1SFRA

Crystal structure of the mycobacterium tuberculosis antigen 85a protein
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
AFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Antigen 85-A
publication title Mycobacterium tuberculosis Antigen 85A and 85C Structures Confirm Binding Orientation and Conserved Substrate Specificity
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 100
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2004-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sfrA00
4BTLA 2O2IA 4K6HA 1QTIA 1QIEA 3C6YA 1AX9A 5CTAA 4QZVA 2OQIA 4GBGA 1UK8A 2B61A 3WK5A 2FX5A 4XJVA 3C43A 2XUQA 4FBMA 2W22A 4EB0A 2B20A 1TIBA 2I3DA 2GBIA 5ALHA 4WCVA 1UKAA 2XUGA 3F98A 2ZSIA 3WKDA 4JUIA 3WJ1A 1TCBA 3AIKA 3IUQA 3DKKA 4G8CA 2HA0A 3U1TA 3QMMA 1UWCA 4UBNA 5I8PA 3WYNA 3C6XA 2XUPA 1H2XA 4AZ3A 2Y1KA 2YXPX 1BE0A 2WJ4A 1VZ3A 1D07A 3F67A 5ALWA 4BVKA 3ZI7A 4ZRDA 4DLNA 4FLFA 4RE6A 3SK0A 5F4ZA 1R4ZA 3HLKA 5K3CA 1LPBB 4WDQA 3O9VA 2NW6A 1XQVA 2WIKA 5ALUA 1UKBA 2VATA 1CUJA 1IUPA 3BIWA 5AOCA 1ACLA 2JEYA 3FAKA 2WUDA 5JADA 2HU7A 1CRLA 4FOLA 4H7HA 3L1JA 3I2GA 2O7VA 1CFJA 3AUKA 2VA9A 2HIHA 5JZSA 2W6CX 3OM8A 3CN9A 4UHDA 2AXEA 1HL7A 1OXMA 4Q3KA 4BVLA 1GKKA 2DQYA 4AX4A 2AJDA 4N8EA 5LKAA 5JALA 1AURA 1CUFA 3TEJA 4CCYB 4DMCA 3IUMA 1IUNA 4ZREA 1WOMA 3Q0TA 4H7JA 2H1IA 4L72A 4W1QA 4WFIA 3FSGD 3BL8A 5CT6A 4J7AA 5DYWA 1ETHA 2FJPA 3STWA 3T4UA 2QRUA 4ZV9A 4CCYA 1C4XA 2CJPA 5AM4A 3CXUA 5T4BA 2XUJA 1R50A 4IHAA 1LBTA 1XZBA 3RLIA 3AJAA 3O0DA 4N8SA 4RNCA 4W9RA 2O2GA 4QWMA 7YASA 1GT6A 4BBZA 5K3AA 3WZLA 1CV2A 3PICA 3S2ZA 4OYYA 1CR6A 3H1AA 2X76A 2XE4A 1UK9A 3WKCA 5HZGA 4BZZA 3BDIA 4DSZA 3OPMA 5EHXA 4FFWA 1ODCA 1DWQA 1HPLA 4N8DA 4DGQA 4Y7DA 4HXEB 1B6GA 4GW3A 2WHRA 4PSCA 3WLAA 3HABA 4JYPA 3I2IA 5ALEA 1G66A 3E4DA 2Y6VA 2BGNA 1A8SA 3O4GA 2WTNA 4Q3OA 4OYLA 4XX1A 3ZV7A 1AMNA 1R3DA 2PVSA 1LPAB 4B7ZA 2WIFA 2R8BA 1Q0RA 1YSCA 3QITA 4KRXA 5SYMA 3ESDA 2XUDA 4JEIA 2JBWA 1GZ7A 2BAGA 4QEKA 4A16A 2JGFA 2OGZA 4CFSA 2WLSA 5K3DA 5LZ9A 1CUVA 4UHEA 3QBJA 4ZXFA 5ALNA 2CKMA 1G42A 1LPSA 3LLCA 1CPYA 4WY8A 1HLGA 4DIUA 1NX9A 2GBGA 4HTAA 4Y2VA 4U2FA 3G8YA 4OPMA 3ICWA 4J0HA 2WM2A 3O4JA 1E8MA 3FCYA 5AOBA 2WHPB 1EDDA 3QMWA 3WKBA 4EBBA 1MN6A 4XIIA 4K6GA 3WL8A 2PU7A 3BJMA 4KE6A 5LZ4A 4QDZA 1JU3A 5HCUA 4KR0A 4J0GA 4AQDA 2XUKA 3UUFA 1W6RA 1VE6A 1R1DA 4OU5A 2B9VA 4G4IA 4GHWA 3I28A 2WHPA 5KREA 4H0CA 3HZOA 1ZGCA 3SWWA 4TPKA 2C58A 3AFIA 3VJKA 5AIAA 2O2HA 4LYDA 2QM0A 3FCXA 3L1IA 3DOIA 3GELA 4M0EA 4BCCA 4DYHA 3VVLA 2QXUA 4HXGA 2HA2A 3GA7A 1I6WA 3I2JA 3C5VA 4IQ4A 5FUMA 1UFOA 1DWPA 1FSSA 5LKRA 5AKKA 3WWEA 3R3ZA 2WHQA 5I7UA 1MX9A 4DMKA 3KXPA 3FVRA 4KE8A 2GYVA 2J4CA 2QOEA 4Q82A 3QVMA 3WL5A 5K5EA 3HI4A 3OTQA 4KACA 2WFZA 1CLEA 1XQYA 3C6BA 4ITVA 3VISA 4BC1A 4BRZA 2PM8A 1YCDA 4LKOA 4H77A 1BU8A 2GYUA 1TAHA 4C88A 1QIMA 1H2WA 5E4YA 4KAAA 2Y2UA 3NWOA 1EA5A 5CH8A 2B4KA 2XMRA 1AUOA 5AKGA 5AP9A 4FKBA 1UXOA 4BDTA 4DSAA 1DT5A 4Y2YA 3KOOA 5DNVA 1K6EA 1XZKA 3FNBA 2QVBA 3AZOA 3O95A 4H18A 5A7FA 3O4HA 2WU4A 3A2LA 2FJ0A 3DYIA 3K6KA 4AB1A 3I1IA 2XLCA 2XMZA 2PSJA 4LIPD 3DD5A 2J3DA 3I2FA 1BCSA 4L0CA 1UK6A 2H7YA 2AJCA 1XZAA 1KU0A 1CUGA 2QJWA 3O9MA 5EHZA 3STVA 2VEOA 1XZJA 1MO2A 3WIBA 4QA9A 4EY7A 5KBYA 2J3QA 4KEAA 4OB6A 1K63A 2DQZA 3D2AA 1E8DA 5FPPA 5A7GA 3R3XA 5AI4A 1A8UA 2BGRA 4FFVA 4CCWA 1IVYA 4B85A 1CUHA 1A88A 3V48A 2D5LA 1XRPA 5AI5A 1X2BA 2V98A 4BP8A 4UFOA 3WWCA 1C7IA 2CBGA 1SCIA 3JW8A 2RGUA 1XZHA 1N1MA 1CUDA 4EHBA 5JD6A 3HXKA 4X85A 1P0PA 4LXGA 2HRQA 3AINA 3QZUA 1OCEA 3V9AA 5EIHA 1TRHA 4F5ZA 1ORVA 2HFJA 5DWDA 4B83A 3ICVA 1BN6A 1CUSA 4E14A 5AI0A 4HRYA 1HDEA 2QT9A 3P2MA 4B0OA 4X94A 2IIVA 3UUEA 4KE7A 1E5TA 1F0PA 3G9TA 5HKBA 5HF5A 2DHDA 4C6HA 1WPRA 3FYUC 5BOVA 3ZLTA 1AKNA 2QUBA 4X91A 1XZMA 2G63A 2HA4A 2WUGA 4NVRA 1LGYA 3G9UA 4P08A 5AKHA 1L7QA 1Z68A 1W1IA 2VQ6A 4N5HX 5AHXA 3R3YA 3H2HA 2XB6A 2ZVDA 3DDUA 3H2JA 1IMJA 4FMPA 3DL7A 1DWOA 5CH5A 3PDCA 2JGJA 2DCMA 1LLFA 2Z8XA 3HRHA 3PF8A 3W05A 1XKTA 2P8SA 2WJ3A 1G4HA 1IUOA 2Z8ZA 3EQ9A 4Y2XA 3V1NA 5FRDA 5ALFA 5AK3A 3M83A 3F9CA 1DQZA 3AZPA 2R11A 3FLAA 3FLEA 3H0CA 3NOXA 4WFJA 3G02A 2OGSA 3IUNA 4CG1A 1FFEA 1ZD5A 3E1GA 3OC0A 1THGA 4X6YA 4UHFA 1P0MA 4H35A 1VLQA 3EIOA 3LP5A 5LZ8A 5I9IA 1BN7A 3SX4A 5FP0A 4NMWA 4C4XA 1PJAA 2BFNA 4GLBA 4DM7A 2WKWA 4CI9A 3FVTA 5HK8A 3H19A 1O6GA 2G5TA 4Q05A 5BV7A 2C5FA 2EDCA 1CUBA 1LBSA 3E0XA 1N8SA 1XZFA 1JJIA 2YASA 5JATA 4W1PA 4WY5A 1FFAA 5EHQA 2HFKA 2HM7A 5C81A 2I3ZA 2EEPA 4K2AA 1P0QA 3RM3A 3IIIA 2QXTA 5JD5A 1NU8A 1YA4A 5ALYA 1ISPA 3VKFA 2WG1A 3H18A 1QGED 2XLBA 1XLWA 4O08A 6YASA 3HEAA 4Q34A 4ZGBA 3STYA 4RPCA 4F60A 5JASA 1LPNA 3D2CA 1ZD4A 3M82A 4Y2UA 3C8HA 2GBCA 2OCIA 1CUCA 1XZGA 1K4YA 3H2KA 1MT3A 1CUUA 1VJ5A 1T4MA 4UPDA 4BTVA 2IITA 4FNMA 1TKRA 5ALDA 1DU4A 1YAHA 3KWFA 1VXRA 1XFDA 2VF2A 3A2NA 3DCNA 4W1RA 2Z3ZA 3MGAA 2RHWA 4C89A 1LZLA 2QS9A 3C6ZA 2ZYIA 1AZWA 3IULA 4A5SA 3MUNA 4Q1VA 4BVJA 5AI6A 1H2ZA 4MXDA 2BKLA 4G4JA 4B82A 2CUTA 1MAHA 5CURA 3ZPXA 4X6XA 1ZI9A 3WL7A 1WM1A 5E2IA 1N5RA 4J0KA 4DNPA 4J0CA 4BC0A 3V1KA 3WK8A 3EQ8A 3W9UA 1OILA 2XMGA 1E3QA 1YS1X 5DNUA 3GBSA 1UKCA 1MTZA 3I6ZA 3I2HA 3X3HA 3DL4A 5A71A 5CT4A 1PV1A 1WB4A 1GPNA 2ZJ6A 3B3QA 1MAAA 2VJCA 1AGYA 1RWQA 4Y2RA 2WIGA 2WTMA 4G9EA 1U65A 3G7NA 3ESBA 4WFKA 2RAUA 2JIDA 1EB9A 4RGYA 4UHHA 1XRMA 5AH0A 3IVMA 5K3BA 3QM1A 2K2QB 2CZQA 5AK5A 3DYVA 1K5PA 1BROA 5JZ9A 3PE6A 1E89A 3LCRA 4AN0A 1LPMA 3QPCA 1XRLA 1QIFA 1ZI8A 4WJLA 2LIPA 4F0JA 4P9NA 4CG3A 2ZYHA 4ZI5A 4J03A 4C01A 3QMVA 4G5XA 5CW2A 4TGLA 4Y2QA 1ODTC 5JARA 4J0DA 5IKXA 2HHAA 2BCEA 1LNSA 5AM1A 2EDAA 1QJ4A 1J1IA 3ESCA 3FOBA 1CQWA 5T4FA 2QTBA 1CQZA 1SCQA 1QIGA 3A2MA 5CT8A 5LLSA 5JIBA 4B6GA 1QONA 1ZJ5A 3A6ZA 5AI9A 4MWTA 4PO3X 3CN7A 1M33A 1AC5A 3G0CA 4GXNA 3FYTA 4Y9SA 2J4FA 1WPXA 3CCCA 4P92A 4AXBA 3R0VA 4EY5A 5C8ZA 4K6KA 1EB8A 4H7DA 1THTA 3W06A 1LZKA 3BE8A 2CB9A 3WK7A 1TK3A 3O4IA 2ZJ7A 1UOPA 3A70A 1XLUA 3H04A 4Z49A 1WCYA 3GFFA 2PBLA 4MYSA 4LXIA 4FTWA 4NS4A 1JI3A 4WDRA 5ALQA 2GYWA 4J0IA 5ISMA 2GZSA 4INZA 4X7BA 3JWEA 4B80A 1JU4A 5AKXA 5FPQA 4AO6A 4DNQA 4UBLA 5HF6A 1LPOA 4MJ3A 4IH4A 1EI9A 1H2YA 5HFAA 1WHTA 1E8NA 4JNCA 2WIJA 1W76A 3ANSA 4E11A 4MWSA 5FLKA 4Y2SA 4MEBA 4LYEA 4YK7A 3TJMA 3IURA 1XKLA 5IH7A 3BXPA 1T2NA 2WQZA 4BYMA 1XQXA 5JZBA 3TRDA 2WSLA 2VAXA 3H2GA 1VOTA 3K9BA 4GEGA 4W1SA 4KJXA 1R88A 4YPVA 1ORWA 4FNGA 3DS8A 1W75A 4U2BA 5DYYA 2Y6UA 5ALOA 2XUHA 1EH5A 3C45A 5LIPA 3GZJA 1XZLA 5AKJA 5ALSA 3IBTA 2WFLB 3ZLUA 4Y2PA 2DHEA 2VT6A 3WWDA 4PSDA 1GPKA 3AIMA 2BUCA 5LP1A 3V1MA 1CEXA 2QR5A 4J3JA 1MNQA 2C7BA 5FDFA 1BRTA 4J0JA 3QPDA 2WFLA 3M3DA 4X92A 5IVDA 5CBKA 2XT0A 1U8EA 4BE9A 4DNOA 4HXFB 4UBJA 4PF1A 3KD2A 5AK6A 3BWXA 5HFNA 3I2KA 2XMBA 1SFRA 4U2EA 4U2CA 3KDAA 5CH3A 4LXHA 4GECA 3PUHA 1YS2X 2GZRA 1XRNA 1ZIYA 1XROA 4OCZA 5DJ5A 4H7IA 1EINA 1DQYA 1ZI6A 5LZ2A 3G0GA 4ARAA 2RIPA 4BB0A 3G0DA 2BUBA 1XZEA 4AZ0A 1XQWA 2CMFA 4PNZA 3WZMA 1J06A 1VE7A 2YH2A 3N0TA 2ROQA 3PF9A 4TVKA 1JJFA 1ZIXA 1GQSA 2X5XA 1UT6A 4RE5A 3FWHA 5AICA 4BATA 2Q0XA 3HYSA 3WIOA 5EIAA 5CMLA 3EBLA 5C7YA 4BE4A 1VKHA 2WG0A 4JYMA 2C0PA 3QYJA 4I19A 2OPHA 4S0XA 4B9AA 3FYUB 3U0VA 5DNWA 4CIBA 4L9AA 4U2GA 1TCCA 3M81A 5AOAA 1MJ5A 3VJLA 5CRIA 3DQZA 3AILA 5HKAA 3Q8WA 4X93A 5BWCA 4BZWA 5JYCA 1FFDA 3BDVA 4IH9A 2ZYRA 2PUHA 4QDTA 3WA6A 5E4TA 4GDMA 2XQIA 1F8UA 2VT7A 3FYUA 4G1FA 2UZ0A 1DTEA 2QMQA 2QUAA 5C8XA 2XDWA 1TCAA 2IX9A 3HJUA 2HA7A 2HU5A 2V96A 4DTCA 3IB3A 4H7KA 2JGEA 5FOQA 3V1LA 1QZ3A 1CUYA 4B81A 2WJ6A 3CCBA 5A6VA 3B12A 3WJ2A 3FBWA 1QO9A 2PSFA 5CXUA 1CUXA 1H22A 3FLBA 4MYDA 3WKEA 4X00A 5CT9A 4UBMA 4KRYA 1EVEA 1QIDA 5K3FB 3RKSA 2WUFA 4QLAA 1CIJA 3H1BA 2XMSA 5J3JA 2HDWA 2V97A 3FSGA 1IZ7A 3H2IA 1EXWA 3ANTA 3PI6A 4OSEA 2ZYSA 4IO0A 3WYDA 4BP9A 1ZGBA 4G8DA 1FFBA 4KYVA 4CG2A 4EUSA 3QH4A 1CUIA 5K3FA 5AJHA 2OCGA 2DSNA 1XLVA 3K2IA 2ACEA 4ARBA 4BCBA 2XI4A 2XMQA 4X95A 4P93A 2XUAA 2XMDA 1QO7A 2RHTA 4B0PA 4BAUA 1BEEA 1JMYA 5ALMA 1P0IA 2DR0A 3C5WP 3WA7A 2PU5A 5AM3A 3ZWQA 2HRRA 4BRSA 2JGMA 3KSRA 4KAJA 2H7XA 1WB5A 5CT5A 1UK7A 1BEZA 4A23A 4MEAA 4YX9A 2QJRA 4ZWNA 1Y37A 3GUUA 3W04A 3WI7A 1SOMA 3ILSA 2CEKA 3OG9A 1O6FA 2ZJFA 1SCKA 5E4JA 1QE3A 2AJ8A 3RK4A 3AZQA 4BDSA 4OB8A 4B9EA 5KWJA 1GKLA 4G9GA 5EI5A 3C87A 5LZ7A 5A62A 1R9NA 1JKMA 3I1YA 1YAJA 4DMHA 5DLPA 2HA5A 5ALIA 3G0IA 4LHEA 5ALRA 2HL6A 2OLEA 4BCDA 4QDUA 4X71A 4CIAA 3JYHA 3WL6A 5AIBA 3DEAA 4UFNA 1EX9A 2OAGA 2OG1A 3VXKA 2QZPA 3WWPA 3PFCA 3G0BA 2PPLA 3IA2A 3NGMA 1YASA 2ES4A 4AMYA 4X6UA 3BJRA 2Z3WA 4AO8A 2WUEA 4B84A 1JMKC 3N2ZB 1QLWA 2AJLI 1ACJA 3L1HA 5ALGA 5LYYA 4FDMA 5AM2A 2VTVA 4XWGA 3STUA 4K5QA 4M0FA 3VJMA 2Y2VA 4UHBA 3STTA 4PSUA 4KE9A 3H17A 1CUZA 1EDBA 2HA3A 5AI8A 5AKZA 1F0NA 4AO7A 2H9YA 3WKAA 4EY8A 1EDEA 3I6MA 3PFBA 2YYSA 4N5IX 3T52A 1EVQA 3WK6A 1CUWA 1VZ2A 1USWA 1DX4A 1WHSA 2JEZA 5JAPA 1UOOA 4YASA 4U2DA 3G9ZA 3KWJA 5IVIA 3R3VA 4FBLA 4I4CA 4OB7A 3WQHA 5C8VA 4QDXA 3G9XA 1E66A 3D5EA 4HAIA 4X97A 3ESAA 4UHCA 2XQGA 1H23A 3WMRA 1G5FA 4C4ZA 3OOSA 3C8DA 1DT3A 2BUAA 1EK2A 1EHYA 3EF3A 1VXOA 4GWLA 2ACKA 1Q83A 3R40A 4V2IA 2VAVA 1LPPA 1GPLA 3RARA 3C70A 2BJHA 2PSHA 3VDXA 3F8SA 2VJDA 2PUJA 1KEZA 1C7JA 2OCLA 3I6YA 5D7BA 4AN1A 3SC2A 4HS9A 1K8QA 1Y7IA 2E3JA 2XUIA 5DTIA 2PL5A 1X2EA 4UBIA 5DYTA 3NUZA 3PUIA 1UZAA 5D3ZA 1ZD3A 4QWWA 2RI6A 5JAHA 4HZGA 4ETWA 5AKLA 1JT2A 1RYYA 3D0KA 3D7RA 1MU0A 5AM5A 1JFRA 5JAUA 2V9ZA 5ALJA 1MX5A 4E46A 2JGIA 1FFCA 3R3WA 1HBJA 3E3AA 1DINA 1QTRA 1Y7HA 2D0DA 5LZ5A 5ALPA 5ESRA 2G5PA 3IDAA 1J2EA 1GGVA 2JF0A 2Z5GA 5AK4A 3D4LA 2H7CA 1B41A 2HADA 1U4NA 1PFQA 3QPAA 4EY6A 1J07A 3ZLVA 2C0QA 5ALKA 1X70A 1XZIA 1XZDA 1Q84A 2HA6A 1DX6A 2I03A 5IVKA 3HACA 2WILA 4QDOA 4OD0A 5ALLA 1SC9A 5A2GA 5HK9A 4ROTA 3F96A 4Y2JA 4C4YA 3OURA 1KU6A 3S8YA 4MQLA 3VVMA 2VJAA 1XRRA 4KAFA 2OGTA 4W63A 2XUOA 3LS2A 3BF7A 3DKRA 3DOHA 1WB6A 5AKEA 4UBKA 1NU6A 3IUJA 5A7HA 1QFSA 1L7RA 2ORYA 3HSSA 4PQEA 2GBFA 2DHCA 2AJBA 3D3NA 1RP1A 3WWOA 3LIPA 2HU8A 5HF9A 1Q0ZA 2XMCA 3DLTA 2O7RA 1VA4A 4E15A 1QIKA 1ZD2P 5FV4A 4QE3A 5HQ3B 4FLEA 4I3FA 2WU3A 1QFMA 1IZ8A 1CVLA 4IH1A 4XVCA 4DMFA 5EGNA 5H3HA 3R41A 2WFMA 3WK4A 1UOQA 4C87A 3DJYA 4H7EA 1TQHA 4EY4A 5D3KA 4L3WA 3MVEA 3D2BA 4M0MA 5JAOA 2FUKA 4AMZA 4Y2TA 1QIIA 5FKJA 4H7FA 5ALTA 1XRQA 1S8OA 5HQ3A 1QIHA 4JH0A 1YB7A 5EHNA 3B5EA 4X3CA 4FHZA 1HQDA 2XQFA 4BAZA 5JANA 1AQLA 2C4HA 5KWIA 1EK1A 4Q3LA 3ED1A 5SYNA 5JD4A 3GROA 5DTJA 2QKYA 1CUAA 4ZV7A 3W2TA 1U2EA 1JJBA 1QIJA 4GI1A 2PSDA 1A8QA 5AKYA 5EIEA 3TGLA 4D9JA 1YA8A 1ZICA 5YASA 2RONA 2XQJA 5HF8A 2OCKA 1BS9A 5D6OA 4UUQA 1ODSA 4MQMA 1W52X 3W9BA 5ALZA 3AIOA 4EA6A 3LIIA 1MNAA 2PX6A 2X8BA 2DFPA 4DNFA 2WG2A 2JGKA 3UMJA 4BAGA 2VSQA 4G4GA 5CXXA 1W4LA 5AO9A 4PV7A 5ALXA 3BF8A 1GQRA 3EQ7A 4FLMA 2XUFA 1YB6A 2OXEA 4G8BA 4QNNA 1F6WA 4HVTA 2PKYX 3WK9A 1L7AA 4UFPA 1CUEA 2ECFA 3MUOA 5T4EA 3YASA 2JGLA 2I78A 4QLOA 1XZCA 5ALVA 4F21A 2WIDA 4FWBA 1YR2A 1VA5A 4OU4A 2ONCA 5K3EA 1GXSA 3R3UA 3HC7A 5IVHA 2VJBA 4HRXA 5FXMA 4PW0A 3D59A 5AM0A 4NZZA 1BCRA 2OAEA 1N5MA 3F97A 5T4HA 2ZSHA 4UBOA 1FJ2A 5BWBA 4EZIA 3DNMA 1R9MA 3BIXA 2PSEA 5EFZA 2OQVA 1A7UA 1QOZA 1MPXA 1ZJ4A 4X90A 3STXA 1HKHA 2C5GA 1MX1A 2G4LA 2XQKA 5AKIA 1ZOIA 4OUKX
chains in the Genus database with same CATH superfamily
1G16A 1RPTA 1W0JA 4Q00A 2GA9A 1C3OB 4HNQA 1JB1A 4E3WA 3PDJA 2NIPA 3CZQA 1AX9A 5EIBC 3KEMA 4QZVA 1T5OA 2CLSA 2O6LA 2ID4A 4P35A 3RVDA 1EFPB 5TGTA 3SM9A 1VTKA 4BNZA 3CKLA 4NU5A 4AJ1A 1GUFA 1JHUA 1LBHA 3H1FA 4ONEA 3JZAA 1V3TA 2O8EB 1E59A 4UASA 3K31A 2FX5A 4KB5A 2IQ5A 4FGZA 3SYLA 2QRMA 2V7UA 2Z1NA 1QQAA 2KLHA 1D0IA 4PU0A 5DI3A 2WAAA 3QA3E 4HDAA 4W7HA 2QDXA 2VPTA 4UULA 2XUQA 1RAGA 4FBMA 2G8LA 5KAMA 4BMYA 5EPEA 2B20A 4IJUA 1R0CA 3DE6X 4W99A 5EEGA 5G3ZA 1JFLA 4PZCA 5ALHA 3ISTA 4PG4A 1DKRA 4F3RA 3PGA1 2PAAA 4Z86A 4D7AA 2GASA 5TB5A 3O7WA 4R01A 1A77A 1UKEA 1PGQA 1M0EA 3F98A 1TDJA 4CQLB 3REQB 3ZE9A 5F1OA 2J7KA 1VI6A 4A6EA 2NYVA 2AEMA 4D9MA 3DEZA 1RAHA 3S8EA 4HB3A 5EPOA 1KA9H 4CKCB 1HSOA 5KJ1A 1P4JA 5I8ZA 4A2PA 1UMBA 2AQ8A 2PBFA 4MWZA 2VCHA 2OC9A 4L75A 4NEHB 3CKKA 3MCUA 3GUYA 2ZE6A 2ZI5A 2ZPTX 5JRDS 3S1LA 1C9KA 1UWCA 3QXCA 4RUKA 3KTAA 1PS9A 4CWAA 3T3MB 2NSHA 2XUPA 4D0NA 3FM9A 1YFJA 4RWEA 1AUXA 5DW0A 1XVIA 5IU6A 1Q77A 3KRTA 3CLKA 3QKRA 3ONFA 2Q5LA 2HHCA 4UXIA 4PG5A 5CNKA 3K53A 4INJA 3LM8A 3V7NA 1N9GB 5ALWA 4KRGA 4DLPA 4BVKA 3ZI7A 2PS9A 4ZRDA 4YP7A 3DDNA 1GL9B 4N6NA 1AQJA 2VDPB 3U80A 2GX6A 3CFYA 4M89A 4DLBA 3TTUA 1TZBA 3ZY2A 4FYPA 2ECQA 4PC6A 4DR4B 4Y0VA 8OHMA 1OFUA 5F51A 5L3QB 3OQBA 2W0SA 3ISJA 1L3BA 4OOEA 2REBA 2C9MA 5EA2A 1ZUD1 2DY1A 1XQVA 2BTOA 3GD7A 1E0DA 4U39A 3G89A 3VU8A 1ZC3A 2VJPA 1WA5A 3QLVC 3GJSA 5BVHA 4MLDA 3QE9Y 3AXSA 5DCYA 4RY8A 1KEEA 2C29D 4X8OA 5G4KA 3OF5A 1CJUC 1E3TA 1L5OA 5BQ5A 3T12A 4DC1A 1OI7A 4MQEA 4D5GA 2JZNA 4KR9A 3BIWA 5KQRA 1ODKA 3D4OA 5KJFA 2WUDA 3VR6A 4XFJA 2EGHA 5HDQA 3WGJA 3FCEA 2HU7A 1CRLA 1U81A 5FWXA 3VV2A 4Z6KA 1EFAA 4PINA 4H7HA 3RUFA 4HZUA 1DO0A 1KH3A 4EZBA 3I2GA 1SU8A 3GCZA 2ZIXB 4PAOA 5BT8A 3HFJA 3ZCRA 1P4AA 3JQ8A 2C88A 2ZOSA 4QYIB 5T5QA 3UATA 1FLDA 3ABZA 3THSA 3TLXA 3HWRA 1ECCA 1KRHA 1YR8A 3MFYA 2VA9A 4RK5A 1COWA 2D06A 1DI0A 1YS4A 2JI8A 2AXEA 2OZVA 1UF9A 2JGNA 2FW6A 2P41A 3LP6A 2DQYA 3P1JA 3UT5A 2X8AA 3ADOA 2Y93A 3EQ2A 3J7TA 2QX6A 2VJNA 1OZ0A 4AX4A 5LB2A 1CERA 1JLKA 4XD2A 4FR5A 4LYGA 4ARZB 1PQPA 1R4MA 3FHCB 4PBSA 4P54A 1EJ6A 1AURA 3OWHA 4HH0A 4E7PA 1LSJA 1WOMA 1M6NA 3U60B 1E2BA 5EMMA 1IFXA 3RHSA 1PYGA 4Q9JA 4TL6A 5T3YA 1UC4B 2CLIB 3V1UA 1FU7A 1ZVVA 3PWKA 4I8IA 4X6LA 4XJXA 2Q1TA 4HDQB 4GXTA 1I7DA 5HKKD 2WT8A 3QLEA 4AMUA 5B3LA 3QPBA 1U0FA 5AVZA 3BXEA 2P3OA 4D6YA 2J9RA 1C1DA 1JXOA 2IYOA 1P62B 4S2EA 3EVNA 4EJSA 3A1EA 1PZNA 3CLVA 5AJWA 1NVVQ 5LQCA 2RKOA 3CEAA 1WQ4A 3EVBA 3IERA 4F8EA 2NU7B 1T5LA 4X44A 3AKDA 1UFQA 3N8KA 3CXUA 2GZ2A 4KN6A 4ZZ2A 5LLDA 2FW0A 2J9XB 3GJYA 1FP7A 3B3GA 1BHO1 1XMJA 1G3IA 3KOXA 3LX5A 1JQ5A 1SM4A 2WV9A 4FFBB 3A04A 3RLIA 3O0DA 2Z8YM 1ADGA 2O2GA 1VPDA 3SVTA 4IUCS 4UVGA 3WO1A 3KQKA 3WZLA 4JN6B 2FHPA 1IZ9A 3HH8A 1CV2A 3I9OA 1UJ2A 4J4TA 1DARA 1M2EA 3PICA 4P53A 1H2FA 3GWGA 4M9UA 3RPEA 1KVSA 3QKWA 2ZWIA 3MWLA 4OYYA 3HYNA 1CR6A 1L4GA 1E1MA 3H1AA 4XCQA 3LUHA 3VHQA 4A6XA 1JIIA 4HAUA 4HUQA 5JLJA 1DIOB 4WLEA 3HO6A 1I33A 2ZJ2A 2Y27A 1CHNA 2P6OA 3DE4X 2AG0A 3CUVA 3AVXA 2ZAYA 2XT6A 3DE5X 3GD5A 1W36C 4OFZA 1V7CA 3ZDEA 1QHFA 4KITB 3AYXB 5EHXA 3TSZA 3PQ2A 3MZ0A 4FFWA 2NSLA 5CFNA 4JI4B 3GV0A 4UAGA 3NHWA 4IIUA 1KQOA 7MDHA 3KT6A 1OXSC 1S7GA 5DLYA 1OWMA 1ZLYA 3D8RA 2FQWA 2MSKA 4PANA 1B6GA 3T3GA 4KDRA 4DGQA 5KCZA 4FDLA 4NJEB 3MRTA 2CL6X 3O2SB 3P9YA 2AR9A 4OYRA 1JG6A 4PSCA 4TLDA 3W7AA 4JITA 3EWAA 4LOJA 1ZK1A 3WMFA 1M8GA 3I23A 1D2GA 3VZRA 1JEAA 1VHQA 1W5AA 5T3UA 4ZI7B 1YJ5A 2IYLD 3H2YA 4YRPA 4AL4A 4V39A 1SN7A 1DDOA 1DIRA 1SK9A 2QDKA 4AMVA 1F7UA 1ZH4A 4OSPA 3A25A 3IJEB 2ONKA 1XAHA 3E35A 3R0XA 4JP5A 4PFQA 4PZUA 2BGNA 3H2ZA 3NBMA 1FX1A 1CR2A 4YC7A 4RTJA 1OIXA 1PJLA 2XWJI 3O4GA 5JFGA 4HPJB 2F1IA 1J49A 2IEBA 1U3GA 1I2ZA 3AOEA 3EGCA 1E7WA 2AR0A 3HHPA 2QTFA 4OYLA 2P2YA 4XX1A 2ECPA 1UODA 4JJKA 2I91A 1E9DA 1F20A 3DHYA 2W6PA 1XJQA 2YHSA 1JPUA 3KKMA 2NUAA 3CF4A 3KSZO 1LPAB 1YZGA 2ZREA 2R8BA 4H1VA 4OK6A 1Q0RA 2HSZA 4UE6A 4CDRA 3HP1A 2PX0A 4Z8YA 1L0BA 2C8VA 2GD6A 3KCNA 5SYMA 5T57A 3NTLA 4C3VA 2O8CA 2J3EA 3AVYA 5HMMA 4OKNA 3VZDA 1GZ7A 3AONB 1BWQA 1JLMA 1U4OA 4AKGA 1CJKC 4L1KA 4LUCA 2B7CA 1XN4A 2JI7A 2Z30A 1Z0SA 3O1IC 1V6SA 4YRMA 1DIAA 2ORED 3TW6A 1M1ZA 3N58A 4GP9A 1HT0A 3LMKA 3GARA 4CFSA 2VHCA 2PL9A 2WLSA 1F48A 1Q16A 3EVZA 4MGZR 2PGXA 3SXUB 2BV3A 2FZWA 3C41J 3G2MA 5LZ9A 1NYQA 5TMDA 5H4GA 4YALA 1GILA 4FGSA 4RMIA 4ZXFA 5KNDH 1T5HX 2FZVA 3BA6A 3FZQA 3HCEA 3QNWA 1G42A 1LPSA 3LLCA 4JBLA 1T5DX 2D5AA 4NCJA 1DKQA 4WY8A 5L3SA 4EQ6A 5C31A 1R15A 3LY5A 2PJUA 3NMUF 3LDUA 1KAMA 4U2FA 5C46F 1P0FA 4ZOAA 4YJFB 5EY5B 4J0HA 1HMPA 1TYBE 1DKPA 3UUGA 3DA8A 1DXOA 1YONA 4J1TA 5C9ZA 2FGKA 4JJ4A 3S2EA 2O2YA 4MOWA 4L8FA 3CURA 4Q7EA 2YY6A 3HUFA 5AOBA 4F9FA 4Z7JA 3FDZA 4WCFC 1EDDA 3QMWA 3GT7A 3S6JA 3ZLJA 4EBBA 4KPEC 1IXKA 1MN6A 1USKA 1ZOPA 1JP7A 2FY8A 2CMGA 5TJHA 2VT2A 4Y1GA 2GJSA 2JCVA 1UBCA 3VTFA 1MZVA 1T5IA 3WL8A 5LU9A 4KE6A 2QD2A 5LZ4A 3VPSA 2CFSA 5H81A 1RQNA 1Z8NA 5ILGA 1VCMA 1JU3A 3H0EA 5DYGA 4BBAA 1S01A 4ZALA 4DKJA 1GGEA 2D5CA 3L04A 2YCLA 1JU9A 4I55A 5HGJA 1FB5A 5K3OA 1R1DA 5F77A 1U7OA 5KYKA 4DIBA 4NP6A 3NH6A 3U39A 2YHBA 1CZNA 4EI2A 2HX1A 3DBRB 5DBOA 4YMGA 2B9VA 4C0AC 5EL0A 1A1VA 2YWFA 4KBFA 3HRKA 2R6CA 3I28A 3WGMA 2NPIA 3OM0A 1AHHA 1T2VA 3FPAA 3HZOA 1MH9A 1ZGCA 4IQGA 4L08A 5I3ZA 3SWWA 1J39A 3JQDA 1Y3FE 3AFIA 3CJTA 2QYOA 4ND5A 5JMWA 2PUBA 3WLJA 1N2CA 2O2HA 4Q3NA 1IRIA 5JRZA 2FHSA 1A98A 4KUHA 4ARIA 5JNRA 1IONA 1TIPA 3KJNA 3S3TA 3SE7A 2RE8A 3OEEA 1APBA 1XLTA 2Y0BA 3O31A 4LYJA 5IBQA 4MI1A 1UBGA 1RJEA 1E2GA 2OXFA 2JJMA 4G9BA 5E3IA 3CVWA 5TQ2A 2QM0A 4W5RA 3DWFA 1KMQA 2I5PO 2ZS8A 5TC4A 2CL7X 2ZUCA 4OJYA 3GMDA 5AW7A 2AV6A 3OSZA 4BKUA 4FYVA 2Q7XA 4RK7A 1O89A 1PJ4A 3CW2A 1J2TA 2X6RA 4BCCA 3ZDFA 3U9TA 1QNFA 2DF8A 1M83A 1YBHA 2VHJA 2Y0CA 4RELA 5A3VA 1WMEA 5TQVA 3WGOA 2IUEA 3C3BA 4MYTA 1GSOA 3QBVA 3LFHA 3FAZA 4HXGA 3RU2A 3RGWS 3O03A 2CCKA 3PQ3A 3TEFA 5HRUA 1ADFA 3E7PA 4OJNA 4XYBA 4GAEA 4E6EA 3UNXA 5BVGB 5CD1A 1UXGA 1Q1QA 4J4BA 4OGLA 1HQYE 3KL4A 1R6DA 3QU2A 2OXCA 3CSUA 4GI5A 2EIXA 1QKJA 1IPEA 1YOVB 3R3ZA 2WHQA 5ICFA 4QODA 3BTOA 3CKMA 3CJQA 3E5RA 3KXPA 4BX3A 5EMKA 2ZYTX 1XQ1A 1N5DA 3KXLA 2GYVA 1USUA 3NX4A 1DHTA 2QOEA 4MV8A 2EKLA 3EEIA 3LDAA 3MYYA 4LNHA 4CM8B 3NVKI 4GSLA 3CNLA 4NBVA 3QI2A 3LX8A 2LCQA 4QNRA 4AROA 2X4IA 4YT2A 3I34X 4KPYA 2FZ4A 2WUVA 2P9FA 1QDLB 3R8XA 4INOA 1CNMA 5EKDA 4EGCB 1D2NA 1CD5A 3C6QA 5I8WA 3VO8A 3URKA 2HV8A 2I9PA 4H77A 1MPTA 1SCBA 1L4UA 4LXYA 5LYJF 1YBAA 2J0QA 1BU8A 1U2QA 4C88A 4RTKA 1B0PA 3ODGA 4YMVA 5E4YA 4KAAA 4FN4A 1VG1A 4I50B 2Y2UA 3F3KA 5CX1A 3CUTA 1WTAA 2VXYA 5JCJD 1IB0A 1CX9B 1RE1A 1EFUA 2JLQA 5CH8A 2FW7A 2MMCA 4HB4A 3WLHA 4E08A 5LMNB 4MHTA 1LRLA 2VJQA 3MJ4A 3NETA 5AP9A 1PEYA 2CHEA 2FMTA 3T9EA 1TM4E 4BDTA 5B4TA 2IYNA 1L2TA 1DT5A 5DE3A 5CYPA 1LQUA 2O5CA 2Q62A 3KOOA 3P7MA 5DNVA 4BTEA 4BZXA 4CYMA 1FJGB 3L8CA 3FNBA 3ZIDA 2YUTA 1YVDA 1Z5PA 1XXHE 3GYGA 4JP1A 4URWR 3BICA 1CJTC 3VZSA 1DAOA 2WU4A 1ZSNA 3V46A 1JG7A 1QP0A 3ERCA 2GAAA 3IOMA 3WBBA 4QUDA 5IJ0A 3AR3A 4L27A 5CNJA 3UJNA 4Z9BA 2BKXA 1TNDA 4PQYA 4C3OB 4TLBA 1FFHA 3I1IA 3ZDDA 3P26A 2XMZA 1QAQA 2PSJA 1PVVA 5TE9A 3A05A 4CN8A 4F4CA 4MIEA 1BCSA 1DS6A 1ZBDA 2V7BA 4L0CA 2PJRA 2AF3C 1UK6A 5DRTA 5KMGA 2G4CA 1TVCA 6Q21A 2VK1A 4QRIA 2J5QA 3OT5A 3B2EA 2UU9B 3BH0A 4XOUA 4CLHA 3PGXA 1OXKB 4DT1A 4EOGA 2QVZX 4O3MA 1KU0A 3DFFA 4MR7B 1G20B 1IZZA 4RMGA 2QJWA 2IU6A 3LNCA 3GEGA 5IAGA 3PUVA 4FNOA 4Q6BA 1U0TA 2C84A 3STVA 2H2DA 3U40A 5K0CA 3LU1A 3UK2A 1RRKA 2SICE 5KBYA 4LNUB 2VH2A 4G41A 1LWOA 3TSWA 1AKMA 1ZRMA 2VK4A 1Z08A 1E8DA 3OPVA 4KNWA 4LZAA 3IE0A 5KOHA 4CXMA 3PDHA 2OFWA 4JSTA 2BGRA 2SCUB 4R05A 2YIVX 4NBTA 4REQA 1Y8QA 3L9WA 2VYVD 3LI2A 3U7HB 3RNLA 1A88A 2Z2YA 3F1LA 4NU0A 3U26A 5CYGA 2QPOA 5F7XA 1PFYA 4Q9HA 3JQ6A 3V48A 2AWNA 2YVLA 4NPCA 2D74A 4QXQA 4DSTA 3NIGB 3LHFA 3PFGA 2QAIA 2WPNA 4KGXA 5DIFA 5JH7F 2ILVA 1J20A 1EDZA 1T4DA 4BP8A 3UOGA 1U3WA 5M29A 1X6VA 4FHEA 4N01A 2WEKA 1A5SB 3LC7O 3VR4A 3O6VA 3ICQB 1HNZB 5CP8A 2Q3FA 4JLJA 2FA9A 3V6MA 4M9RA 4E2FA 1ZG3A 2QUJA 2V7TA 3H13A 4LJKA 3QU4A 4M2LA 2NM0A 1YT5A 5JD6A 2R87A 4UW9A 3HXKA 1SCAA 2JFGA 3UWSA 3OPYB 2A0FA 4RQBA 1YE5A 1E99A 4OI4A 4XYEA 4D0SA 1P0PA 2PUFA 4TYYA 2XYVA 2GXSA 4QOFA 2I7TA 2HRQA 1JNXX 1G7CA 1Q0QA 1X7YA 1Z9BA 3AINA 4KODA 4HQNA 2Q4DA 3V9AA 1VYHA 1QGUB 3IQZA 2XOKA 1NY5A 3VU3A 4LQ4A 5DWDA 2NO0A 3RFCA 3HSYA 5IM5A 4NI5A 3S29A 4DCGA 1CUSA 3EEOA 3OKPA 4DYDA 1HDEA 1YI0A 5T6BA 1CR4A 1NMQA 5EYPA 1JPNA 2VG8A 4B0OA 1YDHA 3IV9A 5AFSA 4J0EA 1N6IA 2MWMA 5BP7A 2AEEA 3IIEA 2OKCA 2XYRA 2D1YA 4KE7A 1C1HA 4Z7OB 3A4LA 3WFZA 1F0PA 3DW1X 1ZHFA 3GFSA 5HKBA 1EBFA 5HF5A 1SA0A 3NFRA 4C6HA 3B6MA 2OBMA 4KBYA 3KZVA 1AKNA 1UXKA 1FDUA 4RA9A 3OT1B 2PRIA 1ZR4A 4CU2A 1JDJA 2QUZA 2VYQA 3QLJA 4Q9DA 4L5CA 3NALA 4G97A 2QUBA 3MPUA 1PR1A 3TBHA 2ISSD 5GMOA 1FX0A 2O1SA 1KOJA 4HN2A 1VLJA 4YO8A 4RKFA 2H07A 1T9ZA 3MTDA 4LFCB 4K6MA 5CK5A 5D1NA 1XHLA 1ZNQO 1SMKA 1PGOA 3DV0B 2FWAA 2AZMA 4KQHA 3JQ9A 3FTDA 3AHGA 4YDSA 3SDSA 1XVUA 5L51A 4L7QA 4X1IB 1QRRA 1XKXA 3OH8A 2WTEA 1WEKA 2FRXA 3HJFA 3FFAA 1B00A 2XEXA 4MQ5A 4PS0A 1NLZA 3NOOA 3DE2X 4MWGA 1W1IA 1W5SA 2HDOA 3PXBA 3JQFC 4NEGA 4N5HX 4OHBA 5AHXA 3R3YA 3T0GA 3UPUA 3DEJA 3H2HA 5E8JA 4OXKA 7REQA 4Q3AA 5FL7D 3N2NA 2DE0X 4HQ0A 1ZQ1A 3NH9A 4HEJA 4LV5B 2W2NA 3LBNA 1ZM7A 4ZV4A 5EQTA 1CP2A 2AOUA 3PGKA 4KV7A 3DL7A 4OLFA 3X2SA 3SYNA 4ETIA 2Z8XA 3HRHA 5CNMA 3LBFA 3LHKA 3BBLA 4PSAA 2ZTLA 4C4PA 4JASB 4J16A 3W05A 3AEZA 1XVAA 1HLPA 3QFRA 2IPMA 1EMDA 4QQNA 3RIYA 2P8SA 5A0FA 1E6LA 2FSVC 4G1BA 4DIOA 1QE0A 2J3JA 2CVQA 5G1NA 3EQ9A 2X9GA 2Z56A 2ZJAA 4OTZA 5KNBH 1V45E 4PGHA 4ZAXA 2OWEA 3ENZA 1M2JA 1AG9A 1KO1A 2C82A 4LOIA 4TKUA 2I8AA 1CETA 3E1SA 2DRIA 7GPBA 3HUUA 2HQRA 1U0BB 2WUWE 4Z8XA 5FH9A 2ZAIA 1TMOA 3KSUA 3EZ9A 1WUTA 3HKCB 1ZIOA 4JGGA 3IUNA 3KOWA 3ZY6A 1TKBA 1KYIA 4JOSA 1VCNA 4L85A 1T34A 2QQFA 4X6YA 1UPAA 1P0MA 4UHFA 4RY2A 1RJ9B 4EJ2A 1VLQA 3EIOA 3LP5A 2MMGA 2D00A 4Q7JB 5ENZA 4YAKA 4MH0R 2BOVA 2QJFA 1E63A 3NWBA 3L77A 1BDJA 2AQIA 2PH7A 3LWZA 1NN3A 5GV7A 1TXGA 4C4XA 3HCPA 4HWKA 3KJGA 4EFMA 5D51S 5AVSA 4WA7A 2ERXA 3QJ5A 4AS3A 2UVDA 3BB4A 4R1OA 1P1JA 2X1HA 4POAA 1BXKA 3RVRA 1QZUA 4B73A 1L9KA 1KJYA 2WKWA 3A6KA 4R3UC 1YUNA 4N76A 1BGWA 2CF5A 3FVTA 3OESA 4GU5A 5HK8A 1GTSA 2B99A 5F3WB 4H3HB 1ZVQA 2G5TA 2NACA 3AHDA 3X1KA 4EATA 2WYIA 3DV2A 4RVUA 2G09A 1ZU4A 1KJZA 1ZCBA 2A9KA 2NT3A 2D5IA 1N8SA 2BSXA 2J07A 5G41A 2LIVA 4BLUA 4EW6A 2BL4A 1HYGA 3PXUA 5K0FA 3GNQA 3RC1A 3U56A 4X3PA 4N48A 2YASA 4XVRA 5JATA 1OLUB 1QHIA 4UAVA 3TH5A 5LQAA 3QHAA 3ZIAD 5K0LA 1QH0A 2HFKA 4RWZA 1XKQA 4JI1B 1C2TA 3M70A 1DAPA 4DAEA 2I3ZA 3A9WA 1XU9A 4M1ZA 3PRKE 1YQWA 3VRHA 3QEKA 4EBFA 4XM1A 3GPCA 3UB2A 4MVJE 1P0QA 3VR4H 3DZKA 3F7TA 4DJJA 4UQOA 4G37A 4EARA 2A5LA 4A27A 3D7KA 3OOEA 4EGSA 3MA0A 1INLA 3IIIA 4P7BA 2VPXA 4XPIB 1YZHA 3SF8B 3SIPA 3OX1A 3NV7A 1FOEB 1C1XA 1PTKA 1NU8A 3FKJA 4RCVA 2CFIA 3TQCA 4DGSA 4PR0A 1LNZA 3GJ7A 1B73A 1ISPA 4E3ZA 2PLWA 4RV4A 3REFA 2XLBA 4B3JA 3ENKA 1I3CA 2Q4TA 3VPXA 1YIDA 4HTFB 4O08A 1E92A 1X1AA 1KTVA 4Q34A 3AWDA 4AS1A 3AGPA 4IINA 3STYA 2AH5A 3AO0B 4ZI2A 5E2AA 1IN6A 1O6BA 2HNBA 1F60A 3D2CA 3M82A 2ZS7A 3R74A 1W2GA 4IGEA 3HMKA 2CMDA 4R81A 5JQGF 5K6TA 4K6FA 2CSUA 5AVRA 4KO1S 2F3UA 3IE2A 5LMUB 4JOCA 4AP9A 2OCIA 2Y0DA 5JPCA 2GFHA 1MC1A 4L5YA 1CUCA 3BGWA 5E6RA 4GOXA 1XZGA 4R8KA 4B3RB 5LQNA 1E7MA 2QROA 3DD1A 3VHXA 1LTQA 1C7ZA 3NTQA 2IZ6A 2Q07A 4OAOA 3V9PA 1KHTA 3ZBPA 5K8IA 1VJ5A 1Y48E 1TPZA 1VB3A 2WTBA 4JQSA 4UPDA 4OK5A 1O0CA 4GZ6A 3GW8A 2V6BA 2XMPA 1UMKA 4AUKA 4PQRA 3KWFA 4KQCA 5FTKA 1OAKA 5IC6A 5B58C 1H4SA 2OK8A 1PG5A 2I99A 2IS2A 4F6LA 3HN7A 2H59A 2BZ0A 1L4EA 3VPHA 3FWZA 3W8RA 2SKDA 2Z3ZA 3ZY4A 4BCDA 2FMKA 3GLIB 3KQUA 5EWLB 3UMYA 4F4IA 1C3JA 2RHWA 3LTEA 4MAFA 5DH9A 1FNSA 3IRUA 2FOLA 4M9QA 3E3MA 3JQPA 1T2EA 2ZYWX 3B1WA 4TS4A 4G5QA 5B64A 1UOEA 2QS9A 1QANA 4RH1A 2BM8A 4YJ3B 3T1OA 3K94A 4JC4A 3VGPA 2N42A 1QKKA 4EVRA 3UUWA 3L2OB 2ATCA 1CQJA 1OOEA 1SVUA 2YYAA 2ZSDA 3AKCA 3FZEA 4A5SA 3MUNA 2K2WA 2QQGA 3BMQA 1EQAA 3DBLA 3DLPX 5AI6A 1RXEA 2FWMX 1XJ5A 2V4ZA 3NTRA 5F2KA 4H6VA 3MLAA 1UMDA 4MW5A 4MXDA 4JI5B 2CC2A 4Y0AA 4B6OA 4D4LA 3KQYA 5AVOA 4P6VF 4G4JA 4B82A 1Q1AA 2VF8A 4U6SA 4ZU3A 4YAGA 3L6DA 5BSKA 3FCAA 2M6KA 2DBYA 1U8UA 2HMYB 2R47A 3DDWA 4LXUA 2V7VA 3K70B 2H4XA 4PPYA 3W3AA 3BL5A 5JQGA 1K5HA 1SJ9A 5AVUA 5KIAA 3A4MA 4K03A 4FR2A 4ATNA 4D42A 3GGCA 4HMQA 1G7SA 1VP3A 1HNXB 1SBZA 1VMIA 5HCNA 2A5FA 1NUUA 2XE6A 5KVQA 3JARB 3EDYA 2V7WA 3F4LA 3OQIA 2W4QA 4FGJA 5PGMA 4TVSA 3BG5A 3GJ5A 1U1FA 3W9UA 4XVUA 1JEEA 2C4WA 3OEHA 4ME6A 5DHTA 3C0KA 1Y7TA 3EZNA 4LHSA 2BFEA 2WNIA 4N12A 4OP1A 4KYIB 1MORA 1EGQA 2RGEA 1UKCA 3AM4A 4KQ9A 3PC6A 4I14A 2XOEA 3X3HA 4UTNA 1BIFA 3CGWA 1EQUA 1N6NA 1I3OA 4RQUA 1KYTA 2CL5A 4MQFB 3SEZA 5F7OA 2WKSA 5A71A 4AG5A 3KJEA 3FWPA 4JLOA 4LC9A 4DJEC 4XQEA 2V03A 1GPNA 3VU1A 5L6MB 1PHRA 2J45A 3B3QA 3A14A 3X1XA 4FM9A 2VJCA 2OYSA 3KDPA 3SFZA 4JA0A 4YP5A 3TKYA 2BHNA 3UMGA 3BS4A 1AK9A 3KKQA 3UJ3X 4CMBA 2FEPA 4MV6A 4U02A 1E9CA 1KJNA 4QUBA 1SG6A 2FOIA 4WKGA 2PGNA 1KDYA 1GR0A 5FEMA 2QTMA 4B33A 2NX2A 2VJLA 5IDXA 3NATA 3LO8A 4WFKA 3MFQA 2DFLA 2RAUA 2XH8A 4BGIA 5IYZB 4US2R 5L3RA 4UHHA 9LDTA 3QXHA 5DK6A 3WIEA 1XSEA 4DUGD 1K75A 2LZ0A 3F3MA 1GADO 1NUTA 4MW9A 1LJ8A 4OBEA 3U3MA 4QXPA 1P4SA 2XA9A 3W8NA 2LKCA 4JUCA 3DTVD 3LUJA 5FFMA 1P1IA 3UQZA 4E5PA 1XRSB 2K2QB 2ODTX 4WNIA 3VC3A 4L8YA 2CZQA 4WGFA 4JEUA 3KUDA 5AK5A 3TF5A 3O2JA 2D3WA 5EWJB 1RLIA 3V2HA 4HP8A 2PFSA 1JE0A 4KGVA 3V8BA 3WBKA 4C0XA 1Q0TA 1A8HA 5EMLA 3PXGA 4AY3A 3BIFA 1BROA 1DBPA 1SBYA 3ITNA 1UXHA 3LCRA 1ESDA 1AUPA 3ETCA 1E5XA 4FFLA 2JCXA 1W34A 3EVTA 4CUJA 4P22A 3G88A 5HIIA 2QMOA 2J09A 3U7JA 4I4TB 3U7GA 2IHKA 5DNYB 2WD8A 3FZGA 2A1TR 3H8SA 3P4UA 4HNTA 1MOQA 3NQ41 5MGNA 2EOAA 3C7CB 3KVNA 2EFDB 1GZ3A 2LIPA 4JLVA 1OIWA 4TTJA 4XQ9A 2DB3A 5HS4A 1WXHA 1W5EA 2WKRA 2B5OA 5K2MA 3DHEA 4C4AA 1TUBB 4GVXA 3QXSA 3TS1A 4F0JA 1OFUX 3A1WA 5K2OA 2FP4A 4CMGA 5J23A 2Z2XA 2ZYHA 4LMPA 4MR8B 4K8RB 1QG4A 1FE8A 1I5EA 2R62A 4GM0A 1UQUA 2NWQA 2ZBQA 4NZOA 5CW2A 3SJBA 1GHTA 1B3BA 2WZDA 5IKXA 1XDGA 4R0MA 4FEGA 2Q0QA 3TRFA 1DHRA 1HDYA 4EVQA 1ZMBA 1AB5A 1QPGA 4UARA 5TNXA 1XNQB 2Z09A 2VF5X 4OXRA 3TQHA 5K03A 3L8DA 4XWAA 4LN1A 5C8YF 3EYWA 2XZDA 2G83A 3ESCA 3H8VA 4MCAA 4PLCA 3GPDG 3GGPA 1KDRA 1DKMA 4D41A 1DJOA 1UJBA 3MRXA 3VA7A 2OBYA 3RTBA 4RFSA 5C4MA 3EZFA 4M7RA 4G2NA 1D5WA 2NXNA 4RMJA 1SUEA 2BH9A 4BBPA 1P81A 5LLSA 2NG1A 2G3YA 3G0HA 4B6GA 4GDFA 3RUPA 2JIQA 3HRIA 1XPRA 1QF6A 2ZSBA 1FP4B 1WQ3A 1QBGA 1MW9X 3BWEA 4DARA 2CL0X 4F9EA 5F73A 1M33A 3UW1A 2OR3A 1DV1A 1RWOA 1UT5A 2OM6A 1AC5A 3A7DA 1TJNA 1T1GA 1S4QA 2X0RA 3FYTA 3OHPA 4R4JA 1DAEA 4Y9SA 2R7NA 4YJHA 5HQJA 1GY8A 2KYRA 2GB4A 4CPDA 4AXBA 3GOHA 3ROPA 2FAXA 4R9NA 3CV3A 1G8MA 2APJA 5C8ZA 5DHQA 2AD1A 2WR8A 3WFIA 4ZOBA 1EAYA 2YWCA 3D3QA 1EB8A 3W7BA 1FJXA 3BRWA 4C2TA 2VNAA 1DEAA 4UTOA 4X5OA 5MHTA 2ZUVA 3L7DA 2HK9A 3EXIB 1KP2A 5CVVA 1LZKA 3W8FA 1QPZA 4DG9A 1XTIA 3CRW1 3E8MA 3UHJA 3T7IA 4X41A 1OH7A 1HKUA 3O4IA 4U6QA 1WZCA 2ZIEA 4KYTA 5EQFA 1UOPA 1ULSA 3LT1A 2BE9A 2JFVA 5KDOA 4A8TA 4LWZA 1NXQA 4C6TA 1K97A 4M88A 3DOOA 4PAQA 4OHRA 3B6JA 4W5NA 4UD2A 1MEEA 1BU5A 3H99A 3OIUA 1CKEA 4QGAA 4WUVA 3KHKA 2QGZA 4IGFA 1W1UA 2CBZA 3NNDA 2W8BA 1WVMA 3OU7A 3A6HA 2B94A 1W5FA 4TV8F 5ISMA 4R7GA 1DG9A 1BVYF 3R7SA 2BGGA 5FOWA 4RENA 3ZDYB 3RSZA 3BSWA 2I8CA 3MERA 1GTMA 1JQLB 1M10A 4MCHA 4NQRA 2DUJA 2M1XA 5UKDA 3E3NA 4TL7A 4UBLA 3KZKA 4BLRA 4DA0A 2UXBB 2FP3A 1ARZA 3ND5A 3JQAB 2IOYA 3IQXA 4MS4A 4PAGA 2VXBA 3DEIA 2BP7B 4G01B 1LK7A 4IH4A 5BWNA 5IDQA 1N7JA 4G36A 3II6X 1WHTA 1E8NA 3AJEA 3C4VA 2CNOA 3MXOA 4QTZA 3A0RB 4RV9A 3ZNQA 5CFRA 3FUXA 5CB0A 1W76A 2BFBB 5F76A 4E11A 3V7UA 1NJGA 4QLBA 5FLKA 5E7QA 1ES9A 4MEBA 4LYEA 1FDIA 5BSVA 3I01A 1XKLA 2FPGA 1D1SA 5DN6D 2CYBA 1H0SA 1P9WA 5KYWA 3L82B 3Q7QA 4M0PA 4MVJD 4P2BA 2BEVA 5JE8A 2VKTA 3FPJA 2D1SA 3HKDB 5ICCA 4ENWA 1V3QE 4X65B 4Z0PA 3E22B 2TRSB 1PR5A 4ILEA 3WXBA 4CZ2A 2VAXA 2WJVA 1Q0LA 1Y4AE 3GAFA 3IBCA 4LOKA 4DAOA 3TPFA 3NC4A 2Y99A 3LOPA 4NU6A 3EODA 3EEBA 5JSFA 3IP7A 1V11B 2UV8A 1UAGA 3E27A 3HDGA 4DHEA 4BXOA 4YPVA 3S1SA 2IYFA 1W4AA 4FNGA 1W75A 4U2BA 5K4HA 3P9ZA 1AUVA 1CP3A 3OUZA 3RK1A 1X42A 5BQ3A 2OSVA 4TV8A 2R7KA 1XA3A 2JJ2A 5ALOA 5H59A 3QWIA 4K9MA 1E2HA 1PEDA 3QFSA 1BDHA 1W87A 4FN5A 4TXHA 4CV3A 3ZHBA 5MFPA 5JW6A 2IT1A 5EKSA 3GLFE 4YJKA 4NPHA 2R6R1 2DFDA 2V7XA 2PZAA 3AR2A 4XDYA 1KAHA 4R1LA 4Y2PA 4CMJA 2HLDA 1D4OA 3KAJA 2ZXUA 2B82A 4N03A 1J7KA 3GHYA 3UO8B 4NFHA 2BCJQ 3IGFA 4Q3DA 3QWFA 3WHPA 5CFQA 3B70A 3LHIA 2MJLA 2IQIA 1SK8A 2IEAA 1AF7A 4PSDA 5IT0A 4JIMA 4L0QA 4B3IA 2YICA 2BFCA 2NYRA 3WIUA 4BV2A 3RAEC 2C57A 5B7GA 1T36B 1DC6A 4XRRA 5AQ1A 1V0JA 1XNRB 2OO7A 2FQXA 3OZIA 2EKDA 2FZCA 4CT4B 3IP1A 4HWRA 1Z35A 2P9TA 1MNQA 4PO8A 2ZRDA 3FR7A 3RI3A 2Q1YA 4P83A 4WADA 1NIJA 2DTDA 5EIFA 3FZYA 4J0JA 4QATA 3SYTA 2PX2A 3QPDA 5HZHA 1Z56C 3N05A 1U7TA 2GZMA 1C9YA 2WFLA 3AETB 2YBDA 4J6EA 4R51A 3M3DA 4EUFA 4BQRA 2HRZA 2WHEA 4JJGA 2WJYA 3I5MA 2C9YA 1TO6A 3OBBA 1C4WA 1TI7A 1SU7A 4G5GA 1OFTA 4PGMA 1QS0A 2D54A 4DNOA 3I0MA 1IWOA 4NG5A 4QU9A 3EAGA 3ZIUA 4UBJA 5GV8A 2RG7A 3EIQA 3VTKA 2LNDA 4ZQFA 3D1LA 3BWXA 2WVHA 2PKXA 3HEBA 3UV3A 5HFNA 1SC3A 3KXKA 3T61A 2GXQA 3EFEA 3PQ6A 3RT1A 3T34A 1F2TA 2VJKA 2XMBA 3U3JA 2D6FA 2J87A 4U2EA 4FK8A 1J9ZA 3FIJA 4LXHA 1RM4A 3BXOA 2KWIA 2RMKA 1GA1A 3DZIA 2CJWB 3DJFA 4P31A 4GECA 5A3SA 1DAKA 5CLLA 2GLXA 4EPTA 3J80A 3BFXA 1JFTA 1P1KA 2GZRA 3BERA 1AXRA 4JUDX 1XROA 1FSGA 4F45A 2HLPA 4AWAA 4RZ3A 3T7EA 3X0DA 1DVRA 1TUEA 4ZK2A 4KXVA 4D45A 2RHLA 3IPXA 3KWLA 2HIAA 4EECA 2FDCA 2WINI 2CNNA 4NBSA 3NKVA 4MS3B 1ZI6A 4V0QA 5GOTA 3NONA 4K1XA 2NPFA 2R8YA 4ZCSA 4AWBA 1RAFA 4P7GA 3R9WA 2JS7A 3EVEA 5IKEA 2FVYA 1ZCJA 2EWVA 3GCWA 4RCZA 3K2BA 5HOEA 3L18A 2D2VA 1Q74A 1GGKA 3G2KA 3BUSA 5DI9A 5SZIA 1K4MA 4HLUA 5COQA 3WZMA 1VE7A 4G85A 3W2EA 5ILQA 2RH9B 4MW6A 2PYDA 1SWVA 2X41A 2VL7A 2ROQA 4ZAZA 4GC5A 3CZ4A 4RF3A 1RTTA 2P30A 1R00A 1V7ZA 3HHEA 3V97A 4MUGA 4UTVA 2GM9A 2VP2A 3ONNA 4Z4HA 4LF6B 1TLFA 2VUSA 1WKBA 2X5XA 4GF5A 3PC4A 1VE5A 1OGJA 2GN0A 4RE5A 3T3DA 3WLQA 5JSZB 5AICA 4BATA 4D79A 5A04A 4HFJA 3ZWCA 3RYHA 3ESXA 4C7MA 5C5CA 1OWOA 1WW3A 2NZYA 3I9KA 3U49A 1WXQA 4XYMA 2PXAA 1A5ZA 2EQAA 3Q7EA 2PTGA 2WYHA 4ZYTA 1VM6A 1C80A 2NO5A 2ZRAA 3U3XA 4NBKA 1CZKA 1FYDA 4HBGA 5AHWA 2ISQA 3JAWA 3SZLA 4EUEA 1GG9A 1IAVA 4K9SA 1OV4A 2AUTA 2IZ0A 3EUEA 1NVMB 3GLUA 3L0PA 3MEQA 2ZVJA 3FPSA 3ZHTA 4ZVTA 1D3AA 3JVVA 1GAQA 4JIGA 4KQFA 3GBVA 3UMCA 1F8GA 2C0PA 4GZ3A 1TECE 2IPNA 4IFIA 2OPHA 4EG0A 5A9SA 2H6EA 2X3UA 2D7JA 5KYGA 1EEXB 5LLTA 1IH8A 4FW9A 3O91A 3R5SA 4K6OA 4MGIR 1R0KA 2H5LA 4DJTA 4H6XA 4BMDA 3O3NB 3ZHUA 3MB8A 1YJXA 5AW6A 3NGLA 5FHRA 1MJ5A 4M1QA 3WLIA 4FXOA 2WU0A 3QUAA 4FWTA 5JNSA 2IPXA 2EP8A 4UNSA 5EWMB 1JEYA 1G8AA 2QYTA 1V26A 5BWCA 4C20A 1QTQA 3MBIA 1FIUA 1GLVA 4WZAA 1GGJA 5JYBA 3PR2B 4N7RA 2DU8A 4BZWA 1R64A 2M98A 1ZHOA 1BW9A 3EGDB 1S9DA 2PGLA 4B71A 4DDTA 1OU0A 2ZYRA 3DMTC 1F6BA 4IDEA 4PZZA 2RFLA 4PC3A 4DCUA 2H1VA 3W5CA 2IH4A 3CA8A 3S2UA 1GLNA 2JGDB 1E3WB 1NHWA 2DYKA 2GJ9A 3N2KA 3JU3A 2QVLA 5FOUA 2HA7A 4UNIA 1C14A 2GF0A 3BOSA 2JLVA 3CZ5A 2HJHA 2VZ8A 5G0UA 2J6IA 2HU5A 1FMLA 5GWXA 3O90A 5I4CA 4QTXA 4G2TA 3V1LA 1DAFA 4B2PA 5ESDA 1P2GA 3V7YA 1CUYA 4P58A 1TE2A 2A5GA 5BWOA 3H9JA 5LD2B 2HDNB 3G68A 3E2PA 4D97A 5C7IO 1XQ6A 3CUEF 3PPVA 3EE6A 4LEIA 4NBWA 1G9TA 1XALA 2GLTA 3D6AA 5ITZA 1FZQA 3MWDA 1K0FA 5FPYA 4KSCA 3ID6C 3L07A 2JARA 3Q6NA 2O7NA 2Q3LA 4D9HA 4JR0A 3EWNA 2VNHA 3R5XA 1CUXA 3JQFA 1Z39A 3TD6A 3WQSB 3OQ6A 2RGBA 4MYDA 2O07A 3FGPA 4N0DA 5IULC 3TL3A 2HF8A 2HNKA 4X00A 4D02A 5A4AA 3WLFA 1MT0A 2OUIA 3LX6A 4UPEA 1E4OA 4WZ6A 2QM7A 3OIWA 1N4DA 2QU7A 3RKSA 2WUFA 4MB0A 4RV5A 1EFHA 3LLUA 4GKAA 4QLAA 2PR7A 5DW3A 2CFTA 4JLPA 3UV6A 4OQYA 2B4AA 4RVOA 3TLAA 3OQMA 2ETXA 1E2JA 1BMDA 5J3JA 2JEOA 2QTVA 4IDPA 5GJVC 1XHEA 3OTIA 5HKKA 3H2IA 3DEHA 2FSVA 3UJAA 3DZDA 1SKUA 3N6VA 3OUUA 1US8B 3TR6A 2ZJBA 2W43A 5FWAA 3W6ZA 5K7SA 1Z36A 1M6YA 2MSLA 3OY2A 5G2OA 4CTJA 3TFOA 2DPLA 3UXMA 2BMJA 1DEHA 2R5WA 4C7JA 4DADA 4OSEA 4HAWA 4KLCA 1P1HA 3MQ4A 3WYDA 121PA 4BP9A 1ZO8A 1XCMA 2PZFA 1FFBA 3PGVA 3C3YA 4G8DA 1QR6A 1I4LD 2B4RO 1KOFA 3G5MA 1LWNA 4IIJA 4ITRC 2B8WA 1MRZA 4XDHA 1H1LB 4DWOA 3LGXA 3TCXB 4IHKA 1U3VA 4ARBA 2E87A 1CXZA 5CPBA 4OX9Y 4TMFA 2YW9A 2IEDA 4TL9A 5KDDA 1CJBA 3IJRA 4UNNA 2FE4A 1HM5A 1XBTA 1JH8A 2FFRA 1VHDA 2B8JA 1C3EA 1WSDA 2UYGA 3AKYA 3F3YA 4LMRA 1PK8A 4P93A 3K09A 1LI7A 1UANA 2OV1A 4OM7A 1KIFA 1E2FA 1K88A 5D00A 2H4HA 3GGJA 4OGGA 3D4BA 1N2GA 2H63A 5DASA 1V47A 2O19A 3EF1A 4YH1A 1OC4A 4KIGA 3WHKA 4ASUD 5ALMA 3VDRA 4PQGA 4TMWA 4AMBA 2EFGA 1NQXA 2NOAA 4F4UA 3WGNA 1TL7C 2OO5C 3IUSA 2MR6A 4QPPA 3C5WP 2DM6A 3EYAA 3GJ8A 1FDWA 1PGNA 3W6NA 1TQ4A 1JG4A 1TPYA 3VAYA 3ZWQA 2ZZNA 3R9XB 3H5LA 3RT7A 2VHVA 2JGMA 4IDHA 1IBLB 3EH2A 3ELUA 4LC1A 1VFPA 2J0VA 4UEWA 2CLHB 3SNHA 2NVUA 3DFUA 3ONVA 4C5AA 2YKGA 2IHNA 3BJIC 1UK7A 4TYMA 1ESCA 3ADBA 3A9CA 5BV8A 4IXDA 2L17A 3OQVA 4RW0A 3BM5A 3GMSA 2QG9A 3KU1A 4YX9A 2ACWA 1QP4A 5JWRA 2QJRA 3I1JA 3J81A 4FD3A 2DULA 3CWCA 4QRDA 2XRZA 1F0KA 2YWBA 3SLGA 2YRWA 1I30A 3T38A 4KVZA 3QV2A 4Q1CA 2DLNA 5CAEB 2ZJFA 1SCKA 4V2UA 3IUEA 1Z4OA 1JHOA 2VZ9A 5E4JA 2WY2D 3VR1A 5A03A 1PKXA 4E4YA 2JLZA 4MKRA 4UM8B 3TKLA 2BFDB 4MV1A 1W44A 1WDTA 3AZQA 4OAQA 3PJFA 2PWYA 2AMLA 4BDSA 1X7ZB 2UUPA 4YRTA 2Q29A 4B9EA 1UEJA 4LOAA 4ZQHA 2AL7A 2FFBA 5EI5A 3G2QA 3K2EA 5A62A 3IAUA 2CDNA 3KYJB 5DFAA 3KQHA 4WHMA 1O5TA 1F2VA 1K7YA 1NMSA 1R9NA 2H52A 3DBHB 1FTGA 2H2GA 4GPZA 5KU1A 1XCPA 4F6RB 5SYAA 4MS1B 2DFVA 5TPWA 4DMHA 1NBWB 5EP2A 4HX2A 5DLPA 1REQB 2HA5A 2PX3A 3G0IA 4LHEA 5ALIA 3WJAA 1XXLA 2WTUA 1EWTA 3DLBA 1E9VA 1D2HA 2FTKE 2OLEA 2PT7A 3F8WA 3NJ4A 5TXGA 1HOTA 3BXFA 4PWYA 2YQZA 4GSKA 4X71A 1JEOA 3DMDA 4A0RA 4OJKA 4AKIA 1TEVA 3EGVA 4YAIA 2JKZA 2QE7A 1KPIA 3DOCA 5AIBA 5EZ5A 3TZLA 3LJKA 1PZFA 4D9FA 3UMFA 1DQRA 1EU1A 1WDLA 1I10A 2VOJA 1UL1X 2R1TB 3VXKA 1LXCA 4O5OA 2P75A 3H83A 4YIKA 1MD9A 4MRRA 3RVKA 3ER9A 2P0EA 4UVIA 2XD9A 3TDMA 1AKTA 1P5FA 1P5RA 3BWCA 1A97A 1H3EA 3A4VA 1GPH1 1EFVA 2PPLA 4K7JA 4M1KA 3IA2A 3TGPA 1CYDA 2PBRA 3Q3IA 3BWMA 4PPGA 3ZWMA 2B0JA 5LYJA 5LU8A 2X0DA 3NGMA 5TT1A 2AKEA 1KFJB 1RC0A 2AW5A 3OZTA 1X87A 4LOHA 4QOGA 2ALJA 5AW4A 1G5IA 1YU6A 4NE9A 1XELA 2IZ5A 4G24A 2JW5A 1SWWA 3EIUA 3MJHA 2PX4A 4GX1A 3V4ZA 3NTUA 2QTZA 4AO8A 1JPJA 1FNNA 2RGWA 4AX8A 5B6PA 2K5UA 1X0VA 3EISA 1JA1A 3C3CA 1IDN1 3OPXA 4QEZA 3GGOA 5EMHA 4ZEOA 4A1OA 4WBNB 3N2ZB 1XDBA 2B21A 1T9CA 3TAUA 1EZ1A 1R8XA 2J9ZB 2BELA 4N5LA 1ACJA 1HYHA 2PWAA 2R8OA 4CW7A 5HA5A 5MFZA 1KK2A 1M1NB 4EPRA 5DO9A 5ALGA 5F78A 5A05A 5LYYA 1YU9A 4GOOD 1LNQA 1SY7A 2GLUA 3EWSA 3KZCA 3M2PA 3NUQA 4HDSA 4O59O 4IILA 1H69A 13PKA 4M0FA 3STUA 4PSKA 4DMLA 6REQA 3HR8A 3K9CA 3P19A 1L5SA 4P5EA 4TTVA 3S99A 2A1UB 4UHBA 4AJEA 3U4IA 4LBYA 1DOZA 5IP5A 1A9YA 2W6OA 4JR2A 5DBFA 5GZ3A 1NQUA 2BFMA 2OB2A 3QELB 2F17A 4G67A 4DA8A 1GTVA 5IF9A 2QMZA 1EDBA 2WZCA 3LQKA 4MUBA 1V5GA 4R5MA 1M7BA 2POCA 5AI8A 4B46A 3ONDA 2OD2A 2SKCA 1YFZA 3DZ8A 5KQMA 4A26A 5LQRA 2ZYAA 3W6OA 3MMZA 2A84A 1PG0A 4EY8A 1FA9A 2F67A 3U4GA 4D92A 2G9NA 3DFIA 4ZQEA 1EDEA 1MV8A 1Z6XA 1V5FA 4K05A 2XD4A 1T25A 1EFDN 3PITA 3VZQA 1Z63A 1BA3A 4HYEA 1EVQA 4EWLA 3OZUA 3QX7A 3KB6A 1M67A 4AIRA 4LXTA 2CZGA 4I5IA 2AB0A 5B3KA 1N8NA 1VZ2A 2Q8NA 2Z5VA 5BORA 3U44A 3THWA 1USWA 1N0HA 4W9NA 2BGTA 3HVIA 5IBPA 3H9QA 2YV2A 1N5KA 4O02B 5F3DA 5BSMA 2ATIA 2G6BA 5DCLA 1N36B 5DX1A 5IVIA 1RHRA 1WBBA 2IHYA 2GNPA 1WUJS 1YCHA 4OB7A 1FYWA 3K1AB 3IP6A 4R41A 3A1VA 1SUFA 3EMKA 1WZ2A 5LUAA 4AP6A 3FUWA 1K2WA 3V2UA 4JC5A 4KQ2A 2B6NA 4S35A 3N2GA 1KGSA 2IWRA 1GFZA 2BIFA 1CW2B 1P80A 2NLOA 4G26A 2FWIA 4QDXA 5EEHA 4DQLA 3G9XA 1XNJA 4TYQA 3A1NA 3VJRA 5H9WA 1E66A 3B5JA 1IY0A 1V4VA 3OEWA 4RJ2A 2Z9BA 3MHPA 4QYXA 3PVCA 1H23A 4MYHA 4C4ZA 5BNWA 2W11A 1NZFA 4EX7A 1ZUHA 1M2NA 1ZSYA 3AFHA 3KUCA 1DBSA 3PCTA 4L78A 3FHTA 1DT3A 4GLJA 2JHFA 4RK0A 1NSFA 1ZK3A 2BUAA 1VCHA 1AN0A 1EK2A 2E49A 2ZSJA 3Q7TA 2IOFK 1DCFA 4RGBA 2X8JB 4TXNA 4UEQA 1A5BB 3S68A 4TWBA 1BMQA 2PCLA 2NUBA 1XAJA 2GXAA 4FFOA 1ZUNA 3AW9A 5K8VA 2JANA 3EAQA 4JGBA 2WJJA 1UPTA 3LHDA 5JBNA 2WWGA 1CG6A 3B8EA 2ZK7A 4HQFA 2IBTA 2ANCA 2PR2A 2Q0HA 3ZNOA 4KQMA 1DJPA 4L4ZA 1GNPA 1I6KA 3UW3A 3WLKX 1XTRA 1MEOA 3BH6A 3LYAA 3AF6A 4IV0A 3NHZA 4Q7MB 3KJZA 3M49A 4QGBA 1Q14A 4YJDA 2Z4TA 1XYVA 3T4XA 4DVGA 3AG5A 1ZISA 3VNQA 1C0PA 1NDUA 3O9ZA 2PUJA 2OCLA 4WN9B 2OPBA 2PQ6A 3ETDA 3OKAA 5D7BA 3BSFA 3MF4A 2WSMA 2H8GA 2VJMB 2YZKA 3U4QB 5BW5A 1Q50A 2E3JA 5DTIA 2QY6A 1FNDA 1ZX1A 2VP9A 1MO3A 3I39X 4ESEA 1J22A 4OLJA 3ICEA 5CEEA 4BO4A 2HF2A 3ZU6A 1TEHA 4O4HB 2QG6A 3OZDA 4EYEA 1ZD3A 2GEVA 2RI6A 1SO8A 1GU0A 3EXAA 3BFVA 1JW9B 3PTLA 2FN3A 2QP3A 3NHYA 5AKLA 4MWDA 5E1DA 1DC8A 4NNPA 1V96A 2OQRA 3KB8A 3O93A 3VOAA 4V0MA 5DV9A 2IV7A 3GVIA 4PONA 4ZANA 2UUAB 4J2TA 5FTWA 1SBCA 521PA 3S7TA 1JFRA 1ICEA 1PQ4A 2XWQA 2V5VA 5JAUA 2RGRA 1AXEA 5A5FA 1JR3E 2BF4A 4E30A 3CXRA 1VPTA 4BASA 3K6SB 3SU8A 4Z3OA 1YK1A 3CR3C 3P9QA 1ZL0A 1VCIA 3NM4A 4L2IA 3HEMA 1UBJS 5JI3E 2IYWA 3R3WA 9MHTA 1HBJA 1GWNA 3OJXA 1ULZA 1Y7HA 1N7IA 1NTOA 2VNJA 5J2UA 1HK7A 4ESHA 3AFMA 1BD4A 5LZ5A 3RYCA 5A4FS 2G5PA 1WEHA 4ZOCA 1EFRD 4OHVA 2EFCB 5IM4F 1WXWA 1T5TA 2IYPA 5JECA 621PA 2R1VB 3A36A 1JHPA 2H17A 4MVJM 1B93A 1SIUA 2FQ1A 1B0ZA 4PBTA 1J2UA 4R2LA 1AHIA 3D3WA 3O8RA 3RC7A 1LSSA 1ZJ6A 1ZONA 3MCAA 4PZYA 1K06A 5CB4A 2ON6A 2VYVA 3UHAA 1W88B 4V3CA 1YCFA 3VH1A 4CQNA 4M6WB 3OQPA 1T2CA 3H1PA 3RS8A 1QQ7A 4UCFA 5BV1A 4C3UA 2OENG 4DXDA 3F8TA 4D8XA 4TLCA 5C80A 3ZLVA 1WNTA 5JPDA 3AI2A 3MJCA 3V8RA 2C2YA 2IY7A 2RKBA 1Q84A 2I29A 3SDBA 1UAYA 2HA6A 4F5YA 1SG0A 1NVFA 4JVSB 4I9UA 3SHQA 1FVHA 1T4CB 1VSUA 2PS0A 2X22A 5FUQA 5ALLA 3NHPA 1NBEA 3EGXA 3CW9A 4BZPA 3P0RA 3ZCSA 2EKZA 2FNAA 5FI5A 2NUTB 2X1VA 5KTRA 2FN9A 4O2BB 3NHUA 1J8YF 1PV2A 4ROTA 3LRTA 1D4AA 4B6EA 5ICGA 1Z29A 4GOKA 3OURA 4M53A 3A6DA 2HTEA 4WECA 4U7PB 1OIVA 2FKNA 4MQLA 4XWOA 4DEVA 3L0CA 2R0QC 1T3LA 1XRRA 4X3OA 2WSYB 1JA9A 2JFYA 3NJ8A 4R31A 3T95A 1DXYA 4W63A 4AUNA 5CGQB 4P8RA 1X1SA 4ND4A 3E3LA 3D4PA 3ZHYA 1U0SY 3GFPA 5KVSA 4KDEA 3EHDA 3KEFA 2HIGA 5TPZD 4CGYA 4V1CA 3DYBA 3DOHA 2IU3A 2JI4A 5KQGA 1Y4DE 3LPNA 4UBKA 1ZKDA 3GEMA 3IKVA 3RAPR 5IKMA 2GCIA 3B3FA 2AF4C 1FFSA 1Z6GA 3WQQA 1L7RA 4I50F 4JU8A 1MXFA 2F3TA 2VRNA 3P4XA 3Q0IA 2ORYA 1SU6A 1JWAB 3HSSA 2BVNA 2BBSA 1RQPA 3K2QA 4LJ6A 5JQWA 1U31A 5L3VA 4Q4LA 5DSZA 3K5WA 4GYJA 2F4VB 1RP1A 4ALNA 2XNHA 3WWOA 4H6PA 4O4JB 1IEVA 5HF9A 4DR2B 2YOFA 3A1DA 4KJZA 4F2GA 4NR0A 2BLLA 2DFKB 5LWQA 5F9FA 1KNQA 2O7RA 3Q3EA 3J81k 4F8YA 2ZJOA 3X1DA 3KT8A 2HYIC 2MU1A 4JXXA 3H3XA 1VA4A 5B1SA 2J08A 3TNJA 4P4SA 4ZO7A 4TT3D 1LH0A 1HE5A 3OP4A 5JS8A 1B3RA 1BA2A 4QE3A 4OATA 4XQ0A 5BYJA 4ML3A 3N5KA 3K4PA 1PWXA 2PAFA 3QSYA 2A9OA 4JT8A 4BQFA 3QKSB 3W4JA 4IH1A 2F00A 1ZRNA 1PJ8A 2OG2A 1E1CA 2A5DA 5EGNA 3VH2A 2PNJA 3IUPA 3VR5H 2P7IA 3G59A 4A4DA 4B8WA 3D8NA 1NLUA 3F74A 3IXLA 3N3BC 4RA6A 5FL7A 1OT5A 4OUDA 5EQJB 3RO7A 3T7CA 3VM6A 1GN8A 4H7EA 2V3WA 3KZNA 2KI5A 1QFXA 4JB3A 1TD1A 1EX1A 3CLTD 3VTZA 4E13A 3G5TA 4ZC1A 2RDMA 1JA0A 4MV0A 4WT7A 1MABB 1H42A 5CDFA 4HNUA 5BQXA 4ZO4A 4Y2TA 3Q8KA 2XBUA 3C5CA 3FNQA 3HXOA 1NZJA 1Y80A 5DNDA 3GLGB 4BY9E 3K9HA 5C1OA 5KYXA 4H7FA 4XUEA 5ALTA 3A58B 1E69A 1IBMB 1XRQA 3M6FA 4PRZA 3SYKA 2K4MA 2NU8B 1Q17A 4GP7A 3ZQ6A 2BEWA 1QJCA 1WOYA 1SPBS 4QDKA 2JLAA 2TECE 4NQZA 1H4TA 4PHGA 3RBZA 3TRJA 5KNCH 4GUDA 1Q7GA 4JHLA 4ZJPA 3UGTA 1SOAA 2H54A 5EHNA 1V9CA 3B5EA 4X3CA 3LLMA 4FHZA 5F4BA 8ADHA 5CXSA 1J21A 3JAKA 3E81A 3H6HA 4LJYA 4YRCA 1ZL2A 1KI8A 2CLCX 1WLYA 1EFKA 2ZRFA 3HYLA 4N0PA 5G40A 3UG7A 3WYBA 4RTSA 1XYYA 1P1CA 2FF7A 2ZWMA 3UKDA 2C4HA 3TSCA 5CFOA 4NXNB 4Q4AA 2QJTA 4MSUA 5KWIA 3H9GA 3ED1A 4QTUB 2Y1DA 1ML4A 1LY1A 2IEIA 5C52B 3IS3A 4HGNA 3BE5A 1TF5A 1W93A 3KUUA 3P8ZA 3A9VA 3CUUA 3ILXA 4D0RA 2GR9A 1AGRA 1GG8A 4YV7A 4M1EA 4AF8A 5AESA 4ZYLA 3WSVA 1QVRA 2ARKA 2GARA 1CUAA 1OX5A 3BYZA 1PTJC 2GEFA 5I6DA 3AXTA 2O14A 3W2TA 1BRMA 1QRAA 2WKQA 4EO9A 4B6QA 3MTIA 1ZPDA 3LBIA 1IHUA 4DV2B 1TAGA 2AK3A 3V8PA 5GJBA 2JFQA 1L5GB 1NPDA 4GI1A 2A9PA 2OBXA 2FCAA 1LDGA 1FQJA 5I9SA 4AQ7A 4X7MA 1N2JA 2N0SA 2QLJA 5GONA 2ZR8A 3TGLA 1FW8A 4P7FA 3DWIA 3OU2A 5IAEA 3NDJA 4N5MA 1UP4A 3FUCA 2FK8A 2JLBA 4X20A 4NAUA 4QOHA 2OCKA 1ESZA 1Y8AA 4TRJA 1PNQA 4ACAA 2OCDA 1JRLA 2KB0A 2WMOB 3B51X 3IKLA 3LT2A 4WN3A 4DF3A 2OFFA 4XUDA 3W9BA 2C03A 3S81A 1COZA 2C99A 2JHCA 2R86A 1P2VA 2VJYA 3CH5A 3RRMA 5A6SA 3SAJA 1H8ED 2C96A 5HW0A 1MNAA 4B3XA 2X8BA 4HR7A 4D5EA 4BFVA 4EABA 5KOJA 2EJVA 4JJ6A 3ZIAA 4HNAB 2NUPA 4NOJA 2CLDX 4O4LB 2VSQA 1CDZA 3ZHRA 5KU7A 5LDHA 1O03A 2DFNA 4EELA 1R5BA 3Q2IA 3EASA 2IBMA 2VI5A 4K81B 3IAFA 4PS1A 5B53A 2JFOA 3E5HA 1PYOA 4NOMA 3H5VA 2I4RA 2XUFA 3A1TA 2OXEA 2A30A 3WLLA 4IHJB 2GRAA 4F9GA 2QYSA 5HYVA 1GXSB 4QNNA 3TX2A 3RB8A 4WWHA 3VU0A 2UUOA 3WK9A 3K1ZA 1RKUA 1WCIA 3UK0A 4UFPA 3VSDA 4EY7A 3KEQA 5ER9A 3VGJA 3RVJA 3WHLA 1J8VA 3A6GA 3KYCB 3MUOA 3KJFA 5T4EA 4ZEXA 2XBLA 3VC7A 1R66A 2Y67A 4Q7QA 2I78A 3PUXA 1E18A 1X1TA 2CZCA 3AFOA 4ZZ0A 5H3CA 3SN6A 2QNBA 4BNLA 3O1LA 2FEXA 3CNHA 2A9JA 1PL8A 3D7SA 3QP9A 3RODA 1EE2A 4UVHA 4IEFB 2P2GA 5DB4A 2ZYGA 3WWYA 3OI7A 4Q93A 1QWOA 5IASA 1O95A 4ARCA 4L57A 1ZXBA 4NYIR 2HCRA 2AGVA 3DMTA 4OU4A 4DZZA 5BRJA 3FOFC 2JAHA 2GDZA 2QW1A 2BW0A 3CUKA 5K3EA 1DAIA 4X24A 5F5LA 1VG0B 3UCFA 1GNRA 3FPCA 8MHTA 1N57A 3ESYA 1G17A 4OQ4A 3GLKA 4PN3A 5CHYA 1T26A 2QL5A 3ZBQA 1SURA 2BSAA 4OMFG 5FXMA 3S4YA 3FMFA 1Z88A 2XYPA 5EXTA 5AM0A 2P9BA 3ZN2A 1NW7A 1W1WA 3E3OA 3THRA 1XXHA 1R9GA 4QGGA 1T6NA 4Z9XA 4YMLA 4DA6A 4KFCA 1NT2A 1ZGGA 2G72A 4HSGA 2EFYA 1DJQA 1AY0A 1FJ2A 5EP4A 4P3OA 5BWBA 2OCBA 2O2CA 3DNMA 2JFXA 1R9MA 3CVYA 3ZGVA 4GG1A 2L2QA 3OZXA 3IT3A 3I4CA 4OQXA 2HXYA 1ZEJA 2Z83A 3U62A 1JR3D 4EH1A 1OROA 1YR1A 1P44A 2Z1MA 2DT8A 2V3VA 5DZSA 5DI3B 4X90A 2XXBA 1JHQA 3Q3VA 2C5GA 3QXJA 1OBCA 2G4LA 3F2VA 4FOSA 4RFVA 1OFVA 4PHCA