XA 3DVLA 1XWIA 3FDIA 1NG1A 1NP6A 4NH0A 4C2UA 1TL7C 1VIAA 4UNNA 3WMFA 2QSYA 4LBZA 1F3OA 3L2OB 3K70D 5FUVA 4GI7A 4D6PA 4B48A 4NONA 4QHYA 3IHLA 3SR0A 3GLHB 2QAJA 5HCIA 2OE2A 5SZHB 2GXQA 2X2FA 3H1TA 1E9BA 3NBZC 3Q7PA 3TVDA 5F9HA 1N6LA 3SI7A 2O8FB 4A0RA 4XWOA 3BFXA 3UWKA 4CF7A 3B1YA 4B34A 4B76A 2QPTA 5GJWC 1LFDB 4C0JA 1PUJA 4KBGA 4Q7KA 2FZLA 2E87A 2C95A 4LY6A 2X2EA 5ELXA 4D0LB 4D0GA 1OYYA 4XVRA 3LX8A 1OH5A 3F8TA 3ADCA 4ZDIA 2ZJAA 5FBLB 3U3JA 4M1KA 2YC4C 2QGZA 2XOKA 3AVPA 4LHVA 4HUQB 4QXAA 3THXB 5IHPA 4URXR 1SULA 4TLAA 1BIFA 4CIDA 1WQ1R 2BVNA 2G77B 3K9NA 1IXZA 3N70A 4ZCMA 3AVVA 1LS6A 1LS1A 1N5IA 4JLOA 4JZKA 2ZU0C 1GUAA 2VA8A 4QBFA 1RRFA 1UPTA 4JL6A 4C0SA 1GL9B 3FFBA 1VCOA 2BEJA 1E0JA 3SN6A 3M4YA 1BMFD 4XVQA 4AYXA 3B9PA 3QEJA 4HLUA 4I1SA 2CEAA 2GF9A 2OAQ1 4BFXA 4UNRA 1RRCA 4PC2A 3Q3JB 4TMXA 1DELA 2QBYB 5HE9A 4IRUB 1OJLA 4E07A 2I1VB 5E7MA 5BYKA 1AS2A 4JLMA 5L3SB 4UJ5A 4GFDA 1JR3E 2FGJA 4BLSA 1US8A 3CF0A 4D4MA 4RZUA 1IJFA 2WMOB 1T5LA 3ZVMA 2WJIA 2BCJQ 4A92A 3EARA 2BM0A 3LBNA 2VHQA 3PUXA 4PSAA 3H2YA 1J7KA 4IEEA 4OQMA 4WAUA 1G16A 2AK3A 3T1VA 1MR3F 1CJKC 3AUYA 2WWIA 4IOMA 4B3DA 2PZFA 1CKEA 1G8GA 2JLQA 3I32A 2WSSD 1HTWA 3W6NA 4DSUA 4OQXA 1RJ9A 1VHTA 4ZIRB 1D2MA 4IXMA 1ZM4A 2R6DA 3V4RA 1LF5A 2IHYA 1SVIA 4NCNA 4OHXA 3TSWA 2AK2A 4TL9A 1VG8A 1W46A 2ANBA 2F1IA 4LBYA 4P3YA 4A8JA 5A4JA 1HE8B 3NKVA 1KO7A 4V0LA 3U3MA 4XWKA 1ESMA 3TKLA 4CEIA 2FPMA 1E3MA 4MRPA 4E5UA 2ZJZA 2QP4A 2REBA 2A9KA 1VG1A 4L4UA 4FW9A 4XD7D 1NVVR 1MKYA 2R62A 5CK4A 5AJXA 3SJBA 3THWA 1E9CA 1FW6A 4TMZA 1ZNWA 3P27A 4A0HA 5HPYB 1DE0A 3ZZTA 2J0QA 4B3BA 2WIAA 3M1IA 3A4MA 3C4JA 5KNDA 3RRNA 4R9UC 5F98A 1VIYA 1UKVY 4JLNA 3H84A 3ZDQA 2ZI5A 1C9KA 2DB3A 1GG2A 1N0UA 3HYRA 2G1KA 4URYR 3S1AB 4BLRA 4PC6A 3X1DA 4C4PA 1DAGA 2IF0A 4ACBA 2CL7X 3HU1A 4MDFA 1JAHA 1ZVQA 4Q02A 2OCPA 2IYRA 5FTMA 1MV5A 4JBYA 4XIGS 2HEIA 5BXQC 4R7ZA 4WZBE 4LOAA 4EJSA 3PUWA 3MGCA 2FFAA 2QMEA 5F2EA 1OT3A 2EYQA 1ESNA 3GJ0A 2WWYA 1KJYA 3VAAA 4Q4LA 1NMYA 4XSHA 1RRPA 3UWOA 3B2EA 1U81A 2RAPA 2QRNA 1EFRA 1PVOA 1UBFA 2BC9A 5TB5A 4Q4HA 1PLJA 4DC9A 2WJVA 2IBMA 1P61B 2AWOA 1JR3D 2JASA 4Q7JB 2JATA 2QG6A 5AJWA 3WP0A 2ZYTX 1YZKA 1QVAA 2XNDD 2P6NA 4JJZA 4LJ4A 2REXB 1GOTA 2JLRA 5GADl 5JLJA 1YJ5A 5KDOA 1KO4A 2GCOB 4DCNA 5LD2B 1HE1C 1E2HA 2VO1A 3W6OA 2R65A 2WJYA 3SFZA 1U90A 1IXRC 1CR2A 1ZUHA 4IDPA 3PR1A 2N42A 3TUJC 2GA8A 2CLSA 5DHFA 3VR5A 4WXPA 2QMHA 3SC3A 4PC3A 1E2LA 4O0MA 4M22A 4URUR 5FPKA 2QP3A 1Q44A 2NPIA 1FP7A 2R8RA 1Q21A 4OQFA 4CRWB 2WIBA 4DLXA 3ADBA 3QOFA 4IOKA 3GMTA 2PMDA 1EFCA 1KIMA 1JXMA 3IEUA 3ZLJA 1D2EA 5L3QB 1CRPA 1NBMA 2W6JA 3C5HA 5EE3A 2ZJ2A 2ZSEA 3DOFA 2WKPA 4UQOA 1P9WA 5FL3A 4MRRA 4TYWA 5L3VA 2XX3A 4CZ2A 4Q7LA 2CMKA 2C78A 3JZMA 3K0CC 4A2WA 4YXWD 1IONA 1KK0A 2OUKA 2ZUDA 3A4NA 3NDBB 1GFIA 1GNPA 5HE8A 3SZRA 3MMPA 3CPJB 1AS0A 3W8RA 4DZZA 5JWOA 3AV0B 3U7EB 2ZPTX 1G4UR 1AS3A 3P4YA 1N5LA 1L4YA 3AVXA 3AF3A 4MRNA 5CDFA 1QHXA 1FOEB 5FI0B 2SHKA 4HB2A 3LVRE 1TX4B 4PHGA 3IGFA 2D2FA 2W83A 1UDWA 1VYTA 2AHOA 5JMTA 1VYUA 2PCLA 4YC7A 1OB5A 4JL5A 3Q7QA 2JJ1D 3HP1A 4RVCA 2EQBA 2QAGC 3H4MA 3RAPR 5J47A 1DAHA 2AXPA 4G5RA 3FMOB 2H7VA 3OFNA 3K0FB 4HLCA 1OFHA 2AFHE 2QU8A 4RD0A 1YRAA 4CGZA 1RYHA 1MO3A 2KBEA 4Q01A 1GVNB 2BCGY 5H68A 5LB2A 4DEXA 2VP2A 1Z0FA 1KKMA 2AD5A 1XD9A 2BWJA 4QHTA 4PANA 2DCUA 2ZRDA 3DZ8A 3B13B 1TTTA 3SU8A 5KO2A 4Q9JA 2X8AA 1M6NA 3DZDA 2P5SA 1HYQA 1NSTA 4AKHA 3CZPA 2PH1A 1QVRA 1LVGA 2VSOA 4WVFA 5JWHA 3ZQJA 1DG3A 4I1UA 4PSKA 4UKDA 3FPAA 1F2UB 5EE9A 1YR6A 5DH9A 2XZOA 3EIEA 2F9MA 4IHQA 1NMZA 3TUIC 3LBIA 4ZDKA 2EWWA 5FL7D 2GJ8A 3UXMA 1KDTA 3FMIA 3SE0A 4C2TA 2WM9B 1BH2A 3B78A 3BXZA 4CEJA 2GKSA 4FMCF 4F92B 1E2JA 2F1RA 5BN5A 4B2LA 1O3YA 3WNDA 1KSJA 4IFBA 3TK1A 2W2XA 1N6KA 1Z83A 5E7IA 4D0NA 1OPXA 5KUTA 4LHXA 2ZRCA 1M8PA 2A78A 2GHIA 2IYVA 3HPRA 5AUNB 4IKEA 1AGRA 2J7PD 2NO7A 3H86A 1W36C 2ZE6A 4OQLA 2X1VA 2HT6A 5DHAA 2OFWA 5FTLA 2NO9A 3KJHA 2V6JA 5TARA 3UKDA 3GLIA 4H1UA 5EE0A 2WPDD 2D62A 1QHIA 1X8LA 5SZKB 3HPQA 4V0NA 2P65A 3O8RA 3TSZA 5JBQA 2B92A 5C2JB 4GL2A 5KTYA 3GLFA 4LBVA 5KHOC 1L7VC 1LF0A 2JGNA 5DYGA 1Z2AA 4RD2A 2NIPA 3SHFA 3T61A 5KU1A 4M9XA 4LJ8A 2W0SA 1CRQA 4WIAA 1U0JA 1SHZA 4OI1A 4A1FA 4F38A 5EP3A 5AUQA 4CT5A 3CNOA 2OO7A 2CK3D 4HDOB 4KJZA 3AVWA 3D7MA 1EX6A 1RIFA 3U4QB 2O52A 2AKAB 3B85A 2C9YA 1SZPA 2CVFA 1GM5A 3U3KA 2FFBA 3CLVA 5IF9A 2GEVA 2RCNA 1OHHA 2VF8A 1W1WA 4NYIQ 3KKPA 2HF9A 1WF3A 3QPUA 1U99A 4RZXA 1S1MA 4QBHA 2VSXA 2ZEJA 1AQUA 1XJCA 2OLJA 4X8MA 3GLIE 2GBLC 2IYYA 2AXNA 3KQNA 3L0OA 2YOHA 1R6BX 2KWIA 4F4IA 4QKQA 5J4VA 1XNJA 3EZ6A 4FIDA 2GZAA 2JIZD 2Z43A 3W34A 4MUAA 1P2SA 4Q66C 2GK7A 2XXAB 1W4AA 2QTHA 4NCIA 2FEMA 4AG5A 2P6RA 5FFMA 4PZYA 4ASUA 1Z29A 4LSGA 2GEUA 3NTUA 4MYCA 4F4JA 1JPJA 4JVMA 2JLWA 2CCKA 1Y63A 4UNQA 1S8FA 2EFHB 3W6PA 1CEEA 4DLSA 3AKEA 2CHVA 2OBLA 4PAMA 3CX8A 3SDZA 4NL4H 2O8DB 2ZRBA 1X6VA 2XTMA 2WMNB 2PBRA 2JJ2A 2A5JA 1BS1A 3MLEA 3IBGA 3VR3A 4GSYA 4OI0A 2C9CA 3SJCA 1V5WA 2IXEA 5K8IA 4X8HA 1IY0A 3I73A 3JVUA 1DS6A 1XJQA 3FHTA 1EG7A 1FUKA 3U44B 1G3IA 2QGNA 5AJVB 2DR3A 4QNRA 1YR8A 2FA9A 1TQ4A 3L8YA 1GKYA 4HATA 3D8BA 2Z4SA 1OB2A 3A1SA 2WOOA 1E4VA 3GEHA 1JECA 3OAAD 4G1UC 4B73A 3VNVA 3NEJA 4RCZA 4UJ3A 2WJGA 4HAXA 3QY0A 1YR9A 5K8UA 3FWYA 2NMVA 3BIFA 1SXJB 1XTRA 3CWQA 4ILEA 4XVUA 3QI2A 1T5IA 1ZYUA 1H8EA 1S0UA 1R10A 3W90A 2XEXA 2J9RA 1OIXA 3OIWA 3LFUA 1X8JA 4KAXA 5DE3A 2CL6X 2KJQA 3OEHA 2J3EA 4Q19A 4JS0A 1Q22A 4WA7A 2YZ2A 5DYIA 2NOAA 3LH5A 1IOZA 2OCBA 1SXJD 2H5EA 3HR8A 4FMCB 3HJNA 4U02A 1XTKA 4BFSA 1KMHB 2GAAA 1IM2A 4JSYA 2A2ZA 2MSEB 4YDSA 4BQSA 2VHUA 2ZM5A 2ZITA 3QBVA 2ODBA 3DM5A 1PLLA 2QMUA 4AI6A 2QL6A 2RH5A 1F6BA 1AZTA 1T91A 2VP5A 1OKKA 2C5LA 4FCTA 4LJ9A 4M1OA 1I4DD 5LBIA 1X1RA 5KSOA 2GAOA 3OZXA 1ZD1A 1XEWY 2OZEA 5FR1A 4ABYA 1E69A 2YOGA 4C30A 3CONA 1II8A 4B35A 5CYOA 5J4KA 2NZ8A 5K8TA 2RGNA 4BEJA 3K0AA 1E1RA 2H17A 3GLGB 2CL0X 1W4RA 4ZV4A 2C8VA 3B1VA 2WAYA 1G20E 4URZR 4B33A 2IHBA 1T0HB 3BBPA 2HJVA 1P6XA 1N6RA 1AKYA 1KKLA 1UKZA 3LW8A 2JCSA 4Z51A 3WRXC 5M04A 4KCGA 1KDRA 1G3UA 2H57A 2UZIR 2ZS8A 1FFHA 5EXXA 2IT1A 3UMFA 421PA 2HUPA 1E79A 2VQSA 4LJ6A 5EQTA 4E09A 2JLUA 2PZGA 3A4LA 2HT1A 4TMVA 3EASA 4IFEA 3SNHA 5JZVA 5KNBA 2EFEB 2F6RA 1SKYE 3KXKA 4V03A 2FJUA 5J5CA 1XTJA 5FI1B 4DHEA 4X8OA 2WWWA 4KYUA 5AK0A 4D2IA 2ZI3A 1FPMA 1Q1BA 1ZAKA 2FE4A 2HCJB 2J5XA 1OIWA 3L43A 2IS2A 4HZUA 4NE2A 4CEHB 2YINC 1VCMA 4LZZA 4Y0VA 5IT5A 2W6ID 1IY2A 4A2QA 3UIEA 1IN4A 1Z0JA 3A1TA 3IHWA 2IYLD 3UMSA 4JYCA 1WRBA 4LK2A 4B3GA 4YMUA 1ZNYA 1DTSA 3I72A 1IHUA 2E9SA 5JEEA 3IO5A 1Q1QA 4MRVA 3VTKA 1S2MA 2ZRAA 2H8KA 4HEJA 5AUPB 2NG1A 1Z63A 3ZVLA 2HXYA 4TTRA 2CNWA 1Z6GA 4LC1A 5JJIA 2TMKA 2F3RA 2DWOA 5DI3A 4OKSA 1GDDA 3EC2A 4AG6A 1WCV1 1G8YA 2PCJA 3CPEA 4YMVA 3PENA 5AUOB 4KITB 1XJ0A 2JDIA 1XBTA 3AP1A 3WNBA 3EPJA 4Q03A 5GJVC 2V7QA 3FKSA 2G1JA 3ICEA 1R8SA 3VMFA 1R5NA 2C99A 3MSXA 5JSZB 1NLFA 3EW9A 1JB1A 2BBWA 2J7KA 1KI8A 1SVMA 2V6IA 4HLUC 3EG5A 1MRSA 4P32A 4BUJA 1CP2A 1G8FA 2ZI9A 3SS8A 3GEIA 2CLCX 1EGAA 3A1VA 4NYIR 2P5TB 1NY5A 3LXXA 4C7OA 1QG2A 1XD2A 3OEEA 3QKRA 1Z28A 3P26A 2A30A 3O8DA 4OHVA 1R2QA 1H8HD 4PC7A 2I1QA 4U00A 1G3MA 2ATVA 3EWSA 1JAIA 3WY9A 1QHGA 1XF9A 2BKEA 5EZ5A 3QEOA 2HYDA 1U2RA 4XTRA 3NVAA 2J46A 1NIPA 1YE8A 1Z8FA 5KSZA 2KB0A 3LA6A 2ZYVX 1GRNA 4ZPXA 1U98A 4OHYA 3KQUA 2CCJA 3EA0A 1XCMA 4TZ0A 1V43A 3K53A 3AEZA 3A1UA 3MWKA 4QHSA 4IVRA 5FUWA 3A36A 3SYKA 2Z4RA 3BB3A 4HAYA 4DCTA 1ZJ6A 5DSZA 1U8AA 4A9AA 1BYIA 4PHTA 2ERXA 4C0LA 121PA 1XZQA 1TF2A 1RFLA 5D3MA 3I92A 4PQRA 4PXAA 4NKRA 4PO9A 2QE7D 1IY1A 3EX7C 1OXTA 1DOAA 1NY6A 1SKQA 4OJKA 1ZINA 5AJZA 1G3QA 5FTJA 1KI6A 2JLVA 1ZU5A 1ZP6A 1N5JA 1CLUA 3ZQ6A 4MQBA 3T35A 4IXNA 4Q1AA 1Z07A 2F1HA 1VHLA 5G41A 2EVWX 2A5YB 2CJWB 1NMXA 3OESA 1NSFA 4EJSC 4M9ZA 1E9AA 1P2UA 3TH5A 1VCNA 3PIRA 3TR5A 3KKOA 5UKDA 1ELOA 3AF1A 2ZAMA 4S2EA 1L2TA 1D5CA 1P73A 2VP6A 5L3SA 1KZ7B 4G5QA 2Q9BA 3QG5A 4HB3A 4MGKR 2RGXA 4IVQA 2RMKA 2ZAOA 4Q4AB 2WSSA 2WWHA 4GRAA 1E0KA 1CU1A 3LDAA 5DISB 2IYZA 2AX4A 1E1QD 2D74A 3QKSA 4HAUA 3RWMB 5JRZA 2V3CC 5L3RA 4XH9B 1WP9A 3Q85A 3BGWA 5EP1A 1Z2CA 4DWJA 1YKSA 1FTSA 1AGPA 2XITA 2ZVPX 2D4HA 3FTQA 3RDPA 1ANKA 3FE2A 3PV0A 3GQBA 3E1SA 4TMWA 4ZIRA 1JQLB 4ZO4A 2ZRLA 1L8QA 2FFQA 2CHQA 3K9LA 1D6JA 5B30A 2ZI6A 3F5FA 4ARZA 4LHYA 3IKJA 1VCIA 4RD1A 2VEDA 4Q1BA 2IYSA 4PHFA 2ZXUA 2WTUA 2F43B 1S9DA 4US1R 1FX0A 5JRJA 3F3YA 2D06A 1ODFA 2JA1A 4EPTA 1YZNA 1P7CA 1IBRA 1N6HA 5FOXA 1VPLA 3P20A 3T1QA 3S1AA 4IDNA 4HLDA 1OF1A 1I4TD 3B8HA 1KI3A 2QEQA 4NU0A 2DWPA 2G9NA 2R6FA 2G0TA 4LC0A 1NVXQ 4LV6A 1G7CA 5B58C 1J90A 3T1TA 3NH9A 1NN0A 1W0JD 3HR7A 4Q00A 2AWNA 2W00A 1TUIA 3LQQA 2B6HA 4TT3D 2Q21A 2IX3A 4LYAA 1PLKA 2XNDA 2VSFA 1W5SA 4BE7B 1UEIA 4W7SA 1HH4A 2OG2A 3RHFA 1TUEA 1YZLA 3LO5A 2RGGA 4BZXA 4B44A 4KFTA 1XDBA 1RYFA 1A5TA 1LV7A 3N2EA 2D2EA 3LBHA 3AP3A 5LB4A 1KK3A 4JKIA 1KAGA 4N3NA 4RKEA 2IYTA 4FMDF 3TVTA 2IF2A 3TUZC 4IOJA 3FMPB 1X8KA 1MRNA 4TL7A 4Q9KA 2PEZA 3X2SA 1A7JA 5CLLA 2PT7A 4D25A 3O8BA 3ICQB 1IN8A 1M7HA 4L9WA 2H18A 4U7DA 2FG5A 2G3YA 2ZE7A 3I8SA 1FZQA 3RS4A 2Z5FA 4R71A 2Q3FA 2J0VA 1ETUA 4RY2A 3ZVRA 1JBKA 2QSZA 4RSGA 1KDOA 4NP6A 1UBCA 1SVWA 4YXWA 5L3QA 4DCSA 1YZUA 2A5GA 2HCBA 4N0DA 4S35A 1JR6A 1KMQA 4UNSA 1R5BA 1NRJB 2YJTD 4FMBB 5IK2A 3SYLA 1J8MF 3M6AA 4Z54A 1UJ2A 4PQYA 5DN6A 1F60A 2PT5A 2OXCA 3CPHA 4QJ4A 1KY3A 1OE0A 2VP4A 1TF5A 1G5TA 2WJJA 2ZANA 3B9QA 2ZI7A 4PHHA 4CDGA 1DAIA 1TPZA 3KKQA 2WKRA 3G5UA 1OH7A 2HDNB 4HYYA 3LRPA 5GVRA 3RLFA 1E2FA 2ZRFA 1OSNA 2Q6TA 3DL0A 5DIFA 1D8TA 4RFSA 4QJ3A 3ETLA 3GJ8A 5KNCA 4HB0A 4LUCA 1RPZA 1UM8A 1QG4A 3TW8B 1NNEA 1XTQA 1KY2A 2A7QA 2B21A 1E98A 2V1UA 4Q9LA 3ZJYA 3IQXA 4PAOA 1G7TA 5AWFC 3LVQE 1ZU4A 4YMSA 3NIBA 2F9LA 1DG1G 2RKOA 2QT0A 3AKDA 4PPFA 5C1BA 2VL7A 3THXA 2BV3A 1JALA 2ZSBA 2IYUA 2I3BA 4XTCS 3VR6A 3R9XA 4DDWA 4EPXA 3K1JA 1EFHA 1G5RA 1C1YA 2GXSA 5EUMA 4ZI3A 5JFGA 1AIPA 3LX5A 3W3AA 4RCYA 1ZIOA 2ZU6A 3VKWA 1WBBA 1ZCBA 3HU2A 5CITA 4Z8YA 1S3SA 5JJLA 2ZRKA 2QA5A 4P31A 3QF4A 2D7DA 4G0NA 4KLZA 2VPPA 5KOYA 4TZ6A 4O2RA 3MCAA 3RSLA 5FOVA 1W0KD 1CJUC 5FL7A 4C0QC 2O8EA 1E32A 1KK2A 3WRYC 1SVSA 2BHRA 1TNDA 3KTAB 3TNFA 5JCZA 3I8XA 3ND9A 4ACAA 221PA 4JLPA 1F2TA 1F2UA 5H1YA 1G64A 2V8OA 2ORIA 2EWVA 4DDUA 1ZC4A 3C15C 4G5OA 3AGQA 3DM9B 3PEUA 4A82A 2IUUA 3I5XA 4U5XA 5DO9A 4AKEA 2FDCA 2O0KA 3KB2A 1RJ9B 2Z83A 3AKCA 3G82C 3MJRA 3BERA 2J7PA 4AKIA 4Q9IA 4RKFA 3ZZ0A 4UXJA 2F7SA 3GCGA 3AB3A 2YKGA 3KX2A 4Q1FA 1FTNA 1FP6A 2CE7A 5EE1A 4KBFA 5HKKA 1HT1E 3BAFA 3OIUA 2ZUBA 3THWB 2B8WA 4TQUS 5ANRB 2WPDA 3C7KA 3IPYA 3ZVNA 4JL8A 2ORVA 1P2TA 4MA4A 4B32A 2FFHA 2H1LA 2OSBA 2XAUA 4B71A 3PCRB 1FQKA 4CVNA 5CLQA 3RS2A 1NBME 1RKBA 4W5JA 3CNNA 2GK6A 4J0QA 4GOJA 3FFAA 2WVJA 2ORWA 4ITRC 4EJSB 2W0MA 2GF0A 1KJZA 1KZGB 3CRMA 4H9GA 1G7RA 1UKEA 3OHMA 2FX3A 2CDNA 2DFLA 2QM7A 1GL7A 5B57C 3CBQA 4KV9A 2O8CB 1GP2A 1CR0A 4QL3A 3FOZA 3ASYA 2ZIAA 1E94E 4M2LA 3VHLB 4Q4HB 3KFXA 4QGFA 1LY1A 1Z0AA 1OLOA 2OILA 4LWZA 2XJ4A 1DARA 1FQJA 3QKTA 3QUSA 3RANA 4A0GA 4Z1MD 5CDFE 1NJGA 5CJ2A 2VBCA 4QM6A 3L0SA 2HXSA 1XD8A 3EA5A 3PUVA 4AD8A 1DO0A 3QVUA 3IBYA 3TBKA 2GZDA 3IQWA 3KQKA 2VRWA 5FBVB 2REOA 4LHWA 2J1LA 4OL0A 4GOXA 1QHHB 3KXLA 4PPGA 1XPUA 2GDJA 1GWNA 1E0AA 3KUDA 1HQCA 3NWJA 1KYIA 5A5GA 4DDTA 3SBEA 2FSIA 2QP9X 3WBJA 2Z6VA 1ZM3A 4NYJQ 4A6PA 4II7A 1FMJA 3PVSA 1VKJA 2PJRA 1W4CA 3CH4B 4L15A 1XMJA 4ON9A 4PC1A 1UKYA 5FH9A 2QT1A 3CO5A 4PPQA 2NGRA 3TQCA 3AVQA 3BS4A 1SQ5A 4GZLA 4D4JA 4PO1A 2RGNC 4OK6A 1E4YA 1T0JB 3THYB 4P4SA 4URVR 1KO8A 2CXXA 2V9PA 1N0WA 5KSPA 2JLYA 4Q5IA 1COWA 2GNOA 1NBMD 3ND8A 5E3HA 4IOLA 2W2TA 1J70A 4OK5A 5FTNA 2R6GA 4OQNA 4MGYR 4Q4JA 5EJEA 2FN4A 1XCPA 1QRAA 4POAA 2WICA 2ONJA 3WP1B 3TRFA 3FB4A 1KK1A 2ZR7A 2AN9A 4MYUA 2X19A 1SXJA 3ZH9B 3GFTA 1M1YE 1GZSA 4FWIB 4ZKEA 2XZLA 1M7GA 1X3SA 3ZYCA 1SGWA 4WBSA 2QORA 3MUFA 2GJKA 1XEXA 1XX6A 3NBYC 1Z06A 3VKGA 4Q48A 3W8NA 2IYWA 1CBUA 3R7WA 4Q1CA 4AURA 2ZRMA 4M1TA 3CB4A 1HV8A 3SYNA 4D82A 1TQ6A 2NO0A 1KMHA 2BBSA 2DPXA 4V02A 2VTKA 1TAGA 2RHMA 4L16A 1A1VA 3OFND 4DB2A 3BC1A 3R8CA 2QZ4A 4IDOA 4M53A 3VU9B 2BOVA 2GCPA 3RS7A 1K5GA 2JLSA 3TIFA 2HF8A 3BRWD 3GLFE 3IIKA 2J0SA 5HCNA 3T12A 2P3SA 3OIYA 3QXJA 4DVGA 2OEPA 4JVNA 4B6EA 4B3XA 2Q9CA 2QY9A 2GVDC 3OE7A 1MO4A 4QOSA 2W58A 4MKHA 2ZYUX 3QIAA 2B8TA 2VF7A 4LI0A 1NLYA 3GLGA 5FOWA 4DLUA 2IEZA 2BMDA 2D7CA 4A36A 4DLYA 1OW3B 1MOZA 2IUSA 4D26A 3I62A 5G40A 3K8YA 3O8CA 3WHKA 2DFTA 4QGGA 3A8TA 1WMSA 5KPJA 4CEJB 2CCGA 1OIVA 2ATXA 1VG9B 4JYBA 1KNQA 4TMTA 1MABA 3QE0A 1E96A 1Q1ZA 1M34E 4LJAA 3SFVA 5EXSA 4TYQA 4DJTA 2AD1A 1XRJA 1RE0A 2FH5B 3AF4A 1E9RA 1JEEA 3DEFA 2LWIA 1G21E 4GZMA 4IJMA 1G6OA 2ZRPA 2W6IA 1GAJA 1P75A 3QSYA 2ZRGA 4EIWA 5FOUA 1QBKC 3CNLA 3GLIB 2IYXA 5G53C 3DHWC 2CLDX 3IUYA 1GNQA 1RW4A 4CEHA 2PEYA 4JLVA 1OXSC 3X1YA 3KFVA 1MT0A 4G01B 2DFNA 1B0UA 1Z08A 3DMDA 3KQLA 1FNNA 5SZJA 4DCUA 2ECKA 3GJ7A 1YZGA 1ZMXA 4GBMA 1U9IA 2VIIA 4B75A 4MKIA 1NF3A 4V0KA 4X8LA 4E22A 2FSHA 1KI4A 4DSOA 3U2QA 5JEDA 3U6KA 1Q12A 4RD6A 2ZRNA 4OI2A 4A2PA 4LJ7A 4DLVA 4M21A 2F1JA 1R4AA 1UBEA 2WSMA 2ZE5A 2ZRHA 2GWHA 3DPUA 1KGDA 1YZTA 4A15A 1CF4A 4ESHA 4KXFB 1M7BA 1P62B 1KO5A 1XU4A 3EXAA 3RRMA 2YWHA 4XOIA 4D81A 5JSZA 5K8LA 4C0HA 1ZM9A 1P5ZB 3JZAA 5F3WB 2C2HA 3QBTA 4Y0AA 5BN3A 2Z0MA 2UZ3A 1XMVA 3FMFA 3K0EA 3KB1A 1N6NA 1R0XA 4JBWA 1G3RA 2R6AA 1LNZA 4OI4A 5E95A 4DT1B 4MRSA 1EXMA 2QRZA 4M1MA 1VYVA 3I1FA 3T15A 4HI0E 2KSQA 2FPKA 1RZ3A 1WDTA 3SJZA 4V0MA 1OH8A 1R0ZA 3T1OA 3EAQA 3PQCA 3KJGA 4LJ5A 5AR1A 5TY0A 3M0EA 4NYJR 2QENA 3VX4A 1OFIA 2YHSA 2Q9AA 2UKDA 4US0R 2DYKA 4PO8A 4A4DA 3AGPA 2QAGB 3A58B 4ZCIA 1XXHA 1G7SA 4BLPA 1G41A 2Y8EA 1A82A 1ZNZA 4TSFA 5TDHA 2WWFA 3BH0A 4IVPA 1Z3IX 4AIIA 2FEOA 3QPWA 1P3JA 4QNMA 2ZROA 2HV8A 1N6OA 1P4SA 1P72A 4KVAA 3SJAA 1IN7A 1K8RA 4W9MC 5P21A 4NCKA 2IK8A 1AKEA 4TWZA 4AWXA 3KDSE 1FL9A 1HUQA 3T34A 3AVOA 3UATA 1U0LA 3BJIC 3DDCA 1IN5A 1QDEA 1HEIA 4TYPA 5BW8A 4DDVA 2GTPA 1AK2A 2XJ9A 1QHSA 3PJRA 2CJWA 4B6FA 1DAMA 3WNCA 5IDVA 4LRWA 2GBLA 3VR4A 1E9SA 1RRGA 1UBGA 2Q0HA 4WOPA 1VDZA 4JT2A 1GRRA 4M0LA 4JBXA 2OHFA 4EQ6A 1QZXA 3OEHD 1KI2A 3IIJA 1AZSC 1ZM7A 4M1WA 2ZSFA 4NYMQ 3QQ5A 5EE5B 2BIFA 1SKYB 3GFPA 3FKQA 2XTZA 2XSZD 4C0KA 3FHCB 4UNPA 1U94A 3BOSA 4B2IA 4D80A 1A2KC 2HLDD 4ZDJA 2ZJ8A 3K0SA 1II8B 6Q21A 3IEVA 2R9VA 2F3TA 3K0AB 5GVSA 1LTQA 1W36B 1W4BA 4KFRA 3REGA 1J2JA 2JLXA 3C16C 2QUZA 3GLHA 1FUUA 3TSOA 1WBDA 3A37A 1AQYA 1S3GA 2PL3A 3AKYA 2YV5A 3R20A 4K46A 1XTSA 2O8FA 3AP2A 4MYHA 1H65A 1M74A 2FV8A 2FNAA 3CRRA 5FBWB 4DUGD 1W36D 2RHDA 4A8JC 1FNMA 2R6CA 3RS5A 2O5VA 3ZIAD 4KYIB 1DAKA 1Z22A 4PSVA 4QBIA 3RABA 3BH6A 1Q20A 1TF7A 4JLJA 4DIDA 2PMKA 3E70C 4BGDA 4HUQA 4MUBA 4QFMA 5GJCA 1W0JA 3VFDA 3BB4A 2IYQA 4LHZA 721PA 5HZHA 5BWMA 1KJWA 2ZI4A 4M4SA 4TQAA 1OXUA 1MO5A 1BMFA 2BKUA 2GXUA 3U7HB 2HYIC 1W2GA 5FOTA 2OESA 3N2IA 1W7AA 1OFUX 3UG6A 2RGDA 4HDCA 5AJYA 4BEBA 4DBLC 1W44A 2ZRJA 4RJLA 4HAZA 1ZIPA 1NJFA 1N6IA 4LV8B 2PLFA 1OH6A 4L5BA 2A5DA 4QC2A 1UF9A 4LJYA 3RNLA 2QBYA 4HSEA 4PQFA 3RYTC 2C77A 3L8ZA 3WYFA 5J4LA 2Q3MA 4TL6A 3TGPA 1W49A 3BD9A 2BEKA 2IS1A 3NC1C 2GESA 1DAFA 2NO6A 4BASA 5DLQC 1E2EA 1WB9A 2DHRA 2CNWD 4RD4A 1N5KA 3PUZA 3MWLA 4JT4A 1CTQA 3UK6A 3QENA 4MKGA 4L8GA 4LYFA 1UEJA 5DNYB 4XD7A 1ZCAA 3PFIA 4DCVA 3RS0A 1G17A 4C7OB 3AH8A 1XD2B 2B7BA 3QKRB 5FOSA 4NDZA 1GSIA 3VR1A 4P4TA 4TQ9A 2RB4A 3QG1A 4BRWA 1E2GA 3CIOA 2IWHA 1EESA 1E9FA 5CJPA 4DB4A 1FMLA 4CT4B 1JJ7A 1G291 1CJMA 1Z6TA 3OEED 3RS3A 2O8BB 4IDHA 2G6BA 1UADA 2PX3A 4HUTA 3Q9LA 1YQTA 1JXOA 5BYJA 3U3OA 4KFSA 3SEAA 5G3YA 1GRQA 2EU8A 5DGXA 3UANA 1HQYE 2C96A 4KO8A 4WZAE 1R7RA 2ASEA 4BZPA 4AYTA 3K09A 3KL4A 4AY2A 1U8YA 4TL8A 2ZYWX 4B47A 4Q18A 1P9NA 3GFOA 4BLQA 1HURA 1KO1A 1G4AE 3EZFA 5H8WA 4YMWA 5FUXA 4FINA 5D3MB 1JR3A 1NN3A 2J0UB 3QJYA 4H1VA 4NTZA 1P2VA 3J81k 1KTVA 3GEEA 5D3QA 2GETA 2J87A 2MSCB 3IPXA 1KI6B 5EUQB 3B1XA 1PV4A 2ZREA 5H70A 3ZD7A 1XFAA 3CKLA 3AVYA 4FCWA 1E2QA 1WE2A 1A2BA 1OV4A 2YC2C 4YQFA 5FBRB 3BH7A 3EPHA 3E2IA 3LD9A 1Z0KA 4BWYA 1F5NA 1W2HA 4P0TA 1X86B 2GCOA 2NZJA 5HZKA 4TLEA 4PAQA 2ZSDA 1EFUA 1DVRA 2WOJA 1W0KA 4UXHA 5FR2A 3U61B 3EZ7A 1IQPA 2NTYC 4D4KA 4JVSB 4Q9HA 3HYTA 1E0SA 4C0BA 3W9YA 4BLTA 4NPHA 3QPVA 2ZTSA 2K5UA 4YDHB 1QHYA 2XTNA 4LYJA 4N0EA 1CJTC 1SVOA 3LWNA 2O0HA 3B1ZA 1CJVC 2XGJA 3KTAA 2V1XA 3LAWA 3W5JA 2ZS9A 2ZVQX 1E9DA 2OXRA 1G19A 1MH1A 3QKSB 2IL1A 4FN5A 1UFQA 5HR5A 2FU5C 1Z6XA 3VNUA 4Q7MB 4NYMR 2YYZA 5FPSA 2BJWA 1E2IA 1BOFA 1R0WA 1AA9A 2J45A 4LDJA 1XTIA 3B60A 1BKDR 1Q0UA 2IXFA 1G8HA 3VKHA 1T3HA 1O87A 3REFA 3BWDD 1K5DA 1DEKA 1TU4A 3KQHA 4YLGA 5KYKA 5C46F 3BFVA 4RZ2A 2WWXA 3ECCA 2JEOA 1T3LA 3NXSA 4ARZB 1Q1EA 2ODNA 1JI0A 3VHXA 3ZGXA 5B2ZA 3IO3A 2JJ1A 2VHJA 4YONB 1ZD8A 4MKFA 4A6XA 4JJKA 3KJIA 1FX0B 3L0IB 2PZEA 2J41A 4D4LA 3KZ1E 2WAXA 2XNSA 1YRBA 4FWTA 2GJAA 2P0EA 4K8OA 2IA5A 4P33A 2X77A 5A0FA 4XJXA 1UAAA 2FOLA 2QQ0A 3C5CA 4JKYA 3TQFA 3JVVA 4QGAA 1W5TA 5BQ5A 3CR7A 4Q1DA 5C4GB 3E5HA 4EKDA 2EFCB 3K0FA 4HZIA 4B3CA 3U7GA 2XOKD 2EYUA 3SHWA 3VR2A 2N1BA 2FGKA 1EX7A 1VTKA 1ZRHA 2OCYC 2OAP1 3HU3A 4Z1MA 1N3BA 2O8CA 3PXGA 4DLZA 4MDEA 2GJSA 5CM8B 2BMFA 1TQ2A 5G3ZA 2YWGA 3GJ4A 4CW7A 1KI1A 4OK3A 1SXJC 1E2MA 1K6MA 1UDXA 1NN5A 4EDHA 1GNRA 1US8B 2CBZA 2DWQA 3Q5DA 3FGNA 3GPLA 1OFTA 2A3RA 3C8UA 3T5DA 1Z6YA 2RGAA 4PR0A 1Q3HA 1QHHA 3PEVA 2MSDB 1YU9A 1I2DA 1S9HA 2BBTA 621PA 2WJHA 2UVQA 2J59A 1GILA 3R9IA 3KJEA 3WYGA 2V54A 4A8JB 4NHOA 1LW7A 4CEIB 3GJ6A 4HDQB 3ONWA 1WXQA 2XB2A 4LCBA 2RGBA 2VP9A 4QGHA 2FF7A 4MITA 2R44A 1CS4C 5TVKA 2AFIE 2YOFA 3O47A 4DSNA 5JECA 3ZD6A 4MGZR 2JJ8A 2WWGA 3THYA 4BFTA 1DO2A 1HY3A 3NHBA 3A6PC 3DKPA 3QXHA 1TEXA 4FMDB 4O2LA 3AF2A 1DPFA 1NG9A 821PA 5J4HA 1KSHA 3RC3A 4Q21A 3TR0A 5IK2D 5FPTA 1IXSB 5JS7A 1NI3A 1JQJC 5CIQA 1NL3A 2VHTA 2ZUCA 3LY5A 1TEVA 4BECA 5DN6D 4RZ3A 5JI3E 2JLZA 2CK3A 4RFSB 2YNMA 1T9HA 1E99A 4DXAA 2P67A 2QROA 1PZNA 3LV8A 3ADKA 4GNKA 3TJZA 5JHGB 1XMIA 2DY1A 3C41J 3TLXA 4LV5B 3R8FA 4BZQA 4GP7A 1VECA 3U4QA 2KI5A 3U60B 1JPNA 1OXXK 3QXSA 2R2AA 3VX3A 4G5SA 2KE5A 4KVGA 2JIZA 2EFGA 1T3SA 2P6UA 4MH0R 4EUNA 3IDQA 1EFRD 4Q47A 4TLBA 1JNYA 4TN1A 2H16A 4RFVA 1XZPA 1XPRA 3KKNA 4B43A 4DIEA 1U9IC 3NH6A 4KLNA 2HJGA 3EPKA 3QF7A 4TTQA 3VU9A 2DBYA 1PJRA 3QF4B 4I1OA 2XXAA 3EIQA 2OBMA 1OYWA 2OCAA 4NMMA 3ZS8A 1G1MA 3UG7A 3NEYA 3QXXA 2O8EB 2OBNA 3EZ9A 1IJEA 4FXPA 2FSGA 4I4LA 1F2TB 2QN6A 2ZS7A 3Q5EA 521PA 1Z0DA 4BFUA 1NVUQ 1HA3A 5J4YA 1GKIA 3WMGA 1SHKA 4KHZA 3BE4A 3CF6R 3CRQA 2OM2A 3CUEF 3RC8A 1Q57A 3P1JA 2O8DA 2PX0A 4ZDWA 3FYHA 1AJEA 3LLMA 4KSCA 1W48A 5CYPA 3TW4A 2ODWA 4TLDA 4DRZA 2C04A 2W6JD 4G5GA 4R2IA 4OJQA 5DI9A 3OAAA 3GJXC 5F9FA 1XB2A 2PLRA 2ZJ5A 4K81B 1NKTA 2YVUA 3U44A 4JMPA 3X1XA 4FCVA 4XSGA 4KSBA 3NHAA 3KKMA 4MGIR 2ZJOA 5EP2A 4GMDA 5E7JA 4EFLA 3AF0A 3UPUA 1TADA 3AQ4A 1CULC 2QTFA 4GMXA 5HKKD 5EXPA 1E9EA 4IDQA 1VMAA 5CB8A 1G8PA 2WKQA 2C9OA 5KSYA 4KU4A 3TAUA 2FSFA 4QJ5A 4B74A 4N1AA 1D9XA 3V00A 2I4IA 4OYHA 4P4UA 3CWZA 1T4GA 3F0TA 3N5CA 4JLBA 4IEIA 4C9BA 1MO6A 2NPFA 5EZ6B 3U3RA 3PEWA 2VP0A 1E2DA 1JEDA 3ADDA 2NQ2C 3GP8A 3CF2A 2O0JA 4LX0A 4ZKDA 4EFMA 3SQWA 2QPAA 3EC1A 3I5YA 4EAQA 2QQEA 3CX7A 2IS6A 3QVVA 1AN0A 2QMOA 1GKUB 2MMGA 2LKCA 5EP4A 4PX9A 1XP8A 5B64A 2IWRA 3W5IA 1Z6AA 4M9SA 2IS4A 4TLCA 3THOA 1B23P 1SXJE 3RRZA 3LNCA 1CR4A 2ZSAA 1NIJA 1XEWX 2W2VA 5TXGA 4F4CA 3B7GA 3K0CA 3A1WA 3ZZUA 5JHHB 2BMJA 4OHWA 1X1SA 2AKYA 4DT1A 4FD2A 2RGEA 1KSGA 1N25A 3CRW1 4C0AC 3K70C 3CRVA 4DSTA 4HB4A 4M8NE 4BFYA 1EWQA 1SVKA 4I81A 2EFDB 2OLKA 4I99A 5CM9C 4OHZA 3ASZA 4OBEA 4EPRA 5KPDA 3X1WA 2ANCA 2VHCA 3MD0A 4ZI2A 1P9RA 2P2LA 4LBWA 2IUTA 2AL7A 3AVUA 4P4SB 5FPHA 3LQRA 3QXCA 1T8TA 3BORA 4KODA 4AK9A 2KBFA 2QAGA 3MFYA 2WBLC 1R8QA 1E2PA 2H92A 3NBFA 3WYAA 1Z5ZA 3AVTA 4NCJA 3GLGE 1ZUIA 3P4XA 1YHNA 2ZETA 2L0XA 1QHNA 3QKUA 3QNUA 3U7FB 4LGMA 2C98A 2GRJA 1IAQA 3L82B 1YR7A 4Q4JB 5FPYA 3GLFB 4AKGA 5L8VA 1COWD 5FTKA 4QM7A 4DLTA 1NLZA 4LYHA 5KDDA 3H0KA 5TMPA 5HTKA 1XPOA 3G0HA 4LPSA 4YMTA 2QM8A 3Q72A 2B7CA 2ODEA 3HWSA 4QBGB 5CIWA 3WMEA 2GXAA 3ZS9A 2FZ4A 3BFKA 5KDLA 4EPYA 1N0VC 5BN4A 1OXVA 1W47A 4TYNA 4Q1EA 3CR8A 5JS8A 3NG1A 1YZQA 1EK0A 1XEXB 1KSFX 1G6HA 5CK5A 3SOPA 3R7WB 1BYUA 1ZD9A 2GJ9A 2QTVB 4GPTA 3P32A 4HAVA 2OFOA 3EPLA 4ESVA 4HLQB 1M2OB 3EIHA 3DO6A 3WHLA 4PZLA 1G18A 1H8HA 3DMNA 4O3MA 2XSZA 5LDDC 3Q8XB 2QI9C 2ZRIA 3VQTA 2HLDA 3CM0A 2OFXA 1DBSA 2IW3A 3K9GA 5CB6A 1OHHD 1E6CA 1LB1B 3PUYA 4O25A 4WZ6A 1U0HC 3WBKA 4BRUA 2ZQ5A 1D2NA 1KHTA 4GP6A 5GJBA 4M1YA 1Q3TA 3GJ5A 2IC5A 4BFVA 3MRSA 5JI2E 4GOKA 3CW2A 2G88A 1II9A 1SVLA 2N46A 4DUGA 4F91B 2JAQA 1T6NA 1Z0IA 3GD7A 4ASUD 1YVDA 2VLIA 4JLKA 4BPBA 2YWEA 1CXZA 1QF9A 3SBDA 1PUIA 2DFKB 3IILA 3ZIAA 1VG0B 3OE7D 4F7WA 1N6PA 3B6EA 1T8UA 5FUYA 3TE6A 3AUXA 2QE7A 3CX6A 3T06B 1E2KA 2A5FA 4RD3A 3MWYW 2BM1A 3IIMA 1AM4D 1MABB 2AR7A 1ZUNB 4IW3B 2XZPA 1JJVA 2JJ2D 1ZW6A 4MYTA 3FVQA 3MJHA 1GIAA 4GT1A 3BB1A 2WZQA 3RVBA 2NO1A 3I4LA 3R9WA 2CE2X 2FMXA 1TQDA 4DKXA 1NN1A 3GJ3A 4EFNA 3HDTA 4V0ME 4ERNA 1U8ZA 3PG5A 4AC9A 3K09C 1E2NA 3B82A 4EPVA 4PPNA 2WV9A 1NKSA 2BMEA 3NC0C 3K9HA 3V9PA 2XB4A 3KXIA 4ZCLA 1D9ZA 4BFZA 4US2R 5J40A 1EWRA 1H8ED 3TAHA 4BLOA 1I4LD 4UXIA 2FPLA 5LPNA 1XXHE 4V0OA 1R5OA 5JWRA 1GL6A 1RC8A 1DADA 1E1QA 1G5PA 1KOFA 3DKVA 3W3ZB 4GDFA 3OF5A 2OT3B 4W5HA 1J8YF 1KI9A 2QNRA 5TV2A 4Q4AA 3D6TB 4I1VA 3L0PA 2V55B 3PEYA 1NVWQ 2E1RA 2GVZC 2PJZA 3U6BA 1C4OA 1S4QA 4NBSA 4WXRA 1N2CE 2G0NA 4QRHA 5LD2C 5EXTA 3NBXX 2BJVA 4KFUA 1TU3A 1II0A 1OKKD 8OHMA 3FHOA 2ZE8A 3KUCA 1BO6A 4TTPA 1CIPA 3C14C 4CYMA 2F55A 3B5JA 2ZJYA 2LCFA 5IRCD 1NVVQ 4A0FA 5C4MA 5JJKA 4B3FX 3BK7A 3MG9A 3NDPA 1IN6A 1E1RD 2WHXA 3D31A 1RVDA 3PITA 2BDTA
chains in the Genus database with same CATH superfamily
2E6KA 1N1EA 2GN2A 5C18A 4JV5B 1XZIA 2BBOA 1RVV1 1IQUA 2RGCA 2FK8A 3CH5A 3ZLBA 4ZHQA 3RVPA 1RT9A 2UUPA 5DYNA 1DTWB 2F43A 3BSFA 1I2MA 3FFWA 1JAYA 3DD1A 2CHGA 2D3WA 4BX0A 1ZC3A 2R8PA 3HA5A 2R7KA 1EE1A 2Y1DA 3PRYA 2QPLA 2DLDA 2BE9A 4MWOA 5C5DA 4P5EA 4CQNA 4UAUA 1QH8B 1XXHB 1Y33E 2OHHA 2OWEA 3RUDA 3G9ZA 4CG3A 4ZZ1A 4LXIA 3TMAA 2W5UA 5ALPA 1GITA 5E4FA 1LPAB 3PU6A 3RWOA 3VPFA 2Z8XA 2VH5R 2ONKA 4HAIA 3GLHE 2OV2A 3H05A 4ND4A 4PLWA 4UUPA 1XRLA 4E32A 2CB0A 4ZEWA 1PYOA 4K86A 1M8FA 4DLWA 3ZHSA 5IBCA 4B2PA 4DDKA 1NXPA 2AJTA 4Y7CA 5A9RA 4YRMA 1H9CA 1R0YA 1HT2E 3SOZA 4Z8XA 1CUWA 2B1QA 3GUHA 4TMKA 4CV0A 4L9AA 1P5JA 1XEFA 1U5AA 1R6DA 2GPBA 4LJLA 5ELLA 5EINA 2FPGB 3UK7A 1E2UA 4JSTA 2TSYB 2Q1TA 3BREA 2ADFA 5AD1A 1G2OA 4JYMA 6REQB 1UPUA 1DJNA 4FP9A 1SUWA 4AMZA 3PC7A 1P74A 4HNGA 4JBHA 1KYXA 3AOEC 4XWAA 1DC8A 4DEYA 2WTMA 4OM7A 3C8ZA 1N75A 5H9WA 1D07A 3UJCA 3C7AA 1P17A 1QFMA 3EYAA 5F7ZA 3NBQA 1RIIA 3AB8A 1IWOA 1KERA 4MWTA 3OMLA 4EPWA 1NBWB 1C0KA 1X2BA 5EKSA 1TK3A 1Y1PA 2F90A 3UJDA 4EB3A 2XNCA 3ORYA 2WRZA 1JHDA 4FOOA 4C3VA 4MK4A 1N9ZA 4DV2B 2L18A 2LKDA 3GCXA 1KH2A 1ZBDA 2GN1A 1P60A 3WB9A 3CXRA 3F90A 3FKSD 3O91A 1ZIXA 2VDMB 2VUSA 4IJVA 4NZYA 3SXPA 3UOWA 4EY6A 3R77A 1ZM2A 3HG7A 2WFAA 1YE5A 4EMBA 4CETA 1JU4A 1NW9B 3I04M 5D00A 3Q6MA 4HNAA 4MSUA 4E2ZA 2ID7A 3Q9SA 3QX8A 1Z4IA 3DLIA 4NH0A 1SELA 4ZHSA 1VIAA 2IBSA 2FEKA 3K70D 5A6SB 5FUVA 3C3JA 3DQQA 3V2IA 1KOLA 3W9BA 4YB8A 1EP2B 4B48A 4NONA 3SR0A 3GLHB 1RXYA 3O90A 5HCIA 1HYBA 1YV9A 2E37A 4R0NA 2Q3EA 1XWFA 1RQGA 3LTEA 2AJDA 2X2FA 3H1TA 1E9BA 2MOKA 1DT3A 3O38A 2JKVA 3M1AA 3Q7PA 4MA5A 4QG3A 2BFDA 1X19A 5FF9A 5F9HA 5SICE 4FDMA 3A0RB 3VOBA 5LN1A 3UWKA 1D2HA 1EZ1A 2D0PB 2QPTA 1LFDB 3W7BA 3CTPA 4C0JA 1QQAA 5J2UB 2QTLA 4TVOA 5B1HA 2C95A 3I0MA 4HRAA 3U3ZA 4D0GA 3D2BA 5FKJA 4GMKA 1J4AA 1TTHA 4EFKA 2HHHB 4WY2A 1A8PA 1P7PA 4WH0A 5CFNA 5FBLB 3O84A 4M1KA 2YC4C 3R0VA 1OLXB 4KV7A 3EC7A 3EXFA 2XUGA 4UDOA 1SULA 4TLAA 1UDCA 2PRIA 4CIDA 5HF5A 3FBWA 4JJ4A 1C1HA 1BQEA 1IXZA 4PFKA 3FLAA 3UJ6A 4ZCMA 1WO8A 1EMDA 3IPCA 4QBFA 1RRFA 4JL6A 1TM3E 5HIKA 1FSGA 1GL9B 2VYVD 5BRAA 2H3EA 5DK4A 1E0JA 3M4YA 1GZ6A 1BMFD 4GOOD 4H3VA 1E1MA 4BFXA 4HLUA 4E30A 1E7YA 2CEAA 2CVOA 3LQKA 5JT1A 3GGDA 2ZSHA 4N7BA 5HTOA 3WWEA 3QE9Y 2XB9A 3DDHA 1DELA 2RONA 4PU0A 2PGNA 2UYOA 1GA4A 1OJLA 3ENNA 4IRUB 4TS3A 2I1VB 1E20A 3VC1A 4MW1A 2V1UA 3PPYA 3DXFA 5L3SB 3MOSA 3ONDA 2ZUSA 4UJ5A 4C4SA 4D4MA 3QEKA 3K9CA 5FUBA 3AJRA 2WYHA 3TLGB 3RBAA 1R9MA 1B93A 2B82A 1SH7A 3OE5A 4ZWNA 2BCJQ 1DIHA 3BCUA 3CR3C 3T7KA 4WLVA 3UMJA 4J0HA 4A0SA 4X93A 3LBNA 4A92A 4YV1A 5IJ0B 3NYIA 4RANA 4WCVA 4WAUA 4OQMA 1O58A 5HILA 8ABPA 4X41A 1MR3F 3TGLA 1O9HA 1QORA 1CKEA 2Q9UA 5E9JA 5LA6B 2OBBA 4IR7A 1K6EA 5BV7A 4GPAA 4ZIRB 1D2MA 1PJCA 3V4RA 3N2KA 1FIUA 4YTEA 1A4IA 3WSTA 1GV0A 2D59A 1VG8A 1W46A 1ZG3A 3PRJA 2GO7A 2QVGA 4HBGA 4LBYA 4A8JA 5A4JA 4XWKA 1QIDA 3U3MA 3ZJUA 2YBEA 2BFEA 1CQIA 2WVGA 1RWKA 5FPPA 2UUAB 1FTQA 4M9RA 2REQB 2E4YA 2REBA 1L5HB 4C6HA 2VFAA 2HI0A 2WTXA 1UZAA 3M5DA 1MKYA 2R62A 4XD7D 1AQ6A 2PUTA 1TA4A 4X3PA 2BN4A 2FQQA 3ZZTA 5HSGA 1EUYA 5JYDA 2WIAA 5JXIA 2K7ZA 3KUUA 3LXMA 1L4KA 5ELMA 3RRNA 4YCLA 1RMTA 3QYPA 3EVZA 3ICVA 4JLNA 4EW1A 2IPLA 5I51A 2G5CA 1L1RA 1C9KA 1N0UA 3HYRA 3ZZMA 2H3HA 4H77A 4PC6A 5K01A 1GGFA 2IF0A 4ACBA 2CL7X 2HK8A 4GYKA 3KC2A 4MDFA 3GAMA 2QXTA 2ST1A 5ALZA 1SFRA 3L9XA 1YHZA 2X4DA 5T6MA 1UP6A 1Q0TA 3I6ZA 3W8FA 3OT1A 2GK3A 2J32A 1EM8B 2QMEA 3MGCA 3UA4A 1ESNA 3GJ0A 3CZRA 4LTMA 3VAAA 1F8FA 4X24A 2WWYA 4Q4LA 3DW3X 4XSHA 4XJVA 1L5RA 1WMFA 3B2EA 5EQFA 4D9MA 2IY9A 5A5EA 3LBYA 4QYXA 1YCHA 4X3OA 4OY3A 1JSXA 3HXPA 2QRNA 3B20A 1EFRA 1XMPA 2VJOA 3EUAA 5JV5A 1YMQA 3NYQA 4N47A 1PVOA 4LRSB 1HE2A 1IK4A 2I7DA 4WNYA 1F38A 4ZU3A 4ZVSA 4BXOA 2JASA 3DOCA 2OMKA 3G5AA 1Z8NA 2CHUA 3WP0A 2PXHA 2XNDD 1QVAA 4JJZA 3QW2A 4PY2A 4UEKA 2REXB 2OZLA 3DWEX 3GEDA 3GDFA 3UTCA 4MB2A 4YAJA 3H42B 3ZI7A 1ZA2A 1FEZA 3OUUA 1A9ZA 2GCOB 2VA9A 4MVJF 4RGBA 4DCNA 4R1SA 1JFLA 1E2HA 2VO1A 5DHSA 2FXIA 2R65A 3LPNA 3SFZA 4DCMA 5CGZA 3N6XA 3NHMA 4MR9B 3PNYA 1IXRC 1CR2A 3QPCA 4Q9NA 4UPDA 2N42A 5DHFA 3VDRA 1KP3A 4F6RA 2C2ZA 2EIXA 2QMHA 1NDHA 4JWTA 3T7JA 4BAZA 1NTOA 4DKJA 1L4HA 2JCXA 2XTJA 1OZ0A 4M22A 5FPKA 2QP3A 3EAFA 1AKRA 3DGEC 2BDEA 3MZ0A 5HF8A 2JFZA 5BUSA 5IC6A 1PEYA 1RQPA 1HRDA 3ZDDA 3KOOA 2G8LA 1QSGA 2F8MA 1XYYA 4RVNA 4WN9A 1EB8A 1UJ6A 2VQ3A 2Q2WA 3L7CA 5L3QB 5C8VA 1CRPA 1JTEA 3C5HA 5BVHA 1TRHA 2WM2A 3EOBI 3DBHA 5KQGA 3SKXA 4HY3A 4BOYA 4MRRA 5JO9A 5L3VA 4TYWA 5HFAA 2JAOA 4LNUB 1M6WA 1F8UA 4Q7LA 4DCOA 4NZPA 2AQ8A 4MPDA 3AM5A 2BISA 2NZ2A 1PFWA 5CXXA 1CT9A 3HHPA 2PD3A 3ROPA 4Y8VA 2ZUDA 2V65A 2Z1NA 2XXAB 1LW6E 3CHYA 1UH5A 3MMPA 3UMVA 5DYWA 3MM4A 4TKUB 1RR6A 2VNSA 4X1IB 1ULTA 5EEGA 1L5MA 3TLMA 4FE3A 1L8LA 3I58A 1M2FA 4KPUB 4FW8A 4JI2B 5DP2A 5LXTA 4MRNA 3WZ2A 2SHKA 3H11A 1MZVA 4TKMA 3IGFA 2D2FA 2P0YA 2HPVA 3WYDA 4E13A 3RJTA 1UDWA 2W4MA 5MF6A 3ZHQA 2PCLA 1UZMA 4YC7A 2D5IA 1Y9AA 3C70A 3PFCA 1FLNA 4XD2A 3E9ZA 1CUDA 3QU7A 3ZTYA 3PGXA 1C9JA 4WLEA 2GLTA 3R0QA 5HVNA 1M1UA 1DAHA 2G1UA 2I6UA 3FMOB 3JRNA 5J47A 1WR8A 3P2JA 4AICA 2H2WA 4CT0A 4P92A 1IAVA 4RD0A 5IMBA 1YRAA 2DBZA 3BRWA 3ZE1B 4R7TA 4DJDC 5F1KA 5H68A 2G9UA 5HFNA 4DEXA 5AO9A 1XNRB 1BXRB 2HWKA 2VRBA 3PLNA 2VPTA 4LA4A 5T67A 1XD9A 2I9PA 1YT5A 2BWJA 4IUCS 4QHTA 2DCUA 1KU0A 3DZ8A 3B13B 2ACVA 3OPVA 3SU8A 4Q9JA 5KO2A 2YXEA 1WU8A 2X8AA 1ZWLA 3DEYX 5HKAA 2EKPA 3WBBA 3BGIA 3WLRA 1NSTA 4BJHB 5C32A 4EGAA 3CZPA 5TC4A 1PQPA 1QVRA 2YMLA 1GHTA 2VSOA 4WVFA 3LUHA 3MJ4A 3AT1A 4I1UA 2VUIB 3FPAA 3S29A 4Z4QA 1B8VA 4J1NA 1CIVA 1XKTA 4HC4A 2YJ3A 2GZRA 4UVDA 4DWWA 2XZOA 2M1ZA 3GEMA 2NTVA 4UU8A 5AK5A 5HGJA 1XRMA 3PWSA 1FDUA 3TUIC 2P4QA 1BX3A 2GEKA 1W94A 2R85A 2WA1A 1PGNA 2B4KA 5FL7D 4JEIA 4KOEC 3FMIA 3SE0A 1M2HA 1AMOA 1JL3A 3PXEA 2HSJA 2X0EA 4RJTA 4CEJA 2GKSA 4F92B 1E2JA 3I1JA 3M6MD 2F1RA 1EH5A 1KEEA 1GLNA 4AT1A 1O3YA 2PJUA 4Q9DA 4OQYA 5IUKC 4FC6A 5HQ3B 1N6KA 1Z83A 4PONA 3WOHA 4D0NA 1OPXA 5HQTA 4P7JA 2W4QA 2VDWA 4LHXA 4OSEA 3IHTA 3RODA 4ZCTA 2ATIA 3H2SA 3V55A 2NO7A 2PJDA 2OO5A 1TJYA 3OU2A 4PLTA 4ZP1A 5H81A 2NM0A 4OQLA 3WZMA 1R0SA 3D6NB 1YS6A 1F9AA 2HJHA 2OHGA 3Q3EA 5EHXA 5FTLA 3AKZA 3OCJA 4LGVA 4J0CA 4PTZA 2L42A 3GLIA 2VOJA 3BYZA 1UPXA 2J5RA 5EE0A 4QASA 3MHTA 2WPDD 1J49A 3GVPA 2PRJA 4UCWA 3V8RA 2XBMA 3HPQA 3TI9A 3E3OA 4D56A 5I9LA 4Z4IA 4FYIA 4FFBB 2EF0A 4RA9A 3PX3A 4IGFA 4GL2A 2AVDA 4DGSA 1YFLA 3EDRA 1KPHA 1UPAA 1WY5A 1S5PA 1UC5B 1L7VC 3JWHA 3LPAA 3VPGA 5ICMA 4B4VA 3MK31 2H9IA 4WEOA 4XPIA 1X42A 4Y18A 1IBSA 2R1TA 5REQA 3SHFA 3T61A 4IJWA 4AZSA 4FUQA 1PX2A 4I4TB 3ICWA 4IQ4A 4X6YA 3EXHC 2FP4A 4O08A 1KS9A 4IGAA 4KJZA 1RIFA 5IDXA 3AVWA 4X71A 3I34X 1SZPA 2PH3A 1Y9JA 3VVBA 1A5SB 4RK0A 1IOLA 3C85A 3BWVA 1EFDN 1JFFA 1G1AA 1M2WA 1XZLA 2GEVA 2P2DA 2RCNA 3WGMA 4LNAA 4OA5A 3TSYA 3QOWA 4F5DA 3JAMA 2HJSA 4NYIQ 2EJBA 3BGOS 5EHIA 2H0RA 3QPUA 4RZXA 1U99A 4BNJA 4ZMRA 3KQPA 3UB3A 1SQSA 3DB2A 4B82A 2GBFA 4NNJA 1QH9A 2MINA 2YOHA 4D42A 2F00A 3N8GA 4F4IA 5J4VA 1W0CA 2BEWA 1FFBA 3DOJA 2O19A 2V98A 4Q66C 1YOBA 2C20A 1W4AA 3IOBA 3Q87B 2XHEA 3GU3A 3VMMA 3A05A 5FD8A 2P6RA 4KLRA 1CNFA 1R3UA 1Y1KE 2BGNA 3ABRB 4BFCA 1E89A 4LSGA 3TLYA 3C87A 3MN1A 1FZTA 1YR3A 1HFKA 2A0UA 3D8TA 4ZK2A 1P4JA 5CBKA 2XMSA 2H1RA 4EOGA 1OR8A 3B9BA 1QG0A 2XT6A 1N5RA 3ZV7A 3UPTA 5EHZA 1DQNA 1IZ0A 1HBJA 1Y1TA 4DLSA 1TRKA 1OFUA 1N9GA 5BUQA 3CX8A 5KOHA 1WAMA 3L6UA 4EGFA 4DAOA 1YA6A 2QN8A 3B6ZA 3QXGA 1T1JA 2PBRA 2JJ2A 2X5OA 1A8HA 1LLFA 4NC9A 3LDUA 4F1JA 3EIXA 1RAHA 3IBGA 1U7ZA 2BTOA 2J6HA 3H0CA 3MD9A 4GSYA 4YDQA 2IXEA 3WGVA 4X8HA 1IY0A 4FONA 3A6JA 2HDWA 4AUKA 5IWAB 4BRSA 1HG1A 3ZJ5A 2Y2UA 1ULUA 2C54A 3L05A 4KK4A 4WKBA 1SB9A 4OUDA 3MQ2A 1G3IA 5IM5A 4C6RA 4JROA 2AVNA 5AVJA 5JTTA 2CJFA 2VT3A 2ZYAA 4RVOA 4B31A 3EMKA 4LKRA 3K32A 2AT1A 2HIHA 2IZ1A 4NMWA 1NJ6A 3D8BA 4Z7NB 2Z4SA 3NEAA 1OB2A 3OAAD 3GEHA 3VNVA 4REQB 4G1UC 1C3EA 4KR9A 3U7JA 4B73A 3NEJA 4YUVA 2NUPA 2WJGA 5LZ9A 5BWCA 1YR9A 2I34A 3CWCA 1QDUA 3EFHA 3QMPA 1SC6A 3BIFA 4QTTB 3T7EA 1UDAA 4ILEA 3TCKA 4XVUA 2C7RA 1ZJ5A 2PUAA 4EO7A 1C8LA 1T5IA 1C4KA 2JPDA 1ZYUA 2P9GA 4OAQA 3UBMA 1DXYA 2XUJA 1XQYA 3WHPA 5LM3A 2XEXA 2J9RA 3NZEA 3QFTA 5LMUB 3PLAE 3FN4A 5B7GA 1D2CA 2GI4A 1U0BB 2QYSA 2CL6X 2HU2A 3TG2A 3OEHA 3LOPA 4Q19A 3BPSA 1N5MA 5ENZA 4NESA 2BJHA 1W88A 2NOAA 3LH5A 1SXJD 4I3HA 1N2HA 2DCMA 3HCOA 4LSWA 1KMHB 2HZBA 4QNNA 1IM2A 3GGJA 4HRYA 2HHLA 5JCJD 1GNVA 3HKEB 4OLHA 4BQSA 2DR0A 1DFHA 2CN1A 2OK8A 3UYLA 4QZVA 1AZLA 3OPYA 3ETHA 4UHBA 3KLMX 4UBKA 3NKFA 1OLUA 1PLLA 2QMUA 4OU5A 5KHLB 2RH5A 3K6SA 1XWWA 3O83A 4ID9A 4YA6A 2YCLA 4PBRA 4ZTBA 4WADA 1T1EA 3WGNA 2Q41A 2C5LA 4LJ9A 1I4DD 4MYSA 5CUQA 1X1RA 3TD9A 4F86A 5KSOA 2GAOA 3OZXA 2OZEA 1XEWY 4ABYA 4MPTA 1ILEA 1XGKA 1IQRA 4C30A 1U04A 2QN9A 4KI7A 4YRPA 5AW2A 3H5OA 2JIQA 3L0BA 3B3FA 3M81A 5E6UA 1E9VA 2Q0QA 2ZWVA 5PGMA 3GLGB 4RABA 1D0VA 1W4RA 5TSDA 2PMEA 1FUYB 4ZV4A 3MWEB 2Q8NA 3KEQA 4URZR 1GZ5A 3EMBA 2IHBA 3ORHA 2QL7A 2XH8A 2HJVA 3G2HA 2J33A 2IVZA 2IXTA 2PY6A 1UKZA 3LW8A 4I1RA 3ROFA 1QP0A 1I1QB 1JSCA 1YSCA 1Z4OA 2SKCA 3KOZA 4KCGA 1KDRA 1Y3HA 4A2CA 2IT1A 1CY7A 1RXWA 1KRXA 4HDMB 1V1JA 1KAHA 2VQSA 3CYFA 4C2AA 2PU5A 3QMWA 2PZGA 2JC3A 3A4LA 4IHJB 2HT1A 2JFXA 3MLBA 2A1UA 1ZJYA 3OBBA 1R0BA 2G0AA 1LLQA 2ZTUA 3DKKA 4WKOA 1HL7A 4IFEA 1JHQA 4YVFA 4ENUA 5JZVA 2QRPA 3H2ZA 5KNBA 3NO4A 5E0OA 4V03A 5CFRA 2FJUA 4PCVA 3FPJA 5J5CA 5ITWA 4LY0A 1RPTA 4X8OA 4HN2A 4DHEA 3OJLA 3PB3A 1HLDA 1VGQA 1KHHA 3VYTB 3MWDB 5E6SA 5FPQA 2OCGA 1ZAKA 2J5XA 2KLBA 1T43A 5AOAA 3OZSA 2FQWA 2IXBA 2RI0A 1ZEJA 1O89A 4NE2A 1P5FA 4CEHB 2HU8A 3GVHA 2HCFA 1A69A 1YKFA 1Z12A 2E4XA 3Q6IA 4GRIA 1Z6ZA 4OMFG 5FWXA 4BJ5A 5CNKA 3Q7EA 4BFLA 4GI5A 2PMFA 5TQ0A 3DOIA 2ONYA 3M4NA 1GARA 1WUKS 1S2DA 2VHWA 3UMSA 2WHPB 4LK2A 3TZHA 2ETVA 4YMUA 1G9SA 5A7GA 5CB0A 4L73A 1KBOA 4M1EA 1ESDA 4KUEA 1D4AA 4FSHA 2JFYA 1PVDA 3JQPA 3LWBA 2RIPA 4AUNA 1Z63A 3ZVLA 1X7XB 1E77A 2BPOA 2DHEA 1JPVA 4LC1A 4IICA 1GTL1 2TMKA 5DCLA 2B5VA 4OKSA 4AG6A 2J07A 5ALUA 1G8YA 2WYWA 3PENA 1R4NB 5AUOB 4KITB 1JVSA 1XJ0A 4G0OA 2FSUA 3V42A 5K7SA 3EPJA 2EC5A 4U0JA 4IS2A 2D4AA 2G1JA 1FQOA 3Q10A 2A9RA 2AW5A 3VRHA 4RJKA 4LDPA 3RIXA 3ZDXB 5JSZB 3KLNA 1GGHA 3QWBA 2Q6VA 1PEAA 1N2JA 2V0NA 1NBOA 3MTAA 4HXYA 1PYDA 2J7KA 5H0IA 4C01A 5CB4F 2OV6A 5BN3B 2NVBA 1UDBA 2P1RA 3L02A 2O1XA 2Y67A 3QUQA 2RI1A 2JCYA 3GEIA 2CLCX 2P5TB 4UEQA 1X9IA 2A0YA 2G06A 3JQFA 3UWDA 2PH5A 1RJEA 4C7OA 4NCBA 4BU0A 1Z28A 5ITSA 3PE4A 3GT0A 4WT7A 2VYND 1EUDA 3A6FA 3R44A 4J49A 3WY9A 1JWAB 3S28A 1OBHA 5BT8A 1F4LA 4BTLA 4EMUA 4X61A 3QEOA 1SCBA 2Q5JA 3GF4A 3R5SA 1KP2A 4D0RA 2JW5A 2OO3A 4DIBA 2YW9A 3IVXA 3NDRA 1CRZA 3TQHA 3EVFA 3HBNA 4YREA 2XMRA 3L6EA 3JYOA 4JNKA 2DECA 3MIZA 1W96A 1B6TA 4EUFA 4J3FA 3ILYA 4OHYA 1T4DA 4NFLA 3I42A 3ZWOA 2CCJA 2HQSA 3EA0A 4TZ0A 2XWBF 3K53A 3QVGB 3H9CA 4I5DA 3A36A 2Z4RA 1Z34A 1Z62A 3JAKB 4S1PA 3PFWO 4N8EA 4AROA 4YJGA 2DTXA 3KETA 4A9AA 3T3DA 4EUSA 4C0LA 1TYBE 1XZDA 2IGTA 1TF2A 4UU0A 3UMCA 1PRYA 3H2JA 5A06A 3WA7A 1XNQB 2OHVA 5CT6A 2QE7D 2Y05A 3EX7C 1OZAA 1CDOA 5KTRA 1ZY2A 1OXTA 1J21A 1CUAA 1OAOA 2YHUA 1EXVA 4G0PA 2UYQA 4BJ1A 4K9OA 1G3QA 5B55A 1ZNQO 1QQ5A 2JLVA 1N5JA 5C31A 5K3AA 4MQBA 2Q1XA 1UZUA 3DHNA 2GHRA 2ZBRA 4Q1AA 3ZU5A 4JD5A 2P1DA 1J5XA 2BH9A 5EERA 1ORWA 3E1GA 4P86A 1PE0A 5ILGA 3T38A 1A0OA 2A5YB 5HZGA 4F11A 1IVYA 1NMXA 2IEDA 3SY8A 4KO4S 2XUPA 3FNIA 4ZAWA 1TECE 5KVQA 2XIQA 1P2UA 4F2DA 3PHGA 1A2OA 1VCNA 3ORQA 3U1BA 2DULA 3LHSA 1EVEA 3G23A 4LZJA 3P9ZA 4AL4A 3W7AA 2HPAA 2K4MA 2G08A 5BXQC 2ZAMA 3LJKA 3NM6B 2WJWA 5BVGB 5IXJA 1I9CA 3RG2A 2I8LA 5AVTA 2ACWA 1D5CA 3KG2A 3UMGA 4B84A 3E7PA 4G5QA 1JXAA 1IHOA 3F7NA 1G42A 3P5SA 2HCRA 1AKMA 1QIMA 3QG5A 4X7BA 3ZWVA 1NW5A 4G89A 3PPXA 3SF8A 1LPNA 2DERA 5HP4A 3E3AA 4IWXA 2WWHA 3IMEA 2CUZA 1E66A 1NM5A 2BFBA 2MIIA 4LQCA 1UXGA 2X15A 5EMKA 1QRSA 2BI8A 1D04A 1UKBA 1Y7TA 3CA8A 2WDZA 1NQUA 1LBTA 2HRDA 2DVMA 2FLWA 1CUXA 1L4BA 3F3SA 1ECJA 3IVMA 4DWJA 5C5CA 2BFWA 1FTSA 1VMIA 3C7CB 2XITA 1P0MA 3F97A 4C5CA 2D4HA 3IQHX 4RW0A 2FMKA 4NOMA 7REQB 3RDPA 3FE2A 3H17A 3PV0A 3TWOA 2ZTVA 7MHTA 3AFGA 3SEQA 1FBNA 2H2DA 1NUPA 2X9VA 3DUFA 1WKBA 2G7ZA 3PJDA 5BMVB 1D6JA 1WY7A 2WF5A 1UBNA 3OOJA 3UCFA 4LHYA 3G8DA 1P4GA 1XV5A 3CQ9A 1EFLA 1VCIA 3NWBA 3RIMA 4REMA 4PBTA 1NX6A 2QQGA 3DV0A 1LZLA 4Q1BA 2IYSA 4PHFA 2ZXUA 2F8SA 4WJLA 4JP3A 2P6MA 4CG2A 4ZHQB 2F43B 3OJFA 1FC0A 1V39A 1YDHA 2A57A 1RZRD 1NRXA 3HBLA 5BRNA 1E5TA 1YZNA 4XM1A 2Q4BA 2EWMA 4DF3A 1VPLA 1ACJA 1C9NA 2AOVA 2JH9A 1PR6A 5BW4A 4BMOB 1TLTA 4IG4A 1JILA 2PKXA 1L5FA 3FZEA 1BRMA 1ONNA 2G9QA 5CG2A 4LC0A 3WGIA 1RQXA 3F9CA 1ZZEA 1G7CA 1R18A 2COEA 3R23A 4FM9A 1H93A 3KOMA 3HR7A 4PSUA 2JKZA 1V37A 1NSYA 3JQAD 2B6HA 3RAFC 2Q21A 3BE8A 1B8NA 1W5SA 2WUFA 3ZVKA 1F0YA 3IUSA 3TTXA 4BX2A 4EKEA 2FTKE 2OG2A 4FJ0A 1TUEA 1YZLA 3GARA 4QTXA 2PGXA 4YFYA 3KZMA 2WQ6A 4HNRA 4KFTA 1XDBA 1RYFA 1UBHS 4AJ4A 4BS9A 4OP2A 1QYDA 3LBHA 5BSFA 4DXHA 2A0WA 2GBPA 4GMHA 5DWVA 1QFSA 5LB4A 4JKIA 1H3NA 4RKEA 1IWPB 4FMDF 4C5BA 2QRVB 3C6MA 1KQOA 1TC1A 1PS0A 2NSDA 3FMPB 1X8KA 3GRAA 4ZJUA 2RHCA 1CHDA 5ER6A 2ZSJA 5CLLA 2PT7A 1E3QA 3JQGB 2GPTA 4GC9A 4IX1A 4PQGA 1M5RA 3D7KA 1M7HA 2Y76A 2Z5GA 3EF0A 2JHFA 1IQ0A 2G3YA 4L5JA 3NHPA 5FV7A 3ZV4A 1MW8X 1FZQA 2WQ7A 2Q3FA 1P2DA 1WVMA 2J0VA 3TDKA 3ZVRA 2XVXA 3UZUA 1ZSNA 2QSZA 2DQ4A 5IARA 3QPAA 1KDOA 2IZOA 3TIIA 5A5VA 4FFLA 4YXWA 1VL5A 1T6YA 1YZUA 4FMPA 1AKWA 1MAUA 1KMQA 4MQ4A 2O2HA 2WTEA 4RORA 4UTZA 3T9EA 5A4DA 3LL7A 2ZKIA 4UNSA 4Y1EA 4FYYA 4BATA 4ZEMA 2ZTMA 4G37A 4UEOA 2O5RA 3C5WP 1JF8A 1ZXLA 1TZKA 1UJ2A 4PQYA 4RTOA 1CEXA 1BXKA 3WV5A 1QQ7A 1V8BA 1F60A 1G38A 3CPHA 1T2UA 4QJ4A 3JAWA 4PHHA 3WOVA 1G5TA 1E3TA 1O95A 4BN4A 2V6BA 2OOSA 2NYUA 2IIPA 3G5UA 3E27A 4CMEC 3BWCA 1OH7A 1MG0A 2VBIA 3ABIA 3HRKA 4FEAA 4IV0A 4B3JA 4FS3A 5E3JA 4PNZA 2FG7C 2FPWA 3GGPA 4JCCA 4BQFA 1V5FA 1RBQA 1BE0A 1FU7A 2A84A 3UGJA 4RTKA 2VTVA 1UM8A 2C0PA 1MB9A 1XTQA 2NTEA 3DE4X 4KGZA 2A7QA 2B21A 2R48A 2WD9A 5CNIA 5CVEA 3ZWPA 1V3UA 4OH1A 4HH0A 4NR0A 3EXFB 2JI9A 2JZOA 5H4HA 4L4ZA 3NIBA 2F9LA 4TUYF 3FPSA 4DMGA 3V1UA 2VDOB 3RSQA 5C1BA 2VL7A 4F46A 3HCDA 1D03A 2BV3A 1JALA 1VE6A 5CVVA 5DOVA 2IYUA 2FE1A 3F2VA 3E53A 3K1JA 1EFHA 4QYWA 3RT9A 4Y6RA 4EF6A 3PI6A 4A10A 5EUMA 4HX9A 1K9VF 4ZI3A 2C1EA 3O8OA 1ECCA 1AIPA 1E1YA 1I3LA 2DE0X 2WTNA 4GM1A 4H15A 1ZIOA 3JWEA 3MOIA 4I66A 2ZU6A 3VKWA 1FS5A 1WBBA 2YTZA 4DCGA 2WYVA 4J2OA 3MCUA 4MJ3A 4DQUA 5JJLA 2EKLA 2ZRKA 1Y7IA 1P1KA 4G0NA 4DMKA 4TZ6A 3RQIA 2AUNA 1P2FA 3MCAA 4O2RA 4RMJA 4L2IB 3RSLA 3I4FA 3BMXA 1W0KD 4EY3A 1RXEA 4U2GA 4XX0A 3GPCA 1E32A 1KK2A 1LBHA 4OEHA 3WRYC 4KQWA 3KTAB 3TNFA 5JCZA 3VR3D 3ND9A 221PA 4C21A 1F2TA 1F2UA 3FOWA 1AB5A 2AA3A 3QLUA 4HX2A 2VK4A 2C9DA 1Q91A 3L4BC 3C15C 1CZUA 3AGQA 3L5KA 1H2AS 1X1BA 3I5XA 1BAPA 1CVRA 1ZJ4A 4WZBB 1LK7A 2MSNA 5CW1A 3VH4A 4ZQEA 3LY7A 1GQYA 4AKEA 5C8ZA 4RIFA 2FDCA 3VYWA 3N2KB 1MJGA 1DKUA 4Q9IA 1P6QA 1QGED 2CLKB 1V11A 3TBHA 1JKFA 4B80A 3GCGA 1SUFA 2YKGA 4Q1FA 2I8CA 1CQIB 5I4BA 3F78A 1FYXA 2JI7A 5EE1A 3OZWA 3VHXB 4BNTA 2OFFA 1HT1E 3BAFA 5DRYA 5IZCA 2B8WA 4YK7A 3VPXA 2Z5LA 1O9BA 3W2GA 3OZGA 4PNPA 3IPYA 2GD2A 4JL8A 1P2TA 5AHRA 3EF1A 4LVOA 4QO7A 4U2KA 2XAUA 4B71A 3G5LA 1FQKA 2P9QA 3A6ZA 4FK8A 1F8GA 3GJYA 4M7RA 5FRDA 3VU1A 5F9MA 1P39A 3DT9A 1THGA 4J0QA 2D1QA 1VSUA 4ITRC 3OT1B 4K2HA 5G0VA 4H6PA 1KZGB 6LDHA 2VHXA 1ENPA 1Q11A 3CZ9A 1G7RA 2FX3A 2WAMA 3CEMA 3ELBA 4H9GA 5AKZA 2CDNA 3NOXA 2DFLA 3KV1A 4OBBA 3FJOA 1F1BA 1GSOA 5DBHX 4AJEA 1C30B 5A3VA 2O8CB 1ISGA 1CZHA 4FEGA 4J0DA 3T1YB 5I7OA 5D7NA 3OH8A 4PZEA 3PPWA 1E3LA 1JIXA 3EGDA 1JEAA 3KFXA 4QGFA 5LYYA 3ELYA 3HVUA 4MARA 2BGRA 3V80A 2PRSA 4DM7A 1YB5A 3LL4A 2XJ4A 3L0DA 3OQVA 3QKTA 1CCWA 2H1FA 3IR7A 3O2SB 3QUSA 4G4GA 4IZIA 2OZLB 2JFBA 5F7JA 1L5NA 1F12A 1MVLA 3F3KA 1HDGO 3EA5A 1YRWA 4W7IA 3HJRA 3IBYA 1XZGA 2XB6A 3IQWA 3KZVA 3KQKA 5F33A 5FBVB 4K0KB 1EQAA 3E8SA 2GUWA 1J2RA 4E88A 5JVDA 3ICOA 4B6JA 3KXLA 4GECA 3K05A 4I9HA 2ZVDA 3G8YA 4N01A 2GDJA 4F6RB 1E0AA 2K2WA 2P90A 3FR8A 1KYIA 16PKA 1JJIA 1ICEA 1RBYA 1X87A 5GTDA 3ACBA 3V2GA 4QQKA 4B6OA 3S8YA 2FSIA 1IVSA 2QP9X 5I3CA 2F2TA 2WR8A 4G67A 4BNKA 2CYAA 3KVNA 4NYJQ 4A6PA 1BN6A 1E3DA 1VRWA 1XZEA 4MUKA 5IVKA 1VKJA 4BQEA 2PJRA 4BNNA 2YY7A 1WHTA 4WN9B 1RXVA 1M1YA 3MS4A 3M4ZA 1UKYA 2QT1A 3CO5A 4PPQA 1HOXA 3TQCA 1DNPA 3G2NA 1SQ5A 1YK1A 3IP7A 5EWMA 3AI1A 3UHAA 3FPLA 2RGNC 4Y2GA 4AZWA 4OK6A 3N8IA 1E4YA 1CG6A 4ZU6X 2RC5A 1YO6A 1EGMB 3UYKA 4G07A 3ZXUB 4QDZA 1N0WA 4ZARA 2OENG 2P68A 2GNOA 1KXJA 4R8MA 1T8PA 4IOLA 2W2TA 4GXNA 1OWLA 1W52X 4N7RA 4XCQA 4CLHA 4F12A 1F7VA 1T5OA 2HF2A 1SK8A 2VTDA 2YXNA 4FNGA 1FDSA 4DYDA 3LPDA 2C1ZA 3IAEA 2VDVE 2AZDA 3ONFA 2G80A 2X5KO 2XI4A 4Q4JA 5K05A 4DNXA 5EHNA 1W34A 4EKGA 3ID6C 3D1LA 4EARA 4POAA 2WICA 4FLFA 5PNTA 4IZHA 4PGFA 2ZR7A 4EX6A 3CVYA 4S2UA 2AN9A 2VWGA 1GUFA 3HI6A 3OHSX 4QRDA 1BDBA 1SG9A 2WIDA 4FWIB 2W2QA 2OQ2A 3MGBA 2XZLA 2BEVA 2I1LA 3E35A 3V8QA 5BSKA 5CDGA 2AZTA 2X1HA 4IZOA 3ZYCA 2DHDA 3D7NA 4KXXA 4BKUA 1GQFA 1XX6A 3VKGA 1Z06A 2F1KA 3GFGA 4JU9A 3RARA 1CBUA 3EXG2 4EY4A 4AURA 3L7AA 4Q16A 1WZUA 2FEWB 4M1TA 3EFOA 1M2OA 1TQ6A 1L5QA 2NO0A 3MGGA 2QZ9A 1QV9A 4QYMA 2DPXA 4ZYUA 4EHBA 3KUXA 2C8KA 1T34A 4V02A 1GYQA 2VTKA 1TAGA 2YMMA 4RO0A 3WRXA 2H4HA 3LCRA 4KREA 1TC2A 1V25A 4RZQA 1E6LA 4JEUA 1ZIYA 5E1BA 1QPZA 2GCPA 3RS7A 4ARCA 1K5GA 1U3CA 2WINI 3Q7SA 4KR0A 5HCNA 2OEPA 2WYOA 4B3XA 2D5AA 2VAVA 2GVDC 2IDZA 3AB7A 3C8HA 3GPIA 1RWMA 3DLTA 4FOPA 1QGAA 4MIEA 3WJ7A 4W6QA 4EBFA 3PHCA 3N53A 3GRUA 2P3LA 1W59A 2XVYA 2VEOA 2IEZA 1YDMA 2BMDA 1HC7A 2CNKA 1OW3B 3E15A 3N0RA 2G5PA 3P0HA 3ZDCA 4D26A 3ELUA 5G40A 2CUNA 1RJGA 4KQFA 3TAXA 1QV7A 2PXAA 3Q15C 4TYMA 2C94A 3A8TA 5D3KA 4CEJB 2CCGA 3MT8A 3NCHA 1OIVA 5CDYA 3MW8A 3DZIA 3ETCA 3WWDA 3ZXIA 4E11A 3NVMB 4FYVA 1MX9A 1C9MA 2IU6A 3QRWA 4ZOAA 1K89A 5IBQA 3A0UA 1GGVA 3VA7A 2P8JA 3SZ3A 3MEQA 2FETA 2VDWB 5EXSA 4ISBA 3G5MA 5C5IA 4Q3AA 4B3MB 2FH5B 3AF4A 1JEEA 1XMXA 1TAQA 1JZTA 4F60A 5C3UA 1JHVA 2EJTA 3AVYA 2ZRPA 2ON6A