3FB1A

Crystal structure of purine nucleoside phosphorylase in complex with ribose-1-phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
281
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purine nucleoside phosphorylase from Schistosoma mansoni in complex with ribose-1-phosphate.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
total genus 90
structure length 281
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fb1A00
3IOMA 1PWYE 2PGAA 3DPSA 1V3QE 1VHJA 1T8SA 1V4NA 4L5AA 1RXSA 1ULBA 5F7ZA 4JWTA 1C3XA 1PR6A 4PR3A 1A9QA 3IEXA 4OGKA 4QARA 2OECA 5F7JA 3QPBA 4QAQA 2HN9A 2QPLA 1A9RA 1A9PA 1YQUA 3EUFA 3OPVA 1Z34A 2A8YA 3SCZA 1B8OA 1NW4A 4MCHA 2HWUA 1CB0A 1Y1TA 1Z5PA 1Z33A 1PW7A 5ETJA 5C80A 2AI1A 1NC3A 3PHBE 1Y6RA 4L5CA 2HRDA 3UAZA 3K8OE 3F8WA 5KB3A 4LNAA 2A0XA 3UAXA 5F73A 1NC1A 4DA6A 3OOHA 1T8WA 1ECPA 1T8YA 2ON6A 1SD2A 1LX7A 3LA8A 5FAKA 1JDZA 1JE1A 3OOEA 4DA7A 4LZWA 3INYA 3DF9A 1A9OA 1OUMA 1U1DA 2OC4A 1JPVA 1SD1A 4TXLA 1OTXA 2BSXA 1PK9A 5B7GA 3FUCA 1LVUA 4WKOA 1U1GA 1YBFA 5CXQA 1K3FA 1U1EA 3ENZA 1TGYA 1Y6QA 3LBAA 3DP9A 1JYSA 5CCDA 4D8YA 2OXFA 1PF7E 1TCUA 4BMXA 5F78A 4NY1A 2GUWA 3EEIA 1PR5A 2IQ5A 2Q7OE 1K27A 4D98A 4M3NA 3UAVA 4M1EA 1RT9A 4JP5A 5CXSA 3OCCA 4R2XA 1JE0A 1V2HE 4OGLA 3MMSA 3UAWA 1VHWA 1A69A 1WTAA 4DAEA 5K1ZA 4OY3A 4BMYA 2A0YA 1LV8A 3D1VA 4TTIA 5EPUA 3BGSA 3PNSA 4IP0A 3FWPA 4LKRA 4BN0A 4L6IA 3E9RA 4YJKA 3DDOA 4KN5A 3T94A 3GGSA 1OTYA 4QASA 1V41E 1PR4A 3UT6A 4FFSA 2P4SA 3MB8A 1V45E 4NS1A 4E1VA 1ODLA 3GB9A 5B7PA 3E9ZA 1JP7A 2A0WA 1Z36A 1YQQA 4ECEA 1Z35A 4D8XA 4EB8A 1TD1A 3BL6A 1VFNA 4F1WA 1M73E 3K8QA 3EMVA 4TS9A 4QATA 4DANA 3O6VA 4YNBA 4F3CA 1Y1RA 3OZCA 1B8NA 4TXNA 1ULAA 1SQ6A 4F2WA 4F3KA 4DA8A 4G89A 4LDNA 5IU6A 1TGVA 5CCEA 4MARA 1SJ9A 1JDTA 3NBQA 3C74A 4OJTA 1VMKA 1OU4A 5F7OA 2AC7A 1OV6A 2HSWA 3BSFA 3O4VA 4GLJA 4WKNA 4MCIA 4JOSA 4DABA 3P0EA 4L0MA 1Y1SA 2AI2A 2I8AA 1PR1A 1ODIA 5I3CA 1N3IA 4QEZA 3KVYA 1T8RA 2QTGA 1QE5A 5EFOA 4I2VA 4TS3A 4DARA 1ZL2A 1Z39A 3PHCA 1RR6A 4X24A 4DAOA 2I4TA 1V48A 4G41A 4WKPA 3DJFA 1A9SA 3FAZA 1RXUA 1RXCA 3KU4A 1PKEA 3FNQA 5CYFA 1JDVA 4H1TA 3E0QA 4D9HA 3LGSA 4BMZA 1RSZA 1ODKA 1Z37A 2ISCA 4TXMA 3OZBA 4GLFA 3EUEA 1RXYA 4TXJA 3P0FA 4TTJA 4D8VA 1A9TA 1U1CA 1PR0A 1JDSA 3NM5A 3UAYA 1Y1QA 1Q1GA 4L5YA 4K6OA 1PR2A 5IFKA 1RYZA 2B94A 1FXUA 4OF4A 1Z5OA 3OZEA 1CG6A 1ZOSA 4TTAA 3OZDA 2OC9A 5DK6A 5EUBA 1RFGE 3FOWA 3OF3A 3U40A 4F2PA 1TCVA 4OEHA 4WKCA 4TXHA 5CYGA 2QTTA 1YRYE 4TYMA 4R2WA 1ODJA 2XRFA 5F77A 4WKBA 4GMHA 4YMLA 2RJ3A 3FB1A 4DA0A 1XE3A 4PNPA 4GKAA 3NM4A 2QDKA 4QFBA 3BJEA 3KVVA 1G2OA 1K9SA 3ONVA 3TL6A 1YR3A 3KUKA 5B7NA 4R31A 4P54A 1U1FA 4YO8A 5JPCA 1PBNA 1OVGA 4G8JA 4RJ2A 4U2KA 4UC0A 5F7XA 4LNHA 1JDUA 3KVRA 1RCTE 1Z5NA 3ODGA 3KHSA 2H8GA 4M7WA 2QSUA 3NM6B 3PNPA 4EARA 1Z38A 5F76A 2AI3A 4NSNA 1I80A 5B7QA 1PK7A 1T0UA
chains in the Genus database with same CATH superfamily
1XXHA 4TM7A 4TWJA 3EZ9A 4R1OA 3STHA 2V03A 3ZZNA 3N87A 4F3TA 5T67A 1UFRA 1W75A 3WP0A 1OXBB 4NBNA 3TD9A 3LFTA 1QWSA 5ULLA 2BGJA 4OJMX 4NCJA 2ZAMA 3ZIDA 2C4TA 2H2HA 2NSDA 3LQFA 3GNSA 4NAHA 4TOIA 3IJEB 4KW7A 3TJZA 4KWIA 1KK0A 2YUTA 3GT3A 5DGXA 4FMDF 2XOKA 2OCKA 2PMDA 4JWTA 1G8PA 3FUTA 2J7PD 4UEJA 5BPHA 1ZK2A 2FDXA 2R1VA 2DE0X 4X54A 3DUWA 1NF8A 1X7WA 4Q1EA 4BX3A 2YOGA 4H7KA 1E6EA 3W5UA 4DDWA 4B2IA 1OX5A 3G9UA 4RGYA 5FH9A 2A5DA 5HJEA 3NBUA 1SURA 3EISA 3SS7X 3ESXA 3AK4A 3GLIA 1T2EA 1J9EA 2ZRMA 3Q6IA 3CTPA 4W8HA 4TWIA 4RTSA 5K0CA 1XU7A 3GXOA 4P5PA 2GJSA 3KEQA 2QRLA 4GYKA 4KQCA 3HZHA 4DV5B 1A1VA 1P6UA 3A26A 1KEUA 3TW8B 3VZPA 3U44A 4WADA 4FWTA 3G7UA 3WFJA 4F4UA 4KVFA 1B00A 1XB2A 4CR6A 3P0JA 4I1IA 4KDCA 4M53A 3I61A 4DQKA 1MB0A 4PQFA 1R0SA 1EDZA 5ALWA 1A8UA 1SUCA 4NH0A 3ANMA 4EDFA 4P4SB 3C7TA 2W4QA 1YZLA 5DGTA 1Y1TA 4OYHA 4E94A 2ZJ3A 1GA4A 2WIDA 3CRNA 2KLHA 2VK4A 3CZMA 2GKOA 3M5CA 1CNFA 3MIZA 4G5GA 1L7OA 1J0BA 2XZPA 4L5JA 3U3OA 4X1OA 4KODA 4HAXA 3AXTA 3WKAA 4TGLA 4K1LA 5EZ6B 3WIEA 4ZVLA 3OT5A 1YJAA 3G88A 3OZWA 2XZTA 1JS1X 4N7BA 1RWPA 2XA2A 4O4JA 5CXXA 4AYTA 4C5AA 3K1YA 4R8MA 3VNSA 5ITSA 2RONA 1SC4A 4NE9A 2SCUB 3T35A 2G7ZA 3EGWA 3VJLA 4F3RA 4XQCA 4AQ7A 1K7EB 4YRRA 1AKQA 1ZVVA 2B4RO 1K97A 3PUHA 4WACA 3VYWA 4MP6A 2QS9A 3E9QA 3DGFC 1W36D 1Z07A 5AKLA 4EY3A 3WWCA 2HPHA 2GYVA 1OLUB 3MRSA 1N36B 1T8WA 1GAXA 3DL2A 3A9VA 4PQYA 1YSCA 1O4WA 1QC5A 4TL6A 2ON6A 4YJ2F 5TJHA 2JAXA 1CIPA 1P0CA 1YQEA 1ZCAA 3OO0A 4Q4HB 5LZ2A 5U9CA 3HJFA 3HWRA 1KFCB 1V71A 1Y4SA 3NBYC 4O3FA 1MB4A 2EKDA 3OEEA 1ECJA 1BDMA 5ALZA 3SQDA 4FB4A 1VLLA 2FSIA 3NC4A 3S40A 3KAJA 5ER6A 3IT3A 2QEQA 3HXTA 3OZFA 4OU5A 3TKLA 5JAZA 3D2CA 1PU2A 2PUHA 3EFOA 3M34A 3MM4A 1QO0D 5TPZD 3L07A 1REQB 1UAGA 1SKYB 1LBTA 4F46A 1CUIA 3RPEA 3GHHA 1Q0UA 5IKOA 3QVLA 4QLAA 4IDDA 1H2XA 5JDCC 3CLRD 4IFTA 4PZ9A 4BV2A 4B32A 3RKRA 3A6FA 3BD7A 4F71A 1GCGA 5B7GA 1FS4A 1C0PA 3CE6A 3WLIA 1VP3A 1XHEA 4LK3A 1FUYB 4EH1A 2ZT7A 2G07A 4IJUA 5H70A 4AICA 4ENUA 2F8MA 3FOFC 3UH0A 3MUFA 4IIEA 3CY6A 1AQLA 5FAXA 3WBJA 1QIEA 2WSMA 2C61A 4B3HA 2ABWA 4Q9NA 4RD4A 1JSCA 1ZU4A 1E5LA 1VYHA 3IVMA 3JASB 3R3JA 4N3NA 5L53A 4S0ZA 3GJ0A 2FPSA 1QRRA 4QWMA 3RWMB 4PYOA 3ZBQA 3OCZA 2ODNA 2X19A 3C3WA 2G9ZA 2PBZA 4MW1A 2Z56A 3DAOA 1X9IA 2P6NA 1E32A 3X2SA 1DT5A 4IM7A 4AKTA 3B2NA 3PJGA 3B36A 1GZ6A 3EEYA 3TOXA 1YD7A 1D0VA 4ZTBA 5I4CA 5IHPA 3NC0C 2GUWA 4ZOAA 3BHNA 1GYQA 1EUZA 2AJCA 3EEIA 3UMCA 3U4MA 2NMVA 1L7VC 4YDSA 3SJCA 3I72A 3WJ7A 3HKCB 3WDSA 2VC2B 4GVLA 4LE0A 4QVGA 1VL6A 2GRUA 5C51B 3C4VA 2E6UX 2FOLA 1JHOA 1YDMA 2QLLA 3R74A 3UAVA 5K3FB 4QG3A 2C4MA 1USIA 2JATA 4JP5A 4B83A 4BJ5A 3NHLA 3RYIB 3B6JA 1CKEA 4BNMA 4QQRA 4ZFNA 5CFQA 3WV5A 2IBTA 3USES 1E9EA 1VHLA 4DTIA 4LNUA 4C0QC 3GUVA 1PGNA 4KIFA 3W2FA 3H17A 1BVUA 1T6NA 1VLZA 2ZLBA 1U8XX 1B6RA 1PR9A 1TIBA 2XMGA 4YJ3A 3FHOA 5FI1B 1D7OA 3HWSA 1IB6A 3OU6A 5G0SA 5T6MA 1P8AA 3A6EA 3AHIA 4URZR 1QQAA 3RRZA 2F9LA 3HU3A 2C78A 4KIUA 2WM8A 4NQZA 1VI2A 2PYDA 2WA1A 1KJZA 4ZTZB 4MRPA 3DMTA 1LV8A 1SCNE 2GX6A 5LA6F 1NW5A 2EZ9A 1ZH2A 2QLTA 2YYSA 4GLBA 3ONWA 4O08A 4DMMA 1D9ZA 2ORYA 2ZR7A 4DS3A 1HSZA 3F96A 4R01A 3I6IA 3CNLA 2J6HA 2Y1GA 2FKNA 4DHEA 3GLIB 1YXMA 2WTEA 4K6GA 3VPGA 5C7OO 2UXBB 5EP3A 5BRNA 3P2MA 3UM9A 1PS9A 1H8HA 4BIIA 2YJGA 3FWPA 3CRZA 4LKRA 4BNKA 5BR7A 5EIXA 4UZSA 1D0SA 1Q1ZA 2FPLA 3R9XA 1U0GA 3CIFA 1F2DA 3WMEA 2C82A 2J9RA 4WK0B 2K7FA 4W6ZA 5EHZA 3CUWA 3HNRA 1ISHA 4HSEA 1KZGB 4D8WA 3WGGA 1OC4A 1F3OA 3SYLA 1O58A 3M7IA 5LA6A 1Z0FA 4CODB 1UDRA 4GFDA 5ESDA 2V7QD 1DG9A 1YCGA 1XX6A 4QUDA 3S0JA 3LD9A 1Z82A 2W6ZA 4IW3B 3SU8A 4ACBA 4EPXA 3IEMA 4C20A 2ZRIA 5H82A 2C99A 2JHCA 3EZ7A 4W8GA 4BVEA 1L4GA 1QYCA 4B17A 1EQUA 1DRJA 4JR2A 1WOMA 2ZSKA 2QSYA 1T1GA 2V55B 4LY3A 3SKXA 2FRDC 5BR4A 4I5FA 1MXFA 3K4HA 4INZA 2D00A 2H2IA 2RHWA 3PU6A 4JY7A 3UC9A 4CIAA 3FKJA 3THXA 1AGPA 3QBDA 1OGYA 1W94A 3LKBA 3MSXA 4QATA 5IJAA 1JFRA 1KEKA 5F35A 1P1KA 3U5ZB 2AN3A 2JCVA 1Y1RA 3TVYA 4YP0A 3V1UA 1V8ZA 2FN9A 2OBBA 3FFWA 3GT0A 1CJMA 3QXCA 5EERA 4A91A 2BL4A 4BMOB 3GOHA 3ZY3A 4J1SA 2R8YA 3KBOA 3U9LA 2YYYA 4BU1A 5ALVA 5I7OA 1M2WA 3W5HA 3DFFA 4F4HA 3DWEX 4I1RA 2AHOA 2ONYA 3HGMA 1SXHA 1FL9A 1YC5A 5THKA 4PQEA 1U8AA 1ZGHA 4Q37A 2YHSA 1I51A 1KP9A 2XJ4A 5KOIA 1QP0A 2EWVA 4LC9A 5B3AA 1JZTA 1BHQ1 4RTRA 2ZVQX 3NBMA 2XYRA 4HAYA 5BMOA 1M75A 4PBRA 3QEBZ 1JQJC 1U9JA 2ADFA 1S89A 3JS5A 3OT4A 3IP8A 1KJNA 1W35A 2R5WA 4XJVA 1FDSA 3PTLA 1ATZA 2ODWA 4GLJA 4OHOA 1MU0A 2QK4A 4E7OA 2Q5JA 3T3OA 4DRYA 2NLOA 1BN7A 2ZEJA 4D42A 1EKXA 3BBLA 4PYRA 3WMRA 2G4VA 2D4AA 3LSYA 2B21A 4BLTA 4EA7A 2QQFA 4H1UA 2AH5A 4JROA 4LHVA 3WZ2A 3BIOA 3JW8A 2FZ5A 4MVXA 5AVUA 3DKVA 4LJKA 4RXUA 4Y2UA 3AY0A 4YDHB 1AQUA 3KT8A 4E2ZA 4ESVA 2I8AA 1UDCA 2YRXA 3NWOA 4V39A 1SXJA 1YRHA 2D7JA 3BX1A 1IVNA 1ZGAA 1I3CA 2Q8PA 3UV6A 3RUFA 1VMAA 1FFXB 3F6YA 4B3XA 2D0PB 4U6NA 3BF7A 3JAKB 1W9MA 1PJBA 1QIMA 3K2IA 2A4KA 1LD3A 1C7IA 1TE2A 1U0HC 3M8KA 2DMRA 3ZWYA 1Z39A 3I30X 2MR6A 2WK1A 3I0MA 5BSVA 2Y0CA 1E3JA 1SR8A 1IRIA 1W1UA 5TMDA 2P67A 1HRKA 3HCOA 3JWEA 4OMCA 1HTWA 4HR7A 1FW8A 1JH8A 1Z4MA 3PC3A 5CIWA 4GQIA 2EATA 3AG5A 1EHCA 1V48A 3R5KA 4IDAA 5K3CA 2PZAA 4KZKA 1CS0B 2IYEA 3LIIA 2QMEA 2JIOA 1JHVA 2PMFA 3IQEA 1FFEA 4TMKA 4YAEA 3V4SA 1YZHA 1O95A 3EJ6A 3EODA 4MQ5A 4P0TA 4B3JA 5TIIA 3A3KA 1LKZA 2Z4SA 5FUWA 1NA5A 4E5YA 4B2LA 1KZYC 4WXEA 2FPXA 2I33A 2XNKA 4RO0A 5FJJA 3W4KA 1G17A 2IUFA 4Z8YA 2DQ4A 3R3UA 1BZYA 4D02A 4ZMSA 3ZVNA 5FV4A 1V1MA 4LZOA 1GTRA 3OWXA 4OQYA 4LC0A 4AN1A 4Q34A 4BBZA 2Z2XA 4WNAA 4XRGA 4CMCA 2W48A 4RZIA 4R2MA 5TT1A 4HPXB 4ARVA 2XA1A 1YCFA 4I3GA 5LB4A 4BRSA 2FSUA 3HDQA 3HACA 3LVBA 5DTIA 4GI5A 1RSZA 4I9NA 4IDQA 4DV7B 1ODKA 1OD6A 3WFZA 5CBKA 3BDIA 1QZTA 3DNPA 521PA 3AY7A 2QTHA 1Z12A 4GLFA 4DR7B 1F60A 2QY9A 3CSSA 3EXHC 1XMJA 1JQLB 4V0KA 3TQSA 4EL5A 3FKSD 2IDMA 1J1IA 3DZBA 4MB0A 1A9TA 5E6SA 3TWOA 2B83A 1RCFA 3WVNA 4DLBA 3NFYA 5BN1A 6ABPA 1B16A 1M8FA 1QHGA 2O0KA 1EESA 3RRJA 1ZHFA 1G3MA 1TT5A 2CHGA 2VAXA 4LSGA 3AXSA 4V1CA 3ELYA 3I83A 4ZQIA 4PYQA 3ZZTA 4C6TA 2W00A 4YWJA 3UMJA 3B3AA 4RWEA 2PM8A 4TMXA 2W6JA 4FN5A 4RLHA 1AD2A 1T3ZA 2Y1OA 4GM1A 2B2XA 5HK8A 4LFAB 1YO6A 4X3CA 1CUCA 1N6IA 4B6PA 1T29A 1RM3A 1X8LA 1HK7A 4URFA 5H9WA 3I6BA 4NXMB 3ZDQA 1JFSA 3SDZA 3HPQA 3ORHA 5CPFA 3TBFA 3OG9A 3R5XA 1UQUA 4H16A 1LLUA 3DOIA 4PFQA 3T1OA 1JHZA 4JXJA 5HBRA 2FRVA 3IHTA 2HF8A 3BXOA 2ZR8A 3K9FC 2VAMA 3D3NA 1L5FA 2HWKA 3IAXA 1C4OA 1E3DA 1JXOA 2RHMA 5DM1A 4EI9A 3GD7A 3KB6A 4FTWA 3CMCO 4E7PA 2W37A 2CXOA 3PUXA 4N40A 2AFVA 4MGEA 2QD3A 3PWZA 4TZKA 3RASA 3I58A 1YRYE 2IY7A 2Q4BA 2P65A 1NJ2A 4L74A 3ZK7A 1NVKA 1PWXA 2VH2A 1A9YA 3ABSB 1OFIA 3B1KA 4HWOA 4QC2A 4ZAZA 5KOJB 2BZSA 1KDYA 1ACMA 1W0KA 1WW3A 5CDUA 3HLTA 5J5VA 5B1IA 4IR7A 3LJKA 3IR7A 1ZJJA 2IS1A 3EDYA 5MFZA 2PXXA 3WLNA 3KLPX 4B3IA 2I9KA 4B09A 5CXUA 3U19A 4RULA 1YAHA 3CVXA 1KVQA 3CURA 3M3DA 2WJ3A 3PZBA 4EMSA 1BXKA 2TRSB 3U7RA 1HTBA 3FTCA 5AJZA 5TARA 3CN9A 1A50B 3UQYS 2QRQA 3T5AA 3DFIA 1XXHE 4AUKA 3UT5A 5JNTA 2TMYA 2Q7DA 4X7BA 1IDN1 5EQTA 1IK6A 4K26A 1E3QA 1MJGA 1O9BA 2GQ0A 2H51A 3A0UA 3L77A 4MUBA 4NULA 4TTTS 4E5KA 5ICEA 1Q14A 3EIQA 4H3SA 1SU4A 2VOJA 5K3SA 2C57A 2RB5A 1US8B 4MAFA 3EMKA 4P82A 1YOVA 3RVKA 3LBYA 1Z0AA 2F7SA 4BLOA 4WCDA 3F9CA 1CQWA 3UKJA 2VBIA 2JFZA 4KUGA 1I2AA 2H92A 2J3QA 1U8CB 1PNRA 4NMHA 1JG3A 5ANRB 5D86A 2XGGA 4DBVO 3RM3A 2WP8J 4BZZA 1FP4B 5BR1A 3WQHA 3EGDB 5TPWB 1M7GA 4WJZA 1FBNA 1CF9A 1GPKA 1TAGA 4I4TA 4GMKA 4ZCRA 2IIQA 2GVNA 3KNZA 5F7XA 1KMQA 2BR3A 4MLPA 2ZUEA 5LN1A 4IOJA 4DLWA 1ABFA 1ZAKA 4PV7A 3AY3A 2VT3A 1M1YB 2JC3A 2IXFA 3VJMA 3I9NA 2CYBA 4CKCA 3S1AA 1AKVA 1CZRA 1JMYA 2FW0A 2P9FA 2Q29A 5D1HA 3AVPA 5AJVB 2LDBA 1SBZA 2D2EA 1CTQA 3SX4A 1FJGB 1N6NA 2AG1A 3UQZA 1N92A 3TNYA 5LYJA 4IKEA 3RC3A 1HH4A 4G37A 1N2OA 1MHPA 2DLNA 4I2NA 1EFTA 2YCLA 4HYTA 4R2HA 3VH3A 4XXHA 3EIUA 1Z68A 1EDDA 2PGAA 2ZANA 4L7QA 2PPVA 5K8UA 4GQAA 1N6HA 2GBLA 4CWAA 3ZDFA 4YP1A 4KR2A 2ZJBA 3EXEB 5BSEA 4KL8S 3WP1B 1HKUA 1UZUA 2QSJA 4Q03A 3AB7A 5COQA 1XEXA 1ESDA 4PHFA 4Z3KA 5AW1A 4TV9B 5FR2A 2HZ7A 3AVOA 1XCMA 5IABA 5FPSA 4EW1A 1CR0A 4KUHA 5DRYA 2EGUA 1EBFA 5B6IA 4YAIA 3NTXA 2O2YA 3PE3A 4MS1B 4X92A 5TR9A 2LUOA 5EJEA 4UEQA 1UXJA 3D7LA 2W6CX 2O3RA 1I10A 5IKMA 1VKRA 1EUCB 5A4IS 5CFPA 3L0CA 5J59A 5AKGA 4D56A 2VQFB 3PPXA 3DCIA 1HEIA 3VDQA 3M6WA 1E66A 2NZ2A 1EFLA 2RK6A 3HLKA 4FZJA 1X7WB 3BMNA 2HSDA 3RF7A 4BO2A 2NO7A 4G9GA 2VJDA 3PQEA 3HP7A 3LUFA 4ID3A 5IASA 1A7JA 3NQ41 3QMWA 3HWWA 2VDOB 2X7JA 1PJSA 4P1ZA 4TLEA 4Z4FA 2JF0A 1G6HA 1BE6A 4MGYR 3UCEA 2XCOA 4DMUB 3KB8A 1TRKA 4IX9A 1HQKA 1A82A 1BRTA 3AFGA 4FKMA 2FE1A 4NAVA 3T7KA 2VYNA 3UB4A 3CVUA 2VQ3A 3ULKA 1VB3A 3RJ5A 5AVWA 1A9XB 3GRYA 4JC0A 4LSMA 5ETJA 3UANA 1VG9B 1GAJA 4O2BB 4RIEA 1KH3A 1L5RA 3I53A 1J0CA 3V8NA 5PGMA 1WPXA 1I2MA 3G85A 3NTVA 1NBMA 5L6LB 4FR2A 3IBTA 3DEJA 3FYCA 4HX9A 4K81B 4U02A 3PLRA 3HDYA 3UAZA 4PHTA 4BCCA 5ELLA 5ENVA 5LKAA 2ISQA 5DIFA 621PA 2XCLA 3ANLA 3PUZA 1RTKA 1X2BA 4UM5A 3W1EA 1S2DA 4OJKA 2MHCA 3R7WA 1E2JA 3JXEA 3TRJA 1YZNA 4HLQB 2NVOA 1U8EA 4IF4A 2MSNA 4JJAA 1AXRA 2I1WA 4XWTA 2FOIA 2WZBA 2IEBA 4HQFA 1DIRA 2OK7A 4QOSA 1DPFA 4FEAA 5E4TA 4GWLA 1Q1QA 4XTCS 2P5YA 2P3SA 1DJMA 5DULA 3U81A 2CKDA 2ANCA 4POAA 3A1EA 3D81A 1X92A 4W1SA 2W6PA 1I3NA 2D2VA 4RA6A 1GVNB 3OOEA 2F1KA 5KYUB 4FUTA 1K3UB 3SR3A 3BZBA 3GJ3A 4UHDA 3ELWA 3UWSA 1A96A 4Y1RA 4X8MA 1VDMA 1ITZA 4MVJP 3INYA 5BMVA 3P9PA 1YHYA 2VQDA 1VG8A 1X3LA 2RGDA 1RKBA 3EGDA 4L22A 4WL0A 1L4MA 1ML4A 2FUNB 3CW9A 1XMPA 3M1LA 4U7GA 2INGX 5HBGA 1VIAA 2VTKA 3LPAA 2RJNA 3KKPA 5FBWB 3HVRA 1NVDA 3HJHA 1QFYA 1DJLA 1Q7BA 1RS0A 2HTEA 2JS7A 2X5XA 4HLUC 2QE7A 3U3XA 3IUBA 5A4AA 4XIFA 3RFVA 1Z2DA 2RDMA 2P9YA 4XGIA 3S55A 1EXDA 1QIFA 1E2KA 4CKCB 1KFKB 2QD2A 4ZAGA 1EFRD 5CDTA 1S01A 3KLNA 4OKNA 4UHHA 1THMA 4QOFA 2PUWA 3ZDEA 4KV7A 1VP9A 4L28A 3GDFA 2M6SA 1R8YA 2XMPA 2H4XA 1D6NA 2OILA 5E2AA 1MG0A 1EM6A 1ULUA 3ACCA 1AA9A 3COPA 3IPAA 3P45A 1J0DA 5CIYA 1RVDA 1G0OA 4KFSA 3LYLA 4HUTA 1INLA 3HN6A 5AICA 5DBOA 1NMXA 4KQJA 1Q44A 2F8SA 5KTPA 4MR7A 2ZWOA 3OZ7A 4IRUB 4MEJA 3X1ZA 4W5WA 2WJAA 2Y9MB 3NS7A 3UIEA 1HYGA 3FBWA 4XPIA 1LDNA 2GD1O 3FMVA 5EMHA 4O2BF 4WNIA 9GPBA 3PVSA 3WHPA 3ZDRA 1L6IA 3V6LA 2NVBA 4P33A 2XBMA 5FEMA 1K89A 3H7AA 5DMHA 5TE9A 2IQ5A 1EZ1A 1KARA 3GLKA 3A9RA 1NYTA 4I9FA 2EP7A 4P2BA 2MIIA 1B74A 1PZHA 1REQA 3BIWA 3AHCA 3FVWA 1XZJA 3L0ZA 3JD2A 3O3NB 4CLXA 1RZRD 2VBFA 3OCCA 2BM9A 4L85A 5ELMA 5GJVC 2JIBA 4YRZA 2QMQA 4NJMA 5TQ0A 3I8OA 4OUKX 2J5QA 1K66A 3Q7TA 3VU3A 1E5QA 2XMBA 1LRJA 2G5PA 2P8JA 2UUPA 1PVVA 2C7OA 2XQJA 3RC7A 4CE6A 2JAPA 2HMVA 1S6YA 1ZITA 2ENWA 1SU7A 1HRDA 2Y92A 1E9SA 3KR9A 1QIHA 4L73A 1H2AS 3FDIA 1W5AA 3VKUA 4JQZA 2XB8A 4IMJB 1UBRS 4FFDA 3T95A 4QBHA 3GRZA 1T9HA 4QPZA 2BDUA 4XSHA 2H4ZA 3Q3VA 3OLQA 4MYTA 1ZD9A 1HDRA 1KOFA 2W2KB 3DYBA 3O92A 5DF1A 5E95A 3D6HA 4UQOA 4UUNA 1BWSA 3ZHOA 3KPVA 1J0AA 3A32A 3NGMA 3PGXA 1Y5RA 4IDOA 4OUDA 5KAPA 4ARAA 4ZI2A 1NVTA 2F3TA 5KSWB 2VWGA 1T6XA 5A1TA 3COYA 5FWXB 3F8SA 5FOWA 4M7PA 3KG2A 4ZD6A 5CT8A 2ZXEA 2AMJA 2V4ZA 4L15A 1PFGA 4L4UA 2WVGA 1HT1E 3VTZA 4AY5A 4DZRA 3GFVA 5UKDA 2EGGA 2IOYA 4O59O 3ZXYA 3GMSA 3OMWA 1NNLA 2FPIB 2CVZA 1HYBA 3DD5A 3JQBA 3YASA 2NAFA 3LW7A 2IV7A 4DN6A 4UTRA 4W7IA 3CO0S 3NAGA 1OBOA 4N18A 4S04A 1DTSA 4QULA 3HN7A 1KJJA 3OMXA 4H31A 2C0QA 5ALGA 1Y5LA 2XB9A 5HGJA 3SPXA 3ZE9A 4E09A 3AH8A 2CJXA 3TQFA 1MH1A 3DVAB 4IS2A 2PKXA 3EGOA 1IBKB 1CQPA 1CUBA 1WCIB 3E9ZA 4E70A 2IJGX 1TD9A 2EJCA 3BXZA 1E2DA 1MP0A 4HDSA 1AM4D 4YREA 1PLLA 1JIIA 4M6WB 2IHVA 2QTNA 3H5OA 1AS0A 4YI3A 1E20A 5LKRA 5AM4A 2E1PA 3VO8A 3LECA 2CNNA 2IEGA 4NV0A 5JJBA 1EFHA 1YKSA 2I34A 2OCAA 3IT1A 5F33A 1Z17A 5B37A 1T5IA 3GA5A 3KE8A 1Z5UA 3KDAA 3O74A 5CH8A 4YJFB 4FLEA 4P5DA 3UFXA 2LR0A 2OQ2A 3ERCA 4KP7A 1P72A 1U2DA 2OD2A 1VMIA 2WD8A 4ND5A 4OHFA 4F2WA 2P1DA 4DLRA 2F55A 1T24A 4N5DA 1DIHA 3OFNA 3A4YA 2OTCA 3P5BA 2EL9A 4WCVA 1TGVA 2ZSDA 4M9RA 1GQOA 2VJPA 3K5HA 3KJFA 1O8CA 1QFXA 3KD2A 3RBXA 5DFAA 3D0QA 5K0BA 2E9SA 1YBAA 3GMIA 4MYSA 4L8GA 5TEWA 2CHUA 3BJIC 1S9DA 3LY9A 4UBOA 4CM1A 3DO5A 4ZMBA 3UXEA 3DDWA 5F7OA 1YDHA 1IL0A 3I0NA 1FY2A 5H80A 3SEFA 2ZR9A 3H9UA 4N8DA 1H8ED 1N3LA 4Z7OB 3OQNA 2CVOA 1XPUA 1FFHA 4MYDA 1Z18A 2GCOA 2HREA 4V24A 4E5MA 1IQRA 4I4NA 2NU8B 1JEEA 1Z06A 5FL3A 3VHXB 1W4RA 4DLUA 3ZQ6A 3FKQA 8LDHA 2AX4A 3OI7A 3CRMA 3FGPA 3HPRA 3OCVA 4Q47A 3WOHA 4NJMB 5TQ0B 5JJCA 1P7PA 4O4LF 2ZWPA 4FUQA 2AJ8A 1GQSA 5AOCA 1JBQA 2FB9A 1QBGA 2AMYA 2I1VB 4OHMA 5L8VA 4LZZA 3WRVA 4HN2A 4QEZA 5AKKA 1OIXA 3RVRA 1J8MF 2JK1A 3WQQA 4TKZA 4MDFA 1KYXA 2QL7A 4QRIA 2ACKA 2C59A 3VNUA 4IHJA 3HJRA 4GIBA 4HXFB 3LY5A 4C1BA 1W2HA 4QFDA 1A5TA 2Z1MA 2HWYA 1Y3CE 2QN8A 5GAJA 2WQ6A 1H2YA 1EYZA 3N0TA 1KGSA 1Q77A 5B4TA 3ZUPA 3LCRA 4DEXA 1K0UA 2ZWAA 3MQ4A 1OMOA 3L0BA 3CNQS 1GRVA 2FH5B 1PCXA 1Z2NX 3GPBA 4JU8A 4U00A 4CFZA 4EFNA 4XUCA 2P11A 2WQZA 2WM2A 1HMPA 4N5HX 4WKPA 1U3CA 2JBAB 3F97A 3BFKA 1GPMA 3LLVA 5CFLA 1FIUA 2O5EA 1ZUIA 4OX9B 1RYNA 2C04A 2OO7A 3C14C 2P9TA 3FCEA 3MNFA 2WAAA 3V8QA 1YTLA 1X0XA 1IEQA 1DAIA 2FZLA 3G2NA 4QBTA 4CMIB 2V5UA 1XKQA 3WGNA 3L0DA 2E21A 4V0QA 4H1TA 5A3VA 2XOEA 5CA0F 3N7AA 2H4FA 3QBJA 5A4FS 3CZQA 4EZIA 3L7JA 1WU7A 3RU9A 5HHTA 3OH8A 4MW7A 5HF9A 3VZQA 2CW5A 4CF5A 3AW9A 1SVLA 1Y9AA 1ST2A 1WRBA 2ZRCA 4KMMA 1V7ZA 2DJ5A 2Q2OA 3RAFC 3FOCA 4AO6A 3BMCA 1N9KA 2BFEB 3RIEA 1JLLB 1XZNA 2H1SA 2Y1KA 4ZREA 4EG6A 4ZI7B 3WMGA 4KQXA 2I8CA 1LJUA 2P9HA 2YWFA 3BWBA 1GFZA 3OTHA 4FGLA 4KXLA 5E1OA 1U9IC 3NDIA 1D8TA 4LTMA 2ZBRA 3W04A 4EHFA 5CP8A 3THWB 3JAKA 1E5TA 2BCGY 5L3ZA 1W30A 3QPCA 1DTWB 2AQKA 5T4BA 9LDBA 3F5SA 4PGMA 1ODSA 1P81A 5AOBA 2VCHA 4MVJA 1CIJA 1FYVA 2X76A 2GKGA 1TMOA 5HKLA 4FW9A 5CDFE 5LB2A 2QXYA 4QYIB 1MRSA 3V5NA 3MJSA 1G8KA 1UKEA 4H7JA 2FP4A 3HWX1 1UDAA 4IG4A 5A2GA 4JITA 5EIBD 4ZJYA 4NFHA 4RU1A 2ZREA 1NPTO 2JAUA 3G79A 1WNTA 3GLRA 4IEFB 4JL5A 4WXHA 2NO9A 4ZPJA 4B71A 4WH0A 3QFFA 5F3RA 3RT1A 3L84A 4NKRA 3TLMA 1OU0A 2DB3A 1CUEA 2X9LA 3ESBA 4LF4B 1KO4A 4LOKA 3LIPA 1YIDA 3IUPA 3U44B 2OO5A 2ST1A 3D59A 4C76A 4YAUA 3K8YA 4ZRNA 1VE9A 2OD9A 2ZATA 5FNVF 3RFFA 1NM5C 3KQSA 4AP5A 3TDNA 1U3TA 4JLDA 4N5IX 1TEZA 4F6CA 1U7XA 5I45A 3BRQA 3VZSA 2XJ9A 1F6WA 2VWPA 4NL4H 4PS0A 4YYZA 2RHCA 3IB3A 5DM2A 3BCHA 4LOLA 2YMLA 5JXJA 2BKUA 4RPGA 3FM9A 5EL0A 3KEFA 1IULA 1KAHA 4BNUA 3FPGA 4HQRA 3LPDA 4WKBA 2I66A 2VTEA 4QX6A 4ZO7A 5A5EA 1XA0A 5I7EA 1XAJA 1HMYA 1O5TA 2BFNA 1F0KA 1TNDA 4M9QA 4PYNA 4TKUA 4UUQA 3HEAA 4W5NA 1HETA 4F6LA 5BNIA 3QFRA 3SS8A 2EJVA 3SFVA 2FEXA 4MW4A 3GQVA 3SP1A 3RC8A 5DNVA 5JVDB 4ZK6A 1TQ4A 5TB5A 1K9VF 1TVEA 2Q6LA 3GPDG 3HBNA 1NAIA 3G1TA 1L8OA 1M6NA 1NJ6A 3KPYA 1DKRA 4HGZA 5JLAA 1LDGA 2RI1A 1A7AA 4OQPA 2HYIC 2E7ZA 3K70D 2AG8A 5JZSA 1YE5A 4ZJUA 3TL6A 5J9FA 2EVWX 4DMHA 4WN3A 5JISA 1GSOA 1XEXB 2WWIA 2ZT6A 4IHJF 4DQVA 4OBBA 3EIHA 4NS4A 4G4JA 3K32A 4IO0A 3EG9B 1G5RA 5B7NA 5DTJA 3ZIAA 4UUPA 5ITWA 2G3YA 3ZV7A 1GFSA 4PCVA 5L6MB 5B5SA 1J2UA 2HA4A 3N2LA 2Q3EA 1U6KA 3HVIA 1I7LA 1L3IA 3QYFA 1M2FA 3WGUA 4EG5A 2R3SA 5HRUA 3JYOA 3GLGE 2IS4A 1QNLA 3CZAA 4QXAA 2Y0PA 1ZRNA 3B1FA 4QDJA 1HXHA 1KEPA 1CSEE 4DMCA 1XDSA 1GPYA 1NI4B 3OETA 3KT0A 4C6SA 1OIWA 4D4LA 1Z0ZA 4J2HA 4FW8A 3V8RA 3AFOA 4EBBA 1T4GA 1Y89A 3CEJA 3K96A 3KD3A 4C5CA 2P77A 2J32A 5C1BA 2QSUA 3CM0A 2VCYA 2GD0A 4I1UA 1CUVA 3HCEA 2VP0A 2XTMA 4RZSA 5HZHA 1Z4OA 4L5BA 3OKAA 1OI4A 1JMVA 5DN9A 4EEKA 1MG5A 4U8GA 4MB2A 3LUBA 5BSRA 3JQEA 1YZQA 1U0NA 4CEIB 4UPDA 4XB2A 3VHQA 2EFDB 3DPSA 3P9YA 5KWEA 5IDVA 1DEHA 1R37A 4PZ0A 3RT7A 2ZYUX 1X2EA 2FTKE 2ZVPX 3QH4A 1C4XA 3NWJA 1IBMB 5CA0B 4F91B 2VZ8A 3RVQA 2FMIA 5BORA 4IHAA 1U28C 5SZHB 3B7PA 1RP1A 3O4FA 1U8ZA 3ZVKA 3HUDA 1GHTA 4S0XA 4DOMA 3FCXA 4B87A 1MIHA 4PR3A 4D81A 2HQSA 2B6NA 2MSKA 5A4MS 5KNBH 1SWVA 2QRKA 3FLAA 5JOQA 2BJWA 3EE6A 1RC0A 3FD8A 5FBLB 3SZGA 4QELA 3PPVA 3RYHB 5AJXA 2HC9A 3I01A 1XAHA 3EXG1 2EEZA 1OLSB 2GAOA 4X90A 1XQ9A 2X4GA 4LJ4A 2A94A 5B58C 1AV7A 3F6CA 4EFDA 2PGXA 4NMXB 1L4YA 1T8TA 1YDFA 1WD5A 2VP9A 3W8DA 1RYBA 3ZCVA 5BVHA 2VTBA 1X1AA 4HH1A 3MT8A 4DC0A 2EXXA 3SCZA 3UPDA 2BCJQ 1NBWB 2DULA 3CB4A 1EG2A 2HJ9A 2FRDA 3DMGA 2J41A 4BFYA 4CKBA 1BXGA 2J09A 4ZKDA 4UFNA 5HR5A 2HCFA 2FV8A 4V1CI 3QF4B 5FXMA 2WLTA 1E63A 1KZ7B 1KO8A 1OYVA 3DE1X 3ENQA 3PEFA 2ZJZA 4PO8A 4BP1A 3N8DA 3QBVA 3HFSA 1Z5PA 3PC7A 2FG7C 4U7TB 1ZN9A 2V7WA 2JKVA 5DYGA 4XLLA 3TLXA 5JV5A 1NWHA 3V3KA 2BEWB 4LRQA 3QUTA 1DC6A 3ETEA 3WXBA 3CZ4A 3GK3A 2ZYSA 4CG2A 4BBAA 3AEQA 2Z4RA 3M81A 3T12A 5COAA 3IDOA 1RWKA 3A9WA 4B82A 1DAFA 3VH1A 4IIXA 3FVVA 3C48A 2WMDA 5F5LA 5J5CA 3RUPA 1BX3A 2B7LA 4MUEA 2R6AA 3TSZA 2QRHA 1M2VB 2EF0A 1MA3A 3VR2D 5F73A 2Z4TA 2PJDA 4EO9A 4JVSB 1IZ0A 1CDDA 2O0HA 2RIPA 3TF5A 4ITUA 2HU7A 3GN2A 4UVIA 1CR4A 2YIMA 1LSOA 4N6GA 4L57A 5KNDH 2TMDA 5B2FA 1U63A 1R9NA 2OZEA 1THGA 1S1MA 3O3MB 1WY5A 5DX1A 4RX1A 1Y8QB 3TW4A 3EOAI 4PG6A 3U1VA 3VNVA 1DBQA 1DKLA 4HAVA 1FDWA 5IN4A 2FWMX 2II6A 2O8CA 3D4BA 3QFHA 2YMQA 4G23A 3IAAA 1UOQA 4N7MA 4QSHA 4UCFA 1H0HA 3C3KA 1DSSG 4B6RA 1Z7GA 3AUUA 3JZIA 1RCUA 3CLRC 1SC9A 5CJ2A 1Q3TA 3SJBA 4JBXA 1XTPA 2YV3A 1COZA 4ZYXA 2WI8A 2C3PA 2J6CA 2WHPB 4PSCA 5E1DA 3GWGA 2VSOA 2WFAA 3NJRA 4V0SA 2EQ5A 4BTLA 3MG9A 2P4UA 2P75A 1VMDA 2FG5A 4YIKA 1U04A 2AK2A 3SBXA 3B6KA 4QHYA 1A8PA 2BFWA 3FUCA 4AC9A 1K5HA 2ARKA 3C8MA 4EK9A 4LRXA 5LVAA 2G1JA 1U1GA 1YBFA 2PT7A 5EE9A 1K6JA 4MWBA 4BNJA 4TV8B 1AKYA 3N75A 4O1MA 1YZYA 3D7KA 5MF6A 2IYZA 2PUAA 2BMDA 1IN1A 2AE1A 5JH7F 3QFCA 4OI4A 2REBA 4EGFA 1B8VA 5BT8A 3Q4GA 2J4CA 1J24A 5NULA 3V7UA 1V7QA 4C7VA 4KPUB 1Z8HA 3H5IA 1JYSA 5JZ9A 4K9OA 2XKAA 4PCLA 1XQ1A 5SYNA 4URYR 4C7JA 5JWOA 2QNBA 3BCSA 2IODA 3RJMA 1T3GA 4HRXA 4TTPA 5CUQA 3U9SA 2AKAB 3S7ZA 2GDJA 2VF7A 3TXAA 2ENUA 1H0SA 2Q3FA 3BBPA 4QXOA 4HAUA 3FVTA 4RY2A 4MYRA 4FXOA 2A58A 4LOJA 4BMXA 4F06A 2Z5LA 5J4KA 2ZBUA 3BGOS 1A4UA 1XJWA 5DI9A 3LUPA 2EKBA 4INJA 1UBMS 3EA5A 4E5DA 4LYEA 4C30A 1Q19A 3UXYA 2ZE8A 1JEOA 5A6VA 1YQXA 3CRW1 3H5NA 3OIDA 2POCA 1SCAA 3IQZA 3BMQB 5SYMA 4D57A 1G9XA 4Z0PA 2I3BA 4ILEA 1PT5A 5AK6A 5E7QA 2V1XA 2CXRA 2IY9A 1IPEA 1WB4A 4Q4CA 2A5YB 1FDOA 1RRVA 3DLCA 3HCWA 4ZCSA 5LJLA 2E48A 3QKRA 1NF3A 4C4SA 3EC1A 3NIFB 5JYEA 3F90A 4IMPA 4IOKA 3F8TA 3D4LA 3INGA 3NB0A 3OQ1A 4MP8A 2XQVA 5SICE 1XP5A 3JQAD 4YJ2A 4BRWA 3SSAA 4KO1S 5LDDC 2DERA 1XOIA 4JB8A 4HYYA 5F1PA 2C5SA 3M6LA 1AQJA 3PHHA 4OG2A 2MSEB 4EP1A 1JYEA 1MC4A 2G8NA 2H1LA 2R6CA 2NSYA 5MHTA 3KO8A 1PTKA 3VR3A 3IQDB 3GAMA 3RS8A 3K0FB 1Q95A 3MK31 4C05A 3WJAA 1QLHA 2PPLA 4JUDX 4LBYA 2I2DA 1VBMA 3DFMA 3GRKA 4OXKA 3TPFA 3C3XA 3PGLA 3QKWA 1WBBA 4BY9E 3LQ1A 3V4PB 1YF3A 3PFIA 4R5MA 2E4YA 2PWBA 5E6RB 2HA3A 2J0UB 2Q5CA 2IHJA 2XEXA 1DQZA 4NOJA 1NLZA 3I4LA 4Z2AA 3DB1A 5JS8A 1QF7A 4IP0A 2W2KA 4BLUA 1KXJA 4DRXA 3LO5A 3OKPA 1HEYA 2B4TO 1G5PA 1OBHA 3HU5A 5L3QA 4PCAA 1DHRA 2EDAA 4PIVA 5KTKA 5C5DA 4B3GA 3G2OA 2PGDA 4HWKA 1IHUA 1Y3BE 1L5HB 4XR9A 1R4ZA 1BQ4A 2CL0X 2H1CA 1RJ9A 2Q3DA 4W1PA 1I0ZA 3KELA 1TFUA 2QX9A 3W78A 1EP3B 3KXLA 2VF8A 4OMUA 1PVOA 3FR8A 2B98A 4WFIA 4R8SA 5AM1A 3QA3E 4BPRA 4PO1A 1A7UA 1E1RD 3L8DA 3GLTA 1OGJA 3QOWA 3UA4A 1KZ9A 4U5XA 4AXXA 4W5RA 4FFBB 3DZHA 5CNMA 5DM70 4ECEA 5CD1A 4GXRA 4KV9A 4ISBA 3BULA 4URUR 3G02A 3RVOA 4C4ZA 2AJDA 3ESYA 2FQ1A 4RLFA 3IUEA 5KQPA 4XM2A 4PYIA 3MTJA 2QV0A 1ICEA 4DR4B 1I1HA 3ILYA 1JL3A 1PT7A 1FQJA 3L93A 3AOEA 3BXEA 4BQSA 1M0WA 4FOPA 3TAXA 4HNGA 4MV8A 1EG7A 4FU0A 5EOVA 5EKTA 1PFUA 1Y3HA 4DA4A 1XZKA 4O2AF 2WMNB 4RSHA 2Y1CA 1VKJA 4K6KA 4YP5A 1QG6A 1RYMA 2I7XA 2HNAA 4FKZA 1U4OA 2VXCA 3I4CA 3QK7A 2WV7A 4NZYA 3RBZA 4M0DA 4AQDA 2JHFA 1KBZA 2B1IA 2WVJA 4TL8A 4AJIA 1NPDA 1QYIA 1TKBA 3AEUA 1U7UA 2P69A 2H17A 5TGTA 2GZSA 1KKUA 4ASUD 1RYEA 1VYTA 2Q50A 2GFIA 1N2XA 1R4AA 4BO6A 4BQNA 5CCEA 2VLBA 3UAGA 3ZCXA 1AO0A 1UXOA 2GD2A 1OHHA 3B12A 3G1UA 3GGGA 4JFRA 4ES6A 3C74A 2MSDB 2MCFA 3F6SA 3C3BA 1GUFA 4DR2B 4ESOA 2OMKA 2FPKA 1XYVA 3A10A 2ACWA 1G291 1K6EA 1IZZA 2ZAIA 2HSWA 2HCJB 1K7FB 3O4VA 1GUZA 1RHJA 4KQ9A 2MT9A 1ZIYA 4JH0A 3DA8A 2F4NA 2WD7B 4MWEA 1RWMA 4JMLA 3LPMA 1XF9A 5MN4A 1LTHR 3HU1A 5I9BA 1GL6A 5IPFA 4E31A 4U3JA 4UTVA 1Z0JA 1UODA 2P9QA 4BLWA 4K88A 1PR1A 5IM4A 1T9GS 4AYXA 3HO1A 2IF2A 4HQOA 4R1PA 4NZMA 1J2JA 3H99A 2B2NA 4FDUA 4AZ3A 4NTZA 2BM1A 4ZVNA 3U17A 4RQAA 4YAGA 2XV1A 4G0NA 4WQMA 4NMLA 1CYEA 4BMNA 4M86A 4PRYA 1TC1A 4J94A 1IVSA 1UH5A 2YQ4A 2PWYA 1EK6A 1MJHA 3NALA 3DUFA 5DSTA 4KACA 3UHJA 2NZ8A 3X1MA 5LMZA 3PEWA 4JQSA 4RENA 2QI9F 5I9LA 1EWYA 5GOTA 4W7SA 3SJZA 4BX8A 3G2QA 4G86A 1NSFA 2GEKA 1HG1A 1GVHA 1A95A 1L4BA 2BP7B 5C31A 2W6OA 3NI2A 4ZYUA 1QQ5A 3MGBA 4XASA 4XFKA 3I52A 3USZA 3DMHA 3RREA 2QRJA 3LWDA 4IF6A 4AKHA 3KZKA 4ZANA 1R8QA 4BP9A 3FAZA 1IRXA 1ISRA 1RWVA 2EG9A 2Y77A 1E3WA 2FXVA 2XBUA 3QEKA 4OAOA 1DO8A 2HJHA 1APBA 5BSKA 1FX1A 5AP9A 2XSZA 4F5WA 4WE3A 5AVKA 3PFKA 3CEAA 3H97A 1I8TA 3W6PA 2F48A 3D8RA 2OA0A 2FG6C 4WZAB 5B64A 3HXMA 4WZAE 1X7YA 1C3OB 2HA7A 3KYCA 3QYPA 4MP3A 4A6DA 4NDAA 3R0QA 5FYDA 2OYCA 4FHCA 2I0FA 4D4JA 5LOVF 1FMJA 3F6EX 2JVJA 1U2GC 1O96B 1L7QA 2TECE 1S2GA 1U0JA 2BC9A 2XUGA 4RIIA 5KNCA 1XTVA 2O1XA 2HOQA 8OHMA 1Y7PA 2FX5A 3MJ4A 4JSYA 5BWOA 1BO6A 1JT2A 3WIUA 1T5HX 4BC1A 1EGVB 3W2GA 3OM9A 4F9GA 2G0TA 1BJKA 3D0OA 3AC0A 3CCCA 3NNSA 4OLBA 1DAEA 1PEDA 4LYAA 1V6AA 5FYQA 3UAYA 3V1LA 1A5BB 2WM9B 5ALSA 3P5SA 4D8TA 4B6QA 1Q1BA 1TJPB 3VR4H 1NQ5A 3OX4A 3QXHA 2XECA 1LPSA 1TX4B 3G8AA 4QU8A 1FFCA 3DC7A 3K16A 3LX4A 3W3AA 5EMJA 4NG4A 4AK9A 3HYNA 1TMYA 4S2EA 1QHXA 2G88A 1FP7A 4DKXA 4OIMA 5AW8A 5E9WA 4CKWB 3DV0B 2Y1DA 1UM8A 1FDTA 3T4UA 4Y9TA 3WRXC 5M7EA 2WWXA 4HCJA 5DX0A 1BD4A 1CVIA 1UL1X 5AVQA 1CG6A 4QXMA 1Z6XA 3RUDA 4E08A 3AHDA 2OC9A 2ADMA 1WOYA 3H11A 5DK6A 2Z2JA 2PTGA 4U1RA 4Z4GA 3SYNA 4YT2A 1JVNA 1Y8ZA 3RQSA 4DLTA 2WQ7A 4FI3F 4Q7JB 2QTMA 2PVCA 5KX5B 3PIIA 2P8SA 3GCGA 1KAMA 1Q0LA 2HF9A 1MO4A 2IT1A 3BCRA 4EMUA 1YA8A 4YV1A 3VVMA 1ZH6A 2BGGA 1RKQA 2BD0A 5GY7A 4CCSA 1SK9A 5I51A 2VUIB 4ATNA 4C2BA 1E4OA 3PI7A 3KDPA 1K0FA 3SG0A 3K6SB 3L02A 4AD8A 3CKLA 1JIJA 3JQDA 4JDUA 4BCDA 4MW6A 5ILQA 5FA5A 4MDEA 1S8FA 5IK2A 1YKGA 3ZTYA 1VYVA 2RE8A 4QPCA 3I09A 4I9UA 3MJEA 4O29A 3V3TA 3ENWA 3IV6A 1SVMA 4DV4B 4BLSA 2NXEA 3GJRA 1BQEA 2Q1WA 2VSNA 4DWJA 1W8IA 2SKEA 1XZPA 2QDKA 2XVAA 1K7CA 1CR2A 1ZUWA 3D8HA 2O05A 4M9SA 2D2FA 4MW9A 5EKXA 3ZKAA 1RC1A 4MWDA 3DL4A 2I65A 3BSWA 4G5RA 3DAFA 4IOLA 1CP2A 3L6RA 4QICA 4A27A 2XA9A 5CA0A 2Q6OA 3PC8A 3VXKA 5CDYA 3NOVA 1EINA 3BWEA 2QM8A 2BFDB 4QUHA 1X87A 1O0SA 3DEHA 1JFFA 1XZDA 3DEIA 3AT1A 3VH4A 3EVNA 2WFLB 4A6PA 1VPWA 2EJWA 3L7YA 3R6TA 3HZZA 4N7JA 4NATA 1L7BA 1VG0B 2HK7A 3DE2X 4YO8A 1YL5A 5I8WA 1U0SY 4J4HA 1KEEA 1TADA 3MT9A 2QA5A 2YWHA 3HRIA 3KTAB 5L3VA 4KNVA 2R85A 3ZC3A 1TCBA 1JA1A 2R5NA 4MVCA 3GG2A 5HOQA 2GILA 2VHYA 3ZHQA 3DLPX 2AKYA 4QJIA 3HO6A 1SXJD 3Q0EA 1WETA 4DC9A 1MKYA 1EE1A 3VU9B 1TW3A 1UZLA 2AF3C 4DIEA 1RBQA 5HE9A 1QVRA 4O25A 4MI3A 4U39A 3R7AA 3IO3A 1GIAA 2I6XA 2QM0A 3JASA 2QPOA 3AJ9A 2RHHA 4WRRA 3WTBA 5CCBA 1PWEA 2H00A 2X8JA 5HEKA 3ZNNA 3ZLTA 2CN1A 1IHXA 3CF6R 3L1JA 3IAUA 1E6CA 1QAQA 4L8LA 1XU9A 2JJYA 4GMXA 4TKUB 4ZYWA 4KWTA 1KR5A 4JGBA 4D26A 2R86A 3OM0A 4UPVA 4KRGA 5HXAA 2PUEA 3TTUA 3FF1A 3O47A 2I4NA 1P0FA 2C9DA 5LL6P 4O3MA 2VPYA 2BISA 4PNHA 1O87A 4R3NA 1JSRA 3VISA 2D6FA 4D46A 5HS4A 2EW1A 3CU5A 4RWZA 4G1FA 1C3XA 1VKOA 4XUGB 4YFVA 4AJPA 4ZEVA 1AHPA 5FA8A 2Q0SA 2XRYA 4CM6A 3DM5A 4TUYF 1HX7A 3C3DA 4DLAA 4LCEA 3VA7A 4KHZA 1FYDA 4RXMA 4KNYA 4CM8A 4RY8A 4QAQA 4AUEA 4F38A 3G6KA 2FZKA 3N6XA 1UKAA 1FDIA 1KWGA 2Q6TA 4N7RA 1A97A 4ZALA 4LV6A 4JCOA 3I0ZA 4HNHA 2HDWA 1LBSA 2B82A 2VJQA 5CYOA 2Y68A 2IXAA 3KE9A 4G5SA 1I24A 5ARBA 3ANNA 1Z0UA 3GLHA 3QVVA 1ZHHA 2JVKA 1B8OA 2GF2A 1HZZC 3LLCA 3MF4A 3OIYA 1L3CA 2ZUTA 1IN7A 1VPTA 4EENA 4GM4A 4P36A 1Z8NA 2FCAA 1RWXA 2HWUA 2H08A 3ADPA 5SZKB 2CDCA 4MW2A 5B4VA 3TSWA 2VZLA 5BW5A 3PC4A 4FJ1A 1RXEA 3L8YA 1DZ3A 3EZXA 4YRCA 2R8PA 1NULA 2DSTA 1JVBA 2CCGA 3JSXA 1IJFA 4OQNA 4RYDA 4AMUA 2PLRA 1WQ1R 3QVGB 4TQUS 4BCBA 2ZJYA 2X9GA 5DCUA 3IDQA 2YN0A 1TAUA 4OQLA 4ND8A 2F3QA 4CT5A 4CMEA 4BTEA 3TD6A 7ABPA 4QTYA 3BUSA 1ODCA 2CSUA 2I2BA 5IBQA 3HSSA 3UZUA 5EGNA 3KQMA 1ZGZA 4UJ3A 3MGCA 1HT3A 2W0MA 5CTAA 3RRXA 3W4JA 4MA5A 4BKMA 4K6MA 1D5CA 1CETA 1VIDA 2G9VA 1E0DA 2H7XA 5EWLB 4U2DA 5B3JA 1XQWA 2VK2A 1CUUA 2FK7A 4L07A 3KFLA 3UWKA 4D6XA 2OQVA 3TZLA 1PJTA 3FCAA 2VAWA 3UOGA 1QTNA 1IBLB 4JYCA 5G0VA 4N0QA 1PVDA 4KR7A 2JFNA 4MXDA 5C8YB 2WYVA 3W5JA 4YJ3F 1PL8A 2HLNA 3LYAA 2CK3D 1WXGA 4Y2TA 3AUFA 2OFOA 3H1FA 3II6X 2P6PA 2WIAA 3O0TA 4D0RA 2I78A 3STUA 5ALLA 1V8BA 2I80A 2AQHA 4D6PA 2EL7A 2PSJA 3SZOA 2K5UA 4GMFA 4N9QA 4CGZA 1ESCA 1E94E 3FMPB 1VCIA 4G3XA 4MEAA 4WINA 3VKGA 2CV1A 2W2LD 1RAFA 3JALA 1V9SA 3UGTA 1GPDG 3B9PA 5ARDA 1W47A 2VBGA 1T5LA 3T3MB 2PZBA 3VPAA 2PX5A 4RW0A 4DCNA 2HO5A 5C35A 2N75A 5J2TA 3ENZA 2NV0A 3E03A 2GBGA 3UJCA 3ZZ1A 4P92A 1WUTA 3N8GA 4Y9UA 5F2NA 1K8RA 4RDXA 1HFJA 4I1SA 1QCDA 3AEQB 5F1KA 2BTQB 3T9CA 4MUKA 2QRVB 4RVCA 1X1EA 3O95A 1JMKC 1WUIS 4MV7A 3RSZA 5J4YA 4GW3A 3EPRA 4GZ5A 1C81A 3DLTA 3MAJA 5FPTA 1HE1C 4N8SA 2OWDA 2FW9A 3QV1A 4NI5A 4Y8VA 1LSJA 2R9VA 3A4IA 3N3BC 3H2BA 4OL9A 4ENQA 2GCGA 3KVOA 5BWCA 2CF6A 3K9GA 4BNDB 2QZJA 5TDHA 4G8CA 3ILSA 3BMOA 4KO3S 5NLLA 1QV7A 3MCWA 1CY1A 4RORA 1SUIA 2X0RA 3PXCX 4I1YA 3IMKA 4OU4A 4RVUA 5IT0A 4G0VA 1P2SA 5BQFA 5L3QB 1Q7GA 3LRPA 2QZ9A 4KXFB 2WJPA 4R9UC 2ODTX 3GXBA 5MN6A 3TW0A 1V9CA 5LQMA 2Q7OE 1BCSB 4FS8A 3K30A 4M1KA 4RFSA 4CCAA 1NW3A 4LRSB 1HE5A 4D98A 3KXIA 3W4IA 3D0KA 4M3NA 4AZTA 3R24A 3FR7A 3BGDA 3U6KA 4WDRA 1EUQA 4NOKA 4XWAA 4ZIRB 3QP9A 4JLKA 2ODPA 4CCYB 2O6LA 2O57A 2XSZD 3ER9A 5AR1A 1KK2A 4EB3A 4E5SA 1OXUA 5B3KA 3JWIA 3H19A 3SWWA 4BNGA 4ZJZA 4EG1A 4UOQA 3UGJA 1WTAA 2KYRA 3MRVA 4DJTA 1I33A 1I1OA 2AD1A 2CCKA 2O3JA 3WTCA 4EPRA 1B6GA 2BY4A 2VF4X 3AESA 3VVBA 2R60A 4WEQA 1U8YA 3V9AA 1K86A 2ZT8A 2ECQA 3WO1A 3ZH9B 5H8WA 4ZI5A 5JSKA 4PN3A 2ZTSA 1ZSNA 2YJ6A 3A4NA 4TUYB 1QO0A 2A1TS 2VRWA 1C1XB 4HH0A 3SYMA 4HDRA 2CLIB 5JD5A 1SUEA 2QL9A 2XNHA 2VO1A 1OJ7A 4PSKA 5DOZA 5FWYA 3PQ5A 3DO6A 1Y3AA 4RTLA 5DYWA 1GRQA 2QVBA 3R3SA 1C8LA 1JHMA 4LHEA 4AURA 4AY4A 4FKBA 3UPTA 5AESA 2GM4A 1W46A 5CVDA 3VBCA 3BWCA 1DMSA 3BXXA 3ETDA 2EDCA 4P7FA 1IM8A 4MA4A 4Q7KA 3PRJA 1W9HA 4OHUA 4LXYA 4BN0A 4D44A 2WJ6A 1R66A 4P3YA 2RHGB 3UO8B 4DSAA 4KXXA 1BHSA 1ZA1A 3TFQA 2QYHA 3DDOA 1JDBB 4YGXB 4RDCA 5EXDA 2CFTA 1JYFA 1J90A 4KI7A 4O02B 1TZKA 3CRVA 4C0XA 4F45A 1Q6ZA 3GH3A 3IT0A 3E9DA 4KAJA 4PAMA 4KOEC 2B1RA 4IIFA 3OQBA 5C4GB 3UT6A 5FWNA 4K1XA 3SAJA 4CCYA 3IUSA 3GU3A 3MS2A 5DLYA 3LLSA 3OD1A 5C18A 1VZ2A 1SVSA 4RA6B 1ULZA 2GPSA 4E2YA 4ENPA 2DM6A 1EQAA 1FNNA 3JQGB 4NDZA 1V16B 1KYIA 2ZBGA 1P61B 1XNGA 1AHHA 1JPNA 5JG7A 3AM3A 1LDMA 3I9V1 1BXRA 1NPYA 1R0RE 5HTKA 1ABBA 1AURA 3N86A 2XMRA 2JAHA 1A27A 2X0IA 2QE7D 4TS9A 1VJCA 2FZCA 1P18A 3R44A 4AXBA 3AIKA 4MH0R 3OZCA 4WLUA 3O8CA 1QTIA 2N1BA 1DQYA 5JNRA 4GAEA 1RQNA 3EA4A 2R00C 4RH0A 1AX9A 5E8RA 1Q0TA 3AEXA 3CZPA 4J6EA 4K86A 2C58A 2JEZA 2JGJA 2J0UA 1QZZA 3C45A 4PR0A 4DA8A 3SQMA 4W1QA 3PEYA 5IJ0A 1HYQA 4YMHA 4NU0A 1ZISA 4ALMA 4XFDA 4G0MA 4S05A 2QUHA 4U9UA 2EX1A 4MHOA 1XNQB 2W8BB 2TMGA 3N59A 1EE9A 4FC6A 5AVRA 4EB6B 1W4LA 1YMUA 3DTNA 3SHFA 1P7VA 2BEUB 1E2HA 2PZEA 1E96A 1HE3A 2VEDA 4YWHA 4LJYA 1ULHA 2DWQA 4KPGA 4O4HB 3RODA 4K2HA 2AN1A 4ITRC 2OCDA 1RYHA 2HJSA 3EFEA 3TE6A 4AO7A 4N76A 4AUMA 1IWOA 3KTFA 1OXMA 3RQIA 4QYWA 4C03A 3PK0A 1GZ5A 1ARZA 3MJFA 5ECYA 6YASA 3S29A 1AV6A 3RBVA 3WL7A 3DDUA 4QBGB 5DYIA 2IOFA 2G6BA 3VYUB 5LQDA 3ND6A 4ASUA 2BIFA 1PEAA 4GWKA 4MO2A 2A3NA 3N0RA 4JJGA 4L76A 2NADA 3O8BA 4P4NA 1P39A 1XAGA 2YL2A 1W34A 1WUYA 3FB4A 3ZQUA 3MEQA 1TB4A 4PM4A 3F0TA 2FPPB 2YCBA 4QDTA 1YQWA 3OJ0A 2WZCA 1QE5A 4ZVRA 1CE8B 3BHJA 2AC2A 3OTWA 3ROMA 1GDTA 1R2QA 4WLNA 4LYDA 3MGAA 5HRAA 3CVOA 4EY5A 5DJ5A 2Z43A 4HNUA 2D59A 1O5IA 2VDWB 4A6XA 3V1TC 3HV0A 1ESZA 4MV0A 5JEDA 4ZICA 2FETA 2R6GA 4N39A 3RIXA 3MT7A 1L3BA 1WKVA 5ALIA 3HB7A 4ZEXA 3MYYA 3Q9LA 3HVUA 4ZO6A 3UPUA 1BMDA 4MQEA 1AQNA 1FMTA 2PU5A 4LZAA 4PWYA 2H5IA 2HJRA 1GGFA 2UYQA 1U1IA 4JBIA 3W9YA 3A1UA 3T1VA 2IHBA 2QLNA 4JELA 4R54A 4E2XA 2FMHA 2FSSA 4NCHA 4UAJA 3R23A 1WDTA 1WKBA 2D1RA 1E1CA 3VR5A 3MXOA 1W36B 2VA8A 2JLRA 2JGEA 3OESA 2AFIA 4M0UA 1PKEA 4JLPA 5F4BA 1XZMA 4Q82A 2G82A 4R1LA 2HU2A 3K9LA 2XGOA 2J6IA 2VRBA 4F4IA 1QZ3A 2POQX 2WG0A 1TUBA 4LSWA 1KVUA 3E8XA 4WVFA 4FE3A 1K7SN 2JI9A 4OKIA 4BMZA 4HQKA 4R1MA 2FFBA 2IIBA 4BMCA 5KNLA 1XROA 2V7GA 4J0GA 1QFZA 4DCMA 2VHTA 5KAMA 1NM5A 4HDAA 1Z16A 4ETWA 1ZCJA 4L02A 1N6KA 2F3SA 2OHHA 3EC2A 4JXKA 4NJEB 4W5JA 2HFJA 2FEMA 3BE5A 1V16A 2J48A 4DLNA 2ONKA 3K1ZA 2BI4A 1JDSA 1RM5A 2V7XA 3OCUA 1KSJA 4NYIR 1XIVA 2YVLA 1M2EA 4MUMA 2OAGA 4Y2RA 1CRPA 1E7MA 2LCQA 2JLXA 2YHIA 1SOVA 2BMEA 4FZRA 4JLJA 3M4NA 4WBNA 4ZOLA 5DCYA 5LNK1 4PY2A 3T5MA 4CLDA 2H07A 4D96A 5HIMA 3M6VA 2QMHA 1XRLA 1FQWA 3QNWA 3PFWO 4L8VA 1BE0A 9ABPA 3HJUA 1Z56C 1VE1A 1CULC 2QTVB 4WI1A 4XIJA 4BWVA 1PEYA 4AWAA 5ICCA 1WVMA 4IL5A 1XQYA 1U5BA 5AJUA 5IDWA 4M2LA 2GVDC 4G2TA 1ZOSA 3KSDO 3ZY4A 1UK6A 1P1HA 3UJBA 4DR3B 1VPEA 2J46A 3A05A 2DWOA 2OK8A 5KMGB 1M5UA 1EGAA 3OF3A 2ZITA 3GY0A 4HGNA 4Y67A 1TUBB 3EVFA 4LHZA 3P20A 4JLNA 5IUKC 3F5QA 2YWEA 4XR4A 3P52A 5JD6A 4D4KA 4P0QB 4NEHB 2UVQA 4ZCLA 4G9EA 3FPBA 2B1JA 3O4RA 1S2MA 1ZLYA 2Y4OA 4RFVA 2Z3ZA 1LRKA 2PU7A 3ETNA 5GGXA 4UNSA 3OE5A 4RZHA 5FLYA 4EKGA 3OQOA 2ZBEA 2DLDA 4QOHA 1BFUA 2EWWA 2GK7A 2ID4A 1OPXA 1USVA 3ITEA 3OICA 4OCZA 1K92A 1Y8RA 4WFQA 3DOHA 3FGNA 2QD1A 2NXWA 4L9SA 4FD2A 5HUQA 4KVGA 3JD3A 4OFZA 3KPJA 3PUJA 1NG1A 5JLJA 4S35A 2PX3A 4KFTA 1BHJA 5EJFA 1O97D 4JLAA 4MITA 1E7RA 2FEOA 4TWRA 1EGHA 3IBSA 4QM7A 1F8UA 3QPAA 2X2OA 3Q7RA 1IXKA 3H6KA 4J0CA 1TQHA 4GZ3A 5EJAA 5LUBA 4MLDA 4CMJA 4DSOA 1MNQA 4GPBA 2HIAA 1R5JA 1NJGA 1OYWA 3C7CB 4CIVA 2FCRA 1Z2AA 1LS1A 4QNNA 3NETA 4RNDB 5JPDA 1OFHA 3GAZA 3LM8A 2O8CB 7GPBA 4EABA 2V3WA 1D6JA 1LC3A 4MGHA 2RB4A 3GZNB 3WLFA 1GTG1 2VKQA 3OMLA 3ODPA 4RDIA 5EI5A 1X80B 3DDHA 4C7BA 4XCQA 3CH7A 1QCCA 3PUVA 1PZFA 4U9HS 1I14A 1QGUB 1E3LA 1DC7A 1IHOA 3OWOA 4PZLA 3DMYA 4QLOA 1P9NA 1XZAA 2WHPA 3O83A 4ACAA 5I01A 5IKXA 3OSUA 2WICA 1WP9A 4TMYA 5LQRA 1LX6A 2O3QA 4MR8B 5AJHA 1JVSA 3RH0A 3D8UA 5IMSA 1EB9A 4IIJB 4G5XA 1Z6AA 4FEYA 1CNMA 1C30B 1RZVA 3AF3A 2D5CA 3ZQ4A 1Z5NA 1F6BA 3HADA 3VM6A 2PYIA 4ZOEA 1DBSA 1B3RA 2WYWA 2JFXA 1SUFA 1CY4A 4NVRA 3UJ3X 4C89A 3U7FB 2XUAA 5C53B 3MQ2A 3OIGA 2AI3A 1EX6A 2R4QA 4FOLA 5K0SA 3BEOA 3L1IA 1KIAA 1V43A 5CM2Z 4DADA 3D7RA 2QDXA 2ZRGA 3MVEA 2GLTA 4I50F 1CRQA 1D03A 4RMHA 2F2TA 4KN6A 2GESA 3I5MA 3N6VA 2ZB4A 1NMQA 2IVZA 2QU7A 4G25A 4MUAA 4DCPA 4EFKA 3S81A 1Q7CA 3R0ZA 3VDRA 1AKMA 1FJ2A 1RXSA 1ULBA 1LDBA 1TU4A 1ILEA 5AOAA 2R1TA 5DLEA 1CP3A 1ISGA 2F00A 2AMFA 3K92A 5HOEA 5IEBA 1WMFA 5EXEA 1T5OA 4NRDA 2A5LA 1SGWA 1ECGA 2ONCA 3AEUB 1JKIA 3HI6A 3P9IA 4IQFA 4GP6A 4OHZA 2OECA 4WJLA 4Q4HA 1ACJA 1GPLA 5K6RA 2IIVA 5E3IA 1AKUA 1R0KA 1WABA 2QPLA 1WCWA 3NANA 1C3LA 3B48A 1U5BB 3QX8A 5KYVA 2JGNA 4RADA 5K7SA 1YACA 4AL4A 3E3LA 2GYYA 2WBLC 1G41A 3NUZA 4PSVA 4E21A 2I99A 4MR8A 4P9NA 1YJXA 3B5IA 2Z8ZA 4QQKA 3QVUA 3WO0A 1G4UR 3EEFA 3R3XA 4KJXA 5DNAA 4DDTA 4ZEMA 3GQBA 2APJA 3WS7A 3Q9NA 4G5FA 1E61A 3V7WA 5J4HA 5KKNB 2QX6A 2ZIXB 3CPSA 4CMGA 2Q49A 1MZPA 5EUQB 4FGJA 3TR5A 4JBHA 1QO7A 2B61A 3AOEC 1IPHA 3FVRA 1F38A 1FX0A 2QN2A 3ZU2A 4N41A 2EFCB 1TVKB 2GD6A 3IE0A 2X0NA 13PKA 1N0UA 3JVDA 4FFMA 4CBVA 4M8IA 2O2ZA 2C00A 2AEJA 5KQRA 5C80A 3ETGA 1RW4A 4YCJA 1T2DA 3AUXA 3KZVA 3PQ8A 4BFTA 2GZAA 3LHIA 2O2SA 1FOEB 5F12A 5T8KC 3VI3B 5M04A 1PJLA 2EZUA 4KPEC 3C5EA 3D9QX 1Y3IA 3F8WA 3K8OE 2A5JA 2ZRBA 4P4UA 4CM4A 5BR8B 3KSBC 3ENNA 1EEHA 1G8MA 5J2TB 2FR8C 2CDAA 4BLVA 1K6MA 1GXSA 3HKEB 1W19A 3NRJA 3QVTA 4OYYA 3B8EA 3NHAA 4BP8A 4B3DA 3WNZA 5IC5A 4AS3A 3S6JA 4DYDA 2UXDB 2XX3A 3PDCA 2Y4NA 3I04A 4DRXB 3QMVA 3N0XA 1XN4A 3IVCA 1IN6A 4WOPA 4H08A 3GUZA 1N7HA 1M2GA 1LU9A 2VA9A 4LGMA 3INRA 2VJYA 4DXDA 4BAZA 1H23A 3NDBB 3V4VB 1Y6FA 1P73A 3E27A 4BX0A 1NOIA 3DAPA 1QG4A 1JSZA 1J1UA 3OEHA 1V47A 1DFHA 4IQ8A 2I29A 2QZ4A 3HYSA 3ORFA 4U63A 2RHOA 3R5HA 4B35A 1W87A 3EMDA 4QIHA 3BL8A 4QJBA 2GERA 1R6VA 4A73A 3Q1LA 3VOBA 3KM0A 4A8JA 5HM6A 5JHGB 4D2IA 4GYJA 1MT0A 3D6VA 1AHNA 1V8PA 1Z0KA 3GLHB 3JQ9C 3PSAA 4C4YA 2O23A 5I3ZA 4PG7A 3U4QA 5A5VA 2AXNA 1LS6A 1UEIA 2NV6A 2YZ2A 3DBVO 4FONA 1Z6YA 4W8OA 2O8EA 1IQ0A 2D5IA 2VNIA 3JTMA 2H7CA 3GIDA 4M37A 4X1YB 3X43A 3GFQA 4IJKA 1JHRA 1EWRA 4ZGBA 2E37A 1P9OA 2HAEA 2QHXA 3EVEA 3FVQA 4A8TA 1II0A 1M76A 2VUSA 5AK3A 1RQRA 3ZLBA 1JKXA 4RVGA 4BVJA 2WSBA 5CVTA 2ZRQA 1GPNA 1Y6QA 1SQFA 2IDKA 3CVJA 2H9YA 3EHDA 1C9NA 1XRNA 1THZA 2XQGA 4UBMA 2G7MC 4O2AA 3Q0IA 4YMUA 1Q1NA 4GP7A 4HY3A 4HT3B 1IZ8A 1EE2A 1SOMA 4HDNB 3G6WA 3ANTA 4LJAA 3P1JA 2CE2X 5M3BA 2FLWA 1MO2A 3L01A 4V3CA 4DG5A 1EIWA 1XR3A 3VR4A 2IW3A 2VRCD 4EOGA 2ET6A 4NNPA 1WLSA 4F9FA 2AD5A 4HB2A 1FQKA 4D8YA 1MGPA 3BTOA 1Q5PA 3G7SA 4EO7A 1TCUA 4B3FX 2H1IA 1TM1E 5AMXA 1LVHA 2Q4OA 1T9ZA 4IDPA 5ALQA 3FSRA 5AW2A 3PCRB 5L4LA 3OFJA 2OV4A 2X8BA 3V1YA 1OH7A 1NKVA 2WAYA 1TM7E 3GGDA 4Y3UA 2BBWA 1B76A 1XD2A 4LS3A 3PEEA 3QM1A 1JR4A 4HNQA 4PC3A 5E2BA 4ZXPA 5IK2D 3THOA 1QH1B 2OXTA 3JCZA 2QD5A 1AMOA 4M9ZA 1C9MA 3QXJA 4Y6SA 4TMTA 4DV0B 4OGFA 3QVKA 3RFCA 3IX7A 3TZ6A 7REQB 4UW9A 5EIFA 5AIBA 1GTVA 1SMKA 2R6JA 3AHEA 5TVKA 3MD9A 4I81A 5ERXA 4FNGA 1XTKA 3NYRA 1XQ6A 1MX1A 3FZGA 4QQFA 1TVKA 2VNKA 4ARZA 4PC6A 4H7IA 3KQHA 2XB2A 4ER7A 1J49A 1W25A 1GZSA 1MNAA 3H0EA 3TMYA 1QHIA 3LGXA 4DT1B 4JLOA 1AQIA 3W79A 2QW1A 2A0YA 1CXZA 3OQIA 1NZDA 4B7XA 3IVGA 4TTIA 4DILA 1FFYA 1E98A 4IJ5A 3O4JA 4C08A 1ZVMA 4MV1A 3AKCA 5CDGA 3HSYA 3HJTA 4LVCA 5AW3A 4YN3A 2OORC 1DBIA 3M6FA 1EPUA 1WP4A 3MIIA 3ICVA 1OT3A 4LJ9A 1BKYA 4XEHA 2A1UA 1IXZA 3QLVA 1HORA 1TYDE 4BVLA 3OQHA 1ADFA 1P9RA 5KOHA 4YV2A 3DCNA 1XD9A 3ORQA 4NZZA 2IV2X 1C8VB 3E9RA 4YRQA 1Y4AE 4XYLA 5AKZA 2C3YA 3IP1A 3CVWA 3G23A 2CCJA 3C43A 2FZVA 3E61A 1VKNA 3QU4A 4GOLD 4KYUA 4OATA 3RROA 3WI7A 4KU4A 1KDRA 2ZDHA 4D4GA 1Z2OX 1A2OA 4E5NA 1QOZA 3CNEA 3SZLA 3L1VA 2HF7A 3A6HA 4FCTA 1E9DA 4LJ5A 4KQIA 3RSOA 1M9NA 1DADA 2PS0A 4CL0A 4WBXC 2VHWA 4I55F 2IX9A 5E38A 1YONA 4AVYA 1RRMA 2AR9A 4DWOA 2YQ5A 3GDGA 2AC4A 2VJNA 2Y27A 1JP7A 3NWBA 1P5FA 2YXEA 4JBGA 2AG6A 3PHIA 4YQZA 2NUPB 2NU7A 2QOEA 1BVYF 2EQBA 2A57A 3TAHA 1SC6A 1U0OC 1FU8A 2BEVB 2C84A 5C1OA 1RPNA 1R9JA 5FNZA 3F3SA 1L1QA 4JGIA 4KXUA 2SICE 4DIKA 1KBQA 3DV0A 2X5KO 4DANA 5DNWA 1CVRA 1CNEA 1CRWG 1D4FA 1YMVA 3A36A 4LW8A 1J8QA 4B48A 1N77A 5CNIA 3VO1A 5CU7A 1E6LA 4IFBA 4J0QA 4WGGA 3ZJUA 2BDEA 3BWVA 3KJXA 3A2LA 3W3AD 4UFPA 5KZMB 1FYFA 3TIXB 1M0EA 2WTAA 3FI0A 3O2NA 3W9SA 1VM6A 4CKWA 1QQ6A 4DDHA 4DIBA 2FWAA 5D1NA 3I6QA 2QAJA 1Q6YA 1I2DA 2WG1A 4EUSA 1Z7EA 4W5TA 2XTNA 2XCRB 3IILA 4ZKEA 3LC7O 1JAZA 1KNQA 5TGDA 3LBNA 1CY7A 3KQLA 3QFSA 2YFYA 3BA6A 3CT4A 4KMRA 3NBQA 5CYPA 4D3FA 1XLTA 2I76A 4OLJA 2GZ3A 5ECDA 1TVMA 2ZAOA 2YJTD 4J43A 5SY4A 1R8SA 1OB5A 2CJWB 2FWBA 3DVAA 3KOMA 3M33A 1OV6A 3Q6NA 1DRVA 4NMMA 3FRHA 5TT0A 4EEXA 1E1YA 2G1AA 4Q3NA 2W5UA 3W3AH 1JECA 3NTUA 2Q07A 1NQXA 2P7HA 1MJGM 3RUAA 4OHBA 1HOXA 1QPBA 4S1VA 5B1DA 3W8FA 2UAGA 4ETIA 5IXYA 5JANA 1YNOA 4KE9A 1G3QA 2F17A 3PYLA 4AJEA 3CKKA 3UMRA 2XKKA 3P7MA 1POWA 2C54A 4HNRA 5D3MA 4NBLA 5T5QA 2PCLA 4DFDA 2AG5A 4W9RA 1UXKA 3EVDA 5EHGA 2RIRA 5JQGB 4WOJA 4WK2B 3IMEA 1M7HA 5H3CA 3PUIA 3I45A 1CUDA 2B8WA 1M5TA 2F1OA 3GHYA 4LEIA 1MC1A 2B9EA 3GFBA 3IE1A 3LL4A 1R00A 3IAS6 1XLTC 1SQSA 1T8RA 4L8YA 2BELA 2QTGA 3I37X 3JATA 3LX6A 4R2JA 4L78A 3LUHA 5D6NA 3SSMA 1STOA 2IE0A 4I2VA 4DSUA 3O8RA 2XUDA 3TG2A 1JEJA 2GJ4A 2HNKA 4XB1A 2VJCA 4DEVA 4AMZA 4Z86A 4L1KA 2YC2C 4ZAFA 1KR2A 2I4OA 2WIBA 1IVYA 1G5HA 4LJ7A 1DQPA 2WWGA 3EZNA 4RC9A 5LQNA 4DB2A 5KVAA 1IG0A 1KJYA 4QWWA 2RH8A 3LKVA 3G8BA 3CH6A 3M2PA 4WFJA 3REFA 3AI7A 3S2FA 4LVUA 5LJIA 3DQZA 4M22A 3HN2A 3PUKA 5AI9A 3WL5A 5K8CA 3HY4A 1KQGA 1ZICA 1CQIA 1TJ4A 2PMBA 3F1LA 1TM3E 5HIKA 4HFNA 3NASA 1U6IA 4DJJA 2VDNB 2HRQA 2ZBPA 2HHHB 3HDTA 1CF2O 2VJMA 3Q7IA 4D9HA 3KV3O 1DARA 1ZCZA 2EHJA 4RBNA 1UQRA 3AVUA 5K01A 1PRYA 4LVOA 3H2KA 1PT6A 3WKBA 5C81A 1UF9A 1JXMA 5JEEA 4AZ0A 3IP7A 3R7BA 4FHEA 3RUCA 1XBTA 4IDFA 2O0MA 3OKCA 3CE9A 3E1GA 2ORED 5HSGA 3GR6A 1PR3A 1UBHS 3G0IA 3VAAA 4FBMA 5IVKA 1SQ5A 3NXSA 1HUQA 5FL7A 3L0OA 5IVHA 4B33A 1Q84A 4HS9A 1WHTB 3M6XA 4S3MA 2UYHA 4Y0VA 3NKVA 1F2UB 2BEVA 1PD1A 5CVEA 3CO5A 5TRTA 1WQ3A 3H04A 1EDEA 1DEKA 1ZQ9A 1ZJYA 4XE5A 1UT8A 4BU0A 3KEOA 3E81A 1R12A 1VLQA 3PFHA 2PJUA 2WUVA 3HKBA 4BO5A 3MBIA 1X39A 5CK4A 5HRCA 4C43A 3EXIB 3P2EA 3FGZA 1RYZA 2PSSA 3FPEA 1XTRA 3L8FA 3LOUA 3OO1A 4RZXA 3I9KA 1BGWA 3VC2A 3C7KA 1T0IA 2UUOA 5A0TA 1MORA 3LUGA 2ZVJA 2XDQA 3QUBA 3PEVA 4LXHA 2WHXA 5A6SB 1GKYA 2EBFX 2XIQA 1KQOA 1IHYA 4G01B 3L5OA 3NDJA 2JCYA 3IHKA 1DB3A 3DHYA 4RIFA 3KXPA 3GNTA 1JHAA 3EG9A 3LOPA 1XZBA 3QBTA 3NIBA 5K3FA 3T3PB 5CW1A 1XRJA 2D2IA 3PQDA 3O2JA 4WGFA 2I6TA 1TW2A 2G4LA 1NXPA 3JQAA 1E8DA 1TPZA 1BCRB 1I6LA 4H4CA 5C0OE 3H6GA 1X77A 4JD5A 3I04M 3ZHUA 4IIHA 4BN4A 3I1FA 2QTTA 1D2EA 1YJBA 2GPBA 3KLOA 4TV9F 5EWJB 5CT4A 5IDYA 2ECFA 2OHIA 1XKLA 4H9GA 4OSEA 1CU1A 1XCGB 2NVUA 5CAEB 4DPLA 4UXIA 1NUPA 3OHSX 2BI8A 2DFDA 3T3EA 4B75A 5FT9A 2QUJA 4YMLA 2Z2IA 4EAQA 3GUUA 4FDVA 2WVAA 1Y1KE 3EF3A 5LZ7A 4YLEA 3RVNA 1T43A 4Z0TA 1O5OA 1WSWA 3AESB 5ESWA 3ZHCA 3AB3A 4DA0A 4RH1A 4EZEA 3FNBA 3EVGA 3EVTA 4V0ME 4J16A 2ACEA 3NM4A 3K15A 1UP7A 1RM0A 3Q85A 5EP1A 3F5FA 2XNDA 3S8EA 1UFOA 1LTKA 4W82A 2OQIA 5KVSA 2F8TA 4Q1DA 2BKVA 1K9SA 2HLDA 1NP6A 3EASA 2KW5A 3W6UA 3AX6A 4F97A 1HEUA 5A1JA 2ATVA 3GEPA 3OLZA 5KYYA 1MX5A 4D97A 2C9MA 4C4OA 2W71A 3AF2A 2AFRA 4LMAA 1EHYA 5LCXA 3TD2A 5ABPA 4MQLA 2C9CA 2OFXA 4RJJA 5GPBA 3L1HA 4BO3A 4CQMB 4MV9A 4NPCA 2IITA 1X1SA 1AK1A 3LVRE 2XUOA 3V8VA 1J56A 2I62A 2JIPA 2ZB2A 5JYCA 4U2KA 3UK6A 3LZ6A 2HNBA 5IJ9B 3IXLA 2HQ1A 1SXJC 2PEZA 2VT2A 2WB4A 3F67A 5EVCA 2QN9A 1VJ5A 3BGWA 4A2WA 5BWBA 1BIFA 3QF4A 4LGVA 1Q74A 3BTSA 1FUKA 4Q3KA 1E1MA 2ZTMA 4JOBA 1YBHA 2Q4EA 4XTRA 3FUXA 4NZOA 4MVJG 4PLTA 1C0KA 1E3SA 3FROA 3TLGB 4CKBB 5LLSA 1NMEA 4EARA 2AW5A 2QRVA 4IDNA 1L5VA 4C3OB 4ZI7F 2GBCA 1T2NA 2GHIA 2QP4A 3OPQA 1F4VA 2PIDA 4O2BA 3ES9A 2EC5A 1SBCA 1YU9A 2AYZA 2J31A 2DFVA 3GC6A 3IPXA 4FR5A 3DMPA 1IB0A 4ER0A 3KXKA 1YS1X 5JVDA 2J0EA 4Q93A 1UP4A 5BPFA 2PXCA 3T7RA 4J2TA 3C6YA 1F2UA