3FB1A

Crystal structure of purine nucleoside phosphorylase in complex with ribose-1-phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
281
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Purine nucleoside phosphorylase from Schistosoma mansoni in complex with ribose-1-phosphate.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 90
structure length 281
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fb1A00
4JOSA 4WKOA 1ODLA 4KN5A 2HSWA 4JWTA 1PWYE 1Z39A 1PBNA 4TTAA 5KB3A 5F7OA 1U1EA 1Y1SA 1T8YA 4X24A 3LGSA 4BMZA 1A9RA 3T94A 4F2WA 1V2HE 4R2WA 1PR2A 3D1VA 1K9SA 5F7XA 1V41E 1OVGA 1JE1A 4LKRA 4TTIA 4WKCA 1JDZA 1ULAA 3PNSA 1T0UA 4NS1A 4K6OA 4GLFA 2AC7A 4QARA 4WKPA 3O6VA 4H1TA 5IU6A 4R2XA 2BSXA 1Z34A 1T8RA 5B7NA 2A0YA 1TCUA 1RXCA 4DAOA 3TL6A 3UAZA 3OOEA 1YQQA 4DANA 5B7GA 3ENZA 3OPVA 3GB9A 4M7WA 1PW7A 1U1DA 4L0MA 4BMYA 3GGSA 1OU4A 1B8OA 5B7QA 4I2VA 3KUKA 1Z36A 4D8XA 2A0XA 3MB8A 1RFGE 2GUWA 1VFNA 3EEIA 4TS9A 3NM6B 1ZOSA 4QATA 3KHSA 4OGKA 3FUCA 1XE3A 5CXSA 4G8JA 1JDTA 5C80A 1OTYA 2HWUA 1YQUA 4QAQA 2OXFA 1C3XA 1Z35A 3FNQA 3ODGA 5CXQA 4YJKA 1CG6A 1JP7A 3PHCA 1U1GA 1Y6QA 3KVVA 3K8QA 3BGSA 1A69A 3KVRA 3SCZA 4MCIA 1PKEA 1QE5A 3EMVA 4MCHA 4PR3A 3OZCA 4GKAA 3KVYA 2I8AA 3IEXA 5EFOA 2P4SA 3K8OE 1OV6A 1N3IA 1NC3A 4L5YA 3E9ZA 1PR4A 4LZWA 1Z33A 4FFSA 5EUBA 4P54A 4TS3A 5EPUA 4DA0A 4BN0A 4LNHA 1TGVA 4BMXA 1Z5PA 3UAWA 5CCDA 5JPCA 1ODJA 3NM5A 3EUFA 3F8WA 1RXYA 1A9PA 4G41A 4OGLA 1K3FA 4EARA 4L6IA 1SQ6A 1VMKA 2HRDA 4QASA 1VHWA 4DABA 1Y1QA 1NW4A 1JDUA 4TTJA 3BJEA 3UT6A 4D9HA 1PK9A 4F3KA 1JDSA 4F1WA 2QSUA 3E0QA 5F78A 1ECPA 3DF9A 3EUEA 3UAVA 3QPBA 5CYGA 3DP9A 1ZL2A 3NM4A 5CYFA 4D98A 3OZBA 3U40A 4DA6A 3UAXA 4R31A 3PNPA 1PR6A 4YO8A 2IQ5A 1TD1A 5IFKA 4OF4A 2OECA 3C74A 3FAZA 5CCEA 4F3CA 1RXSA 2AI3A 3P0EA 1FXUA 3LBAA 4DA7A 2QTGA 4PNPA 1RXUA 4U2KA 1VHJA 1M73E 1SD2A 1Z5NA 1OUMA 4L5AA 2ISCA 3FOWA 4NY1A 1SJ9A 4DAEA 4IP0A 4YMLA 1Y1TA 2AI1A 3MMSA 2A8YA 2HN9A 1Y1RA 1V48A 1ODKA 1Z5OA 2AI2A 4JP5A 3BSFA 4D8YA 1JPVA 2H8GA 1TCVA 5B7PA 2I4TA 3INYA 1U1FA 5F7ZA 1K27A 1JE0A 5I3CA 4G89A 4M1EA 3P0FA 3IOMA 4TXJA 3OF3A 4WKBA 4MARA 5F76A 1WTAA 1CB0A 5F7JA 4GMHA 4YNBA 2B94A 3BL6A 2QDKA 1T8SA 3FWPA 1I80A 2OC9A 4OY3A 3OZDA 4RJ2A 1LX7A 1V4NA 1V3QE 1JDVA 3UAYA 4TYMA 1Z38A 2A0WA 1RR6A 5FAKA 1A9SA 2QPLA 3PHBE 1ULBA 4TXMA 4TXNA 4DARA 1RYZA 1Y6RA 3FB1A 3DDOA 4EB8A 4L5CA 3DPSA 4TXLA 4DA8A 3O4VA 4F2PA 3ONVA 5K1ZA 1V45E 4QEZA 1A9TA 1B8NA 1LVUA 1RSZA 1T8WA 4OEHA 1NC1A 3DJFA 1RCTE 4D8VA 1A9OA 1G2OA 3OZEA 4OJTA 4E1VA 1JYSA 1TGYA 1SD1A 1RT9A 3KU4A 1PR1A 3LA8A 1Q1GA 3NBQA 3OOHA 2RJ3A 4QFBA 2ON6A 3OCCA 1YRYE 5DK6A 1PK7A 4M3NA 4LNAA 4GLJA 1U1CA 2QTTA 1OTXA 3E9RA 1A9QA 4LDNA 4UC0A 1YR3A 4NSNA 1ODIA 1PR0A 2OC4A 2PGAA 4ECEA 1LV8A 2XRFA 4TXHA 5F77A 5ETJA 2Q7OE 1PR5A 1YBFA 5F73A 1PF7E 4WKNA 1Z37A
chains in the Genus database with same CATH superfamily
3NCTA 5BV7A 3P0IA 3AC0A 5DNCA 3DVLA 1GZHB 4M0DA 4KMSA 4TLBA 2IU4A 3CX8A 4ZYTA 3PNMA 1ZW6A 1C4OA 4GMFA 2WAXA 3P9YA 5FOSA 2FU5C 3K9NA 4NCJA 3DZFA 4B3FX 5HUQA 5TQ0A 5D3ZA 2QR5A 4HN4B 5CNKA 3IVMA 5GONA 1DG3A 3HCFA 3WHKA 5CFRA 1HNXB 2YS6A 3MS2A 3T0GA 2KBEA 2NPFA 3PLAE 5EJAA 1WD7A 4B4WA 3EZ9A 4HNRA 2CCGA 1YC5A 1EK2A 1T24A 1Y1SA 2CUNA 3L84A 2X0EA 2XYHA 4DNFA 1WU7A 2XWQA 4WBNB 3BILA 4HMPA 3H75A 4M8KA 2GJ4A 1TPYA 5D00A 3QIVA 2CMDA 3JYHA 3EYWA 2GCNA 1QHSA 2XE8A 3T1YB 4AWAA 3LQ1A 3BWCA 5JFOA 2QROA 1L1QA 3D1VA 2IDJA 4NULA 1CE8B 3JAWA 4GP6A 2A1TS 3KV1A 3RTAA 3U4QA 2XMBA 2JGLA 4DLKA 3TDMA 1MN6A 1JE1A 2X3FA 3U3DA 3TDNA 4EB3A 1U0HC 2Y27A 4ZALA 3CCCA 3VSCA 2YWBA 3I8XA 4XSGA 1IUNA 4UOQA 1RRMA 4YRDA 5FPHA 2X0DA 3PRKE 3DEIA 4O6VA 3IBSA 3FCYA 2VQFB 3MNFA 2A35A 1FFCA 1QBGA 3I0MA 2AXQA 3F2IA 4FU0A 3G8AA 3PLRA 5IU6A 1XA3A 4KQ2A 3GJYA 5AUPB 1V9LA 1BWSA 3GGOA 4FTWA 2ZE6A 4R2IA 3SR0A 3DFZA 4HC4A 4JLJA 4ZAGA 4F9EA 5FLEX 2VT7A 3PWKA 4IFBA 2VEOA 2Z9CA 1X8LA 4WK2B 5IXYA 5KVVA 2GPNA 3BRQA 5CLLA 4QTXA 3V4ZA 3ERCA 1LF0A 1T4MA 2WVJA 3CG0A 1PEDA 2QTLA 3COZA 4GLOA 5C5DA 1QZZA 4QJ4A 2C3MA 5TARA 5HQ3B 3FOEC 3OFVA 1PL7A 4K9OA 4FZRA 4UFNA 3L6CA 2A5DA 3N0XA 3ADDA 4OHZA 1XEWX 1Q2UA 5IVPA 1RM3A 3EVFA 4DIKA 4LGCA 1CUWA 4WERA 3I2JA 4D26A 3IA7A 3AUAA 1OU4A 4BB9A 4Q16A 3REQA 4I2VA 5GVRA 1NJ1A 5JAIA 1I5RA 2V74B 4A73A 4MLZA 2C2KA 2NZVG 1Z36A 3BDAA 4QGFA 2GZ3A 2BP7B 3IHKA 2PAFA 2JFPA 4HSEA 1JSRA 3MOGA 1J5XA 2PZJA 4WLOA 5FHRA 3W6PA 3K1TA 2ET6A 2AXNA 1P1KA 2X3UA 4TS9A 2RAFA 2WZQA 4TV9A 2X0IA 5J5AA 1M8PA 3PDUA 3JZIA 2M98A 3NM6B 1WETA 3K0FA 3QPUA 4MVYA 4G8BA 4RD4A 1FMLA 1QHGA 5JZMA 1DB3A 4FFMA 4B6OA 2GPBA 2WSBA 1Q7TA 5CVDA 3W6OA 3FUCA 4I4LA 1X7WB 1RHMA 3W04A 1XE3A 1RBZA 4YCLA 4H27A 3GLTA 4J1TA 2GZDA 2C7RA 1GAWA 2FZVA 4W8HA 4JELA 5FFFA 4LYGA 3ZY5A 4F93B 1T9GS 3AERB 3D4OA 1UADA 4BN4A 4TWJA 2EL7A 1SUWA 4FJ1A 1JU4A 2OXFA 4QYTA 4WWHA 4WCFB 3SF8A 1YGYA 3WIEA 1A88A 2AN3A 2IOFA 1U5BA 3ITDA 3VDMA 3HTXA 2ZBUA 4EAAA 4F4FA 1VIVA 5CXQA 3UAGA 4EZBA 1O8CA 3D54D 2RGRA 1X1BA 1WCV1 3WK8A 1U6JA 4MYHA 5IVKA 5KSYA 1RWXA 3AW9A 1DL5A 2WG2A 2O14A 1TB4A 4CCAA 1VJGA 3B5JA 1KZGB 1HC7A 3DDHA 1IK4A 3QTTA 3A27A 1Z8FA 4LOLA 4HD8A 4QYSA 3SKXA 3OKPA 1QTRA 4FHGA 5E0OA 3G13A 4AJPA 1DPFA 2VZ8A 2IYFA 3TQTA 4XVCA 5A0TA 1JPJA 1QMPA 1MTOA 1YL5A 1RZRA 4RHUA 4DCOA 1J97A 2X58A 3RKRA 3WLHA 3FOFC 1C9YA 4K3VA 4FEEA 4KDFA 1HDEA 4KN6A 4NBSA 4BVFA 4M1MA 5JQGA 1SCUB 1UDRA 1XK7A 1YSCA 3ZOKA 4Y2UA 3FAKA 4TLMB 4CU5A 2I55A 5IBCA 4Q3DA 5KTOA 3H99A 1HLDA 4D9MA 1C4XA 4FONA 2WV9A 3U4IA 1PTJC 2FX3A 2JFNA 3PGA1 2ZYAA 4YBRA 4C0LA 1WIWA 3UJ6A 4HB3A 2BFPA 3FDFA 4HDSA 1SURA 3LGXA 3FHTA 2M1XA 4DXHA 3D7RA 1CUBA 3NPAA 3HO6A 1JBKA 1QWSA 1FTSA 1C3OA 3A1VA 5F5LA 3VYTB 2W6CX 2IH4A 4GYYA 1PEAA 1N5OX 1JEQB 1NKSA 2CXRA 2IVZA 1WKCA 2QW1A 3GAAA 3R3JA 1XHEA 4Q66C 2QENA 4A92A 5B3KA 1XKQA 3IQEA 3CUTA 1L5RA 5KYKA 3QVUA 4TL8A 4TMTA 1IU9A 2AFHE 1SQFA 3PC3A 5JDCC 3SHOA 3R0VA 1I3OA 3F9CA 5ALDA 1UFQA 3QY0A 4UE3S 2ZJFA 3R5HA 5EMNA 3ZDXB 4ESEA 1JQ3A 4F4IA 4B4DA 1ZK2A 4ND5A 3RVKA 3ZV7A 1HT3A 4IIGA 1HGXA 3JWEA 4FSHA 4W7HA 1GD1O 4ZVOA 1ECGA 1RRCA 3WLAA 3FFTA 3QLUA 2DZDA 4TZTA 4HYTA 1GZUA 5KDLA 2ACVA 4CMEA 3LC2O 1SG6A 4A8TA 4KO3S 3C3EA 3GLRA 4GI5A 4JFAA 2BI7A 3G79A 3PNBA 4JQOA 1TC2A 2ZBGA 1JDUA 1O5OA 3GDFA 4JBYA 5E6SB 3HKDB 2QRVB 3ZY4A 3KOWA 5TLSA 4K0RA 1JPNA 1G64A 2AC2A 1D9ZA 1K4KA 4FR5A 4WLUA 4ZOLB 4D9HA 2AF3C 3A11A 1LBQA 4QJ5A 3WLMA 2FFHA 3TLZA 3D0OA 1PV4A 1AG9A 1CY2A 2WU3A 1L1EA 3CH5A 3KZKA 1F7UA 3ZWAA 2JCVA 4QUKA 3DE2X 3ROEA 1OKKA 4FGUA 2QJFA 1KEEB 1NR1A 5H3LA 1WCIA 1I3LA 5K0CA 3FOBA 4IZHA 2DPMA 2W2TA 3PWTA 4JBHA 3HCOA 4HEJA 3DP9A 1ZL2A 2FH5B 1OI3A 1G21E 3NM4A 4TWBA 5TE9A 5A71A 2JLVA 3U40A 1ZN7A 2UYHA 1OH8A 3CW2A 1J9ZA 2AT1A 3PNPA 4P98A 1AHIA 3E70C 4NICA 2YVQA 5K3OA 2J3MA 2J3EA 5FT9A 3KKZA 3A4LA 4RD3A 4RF3A 1C0PA 1H1LA 1TD1A 4DWVA 4LXGA 3S2SA 5JXWA 2VF5X 3V4VB 4TSFD 1WY7A 1ZWLA 3LWNA 4I50F 4O2AB 3CE6A 4RIEA 3WFJA 2R6ZA 2RH5A 5DT2A 4ESHA 5B55A 2A58A 1VC2A 5L3QA 2PXCA 2Y1KA 2XHZA 3JQ8B 4G5OA 1H5UA 3LECA 4XH9B 5AIAA 2ASVA 2Q5JA 2ZSKA 4AY3A 1E7WA 2RH8A 1AD2A 3EUWA 2XITA 3PIDA 4HCJA 3ROKA 4QVIA 4M9RA 2BLNA 3L6RA 3V6LA 3OEYA 1I6WA 5H7XA 3CN7A 4M9ZA 3L02A 3EVEA 4EABA 1C7RA 1T43A 2FFQA 3JQDA 1BHQ1 3DVQX 4REMA 4R84A 1GZVA 2EX1A 3IX7A 3K2BA 3NHWA 3S40A 4B2LA 1BE0A 3A4TA 3S6JA 4PAOA 2P68A 5AJHA 1OHHA 2FG6C 1I36A 2FUNB 4UJ5A 3FOWA 4XGIA 1JLSA 3WYAA 1PS8A 3MAJA 4PZLA 1BMDA 5TQ2B 4FM9A 4NY1A 2NU6B 3OPYA 3TXAA 3ZGXA 2O2DA 3IMFA 4MDYA 4CM3A 1A5SB 4MX8A 3KPVA 2AI1A 1TUEA 3EXIA 4IJQA 5AK0A 1S3SA 3DT8A 1E3EA 1SWVA 3ORFA 4G2TA 5E1MA 4UM9D 3AY6A 4MAMA 5JECA 2EKLA 1UBUS 3DXYA 1R00A 4CUKA 4BFSA 3NHRA 3NZEA 2LR0A 2XCOA 4PC3A 1JPVA 1N3YA 4AF8A 4I5FA 4TKLA 3VOAA 1D6NA 1P2FA 3GPIA 3X1KA 2V7BA 3LC0A 1YC2A 4WNAA 1AO0A 3BH7A 4GIBA 3NYRA 4P58A 3C3YA 3A2MA 1WZEA 1C1DB 3M70A 2J5RA 2I7CA 1JQEA 3SVLA 1Q7RA 4KYIB 4HAVA 4G89A 2O23A 5FUXA 4D97A 1E1YA 1P4SA 1EXMA 1RD4A 3DHNA 1Z6ZA 2VP3A 3L0IB 2BWJA 3N28A 1XLUA 1H65A 1B8VA 2V7TA 5C37A 2X2OA 1VGVA 5F76A 1ULHA 1GKUB 4IIJF 3WYGA 2XTJA 1EVZA 1IM5A 2VSYA 4C4ZA 3SM9A 3FZYA 2B98A 3ZHXA 1ZH0A 3PV0A 3UFXB 4LJYA 1KVQA 3AHHA 3BL6A 4HRXA 3LVBA 3TZHA 1BE8A 4PRYA 3WOHA 4BY9E 2IU3A 4LTDA 2VPPA 2CZQA 4RJIA 5FUBA 5A05A 3GLFB 3E8XA 4UM9B 1IZ9A 4R51A 2CNBA 3OETA 4L5BA 1C1XA 4ZRMA 4C3VA 1WXWA 3KT8A 4PY2A 4HN9A 4QBHA 1MJ5A 2P5SA 4RJ2A 1ZN2A 5L3SB 4ENTA 5LD2B 4PONA 1XELA 1TF2A 4LGYA 3ZV4A 3PUZA 4JEUA 2OV8A 4ZOEA 5H16A 3DNMA 4S1OA 2B9VA 1A77A 3BWYA 4BNZA 4GRAA 4P84A 2DX7A 3SS9X 1WVMA 2QN8A 1P4AA 1LI5A 3DVAA 3D2AA 3C14C 3D0KA 4I4TB 4O4HB 3DR5A 5B3JA 5B5SA 1RM5A 4QODA 5AKYA 4O2BB 4L7QA 4QBKA 4XD7A 3KSBC 2Q2VA 1ZGHA 5ALLA 1ORIA 3E1SA 5BQPA 3T4PA 1G21B 3DQZA 2X9LA 3LQYA 1ENOA 3ONFA 4L4RA 3UBMA 3WGGA 4DC1A 1PGNA 1RYDA 3I5AA 3KJEA 1NBHA 2YIVX 5ARCA 2ZYDA 3P9RA 1CUGA 4DG8A 3A10A 5LP6F 3DOHA 1S1CA 1TW3A 4JL6A 3RANA 1FYWA 6ADHA 4BO8A 1L6IA 3TG2A 4DRZA 1U9JA 2EJBA 4MWCA 2R751 1PZHA 3P71T 4W5TA 5HKBA 1E3QA 3EG9A 4MKGA 4HL6A 1P4RA 4EATA 5EXTA 3AEZA 4OJMX 2B0JA 1LJUA 3CLSC 4TXLA 3QA9A 2O8BA 1SXJE 1L5WA 1ZI8A 5ALKA 4XR9A 1JA9A 5K1ZA 3FNFA 4KKXB 1TLTA 3R5TA 5TGZA 3N2YA 4EQ6B 5LZ9A 4PYRA 2FZLA 1N7IA 1SBTA 2X40A 3H87A 4JXKA 2H1RA 3UTDA 4TTVA 2PEYA 1G66A 2UZ1A 4OMUA 4WZAA 3GG9A 5C53B 2BEVA 3WS7A 1YJQA 1U5AA 4QPPA 1MC1A 4YT5A 2OV6A 3EQ2A 3UGJA 4M0MA 3DVSX 3DL0A 3BXEA 3W5DA 1KAQA 2IIPA 1BQEA 4QPJC 3KX2A 3R9XA 4Q03A 2H48A 3HM2A 4HATA 4Y6PA 2VK8A 1IEVA 4RX1A 1DKOA 1RWVA 4BEJA 4MVJH 1ZUWA 2B8TA 4E30A 1XA0A 1GEGA 5AW7A 1LS6A 4FR2A 3ZQUA 1P17A 5KS2A 1N2BA 2RJ3A 1NUTA 2CHFA 1ATIA 2DKFA 4OBBA 1N5IA 4XLTA 3WI7A 5FUVA 2LCQA 3HCDA 5D3MA 3A05A 2ODPA 4QFBA 2VZLA 2CLMB 2OAP1 5EVJA 1PO7A 3O8OA 4CEIA 2HF9A 4DGQA 2FPPA 5CLGA 3TLEA 4KQJA 4L9SA 1YAHA 3DNFA 1ESDA 1XVLA 5DRTA 1PWHA 5IDYA 4ATNA 1XU7A 4EHHA 1QCZA 3QEBZ 3OAAA 2P8SA 5AHWA 1B6GA 5BSEA 1HQYE 4RORA 2ZJBA 1AX9A 2O05A 5SICE 3DKPA 4KGVA 2QKYA 5AESA 5KYYB 3PI7A 4Q4DA 4E0BA 3PUKA 1KPHA 2A7QA 3IUEA 4P5DA 1SHKA 4H4DA 5EE1A 4DCTA 2ZIXA 2NAPA 5BNIA 3QNMA 1AC5A 3ZVKA 1FSPA 1GAXA 3OTQA 1OTXA 3U44B 4GWGA 1M8JA 5HE8A 4ZV9A 1U8XX 3DTTA 3QLTA 1G8GA 2DHRA 1UBLS 4NZPA 4F71A 2WU4A 3N1UA 3O91A 1E9SA 1MDFA 3QH4A 2J45A 2IUFA 4MPJA 4P32A 3UENA 5J58A 1UIRA 4UEKA 5KVAA 3G5TA 4RYDA 3SYNA 2HRRA 2P35A 4UU0A 1GSHA 1YZGA 1WCWA 3QG5A 1A7AA 2ZSHA 1T2EA 2WHPB 1JWLA 3THRA 3M3DA 3ZJYA 1LX6A 5ITWA 1G55A 1LV8A 2QHXA 3C3KA 4G1VA 4Y2RA 5H68A 4EM6A 1NFFA 4J3FA 4UUPA 3KOUA 1KFEB 5ETJA 2QLLA 3O8CA 5LLTA 2O3TA 3VYWA 4UNQA 4C76A 4RL6A 4YMGA 4GOND 2F4VB 3VJRA 2ADFA 4B3RB 3UNXA 2YVAA 3PZBA 1GZ4A 3MTBA 2OXTA 1KSJA 2C2ZA 2MHCA 4L9RA 1ULUA 1YOVA 1B1CA 3OOYA 1XRSB 2UVPA 4C0JA 2PJUA 4MO9A 3RYHA 3OQBA 4HXYA 1P0PA 2CNDA 1PRYA 1Z2OX 2W83A 3TB6A 4KV9A 4NYJQ 2CXXA 3E61A 3HZZA 3DQQA 1GOTA 1YE8A 2K2WA 1OLSB 3TEJA 5KNBH 2ZYVX 3NONA 5EJ6A 5CGQB 4BKMA 1OA0A 3R20A 4JLVA 1HPLA 5EAIA 3ZCVA 2UXDB 1EH5A 1C8KA 2D1FA 2QUHA 4ZO7A 4FMPA 1VZ2A 2Y9MB 4KNVA 3CLUD 3WV4A 5MFZA 3AVYA 5HF9A 2PZ8A 3MWGA 3OZUA 3R6TA 4UAJA 5A06A 4GDFA 8MHTA 1HLPA 4HEA6 3VVMA 4K2HA 2VWQA 3F6BX 1P9LA 1EUYA 1OZFA 1QJCA 2X2FA 3IH5A 4YRBA 4ZCMA 5C5CA 1AMOA 1NN5A 2HOQA 3KSRA 3VSBA 4Q7LA 4KMOA 3A9RA 5ILGA 5IANA 3HJHA 1UK8A 1FP1D 2ZQZA 3MD9A 2PR7A 4KAXA 4YI3A 3VJLA 3ESQA 4TL9A 5AW9A 2DR2A 1AGNA 4NOMA 3VR6A 2LV8A 3UW3A 3G2MA 3OQHA 1AHNA 2ANBA 1TECE 3H5WA 1I6MA 2NWQA 2OFPA 5CVCA 721PA 4ASUA 2GK6A 3QVWA 3IL2A 3P9KA 3V32A 1NZDA 4MV1A 3X44A 1YRWA 4KO8A 3LXRA 1XD2A 4IIHA 2B4AA 1UDXA 1ZZGA 1AUOA 3H83A 2PBFA 2ETVA 3Q7QA 1VOTA 4IZIA 3REOA 1RHKA 3H2ZA 3ND9A 1MF7A 3DB2A 2O7SA 5EIFA 5B1IA 1N8SA 4ZAYA 1BCRA 3DWEX 2QYHA 1BH2A 4HB2A 1DLJA 3L8HA 4OM7A 1M2EA 2LRHA 2YIMA 4WSOA 5KYWB 1S4QA 5FIUA 1CNFA 2R66A 3HNOA 3FF1A 1CNMA 3WC4A 1CUJA 1UJBA 3I8SA 3G5UA 3B1FA 5LM3A 5F3WB 2ZI4A 2GBCA 3EJ6A 4EO7A 1ISJA 2RHJA 4OUKX 4IF6A 4EJSC 2BHRA 1GLNA 3WB2A 5KQPA 4CNBA 1TCUA 4UE6A 2H1HA 3S81A 2JAQA 3K0AA 3HJCA 1B6TA 4QVKA 3WISA 1J8QA 4KDEA 4TTSA 2AX3A 2FTKE 2GBGA 2VATA 1KOGA 1RRKA 4MPPA 4RLSA 2I7DA 3T7CA 2NYUA 4QGGA 3R76A 4L5IA 1OFIA 3AV0B 1PFGA 5CITA 3GB9A 1P44A 4C7XA 3SBDA 3H6GA 3IODA 4Q4LA 4DOMA 2JLUA 2WFMA 1CC1S 4YS6A 1LPSA 2VO1A 4YREA 4Z49A 1RRPA 3A26A 3WDMA 2VYQA 4COOA 4IIEA 3MTDA 1FC0A 1YNOA 2FMHA 4G0QA 1TK3A 2RCYA 3EGXA 3QWHA 4L6AA 2JKZA 4MJLA 4NJOA 4CCSA 3ULKA 1ABBA 4KRFA 3SS8A 5LJIA 4LF9B 2B4RO 1ZD8A 3VA7A 2A86A 2Z5VA 4B8WA 3QOWA 2DPXA 2JFXA 1NBMA 1TPZA 2R1VA 4GFDA 2E9SA 5DISB 2WWYA 1DV1A 2ID7A 2CLLB 4A03A 4KPUA 4Q1CA 4A2PA 5U9CA 2C5EA 5AM0A 2OTCA 4UVIA 4RS3A 5IAGA 3UC5A 3KHSA 5D6NA 3V7FA 7REQA 1YL7A 4PFSA 2HJVA 5JWRA 2OP0A 2VHVA 3GROA 4M8LA 4TVSA 1L7DA 3NI2A 1VPLA 1ZJZA 4UKDA 3Q10A 4HDKB 2JASA 1MZPA 4FINA 4LVCA 3PNQA 3K1JA 3GEIA 3RC1A 4UTPA 3KYBA 3TRHA 2RK6A 5DASA 3NBZC 4MS4B 2QX9A 4JUIA 2WEKA 1F2UB 4IWNA 4IFTA 2OZLA 2XZOA 5CH8A 1K86A 5CURA 3VKFA 1RP7A 1Z73A 3L7NA 4N0MA 5HM8A 4P0PB 4GYJA 1KMHA 4M2LA 2LDXA 2VJBA 4QNMA 4PX2A 4AKSA 3FBWA 2Q3HA 2YYYA 3AUTA 2MMCA 4MP8A 2DBZA 3C70A 4UEOA 5DB4A 2VPXA 4L9WA 2XNDD 2B82A 2Z4SA 3OURA 3PFGA 4OHCA 2H2AA 4PFKA 5KVCA 4ON9A 3GJ6A 1NHGA 3JWJA 2O8FB 1DXHA 2PGJA 1L7BA 4Z7JA 3KV3O 3LWDA 3UH0A 4EHLA 2BKAA 1SCIA 2IQIA 2PL5A 4IDQA 1ZUNB 2F43B 4Z1MA 2JJ1D 5KC9A 3QPVA 1GCUA 4LHWA 3TNFA 1Y8QA 4CR8A 2HMWA 2XT0A 4BTEA 3QWIA 4ZCSA 2QAIA 1KZ6A 2XQJA 3A3OA 3CURA 1P2GA 2QF7A 4KAFA 2FSPA 2QMHA 5DOZA 4DJEC 3TFOA 1EUZA 1A1VA 3E9YA 3BULA 4DFDA 1YI1A 2B92A 3RRZA 1YKGA 2BVNA 2CF5A 2ATXA 4MUKA 3WX0A 3AG6A 4E5PA 3FNIA 1PR3A 5MF6A 4Z0PA 2X8LA 3LRTA 4DLYA 1SPXA 4PG4A 4OFZA 3L0DA 1P29A 5J4VA 5E7QA 1NF2A 4KQ6A 1UC5B 2I8LA 4U9IS 3F5SA 1UBNA 1YTUA 3P0RA 1CF9A 3K5PA 1Z2AA 3E9ZA 2QD1A 2WTUA 2WSMA 4JI1B 1Q0RA 2CJPA 3Q0EA 2YINC 4HRYA 4BVHA 1UF9A 1X38A 1VJCA 5EJ2A 1YXMA 3GJXC 4G85A 4CKCB 5BN5B 4GGOA 1Y5MA 2LP4Y 3EWIA 4MLDA 2CDCA 3VKWA 3IKTA 1X19A 1TMKA 2BFDB 4QARA 4BC0A 4POOA 1Q3HA 4EYEA 1QTNA 1VXRA 4ALMA 2IS2A 5JJBA 3VZCA 4DV3B 3OT5A 2ZTVA 4P80A 3KP1A 4X1YB 1A3CA 2B20A 1U99A 5E6UA 5CAEB 4MP3A 3ZHQA 1HX7A 2PCLA 1Z6PA 3L1JA 1FFGA 5FO1A 1RKBA 1QE3A 1ZNZA 2DVMA 3CNEA 5AW5A 1IBLB 2F8SA 4IGAA 3GVHA 4BX0A 1CETA 3ZHYA 1YZVA 2WWHA 1FP6A 4GR4A 2HRDA 2WUFA 3INGA 4L75A 3JD3A 2QK4A 4XCXA 2GBIA 2ONZA 3EVDA 4YRKA 3N9IA 5BVGA 1ESNA 3FA2A 2HTEA 1OX6A 1MIOA 3SEAA 1NW4A 3OF2A 3OBIA 3JQQA 3WGLA 1EFDN 2AB0A 2XUDA 1PJBA 1VBFA 1KJYA 1R7RA 3PPYA 3H7IA 1P0MA 4DLRA 1GA6A 3O31A 3S2IA 3A2KA 1EXWA 4F9FA 4U6SA 4ME6A 4E94A 3UV7A 2QUZA 3ZD9A 4DF3A 5FNVA 5G0VA 2D59A 4RENA 4DG9A 3E0QA 3TJMA 3K1AB 1NMZA 1C2YA 3DF9A 3GT0A 4N0QA 3CVJA 2FK8A 1VI2A 1MZVA 4D82A 3WQRA 4BATA 2QTVA 4WL0A 1T3TA 2GMWA 4KWEA 1SD5A 2O2JA 3FYTA 2YBEA 3GFPA 1GT6A 4X20B 2ICAA 3O47A 3N70A 4Y0VA 3UAXA 4ALLA 1CYDA 2I3GA 3GUCA 1P1CA 4MSUA 4BTLA 3C3XA 1C9DB 2HBQA 1Q0TA 4H3KB 4XARA 2FJUA 3HVIA 5E7JA 4OF4A 3UCFA 2AVDA 2XVZA 4U7DA 2WP0A 4G5FA 4V3CA 1WY5A 4S35A 1ZWKA 1M2KA 1XSEA 2Y1EA 4CRWB 3U3MA 3ENKA 1H2WA 2Z3VA 2IL1A 2RB5A 4KWIA 3NDJA 3WAJA 3OIUA 4P36A 5KOIA 2DEUA 1Z29A 1FK8A 4P4GA 5HKAA 4J7UA 3VOBA 4QD3A 3MINB 3R3YA 3T5TA 2H2DA 4ND1A 3L6EA 3V1UA 3FPAA 1T6YA 1RCFA 4DJ5X 2RGYA 5DM1A 4IHQA 4UTNA 1I24A 1UJ2A 2ODEA 2OT3B 4W9NA 4FFLA 3KZOA 3K5WA 2BYTA 3DAFA 4WUVA 1AXGA 2CSXA 5DRYA 2C59A 5JCOC 4O2LA 3F5QA 3OLZA 2OCYC 4EJMA 1GUAA 2BSAA 2WJVA 4PN3A 3FR8A 1YCFA 2YVKA 1QH9A 3AHJA 2XMZA 2VAMA 2H3EA 2VH5R 4UREA 3IR7A 3IAM1 5JHGB 4CKEA 3RB8A 3ROXA 5DGHA 1PJQA 2OBNA 4JODA 4NRDA 2EP7A 3TBKA 2A5LA 3QVLA 5AXBA 1EFPA 3U3ZA 2RKBA 3PQ5A 4G65A 1IUOA 4ZYLA 2CE2X 1AS3A 1Z0DA 2JRLA 3V7NA 1ZK3A 3RG8A 4IDGA 3IKJA 1Z4JA 1XT6A 1T4GA 1Z6XA 4EVRA 1KO7A 1KF0A 1PGJA 2G72A 3QE0A 2GT1A 4RMIA 2X19A 2OMEA 3CS3A 2CN1A 2VF8A 3MD0A 1JZTA 4L3WA 4JJGA 3KVNA 3O92A 4NFLA 1KJZA 4RXUA 4JHLA 5T41A 1T6ZA 3GRKA 4EPXA 4OLAA 4FYIA 4XOIA 5TMBA 4BNNA 2HD4A 1Q7EA 1V6SA 1XDUA 2O3JA 2WFAA 4M1OA 4F2DA 2Q99A 4ZEMA 4REOA 3VZRA 4INAA 3DBHB 5HEKA 4BB5A 1NF3A 2QDKA 3E4CA 3KLPX 4TLLB 3T1NA 4QDZA 5D3KA 1ZD3A 1UMBA 2A6PA 2ZRDA 2V7GA 3DEHA 4FXOA 5BP7A 4DY6A 4YAIA 3GFFA 4LXXA 4TTQA 1FSGA 3B6ZA 1DUIA 4RFSB 3JS5A 2EC5A 3I5YA 1C3JA 1GPMA 2GXSA 4IIJB 3GDOA 4I9GA 3HXTA 2B61A 1CQJA 1ZOOA 1EP2B 1V5IA 2E85A 4EH1A 3ILXA 2WG0A 3KD3A 3AR8A 2AOTA 2O4CA 2P1RA 4FGZA 1JQDA 4TMXA 3PHLA 5CW2A 4YRQA 1BWQA 3E2MA 1KEUA 2PWZA 5FWAA 3D3EA 2VEDA 3VH1A 5FBVB 5FTLA 2RONA 4B80A 3CVYA 4HPWA 2C96A 1KR2A 4B3BA 3FCUB 1R4MA 1U98A 4AX4A 2IOYA 5CLIA 1YE3A 4LF4B 1ZP6A 1FDRA 2EJTA 3NJRA 4V02A 3FPGA 1PZEA 2OYRA 2G4VA 1C7IA 2XVYA 1IZ0A 4V1CI 4E5KA 3SJUA 4JFRA 5KQGA 1NOIA 2A3NA 4U7PB 2O2CA 1KH2A 3ELWA 4U3JB 3D81A 3EVAA 1QO0D 3JTEA 4HNUA 1P2VA 2GN6A 3LCMA 3O4HA 1K97A 4UHKA 5IW8A 4YRIA 2YOFA 5CMLA 3DPSA 1LH0A 3FWZA 3Q87B 2JJQA 2P0AA 4ZCRA 3WNQA 2XXAA 1ZN8A 4PHGA 1SWWA 2W2XA 1HRDA 1V1RB 3CLTD 1T9AA 4GMGA 1AU9A 4ENRA 1XCBA 4YUAA 4OYYA 2DH6A 4D42A 1I4WA 1SUEA 4PQFA 5LP6B 4Q1AA 2K7FA 2GF9A 2BFFA 4G4SP 4EW1A 3ZQ6A 4B5KA 4HAOA 1H4SA 3K9QO 1NC1A 2HCTA 3BHMA 3I9LA 4C7MA 2JDIA 3PZRA 1SIUA 1YJ8A 4QQ8A 1Z82A 3OZEA 5JE8A 2HYIC 2OBLA 4NBKA 4BRZA 1CTQA 2FFAA 1TDJA 2IYSA 4O4IF 3NRJA 1KKMA 2GPJA 2OWEA 4UBJA 5JC8A 1CZRA 2EHJA 3AT1A 4GL2A 2FXIA 1U9CA 3PC2A 3PGJA 1QLJA 4HF7A 1JQ5A 2X0RA 2PZEA 4UUAA 1C4KA 2ZATA 4PTZA 1Q1GA 4WZAE 4YXFA 2VHTA 5FLXA 4NBWA 1JR3A 4HMOA 3F5MA 3OOSA 4S2EA 4KYVA 4Q48A 3RS8A 3TQRA 5JEEA 1K7YA 3I6ZA 5DM0A 1JWAB 1L4KA 2XB6A 4XUCA 1MVOA 3UMRA 4CR6A 4U2BA 4GX1A 2JLSA 3M4NA 4FW8A 4ZU6X 3SNKA 3UAOA 3HDHA 4C04A 4B1FA 4JI7B 1UWVA 2GCIA 2OB1A 4AUNA 5IT5A 4O1IA 4RK0A 3NDIA 3ME5A 4KL8S 4UDNA 2X7XA 1ZH8A 4LOIA 4P34A 3O83A 4FIZA 3WWEA 2G88A 4MVCA 1GPUA 1SVLA 2Q50A 2DFPA 4Y1RB 4IDNA 4K0KB 1X1AA 1NLZA 1JB1A 2O5VA 4GLJA 1B42A 3WHPA 1LCIA 1G7CA 1U1CA 1WVGA 2QTTA 2VPTA 3D6HA 3NT5A 1PFKA 4WHMA 4Q9JA 4ER7A 3WYNA 5IDQA 3RSSA 4O02B 2XZPA 3PUYA 1P77A 2PJDA 1JFTA 4IIBA 4B3DA 3WLQA 1R10A 3H42B 4OKSA 1FFDA 1MU0A 2JGDA 2PDAA 4MW9A 1MEOA 2A67A 2H2FA 4HQNA 2G5CA 1GTRA 2ZP1A 4JEIA 1KO1A 4REQB 5KNDH 2UZ4A 3KPJA 2LIPA 2IYRA 4CLRA 1PLKA 4Q4AB 3WYFA 4YAUA 1X1TA 5L8VA 2C2HA 1NUQA 5E9JA 2I91A 2CJXA 2AXEA 1YR3A 1X15A 4Q9NA 7AT1A 3UFBA 2YFQA 2Z2YA 2MOKA 4DR2B 3IDSA 2MJLA 3HBMA 4MWBA 2GRAA 3QF4A 1TUBB 5E6RA 3V2IA 2B3TA 2APJA 2W6PA 1DEAA 1KEWA 2JJ2D 1EFRA 1VL5A 3Q5DA 2PSFA 1BJRE 3ZI0A 1OFUX 1YBFA 4IZOA 5EZYB 5F73A 3UJ3X 8ATCA 4RTMA 5JJKA 1ABFA 3ABRB 3C48A 2BCGY 4ENWA 2WJHA 4W8GA 2CNLA 5IFKA 4MW0A 2V54A 5I8WA 2XA1A 3V3TA 3EVCA 3TLJA 1Q83A 2FUCA 3WQBA 3LY5A 4JROA 1CUXA 3W8RA 5DYIA 4TPKA 5EXPA 4BQIA 2G9ZA 3KOYA 4X54A 1E3TA 4YBZA 1NNSA 2ADOA 3H2HA 3L6UA 4P3YA 2UYCA 4X1KB 1Z39A 3OCYA 3CW8X 4MV7A 5DHUA 4WUTA 2AZMA 2IBTA 4W7SA 4JASB 4LE0A 2YXLA 3AOEA 4M8IA 1V1MB 4S3MA 4B87A 4H7FA 5CR9A 5EHQA 4X24A 3TW6A 3TRKA 5LQMA 4RIHA 1XHLA 2C5LA 1QHYA 3UPTA 3WG9A 1SC3A 1S8FA 5BW6B 3QE9Y 4KX3A 4KQKA 5HK8A 2XDAA 4XOUA 2I6SA 4R2HA 1TMYA 3C5EA 3R3WA 2HU5A 2NTVA 3ER6A 4MWOA 5LZ8A 5TJHA 1WABA 3A1EA 1EWQA 1JFLA 3KQNA 3JW8A 4IV8A 2CCJA 1TFRA 4PQYA 1MENA 3AI7A 3BM5A 2RBGA 5JHHB 4GXQA 3KBOA 4X92A 3MMZA 5CW1A 2X8AA 2XODA 2CKDA 4JKYA 2JI4A 3ZNNA 5E3JA 2Q9CA 5JMWA 1Q21A 2WSYB 4I8XA 1MOSA 2OZEA 3D3WB 4JU8A 3RROA 3MAAC 5SZKB 2QRJA 1O94D 1O9BA 2VA9A 4JXZA 1OV4A 1G7TA 1J70A 3A9VA 2PA3A 1NKVA 3QEMA 4KPGA 3THWA 1T3SA 1IH8A 3Q8WA 4EI9A 2EFEB 2VJPA 2VJAA 1S8NA 3GNTA 5IM4A 2QVGA 3LM8A 4RVSA 1B2RA 1WZCA 1KGDA 1M2FA 3TKLA 5JW6A 4PU0A 4D0NA 2D2FA 2JGFA 3HDJA 1LJ8A 4P83A 5BV8A 1H5NA 3KSMA 4JCOA 5A0FA 3R7FA 1CJMA 1NR5A 2H5IA 4OHUA 3R3ZA 3OTGA 4MRNA 1T2UA 2AW3A 1OXSC 2W6ZA 3KLMX 3GNLA 5TF0A 1YQQA 5HBGA 3SFZA 3K70C 3PBKA 1E1LA 1UQUA 4Q9AA 3TLGA 2IDMA 3NFRA 1DBQA 4UU7A 3V2HA 2VG8A 1DKLA 3A8TA 1K06A 1W8IA 4NBLA 5HDQA 5REQB 4URWR 4M7WA 4LC1A 5IUNC 1FVXA 1M1YA 3P8ZA 4QOHA 4XJVA 4DMLA 1YUMA 4FNOA 4UMFA 4DTCA 3KZCA 1HL7A 5KSOA 3WGVA 5EE5B 3AF5A 1IMJA 1NVBA 4Y1FA 5DM4A 4ZYVA 1H8HD 3EXEB 3IP1A 1U0LA 3ZKWA 1UODA 4YGYA 3GT7A 2EZ4A 5JSYA 1KEZA 2WILA 3X0DA 2A78A 2VT6A 2QXTA 3FYUB 5AK6A 2D2VA 4EHJA 4EKNB 2WM9B 4RTOA 4F6RA 3BMXA 3ETGA 3GLIA 1QP7A 3FE2A 1H93A 1L4MA 5CFOA 3PJDA 4OD0A 2BFCB 3GWGA 4X7RA 4ROSA 4PPQA 5JEDA 3FFBA 4ZGGA 3MQFA 1ZOSA 2JCBA 3WY9A 4EFLA 3DULA 3W4KA 3FX2A 3DZCA 4OGKA 2ZS7A 1N1GA 2AW5A 3CEJA 3O73A 2XWBF 4IF4A 3JATB 1U8ZA 2XBUA 3RUEA 1ESEA 2XUHA 4NNOA 4Y2HA 2ONYA 3LOPA 5LLDA 2JD2A 4A0RA 1CZLA 3O9VA 5FL3A 3GUYA 2PMBA 1OB5A 4ZC8A 2IEZA 1NBME 3GLGA 3LIIA 1AXEA 2DP4E 1THGA 2V3WA 1L5YA 3FDXA 4MB6A 3ZVLA 3BJMA 3L04A 2AJLI 1W0KA 5IP5A 1JH8A 4TKVB 4EJFA 3BERA 4LRUA 3B36A 2EJWA 2EG9A 2GEFA 3DD1A 3E9MA 4AIIA 2IX3A 1RHRA 2DBRA 3MTAA 4M7RA 4DCJA 4MMZB 4KEAA 2QQFA 4LC0A 2TSYB 1DEHA 3U09A 2G70A 4BMNA 2PU7A 4BCDA 1GTJ1 3NP9A 1XPUA 2FG7C 2C4HA 4BECA 2RBKA 1M6YA 4XGKA 3IHLA 4URZR 3SPXA 4EI8A 4ODIA 3NTVA 1EMDA 1KDOA 1NJFA 1Y6QA 2GYVA 1AZSC 2UVQA 3AETB 1D2EA 3PX2A 5EEGA 2C78A 4UUOA 4ZU1X 4C29A 4GP9A 1N77A 4UBMA 1E1CA 1DPGA 1F14A 2GVDC 2WKQA 4UMVA 2P77A 1KI9A 3K2EA 2UZIR 3BRCA 4BUJA 3WXBA 1PVDA 2BF4A 1FYDA 5I9SA 3WKEA 1QRRA 4H60A 3F67A 4OUDB 4DYHA 1YV9A 4C9BA 4F11A 1Q0SA 3EHDA 4HB4A 5AVVA 2IX9A 3ZJTA 3ZZUA 2XY4A 1JLRA 2W2QA 4ZCLA 3R6GA 3OZIA 5ULLA 5DV9A 1ZVMA 2P4SA 3L1UA 4GX2A 1SO8A 5IVIA 2R6GA 4EG6A 4DHWA 4GZMA 1ZH4A 4QXRA 4I1IA 5K0JA 4ZZIA 3RVRA 1XG5A 4MWZA 4RSGA 4HDNB 5EP1A 2XT9A 3H8JA 1I7LA 2WK1A 3ISVA 3UMGA 4EK9A 2P3QA 3RU3A 4F1JA 4CLOB 1XVAA 1S2OA 1XQYA 2J6HA 4WPGA 5EIHA 5KTNA 1A7UA 1EBFA 3FYCA 3CLUC 2VQEB 4FOLA 5FTNA 2WIKA 4BTVA 1KJWA 1R4NA 1LBHA 1WCXA 4YDQA 3TUJC 4YPOA 2ZTLA 2GFIA 5JR3A 1QYXA 2VDOB 4FYMA 4U6NA 1R5OA 2RGNC 3JYLA 3A36A 3UMJA 2RSLA 5DLDA 1YONA 3QHAA 3KDPA 2HUNA 1Y8RA 2VFAA 2P6OA 5ALZA 1RRVA 3F8WA 1MP0A 3VR1A 4D8TA 4QM7A 1N9KA 4PZ0A 5AHRA 3ET5A 2CDBA 3D6JA 2DQKA 4OGLA 4KR2A 3C3DA 4MUXA 4RADA 5J9FA 4WXPA 4DT1B 2OY0A 1ZH6A 3CQ9A 1EDOA 3PFBA 4CQMA 4K46A 1BX3A 4PGMA 1NVDA 3PHIA 4JUCA 3ID6C 2GZAA 1KXJA 2Q45A 3IMKA 5BQ3A 2ZUDA 2UUBB 1KSGA 2HHCA 3W1VA 1LRKA 2AWNA 3KXDA 1RWQA 2ZT6A 3UIEA 2NUTA 4Q39A 3EQ9A 1V95A 1ISMA 1USWA 5AVUA 1J1ZA 1RDFA 1R16A 3IS3A 4BASA 1X77A 2P9TA 1XV5A 4F3KA 1MAUA 2WDZA 4UUQA 5DHTA 4EB0A 3CR7A 2HK6A 3RRXA 4BU1A 1XRNA 4II7A 1GTL1 2BRUA 3AVQA 3BWDD 3DKRA 3INTA 1UJMA 3M4ZA 4KWTA 3KT3A 5TNXA 2CEKA 1TM3E 2Z8YA 1R0LA 2WIFA 2YWXA 4IOJA 4EI7A 2FE4A 5SZJA 4BXOA 2X13A 3UAVA 2CNNA 2NNWB 3EGEA 2WIGA 1W75A 2Y68A 3EGOA 2O1EA 4X94A 1TM7E 2C2GA 3U3RA 3WVNA 2VJOA 2VF2A 2OMKA 1TAQA 3ADKA 3GGJA 2UYGA 3C4QA 3WIDA 2BDTA 2HXGA 1G8JA 3BMCA 1JAHA 2GPSA 3D4PA 3LDAA 1T1EA 1AB5A 1F8GA 1R4AA 4BZQA 5D5PA 5BNWA 5JMPA 2C7QA 4DSAA 2VPZA 1XNJA 4PGHA 1DCFA 3H5TA 2FQ1A 1O5IA 3MSCA 4QGHA 1DXYA 4EMUA 1XD8A 3ABSB 3NKLA 3GUUA 5I47A 1E9VA 2OFOA 5GJVC 2PLWA 3AOGA 4EAQA 2Q4OA 1P1IA 2TS1A 3QV1A 5K8CA 2GJ8A 3LP6A 3ZXIA 1SB9A 3HY6A 4BO4A 3LRPA 4K03A 5HYVA 2NZ2A 1F8YA 5AI5A 4B7AA 1J5EB 2G1PA 4MVJD 3BRWA 3R77A 1RXUA 3MJHA 3FDJA 1X6VA 2G3YA 2H52A 4KVZA 1EK6A 2D5CA 3G1TA 3BA1A 4A0HA 1GUYA 4JBXA 4FMBB 1H1TA 4MXDA 2RGBA 1Q22A 4L5AA 5IKMA 2Q3JA 3PDCA 3WGMA 4F97A 5JZOA 3QQPA 1W0CA 2I67A 4ZCTA 3EVBA 3N2ZB 1SJ9A 1XLTA 4ILEA 2VTKA 2REXB 2KYRA 4LTNA 2J5BA 3C6XA 5FBRB 4ZAWA 3L1KA 3U81A 1PYOA 3M8KA 3MMSA 4JQCA 3WGZA 2HN9A 4YJFA 4BNTA 1QF9A 1SXPA 1Y1RA 2GBLA 2P9EA 3IE2A 3M6VA 1JXQA 3CHYA 3ZWPA 3JWPA 1FS4A 4BNHA 1YBVA 1NBWB 5KREA 4Q19A 5EQDA 5KIAA 1X3SA 1G6OA 2QL9A 1CDDA 5EIWA 4LC9A 3QQ5A 1GL3A 4BLVA 1B14A 3E7DA 1NQOA 2R25B 5E4FA 5CEFA 2P9FA 4LBWA 1MH9A 3I76A 2ZQYA 4MI6A 4MR8A 1JE0A 3USES 2FAXA 1L5HA 3D4IA 4BQSA 1EWTA 3OF3A 1G6Q1 5IX8A 4M0FA 4KVGA 3M6LA 4WZBA 3U9TA 3E1GA 5KVQA 1U7ZA 1UPAA 4KB5A 3U48A 1Q7GA 3NUGA 3L1VA 4I9FA 4YP7A 5A7GA 3ZGLA 4C1BA 4GMHA 1ISGA 2I4LA 2CXUA 2HK9A 4FILA 2JFZA 1MGPA 2P65A 4JOQA 4XYBA 3IE0A 1E3LA 4D4MA 3HCNA 5A7FA 1FSFA 3EQ7A 5DBGA 1EXDA 2FSGA 5FBWB 1SB8A 2CHEA 2Q9AA 4U7WA 4Y67A 4COKA 4PQEA 5I6DA 5K20A 5M34A 1P6UA 4U8HA 1NTOA 3GL9A 3ESBA 3ND8A 1XTKA 4KIUA 4Y2JA 2W43A 1OWNA 4UPDA 2DPGA 1ZMOA 2V45A 3LDGA 3LQRA 4NCHA 2ATVA 3SP1A 1MJGM 1NONA 3V00A 2AE2A 5K01A 2G25A 2WYUA 3JYNA 4Q00A 3B3GA 3M82A 5EJFA 4F5YA 4J94A 5KNBD 1RR6A 4GQBA 4DYVA 5L53A 3K0BA 1JNXX 2X22A 3BDVA 2IV7A 2C00A 1G9XA 3TTUA 1DV2A 2AE1A 4CBVA 1W1UA 3F74A 3S1AB 4PG7A 1P3DA 2PH1A 4HLCA 4OAQA 4TV8F 2NGRA 4QZVA 1S6YA 1BH6A 1K7EB 4J0KA 4HYQA 1O0CA 4MRRA 3PQ7A 4X62B 1SC9A 3FB1A 2FUG6 3MJFA 3OEHA 3BWEA 1JEYA 3HY3A 1LTQA 4DJTA 1JHMA 1M75A 3RU2A 1Y98A 1RAEA 2I29A 2PO7A 2Y1XA 2CBGA 1SQGA 1MHPA 1Q0PA 1QVWA 2G0TA 2PSHA 3C3MA 1XZHA 3IXLA 4K9KA 2PLNA 2VA8A 4MV4A 4KAJA 3T5BA 4TKUB 1UT8A 1C9JA 5DCLA 1D7AA 2ZZMA 5DMXA 4TS1A 3TKYA 1SBZA 4BCCA 3VU3A 4XKJA 1SOUA 3UKDA 4QDJA 1Q50A 2QX6A 3PUVA 2OCKA 4FMDF 3ZJ5A 4ZJPA 3FDZB 1XTSA 1MAAA 2IHYA 4P7GA 5EIEA 2AVNA 2GO1A 1G2OA 4OJTA 1UAAA 3TD6A 2V4UA 3U1BA 1UBMS 4JJ7A 1P2DA 1SOAA 3BF7A 1EYZA 5EZQA 1UFVA 3PNLA 3FYDA 1N6HA 4YP0A 3TW4A 4AMVA 2WF6A 1T0PA 3T38A 1CHNA 1XCMA 2AOXA 2CUTA 2NU7B 3IIIA 4EQZA 2CT8A 4N7BA 1Y3FE 4G9EA 4H15A 3UKOA 3V4FA 3IT0A 3LA8A 1ECCA 4ZTBA 1H3EA 2ISSD 4HZIA 4FLFA 3V46A 1XMJA 2BPOA 2WAYA 1THZA 4M36A 3IVAA 4M83A 2QTMA 4JKIA 4YB8A 3GO4A 5CA1F 5ALVA 2GVZC 3D7LA 3ZHUA 2NO6A 4E03A 1KSFX 4O4IB 4OXYA 3RC2A 3EY4A 3NNNA 1JHXA 2VJMB 3ZWMA 2AA3A 1XRLA 2O2GA 3SIXA 5AW3A 2B34A 4LNUB 1YS9A 3HBJA 3NUQA 1IWBB 2BLLA 3VHXA 4DJDC 2O1SA 3F96A 3GU3A 3IUJA 1NI5A 1V35A 4MKIA 5E7MA 1JR3E 3GJQA 4U02A 4M3NA 1IULA 2EQAA 3U17A 3RSOA 4Q7EA 3UVEA 4D9JA 3EA0A 3DTVD 4OFBA 2V9CA 5A4IS 2NUTB 2OA0A 5HZKA 3DEAA 4I2NA 1UM8A 4RZQA 3VR2A 1MDBA 3CTMA 5DGCA 2F90A 5IKXA 4H31A 1R8JA 2V5VA 5G0UA 4QL3A 4WDQA 1J2YA 3IQFA 5IJWA 1SXQA 2Q7XA 2I4RA 3BF8A 3PD0A 3CC8A 4LSGA 1E62A 1U65A 2M2IA 2HJWA 4PN7A 2JIZD 2XSZD 3H17A 4U39A 3U49A 4X66B 1WPXA 1APBA 1LW6E 2NIPA 4EI2A 1Z4NA 3CNNA 4TXHA 4LFBB 3KO8A 5TPWA 4LJAA 2ENWA 4TWAA 1ZQ9A 3SYTA 3FMIA 4MKHA 4P5PA 2DFVA 3JZDA 3E15A 1EZ1A 1I1NA 3CUWA 3NU1A 1O54A 1KY2A 1WKVA 3P9CA 3TQOA 2E87A 4NZMA 4Y9TA 4MWEA 3RC8A 1IBCA 2L18A 1E4OA 1OAKA 2HLNA 3DTVB 4LJ5A 3VU0A 4EOGA 3BD6A 5B1EA 5SZIA 1IWPB 2RKWA 1OT3A 1YRQA 4G1UC 4V0RA 4MROA 2JI9A 2FGJA 1SCKA 2XE6A 4YEDA 2HHAA 2V97A 3LBHA 4TTRA 3WGUA 3FI0A 5AHOA 1F4VA 3HP7A 5AKLA 3Q5EA 1G5PA 2CVPA 4EX6A 2IIBA 2JVJA 4JITA 3SJAA 3ZDDA 3JVDA 4GNRA 3QVOA 1DCMA 3C6QA 1GDTA 2SECE 4HB0A 4QXPA 3TL3A 4YV0A 3HUEA 4LQCA 5FL7D 1E59A 1E2KA 2KWIA 1PT6A 1I3MA 1HYHA 5K6AA 3TGPA 2QXUA 2ZYGA 4UATA 2XOXA 1RXIA 4M46A 1RC8A 3MWEB 2R84A 4J76A 2YQZA 4BQOA 4IOMA 5CCBA 2JANA 4PSAA 1Q5PA 4JP8A 1LPNA 5DX1A 2EL9A 1JTEA 3ANYB 5LP6C 2DBYA 1JNYA 3HCWA 4LXYA 2R7KA 4MJXA 3CLRD 5DO9A 2IUEA 3P9SA 1ULAA 4CN9A 5KTYA 5IS2A 1D5CA 1SU8A 3LPDA 4NV3A 4YRFA 4DM3A 4AO6A 3GDGA 2Q1XA 1QCYA 5C51B 1YT5A 2GPAA 2PMFA 3DAYA 3IELA 4JBNA 4XWYA 3UWOA 2H18A 1KHTA 1WLYA 2V8BA 3DLPX 3H9BA 4GXNA 3RUAA 2O2XA 4J0FA 3OZXA 1R6VA 2EF1A 4KYUA 4KE7A 3EIWA 4UD2A 4JYMA 2GX6A 3B9QA 1FUIA 3DKVA 1N5JA 4L0DA 3I5XA 3ZG6A 4GQAA 3SD7A 4Y7DA 4BKUA 1UZNA 3L7AA 1Q1QA 2BI8A 2A0YA 3HN7A 1TVKB 4RA9B 3QKTA 3K35A 3HP1A 3OWOA 4IVPA 1LI4A 3PHGA 8ADHA 1HLFA 3IP8A 2XGJA 1GAJA 3I73A 3QELB 4CEJB 1OREA 4BJHB 2EIXA 3HRIA 3G02A 3TZ6A 3WGNA 3NXKA 4YQYA 1SNYA 2WSIA 2XA2A 4MUJA 1LPMA 3NAMA 3ROGA 4D6XA 1QKKA 2ES4A 1X8XA 3EPLA 1QIJA 1Q2XA 3UMMA 2GCEA 1P39A 2W7TA 5AM4A 3IJRA 5IAEA 4G25A 3BREA 2WDPA 2R65A 3KFLA 4IIVA 1NM5C 2HI0A 5CT6A 4LIPD 1YVDA 3KQTA 2RH4A 1KVTA 3Q4GA 2WFLB 1TT7A 1IEWA 3C45A 3EXHB 4QDXA 4WNYA 5EYPA 2XUPA 3ZJUA 3BIXA 4XRRA 3T95A 4C03A 3W5UA 2P9QA 1KS2A 1V9CA 5EVCA 3A2NA 1WPRA 4QGSA 3ZH2A 1U4OA 1M2OA 4EY7A 2Z95A 1W36D 4A0GA 5JNTA 4LPSA 1PNVA 4RXMA 4WACA 5IDWA 3FMPB 1BROA 2IXTA 2W8BB 3FZEA 4GGMX 1I2DA 2OBXA 5AJYA 5COQA 5KHOC 4BQNA 4BKRA 4NAVA 1OH6A 1F3LA 4RF4A 4HVLA 2G77B 4HK4A 3SSOA 1G16A 2PZKA 3NBXX 5DI3B 2NADA 3RD5A 3LPAA 1JJIA 4L5JA 2YYAA 4PINA 3VHQA 1DC7A 1IXZA 1P9NA 2ZBVA 4JI3B 3W5HA 5I5EA 5J1SB 5J43A 2WIJA 3LBNA 1QDEA 4R1MA 4CKXA 4B73A 3EW7A 1EIWA 2FPGA 5HKKA 2C7OA 1TU4A 3SQDA 2DLDA 3GLIE 5GPBA 1A9XB 4AG3A 2CHVA 3A4MA 2REQA 1ADGA 4PE5B 4E5UA 4BJ1A 1TJ4A 2OO5A 3VGJA 4HGPA 3C6BA 3ZI7A 1IN7A 1P9OA 4CEHA 3M6MD 4O1MA 1CCWA 1KJIA 2WI8A 3CSUA 2DAPA 4AMUA 4HNQA 4HS9A 4AAYA 2G6BA 2G9NA 1PQYA 5BMVF 2GEVA 1ECBA 1CJUC 1KJNA 2OP1A 3FKJA 3SBEA 3OHPA 1U2DA 1E9AA 4D9NA 4ZK6A 3D9QX 2EZUA 3AVPA 3IOCA 3WNCA 3NMUF 2Y0EA 2LWIA 2OAEA 1RPZA 4D4GA 3GLGE 3M49A 4HLUA 4RM3A 2AFVA 2PWYA 2OM2A 3RRFA 3N7AA 3RF7A 3BXPA 3PHCA 3TIIA 1HH4A 1VJRA 5CDUA 3D7NA 4AY6A 4D4LA 4OQDA 3W2HA 1F5NA 1SK9A 4DMHA 2QD2A 3ZI4A 3KVRA 1ST2A 1SBQA 3B1KA 3LFTA 3ZNOA 1DKUA 1B2LA 3D31A 3NDBB 2YJ3A 4OLBA 1QE5A 3KUDA 4NFYA 1EVJA 1BX0A 1XMIA 4BNUA 1OLUB 4BE4A 3GMSA 3I6IA 2VTBB 4TN1A 1ANKA 1HFJA 2P9CA 2VC2B 2BI4A 2AFIA 1IONA 2IELA 1G0OA 3HSYA 3IEXA 4HWPA 5LBUA 1OT5A 3ZWCA 3OCUA 5G3YA 2I2XB 4UJ3A 1KP2A 3MHTA 1RMTA 3SU8A 3NIBA 4LISA 4R1NA 5BWOA 5K2OA 2FI1A 4NZZA 4ACAA 3I62A 2HHHB 1LBEA 1A7KA 4KR3A 3DMFA 1SZDA 1KHHA 4DC9A 2O8VA 2YZNA 3ZHVA 1JAZA 3DZDA 4EW6A 2BM9A 4Q7QA 2YCBA 1PDWA 4UNIA 3TCXB 5HP4A 2IY9A 4OHBA 4MQEA 3RT9A 5ITSA 3FTNA 3OFND 5BN3B 5IVHA 4IILA 4RVFA 5K6TA 4NYIQ 4BHTA 3G85A 3ED1A 3RYCB 1HETA 1TGVA 1CJCA 1Y9EA 3UAWA 3RFUA 2R7MA 2PNFA 4IQ0A 1ZD4A 3LBIA 2NSJA 5EKDA 1A4IA 3ZJ4A 2J0EA 4EL0A 1HNWB 1K68A 1R0KA 4WQMA 1E2UA 3PR1A 1W34A 4KU4A 3OE7D 3PG5A 4YWJA 2UUOA 2BBSA 2WPDA 4IICA 4PQRA 4YJ2A 1QO9A 1ZESA 4U5QA 1F8FA 1I2CA 1ZK1A 2VZ0A 1GSOA 1VI6A 3DMGA 4F5DA 2RHHA 3NASA 3RBXA 1ISIA 1Z2CA 3DBLA 2X0FA 1O94C 4W5QA 3D6AA 2R8XA 1MC8A 2XIQA 2QRKA 4KGXA 4CM6A 5KTMA 1RKUA 1SN7A 5KTPA 2PRSA 3BSWA 5IKOA 3VSDA 4E5DA 4K6FA 2GTPA 1W9HA 4X3PA 4B71A 3UUFA 4G5SA 4TZKA 1JFSA 3VJKA 1T8UA 2J6IA 1U28C 2PYDA 3K20A 2KBFA 5JSQA 3GOQA 2JFWA 4ZRNA 4AZWA 1KAOA 4MS3A 3LP5A 1NUSA 3OP1A 3CZPA 4QUIA 1D03A 4WV3A 2CW5A 2C9YA 1IC6A 1U7DA 1XYVA 1QGOA 1O3YA 2YIDA 3K73O 1ETUA 4P9NA 4Y7CA 2QSYA 5F78A 5FJJA 2NZWA 1AKEA 3H8WA 1AKRA 4MWGA 2J7KA 1K9VF 3KDAA 2Q4TA 3NV9A 3WLOA 5AKKA 4ALIA 2F67A 2QMUA 1WP9A 3GEMA 2HLPA 3EQ8A 1YO6A 2G1AA 2PEZA 3UOWA 4UTRA 2IZ7A 1X2BA 3T9DA 1RPAA 1OYYA 3BZWA 3PPXA 2CYAA 2YFYA 4OSEA 3OO1A 3VR4A 1PR6A 4UNPA 3LDUA 421PA 1VHTA 1REQB 2FMXA 2P2SA 1K3UB 5BO5A 2E82A 2D7CA 1ENPA 4MRPA 5CJPA 4BZPA 4U9HS 1ZSYA 1UOEA 2DKNA 5HS4A 3HB1A 4DNXA 1QF6A 2HCBA 3UHJA 4L8YA 4X1IA 4O4JA 1X80B 2JLXA 5DLEA 4DDKA 1FPMA 3NATA 3HJRA 4HDRA 1C3EA 4D74A 2AOVA 3VSEA 4FZVA 4IOLA 4P93A 4DA7A 1MT3A 4TLCA 2ZRPA 4A16A 1JHYA 1J6UA 1HOTA 1DARA 2YC4C 4FEGA 2F8TA 2PX0A 2I71A 2YJNA 4XPIA 3AV3A 3BOSA 1XROA 2IYPA 1BOOA 1SD2A 4JX9A 3BE4A 4IUCS 4P35A 1WMFA 3ROQA 3V48A 3TZEA 1GTZA 1W85A 2AOUA 2ISCA 2RIPA 3PVSA 4QYWA 2YHBA 1FYXA 1ZIOA 3GHHA 4M0UA 2ZEJA 3GLUA 3HRKA 5SYMA 3ZIAA 1UMCB 5AVXA 3AIIA 4RTLA 1UDCA 3M2TA 3QMWA 5F2KA 2YH2A 4KXQA 4KQCA 4C21A 2BELA 5K8UA 3B5IA 4FFBB 1COWD 1H9BA 2OGWA 2RDMA 4XASA 1S01A 3U2QA 3MIIA 2AI2A 5FWXB 1QAOA 3J7AC 2B36A 2WOOA 1QMGA 3LF1A 1D8AA 1RJGA 3DXXA 4BX8A 4WH0A 3R5SA 5JAOA 2P6RA 1HV8A 3Q9SA 1NVEA 2R85A 3N39C 4RPJA 3U13A 3V97A 1R8YA 3OOJA 4N6GA 3RHSA 2IXAA 5G02A 1ML4A 4TUYA 3SIPA 3U7RA 5I9MA 1K4MA 1MQ8B 3NH6A 3K5HA 2FLKA 4W8OA 2O06A 3MCAA 4I1YA 1WQ3A 1MO2A 1HQKA 1X1RA 5KNDD 1T2AA 1KJQA 2O0KA 2A9KA 4G1BA 2ZSBA 3N7UA 1CB0A 2CXHA 2Q6KA 2JH3A 3JQFA 1GQOA 2B5VA 1U9IC 3AF4A 3P9XA 4DCNA 4B3SB 2AMJA 3R6WA 5BQFA 2XGOA 4RE5A 1RC1A 4W1PA 4OVKA 2UUAB 3F4BA 5E4JA 5DP2A 4KP7A 4FN5A 4GPD1 1DTWA 5EZSA 3AEQA 1EK5A 4OY3A 1IVSA 2Q1TA 1Q95A 2F59A 4OKIA 3ZW9A 3R5KA 4JVLA 4YGXB 4ECAA 2IPNA 2J3HA 4D6YA 1W88A 4HGQA 1I2MA 2Q07A 5IKPA 4Z9AA 5CU7A 1SUCA 1O4WA 1ZR2A 1QGUB 1KI1A 4XB2A 2X5OA 2CGEA 3OI7A 3FFWA 1IM8A 1EDDA 4JU9A 5AKIA 4ZRDA 3JX9A 1OA1A 2NOAA 1S96A 1UJCA 3M0EA 5CBPB 2KLHA 2EGGA 4G4GA 3EC7A 5AFSA 3WADA 1F51E 1VHQA 4RQTA 5T64A 4GSKA 2IYQA 3IERA 2ZSJA 4EGQA 3ORSA 4YDRA 2IWHA 3TS1A 2NZXA 1AVTA 4AJJA 1U3UA 4ND2A 3IQXA 1A1SA 1QUEA 2BEWA 4LQLA 3JRXA 4F3NA 2W0MA 5LUAA 5F3DA 4NECA 4LXUA 4DLUA 5DI9A 4YCMA 1WMAA 5B12A 2RHRA 4MS1A 1X3LA 4NMMA 4ISCA 5A9SA 2BCJQ 1YJCA 1F7VA 1KIFA 1Y34E 1GZ5A 2DUNA 2OZVA 3E05A 1G5IA 1NFQA 2NT3A 1YE5A 2EP8A 4IGEA 2POQX 1H8ED 2VSFA 3AB7A 4DGSA 3C3AA 3SQXA 3ORYA 5ED0A 2FQQA 2FSUA 3L7OA 1GO2A 3RK1A 2YOGA 4TV8B 3BWBA 3NORA 3CF4G 3E7FA 5I7FA 3QW4B 2ZPUA 3CVOA 1DSSG 4JSTA 4ZD6A 4IYRA 3V9AA 1L3IA 5HJEA 1Q16A 3IXQA 1JG7A 2PUDA 1AUPA 1JILA 2ZJ2A 2BGIA 3JQAD 3MUEA 4WCVA 1J21A 4MPRA 4XSVA 2RGGA 3C4JA 3JRWA 3PDWA 3JCZA 4B4OA 1DS6A 3T4UA 2AWOA 2V8OA 2GCOA 3ESZA 4P3XA 2O6LA 1NRWA 4QPCA 2QTNA 5EIBD 5KSPA 4J16C 5FUWA 1HE5A 1F9AA 4LZAA 4EHKA 1BIFA 2D3TA 5CB6A 1EWKA 4K6MA 1IXSB 3WMEA 3HXKA 2QBYA 2I4NA 2FP4A 4AU1A 4JB3A 3CEPB 2OQVA 4MQUA 1AMNA 4FMDB 5DBEX 4UFOA 4N3NA 3VTFA 5KX5F 4OI1A 4LWQA 4YPVA 3GD5A 3A0UA 4CGYA 2W2LA 3VOSA 1Q77A 1XCLA 1IHYA 1ZMXA 4AG6A 4LJRA 1ZCAA 4FGSA 1ZVJA 4FCTA 3RSZA 4US2R 3K6SB 1W581 1XBTA 1R12A 2BBWA 2ACWA 1ZUD1 2EKPA 2QI9C 1FFXA 1SBCA 2Y8EA 3PPVA 1NF9A 4ZQHA 4G9BA 4UFPA 3D6TB 4DW8A 3AI2A 1E20A 3P26A 3OCCA 3JQAB 1WM1A 2EF0A 3OTIA 4G01B 4BFZA 5AW1A 5LYJA 1YL6A 1VG9B 1D4OA 4HNAA 2EDCA 4KXLA 4XFKA 3ZWOA 4B2IA 4L85A 5CEJA 3JZAA 4FP9A 5CA1B 3H9UA 3N6VA 3CNBA 3PE6A 2W6JA 3W9UA 4Z3KA 4Z4HA 1VE3A 1MABA 1NJ8A 1D7OA 1BMFA 2PXHA 2Y1OA 2QJWA 2WA2A 2JA2A 2WZBA 3HDQA 4X97A 2QT1A 1R3DA 1LBSA 1UOQA 3SMQA 4E5NA 4IQFA 2IDKA 2YZ2A 5COAA 4R98A 1MBZA 3DDWA 2JLRA 4MGEA 3WKDA 3E9RA 2OCPA 1K63A 5IT9A 1IUPA 1D2RA 4FYYA 4P4LA 2IP2A 3O82A 4BBPA 4EMTA 2XNSA 1NSYA 3DYBA 3P9PA 1ZBDA 3UJPA 3O3CA 4ZOCA 3PC4A 4EPVA 1QQ5A 4GXTA 3GQBB 5ERYA 2IHJA 5L3ZA 1NULA 1E96A 1DU4A 2H5EA 3BQMB 1KI6B 1BAPA 3UT5A 2X4GA 5FLYA 1I13A 3L8CA 5HR5A 1TZ2A 4V39A 1UL1X 2HA7A 5L4SA 5JTUA 1KAGA 3K4PA 3ZNQA 1R6TA 2Q8PA 4JWTA 4BLQA 4BB0A 1XN1A 5BNTA 5I7WA 4C08A 1NR7A 2IITA 4CGZA 1YJ5A 4JDPA 2IHTA 2EP5A 5HKOA 1BDIA 2OESA 3AEXA 4W4TA 3L8EA 4NQZA 2E5FA 1PBNA 2BTOA 4NNPA 3RTGA 5F1KA 4AJ2A 1GPKA 1IWOA 1ZI6A 5U4XA 1PDOA 5JDIA 3RM3A 1KZ1A 4G0XA 5I4CA 2ZSIA 1E1QD 4UCFA 4GLLA 3AF3A 2HMUA 3SHVA 1T1IA 4C6TB 2DOKA 1TRKA 4ND8B 1X14A 4IR7A 3WLKX 3EOBI 4O25A 4ZQFA 1EU1A 4DBZA 2FR1A 3UB4A 2PZBA 4GAEA 4KX5A 1EDZA 4KDCA 4WXMA 5EWLA 2XLBA 1E2FA 1HEIA 2VT2A 1YVEI 3U3XA 2XD4A 1S0UA 2L19A 3CX7A 1ZKMA 2XMDA 5KKCA 1HL3A 1L1RA 5JAHA 1N8NA 4EY3A 3GUVA 3LPLA 5IHXA 1IIBA 5A3QA 1KK1A 3IMEA 1U8TA 3AKYA 3QJ5A 4GT1A 4Q5IA 5EE0A 4LHYA 2MCFA 4J0IA 2PVSA 4EG7A 1J33A 4DN6A 5FV4A 5AJXA 3V1MA 5I7SA 3ZVNA 2WSLA 3NG1A 1X7GA 4E2FA 3X1MA 1FRNA 2ZVJA 1LNZA 1Z0FA 4DREA 3FLEA 3TQHA 2RBEA 2NX2A 1U0RA 3MWKA 2JFOA 5TPZA 5DTRA 4PIVA 2XWSA 2BSXA 3HWSA 4R1QA 1LV7A 4KACA 2IYUA 2V55B 1OTHA 1WBJB 3DMNA 1GUFA 4AS1A 4P2GA 4CI0B 2QM3A 4BFWA 5KBYA 2L17A 3L6DA 1SUPA 1CP3A 1UM9B 2UZAA 3AFOA 4OGWA 4ZANA 1LD3A 3H11A 1DIHA 5L9AA 1QONA 4YUYA 5THQA 5C34B 3T34A 4LBVA 3Q7EA 1DCTA 5AVJA 1L3BA 2C5GA 4R0MA 3NNSA 4X5OA 3FCXA 3TQCA 1RZRD 2ONKA 3RV4A 1IVYA 2GZSA 1RMQA 1VBNA 4O33A 4DG5A 5BY2A 2A92A 5L4LA 2YV2A 2XI4A 4YWHA 5LQAA 1T3HA 1Z45A 2PFKA 1PP4A 1R8SA 5FBQB 3IEIA 3NAQA 2H31A 3KQMA 2CFTA 2K4MA 3LKBA 2CK3A 2JZOA 4FNMA 2OUKA 4QG7A 4LN1A 2ZI7A 1MPXA 3ANLA 4RO0A 2ZSUA 2KHZA 4JV5B 1U6KA 2O8EB 1H6AA 5TDHA 2PS0A 2P2CA 3C85A 5H4GA 1JH9A 1E6KA 5HFAA 1EJ0A 2BTQA 2OB2A 1E3DA 2YN0A 4MPDA 3ZCXA 5DNWA 4UDYX 2AN1A 2QTWB 2WC1A 3OLCX 3DPIA 2R2GA 3UB2A 3KL4A 1WMSA 4AICA 2GR9A 5D7BA 5EJGA 5C1OA 1V11A 3B1WA 3LHKA 1GKIA 2QVLA 4UTVA 5JXIA 4C6RA 4NYMQ 2EDAA 4YDSA 3DHVA 3LW8A 3CEMA 4AZ3A 1ZD1A 5HSGA 4S1VA 1NX6A 1T5SA 4XJXA 3B38A 3QKRB 1G20B 3GJ3A 1PZFA 3QVJA 4IJ6A 3SZOA 1ELOA 3MPOA 4EHBA 4PIMA 3B7PA 1KXZA 1JDTA 3PUXA 4HLNA 2V0GA 1P5FA 3BJZA 2EATA 5LXTF 1M8FA 4YJHA 1O96B 1PJ8A 3FGZA 4G0YA 4HLQB 3N2KA 2PMEA 3WQSB 1VLZA 5KOYA 4Q4CA 2CVZA 4OJKA 4EKYA 2ZUWA 2V65A 1C3XA 2RHBA 2W11A 2ZKLA 3AHDA 4ZYUA 1U0GA 1CIVA 1VFPA 3U0BA 3WYDA 1XEXA 3WXMA 2JIOA 2X4LA 5AO9A 1FTYA 3OA2A 1K1EA 5L3VA 1ZJYA 5MHTA 2XVAA 3I6QA 4YT4A 4HDSB 3SJBA 3CZ5A 3CE9A 4ALKA 4DV6B 3ASVA 4A0FA 1MORA 1RRFA 5CB0A 3DOOA 4K8RB 3WSTA 1ZISA 1HLGA 1QH0A 3BQ9A 1H2HA 3A58B 3KWJA 5BR4A 5IT0A 5EMJA 4IJKA 4JP1A 1X7HA 1Q11A 2XLCA 3QUBA 3TDKA 1PVVA 2Q6TA 1WNTA 1CUEA 3B1VA 1IXYA 4RKWA 1KI7A 4MCIA 1PUIA 5AH0A 1FBTA 2AF4C 1JTFA 3WHLA 4CG1A 1PKEA 5BMVB 1JMKC 2PUBA 1JHRA 2FNAA 3OJFA 5H3CA 5AOCA 1Z5WA 4HAYA 4HAZA 5FI0B 3PTAA 1UBRS 3GFVA 5KWIA 3O3MB 5C52B 2F55A 6GPBA 1HYGA 4OB6A 3KT6A 4RV4A 3W9YA 2BGLA 4R5HA 3E5RA 3NWOA 2DWUA 2UUPA 3L0SA 2GN9A 3QNWA 2CVOA 1AKYA 1AS2A 1SCJA 2KJQA 4LPKA 2JFBA 4NV1A 2X9VA 3PS9A 4IXDA 4L0QA 2JLCA 3AUUA 3H4IA 4P22A 5BYAA 5JYBA 1NI3A 1T0BA 4DADA 3WMWA 3W2TA 3EMBA 3EPRA 3GAMA 4PCVA 4A26A 3C8HA 4FR0A 2OXRA 4GI2A 4CIWA 5A3VA 3STXA 1UMDB 1CF4A 1XZMA 3RADC 4XFJA 3OICA 4N54A 1ZJ6A 1MOPA 4QO8A 3DTNA 5TEVA 3URMA 1JG3A 1BSVA 4YR9A 3RSHA 3TOCA 1U3CA 3ISTA 4UNNA 4DLAA 3BHIA 4NJEB 1ZOIA 2V59A 1POWA 1ZMTA 2Z4RA 4KO1S 5CCDA 4B6QA 4EA7A 1G0NA 2YJTD 3EEBA 2EQ5A 1RACA 1RYHA 3UJ7A 3WR5A 1LSOA 2AQ8A 3EISA 3P5BA 3TJZA 5DN6D 4AZ0B 1PQUA 3I53A 3VAZA 4EPTA 4WGFA 3CLRC 1A9PA 2XGGA 1MH1A 3HXLA 3Q85A 3KR2A 1KQ3A 3FPCA 2H0RA 2Z2IA 3INRA 4KJXA 4RY9A 1KFJB 1E6EA 1G3UA 3TZKA 2VAPA 2IHBA 3DGEC 4IFIA 1M1ZA 5CYOA 3V2UA 2J0SA 2E49A 2G9UA 3IBYA 4QSHA 5IAJA 3LQFA 4HFRA 4LTMA 4M1WA 2XCTB 3RUFA 1TYAE 2ID9A 4KSBA 3X1DA 4CTMA 3K9GA 3N8KA 1VMAA 1KMCA 4QPNA 5FBKA 4DABA 1ZXLA 1RW4A 4FNAA 4OPMA 1KBQA 3R7SA 1P2UA 4B6SA 4C4XA 4DWOA 4A82A 2OL4A 4BVLA 4QM6A 1AN0A 1QAMA 4NE2A 4MV8A 4QA9A 3FFAA 4CQJA 1TTQB 5KOJA 4DV2B 5JZBA 3ZGNA 4IGKA 4CKWB 3A3PA 4MYTA 1ACMA 2Y67A 1VE6A 2PLAA 3AUXA 1DQSA 1KZ7B 2HU7A 5LB2A 4ZVKA 1PSZA 1R0CA 1JG6A 1R5JA 1HURA 3KDSE 4L7VA 4YVFA 2JF0A 3QPBA 4MOWA 1Y3IA 4YRRA 4ZEOA 1EEXB 3RK0A 2G40A 1PVOA 3OZSA 2RIRA 1PTJA 1RWPA 1O0BA 3FUWA 3A1WA 3W3AD 1DAIA 2H7VA 2ZWMA 4YAFA 3OZBA 3VZDA 5DWQA 4OOEA 4X45A 4YC7A 4BVEA 5K99A 3E53A 1CK4A 1FUKA 2WJGA 2GD1O 3L1IA 3EVGA 4YY3B 3CV3A 1HTWA 2I1LA 1LJLA 1KY5A 2HCJB 3ZWVA 4BCBA 1WF3A 3ZGZA 3LZ6A 2JB9A 1EBUA 1U7XA 5L51A 2D0DA 4XQ0A 1K75A 3I28A 2FZ5A 1BW9B 1W36C 1P9WA 2NXCA 1DDIA 1EB9A 4CKBB 4KYTA 5JDCA 1AN9A 3HJBA 3ILSA 5BWNA 1OB2A 4J2OA 4NMWA 3Q1LA 3A7DA 1JKJA 4TL7A 2O57A 5ALWA 2N1BA 1XF9A 3BFXA 5FBLB 2EWVA 2VIIA 1GGJA 3WO0A 5DSTA 5LVAA 3HVRA 2PYZA 1W7AA 2DY1A 4MUMA 2IOQA 3HEMA 5DEIA 3LVRE 3VPCA 1PJ3A 1RNLA 1KZHA 1LQ2A 4ZO6A 3B9PA 3RUPA 3QLVC 1BXRB 2C83A 2H5LA 4BMPB 3UHPA 3M81A 3QLJA 2UAGA 3DFUA 3WLNA 1XP8A 2XWJI 4Y2YA 1BGVA 1M2WA 3K8ZA 4PLCA 1ZM3A 4WVLA 4ZMBA 1YK1A 1HFEL 3SMVA 4YUZA 3X43A 4R8MA 1PFWA 1NRIA 4DZTA 1C9EA 4XVQA 2XB2A 3S3TA 1UXHA 4TGLA 1TUGA 1BC5A 4RSHA 2HDNB 3SNHA 4QOIA 2I7TA 3VH3A 4A3SA 1AXRA 5ICSA 2VS1A 2JPDA 3ZLJA 3PTZA 1L4LA 2XDQA 2BHTA 3Q5GA 4JI5B 5C5IA 5C8ZA 3OIDA 3AJEA 1DX6A 3NETA 3QPAA 1Y4AE 2I4TA 5F21A 4PLVA 4CTOA 4NFHA 1F6DA 5DNUA 2FV8A 2QPAA 5A4JA 1JEAA 1K27A 2CMKA 1FXSA 3QK7A 3AM5A 2ZM5A 3KZ1E 3HGMA 3ZK7A 3LUPA 3JVEA 1WLSA 221PA 2V4MA 3EIXA 4MQ6A 3II6X 4BDTA 1WTAA 1W9MA 2H7CA 4Y2VA 3W0LB 3FVRA 4F8EA 3HKBA 5AW0A 4HEQA 3W05A 2IU0A 4CL3A 3IEUA 3OECA 5K4HA 4KXUA 3N6RA 3MRVA 1M7BA 5CFMA 3HB4X 1T15A 1VZ3A 3Q3IA 4TN5A 1CS0A 4BO2A 2H92A 3RYFB 1O5TA 2P2GA 2YHAA 4L74A 2O52A 4TMWA 1PJTA 4G5XA 4KIWA 1G4AE 1QG6A 2J3JA 3QXJA 1YA6A 3TIGA 3K0HA 4B43A 3L06A 1P2SA 1L7XA 3IQZA 4OHFA 1GCIA 4W82A 1H05A 4AY4A 1NXOA 3ML1A 1KYYA 1AURA 1V3QE 2RHLA 4R2MA 4GW3A 4KIFA 2J31A 3LK7A 4DPLA 2LD4A 2PKWA 3HVUA 1I2ZA 1R0WA 4CT0A 4FMCF 3OAAD 4RH0A 5CLJA 2O0HA 1JZQA 4NG4A 5J4LA 2JAWA 3ACCA 5BUZA 4DNOA 2FRDC 5K8LA 4X8HA 1YB6A 3LXXA 1FYEA 2PTHA 3IIMA 1R0SA 1E6LA 3IVGA 1P33A 4QDTA 5G0TA 4M0PA 4WD3A 1U2EA 5BSKA 3PUIA 5FCDA 4PF1A 2QJOA 2QL7A 3DAOA 3IUPA 3PD7A 2Y77A 3R2JA 4R54A 2FJ0A 3OFSA 1Z12A 1IHPA 4X90A 4K1XA 2CZCA 3QSYA 2CHUA 1FRZA 5IARA 1DG1G 1KH1A 1U4SA 3QKSB 5FPQA 5H1YA 5BORA 2HA0A 2V5UA 4D8WA 1E4EA 4BQPA 1UBFA 4PBTA 1Z63A 3IJPA 4DA8A 1F60A 1T6BY 4OK6A 4MR9B 2BM8A 4PSCA 4JI0B 3U9LA 2MWMA 1Y5IA 2YV1A 4DQXA 1N4AA 2V5AA 3TZLA 4XEHA 4QEZA 3KXIA 3ETEA 3NX4A 1Z6YA 4R9UC 5JBQA 1MB4A 3D6NB 1XZDA 1N9ZA 3VBCA 1MJNA 1FB5A 1CUZA 4II2A 2HF8A 1LNSA 1I4TD 2BFWA 4UBKA 5HBRA 5A4MS 2BFAA 4B79A 1XTJA 1R6DA 5CM8B 2CNWA 1YCHA 4IMPA 4WDRA 3CVXA 3COJA 4EUHA 3B6MA 3WK4A 1SBIA 2FPMA 3GRFA 3EEOA 2AK3A 3NS7A 4QIHA 3WB1A 4KFCA 1LUAA 1K92A 2UKDA 3DLHA 3P4UA 5HF8A 1WXEA 4FGJA 4MRSA 4ETIA 1PR1A 3ZDRA 3BIWA 3Q3VA 4C87A 1NW5A 3F4KA 3MJ4A 4UEWA 2IEIA 4YXWA 4F4JA 3ER8A 1EAMA 3RJZA 1ORHA 1T5LA 4XAQA 3NRCA 1LB1B 1PG0A 4J9VA 2YUIA 1GNRA 2Z43A 2R87A 3U16A 3HYSA 2BGMA 2QU7A 2QVZX 4BLSA 1J39A 4DEYA 3K3PA 2VYVA 4R41A 4BO6A 4FGWA 4K26A 1IJFA 2PMDA 3MJVA 3CH6A 1XYYA 2CY0A 2FSVC 1H0KA 4KQMA 4RVCA 1TVCA 4ASUD 2H1WA 5FO0A 1ZM2A 2ZUCA 4KAAA 1GVHA 1MG0A 2FZGA 3IEKA 1KZYC 3OLVA 3VTAA 5C8VA 3H1GA 2XNJA 1DFIA 3L77A 3KELA 4H59A 5JY1A 1TM2A 1LGYA 4W63A 3RNLA 3M6WA 2GM4A 1P45A 2HGZA 1JEOA 4N48A 2HJRA 1SXJC 5CX4A 1EUDA 1H2EA 1IHOA 3H9JA 4Q1EA 4YECA 1NT4A 2AHRA 2LCIA 4R4JA 3W8NA 3TOXA 4E11A 1NVKA 3RARA 4HXGA 3LTEA 1KERA 1G9TA 4PO1A 3CR3C 3RHFA 1TKRA 4JBWA 2PN1A 3ZIUA 3F7MA 4LUCA 3T54A 1TZMA 3R09A 3QHQA 3JR7A 1QK5A 3DMTC 3IIJA 2Y0CA 4DIOA 4UC0A 4C4PA 3AJRA 1Y37A 1I6KA 2H51A 4NSNA 1KVUA 1T9BA 1ODIA 3WNBA 1LLDA 1XIVA 1XZFA 3KWMA 5FP0A 2ZYIA 4YRNA 1J0BA 4CMHA 4LV8B 2RI6A 5K51A 4B85A 1JECA 1EFHA 3K0KA 4YTEA 1UBHS 3GG2A 1GLGA 1W93A 2SCUA 3DLIA 4DV5B 1XMPA 2OZPA 1GXSB 2BFOA 3HN2A