1SFRA

Crystal structure of the mycobacterium tuberculosis antigen 85a protein
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
b'AFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen 85-A
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity
pubmed doi rcsb
total genus 100
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sfrA00
4Q3LA 1XZAA 3DDUA 1XRLA 5C8ZA 2XUHA 1EK2A 5ALQA 2XQGA 1QIKA 5CXUA 4EY4A 2HHAA 5CRIA 1YASA 5JZBA 1MN6A 3BWXA 1LPPA 2RI6A 3ZLTA 1B41A 1GQRA 3KSRA 3NOXA 1QFSA 4G4GA 5FPQA 4G8DA 2HL6A 1VA5A 4Y2VA 5A7HA 5AI8A 4C4YA 1R4ZA 4GXNA 3D59A 1SC9A 1SCKA 2DQZA 2BGRA 3C6YA 1EA5A 2WUFA 2HU8A 5E2IA 1IUOA 4W1SA 5JARA 2QUAA 4QWWA 3C8DA 4UHFA 4MQMA 4PSDA 2QZPA 3WJ2A 4PW0A 2HFKA 4HXGA 4CG1A 4K5QA 3O4JA 3L1JA 1QIHA 5AK3A 4BB0A 5K3AA 2WILA 3W06A 1J06A 1K4YA 3VJMA 4FLFA 1MX5A 1T2NA 2BFNA 1E3QA 3G9ZA 3V1KA 2QM0A 4FFWA 2OAGA 2ZSHA 2OCLA 5IVDA 2JGEA 1GT6A 4M0MA 1GPKA 1XZDA 3H2JA 4UHDA 3C6ZA 2BUCA 2OXEA 3CXUA 1YA4A 3HRHA 1RP1A 2OAEA 3WJ1A 4X6XA 5H3HA 1JFRA 5K3EA 5FLKA 4WFKA 5HF5A 1UK8A 4UFPA 1K8QA 2XMGA 2WU4A 3QH4A 3WZMA 3KDAA 2ONCA 1QTIA 3R41A 2QOEA 3QPCA 3H2GA 6YASA 1MO2A 2FUKA 3HJUA 1CUCA 5EHXA 4F5ZA 2H7YA 1BEEA 1QIEA 4X95A 4H7DA 1TCBA 5BOVA 5FP0A 2FJPA 5EIHA 4DSZA 5AKZA 2PX6A 2O2HA 4QLOA 2CKMA 5DTJA 3BDIA 2WSLA 1VE6A 1JJBA 4NS4A 5EHZA 2WTNA 5AO9A 3C5VA 4QLAA 2IX9A 1XQWA 1HQDA 1QO9A 3G0IA 4CIBA 4BVJA 1EHYA 4PSCA 4ZV7A 1W6RA 2XMBA 1E66A 5FXMA 3RK4A 4KRYA 3CN9A 2G5TA 2RIPA 3FCYA 4DSAA 5JATA 4WY5A 4G8BA 1JT2A 1THGA 4BTLA 4BDSA 2K2QB 2XQIA 1UKBA 2XUFA 1PV1A 4FHZA 4H35A 5ALMA 1J07A 2JBWA 4XJVA 2Z5GA 4LXGA 2BCEA 3WK6A 3WWCA 1MAHA 5AKIA 2H7CA 3DQZA 2ZYHA 4BAZA 3IBTA 1R1DA 4FLMA 4BC0A 4C4XA 3IUJA 1IUNA 3W2TA 5K3DA 1MNQA 2Z3ZA 3A2NA 1ZI9A 4ITVA 4I4CA 4Q34A 2XMCA 1FFCA 2EEPA 1MPXA 3AIMA 1XQYA 3DKKA 1XLVA 1IUPA 5AM5A 5IVIA 3DL4A 2Z3WA 3H2HA 5HQ3B 1YB6A 2QR5A 4OYLA 5LYYA 1YAHA 2XMDA 4F0JA 5AHXA 1JI3A 2HFJA 1FSSA 4UHEA 4IQ4A 4Z49A 4PSUA 2CBGA 3VXKA 3G0DA 1MU0A 4FWBA 2DHCA 1ACJA 2WIGA 5CMLA 1XQVA 3H17A 3IIIA 3QBJA 1ISPA 4BVLA 4PF1A 5DYYA 1FJ2A 3DCNA 5AOBA 3D0KA 3SWWA 4B7ZA 4NZZA 4KAAA 2IITA 1CFJA 3FLEA 1UOOA 3H0CA 1QIMA 1IZ8A 4E11A 5ALUA 2AJDA 2HA3A 4QDTA 4MEAA 1GZ7A 3DYIA 1HL7A 3LS2A 2EDCA 5I7UA 5LZ2A 1XZKA 3WWOA 2XQJA 5LZ9A 5ALOA 5AKEA 3R3XA 1B6GA 5AM2A 3H2KA 4U2DA 4GW3A 4ARBA 3WL8A 5IVKA 3NGMA 2PU7A 5HF6A 2VJBA 3D3NA 3WK4A 5BWCA 1C7IA 1VZ2A 3GBSA 4JUIA 3QITA 5JAHA 1MJ5A 1CLEA 1VOTA 1CUUA 3D7RA 3W9BA 1BU8A 3HACA 2WKWA 3LIIA 1R3DA 4UBMA 2HU7A 1XZJA 2WUGA 2WFLA 4ETWA 1YS1X 4L9AA 3QMWA 4QA9A 3BE8A 4GECA 1ZIXA 2JGIA 1EDEA 4E15A 3WA7A 1WB4A 2J3QA 3AIKA 3G02A 4OCZA 1AMNA 1H2YA 1GQSA 3Q8WA 3VJLA 2HRQA 3OTQA 2YXPX 3STVA 4Y2XA 4QWMA 1DT5A 1JU4A 1FFEA 4KRXA 3BJMA 1DTEA 3WL6A 1CUVA 4GHWA 5AI6A 3FYTA 1JMKC 3W05A 1AURA 3ED1A 1X2BA 4U2CA 2WFZA 4KAFA 2H7XA 4G1FA 5JAUA 4ARAA 3OM8A 4U2EA 1SCQA 5ALKA 5AKJA 2JGLA 2C5FA 4DMHA 1VZ3A 3DOIA 4E14A 3BXPA 3G9UA 1F0NA 5LKAA 4EUSA 1DWPA 2XUGA 4V2IA 5AI0A 1PJAA 4QEKA 1A8SA 2XB6A 3KWJA 3R0VA 3OPMA 2YYSA 4G4JA 5IKXA 2G4LA 1Q0ZA 1USWA 5ALVA 1CUIA 2D0DA 2FJ0A 4OPMA 5EI5A 3EBLA 1YA8A 4C6HA 3AZQA 1KEZA 2VEOA 3MUOA 1QIIA 3F8SA 3WIBA 3H2IA 5AIBA 5JD4A 2DHEA 4X90A 3I2GA 5K3FA 3GUUA 1VXOA 4Y2YA 1F0PA 1X70A 3F67A 4EY7A 3HYSA 2JGJA 4CCYA 5D3ZA 4Y9SA 1LNSA 1EH5A 3OG9A 1N8SA 1AZWA 2WQZA 3PUHA 1WB6A 1ZGCA 4U2GA 4ZRDA 3TEJA 3KD2A 4LYEA 3WKBA 4M0EA 3BIXA 1Q0RA 1CEXA 2G5PA 4IH9A 3WK8A 2QMQA 3A70A 2QXUA 3PUIA 1CQZA 3WKEA 2ROQA 1MAAA 3WKAA 1Y37A 1UWCA 1XFDA 3WKDA 3ANSA 4C87A 1HDEA 2C5GA 5E4JA 1BS9A 3I6MA 3V1NA 5CBKA 1XZLA 2LIPA 3F96A 1PFQA 3K2IA 1LGYA 1XRQA 3DKRA 3I2JA 1S8OA 3VVMA 4FNGA 2QTBA 3I2KA 2V9ZA 4X3CA 5ALDA 1A7UA 4B85A 3ESDA 5AKHA 2VAVA 1BEZA 5FKJA 1UXOA 5ALSA 2C58A 5ALZA 4B0PA 5JAPA 3MUNA 2W22A 4BP9A 3C8HA 3EF3A 1H2XA 4EA6A 1CR6A 1A8QA 4WFJA 1CV2A 3PICA 4GWLA 3IA2A 3QVMA 4YASA 5FRDA 1K5PA 3ZLVA 1D07A 4N5HX 1CUXA 2X5XA 3R3WA 4Y2RA 3Q0TA 2OGSA 4JYPA 5AK5A 1RWQA 3HC7A 3HXKA 4UBJA 1L7QA 3WZLA 1BCRA 4JYMA 1DX4A 1XZCA 1J2EA 3I1IA 2WHPA 1CRLA 3O9VA 3R3ZA 1NX9A 4X6YA 4ROTA 4P9NA 5AH0A 1ZGBA 2OCGA 4B0OA 3ICVA 1DU4A 3C45A 1FFAA 3S2ZA 4QZVA 2GYUA 1E89A 1XZGA 1ZD5A 1XQXA 1G42A 1TCAA 2JEYA 4RGYA 1CUAA 4X7BA 5A71A 4HAIA 3M83A 1U2EA 1YSCA 2OPHA 3B5EA 4I3FA 1VLQA 1QTRA 3FBWA 1GKKA 4JEIA 4Q82A 1JJIA 1EVQA 1DX6A 4UHHA 4B80A 2WHRA 4OUKX 4BE9A 1BN7A 4KEAA 2H9YA 2VJCA 2X8BA 1CUWA 5JD5A 3AZOA 1OCEA 4KE6A 3VVLA 1W75A 3DD5A 4LXHA 2GBGA 5LIPA 4HRYA 1YAJA 5JANA 4KE8A 5LZ5A 4BCCA 3GA7A 1LBSA 1E8NA 4B82A 1UOQA 5KBYA 1XZIA 5LZ4A 5AOAA 4AZ0A 2XUKA 4TGLA 3FLBA 2HA4A 3DS8A 3V48A 5CH5A 1AC5A 2BAGA 4HZGA 2WIKA 3ZV7A 2XI4A 1T4MA 1XZEA 4DLNA 2JGFA 1CUSA 2QRUA 1WOMA 4DMCA 3RARA 1XRPA 3AZPA 5LLSA 1MX9A 2P8SA 1AUOA 1VJ5A 5DYTA 3L1HA 4FLEA 4Y7DA 4OYYA 1CPYA 4MYSA 4G4IA 1AGYA 3C87A 4P93A 2NW6A 3BDVA 1K6EA 4N8DA 3HLKA 5DLPA 3DOHA 4RE5A 3BL8A 4L3WA 1E5TA 4AB1A 3UMJA 1UKCA 3ANTA 2OCKA 3N0TA 4EHBA 2O2IA 1TK3A 4JH0A 4BVKA 3BJRA 3KOOA 4EZIA 3SC2A 4TPKA 1DQZA 2C7BA 2DQYA 1ORWA 3DEAA 5ALIA 4CG2A 3FVTA 3NUZA 1EDDA 5AKYA 5AKXA 1L7AA 1EK1A 1YB7A 2XMZA 1CUHA 3ESCA 3D2AA 5ALEA 1Q84A 1E8MA 1UFOA 4MXDA 1XRMA 1XRNA 3U1TA 3STTA 3I2IA 2PUJA 1LLFA 1QE3A 3F98A 4B6GA 3O4GA 2WJ3A 1QONA 4B9AA 4QDOA 5D6OA 1W1IA 3WL7A 3K6KA 3OOSA 2Z8ZA 5K3BA 1DQYA 1TKRA 1YCDA 5JASA 1XLUA 1N5RA 4Y2QA 2JEZA 1TIBA 2QT9A 1ORVA 5ALPA 3AUKA 1EB9A 1ZD3A 2O7RA 1ETHA 3EIOA 3O9MA 2HDWA 4XWGA 3F9CA 4M0FA 4BC1A 2PSHA 4ZXFA 1QOZA 3OURA 2O7VA 5E4YA 2Q0XA 2OGZA 1XLWA 3H18A 1HLGA 3A6ZA 1IVYA 2XDWA 4INZA 3H1AA 5ALXA 1CVLA 4AMZA 4UHCA 2DSNA 5AKLA 4H7EA 1EINA 1UK9A 1WPXA 2XUQA 4J0IA 3VISA 5ESRA 3QYJA 2HA0A 3GELA 1TAHA 2WG0A 3L1IA 5BWBA 2XMRA 4K2AA 4J3JA 2QXTA 1F6WA 2BUBA 2WHPB 3WYDA 3H1BA 5HK9A 2PM8A 4A16A 3HSSA 2QS9A 3D2BA 2ACEA 5EIEA 4PNZA 2C0PA 1EDBA 2PSFA 1QO7A 1Y7HA 5AM3A 5AIAA 2Y2UA 5EHNA 1XZHA 5JADA 4OB8A 4PO3X 3FOBA 1CUGA 2XQKA 3I2HA 1GGVA 2VATA 4X85A 2XUJA 3V9AA 1QZ3A 4WDRA 4NMWA 3IVMA 5DYWA 1TQHA 4W63A 4L0CA 1R9NA 1BE0A 4XX1A 1IZ7A 2JIDA 1P0IA 1KU6A 1UZAA 5JAOA 1E8DA 3ZPXA 1ZICA 4FFVA 5HF9A 1SFRA 2VA9A 5AKGA 3VDXA 3HZOA 2ZJ6A 5EGNA 1JKMA 1L7RA 3IUNA 2HA6A 2H1IA 3WI7A 3EQ9A 4IH1A 3T4UA 2WG1A 2AJBA 3G9TA 3X3HA 2E3JA 5C8VA 4AO7A 3IDAA 2WJ6A 1QIJA 3WK7A 5CW2A 1WB5A 5F4ZA 4J0KA 4N8EA 1CUEA 3NWOA 5I8PA 4FOLA 5FUMA 4DNOA 5CT9A 1NU8A 4HTAA 4LHEA 5A6VA 1LBTA 4WJLA 5T4HA 2B9VA 5T4FA 4B84A 5DNUA 4HXEB 4BCDA 5DTIA 4JNCA 4EY6A 3CCBA 2WLSA 1UK6A 2G63A 4RNCA 1WM1A 2CUTA 2QVBA 4DNFA 5ISMA 3AIOA 2AJ8A 3GFFA 1GPNA 2ZJFA 3DNMA 1ODCA 3SX4A 4LYDA 5HFAA 4PQEA 2OQVA 5T4EA 5K5EA 4HRXA 5AK6A 5ALRA 4HS9A 2B61A 4AO6A 3RKSA 5SYMA 5KWIA 4N5IX 5CXXA 3O0DA 3G9XA 1N5MA 3HABA 4BAGA 4YX9A 1N1MA 4UFOA 3P2MA 5IH7A 4BZWA 2ZJ7A 1LPAB 4YPVA 2DFPA 5FOQA 5AM4A 2QKYA 2O2GA 4D9JA 4MWSA 3IUQA 2PL5A 4AXBA 1XKLA 3I2FA 4CFSA 2XMQA 1U4NA 2XMSA 4ZWNA 1A88A 3VKFA 5J3JA 2V97A 4HVTA 4AMYA 2VF2A 4BP8A 5LZ7A 1VKHA 1LPNA 4LIPD 2X76A 4KR0A 3PE6A 3TRDA 5FPPA 1BN6A 2GBFA 2GBIA 5BV7A 2Y2VA 3E4DA 2B4KA 3H19A 3EQ8A 3O4IA 1MX1A 2QJRA 4QNNA 1ZI8A 5DWDA 1WHTA 5LKRA 3BF7A 2RONA 3WIOA 2PPLA 4J0CA 2V98A 2BKLA 3E0XA 3ZI7A 4WDQA 5AI9A 4A5SA 2GZRA 5DJ5A 3C6XA 2PVSA 4W1QA 1ODSA 1KU0A 2VJAA 3M81A 3GROA 4EBBA 3O95A 3G8YA 4UUQA 2XUPA 5ALGA 4X97A 2PKYX 4AQDA 3I6ZA 3FCXA 1R9MA 4J7AA 2Z8XA 5ALJA 5EHQA 5EFZA 4Q1VA 4KACA 4KJXA 1LZKA 4CCYB 3BF8A 4Y2JA 2WIDA 2PSDA 4X00A 5D3KA 5HF8A 2GYVA 4X6UA 4BZZA 2ZYIA 2ZSIA 3E3AA 3QMVA 4C88A 3QZUA 2HADA 4K6GA 4W9RA 5A7FA 1HBJA 3TGLA 4RPCA 1H23A 4QDUA 2I3ZA 5CURA 5HKAA 1CUDA 2VQ6A 4AN0A 1MNAA 2VAXA 1EI9A 2OQIA 3AILA 1W4LA 4A23A 1EX9A 4J0HA 1O6FA 4OB6A 1ZD2P 4I19A 4C89A 5ALWA 2XUDA 2VT7A 2BUAA 5A62A 5C7YA 5FV4A 3HI4A 3WL5A 1LZLA 3WQHA 4Y2TA 2XT0A 5A2GA 2YH2A 2J4CA 3CCCA 5AOCA 3FWHA 1UKAA 3IULA 3AJAA 3DLTA 2WHQA 3DJYA 4UBLA 4J0JA 4W1RA 1Z68A 3MVEA 3PFBA 4UBNA 5AM1A 1RYYA 3YASA 2OCIA 4J03A 1VXRA 4ZGBA 2WIFA 5HCUA 3PDCA 2ZYRA 3M82A 2AJLI 2BGNA 4QE3A 4Y2PA 1W52X 2J3DA 3LIPA 1LPMA 4GDMA 2JGMA 2OLEA 4IO0A 3U0VA 1YS2X 3G0GA 4YK7A 1LPBB 5LP1A 2I3DA 1BRTA 2CMFA 3FYUC 3ZLUA 4BRZA 2ZYSA 5HKBA 5K3FB 1FFBA 1FFDA 2XLCA 4GEGA 2JF0A 4BATA 4EB0A 2AXEA 4MYDA 4H18A 3A2MA 5AI4A 2HIHA 1W76A 2GYWA 4Q05A 4BYMA 3W9UA 2Y1KA 3QPDA 2ACKA 5ALLA 1CQWA 5E4TA 4KE9A 5FDFA 4C01A 1CUYA 1G5FA 5KWJA 2HU5A 1Q83A 4XVCA 1C4XA 3JW8A 4CI9A 3IB3A 5CH3A 4DGQA 2VT6A 3JWEA 1G66A 2XUOA 1SCIA 3VJKA 3WWDA 1JMYA 4FDMA 1HKHA 3FLAA 1P0PA 4X94A 2GBCA 5HQ3A 2XE4A 3LCRA 3WWPA 4PV7A 1QIFA 5AK4A 1UOPA 3K9BA 2W6CX 2UZ0A 5AM0A 2WG2A 2XQFA 4LKOA 2DHDA 2HA2A 3LLCA 4ZV9A 1HPLA 4MQLA 1NU6A 2ORYA 4K6HA 5ALYA 5D7BA 4ZREA 3W04A 4O08A 1MTZA 2HA5A 5AJHA 1JJFA 2D5LA 1P0MA 1EB8A 3FYUB 3C5WP 3QM1A 3WMRA 1ZD4A 2WUDA 2Y6VA 4FMPA 2XUIA 4OU5A 1THTA 3MGAA 5CT6A 3R3UA 2RAUA 3WLAA 2GZSA 1OXMA 4X71A 3O4HA 2C4HA 4OSEA 2WJ4A 4AO8A 3G0CA 4WY8A 1OILA 2WIJA 4BBZA 4GLBA 1JU3A 4F60A 4DNPA 4GI1A 2AJCA 5LZ8A 5ALFA 4IH4A 1UT6A 2C0QA 2ECFA 3D2CA 1VE7A 5I9IA 5CT4A 4H7HA 2PUHA 3WWEA 2I03A 4S0XA 2RHTA 1TCCA 3QMMA 4ZI5A 2WUEA 4GBGA 1XZBA 4U2BA 2PBLA 1WHSA 4WFIA 1BROA 4U2FA 3FAKA 5DNVA 4G9GA 2HA7A 1EVEA 5SYNA 5HFNA 1Y7IA 1YR2A 1ZI6A 3M3DA 1XRRA 2OG1A 3ZWQA 3HEAA 4G5XA 2CZQA 3WK9A 4DTCA 5T4BA 4KYVA 5C81A 5IVHA 5ALHA 1XKTA 1DT3A 1BCSA 5AP9A 1AX9A 4Y2UA 1F8UA 5CT5A 3T52A 4B9EA 4TVKA 3EQ7A 3PF9A 1A8UA 4LXIA 4Y2SA 4EY5A 1VA4A 4DMFA 4J0GA 1CUFA 3ESAA 1SOMA 4QDZA 1MT3A 2WTMA 3FSGD 5CT8A 3IUMA 1R88A 5KREA 1ZOIA 1WPRA 4UBOA 1DWQA 2VTVA 5JALA 3IURA 5DNWA 3R40A 1ODTC 3UUFA 3KXPA 1CIJA 3WK5A 4DIUA 3PI6A 1O6GA 5JD6A 4OD0A 5C8XA 3E1GA 4CCWA 1I6WA 4FTWA 4MWTA 1H2WA 1G4HA 3OC0A 1DINA 5AICA 4H7JA 3B12A 1C7JA 3KWFA 4MJ3A 1J1IA 3G0BA 4FBMA 2YASA 2WFLB 5K3CA 3SK0A 3ICWA 1GPLA 3BIWA 7YASA 4KE7A 3S8YA 3STXA 3D4LA 4Q3KA 3JYHA 3WA6A 4OB7A 1M33A 1H22A 4DYHA 1QGED 1EXWA 4N8SA 4FBLA 4BDTA 3A2LA 1ZIYA 4HXFB 2FX5A 2B20A 3DYVA 2PSJA 1QFMA 2EDAA 3ESBA 2WM2A 3I1YA 1H2ZA 5ALNA 4FKBA 2IIVA 4BRSA 4UFNA 2QUBA 4RE6A 4UPDA 2VJDA 3I6YA 4W1PA 5CTAA 4BTVA 1U65A 4H7FA 3R3VA 4H0CA 5EIAA 1ZJ5A 4OU4A 4H7IA 1GKLA 4C4ZA 3V1MA 2WU3A 4DM7A 3C6BA 3F97A 1TRHA 4X93A 3AINA 5CH8A 2CB9A 4IHAA 5ALTA 4CG3A 3I28A 4NVRA 5JIBA 4L72A 4X91A 3FSGA 4H77A 4G8CA 5JZSA 3UUEA 4BAUA 2WFMA 3PF8A 3G7NA 3STYA 3FNBA 2DCMA 4KAJA 3RM3A 4EY8A 1XROA 1XZFA 4F21A 2CEKA 4DNQA 3B3QA 5HZGA 1IMJA 1AQLA 1QIGA 1CUBA 1LPOA 1QIDA 2ZVDA 4P92A 5YASA 4UBIA 3STWA 4B81A 3C70A 3QPAA 4AX4A 3RLIA 1XZMA 4B83A 2V96A 2BJHA 4UBKA 3AFIA 2ES4A 1CUJA 2RHWA 1GXSA 3N2ZB 5HK8A 4P08A 2I78A 2DR0A 2HRRA 5AI5A 1U8EA 4QDXA 2RGUA 2XLBA 1ZJ4A 1P0QA 2R8BA 2OGTA 3DL7A 1WCYA 3FVRA 4BE4A 2CJPA 4AN1A 2J4FA 3TJMA 1LPSA 3FYUA 4FNMA 2R11A 2PU5A 3R3YA 5JYCA 3LP5A 3ILSA 4X92A 1DWOA 1X2EA 3STUA 4AZ3A 1K63A 4DMKA 2QJWA 2VSQA 1R50A 4G9EA 2JGKA 3WKCA 3D5EA 2XUAA 3WYNA 4MEBA 4Q3OA 3CN7A 3C43A 1CUZA 4H7KA 3GZJA 2HM7A 5AKKA 1QLWA 4J0DA 4WCVA 1AKNA 1QJ4A 2Y6UA 4K6KA 4BCBA 4XIIA 3V1LA 5A7GA 3H04A 5JZ9A 1UK7A 1ACLA 4CIAA 3PFCA 4UHBA 4E46A 2PSEA
chains in the Genus database with same CATH superfamily
4BZPA 3JVIA 4XVRA 3DDUA 3K9GA 1K89A 2XE7A 2IPXA 2LCIA 1NBAA 3FJ1A 1LX6A 5ALQA 2WQ7A 4IOKA 2QTMA 3AONB 4NMMA 3AX6A 3K0AA 2EFDB 4JKIA 2C4TA 4PFQA 4QUDA 1ZMTA 2HHAA 4Y0NA 1BJKA 3AF1A 2A0XA 3GGCA 5CRIA 3S1AA 4B6QA 3LBYA 1L7VC 1YBVA 4RMHA 1VJ0A 1H2BA 4KDEA 4BBPA 1TEVA 3HP1A 3QFRA 1XDDA 3P4XA 3AVPA 1MIOA 3QLVA 4LRSB 2Y67A 1U6KA 3ZHRA 5THKA 3P2YA 2HSWA 1ID1A 4S1TA 4LJYA 4FDVA 4U9IS 4A73A 3GFBA 3MILA 1U8FO 1SXPA 1FEZA 3NOXA 1E62A 5FPQA 4GS5A 5FWDA 5A7HA 1WR8A 5GV8A 1X3SA 2DQKA 1IH8A 4TYYA 5AI8A 2OHGA 4C4YA 3GFPA 4GXNA 3QU5A 4JJ4A 3SJZA 5C1PA 3CB2A 5THQA 2DQZA 4FHEA 3MD0A 3ZOKA 3GRAA 3F90A 4IW3B 3G88A 4KSYA 4ZVKA 4IZOA 2HK8A 2B30A 4YDHB 1YQGA 3S2IA 1CY0A 2HU8A 2GAIA 3K72B 2FFBA 1N6NA 3KVVA 2X3FA 4IQGA 1ZIOA 2R7KA 4MQ4A 3EE6A 4W5WA 4W1SA 5IMBA 3OQ1A 4FFMA 4QWWA 4UHFA 3L46A 4A8JC 3TOVA 1E69A 1U0FA 2FEOA 2PZ8A 2O59A 3PCXA 3AP3A 2BFOA 2WZDA 5DYGA 1I3CA 4MKZA 3BILA 2QZPA 3HCOA 3UK2A 1T25A 1A77A 2ZIFA 2JVJA 3PP8A 4X84A 2IUEA 3AHFA 4LE2A 2HWXA 2Y1FA 5K01A 2IRWA 1LRJA 1DTWB 1U9IC 3L1JA 4TXNA 4DQDA 1VJDA 2C8KA 3A26A 3KYDB 4QL3A 4CCSA 1KNXA 4JELA 1BVHA 5KMGA 5K3AA 3LUPA 2VHUA 2ZCVA 5IBQA 3W06A 2O8EB 2GCEA 3AKZA 3G8DA 3IOCA 1U81A 1GUZA 2I8LA 2Q1XA 2WFAA 3O7MA 3IMEA 4Q1EA 4R01A 3HA3A 5CDGA 4KLCA 3X1KA 4BNYA 4AW9A 1F06A 5DT9A 5K0EA 3BL6A 4B2PA 6ABPA 4JXXA 1JR6A 2BFNA 4HPXB 1TM2A 4YP7A 2ENWA 3V1KA 1JAYA 2COUA 4L3VA 1JF8A 5LJLA 3QX9A 4NP6A 2KYRA 5KX5B 1CX9B 2F8MA 4FFWA 4MW2A 1N4DA 4DLYA 1Q6ZA 3WAGA 4E09A 4XKJA 4CM4A 1XLTC 3ZQJA 2OCLA 5FPTA 3GX1A 1T2CA 2CD9A 2GZ3A 4M0MA 3RIMA 1XZDA 4EPWA 3I9JA 3JQRA 1UKVY 4HPWA 3H2JA 3KQYA 3OO1A 2I7CA 4Q4JB 3U44B 3M4YA 4LOJA 1EGHA 2PLNA 1VP3A 1NM5A 3KSMA 2VDOB 2B4QA 1YA4A 3GGPA 3X1YA 3ZXIA 2PQ2A 1ZH2A 2XA9A 3MS2A 4GLLA 1KYXA 4X6XA 4DV3B 1IB6A 1TVCA 4ESEA 5AD1A 4E08A 4YCAA 4DYDA 4GL2A 1GAEO 2JI4A 4FQ5A 5FLKA 1QAMA 3UMCA 1OW3B 4BLQA 4D46A 3GY0A 5HF5A 3GB9A 2OAQ1 4PIVA 3RT9A 4A2CA 4UFPA 4ZV4A 7MDHA 3TFOA 2GR9A 4U7JA 1J99A 3RYIA 1CNMA 4L78A 2XH8A 1Y4ZA 5EUCA 2XAAA 4K0KB 3KOZA 5GADl 4NCHA 4C14A 2RGBA 2PWZA 3R7AA 2BDUA 4DAEA 3Q3IA 4P2BA 4DSOA 2QOEA 3TKYA 1NL3A 2YFKA 1PR1A 5CVDA 1I2ZA 3D3EA 6YASA 2PWYA 1GPBA 3CPHA 2ZJ2A 4HNAB 3D6TB 4INPA 1JDJA 2PH5A 2YNMA 4KQHA 4YT4A 1DAGA 1X7ZA 1QG2A 3K1JA 4PO8A 3VU0A 1GZUA 2ZJOA 4GLOA 4JHXA 1XJWA 2ETXA 1QIEA 4NIMA 1H4TA 1Z6AA 4D45A 2P0EA 2JASA 1U63A 3JWPA 3N74A 5BOVA 5JSZA 1O5TA 2O2EA 4N12A 5CDTA 2NNWB 3MUEA 1FDRA 4L8FA 5EIHA 1PN3A 4YRFA 1IN6A 2IPAB 2IU4A 2AZMA 2HNKA 1Y1QA 3RWBA 1HNZB 1F51E 4QLOA 1JLHA 1L7PA 2I6TA 4EM6A 4HNUA 5LQKA 3QUQA 2CKMA 5I5EA 3UM9A 2I0FA 4M83A 3THSA 1Z5UA 2EKQA 5HIAA 4YJ3B 2I7TA 1KXZA 3GU3A 2QK4A 2AQ8A 2Y8EA 3ZV5A 1VE6A 1Q57A 5LA6A 2A3NA 2W2NA 2WTNA 4IP0A 3OZAA 1VLMA 3ZH2A 3HJBA 1HQDA 4QBFA 2VQEB 4LNUB 1FDIA 1JDSA 2VJPA 4HMOA 5AW9A 1QO9A 1Y7TA 2M32A 5B6PA 4CIBA 2QTVA 1E1CA 4BVJA 3J81k 5LNK1 2XCUA 1ARZA 4CUJA 5E1OA 1JG3A 4GF5A 4TLLB 1KE1A 4EFKA 3LKBA 2NAPA 4ZV7A 3CRW1 3FDJA 2A14A 1CEQA 2VTDA 1T1SA 4LW8A 4RK7A 2BGUA 3RVQA 1M2EA 1XI2A 4LF9B 3G5AA 2L19A 2XMBA 3CCFA 3MWEA 3E3LA 5CVUA 1B74A 1E6KA 3RYIB 1V2GA 5FXMA 1VYVA 2OHFA 3W5VA 2WYUA 4HT3B 1Z5ZA 2FXVA 5LQUA 1GARA 1WXHA 1IM5A 4IGKA 3BSFA 1EP9A 1Z4MA 4RA6A 1IJEA 1H05A 1T35A 3CN9A 3KOUA 2R62A 4RDHA 3EQZA 3FCYA 3PS9A 5ES3A 4B6OA 1FUIA 2CUKA 2PZKA 3EAGA 4CU2A 2QRVB 4WY5A 2O8DA 1OYOA 4V03A 5EQFA 3U3JA 2NO5A 1PZMA 4Q4JA 1OIVA 3RLFA 3V8PA 3ED5A 1M10A 3N76A 4YT8A 3SHWA 3VSBA 3IKJA 3KU4A 3F6BX 3QVTA 4YUVA 2PEYA 4K8RB 2FWBA 2XZOA 2ZUUA 4IY1A 1KPIA 1Q1AA 4N7RA 4UDYX 4ZAFA 5JHGB 2FFHA 4URXR 2BBTA 1G6KA 3A3YA 4NR0A 1BH2A 5CDYA 1UDBA 2ZOSA 4J6FA 2W90A 5CLIA 4BVGA 2Z5GA 4P5PA 4D4KA 3WK6A 2BCEA 2CK3D 4ZU6X 2OFOA 5L4SA 3WWCA 2C78A 1MB9A 1VSVA 3C3BA 2XEDA 3W5UA 821PA 3HVUA 3W2HA 1T9KA 2HRBA 2O2CA 3QOFA 4PR0A 1OUMA 1K6MA 2P5SA 4WEQA 4BO1A 5JYDA 1FVOA 1L4UA 1VRCA 5EJ9A 3I4FA 1XHLA 5KVVA 1G21A 4I3GA 1PX2A 3WVNA 1H93A 4KZKA 1K0FA 1U7UA 2JH9A 4FWIB 3QPBA 4P3XA 3HDJA 4FLMA 2G6TA 5CEFA 1ZCJA 1U1CA 2PGOA 1HZZC 3K73O 2CVHA 3BCRA 3LDUA 4N0QA 1FZQA 4F72A 5GTDA 3PX7A 4FOTA 1V37A 3K0HA 1T26A 1T1RA 4XI9A 1V6CA 2CSXA 4MA5A 1QF6A 2PSSA 3PWTA 5K3DA 2APJA 2VH2A 2W2KA 2V4ZA 3UAXA 4D44A 5FOVA 1E7SA 4ITVA 1M0WA 3BXEA 2O8BB 4DDTA 3ZW7A 2ZUEA 3PFIA 4Q34A 2AQIA 1E9RA 4R2MA 4ZPJA 3SDZA 3BULA 4YMSA 3EXEA 3MS7A 1EG2A 1Z17A 2V74B 3AIMA 1A4UA 1MV5A 4DR4B 1XLVA 4FD3A 4FEEA 3WLSA 4OJTA 1M1NB 5FA5A 1EHIA 1JLMA 5IVIA 3RT7A 2GF2A 2QVXX 3ELYA 3SJ7A 3NHYA 2FRDA 4ARUA 2AKYA 2BR4A 3FKJA 2RE8A 3E22A 1X80A 3NVMB 4M38A 5JQGB 3H2BA 4HWSA 4OYLA 5LYYA 3D3WA 4EL0A 1YAHA 2XMDA 5H0IA 5MGNA 3GJSA 4LXYA 1OPXA 2ZU0C 1Z9BA 1VHDA 3GF4A 5EE1A 3V8NA 2Q49A 2EZUA 3KLMX 1SD2A 1YDEA 4RETA 3KG2A 2H5IA 1PQYA 5CM9C 3EDQA 4NJEB 4P83A 4BYGA 4D99A 5FUYA 1N2HA 2ZS8A 4OXKA 2V1UA 2YQ4A 3G17A 3K6JA 3PNBA 3BGSA 1VDMA 1E1NA 3VXKA 1Q7GA 1HDRA 1MU0A 2RK6A 3LKZA 4YRCA 1O03A 3ER8A 3SGLA 1AK1A 4D4JA 1FFYA 1ACJA 2WIGA 4Q4DA 1BW9B 3PKJA 1MJGM 2OMEA 2B7CA 3E2IA 4P22A 1XQVA 1O0SA 3LW7A 5FTKA 1Y98A 3DMPA 3QBJA 5JYEA 3GA0A 4DQXA 4ZVRA 2QZJA 1N2EA 4S35A 1ISPA 4MQEA 5E0OA 5J5CA 3ZE1B 5A2QA 3W77A 1UDWA 1UODA 2CXQA 2P2GA 4NBRA 2JLVA 3AVQA 2XKAA 4L9RA 1LRKA 4QQNA 4XJTA 4RHFA 5AOBA 3SWWA 5H81A 4KAAA 1RRPA 3SE7A 1GTSA 4LZAA 3ZWAA 1QIMA 3Q5EA 2G71A 2OYSA 3JQAB 4QTTB 4ZAWA 2J9YB 3OPYA 4E11A 4NULA 2OT3B 1E99A 1YQXA 2ZPTX 3NR2A 3EARA 4QDTA 3WGZA 1E1MA 5CVCA 3OTOB 2C61A 2IZZA 2GVNA 2QM3A 1CIPA 3OKPA 4WK6A 2B78A 4PQYA 2VPPA 4PNEA 4BEWA 4UMFA 2BM0A 2HSEA 3N0WA 5LZ2A 4FONA 3WWOA 4QLBA 2Q5JA 2XQJA 5JMWA 4IIHA 4MTCA 2B98A 4KSBA 5ALOA 5HBRA 3TCNA 1S6YA 3H2KA 5AM2A 4KQJA 4RCVA 4RTJA 4W5OA 1FSGA 5IVKA 2GZ1A 4QUKA 3VNBA 1RVV1 3K0BA 1QHHB 4JDUA 3UAOA 3QF4B 5AVQA 1R16A 1W5BA 5J2TB 3R24A 2PU7A 4WLFA 2IW1A 1I3MA 2QVLA 6AT1A 5L3SB 5G2OA 1EVLA 2O0JA 2JFOA 3D3NA 1V41E 4CF7A 2Q50A 2BGIA 4MULA 3V4PB 2FE4A 1JIIA 3CO5A 2X0RA 4NH4A 2DM6A 3WK4A 1GPJA 2X9NA 3WB9A 1V16B 1V5EA 1FFHA 3WLMA 1SURA 2VHTA 2ZULA 3O2SB 5BWCA 2VJKA 1B42A 1C7IA 4HNHA 1UJ6A 1L7NA 1YS9A 3KB2A 5LNK6 1L2TA 4NRDA 4WBNF 3TLXA 2FDXA 3T1NA 4B3XA 4DSNA 2QAGA 4GRAA 1MJ5A 1CLEA 2QAGC 4DADA 3CMMA 5HQJA 2QLBA 3I34X 4AJ9A 5JAZA 2AEJA 2GWRA 2JGNA 4BO9A 2XSZD 1ZUNB 2D59A 1OXBB 1OVMA 4HMQA 5EOVA 4UTPA 3D7RA 1LVUA 3HACA 4FIDA 5EJ4A 1M1ZA 5IWCA 3FMVA 3TUJC 4GEKA 3JATB 3M4JA 2VNAA 2Y1EA 3HJNA 1NM5C 5LBIA 1R3DA 1WMFA 2F59A 2XYGA 3DOUA 3IUYA 3NRCA 5BYBA 1Y34E 3QXGA 1TMOA 3PCRB 1JP7A 1E4VA 3B52X 3EFOA 3CKKA 2PE5A 1ICIA 1XWIA 4KDFA 1YBHA 2K7ZA 3S28A 4IBOA 4GECA 4Y1FA 3RC3A 1DIAA 1IY2A 1G4UR 2CLKB 1L5QA 2HQRA 1Q0HA 1TKAA 3TK1A 4CM1A 2FPGB 1WB4A 3FVQA 2WJIA 3T3DA 3WAKA 4ATNA 1PK7A 4FJ2A 3R4VA 4D3XA 1AMNA 4KQ6A 1HORA 3B82A 4C78A 5AW1A 4OHVA 1UC4B 2NXWA 2P4EA 3HP7A 1JLKA 1H2YA 3ZWWA 1GQSA 1J97A 3Q8WA 3FNIA 2HRQA 5DHUA 1IN4A 4MH0R 2VBFA 5A4KA 5A3RA 2DWOA 5K6AA 4PY2A 3ST7A 1EBUA 5EP1A 1DT5A 1L7XA 5KAPA 8GPBA 1USGA 3ADPA 1CR1A 1BXZA 1QFZA 1DTEA 2D13A 3AY3A 3D4BA 1CUVA 4D98A 4G4SO 1C9JA 3UJDA 1U1IA 3W05A 1XNQB 2LRHA 4JQOA 1KGDA 4HQRA 4KODA 3GXOA 1AURA 1T8RA 5KQGA 1X2BA 2OCAA 1VBKA 4I1PA 3AB3A 1M6WA 3K15A 4PCAA 2PY6A 3EEBA 3VV3A 1Y3BE 2ODPA 1KI4A 1ZNQO 3KPWA 3DPSA 3RUEA 3U3MA 4HQKA 1N1EA 2PH3A 4ISCA 3E5RA 3JQAA 4NJOA 2OORA 3F7TA 4PPYA 2RHJA 2OXFA 4WERA 3GLRA 1EMDA 4M3NA 3A7DA 3BJEA 4A6PA 3ZDCA 4HAYA 2O7QA 3FR7A 2C9OA 4DLZA 2KJQA 1ZHOA 4EGJA 1BU5A 2W6QA 1T9DA 3GEGA 4FKZA 4R1UA 4BQRA 4BQOA 2C5FA 4DT1A 1KEPA 2VHZA 3DEYX 1G3RA 4K28A 2OHHA 3EGXA 5EA2A 1P75A 2Q9BA 4NEQA 2BEVB 1XMVA 4RIFA 4GXRA 3C7CB 4Y6QA 1KOLA 4B1FA 4C0HA 4DW8A 4E5UA 2DXIA 4OLAA 1FBTA 4G2NA 5ERXA 2HV8A 4OA5A 4H7PA 4X3OA 4W5NA 4B6FA 2BKAA 3AI3A 3H8SA 3W34A 3IL2A 1DWPA 1Q17A 3DXXA 3JX9A 1AB5A 2X1LA 2HIGA 5B3KA 3ESXA 4Q21A 3CZ4A 5BN3A 4HEHA 4KN9S 4BGEA 1DAEA 2EHDA 4WH0A 4QDKA 4DM3A 5B4UA 4A8PA 1W19A 3KKMA 1RYEA 2AUTA 2YYSA 3OPMA 3NHZA 3Q9UA 3R0VA 4G4JA 1WXGA 3IERA 4Q48A 5DOZA 2ZBVA 3R9KA 1Q0ZA 1USWA 4BWVA 1RWXA 4F93B 4WOCA 2C5EA 4WWHA 2QTHA 1CUIA 2AF3C 2CY0A 2R6FA 2F9LA 2FJ0A 2OO5A 4JVOA 3NDBB 4X1YB 2H9AA 2XDYA 4DPMA 1YHYA 4TSFD 4MZDA 2PX4A 1TPYA 3JQBA 5DP2A 3LHIA 4O2BA 2LZ0A 2FMFA 3G9QA 5CP8A 5CYOA 4OXRA 3G0HA 5INTA 1SU6A 1SQSA 2H0QA 3H2IA 5AIBA 1KYIA 3THWB 3ZR4B 2C3OA 3PGLA 4G5RA 1QYDA 2DHEA 3D4IA 3H5IA 3I2GA 4CMKA 3CJQA 4JB8A 4YCLA 5FPHA 3QBVA 2BMWA 4C21A 1GZ4A 4LMPA 1RKXA 4Y0AA 1KKMA 4LJ6A 4GM4A 4EO4A 3HYSA 3IOYA 4S1NA 5DFAA 4CCYA 2CJYA 3U3RA 1ZWLA 4POAA 1P91A 4OK6A 3GLFE 1JHXA 3OG9A 3TYXA 1E2MA 3V3TA 5B1YA 5CFOA 2WQZA 3UPDA 3LXXA 4BJ6A 2XUZA 2H2WA 3AM3A 4U2GA 3VPCA 4TYPA 1A9SA 4CN9A 5ITVA 4HH3C 1PNVA 4I99A 3TEJA 4IXMA 4E3ZA 2A0YA 1DEOA 1A9QA 1R0WA 4G86A 4L4XA 4TV9B 2DBZA 3G2JA 3AFGA 3P9QA 4H6WA 1QVAA 4YRSA 3OU6A 4IH9A 1P4JA 3KSUA 3WK8A 2BP7B 1WZIA 1Z5WA 2WJAA 5F1YA 1YGPA 3ZUPA 4BMNA 5ADVA 3MIZA 3HCNA 3AW8A 3FZYA 3LWDA 3G7UA 3M5PA 4N7JA 4V0OA 3V4FA 4GMFA 2QXUA 1EU1A 1IJBA 1KFBB 4LCEA 4AY6A 4TTPA 3BHNA 3BMQA 1PNRA 1L5GB 2QUKA 2YRWA 4DLTA 1C7QA 4PYKA 4R1NA 4CKBB 1RYNA 1TTQB 4B2IA 3VTKA 3TEMA 2ERXA 3II6X 3WKDA 1JQDA 1R8JA 3BA1A 1PJCA 1W29A 3AETA 5SY9A 3WLFA 4A0QA 1NMZA 1RU3A 5E4JA 1BS9A 5IARA 4C20A 3SCZA 3KFVA 3TOZA 4OI4A 1Z26A 2BVNA 3QJ5A 4OJQA 4RACA 1XZLA 3K2IA 3WIVA 2HUNA 1M9NA 1S8OA 1OV6A 3KR0A 2VDPB 3NONA 2VHCA 5L51A 2QTBA 3KZOA 1NUSA 1WHTB 4K9QA 4YROA 1AZSC 3USCS 1EQUA 2I2CA 3NRBA 4H27A 2VDQB 3H7AA 3KTAB 3DMTC 3I52A 4JCOA 4RABA 5AKHA 2VAVA 3NM5A 4TS4A 1U7HA 1KDOA 1GXSB 1PVVA 3ZD8A 3ZY4A 4EW2A 1Y3FE 1UXOA 1T5IA 1GOTA 1KRHA 4ZTBA 2HMSA 3BTSA 4KGVA 1ABBA 1NVMB 3EXAA 1Q0LA 1XN4A 2W6OA 1JG2A 5DRTA 1G8YA 4ER3A 2Q6VA 1L5SA 2J9GA 3AEZA 3K96A 3VU1A 3FPSA 1HEYA 3B6IA 3OMLA 1ZMBA 1WL8A 2B34A 2B8JA 3OIYA 4JXJA 1BNCA 2RAPA 1P5FA 3WFJA 1G98A 3V2HA 2IQ5A 1KMHB 3PEYA 1KYVA 2BTQB 1DC7A 1M6HA 2XX3A 2ZUBA 4G89A 1PO7A 1GL9B 1B1AA 5HUHA 2CFRA 4LY6A 5CD9A 1CV2A 3VR6H 2ZG6A 1RJEA 1GT91 4LC1A 1YHZA 1QGDA 3IA2A 1NUPA 3AQ4A 3ZTTA 5KNLA 4H1UA 1F1JA 2NTJA 4WZBA 4MB6A 2UVPA 2VXYA 4PZLA 1EM8A 3F6RA 3SEAA 4X41A 3OICA 4JB3A 3ZLVA 3FR8A 1LVGA 4TTJA 2NXJA 1TZCA 1WEKA 2PPVA 2PLRA 2BRUC 2FEPA 5D2CA 3DNFA 3RYFB 2X5XA 4HFNA 2B4AA 2VRNA 5M34A 4G0WA 2R4TA 3IHWA 3RRJA 4N4AA 4WXEA 1ZR2A 3JALA 3PU6A 3LECA 3AESA 3MTBA 3PSHA 3Q98A 5G3YA 1OC4A 5IH3A 4GDFA 4JGBA 1QV9A 3OZTA 1XAGA 1Y3CE 4FCWA 1JHOA 1LJLA 3PDIB 4I36A 2VYVD 4X8OA 2QUZA 2XXAA 1CJMA 2EKBA 2C3UA 4FZRA 4BWFB 4EG4A 3L0ZA 5FJIA 3S3TA 3OQNA 4UBJA 5F1KA 4MO2A 4DDMA 2JIZD 1T8SA 2VPWA 3KM0A 2PT9A 3OOWA 4UD2A 1GZHB 1JFSA 1FIUA 1J0DA 4O29A 3I1IA 3R9WA 2WHPA 4ER0A 4BNUA 2ZIUB 4CQMB 1L8AA 2A5YB 1FW8A 1TJ4A 2IOFK 2IW3A 3O9VA 4ZYZA 2RHOA 3PK0A 4LG1A 2NUPA 2WWIA 2Z9DA 3LH5A 1EFCA 4MEJA 1V7ZA 3TD9A 3VAAA 2VYVA 3I32A 2X6QA 3U7FB 1HDZA 2WB4A 2RH9B 1EHCA 4B0OA 4HDNB 1NX6A 5JNSA 1JHDA 1DU4A 4LXXA 2NU9B 1LC0A 4RX1A 3KJFA 3B1JA 3UOGA 1TMGE 5SYAA 3S7TA 3RVPA 5F9FA 1GPYA 1OZGA 1ZNXA 2GYUA 1PQ4A 4L4RA 1JIJA 2F64A 3OLQA 4GZ6A 1MO5A 3V97A 2WF6A 1QMGA 3U44A 2P6RA 1TJ3A 1ZD5A 3GWGA 1QR2A 3N2KB 1NV8A 3OPQA 2XF8A 2HYIC 3CLRC 5JMPA 2O7NA 1G42A 3Q3JB 2QD4A 3GJ6A 2JEYA 5ICGA 3LVRE 2PGNA 2G28A 3HS3A 3L5KA 3PLRA 4E70A 4X7BA 5A71A 3G8CA 3ZCUA 1Z7YA 2P2LA 3M83A 1FRZA 1HRDA 1CS0B 3PD7A 4XGQA 2W2QA 5FI3A 2HMAA 4WKCA 4FOPA 2OPHA 3DFMA 3GLGE 3K0KA 1DO0A 4R81A 1RC1A 1ORHA 1ZISA 1SXJD 3OBIA 4PTYA 2X9GA 2JRCA 1GKKA 5GGXA 4FJ1A 4ZJYA 4QUJA 4O4HA 1NBHA 1FX1A 4JEIA 4ZOLA 4E2WA 1JJIA 1A8IA 3EGVA 3K1YA 1EVQA 1RLTA 1QK4A 4UHHA 3A06A 4EW6A 1GNPA 3KUXA 3IV6A 2RJNA 3BE5A 3LQQA 3NP7A 3UJBA 4C0KA 2EKPA 4GXTA 2QRHA 3CPSA 4BE9A 4HH1A 3S2SA 2WDPA 1U0NA 2NN3C 3KT8A 1H69A 1Z37A 3GK3A 1H5NA 2GRUA 3HG7A 2AF4C 4X8MA 1E2GA 1CUWA 1EWRA 1GV0A 2JFZA 2WSSA 2YCBA 3P32A 4M7PA 2CLIB 4MS1A 2ZJ1A 5EP4A 3RVJA 3TW4A 3F5DA 4BO5A 3PUZA 5EJ6A 3E5HA 2RK4A 1BX0A 1ZM7A 5BUCA 1DIOB 4OY3A 2UXBB 4KE6A 2BC9A 1UDXA 3O1JC 3SIXA 1KAQA 3O8DA 1NJ5A 4GE0A 4MWCA 2SBTA 5I5GA 4Q4CA 2KBFA 4HRYA 3UHOA 3EW9A 4JMLA 4QBHA 4D4HA 3I9FA 4EFLA 1ADYA 2J3IA 3PQCA 4BCCA 3GA7A 1A82A 1T9GS 2B4RO 4UUNA 2FJUA 5C4IA 2ZBUA 1LQTA 1UOQA 2ZUDA 5KBYA 2HLDD 1C1XA 5JSFA 1TM5E 4BJHB 4OBXA 2A7XA 2JH3A 2BELA 4P0TA 4NOLA 4L27A 3MOSA 3EDOA 4AN4A 4AZ0A 4AWAA 1TMYA 4FW8A 2Q5IA 4DHWA 2HA4A 2A9RA 5KTOA 2Z57A 2J45A 3HUFA 2K5UA 1ZCFA 3IMGA 3M6WA 3MJ4A 2AQHA 5HS6A 2BAGA 5G4KA 2YOGA 2QRLA 3THOA 3GFVA 2D4AA 3BN3A 4L15A 2ZRKA 3RVNA 2GD2A 3N7TA 3IIMA 4E07A 2I71A 1X8KA 4LMAA 4DILA 3BAFA 5LJIA 1AKVA 3T12A 3SQNA 1CUSA 1FUYB 4EKIA 4PFSA 1EQAA 2HMYB 1W87A 2IGBA 2X8AA 1XAJA 4N3GA 3S5JA 2GK7A 1BJTA 2FQQA 4DC1A 1LC3A 5HSGA 4ZC8A 3P9RA 4EKDA 4DDWA 1XRPA 4H0NA 1PRYA 2ASEA 4LFAB 3GPDG 5GJBA 3HR8A 4H1VA 4G0MA 1MX9A 1EWVA 2P8SA 3JU3A 1AUOA 4M1WA 1VJ5A 4TL7A 2HXYA 1AK9A 4ALMA 3VYVA 3KQKA 3AL2A 1ZK3A 3EY9A 3MTJA 3ZOZA 2HQOA 2RHMA 3UJCA 5EMNA 1PJ4A 2AR7A 3JZAA 1D6SA 3AFNA 2O0MA 3OC6A 2IZ5A 2W6JA 3JTMA 3KLOA 4FWTA 4G4IA 1Z28A 2FPLA 5HIKA 1AGYA 5HIJA 1C2TA 3LHFA 1FQWA 3BDVA 4N82A 2ONYA 2PV0A 3HLKA 2XGOA 4FGLA 4D2IA 1LQ2A 3PX3A 3BL8A 4UDOA 2FZ4A 4CLRB 4EMTA 2Z1NA 5JNUA 3DG9A 1MAWA 1I13A 1UKCA 3ZLJA 1C3LA 3ME5A 3N0TA 4YRGA 4G3XA 1Z6PA 2IYUA 1TK3A 1TL7C 2JATA 3DUFA 2G88A 2RGCA 3BB4A 1G291 1ZUHA 2A9FA 3HZHA 1UXGA 2VXOA 3KOOA 5BSRA 1KEKA 4EZIA 3JQQA 3SC2A 3W1VA 3FKSA 2CHQA 2PD3A 4TPKA 2MSWA 1NXOA 3S70A 4ZYLA 2RGNC 1JR3A 3NT2A 1KZ6A 1OIWA 2TMYA 3HA7A 1D5WA 1EPUA 3I45A 3P0RA 1WF3A 1LSUA 3R4CA 3NUZA 4P7JA 4XCVA 5ED0A 3CEJA 4BO3A 4NF2A 4NK4A 2F90A 1AQUA 1QRDA 4R54A 1YHNA 2WTAA 1EGQA 4KNVA 4GPAA 3PUXA 1L7AA 2W42A 4I5EA 5E8JA 1TKBA 2IYVA 3AP2A 3I30X 4MITA 1SC1A 1CUHA 1B15A 3D2AA 3VR2D 1Q84A 2VBCA 2D00A 2ISSD 3GLHB 3QXCA 4RD3A 1OXSC 3DZKA 1CB7A 1F2TB 3H65A 1TYCA 2EJCA 2IZOA 3I12A 2PUJA 4AMBA 4AS2A 5KPDA 4A6EA 4ZCLA 4TMFA 5B3AA 2I6QA 2GDZA 3OE4A 4ZAZA 4XE5A 2DP4E 1Q1GA 2R7NA 3C3DA 4FR2A 1SB8A 1BIFA 1KK2A 3JQFA 3O8QB 4YPFA 3DOEA 2IH2A 3P45A 4KH1A 4B4OA 1QVRA 4QAQA 3H11B 3WLOA 1YDMA 4ARCA 4L8GA 5GP1A 3HEMA 3EA4A 1DCKA 3I5UA 1JH9A 3BMQB 1UUFA 3X1DA 2JD0A 4FFBB 4KXQA 4P7KA 3WNQA 2AMYA 4DLUA 5B64A 3IXLA 1YR7A 4DG9A 2QM8A 4O25A 1H0KA 1PFUA 1PS8A 1ULUA 4LY0A 4B2YA 4HH0A 3L4KA 1T1EA 1YCDA 3DTYA 1Q7BA 3W3AA 5JASA 3QQ5A 1D03A 1ND6A 1LV7A 1VJGA 4KWEA 3ASYA 1T3SA 4CDNA 4EUEA 4JC0A 3PC8C 4Y2QA 2JEZA 5DW3A 1TIBA 2JA1A 3FRJA 3GP3A 3R6GA 2GF9A 1FP7A 2R2AA 1GGHA 2XGMA 1L3IA 4NQRA 4PS1A 5ALPA 4K3UA 2IH4A 4R7TA 3DR3A 1GADO 4K9LA 4DV6B 3A0UA 5CLGA 5LCXA 1P1FA 1JWAB 4GT1A 3L9WA 4YAJA 4KU4A 1UDRA 3FSRA 3DBRB 1Z73A 4OHKA 1V4NA 2BFMA 2CN1A 4HYEA 4RAQA 2WSMA 1YB2A 4QEDA 4CJXA 4JV5B 3FGPA 3JD0A 4HLUA 1NI5A 3M5WA 4UNNA 5E4YA 4AG6A 2ODAA 4K9PA 1L5YA 5F9MA 4RGBA 3W3ZB 4O4IB 2FPIA 2OOKA 1T9AA 3H18A 1HLGA 2QSYA 4HGZA 1X92A 2JD2A 1GYRA 3IOMA 1E5XA 3UCXA 5AUPB 1CVLA 2OBXA 4I5GA 3R8XA 1MPTA 2KM1A 5AKLA 1Z6YA 2GX6A 4I5DA 4PHCA 3PD0A 4X1YA 2J0SA 4CM8A 1UK9A 1XMOB 3DQPA 5I7AA 3ZDAA 1RHKA 1G6OA 1JSZA 1W85B 2PVCA 1X1EA 2RHDA 3EFBA 4I4NA 3TDKA 3I64A 3PHJA 4Q1BA 2A3RA 3WC4A 2AOUB 4LKRA 5FIUA 5ETJA 1NSFA 2JFQA 3BD7A 3ZWOA 3QYJA 5J1SB 4PG5A 1NJGA 1NLFA 4OQXA 4BNLA 4Q24A 3HB4X 2Q99A 3SNHA 1VFPA 1B00A 1BH6A 1VL5A 4X0EA 5DF1A 5DRYA 1TVEA 5BWBA 4RCZA 1TOAA 2BH9A 2Q45A 2CJWA 4N7BA 2R00C 1HE3A 1EG7A 4FGSA 3MRVA 5EIBC 1GAQA 2BUBA 2VJOA 4F96A 2VS1A 2UZ1B 4RQAA 5JISA 1YXMA 4YDQA 5HUJA 3HL0A 1V35A 2HPZA 5ED4A 5IEBA 1B8UA 1KK1A 2UAGA 3SOPA 4ZI3A 2ZXEA 4TZ0A 4Q66C 2PM8A 3AT1A 2I9KA 4XLTA 1X1BA 4A16A 3H4VA 5B4VA 2B83A 4XWYA 4IM7A 3IQZA 3Q12A 3F6PA 4FCTA 4FN5A 2HI0A 2N1MA 3WIDA 4H4DA 1UBOS 5EIEA 4GU5A 5K8UA 1LX7A 5K8JB 1W0KD 4PNZA 3VPBA 2ZDHA 4U3JA 1M2NA 1T5OA 5KDLA 5ULLA 3VX3A 3NHKA 1NQ5A 4KI0A 4EPRA 3HNOA 5FL7D 5CNIA 3WKBA 3DMGA 4HX5A 1UAGA 1ZN8A 1TLLA 1N33B 4XX0B 1U3VA 1A9RA 1CQPA 2PRKA 2FWJA 4RZSA 1I5EA 2HCFA 2JBAA 4AWXA 4GRIA 2VJNA 5F2KA 1T0UA 5AIAA 4BNMA 5DNDA 5EHNA 2MSDB 1H0HA 3KAQA 1JRLA 4RFSB 4YN3A 3PHHA 5JADA 3ZEAA 3R9XB 4OB8A 1H1LA 2A33A 4PO3X 4HLCA 1PL8A 5CVJA 3ONNA 1WKBA 3I2HA 4BHTA 1Q15A 5FYDA 4DLXA 4E31A 1GGVA 3NNDA 1YACA 4DG5A 1WKVA 4YQFA 5IYZB 3NORA 3UAYA 4YCSA 4PRYA 2RG1A 4MCAA 3W5JA 2QX6A 2B5WA 1N7IA 1QZ3A 4V2UA 3IJ5A 2YVAA 3MJRA 4NMWA 3ZCVA 5BWOA 1Z4KA 2LKCA 4BNGA 3PGKA 3DTVD 3EB9A 4B6SA 4L0CA 5IC6A 1N5DA 2F1JA 5JOQA 2GERA 1ZH6A 1NMQA 2QTLA 3QA3E 4OHOA 4MWDA 4UAJA 4QPJC 5AVOA 5ITZA 2XDQA 5K3SA 1NSYA 1ORIA 2DWCA 2R85A 3BHJA 3DT8A 2NXEA 4MS4B 5E1BA 4CV2A 1IYZA 1ENYA 3JQ8B 3LHKA 1UPTA 2VA9A 1T13A 4PAQA 1T1IA 4HUJA 3ODGA 5AKGA 3QHQA 3VDXA 4FYPA 2QGFA 2ZJ6A 4IDNA 1ZJZA 4G84A 4M7RA 3FTEA 5J4LA 2I3BA 1JKMA 4KUGA 5HJ5A 1U11A 1W59A 1RP7A 2AT1A 2H1IA 2I55A 2QP3A 4MRPA 1WV0A 1IIBA 2HPHA 4PYIA 2O8CB 2C8LA 1RWBA 1UZMA 4ZT7A 2WG1A 2AJBA 3G9TA 4TWBA 1KJQA 2NO4A 4XGNA 2X3YA 4LMRA 3T34A 5BNWA 2GHQA 1I94B 1A69A 5C8VA 1DKOA 1NW4A 1IEWA 3GNQA 3H11A 4MW4A 4AX8A 1MRNA 1W4RA 4RUKA 1WHSB 2R66A 1IHPA 3IDAA 3CVXA 4YUAA 5F4BA 2IHBA 3DFZA 3WK7A 4YRIA 4E2FA 1E7MA 3FIJA 2O3TA 1GZSA 4N8EA 2CYCA 1CUEA 1YRYE 2QSJA 3NWOA 2JRLA 1M2KA 4BN0A 5FWYB 5FUMA 3VR5H 2XZLA 2ISQA 3FKQA 2ZRFA 4DNOA 3A3PA 3BD9A 5CXQA 3L6RA 2WA1A 4Z8XA 1I5OA 5JDIA 1IVSA 4K87A 2QLLA 2KWIA 1CJCA 2YMMA 3KEQA 4FDTA 2ZE6A 1M3SA 3D54D 4KQWA 5GOTA 4AJJA 1LBTA 3BTOA 5CFPA 2J59A 1XIVA 3IBFA 4WJLA 5T4HA 3NALA 3SLGA 3EC7A 2DETA 2J1LA 3BSSA 1GKYA 1E79A 1GPUA 1RQXA 2IY7A 4P31A 4R8RA 2BGJA 4BCDA 1ST3A 1AO0A 4PTZA 3OM0A 5DN6A 3U1BA 3C1UA 2WLSA 5JBIA 2R8YA 4CWAA 4LRWA 3WGGA 4RVUA 3ZBPA 2BZSA 2ZK7A 1Y9AA 4RNCA 5HJ7A 1TMKA 4ZYXA 1L4FA 3LY7A 2QX8A 3OIVA 4IF6A 1RXVA 4DNFA 3S5UA 5ISMA 5B30A 2ARKA 3AIIA 5BRNA 4NYIQ 5A9TA 4LN1A 2VSNA 2PBFA 4DUGD 4LYJA 1SELA 1R8QA 4AROA 3V1YA 5KHAA 1XR3A 3GFFA 2O3JA 5LQDA 4DRXA 2C2ZA 3G5LA 3DNMA 2QI9F 2FSVC 4LDRA 3I53A 2OHOA 4TM8A 1OF1A 3F3MA 2A84A 4XGKA 1I9GA 1ZMRA 3EZ2A 4G1BA 3MS4A 1QQBA 1MABB 1ZL2A 2BDEA 1XVAA 1L7OA 2IC5A 2WJGA 4HAXA 3KHSA 4LYDA 4UVHA 2J5XA 1H2AS 3T3HA 1ZK1A 2P2NA 2WJVA 4PQEA 4BMZA 4E4RA 5K5EA 2HKIA 2QYTA 4X60A 1ACMA 4DBLE 2XHZA 5ITWA 3M6FA 3J7AC 3O9ZA 1YT5A 1RZRD 4M8LA 1DEKA 3IAFA 4MVJH 2B61A 4D4LA 4AO6A 3UFXB 3RKSA 4RELA 3E0QA 2YV3A 4BEJA 4EJSC 1YFJA 1KF0A 2XWBF 2GEKA 3KT3A 2AV6A 3O8LA 4E13A 3FUUA 3CEMA 6GPBA 1EUYA 4N76A 4CGZA 1DJLA 1DELA 3GJ3A 3IXMA 3PQFA 3O8OB 1DKLA 4MA4A 4EVSA 5HDQA 3QTTA 4CL8A 2FFJA 1N1MA 3QV2A 1IQPA 2AL7A 1ELOA 5AVYA 2YJ5A 3ZGVA 2FA9A 3SQDA 5C1BA 2C9DA 5IH7A 2NVUB 1QLHA 5EP2A 3C1AA 1YUNA 3CF6R 3PJGA 4ZOAA 1UJ4A 2RI0A 2WPNA 1U8CB 1BS1A 2DFPA 2J5BA 1CNFA 5A0VA 2XWJI 3WBBA 2Y92A 3HWRA 5M29A 4PAMA 5BSVA 5FLYA 4FMCF 3K9HA 2O2GA 4EW3A 3DMNA 2ANBA 4I1UA 2PL5A 4OO3A 3UH0A 5BQOA 2PT5A 5E1DA 4DR3B 3ORQA 5K6AC 2A86A 1DQRA 3ZHQA 4LK3A 5ERGB 2A9VA 1H5UA 2EX0A 3N3AC 1OI4A 2JJ8A 1MW9X 4J29A 5HPYB 3ZWVA 1A88A 2YRXA 3VKFA 4BB5A 2ORWA 3L4SO 3NQ41 4HVTA 1VL1A 2C5LA 3I01M 3WYCA 4AMYA 1JKIA 3G7SA 4XYLA 2XCLA 4RJ2A 1E0JA 1KFJB 1NV9A 1ZVQA 2W2KB 2JJMA 2W6IA 3CW9A 3BGOS 4WKGA 1M1UA 1O2DA 1HLDA 3QJGA 1UINA 3FFAA 4CE6A 4M86A 4U7FA 5KYUA 1G8HA 1LPNA 1UMCB 2BJWA 1TI7A 1D1PA 4FK8A 5G0SA 3RYHB 3T7SA 3TXXA 1EDOA 4G1EB 4KR0A 1Z0DA 1EUDB 3CLKA 4QQKA 1A5SB 2BHTA 4LQCA 1AMOA 5L4NA 2L17A 3EGEA 2W2LA 3DFIA 3S8MA 3RRNA 3WGNA 2GBFA 2PBZA 3FI9A 1MVNA 3MWDB 4FI3F 3DMHA 2I80A 2Q0HA 4AULA 1VHLA 1PJ2A 1XFAA 1PYOA 2FSGA 4TV9F 3A11A 2IF2A 3F5FA 3FNGA 4WA8A 1B73A 3RNLA 1DMSA 2ZJAA 3EQ8A 3Q7EA 3GI1A 2HXSA 4Q3BA 3SMQA 5EE3A 3VKWA 4DCMA 7ADHA 2L69A 1TO1E 2CLCX 2LWIA 4QNNA 4UCQA 1DAIA 4L3OA 1NW9B 5DWDA 1INLA 3T9CA 2J0UB 3U4QA 1XU7A 5E38A 1Z6GA 3HB5X 4JI1B 2HBZA 4HSEA 1HQKA 4LJ7A 2PPLA 1ONSA 2V98A 1N2CA 2NV2B 4LGCA 3ZI7A 1PZHA 5GIOE 1W36B 1Q14A 4WDQA 3VH4A 2CE7A 3NXSA 5AI9A 3R23A 4A5SA 3KJXA 1NT2A 4IMPA 4NE2A 1BWRA 4RZQA 2QRMA 4XTCS 5DJ5A 5DCLA 4QUHA 3TSZA 3W5IA 3IAXA 2C88A 3UQZA 1OLXB 2PVSA 3WHIA 4B48A 5CBPB 3L7OA 2J46A 2Q0QA 1GG2A 2WW8A 4LVOA 1Y5LA 5KYWB 3VO8A 3O95A 4B7AA 5LSAA 5ERYA 5KJ6A 1L5OA 1RAIA 1Y3AA 4M1OA 4IHKA 1QYRA 2O50A 3DTVA 3KYCB 2RGWA 4IGEA 4P2GA 1RADA 5EMKA 2YJGA 4FUQA 1OE0A 4BLUA 4ZYUA 3C5CA 3RHZA 3GP8A 4EF4A 3EWAA 1PGQA 3B51X 2TRSB 2X2OA 3OA0A 2G4CA 4NCJA 1VIMA 4OBEA 1EUCA 3QA9A 1YOBA 2GJKA 2J0EA 3CVJA 3FCXA 4IXNA 1N0WA 2WP0A 1Z6TA 3AG5A 3F3SA 1G7TA 4NFSA 1QB7A 1NC1A 1RYBA 3CV3A 3ENVA 2OV3A 3Q8XB 4QXPA 3RWOA 3NPAA 1VL8A 2WA2A 2DERA 3QVWA 5EHGA 1IZZA 1SKYE 1U6JA 3T99A 4E2YA 4L28A 3IQGX 5EHQA 3NHLA 2G17A 3HWSA 3AEKB 4YAKA 4QTXA 5CLFA 5JNRA 3M1LA 4G09A 4KJXA 4RF3A 1WZ2A 1LZKA 4FSHA 1HZJA 2P78A 3AR4A 4Y2JA 4DE5A 1YULA 1I6LA 1W46A 3A1TA 1FLAA 1NDUA 6PFKA 1NJ1A 5D3KA 2ZT8A 3EHDA 3F5MA 4G2TA 4TMTA 1Z5VA 2AE2A 5HF8A 1OWNA 2X13A 1Y1RA 4BZZA 3KKEA 2X5OA 4TTRA 2HNBA 4YMIA 4EATA 4BVAA 5BQXA 2OAP1 1SU8A 1UM9A 3E3AA 2POQX 1GQQA 4AF7A 3QMVA 4PHHA 4TSKA 4WXMA 2CVPA 3ZDEA 4K6GA 4W9RA 2PRSA 1RFGE 3SICE 1DQSA 2JCBA 4KK3A 3GEEA 1X7ZB 1HBJA 3TTVA 3QQPA 3WYGA 1MTOA 2H29A 2CF6A 4JP3A 4LBZA 3Q7TA 4XIGS 3UYLA 4C22A 5TIIA 5JJIA 5IXSA 3JRWA 4UHKA 4JUFA 4DJAA 4E5SA 1YVEI 3TGLA 2I3ZA 3QGMA 4QNRA 4GOXA 2VQ6A 4ZZ0A 1AU9A 3HU1A 3N5CA 4PO1A 5DLDA 3NT4A 2DCUA 1MNAA 2E55A 1GTZA 4N5LA 3GPCA 3B38A 2YZGA 4UTOA 2D5BA 4DF3A 4ZMSA 3ZDDA 3PE3A 2ZANA 3OQBA 5FTMA 1OLXA 4B6JA 1QJCA 3RJ9A 3C6QA 3ZBQA 2ZVJA 5L3RA 4BO6A 4E5NA 2G4VA 4BE7B 3D5TA 5BSFA 2PKCA 4MMYB 5F33A 2YFQA 4YDSA 2FPOA 1NF8A 1IK4A 3BXHA 2LTAA 2QN8A 3ID6C 1A4IA 1NBME 2Y68A 5EJ8A 3OOEA 4Y2TA 2QQ0A 4L6CA 3O6VA 3E7DA 3M34A 1C5KA 5A2GA 3C3YA 2XECA 2Z43A 3WDMA 4LC9A 2C1EA 3AVXA 1E6WA 1K7FB 3FPKA 1RQGA 3I3OA 2PNFA 2B21A 4J4BA 2VDWA 3IPCA 4LE1A 4Q1AA 3T4EA 3E7FA 5AOCA 3QX3A 3FWHA 1H6DA 8LDHA 1JIQA 1QFXA 3OEEA 3P9YA 3FPBA 3WL4A 4KWTA 3IE1A 2QRZA 2ZKIA 2ZJ4A 3AJAA 2X7HA 3WJ7A 2PGDA 2YOHA 1HF3A 2DRIA 1FFWA 2Y27A 3DJYA 4UU8A 4Z86A 3D3KA 3RIXA 1QU2A 1FS6A 1RYYA 3N7UA 2GSWA 4PG6A 4J0EA 4OHPA 3MB5A 3MMSA 4J03A 3L7DA 2VNSA 4JCCA 3SFTA 3UBTA 2MSLA 3GIDA 1SPBS 4EENA 2V0GA 4O59O 1X13A 1TFUA 2W9XA 3ABOB 3M82A 2AJLI 4QE3A 4Y2PA 3DLAA 4AYXA 3WZ2A 4D4MA 2GNOA 1EXVA 4CKCA 3L79A 3GEBA 1PBTA 3LIPA 4YBZA 4Y6SA 1WXWA 3JAKB 3KP1A 4IR7A 5JSYA 5CA0F 1O8CA 4ABTA 5MGBA 4FGUA 3G59A 3LYHA 1KDZA 3EDYA 1KMCA 1YI0A 3SS9X 4ZOCA 4DCPA 3T3GA 5TRTA 2GPBA 1XDGA 3TRIA 3FUXA 4OHRA 3W5CA 3M89A 4C2UA 4QM6A 5EKSA 5IS2A 2V1XA 3FYUC 3WB2A 4XWAA 3FWZA 5KC9A 4EDFA 4BRZA 4TMVA 1DKRA 4PC3A 2CXUA 5BQFA 3WAJA 1KJ8A 1VIDA 4L9SA 4F92B 1OU0A 1QKJA 2QZ4A 2XLCA 3R0IA 3DH0A 3IAM1 5J4YA 4RWEA 1UPAA 2JF0A 3R5JA 4UCWA 5DCWA 1IHYA 2RIRA 4BATA 4MYDA 4N48A 4CF6A 1CJSA 1WD7A 3A2MA 4FC7A 4KXYA 4O2BB 2OXTA 5AI4A 2HPVA 1GFSA 1DHTA 3CLRD 2YYYA 4Q3NA 4V1CB 3GOHA 1XD8A 3G89A 3U7EB 3LMKA 5KCMA 3RANA 2WI8A 4YAIA 3UC5A 2Y1KA 1QB8A 3ONDA 4ETNA 1DBSA 3UW3A 1AUXA 3DOOA 3RBZA 4M9CA 4IRMA 2WR8A 2ZIAA 3CKMA 4KE9A 3TRKA 5FDFA 1VMKA 1YS7A 1MOSA 2OENG 1CUYA 5B2EA 2ZLBA 4IO1A 4ZVPA 2D1RA 5KWJA 3DWEX 4NATA 2WTUA 2FF5A 2O07A 5EE0A 3RABA 4CI9A 3RFXA 1FY2A 3BJZA 3IB3A 4XRRA 3RPEA 5F5NA 2OZPA 2ZYAA 4NPHA 4XQGA 3TRFA 2I1QA 4FIZA 2FEWB 4KJZA 3NM6B 2FEXA 1RKBA 2NMVA 3NLLA 4LCJA 2YVLA 2C20A 2B82A 3E1KA 1TUGA 5LBUA 1P8JA 5I01A 1Z6QA 3BRSA 4DPLA 2R1VB 3JASA 1TZ2A 3RGGA 1KNQA 1QM5A 3JWHA 4AF8A 3OJWA 3KAKA 4TLBA 1FNNA 3L6CA 3L7NA 5HGJA 4P0PB 1GUYA 4EIWA 3QLTA 4NX2A 2GBCA 5HQ3A 4S04A 3SY8A 1ZFNA 2OLKA 4LF4B 1QXSA 1Z18A 2WNSA 1EKXA 4HDKA 2XY4A 2JI6A 4PV7A 3U4CA 3UWSA 2AFIE 1QIFA 1SPXA 2GM3A 4OEHA 2ERYA 4XM2A 4PAGA 2C2YA 2IIBA 4DR2B 5AK4A 2FAXA 2I34A 4GMHA 4E32A 2C7GA 3K9BA 2W6CX 2UZ0A 1R2QA 5AM0A 3IB6A 5HCNA 2J3EA 3TZQA 3KUUA 2WG2A 4XD2A 1V3QE 2C4UA 2BHRA 4HWKA 1U8TA 2XQFA 2D62A 3FUWA 2HOQA 2FOXA 3FLMA 4PCVA 3S68A 4M4SA 1BE1A 3TE6A 1NKSA 3UMGA 3HO1A 2F55A 4R2IA 3B8HA 4TV8B 4ZOQI 3T5MA 5CPBA 5H02A 1Y1TA 2C4NA 1HPLA 2CXXA 3NXKA 4ZCPA 4YV7A 1V25A 2Y76A 1NYTA 1Z7BA 2IYOA 4OJNA 4Y1RA 5JBQA 1GP2A 3LUJA 5AUOB 1Z6ZA 1CERA 3PVZA 2IEDA 1Z7GA 1FPQA 4FZVA 1FMJA 1G20A 5TQ0B 4BNZA 3N1UA 4DXDA 3IUPA 5BVGA 2KE5A 4KLRA 2D5LA 3E84A 4CF4A 4WFQA 2I3GA 2I2DA 1CEEA 1HX7A 2HO5A 4A2QA 2Y6VA 3SYLA 4JR0A 4XOIA 1Q74A 4F3TA 2JFNA 4BV2A 4RVNA 1T5LA 1FTYA 2OKCA 1J70A 1NAHA 1XJCA 3GT0A 2EX1A 4RXUA 2PL1A 4W7HA 4Y67A 2BFPA 3B2EA 5I7VA 3QKIA 2W11A 3F47A 5CM2Z 2GZSA 5ENZA 1JDZA 2BV3A 1ISSA 2BFEA 3O4HA 1RWPA 1TGVA 3JATA 4GR5A 1QCZA 4OSEA 2A6PA 4US1R 1LBEA 5K0GA 5KVSA 3K16A 1UM9B 3VKVA 4WY8A 1JXQA 1EGAA 2HDHA 3GAMA 4UJ3A 3DE1X 1I5RA 2WIJA 5GZ6A 5EXXA 3C3PA 3DWIA 3EBPA 2IODA 1XDWA 1W36D 4JLDA 2MR6A 3X44A 2AC2A 2ZZKA 4Y1GA 4OYRA 3RCBA 1R37A 2D3TA 1UPXA 2JJ2A 4DNPA 4F60A 2HK7A 3UG7A 3L7MA 5T41A 1EWQA 3JZIA 2AJCA 3HN2A 3T9DA 4C9BA 3EMKA 2CLSA 4HB0A 5KB3A 4G24A 5ALFA 2A7QA 2C3PA 5LZ8A 5ITZB 4XLZA 1QG6A 5A6SB 4ZYWA 1L3CA 4WTOA 1VMDA 3H05A 2VZEA 4Q4HA 1E3TA 3GLKA 2EFCB 1P1JA 1L3BA 5C8YA 2YC2C 3AVWA 1LK5A 2CZCA 2WJJA 3IAEA 4XUDA 4LHZA 2GTHA 3WRWA 2AG1A 1Y8QB 2IOFA 3I6QA 1ZJYA 4R9NA 3G2KA 3NNNA 1WZCA 5TQJA 3GVPA 4HWPA 3LDGA 1RXWA 3T3OA 2WWWA 4KLNA 3RK1A 5JS6A 2IXBA 7ABPA 2GJAA 2VTBA 2BW0A 3EGDA 5LP6B 2IIQA 2I03A 1PGJA 2VKTA 3CONA 3C3JA 3BXGA 4KR9A 4R1TA 1Q3TA 5EJ2A 1M7HA 4RFSA 5LN1A 1L5HB 4YJGB 4CMGA 2CFSA 2WUEA 3JQ9A 4GBGA 3DMFA 3A04A 4YBRA 2G3YA 4Z3KA 4LI3X 3U39A 1TQ4A 1XK7A 1SQ6A 2O8NA 2YQZA 2NQ8A 2PBLA 3OZEA 1U99A 1DL5A 4FFOA 2XB8A 4CMJA 3E9NA 5HHTA 5JC1A 1BROA 4LF7B 2VDUE 3B8EA 3NI2A 4G9GA 1U9YA 2MYPA 2HA7A 4JNKA 5FB3A 4J1NA 3CRZA 3MLEA 4K86A 1FUUA 1NVFA 1SVMA 4D3DA 3TXAA 5FFMA 1KFCB 2XYRA 2A5GA 2VHVA 4NYMR 5KYXB 2IUYA 1V4BA 2OG1A 3MPOA 3H5RA 3L4BA 3H6GA 2CZQA 4RQBA 1FUEA 3WK9A 5C51B 2UXCB 4RHXA 5JVDF 3LCUA 3E7WA 5KSWB 3INGA 4I46A 3KZNA 1NN1A 2AFIB 2TSYB 3K2QA 4OXYA 5IVHA 4MQEB 5ALHA 3AM1A 2H5EA 4LHVA 5GIPE 4LXUA 1C9YA 1DT3A 4FDAA 1G5QA 3IV7A 4NU0A 1PG2A 3X2FA 1IBMB 1V95A 3SC6A 2X40A 4Y2UA 2QN9A 4BO4A 3DOFA 5FT9A 1V47A 5J23A 1M2FA 1PWHA 5I4CA 2ZIZA 1DNPA 1K2VN 1NG1A 1BXRA 2PWBA 3BSWA 2JHCA 3GUHA 721PA 1RW4A 4L5YA 1D1TA 1XF1A 3OQPA 4Q7LA 1WNFA 2EBHX 2QPOA 3EPHA 5LXTB 2CDAA 1E1YA 3OZRA 2E2WA 4BLWA 3NH9A 4PCUA 1VQ1A 5JNLA 3BQMB 4AUMA 1IU9A 4U7HA 4HVLA 5JQWA 4LXIA 3L1UA 1A96A 5B2ZA 4MVJG 1H3NA 3RG2A 3NETA 1TIKA 4Y2SA 2H51A 1RFLA 2CNOA 1U0EA 7REQB 1OZFA 3KLPX 5JSQA 3AR3A 3JYLA 4D3YA 1FRNA 1OWPA 3GJ0A 1P2TA 3UAWA 2OYRA 3WTCA 1Y3HA 3VDRA 4O4IA 1DIHA 2GI4A 1IOLA 1YQUA 5A5GA 1C0PA 3EISA 5EJIA 4C1NA 3A6PC 2FMTA 3DP7A 5LFAA 4QDZA 3AFOA 2WTMA 3EASA 1RRVA 5FEMA 4PLVA 3D6NB 3FSGD 5CT8A 3VI3B 1FFXA 1R88A 4IMJB 3CVWA 5IK2A 1TC2A 3R20A 1M8JA 3KOMA 3ZDFA 4JD5A 4KQ2A 4UBOA 4C06A 4G81A 2VTVA 4MI6A 4CNBA 421PA 3OIFA 5CJ2A 2FH5B 1DIRA 3IURA 5JALA 1XDZA 1RT9A 2H2HA 3A1SA 3G5UA 1X1RA 1ZIDA 1KARA 4D9EA 1C3OB 1X94A 3EPPA 3WK5A 1V8PA 2QA5A 3FJOA 1GL3A 4I7EA 5IJXA 4ENUA 1Y6JA 4FYYA 5ARCA 4MROA 5CJPA 3B6ZA 4RNDB 1F4LA 2ECQA 3A4MA 4F9GA 3QLEA 2B0CA 1UFKA 3KUKA 4R3UC 1HDIA 3GJXC 1I7PA 3M4ZA 4KYTA 2CVZA 3SF8B 3VR0A 3OC0A 3SBXA 4EUHA 1GZ3A 4JBNA 2QTGA 4LGYA 2VJMA 1Z13A 2NZVG 2NOAA 4IIJF 4IIYA 4MJ3A 2OTCA 1LS1A 1NNEA 3UGTA 1UBRS 2Q3LA 2YASA 3CZMA 3ER6A 3W8EA 2BI8A 4MUEA 2F1RA 2ZYTX 3ICWA 4DIFA 3H9UA 2BRUA 2P65A 1MABA 2B9EA 3OZCA 3T35A 1VE3A 1QAOA 3BIWA 1TU0A 3EZXA 2FXIA 3L49A 3PXBA 4YRZA 2GQ0A 4PLPA 3T1OA 7YASA 3S8YA 1GQOA 5EVJA 3V4ZA 2HR1A 1LK0A 2YIVX 3A4VA 3RIYA 3WGQA 3STXA 1CDDA 2X8JB 3GRZA 4ENVA 2GD6A 1W49A 4DMGA 1NF3A 1M1YB 3WA6A 1QDLB 5AJZA 3GLHA 2SECE 5T3UA 3AWIA 2HHJA 3QW2A 4POOA 3GEPA 4NCIA 2QNBA 1NIPA 1P45A 2C4KA 5FBWB 1EFPA 1ZM9A 1SU7A 3FFXA 3NWJA 4EK9A 1S8AA 5JTUA 1UT8A 5G1PA 1KBZA 3OJOA 3NWPA 1G2IA 2Q0SA 2UVDA 3GGOA 2VT3A 3MWEB 4N8SA 2CHVA 1CY4A 1Z25A 1IWBB 4GSLA 4GGMX 3MG9A 3PGA1 3GRPA 4K6FA 1JG7A 3H1EA 5EYPA 2J7PA 4M0LA 2GVZC 1OWOA 4ZCMA 1Y7LA 3E8SA 3A2LA 4FP9A 5E9JA 1YZ3A 1KS2A 3TPCA 5TMPA 3DEKA 3NCTA 3KQHA 2LGJA 1GGJA 1F2DA 1RRGA 2FX5A 1NONA 2WJZB 2ZUFA 5HP4A 1ND5A 3LQRA 2BIFA 4QPPA 4FYJA 4WD3A 2E89A 4YRNA 1UC8A 1DDGA 1SCJA 3WNDA 2HRZA 3JQEA 3A10A 1X77A 2JW5A 2W48A 3HN7A 3HZRA 1KI1A 2FLWA 3SFZA 1N5OX 2Y1DA 4IYRA 3WQBA 4C0QC 2WM2A 3DZHA 3KJGA 1K6XA 2EBUA 3QKUA 4YNBA 3FB1A 3HJHA 3P26A 3KKKA 4PGHA 1PYGA 4A1OA 3RKUA 1HMYA 4R9RA 2IUSA 1G4AE 3UK6A 4BRSA 1E3EA 2V8OA 5BRAA 5LP6F 1J20A 1UAYA 3O7WA 1GZ5A 4BVFA 2EW1A 2VJDA 4BX9A 3ZV4A 2V03A 2HCJB 3LOQA 4W1PA 2FZWA 3K5WA 5EQTA 3WSWA 2WMYA 1YCFA 1BGWA 3IQFA 4RIHA 2DQSA 3VNAA 1DIBA 3IRUA 4L08A 4C0BA 2LKDA 1MC1A 3EWNA 4NE9A 5DGIA 4ZC1A 3RIEA 1LH0A 1N7HA 3FCOA 1GRQA 4OMUA 2HMTA 3FCAA 1USVA 2PKXA 1GKLA 4D0SA 2P5UA 3V1MA 3OEHD 1O54A 2KS6A 2ZRDA 2ON6A 2G0NA 3F3YA 1Y6GA 1B8NA 3IKVA 4BGUA 1PCXA 3AINA 4BECA 3PHIA 4R8KA 2CB9A 4J8PA 9ATCA 1RYDA 1KTVA 2UUOA 5ALTA 4Z9YA 3OLYA 3AYZB 2NSLA 2G8NA 4XFDA 5IHPA 1P39A 3QU4A 2PRYA 4ND3A 4BNDA 1F8FA 4EHNA 4PHTA 3LLSA 3LT1A 1J5XA 1UWKA 3QKSA 4W7SA 1KSJA 4YDRA 4BNHA 4DLBA 3T1YB 3FSGA 1PT8A 3HJTA 5JVDA 1SZDA 3U5TA 4RM3A 3OJXA 3GRCA 1RXCA 4RULA 1Z74A 5I9TA 4BAUA 1UQTA 4MDHA 3H5WA 3RKRA 1S2LA 4FE7A 3SZMA 2AG6A 4QRDA 4CG0A 4F5DA 2P6MA 3PA8A 3D7NA 4E1BA 2YWFA 3DAFA 1XZFA 6REQB 4P3YA 1JB1A 5B3LA 5G0WA 2IH5A 4XB1A 4IDCA 1I80A 4DLLA 1EIWA 3ILYA 4IJVA 4W6QA 3S2UA 3I04M 1AQIA 1D9XA 3G2QA 3ML1A 3TLEA 2RGYA 1DTSA 1CUBA 1QIGA 4JU9A 1K3FA 5DI3A 2EG9A 2AR0A 4G67A 4REOA 4ZQCB 5HFJA 2OP0A 5KX5A 4Q7MB 1L9KA 3R77A 4CTOA 4EWLA 5KIAA 3EF1A 1SWVA 3H3JA 4C5AA 2AWNA 3B3GA 1G38A 1JR3E 4O63O 3RLIA 2X0EA 5A4MS 4TV8F 2V96A 8AT1A 1VG9B 4HY3A 3PUVA 2VPZA 1LBHA 4XDHA 3FAZA 3CLSD 1JILA 2A94A 3COYA 3KS9A 4JQSA 5BUSA 1ZONA 4WOJA 2ES4A 2I87A 2RHWA 3ES9A 1D9ZA 3EMDA 1T10A 1T5HX 3O83A 3N2ZB 5KOIA 2X0JA 1Y8ZA 3EIHA 3UK1A 4P08A 1DTWA 2I78A 3MLBA 1LLDA 2CHUA 4X7MA 3OFVA 4WNCA 4HQFA 4L4ZA 4BZXA 2A88A 1E0DA 3B1FA 1J2YA 1V5FA 4QAJA 2H65A 2RHRA 1OPRA 1NFRA 1DKQA 1U8EA 2FQXA 3IT0A 4UNSA 4EA7A 3SXPA 3IR7A 2WKQA 1MB0A 1R0LA 4MR8B 4QBKA 1FZTA 4MW5A 3UWKA 3HQ4O 4HX2A 4J7XA 3QY9A 2WV7A 4OJYA 2ZE7A 4MYCA 2D1YA 2I4OA 1POXA 3N2KA 3AW9A 1WCYA 2JAUA 3HM2A 4RK4A 4G26A 3NDJA 2VDNB 3B70A 3FVRA 1KFEB 5G1NA 4CIDA 3UOAB 5B57C 4BVHA 2CJPA 1E2BA 1AXGA 2FSFA 3INTA 4TTTS 3PPWA 2NU8A 2DJIA 2AFHB 1XLTA 1VBFA 1UMBB 1FCJA 1H8ED 1F6DA 1RCUA 1QMPA 1IQ0A 3SZGA 3HKEB 2FPRA 3FB4A 1JYSA 4HDNA 4IDEA 4IJWA 1P72A 3MNFA 4YJFB