3FB1A

Crystal structure of purine nucleoside phosphorylase in complex with ribose-1-phosphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
281
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGKLADGVKDKITIPYTKIPNFPQTSHSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine-nucleoside phosphorylase
publication title Purine nucleoside phosphorylase from Schistosoma mansoni in complex with ribose-1-phosphate.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 90
structure length 281
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fb1A00
1B8NA 3TL6A 1V3QE 3LBAA 4DAOA 3K8QA 4OGKA 4MARA 3NM4A 3FB1A 2HSWA 3OOHA 2QDKA 4F1WA 2OC4A 3IOMA 4OEHA 3DDOA 4GKAA 5F7ZA 4KN5A 1T8SA 5IU6A 2BSXA 4H1TA 3KVYA 3D1VA 4DA0A 4F3CA 2PGAA 1G2OA 3GB9A 3EUEA 1JE1A 1VFNA 1JP7A 1LV8A 4BMYA 1V2HE 3OZDA 3OF3A 3FUCA 1Y6RA 1QE5A 4PNPA 1ZOSA 1RFGE 4TXNA 1RSZA 1OU4A 4L5CA 5CCDA 4TXLA 4WKNA 5CXSA 3KHSA 3DF9A 1Y1QA 1U1GA 3BSFA 1TGYA 2OXFA 4DABA 1OUMA 1ODKA 2P4SA 5CYFA 4JWTA 3P0EA 3BL6A 3NM6B 3ODGA 1NC3A 4EB8A 2Q7OE 2RJ3A 5EPUA 4TTJA 3FNQA 1M73E 1A9QA 4GMHA 1YRYE 5B7NA 5F7OA 4DANA 1ODJA 4BN0A 1RXUA 3FAZA 1JDVA 1A9PA 5IFKA 1ODIA 1K27A 1JE0A 1NW4A 4D8YA 2OECA 1Z36A 1PR4A 5I3CA 1B8OA 5C80A 1OVGA 3OZCA 4WKBA 1JDUA 5JPCA 4U2KA 1VHJA 4LNHA 4I2VA 3E9ZA 4OJTA 1SD2A 4NSNA 3F8WA 3UT6A 3ONVA 1Y1SA 3C74A 1Z34A 2I4TA 3UAXA 5CCEA 1T8WA 4MCHA 4OY3A 1V41E 1ODLA 2ON6A 3E9RA 4DAEA 4G41A 1JDZA 4TTIA 4YO8A 4QARA 1Z5PA 4X24A 2QSUA 3O4VA 2QTTA 3NBQA 2A0WA 5ETJA 3E0QA 1RXSA 1ZL2A 3NM5A 1RT9A 1ECPA 2XRFA 3KU4A 1PR5A 1YQUA 4DA6A 4D9HA 3MB8A 1SD1A 2A0YA 3FOWA 4DA8A 1FXUA 5F76A 4LNAA 3LA8A 3GGSA 3OPVA 3UAWA 4TXJA 1A9OA 3OZBA 1OTYA 1VMKA 1TCVA 2ISCA 1V45E 4NS1A 1PKEA 1PR0A 1PW7A 1CG6A 4TTAA 4OGLA 1WTAA 3OCCA 3IEXA 1TCUA 4LKRA 4QASA 1RXCA 4QAQA 3DJFA 1A9TA 1U1EA 1I80A 1Y1RA 1Y6QA 1VHWA 1T0UA 4IP0A 4R2WA 1Z35A 1YR3A 4R2XA 4L6IA 1T8RA 3T94A 1NC1A 3OOEA 2IQ5A 1PR1A 4QEZA 1N3IA 5CYGA 1RYZA 1A9SA 3QPBA 1K9SA 1Z37A 4TXHA 5F78A 1V48A 2HRDA 4DARA 4K6OA 1Z39A 4E1VA 3UAZA 1JDSA 4F2WA 1OV6A 3UAYA 2AC7A 4QATA 1JPVA 4TYMA 1TD1A 4BMXA 4JOSA 1TGVA 3INYA 5EFOA 1PBNA 1PWYE 4YJKA 4F3KA 4F2PA 1LVUA 2QPLA 3PNSA 1XE3A 4BMZA 4YNBA 1YQQA 3OZEA 1RR6A 1PR2A 4NY1A 4QFBA 4RJ2A 5F7XA 1PR6A 1T8YA 1K3FA 1ULAA 5B7QA 4TS9A 5EUBA 3KVRA 1LX7A 1OTXA 5FAKA 3FWPA 4FFSA 1JDTA 4JP5A 5B7PA 4TXMA 1RXYA 4P54A 4G8JA 1Z5NA 4L5YA 1RCTE 3KVVA 3DPSA 4G89A 4DA7A 1U1DA 2HN9A 1PF7E 4WKOA 4YMLA 3EMVA 3BGSA 4L5AA 5CXQA 3LGSA 2AI1A 2HWUA 3SCZA 5F73A 5F77A 1CB0A 5DK6A 4WKCA 1SJ9A 2AI2A 1Q1GA 3BJEA 3EUFA 4GLJA 1Z38A 4ECEA 3MMSA 1PK7A 4LDNA 3DP9A 3PHCA 4M1EA 5B7GA 1SQ6A 1ULBA 4D8VA 5K1ZA 4D98A 3ENZA 4GLFA 2A8YA 1Z33A 1C3XA 3K8OE 4D8XA 3PNPA 3UAVA 1Y1TA 3O6VA 4PR3A 4OF4A 1U1CA 5F7JA 2A0XA 2B94A 4L0MA 1A69A 4M7WA 1V4NA 4WKPA 3U40A 4TS3A 1Z5OA 1JYSA 1PK9A 3EEIA 3PHBE 1YBFA 1U1FA 4R31A 5KB3A 4LZWA 2GUWA 2OC9A 2QTGA 4MCIA 4UC0A 1A9RA 2AI3A 3P0FA 4M3NA 3KUKA 4EARA 2H8GA 2I8AA
chains in the Genus database with same CATH superfamily
1QAOA 3LP5A 2OPBA 1JG4A 4KIUA 4KIJA 3RTCA 5AIBA 2SBTA 4BGDA 3GA0A 2RHJA 1U28A 3MCZA 4PAQA 3D3KA 2CJWA 3URMA 2XAUA 2XMSA 1UM9B 3G82C 3N58A 2R4TA 4EG0A 1U0HC 5I8PA 2WM8A 2YJ3A 4LOJA 4WECA 4J7CA 4YAEA 3PHLA 4LVNA 4A6XA 3W3ZB 2W83A 1DPGA 3BIWA 3DEFA 8AT1A 4GVLA 4BVEA 3AZPA 3O8QB 3ZCQA 1U2DA 2WVHA 3G7UA 2AK2A 2GRAA 3B2NA 4UASA 4ERXA 1JYEA 1U80A 1W0JA 5F7ZA 4MUGA 3B7GA 5JXWA 3IJRA 2J08A 4RKEA 3T5DA 4LE0A 5F1OA 1UWCA 3IODA 4BV2A 2QUBA 3ZY4A 3U4MA 4L4ZA 1ARZA 2QTWB 4NCBA 3D1VA 1ID1A 1WY5A 3BA1A 3HBJA 1JN0A 1GGMA 4NMLA 5M2QA 1LK7A 3B1WA 1CUSA 2BEWB 4I50F 3ZVNA 2C2YA 2BTOA 2O8NA 2ODNA 5T67A 2M1ZA 3NIWA 3RHZA 2ZXUA 3UJ8A 3RBAA 3C1AA 3FWNA 3CEMA 3DE3X 3PGA1 3PX3A 3QYFA 1TVKA 2VDOB 1RBZA 3KYDB 4HB4A 1U99A 1TF2A 1QHHB 3FCOA 4N6NA 4AKSA 5JRDS 3TCNA 1B6TA 3D4BA 4FWTA 3CF0A 4DCSA 2PL9A 1UK9A 1I94B 3OJ0A 5F33A 2K6GA 3NGMA 3Q85A 3RT9A 3EA4A 1WNFA 3NYRA 4LJ5A 4NS4A 5F52A 3A6EA 1A98A 2YTZA 3W7BA 1VYUA 2JEOA 1WAMA 3L9XA 3UKDA 4QBGB 2ZRLA 1FFGA 5EHXA 4C6HA 1PT8A 3OBBA 2HMVA 3V9PA 4BZXA 4K0KB 2IU3A 4YEDA 5DCLA 2X15A 2Q7DA 1U7OA 4NU0A 1OBVA 5EHIA 2WJGA 1ELOA 1ZSVA 2PS1A 1VPLA 3GLHE 5GP1A 3SMQA 4AS2A 4QLBA 5CB6A 2BF7A 3QQ5A 4OHXA 5DI3A 4QOFA 1VSBA 3AJAA 4LOIA 2VQDA 4XM0A 4D96A 4UVDA 1SHZA 1XMQB 3ETGA 3D1LA 2DC1A 1X7WB 2J87A 2G82A 3U17A 3MWGA 5TMPA 4HS4A 4JWTA 3REOA 2D2XA 2AEJA 3M0EA 5DX0A 3VO1A 2R65A 2VUUA 2X0KA 1L4UA 3B12A 3CH4B 1L4BA 3M5DA 4O1IA 5D7BA 1SGWA 4QC2A 2HCJB 1YK0A 4BJHB 2H51A 3FNFA 2Y67A 1RRKA 4F4DA 2PM8A 3LDHA 1N34B 2ZT6A 3TW8A 2YNMA 3VGJA 1OWMA 4JB8A 1XK7A 1T29A 3SX4A 4P33A 4PS0A 3DXYA 4W5JA 3FPCA 3E3NA 2Q46A 2NU8A 4GXRA 2C7PA 1R8SA 3T9EA 2OILA 2FPGA 3L4BA 4BV8A 4DIEA 4ZK6A 4C0XA 2RD2A 2O3RA 1MO6A 3FJ1A 3QUQA 3UV6A 4B6GA 5H02A 5K8TA 4QBHA 1JR6A 3CZCA 2NO0A 2HYDA 2GDZA 3IAM6 3DMPA 2VXCA 4RZQA 2IXBA 2C5EA 2P4UA 3H0CA 2NZJA 3QI2A 4M9SA 4M83A 5FL7D 5KNBD 3F7OA 4BQNA 4KQIA 1FC0A 3B3JA 4L4YA 1MJGM 4P22A 3VFDA 2C5GA 2J32A 2W6QA 3IDOA 3TVTA 4DC1A 4YH1A 2CLOB 1DWUA 3QOXA 1L5YA 1WKCA 3DFFA 4H7EA 3O2NA 4JU8A 3EODA 3JRWA 4WADA 2R8EA 3VR5H 5A2QA 5HHTA 1PFKA 3H1GA 4UAGA 5CB0A 3FDZB 3NHFA 1E2DA 1L1RA 2AWOA 3U5ZB 1Q6YA 3AG5A 3DZKA 5EP3A 9LDTA 1YR2A 2FW0A 5BP7A 1MIOB 3C3EA 3LX6A 3MCWA 1BWPA 2DQKA 2YUTA 2DWOA 4B74A 2Q6OA 1J8QA 2J3EA 3R7WA 3W1VA 2P3OA 1H8HD 3SBOA 1F4PA 2Y1OA 1J33A 2PX3A 4LYDA 3HCWA 4DRXA 5ADHA 5JPCA 5K8LA 3JD0A 3VBEA 3SZUA 4U2KA 4ZYVA 5JROA 3GPLA 2C96A 3FTCA 4U8GA 3ZXIA 4KO1S 1J24A 2OYRA 1S5PA 4ENVA 2QRLA 5LN1A 1Z62A 4MDEA 1QMGA 2JBAB 4BNZA 2DY1A 2TYSB 3BJMA 1BNCA 2OCXA 2VHUA 3BK1A 3CISA 4XXHA 3TJRA 4POOA 4Z1MD 3BPSA 2H0RA 4BBAA 3TSOA 2I6TA 5DGIA 4GT1A 4Y2UA 1F4VA 3UPTA 5IF3A 3M2PA 1Z5GA 2AG5A 2JCBA 3NBAA 4NECA 2CB9A 4URVR 1BGVA 5CD1A 1XVAA 4M8KA 4XIIA 1D2GA 1PVOA 2WJJA 4NESA 2P2LA 2QVLA 2AW3A 3LVBA 4KPUB 4O4LA 4NG5A 4BJ5A 4EKEA 4BRWA 5CBPA 3SXJA 3DEIA 3I04A 1Q21A 3UK1A 1FDWA 2R2AA 3HG7A 5DVZA 2NLOA 2MSCB 5ARDA 2FWAA 3T54A 2X4LA 3LHDA 3KR0A 4BTEA 3WYCA 4NHEA 1O8CA 1YI8A 4MIYA 2Q0HA 4L5IA 1SR8A 4YLYA 2Z4TA 4UBOA 3FCCA 4CT5A 16PKA 1I7DA 1JBQA 1S2OA 4BVFA 1IU9A 4YO8A 4QARA 1IONA 3HMQA 1DARA 3C3AA 4QRHA 4DREA 3V32A 2ZW9A 1P61B 3WGVA 5IHPA 4ZA2A 1SKUA 1KMHB 1MO4A 1KSGA 3UTDA 4TV8F 3O2JA 3AEYA 4OFXA 4F9FA 3HB7A 3E27A 1V6AA 2WPDD 3KJZA 4HWTA 3CRQA 2OV1A 5EFZA 2VQFB 1RKVA 4W1PA 2ZAYA 3FTDA 3JASB 2Q6LA 3I9MA 2Y1DA 2IYFA 5ESXA 3OPNA 4MQEB 5LNK1 5LQKA 5EUQB 1GPBA 4DZZA 3LCUA 1NASA 1FFDA 4IJKA 3RE1A 4EBFA 1T4DA 3JQ9A 2ZZMA 1K4YA 4K9MA 4E12A 1PS0A 1RJWA 1DIBA 1G6Q1 3OMXA 3ZEAA 1VL6A 3PB3A 4EGFA 1QP8A 2OHFA 1XJ0A 4FWIB 4Q4HA 2PMFA 3C3XA 3HWWA 4JEMA 2H11A 3SZMA 4BKMA 2V7PA 1AQIA 1K3TA 3H5VA 2XZDA 3O74A 4G67A 3EE6A 4S1OA 4L08A 3DYIA 4MVXA 3LHIA 3MT9A 1J56A 2WU1A 4N9WA 4EP1A 3ETDA 1XZ8A 3MD0A 4N3NA 1W44A 2ISCA 1OU0A 1ZS9A 1C3EA 2FKAA 4JNCA 4IUBS 5K3EA 2JJ1A 2FWMX 3NC0C 4HX5A 3VR4A 5HE8A 4DRYA 1PTJA 2RGUA 3M89A 3R9XB 2WTUA 1UBHS 3B6ZA 2C9OA 4KR7A 3CLRC 1ZJ5A 4QBTA 2X1HA 3QPUA 4U6QA 1M6VB 2R1ZA 3DWEX 4WZAA 2I4MA 2WSLA 4CI9A 3NRJA 4FKMA 4O59O 2BMDA 2GBIA 4I0WB 4QXOA 3ZJ4A 2FN7A 4RANA 5TRTA 1Q92A 1SOMA 2V7QA 2OD7A 3IJ5A 3LT5A 3PRJA 3AHGA 5CX1B 4DEYA 3V3KA 4Z51A 3L7DA 4LV8B 4X6UA 4WXEA 4C88A 2IS1A 5GIPE 1KP2A 3Q6NA 4I4TF 1L5MA 2B6NA 2II6A 1R6VA 1FVXA 1TX4B 2IOFA 3MJCA 1ENOA 2XMQA 3JQ7B 3V00A 5HRCA 4QFCA 4RD3A 3NTQA 3PS9A 4UMEA 4DYVA 3AUUA 3V48A 2B7CA 2ZVQX 3HBLA 4IDOA 2CXSA 4JP2A 3UXYA 1QHFA 1CS0A 3AL0C 2BMFA 3W06A 2JB9A 1G4UR 4UCQA 1JIVA 2DFVA 3ASYA 3AU9A 1T8RA 2H8KA 3C7AA 4PGMA 4QGFA 1B76A 3N2NA 1JIQA 2JCXA 2JFPA 3A1EA 5ALKA 3UH1A 5T7BA 2RIRA 4KYIB 2BP7A 5D00A 4B73A 1U0RA 3WK9A 2V7XA 3B3QA 4S24A 3W2HA 4Q1BA 1GR1A 3BJIC 3PDIA 1FK8A 3ZXUB 4J0GA 2RE8A 1GFZA 3IOCA 3QPBA 4RF5A 1K9SA 2I54A 3DWFA 3S99A 4KXLA 3HGQA 3TLKA 3V4SA 4CL0A 1NNLA 1KWGA 2IHBA 5ALUA 3SHVA 4PN3A 1C14A 1TKAA 4IO0A 3UF0A 1V5IA 1KJ9A 2BFMA 4G97A 4BBJA 4DQKA 2J3KA 2DSNA 3H3XA 1U7PA 4Z3DA 4UCFA 1R9JA 5JDIC 3NOXA 5T57A 4LJ4A 3GAMA 3PQCA 5A5DA 1GAWA 3PFFA 2JHAA 1VSVA 1X13A 4XGIA 5A5EA 5AKYA 1OV6A 4TMXA 2ZAIA 4H4EA 5EJ2A 3T1QA 4DIOA 4DJFC 2GEKA 1MB9A 3I72A 4DHEA 3R5TA 4HDAA 5TVKA 1SB9A 3L7NA 7ADHA 3FX2A 4NOMA 3ZQ6A 5E6SA 1YA8A 3UHOA 4BMXA 3FPLA 3AFMA 5BWCA 1UXOA 1FDUA 2Y3IA 3RBXA 1VBNA 3WRYA 1FSZA 1Q0PA 3PNKA 3LKZA 5G1NA 2DAPA 3RIXA 2QU8A 1LI7A 1FEZA 3KUCA 2CVZA 2YHIB 4KGVA 3WLAA 4F91B 5L8VA 2IE0A 4NXNB 1TYBE 1SC9A 4BC0A 5A71A 1EIWA 2VC2B 3DZ8A 5REQB 3HUUA 2JF0A 3KL4A 5HDQA 5IBQA 4LKOA 1L7XA 5K6AA 2QW1A 2RHMA 4OHKA 2WQ7A 2BC9A 5E8JA 4D79A 4RGVA 2WY2D 4XGKA 1TO1E 3SP1A 2JCSA 1BEEA 1C2YA 1E5VA 2BM1A 2L17A 2R8OA 3HHEA 3MYYA 3T7RA 2BONA 4IQ8A 2CMGA 3IP7A 3M6UA 3TFQA 2PGLA 2QNIA 5FUWA 4DDWA 4TKVA 3PSHA 3W0LB 4XOIA 1Q3KA 4JBWA 5FHQA 1O5TA 3SM9A 3L1JA 4ACBA 5LQMA 1RR6A 2Q3BA 4WOCA 3NHZA 3GWGA 4NG4A 4KPYA 1RXWA 2XZTA 4ACAA 4J1QA 10MHA 4EMTA 4OP3A 3FN4A 2HJWA 1WMDA 2I65A 5EE9A 1KMCA 1HYBA 1GIAA 1OKKA 3C3KA 1MO2A 1KK0A 2NYUA 3T3GA 4UQLA 3OX1A 4NBRA 2P4EA 1SG6A 4XASA 1MT3A 2WSYB 1QKIA 3RU3A 4E5KA 1BXGB 1GDHA 4ENSA 5B3JC 1CUCA 4X8HA 1K92A 5CEFA 1BVHA 2QAGC 4KB5A 5FYQA 5M3BA 3HUDA 4YASA 1CF9A 3W3AH 1GCOA 1W47A 3LTEA 4FE7A 1RWBA 3UKJA 2VZEA 2G8NA 1J20A 1KAOA 1U0JA 4L4UA 1NU8A 4OGFA 4PRZA 1OXBB 4HGZA 5AOCA 2VJPA 2RAFA 3O7MA 4TXMA 2PYIA 2XV1A 3F1KA 5LR6A 4O8CA 5ISMA 1LV7A 2ECQA 1FTNA 4QUHA 5FOWA 1GNRA 2R00C 4ZYXA 3KAPA 3KEOA 5A4FS 1O03A 2JD2A 2OQ2A 3E82A 4YACA 5HUQA 1TIKA 4LVUA 3ZU5A 4G9GA 4CF3A 1VJTA 4CM5A 1TADA 1P2FA 1WJGA 4PLVA 5KYWA 4E4RA 4EHNA 5EY5B 1ECCA 3K32A 3TWOA 1IDN1 4AC9A 1CHDA 3C15C 3OFNA 3B3GA 5EL0A 3EIXA 1P4GA 2YYSA 1AKRA 2O07A 5EP2A 1ZAKA 3D7RA 1Z15A 3KZMA 1D4FA 4HNRA 4QL3A 4AYTA 2QTRA 4C4XA 3AW9A 5K8JB 4PSAA 2GR9A 4E22A 1XGKA 2DH6A 5FBVB 1SY7A 3VSEA 2X19A 2ZANA 1NJ2A 1RYFA 1ORWA 1XEAA 4GM4A 1QPZA 5JASA 2GUGA 5IKEA 3I5YA 1Q3HA 2VCHA 4XD7D 4GSYA 4KBGA 5LUAA 5G1OA 3INRA 2R66A 3D6VA 2P2CA 1UUFA 2CLDX 3BDAA 4LDQA 1SOUA 1IMOA 3U6KA 1KF0A 2O3UA 3GLHA 2J5XA 3K6JA 2FGJA 5E2BA 2NXNA 3STVA 2GN8A 2WHQA 1N6HA 3ANTA 1S2GA 3BH0A 2P6PA 3WTCA 1CEYA 1T0JB 4LGMA 3JWJA 2GZRA 2O06A 1EG2A 3KWJA 3NRCA 1Y89A 4AY5A 4BN5A 3GT4A 4HGPA 2XNDD 2VP4A 3DB1A 3IIEA 3IQEA 4OAPA 1Y4AE 3VUEA 2O5EA 1RM4A 1YBVA 2A8YA 3T61A 2CVOA 1Y6ZA 3AKYA 4K88A 2PD4A 4LZOA 2LVBA 5I9SA 4ASUA 1LPAB 3IKMB 1KRHA 4B6RA 3PNPA 4I1UA 2A9RA 3HJNA 4IOKA 4DBZA 3PEYA 2MOKA 1TUGA 1T1RA 5JYDA 1G3MA 1CEQA 1HE3A 4LJSA 2H1WA 5J43A 3CFYA 1JMVA 1ZCJA 3BFJA 1A69A 3KD3A 1Z2AA 1CJMA 1SBZA 2CVPA 5CAEB 4EJMA 3RRZA 5BQ3A 3FLBA 1P0FA 4I9GA 3HUTA 1PK9A 3BCRA 1GARA 3IAM1 4XI9A 2C5LA 2JHGA 3WLEA 1O97D 4UUNA 4DXHA 4TN1A 2Q21A 2BYTA 5EXXA 4YP7A 4HDKB 3OJWA 1XTPA 3CVWA 2ZRJA 2QJWA 5LQNA 5FTJA 1E1NA 3KZVA 1AQ6A 3DBRA 4RK7A 4M6WB 3WLTA 2BAGA 3FMVA 5KZMB 3R9KA 3DBHB 3WDMA 3VU9B 2EP5A 1A9RA 3T9AA 4FOSA 3P0FA 2LKCA 3WLRA 4F46A 4JGGA 4MHSA 5CHYA 3GW8A 3LW7A 1H6CA 4BFYA 2VQ3A 1EVEA 4XE5A 2QUAA 4MW4A 3CONA 4V39A 3C3CA 2ZUBA 3LQRA 4K9SA 3RR2A 2C2BA 3SIRA 3BZWA 5F9MA 1RYNA 5MN4A 3WB9A 3N0VA 1WTCA 2AJCA 2ZRFA 4LXHA 4J1SA 3DKKA 3WI7A 4JA2A 1WW2A 2MINB 3A1SA 5D5PA 3NLLA 1EH5A 4IEIA 3JS5A 1N8TA 4Q4JB 1GGNA 2HJHA 2F3RA 2F3SA 3WXMA 4D0NA 4AI6A 1W4BA 1B2LA 4RQUA 4OQNA 5DHFA 3PGKA 1OZHA 1J8MF 3QLTA 3TD6A 3COPA 4JL5A 3WL6A 4CM7A 5JZOA 1WB4A 3ORQA 3EDRA 2HSEA 2V0GA 3JQQA 1SD5A 2EGUA 2QX4A 1DZ3A 1VBFA 2B0CA 2I2AA 2WWFA 1RPAA 2QRQA 5GY7A 4JY7A 4NJEA 5HKKA 2RGRA 2Q49A 2VZLA 3NP7A 2Q3HA 4TTPA 1L8QA 2C9MA 3AEUB 3FI0A 1XTQA 1PIWA 3I64A 4G4JA 4Z4CA 5KQRA 2H1RA 1JE1A 4XEHA 1KZ7B 1V47A 3K0BA 3BMXA 2G06A 2QXTA 2A78A 3IELA 4CIVA 1BCRA 1KXZA 5FBLB 4Q4CA 1HF3A 2XE4A 4K9NA 1SB8A 3FUCA 2Y0DA 3I39X 4KXQA 2D3TA 1SA0B 1X39A 5H9WA 3OCVA 5JE8A 3H2SA 4DJEC 1T8TA 5CH3A 1PDWA 3IAFA 3UZUA 5L53A 4KRXA 4L5CA 1WVIA 3LJKA 5D01A 2FPUA 2Q4RA 3FZYA 4CR7A 2PKCA 4FR0A 1EINA 1GQQA 5JVDA 3DE1X 5ALSA 2FUNB 5KC8A 1CYEA 1KO1A 1E6CA 5F12A 4IUCS 3JQAB 2JKVA 2XCIA 2YYAA 1ST3A 3WLLA 3N8IA 1E2QA 1N3BA 2NGRA 3FNEA 3OLCX 4KQ2A 3AF3A 4ZVQA 5JMPA 3RFUA 2WWXA 1G21E 1R37A 2LTAA 3VYWA 4C4YA 1PDOA 5BN4A 2UDPA 1WD7A 3F7NA 2GFQA 2EDAA 1DRUA 1M8JA 3D3QA 4JLDA 2AG0A 5CW1A 3TSYA 1R4MB 2EWWA 1GGJA 1B3BA 4K40A 5JXJA 1U2GC 4O4JB 3UWDA 3QEKA 3L7MA 5CYFA 5CFPA 4G23A 2QMZA 3C43A 2W43A 3G17A 3M82A 1YS2X 2TMDA 2WUVA 1QAMA 3OQIB 4EW2A 1ZA2A 3KKKA 3OEHA 1OIWA 3CBGA 4GFDA 1NXXA 1XBTA 2O0KA 4M1MA 4EY6A 4AKEA 4C87A 4CDGA 5HIAA 3I2JA 4QUKA 1UT8A 3KBBA 3QLVC 2V65A 4UUQA 1MJHA 1AUXA 2ZB8A 3UQYS 2OVBA 2PVSA 2AFIB 3LBFA 3SXUB 1WU7A 3TNLA 4QDKA 3K92A 1R6DA 8ATCA 4IRUB 4RGQA 3OZSA 1JECA 2QRUA 3RVJA 4C2TA 5L95A 3T7SA 3OAAD 3RC9A 2Z6UA 4L6AA 1Z75A 2PZ8A 2PUJA 3S70A 1XEWY 3WLQA 5F7OA 1ESDA 2ATVA 3OEWA 3V42A 2H48A 1NT2A 3L82B 2Y27A 2X13A 2RK6A 3ON5A 4INOA 4FMPA 1CY1A 2ZVDA 4Q3EA 5I4BA 4RIFA 1W85A 5U1PA 3O8NA 2AGVA 3KYCA 2G36A 2R6GA 4IDPA 4MZDA 2LRHA 3ZX5A 4EI7A 4KREA 1ZXXA 1T4MA 2GJ4A 2Z3VA 3PLRA 1PJAA 3JAWB 5KOHB 5IC5A 3RH0A 1NW4A 3AHHA 3T7TA 2AVNA 2BH2A 4WBNA 3MT0A 1BXRB 1T2VA 3NH9A 3QVGB 2OECA 4FDMA 4O2BA 1PR4A 4UULA 5CLGA 1AS2A 1JLLB 1E8MA 2AFRA 2XD9A 1KVQA 2Z5GA 1FSSA 1DBQA 1RAHA 2IIBA 2IODA 2WA2A 1IBKB 1W46A 1S3GA 1TM4E 2RGEA 1G8KA 3IEKA 5IAGA 4EX6A 3QSYA 1I1QB 1U9YA 3JVIA 1XDZA 4JLWA 1ATZA 1WEHA 2YWEA 3S8YA 1LW6E 4NR0A 2XCUA 3W05A 2X3FA 1TYCA 1L5ZA 5B53A 5KYKA 3HL4A 3OECA 1HM5A 1CC1S 3ESCA 2OORA 5IN4A 5FPSA 1XRSB 3OMWA 3THWA 1P3JA 1TLFA 4RVOA 3ZZ0A 4Q82A 1QRSA 1VL0A 3DOIA 1Y1PA 3EOBI 1JZSA 1SD2A 3VSDA 1MEEA 4DLLA 1DS6A 1XKXA 2H1FA 1CRZA 5A6SA 2BFAA 4G0MA 1P9WA 2BMAA 1AK9A 2RJNA 1SHTX 4NLLA 2G25A 1DTSA 3C74A 5IHXA 1QP4A 4F71A 1ZW1A 1HFKA 1NFFA 1TJPB 3AVTA 4FEGA 1U7UA 4HAZA 4GOOD 2GO1A 3NBXX 5CD9A 1GG5A 2I34A 2KSQA 3KYBA 3OZGA 4B75A 1OH5A 2AJ8A 2MSDB 4WXYB 1YS1X 1CUZA 1HMYA 3NETA 3R20A 4RH3A 1MR3F 2CN1A 2E6KA 5CVDA 4C3VA 1D4ZA 5B57C 3CTMA 3FFAA 1M83A 2C0CA 1TIPA 2PSJA 2W2KB 3FNRA 4NYJR 2GBPA 4QTZA 5GPBA 2QY9A 3THXB 4XW2A 3E9RA 4MRVA 2O3TA 4G41A 3FAKA 4QTTB 1Q0ZA 3JQGB 3RD5A 1SKMA 4BLUA 2DR2A 3TQRA 4G1BA 1U94A 3A4IA 3SE0A 4I66A 2OZKA 4AUKA 2INGX 5HE9A 4A1FA 4TUYA 4O4IF 5H7XA 3N86A 3SXPA 1ZESA 3IPLA 3NYQA 3F73A 4G0WA 2M1XA 3UNXA 2CXHA 1K6EA 1ZL2A 1NYTA 1W2GA 2J85A 4C08A 5JFGA 1IM5A 1FLVA 3BD6A 3O47A 3NWJA 4PYKA 1TQ4A 2VCYA 3ZEIA 1QFYA 2XQVA 3BGOS 4OA5A 3HCFA 1IM8A 2QQ0A 4GZLA 3SHWA 3DFZA 4DA8A 2SICE 2BFOA 3EZ2A 3ROKA 1WXXA 4WFJA 3HQ4O 4GMKA 2JA1A 3T95A 3DD1A 4AF6A 4BPBA 1DAMA 5K9ZA 3ONDA 1C29B 3D3WA 5JMTA 2MDTA 4LNUA 3BE5A 4Q12A 3UAWA 3O90A 4A82A 4E07A 1FU7A 2Q99A 3FKSD 4OD0A 4X6XA 4MUXA 1LDYA 1MJFA 1Y37A 1ZEMA 2Q0XA 4PFKA 3W6ZA 3KX2A 1ZK0A 4QJIA 2YFHA 4N5LA 4LOKA 1QDEA 2E4ZA 3DEHA 3KAKA 4V02A 2ZM6B 1BX0A 4MEAA 2BL4A 3EIHA 1K7FB 2P9BA 4QJBA 4ZT3A 3W7VA 2JPDA 1CR4A 3FOEC 2ZDGA 3IDZA 5F5XA 3RWOA 1Z7WA 3W7AA 4EENA 1EVJA 4OXKA 1L4MA 3TNYA 1WTAA 4OG2A 3ROMA 3KLMX 1L5HA 2AUTA 3MTEA 4C78A 2C5HA 1JEEA 1JXAA 3M49A 1EVZA 4GRAA 1SC4A 1UQRA 3EGEA 1L7QA 4Y1EA 4CLRA 4KQWA 1NRXA 2XBLA 3LSYA 3WLNA 2Q6IA 5F1YA 1CQZA 4TLLB 5KJ6A 1UKBA 3FYTA 4MIOA 4OX9B 5BUCA 1EWVA 2D5BA 1Z8DA 1ZVMA 2WG1A 4P2BA 4Q34A 3MSXA 1VHWA 4R2WA 1JJVA 2ZYRA 1Z35A 3GAAA 4XIYA 3L07A 2PBFA 2IBSA 1U2TA 2XDQA 1E18A 2H1OA 1IJEA 3DT6A 2Q29A 1UXHA 2GZMA 1BRMA 1H8EA 3A10A 5FPYA 3RC3A 3VC7A 4KLAA 5A0TA 3AFHA 4R16A 1PFUA 4EH1A 3FJYA 4J0DA 4HDOB 3PGJA 1A76A 2VAPA 1PJZA 3IQZA 2IKSA 3ZDDA 2J9RA 4GWKA 3ZYZA 4FKZA 2BFDB 4G5RA 1W9HA 5F2KA 1KOJA 1VTKA 1Z37A 4TXHA 2HH9A 5FFFA 4QGGA 5DWQA 5FEMA 5MDHA 4Y6PA 2IHVA 1RHKA 1WKBA 1SZPA 2IW1A 4OI4A 2P9CA 2YUIA 5DM1A 2DJIA 2F43A 4M89A 4EATA 3O95A 3IPRA 2GB4A 2EFGA 1P4AA 1QHGA 3DQPA 3F3SA 2VTDA 3OCZA 4DQLA 5AVVA 1NW5A 1WCV1 2OHHA 6ADHA 1QIHA 4RORA 1USGA 2R8BA 4KQHA 2R1UA 2EC5A 4E5NA 1P1HA 1Z25A 3LUCA 5E4JA 4B6FA 3V8NA 1TD1A 3QVJA 1VJ0A 2Q9AA 5IVHA 1UOPA 5DNAA 1OXUA 4O2RA 5K0BA 1XMXA 4B3HA 1XXLA 2OCDA 4DW8A 1BS2A 3RNOA 5AK5A 2AOUA 1Z2PX 3JRNA 3T1NA 4F4UA 3V4RA 4MQLA 1TGVA 3HB0A 1I3KA 3HU5A 4RDIA 1HT0A 2DPHA 1PBNA 1TEVA 1AXRA 2O7NA 1PWYE 1N4AA 1A5ZA 5IPFA 2BM8A 4F2PA 1N2XA 4BNWA 2XZPA 1YKFA 2IZZA 3ZLTA 5ES4B 1T9CA 2XA1A 3GPDG 3AFOA 4ZCSA 4B3GA 5G0WA 2BRUC 2G5GX 4CKWB 1V96A 2WVAA 4P3XA 1YQXA 2VRNA 3ACDA 3BORA 1FTGA 4OIFA 4JU9A 2JGIA 1H2WA 1W52X 5E4YA 2YIMA 3WV4A 5JH7F 1F2UB 4F3YA 4DUGA 4UMFA 1V1RB 1HZZA 3WGNA 4AROA 1E20A 1GJRA 1UMBA 2CUKA 4CMJA 2J9YB 2QA5A 4J7XA 1E89A 4RJ2A 5JJLA 1YU9A 4ICIA 2QP3A 1HDOA 2HO4A 2P9ZA 2IA5A 1YF3A 5EMLA 5C8YA 1XZGA 5BW5A 5DNCA 5ITZA 4DQDA 4LXGA 4L8FA 1Q7BA 2HLHA 3KJHA 1M2JA 1ZIOA 3OPYA 3WBJA 1W581 2QOEA 2FRVA 1P7VA 4PF1A 5FFNA 4ALJA 4Y1GA 1TCCA 2XWQA 2XWBF 2FF7A 3A1CA 3ANNA 3PCTA 3PXUA 4LRUA 2DT5A 4ONEA 4PW0A 5BN1A 4BGUA 3BERA 1MTZA 2EBUA 4FFSA 3PI6A 4ZT5A 4CZ2A 4UOZA 2HRZA 2I99A 5IF9A 3T1HB 4YCSA 2RH9B 4MVJP 4TRRA 3TLJA 3WLKX 2QJFA 1RHJA 3SIWA 3TK1A 2RH8A 2H4ZA 1U2SA 4V0SA 5J2TA 4P80A 1H6AA 3HB5X 3QMPA 5G1PA 3IAUA 3OZ7A 4IG4A 2EDCA 5FULA 4B4WA 4MTLA 1G20B 4M1OA 3HS3A 2OYCA 5HF9A 5DHRA 3FPBA 5KNLA 2VK4A 4AZ0B 1KDPA 2P9HA 2HA3A 2Q1SA 2OXCA 3FRHA 3ILVA 1CQJA 3K05A 3L02A 4E09A 4BECA 1Z2NX 1RWQA 1PF7E 4XGRA 1CQIB 1BE8A 4YMLA 4K3VA 5TE9A 1POWA 5BVGA 1I4DD 4BU0A 1GY8A 4HRXA 2OHVA 2ZSAA 1QG2A 2CNKA 2GPYA 2UYGA 3E9QA 4G5SA 4IQGA 1LDNA 1S3FA 2FW1A 2OBLA 3EGXB 5TQ2A 3RVKA 5AJTA 1DKLA 2XVYA 1MZPA 3GH3A 4MWCA 1YZTA 3SC2A 4KP7A 5EKXA 1FP4B 1ZWKA 2RH5A 5EVCA 5EJ9A 1CJTC 3ANLA 3KBOA 1KETA 2GEDA 3MD9A 1Z56C 1XNHA 4HFNA 4LMRA 1XKLA 2P9JA 4XWOA 4IXMA 1IMJA 4AN4A 1RFLA 3A6ZA 2AI2A 1RC0A 5E0KB 3U9LA 2JKYA 3W9SA 5LP6A 4YCJA 1Z63A 3FZNA 4WJKB 2RGGA 1CRLA 1KXJA 4I1RA 4A0HA 4D92A 1JF8A 3PKIA 1DAEA 3SKXA 5BV8A 1PHPA 1T9HA 1Y5MA 4JBHA 4K3UA 4M1EA 3TH5A 2UZ4A 3H65A 3HPRA 3ENZA 4RX1A 4GLFA 5IM4A 2YXNA 1R9NA 5UKDA 1NI4B 1DU4A 2G1JA 1QORA 4B0OA 1HQDA 1W29A 3OETA 3GLSA 2GN6A 2ZR9A 1KZHA 4ZVMA 1ZIPA 3ROPA 1UWLA 2BUAA 2YVKA 1USVA 2ID8A 3CXUA 3IVRA 5FNVB 4MYDA 5D5HA 1OAOC 3FXAA 2H29A 1GL3A 2J3IA 3CCBA 3RI3A 4C0JA 1IQRA 4QJ5A 4KTTE 1JKJA 4Q1VA 2BF4A 3G8CA 4DIBA 4EYQA 3NYIA 3WSTA 4Y67A 3EXHB 4FYMA 4F1JA 5FV4A 5E8RA 4NCNA 1X86B 5FBHA 1LNSA 3DO8A 4DYDA 1DDOA 1LK0A 4AKTA 5EQJB 1Q0LA 1BFDA 1TAGA 3CJRA 3K2IA 5GOTA 3JPWA 2PWPA 3IP9A 4B81A 3I9V6 3RVDA 2BGWA 5C9ZA 2IUUA 3K70D 1ISSA 4BQQA 5SZHB 4F5WA 5KEIA 3AM3A 2Q1XA 4LHZA 3H42B 5L7TA 3N59A 3DDSA 4H4DA 3PXGA 2QGFA 3CGGA 3QWAA 3CX7A 1O8BA 1RHUA 4X66B 2Y0PA 4BB5A 3VR4H 4Y2HA 1EFRA 1SKQA 1UL1X 4ZOLF 1ETUA 2R68A 2C31A 5DT9A 1EX9A 1SN7A 1IPHA 4RFSA 1NBHA 1BIFA 2APJA 1H69A 4MUEA 5CHEA 3ZI0A 4RTKA 2HYIC 1E9VA 1IM2A 2H8GA 4YONB 5FLKA 2H7CA 4PPYA 1QGYA 3B51X 5A0VA 3L01A 1WHTB 4OHWA 4XX0B 3ML1A 4G0OA 1ZI6A 2HRRA 5ELXA 3RT7A 4I55A 5HM8A 4Q4AA 1TK3A 3LUPA 3UJDA 1M6YA 2DT8A 4UBIA 4F93B 1U0TA 2P77A 3ZQKA 3I32A 3PUKA 4C6TA 3UMJA 4KSCA 2FLWA 4UFNA 4BVKA 4W5QA 4XGNA 1D5CA 3LTNC 2YZGA 4FP9A 4LY0A 1UAYA 1OBOA 4LCBA 4MZXA 3P52A 4X1IB 4EI2A 2N3ZA 1KC1A 3GEBA 4B4OA 2WNSA 4E3WA 3E61A 2VJDA 4N0QA 2A92A 3WGUA 5DV9A 1E2LA 1KKLA 1H5QA 3BGIA 2FEPA 3EIEA 3GPIA 1ZGZA 1N77A 3STYA 3TTUA 1J06A 3HVIA 1FFXA 3QUBA 4L28A 3KJNA 1XALA 1HETA 4XUGB 5DYNA 2O3JA 2PZFA 3RJZA 1E2HA 3ZXXA 3I52A 5ICGA 4BMCA 3ETNA 3HCDA 1KZ1A 4GYYA 5SY9A 2CF6A 1EXNA 4OYHA 4FILA 4QBKA 4PR0A 4PSDA 1E0SA 3K1ZA 2WHPA 2Z8YM 2IS4A 5DB4A 2VPIA 3GD7A 3L6CA 1ESMA 4O4HB 8ADHA 5K09A 4EX7A 4RTNA 1EJBA 3QXSA 4R40A 2VH2A 4CLOA 2OCGA 4KQ1A 3V55A 3EQ2A 4TM8A 5DTJA 5A4KA 1T43A 1N5LA 2C9CA 2NSHA 2ZIGA 1ZPDA 2ZITA 2M6KA 2XQFA 2H9IA 3L46A 5B6IA 2XSZA 4KHZA 2ZYWX 4JLAA 3UMMA 2ZGVA 4URWR 4C1BA 4HYEA 3DCIA 3H5OA 4TKMA 2CCJA 3DKIA 4PCLA 1YDGA 3IFSA 4LHWA 1NP7A 4Z0TA 1OUMA 2VBGA 1LK5A 4OLBA 4QGSA 3OOSA 2GARA 4YUYA 1RP1A 5DHAA 2EJVA 1ICIA 5EJIA 1A8IA 3H2ZA 2MSKA 2DY0A 1GPH1 2CNNA 1EA5A 1RKUA 2WEKA 3KB8A 2GJAA 5T41A 5LMNB 1U2QA 3DT8A 4A7PA 4CIAA 1P5ZB 2Q5QA 4IR7A 2MSWA 3CZ4A 2YV5A 3DZIA 3I34X 4ABYA 5DISB 2HGZA 2QX9A 1S2NA 1HG1A 1GU0A 1PJTA 2CW5A 2REBA 3C7KA 3GEPA 4IJQA 4MIKA 1L7BA 4QECA 1JEQB 2NVUB 1I51A 2VQEB 3TIFA 1AD2A 2VDRB 3FNQA 4A8JB 5AXAA 4MQFB 5AIAA 4ZDJA 1WXFA 4BX3A 5DGDA 2G0NA 1JDBB 3WMEA 3BHIA 5IFLA 4A23A 2PUFA 3OSZA 1SVUA 5C0OE 2FP4B 4QFMA 4TN5A 4MVJA 4Q9AA 3H1TA 3IXMA 5DMXA 5AWFC 3IO3A 3Q98A 1U02A 1RWXA 4QULA 4MV6A 4R05A 5GOZA 1VCOA 2J7KA 4W1QA 4I81A 3VH3A 1Z0FA 4AJJA 1Q5PA 5DU2A 5CFNA 1E9BA 1HORA 1EK2A 1ZN2A 5BN5B 1JEYA 4MKZA 3W77A 1GZSA 3B78A 4KIGA 1IY8A 4NFYA 4A5OA 4AZSA 3ZHSA 1CSEE 1UR5A 2AMJA 1QU3A 4WOJA 3NNSA 2ATCA 4CMIA 4EUFA 1GCGA 2D74A 3E1SA 3FFWA 4GPD1 3X0DA 2YQ5A 4EMBA 2KPOA 3HKEA 3QJ5A 3CU5A 4HJXA 4BGEA 4YDHB 3T0IA 3T5GA 1U31A 2LBPA 4LA4A 2J3JA 1B8PA 1YQEA 2CZCA 3K31A 4CG0A 5LXTB 2O8EB 1QVZA 4ARZA 1YU6A 1KH1A 4FYXA 4CF5A 3D31A 5C80A 1TU4A 4DL9A 2N75A 3JRXA 2OHXA 2FEWB 2IWHA 2I67A 3TQOA 1IBMB 1TO2E 2OCBA 3AR4A 3AH8A 3EF3A 3TUJC 4ZARA 3UTCA 2CBXA 4X85A 3IQIX 1PG0A 2VF5X 4Q19A 3ZK8A 2FXIA 5AW3A 4PBSA 2FX2A 3NTVA 4JNKA 3ETEA 2BFEA 4GNKA 1IC6A 4U7FA 1KEWA 1NHWA 3F96A 2Z58A 2VYNA 1W76A 3N39C 1TTHA 3LF1A 4I50A 4RF4A 3E22B 1BH6A 2G1PA 4N5HX 1V6SA 4MAFA 5CNJA 4ZC1A 1Y4SA 5A4JA 5INTA 4D0RA 1M8FA 4DR3B 1B26A 1JA1A 2ARKA 2ES4A 3K0HA 4UHBA 3MOSA 1LJ8A 4B3TB 2HREA 2BIFA 4U7HA 1K4MA 4MEJA 1BYUA 3I0NA 1LA2A 2A4MA 3C85A 3Q12A 3KUXA 2ZYAA 4Q9DA 3H16A 2UYOA 1LSUA 1NVMB 2FFBA 2YC2C 2XMBA 4LX8A 1TJ4A 4EHLA 4FW8A 5TMDA 5IK2A 5IJ0A 2ZDQA 4EJ2A 5MN5A 3GOQA 3W79A 4YAIA 5JWRA 1XPUA 1X14A 2HRQA 2WIAA 2Z1NA 1T8WA 4DLSA 3K9WA 1T0PA 1WMSA 4W4TA 3PQ5A 1V7ZA 3VZSA 4NAUA 3UMCA 5F3WB 5AW0A 3PKZA 4NRDA 3AJRA 3T7EA 3ZDYB 2H1IA 3FNBA 2WJZB 1NFQA 4Y18A 2O8BA 5K8IA 5CA0F 5G53C 4EYSA 2BV3A 1W1UA 2ZYVX 1D2CA 1E3QA 1ZYUA 2QXYA 1WS6A 4G4SO 4X1KA 5ESDA 3IEUA 3L4SO 4KXWA 3B1YA 5CTJA 3VU0A 4BAGA 4CRWB 4DLXA 5AJHA 3DLHA 2AFHA 3E0QA 2ZATA 3BMCA 2FXVA 2J3HA 4CEJA 4X3CA 4GO1A 2H59A 4LW8A 2OB2A 4S0XA 3W8RA 2F9MA 1NJFA 2Q3EA 3SWWA 1QZZA 4GPTA 4R8MA 1FIUA 1P4JA 4ER7A 2NP7A 2DECA 2JK1A 1DC6A 2EW1A 2HNAA 4C3OB 3LQ2A 4DVGA 3U5TA 3Q3EA 5JTTA 1Z17A 3Q9NA 4REQB 5GM2A 3GFQA 5FUMA 1PEDA 1SOWA 2EBHX 2J3DA 1FMTA 3C16C 2AXPA 3EQ9A 2Z4SA 3PJEA 2OHOA 3HU1A 5L51A 1D6JA 5AVRA 4TZ6A 3AQ4A 3MPUA 3TX2A 3E70C 3L49A 3O1JC 3OZBA 4YO7A 2Q2WA 2VIIA 3MUOA 1DRKA 2XHZA 3ICWA 4E4TA 1K5GA 3LVFO 5TSDA 4KR6A 3O8CA 4RTSA 1GFSA 3WP0A 1MVNA 3HVKA 1TC1A 2BJVA 1XTJA 3C6YA 1HT1E 1NDUA 4DM3A 4ZI2A 4TSRA 3OHSX 1EI9A 4B8ZA 5I8WA 5C51B 1Y6FA 5HBGA 3T35A 3UKOA 3EF0A 2XD4A 4HYTA 3AY7A 1VPVA 2H92A 4AP6A 3OE4A 4OGLA 1KY4A 3DQZA 1U8CB 3VU1A 3A58B 1P2BA 4ND8A 4YJ2B 5D51S 5FL3A 1E8NA 3GX1A 1CCWA 3U4AA 1FP7A 2AZXA 2PNFA 2QRNA 4KIWA 4RC9A 3RUEA 1LY1A 2OGZA 4QU0A 2BPOA 2E82A 4B7CA 2PWZA 4C7OA 2IFTA 4KV9A 4ZAGA 4MAAA 1NKTA 1RAAA 4QLOA 5CVUA 3QTTA 4WUVA 3EGDA 2QD4A 2HGSA 1WIWA 2YWDA 3H9QA 2JD1A 4QSMA 2JLWA 1DJOA 2XVXA 3MS4A 4A9AA 3FNGA 5E1OA 5EGSA 1LJLA 3LRTA 2H4WA 5ALTA 5GTDA 1T10A 4KN8A 4LBYA 2ZB2A 3F1LA 1X3LA 1G7RA 2A7XA 4ESOA 1JT9A 1KYTA 3FFTA 1HBJA 2EKPA 4IV0A 1RPZA 2FZ4A 1A2OA 2A7QA 2GBFA 1O58A 3QHQA 2X4IA 3QIVA 4OQDA 1IHPA 5LBTA 1KQFA 2W5UA 3WIUA 1NUTA 5JAPA 2JLYA 4FNGA 3V5NA 4AWXA 1A9SA 4F04A 3R5XA 3LT1A 2MCFA 5EMKA 2O57A 2F90A 3OTGA 5EIAA 1LKZA 3VR6A 1GAEO 1RTTA 3DHNA 5DGXA 3UJ6A 4TLAA 4Q47A 4CDNA 3LI2A 4K6OA 3RIGA 3GLFB 3VV2A 3HA5A 3A4VA 1G9XA 2O2IA 2FUG1 4N5NA 2ETXA 5HX7A 1DAHA 3QY9A 3KQOA 2PZBA 1ZMXA 5EEGA 1FQJA 4IS2A 1JHYA 4MICA 1XLVA 2HD4A 4G86A 4L50A 4RK5A 4KX5A 3OOYA 4TV8A 2R6HA 2V7EA 3CZ5A 4H7FA 2WSMA 1EXWA 4OXYA 1BDIA 5BSVA 1ULUA 3WL7A 5HM6A 1XNRB 3G9ZA 2C00A 3IBGA 4WNYA 1HUQA 1BXZA 4IGAA 4YIKA 3AHEA 3ZZNA 5IANA 2GF0A 3CUUA 4EFLA 3A2MA 2ENWA 3M1AA 5GZ1A 4OFBA 3G02A 1VA5A 3IILA 2FHSA 3FF1A 1SPXA 1VLZA 1NN0A 3EEYA 5ALOA 4B7AA 3N76A 3ZKAA 2WHXA 1CUFA 3A0UA 1QLWA 1U3WA 4R9UC 1FJ2A 1U9CA 1KY5A 3E4CA 4IDHA 3HJTA 4BN4A 4RTJA 2GBCA 3KDPA 4ZQEA 1HNXB 4B45A 2OCYC 1YBMA 5DXFA 2QPLA 3KOUA 3UICA 3NDBB 2Z9CA 3GG2A 1MW9X 1M0WA 3U4HA 1E2MA 3EGIA 3YASA 3BH6A 3E5RA 1Q7CA 2P7IA 3VKUA 3LWDA 5JZBA 1N9GB 2L82A 1KR2A 4M9QA 1JSLA 1XMJA 3V80A 3PNLA 1CB7A 5KSWB 5T6MA 2REOA 4YPFA 4IQFA 4EM6A 4OREX 1E0AA 3C1UA 1KAEA 1TZBA 4OIMA 3BWBA 4QU5A 1TZJA 3SQXA 1KJIA 4M22A 3RCBA 5FQOA 1JQ3A 1V37A 1W88B 1LPPA 2P9FA 3GFFA 1KJQA 4NTZA 4PQGA 3TUIC 3J80A 3A2LA 1JSXA 3N2YA 1VMIA 2D5LA 4AZTA 4ENPA 1JFLA 2BFPA 4OQZA 1CY8A 2OBBA 1YDFA 2GXQA 2Q3MA 5BMVB 1O0BA 1RZ3A 2MWMA 4D4HA 1RJDA 2RHWA 3PLNA 5CLFA 5BURA 1DC5A 2CNDA 2CLKB 2FX5A 1ZQ1A 2WKPA 3KKOA 3PPIA 4QIHA 3WSVA 4I4TA 4LEIA 2W8ZA 4QICA 1CHNA 3GJQA 4Y8VA 1C3JA 3UWSA 3JWIA 2CNWD 3EIFA 2Q4BA 1NLZA 3C39A 4HZIA 4WFQA 4WZBB 4EKYA 3SZGA 3MRXA 5DSZA 2XPCA 3PHIA 1YS4A 2I4LA 3F9IA 4HN9A 4B35A 4CKEA 3DKRA 4YJGA 4A16A 1NHGA 4H59A 4TLEA 4F2GA 2K2QB 4RVSA 1WV1A 2AD5A 2ZTUA 3WISA 4P9NA 2WPNA 4K9PA 1TEXA 4MP8A 4QBFA 4AMVA 5JSZA 1BDHA 1GNSA 1I2DA 2F00A 5EA2A 4ETMA 1Q1EA 3MZ0A 1ZBDA 3GRVA 3IV7A 5A1TA 1KVTA 3GNLA 5KYXB 1QCZA 3HL0A 3C3BA 3V8EA 1EP1B 1SHUX 4QPPA 3G2MA 2YN4A 2A35A 3QZUA 1TZCA 4IQ4A 3HB9A 4IIGA 1VCNA 4MJ3A 4ZALA 3WA6A 5JCJD 1ZGGA 1XDWA 1UPUA 3H6KA 1NXVA 1L7EA 1IQ0A 2IEIA 3LQ1A 2JD0A 5B1DA 1DRJA 3U7GA 1TKCA 3DL7A 1QBKC 2DBQA 3EEQA 3G8DA 3HKCB 1TM1E 3NORA 2QE6A 4GOJA 4J2OA 4P35A 3B60A 3QFTA 2FMHA 5SYNA 4KQ6A 2BR5A 4EKDA 3GLTA 1Q44A 1EFDN 2WOOA 3V1YA 5K0ZA 3DM9B 3LT0A 3M33A 4OB7A 2FUCA 1XQ9A 4G1FA 4X1OA 1TZMA 1KBQA 1NVWQ 1O87A 4XR9A 1Q1GA 3N2GB 2J0UA 1TLTA 2GVNA 3UHPA 4EFNA 4ISBA 4DR6B 4U5QA 1DV2A 2YDXA 2R7NA 2ZR8A 3OQ1A 1E3WA 4FMCF 3QF4A 3V7FA 4CDRA 4ECEA 3EVZA 1MF7A 1LDBA 4TL9A 5DM0A 6GPBA 5B7GA 3HU3A 4P7JA 2R5WA 2B5OA 2QT1A 3BG5A 1N8NA 1JWAB 4FEYA 1OZGA 2ZIEA 1EQUA 1YHNA 4XCQA 2OFPA 3S7TA 5KOJB 2A9QA 3NBZC 1A7KA 4DOMA 4NBVA 4RAOA 3FFBA 1KP3A 3PNYA 3IA7A 3P7MA 3K8OE 1JFVA 3CUEF 5KNCD 1NZFA 5KX5B 4DR2B 2G8LA 1UEXC 4MS4A 1SKBA 1Y3HA 1MRSA 2ZE7A 3MQ4A 3U62A 1IZZA 1C3OA 3X43A 3X44A 2WTEA 3GRRA 4YRNA 4WOKA 1YA6A 2BKVA 3JWGA 1GM5A 3N8DA 3G6KA 4UE2A 2W00A 4FHDA 1QF9A 4HP8A 3VHRA 4BNTA 3MERA 1TT5B 2NV0A 1X7YB 4KUGA 4MW0A 3E9EA 2NXWA 4H2DA 5BQPA 3KXIA 1YR8A 3ZKWA 4CETA 3E18A 2PQMA 3DMYA 4RYDA 3NOOA 3I23A 3UB4A 1NBEA 4W1RA 4DMHA 3RM3A 4C07A 3FPKA 1F60A 3KG2A 4ZGWA 4X7PA 1JILA 4GPBA 3ME5A 3EJ6A 3R6DA 5EWJA 5KREA 2C99A 4F4IA 1V11B 2KBEA 3IA2A 4F56A 3EF1A 1N2ZA 2XHEA 4PLCA 1XNGA 5ERYA 4B17A 3GLIA 1W5EA 3K2BA 2QAIA 2BEVA 4PG6A 3H4IA 5ENDA 3ZWDA 3AVWA 2ZWPA 4MV1A 2QRKA 3L1VA 2J3QA 1U8TA 3QMVA 3EZ9A 1HE5A 1KAHA 1Z8NA 1YFZA 3E35A 3U26A 3TPCA 2NZYA 1N33B 1NW3A 9ABPA 4M9XA 5B3JA 1G8MA 2NAFA 2RIPA 2WIKA 3GP3A 2QAGA 3LL7A 4DMUB 4IIXA 4PYLA 1BDJA 4JITA 1GRQA 2ACKA 4M38A 3SF8B 1PUJA 2JFNA 3QFRA 3ONEA 1T5SA 3SYKA 1NMXA 1NM5C 4AJKA 1ZD3A 1S96A 3DC2A 3AU8A 4QA9A 5CX4A 4AN0A 1F14A 1MU0A 2JJ2A 2DUMA 3GN2A 2R00A 1AXEA 1F8FA 1SKYB 3E3LA 2AR9A 4J43A 2P67A 4KFTA 1T3ZA 1GWNA 1F2DA 1PJLA 3EIOA 3PJGA 3CRW1 4L16A 3PJFA 3KQUA 1REQB 2VLIA 1OPRA 5IJXA 1JIIA 4C7VA 2H4JA 4MKIA 1QK3A 2HM7A 1G5HA 4YAOA 4ZMBA 1VPDA 3UAOA 3DBLA 3RJ5A 1E1MA 4ZO9A 4XQEA 3ESBA 3ZGVA 3T7JA 3TOSA 3OJOA 3JX9A 4B2LA 2HY7A 1O7JA 2JGLA 2A84A 2Q3JA 2QZZA 3C8HA 4R81A 1UPXA 1VCHA 1XQYA 3FJOA 3I30X 4ZZ0A 3SX0A 3COZA 3CRVA 2Z0MA 1G18A 3AR3A 3DFKA 1ZG3A 2GA9A 3ENNA 3IERA 4QVKA 5T4FA 4BMYA 4BHTA 1U2PA 1LW7A 2SECE 4RV5A 5HCUA 4D3SA 1J21A 4K2HA 7GPBA 4HYYA 3SJ7A 4N3CA 1Y6RA 4MPDA 2P90A 3PFIA 1XL0A 3NXKA 4ZHSA 1ZR4A 3TLGB 3ZW8A 1OU4A 1JDJA 3NBUA 3AB7A 1NYQA 1VZ3A 4UVEA 4WCFB 3IVMA 2WV7A 5LDDC 3UJNA 4O33A 1OXXK 3EOAI 2X42A 5J40A 4DMGA 1ZMBA 3L6RA 5G0SA 1O96A 5E1DA 2YQZA 4ER6A 2Q5OA 1ZRSA 4KIFA 4X95A 1AOXA 3FKJA 1ZJJA 4F60A 2XRMA 5DHPA 4H35A 2ZBDA 1QRRA 1KZ4A 2GAOA 3PVSA 4CQNA 1AUPA 1V1MB 2HMTA 3IAXA 2KI5A 2WM2A 3E9NA 2D4HA 1LDMA 4G5FA 4M49A 4Q05A 2EQAA 2HA5A 4LWQA 4QPJC 3FSGD 2WWVD 5ALJA 1NVVQ 3BBLA 5DBFA 1NQXA 3LE8A 1J9GA 1VJCA 2QTMA 4UHJA 1MA0A 3L8CA 5D5QA 4PHGA 4OJMX 4XWYA 3ANYB 4M60A 3P9PA 3TJZA 4KYTA 3NHAA 2HCTA 3R7SA 2F4VB 1N9ZA 2IY8A 4BZWA 4IZHA 4N5MA 3LPDA 3ZWMA 1N0IA 3RFTA 2AJBA 3OTOB 1V16A 2JGNA 3G49A 4IIJB 4W6ZA 3QP9A 5CDTA 2WF6A 3BMNA 4I6GA 4YCAA 5CLLA 1G64A 4N12A 2ZUWA 5HBRA 5JZ9A 2O1XA 1Y5IA 4LE1A 3A4YA 1QH1A 2B4KA 2CVFA 3GT0A 3MJ4A 4FSDA 4QM6A 2PZAA 1THMA 1OILA 3OIDA 3F4KA 2F4NA 2X8BA 4GC9A 1KI9A 2VJLA 1YVEI 2E4XA 1BROA 1UFQA 2GK6A 1X92A 2ZZKA 5AOBA 3ETCA 1UWKA 1IEWA 2GM5A 1JDVA 1GA6A 1JG1A 3HNRA 3M8KA 3UA4A 3AESA 1UDWA 1USIA 1A9PA 1DKMA 2VPWA 4FU0A 4RCVA 3E48A 5F51A 5CB8A 5DBGA 1N2CB 3ZK9A 4BMNA 1ODIA 1YRBA 5EWMA 4LDRA 1ZJ6A 3QJGA 4HWKA 4JP8A 2VBFA 4D8YA 2I6XA 3KD2A 1RKQA 3D2CA 1PSWA 1ZD9A 5LSAA 2VYVA 4RF2A 3UMBA 4EG6A 2O8VA 5I7EA 3H18A 1CZNA 3NDPA 5LQDA 4OI0A 1EBUA 3R40A 2J48A 3LVRE 5TEWA 1OZFA 2IU4A 6CHYA 2GVZC 3LFTA 4EYGA 2O7SA 3TD9A 2ZBUA 4CR8A 3IXLA 5PNTA 1NUSA 2R7AA 3G0DA 2L2QA 4QVGA 5HTOA 4TQUS 2WNHA 4RKQA 3ZIAD 2QTLA 2ZB3A 4BOYA 1KH2A 4KGDA 5H81A 3WJ7A 4H16A 3PR3A 5E38A 4RLSA 5IDWA 1P6QA 2XT0A 3M4YA 4GEKA 4NJMA 2XGMA 4N82A 4FFBA 1T5BA 4OMUA 2P5YA 1C4KA 4JB0A 3G9QA 2WMOB 3OQHA 1GP2A 1I4LD 2KJQA 4RSGA 1GTMA 3EVEA 3AL3A 3EVTA 3MTJA 2JDID 1QDUA 4IBOA 3EISA 1XMIA 2Z2KA 4GKKB 1L9KA 1ORIA 2IOQA 2NZUG 2O20A 3K53A 1KC3A 5FWAA 1T0HB 3NASA 2OP0A 1NGSA 2OZPA 1YR7A 4TMWA 2BZGA 3UWPA 1KMIY 4P5PA 4R8SA 1QRUA 4OMFG 1RLOA 2Q5EA 2OOSA 1PZGA 1L3BA 2VOJA 5FO0A 5FTWA 3L8DA 4HZUB 1I4EB 4TMKA 3ZHRA 2OV6A 2P9GA 3R8FA 2FSVC 3CW2A 2JZNA 3DVAB 5I3ZA 4KMOA 2WFLB 2XWPA 4XWAA 1Z5PA 3M3HA 1BE0A 1N8SA 2UVPA 2FZGA 3U7RA 1E3EA 2RHGB 5K03A 1NTOA 4AX4A 4KDRA 2YXDA 4P0PB 3B8HA 1JALA 1RRGA 5LZ5A 4DDKA 1NVDA 3NBQA 1DTWA 3QNMA 2A0WA 3E1GA 4U2DA 3TZ6A 1N36B 1JXMA 2QTVA 2WHEA 3OEEA 3OTIA 4EYKA 1XAHA 5AHOA 1K0UA 1WF6A 4NJOA 5BQ5A 2PV0A 3NR2A 5AVWA 2CUZA 2WLTA 3D9QX 1G8HA 3GC6A 1U2GA 1RT9A 3W5IA 2CNOA 1Z12A 2HF9A 2YL2A 1DC7A 3F9CA 4P6VF 2C4VA 3UYLA 2VO1A 3VPXA 4KL8S 1M34B 4NZPA 3IVGA 1EG7A 3KV1A 1WPGA 2RGDA 3MWDA 4V0QA 2NM0A 3CLTD 3FOWA 5HJ2A 3CKYA 1BG6A 5K8UA 1I3MA 5F76A 5IEJA 3JQAD 3QLVA 2V9ZA 4H4CA 4LNAA 3IUJA 4KPEC 3T9CA 3CO0S 3OZAA 4MYHA 1U3UA 3GQBA 1ZM4A 2PEYA 4K9LA 4LS3A 5KSOA 1W5TA 3A6KA 3MJSA 4HX2A 4IS3A 1BOFA 3JAKB 2WMNB 4N7RA 5HQ3B 3BRQA 2IZ5A 3UMFA 1FUEA 1E6MA 1VL2A 4FK8A 4BWVA 2EJBA 2AOTB 1H2RS 3HM2A 4MR7B 5EIFA 3REQB 4KI0A 3CLUC 1J7JA 2PMWB 4KE7A 3RLFA 1G3RA 3F9RA 1QWOA 3A6GA 3COSA 1T4CA 1M6EX 4HAXA 2P62A 1JJFA 2FA9A 3EVCA 3LWBA 4KO4S 5D1HA 2FPRA 1XLWA 3MMNA 4H1VA 4IJVA 5K0LA 2D1QA 2WU8A 4DZTA 4CTOA 4ATNA 5C53B 2O8FA 2GSWA 3TTYA 3D2AA 1I14A 4OJQA 3BKXA 1TL7C 3DTTA 4N54A 3DTVA 2O6LA 1UBEA 2AX3A 2QKYA 1AC5A 1H0RA 4UDXX 1YONA 3T7IA 1RDFA 3VNBA 1ILEA 3Q7RA 4OXNA 4FQ8A 4TWBA 1X1QA 4IDEA 2SKEA 4D6PA 4Y7DA 4XFKA 3DVRX 2JW5A 3NCTA 4CM4B 3MQ2A 4GHWA 4OGGA 1VE9A 2COKA 3I6IA 5P8WA 2JIZA 1QVAA 4A15A 2HR1A 4R98A 2IELA 4EYOA 3V8BA 2JFUA 5KWEA 2OAP1 4OM8A 2ADFA 1WPQA 3MB5A 1SEPA 1E9DA 2X6QA 3MQFA 4PGAA 3PUJA 3WGIA 4Z0PA 4JIGA 2QRMA 1L5OA 2QRGA 5DPMA 3ROEA 2JG3A 1D6MA 2X0JA 3BS4A 4Y6SA 4DIFA 4DLAA 5LZ4A 1CS4C 4OATA 1DP4A 5FBRB 4CL3A 5L6LB 3RF6A 2W48A 3FRIA 4PC1A 3FHTA 5EG5A 1A82A 2IHNA 1FTSA 5BOSB 1DJQA 1LVHA 2WAOA 2HT1A 1N6PA 3NXSA 1L4LA 1T2NA 3RC2A 1MFZA 3JZAA 2QAJA 2G77B 4COOA 4JB2A 1N1EA 4P4LA 1XTIA 4AJ4A 4QNMA 3ZDFA 4MHTA 1SQ0A 1MAAA 3LSTA 4ZVTA 3RYIA 4WA8A 1QB8A 4Z7JA 4BGVA 2IV7A 2JLCA 3R1IA 2R62A 1OI2A 3LXXA 1HQYE 1CUYA 1KZGB 4O6VA 4DQUA 5HJ7A 1DXYA 4XSGA 5DBHX 1XVVA 4DLYA 2QD1A 3DO5A 4EUKA 4E2XA 1W93A 5ECGC 3HY4A 3TQQA 3DE2X 1H4VB 1SCUA 1QIKA 1F3OA 2IYPA 4O4IA 4TZ0A 3OT5A 2PX8A 4M9UA 3IAS1 5MGBA 2V8OA 4C7BA 3U44A 4LK2A 3IR6A 1F12A 1QQ7A 2IXFA 2K4MA 3H0KA 1J8DA 3FVTA 4FCTA 5ILGA 2XECA 5CK5A 4BXOA 2C8VA 3MJHA 1AE1A 3FBGA 4ROSA 1U8EA 4RE5A 2YOGA 3RB8A 2WAMA 5HKAA 2COEA 3GAFA 3HFJA 3EUAA 1KMNA 1AZWA 1VC2A 2NU9A 2YW2A 3AF1A 3NNNA 4HWSA 4MYUA 3VZCA 2B0JA 2Y2VA 3U7JA 1XK6A 3CNHA 3RRFA 1NVFA 7REQB 4HB3A 4J0JA 5F2NA 1C8BA 1NSFA 2V6JA 1YDWA 2ANBA 3ZW9A 1GN9A 3S6JA 3RBZA 1FFYA 2C83A 3OIFA 4XDGA 2OQIA 4DBLE 3MTGA 2Z2JA 3AKEA 3FY4A 3FUTA 4DLKA 2V6IA 3RYFB 3A7DA 1A88A 1X7XB 4MVJH 1DLJA 4N3BA 7MDHA 2PG3A 5LZ7A 2UUPA 1FDSA 2CFSA 5CT6A 5DSTA 3M3DA 3WY9A 2LCIA 2O2ZA 4ZO6A 3WOHA 4BVJA 1XMSA 5G4LA 1YULA 4FZRA 1SBTA 5DZSA 1JR2A 5C1OA 1EAMA 2PGIA 4GZ6A 3SZ3A 4WNCA 4L9AA 3PC3A 2JI8A 1LLDA 1M5RA 1ZOOA 3CGWA 2WICA 3ESRA 4MKGA 1Y6GA 5B7QA 1CRQA 3Q40A 4Q1FA 3TZCA 4M86A 2EJUA 1QX3A 2I2CA 4U39A 1GD1O 3F97A 5G3ZA 1LX7A 3ZV6A 3PTZA 4OL9A 5B2ZA 1NULA 3I0ZA 2NO4A 1XDGA 3MSCA 4MULA 2QM0A 3RAPR 5AJWA 1QRDA 1XI2A 3H19A 3ESQA 3CNQS 5FI3A 4C4SA 4CCWA 4LQDA 4MIEA 5T5QA 1K97A 3SFZA 1RYDA 4E5SA 2AR7A 3FI9A 4EEZA 5BT8A 4ZT6A 2QTAA 4X8MA 2HUNA 1G98A 2C84A 1V7CA 2VSXA 1HOXA 4RK0A 4NMXB 3TTSA 1YS7A 3WZMA 3PK0A 4IH9A 2NUTB 2ZBEA 4JELA 2BHSA 1J7KA 5EHNA 1NLMA 1B0AA 4RBNA 3KWMA 4OK3A 5AQEA 3VUFA 1XXHE 4C21A 1D2NA 1K3UB 3JTMA 3ONNA 2FVYA 4PCUA 4ER5A 2PFKA 1H2HA 1QR2A 2HL6A 4RLQA 3S2IA 3S0JA 2AXQA 2JRLA 5E2AA 2IHJA 1SG9A 2IH5A 4N7BA 2QMQA 5EZYF 1LH0A 1CK4A 2GD6A 5TPZD 5B4UA 1G66A 1O4VA 3QK7A 2EJTA 2AI1A 1QAQA 5I7AA 2GN0A 3S68A 4A3SA 4BLRA 4IIVA 2E2WA 3WO1A 2V9CA 3ZGZA 3U81A 4A1OA 1VQ1A 2ZQYA 1P7CA 4NE2A 4TVKA 1X0VA 4G5GA 5CH8A 1VE6A 3QJYA 5CGQB 4IDCA 5IT5A 1T9BA 4YHHB 1CB0A 3D6HA 4LC0A 2HUPA 3H4VA 5I51A 3LKVA 3SNKA 1RMQA 2CXOA 2VTBB 1NUHA 1EK0A 5FPPA 4U0KA 3EUFA 3K9NA 1KMMA 2OWEA 3OSUA 1OLSA 2DG2A 4YDSA 3QLEA 1EP2B 1MV8A 5FQNA 1BWQA 3G8YA 4YIHA 3ETLA 1ULBA 1W94A 2JFFA 3HCCA 4N47A 4D98A 4Q66C 1HX7A 2VSNA 3DV2A 1CRPA 5EUMA 3T9BA 3TFOA 3CC8A 2GSDA 3WK6A 3HU2A 5D85A 2AA3A 4JROA 3V8MA 1X8XA 4FGWA 3U3RA 1W19A 1I4OA 5KU7A 3F3YA 3NHMA 1CUAA 2PLWA 4IWNA 4B4VA 1P3Y1 4CBVA 4EHBA 4M1WA 1YXMA 4FGUA 4BX0A 4IMPA 2BI4A 1TUEA 2OHIA 2NZ2A 4HADA 5TC4A 1KHHA 1ZIXA 3GI1A 5A3SA 4A03A 2ZPAA 3PXDA 5BRJA 2MMGA 1J2RA 3F3KA 3QOYA 3RVRA 1Z4KA 5JH7A 2XCTB 4D8WA 3OBIA 3O8LA 3RRBA 1XMVA 4U7PB 3ERCA 1HMPA 4G5HA 2BRUA 1QG6A 4JR2A 1UMCB 3ZY6A 1N6KA 4KYUA 4BEBA 3GLGE 1U1FA 5KTKA 2RB4A 2UXDB 1P75A 2J5BA 5AH0A 4ZVOA 3BMQA 4MO9A 4WGGA 2ONYA 5DLYA 5AHKA 2BBTA 2PQ2A 1NQ5A 3NUGA 3IJPA 4RK6A 3DV0A 5E95A 3TKYA 2IH2A 5I7OA 2Q6TA 3P0HA 4JLJA 3H13A 1MENA 2QG6A 3JQRA 2VT7A 3LLCA 3Q0EA 3KB2A 4AZ3B 1T25A 2I8AA 3VNSA 5KYTA 3N2IA 5HIIA 5JPIA 2IXEA 3OTQA 2P2SA 1A97A 4HH3C 2XT6A 4BX2A 1S6YA 4KHPB 3L40A 3L1IA 2I62A 2JIDA 2CFOA 4O0MA 4DF3A 2RBGA 2H9AA 4XKJA 1A1VA 2XUOA 1GZ6A 4Q01A 1Y33E 2RGYA 1MTOA 4X61A 4EB6A 3WAKA 1AKYA 3IUPA 4TSFA 1R6UA 5LYJF 1Z16A 1PNOA 5B3AA 2XXAB 2XKAA 5AXCA 4B34A 1Z6PA 1BXKA 5KC9A 1X8KA 2WB4A 3BF8A 4EY7A 5ALGA 2VZ0A 5IAKA 1CVLA 4CM1A 4P0TA 2B1GA 1FSGA 2H08A 4CPDA 3NHRA 5JY6A 4NMHA 1XQ1A 4FIZA 3E0XA 1ZMTA 4C4RA 2XAAA 1MJ5A 3H2JA 3MCTA 4YJHB 3EAFA 5KWSA 2B98A 1YUMA 1N6IA 1PFGA 1ZH2A 4I99A 5IZCC 1E9FA 1E99A 4HS9A 3RFXA 2PA0A 5K05A 1RLTA 1XPOA 1XCOA 1EVLA 4A6PA 1ZJWA 1WUKS 4EPRA 3HKBA 3MJTA 4MPJA 2A1UA 2OLEA 3OCYA 1YZYA 5DNUA 2MSEB 2UXCB 1QJCA 3VR6H 2HHAA 1TVKB 4EHDA 3AOEC 1ADCA 4MVYA 4EI8A 4INJA 1DG9A 1B16A 3QXJA 2ERYA 3T5TA 4DM7A 1D0VA 4K8OA 5CW2A 1UZLA 5ELMA 1U04A 4HDQB 1I1OA 3WNQA 3D0KA 2ZE8A 3C2QA 1JMYA 5CM9C 3NW9A 1C0EA 1BTOA 4B87A 4C03A 1JVSA 1ABEA 1JQDA 4JJ4A 5IAOA 4DUYB 1MGOA 4DV5B 3AVXA 3KTAA 3D7NA 1XU4A 3DH0A 2CWDA 2NO9A 3IPAA 4OU4A 4XTRA 2FMTA 4CMHA 2YZ7A 1K5HA 1K7SN 3HC7A 4H9GA 1PRYA 4W9NC 4WXRA 3BSFA 3ST7A 1W4CA 3IB3A 1JGTA 1JHMA 3VJLA 1JSRA 3NBYC 2XUPA 4E5YA 3TQTA 4JT2A 1JIUA 2HLDA 5HIJA 4G01B 1C1XA 1L5GB 1HYGA 2A9VA 2PMCA 3GBVA 4BC1A 4FT2A 1SVLA 2HW8A 3W5DA 3IHTA 5DI3B 3ZGOA 2R1TA 3I5UA 1YFKA 4KWTA 1OAOA 4ZRDA 3T52A 3CLTC 3ZHUA 5E6UA 2FR8C 4H15A 3WIDA 1NJ6A 4CG3A 5C34B 3UB3A 2V5AA 1MHPA 5EWLA 1BHJA 1R9MA 3FHOA 4P3OA 3DGFC 4BCDA 1KJNA 1XDDA 4O2LA 1E0KA 2XE6A 1J90A 4WTOA 2B4AA 3VYVA 5DDIP 1W0KA 4NPHA 1I7SB 4RK4A 4EW3A 4UBNA 3IKTA 5LWQA 3TW8B 1CZKA 1HDRA 3LCCA 1E5DA 2XA9A 3A1TA 4WSOA 4ZOLA 2P8SA 3KUUA 3L8FA 1PEYA 2WMYA 3OIYA 4L2IA 1P44A 4C2BA 1SZCA 4D9EA 5BWOA 1NAHA 1BW9A 2FPGB 1UKAA 3BE6A 2X9NA 3O4HA 3Q6MA 3TINA 3ZVRA 4O4JF 2AIRA 3UJ7A 3CLSC 3KFLA 2EV9A 1NNI1 5F4ZA 2J0EA 2YASA 1F0KA 1S4MA 4ITVA 4ZVLA 1RVV1 2B92A 3GUYA 3SOZA 1AQUA 4KU4A 4QQRA 4FKBA 3S81A 1PX0A 1QM5A 2X86A 4JN6B 3O82A 3TNFA 4X93A 4EUEA 4MYCA 1Y8ZA 1JW9B 2F62A 3CQ9A 4PIMA 4MKRA 4AP5A 4EQZA 3CRMA 4CLDA 1RIFA 1E79A 1ZKDA 2DPYA 4H18A 4UW9A 4DUZB 3AY6A 1SHJA 4K46A 4RIEA 5K3BA 3HVRA 5FR2A 3I4CA 4J0KA 1BZYA 1Z73A 2E5WA 2QS9A 3I9LA 3IQFA 5E7MA 3AO0B 4AZVA 4DRXB 1FTQA 1E2PA 3IUQA 5FWXA 5JTUA 1YCGA 4MVJI 1BMDA 1QDLB 3PFNA 1N5KA 1ZW6A 2GASA 2WWHA 4F4HA 2AZ4A 4I2VA 2FKNA 1ADJA 1G4AE 3HP7A 4K1XA 2GAAA 1UOQA 4UU7A 4YK7A 4H6WA 5A5FA 1XNJA 5HK8A 4C7MA 1EJ0A 4ZFNA 3CSSA 2PRSA 4MP6A 5BR4A 5EJ8A 1H23A 4IV5A 3K1JA 3D2BA 4TT3D 1LBIA 4D57A 2GNOA 3ONVA 3IEMA 5D3MB 1A8QA 2VH1A 3QV2A 1J2JA 1OHHD 4ZI5A 3PC2A 5A7HA 4N6GA 3ROXA 3UEOA 4B5LA 1I3LA 3N5KA 3IALA 5JSQA 2X8AA 5IJZA 1E7YA 3UGKA 2NXJA 2CK3A 2D54A 1VOTA 4I8XA 3AMVA 4DDVA 5CBPB 3COJA 5K99A 2RDMA 4LSMA 3QTBA 4ID9A 4KC0A 4EELA 3A25A 3TDKA 4IM7A 4JMPA 3RQIA 1ST2A 4BO7A 1IYZA 2ZI9A 2B34A 1NY5A 1QH8A 3RAGA 1C7JA 3CZQA 2F1JA 4KK3A 4KMRA 4DY6A 3D4OA 3QE9Y 1E1YA 1LPNA 4U00A 1YI1A 2QSUA 1DUIA 2GD0A 3I8OA 4QDTA 1ZFNA 1ZUNA 1I5RA 4XDHA 3FFXA 3BX1A 4KXYA 1LZLA 2X8JA 4XCXA 1TQ6A 5HPYB 3Q1LA 1XIVA 3BIOA 4IFEA 1O77A 3NYWA 1XF1A 2PYZA 3S3TA 4TVSA 3WRVA 4RDXA 4ZTZB 3K0KA 3KU4A 1JLMA 1OPXA 1YA4A 3OZIA 4D9CA 1I3CA 3H3JA 3ZE0B 4JFRA 4D45A 4II3A 3A26A 2WJPA 3U7FB 1GV1A 1F3LA 1FYXA 1JR3E 2GMWA 3VZRA 3PRKE 3W6PA 3PD7A 2C95A 1LPSA 5HVNA 2D06A 4EZIA 4BNDB 3ZTYA 5THKA 1GITA 4J2TA 4IIHA 3S29A 3ZJTA 2PH3A 1SCKA 1UMDA 5AP9A 5G2OA 2QT9A 3GARA 1NIJA 4UPDA 1KSFX 4Q4HB 2BR4A 1L1EA 1T1SA 1XU9A 4RM2A 3NGLA 3P2IA 4MUMA 4TMYA 1FDOA 2AL7A 3RSOA 4M1YA 2O6HA 2SCUB 4LMAA 3WKBA 4I2NA 1BKSB 5IH3A 4ALIA 5F1PA 4DCOA 1YGYA 4N48A 3R5HA 4L4RA 4YV0A 3DEZA 1JDPA 4BLTA 4ZO8A 5FNZA 3EC7A 3CT6A 2R0QC 4IDQA 3BH7A 2IKQA 3GYGA 4JX9A 4Q1CA 1E1DA 4W7IA 4UFPA 1R5JA 2LNDA 1PW5A 1MAHA 1XXHA 3GT7A 1JTVA 1OBHA 1ZX1A 3IPCA 1L6IA 2HBYA 1AX9A 3ZDQA 4Z49A 2PUBA 2CFIA 2W2LD 4F3TA 2ZWMA 1Y3AA 2FF5A 2OGUA 2F8MA 2JFQA 2IV3A 3OX4A 1JLHA 2OZEA 4EQ6A 5I9LA 2JLRA 1PSZA 4ZODA 3I92A 4QAQA 4X1YA 4Q39A 5TF4A 3QKRA 2I91A 4F6CA 1NF2A 2YFQA 1LQUA 1Z4NA 4FLMA 4AQDA 4D43A 1IVYA 1YO6A 2BUBA 4BMSA 2XH8A 4UBKA 4BEWA 3E81A 1BKYA 1IOWA 2WT8A 3G0IA 2O23A 1OFHA 3GAZA 4XB1A 1SVNA 5DHQA 1IJKA 4RGBA 2J9XB 4Z3KA 5C8VA 4DTCA 1CS0B 3N3BC 2IIVA 3TYXA 1B00A 1FS5A 3IS3A 3GNQA 2QUZA 2TSYB 4JLKA 5KOIA 2FVXA 2QE7A 4A6EA 4EPYA 1VBMA 1EKXA 2VP2A 1T8UA 4XJTA 5G4KA 4ZCQA 2XYQA 2BP7B 4EECA 1XD9A 2C07A 5AW6A 2FG5A 1M5TA 3EXEA 3GELA 3ER8A 2P5TB 4I8IA 2DHCA 2XMDA 4EGJA 2VPXA 4DXDA 2HV9A 1ZRHA 1P74A 4PFSA 5JYCA 3H11B 1GPDG 5AI5A 1PWHA 2QX7A 3RUFA 1DDGA 2DPXA 3PVZA 4BDSA 2J0QA 4W9MC 5TARA 1C0IA 1CUBA 1OI7A 3Q3GE 5EPEA 3UWOA 4GXQA 1MP0A 5CA0A 1X1CA 2AQHA 2C61A 4RW0A 2A0UA 3OE7D 2OO5C 4CKCA 2CV1A 3GUUA 1Z6YA 3F6RA 3O4JA 3PD0A 4B3BA 1GVNB 1Y3IA 3NC4A 3WTBA 1ZM3A 3F67A 5A4MS 1G5TA 5B1YA 5GJBA 2IJGX 3EHEA 3DNPA 2AN3A 2OY0A 3BQMB 5TT0A 1JL3A 1T5IA 1ZO8A 4P4NA 3QMWA 1E96A 4QAJA 1TXGA 4RLHA 4F5DA 2ZT8A 5EYPA 3EZGA 1FFBA 1XLUA 5AR1A 1ORRA 3C1OA 2VRCA 1JB9A 1MAUA 1RJFA 4IDAA 3H1EA 1XV5A 3ED1A 2X5OA 3BULA 4HB2A 3SSOA 5BQFA 3GLGA 2P3QA 2WK1A 3BEDA 4FBMA 1IB6A 1P8AA 4GPZA 4MJ7A 1P0MA 1SO8A 1X87A 3VNVA 5FTLA 4ZV7A 1CF2O 4NPAA 2GTHA 2OESA 1NXTA 4IMRA 5B4VA 3N53A 3HO1A 4C3ZA 5DLEA 2VHQA 1VMDA 4WESA 1U3CA 1LPBB 3U4QB 3P8ZA 1JHUA 1OF1A 2HCFA 2ALJA 1NQAO 1SHLA 1VI2A 4MUNA 4ZPXA 1GSHA 5LFAA 1YQQA 3OZEA 3A1WA 2G6TA 5A3QA 3VR3A 3IOBA 4RFVA 3VYUB 3W6NA 5LP1A 2PGNA 4FM9A 1T8YA 2FV8A 2X5NA 3GFVA 4YAJA 5EIXA 1EP3B 9MHTA 2GF2A 3RSLA 1O94C 1AB5A 4HFRA 1GADO 1UBMS 1UPTA 3HYNA 3AGQA 1YJBA 2ZUDA 2D13A 3FOAA 1LUAA 3CA8A 3LY7A 4J3FA 4LJ9A 1JHXA 2YMQA 2ENUA 3TMYA 3I2FA 4PVCA 3NHLA 1SUCA 4UU0A 4C6SA 3PEUA 3JWPA 2HBQA 2CD9A 2PDAA 3OP4A 1L5RA 4WNIA 4QT4A 4ITUA 3ZDAA 4MUFA 4EI9A 2PTGA 3BDVA 1AK1A 1PQPA 1R0SA 1XHLA 1Z13A 4GPEA 4QYTA 4QEKA 3GFPA 2HMSA 1IRIA 3L7OA 1IY9A 1KJJA 3NIDB 4XPZA 2VKTA 4BRUA 1GLGA 2GEVA 2ORIA 2ZSDA 3LXRA 3H5IA 3QKUA 1WM1A 2GNAA 3EMVA 1QV9A 4P7KA 3ZJVA 3UMVA 1R27A 2C4NA 2QQGA 3P2EA 1WBDA 1EFKA 1P19A 3LGSA 1JAZA 3MRVA 4I1YA 1HDIA 4QDOA 5JO0A 3DE4X 1YZFA 2QQ5A 3ZCPA 4KO2S 1NKSA 1O3YA 5BV2P 4JYAB 2WSSA 1P73A 1P60A 3OT1A 4NVRA 3ZE2B 2C7QA 3FOCA 1Y82A 2R4UA 3NBKA 5G0TA 3KFVA 2EX0A 2V3CC 2O3SA 1E3DA 2DBVO 1DSSG 2MMCA 3EYWA 3GXBA 4RKRA 1Z9BA 3VM6A 5L3QB 5C31A 1W36C 1P81A 1WUIS 3BZUA 4WW0A 5A5VA 3K3PA 2P69A 4FX2A 1JB1A 4JQOA 4FPXA 2IU0A 5L7WA 3DOEA 3GLHB 2O5CA 1Z8HA 5BXYA 2X41A 1XLTC 1NAIA 3ZUPA 1UEJA 1PK7A 1IWOA 3JQEA 5HKBA 1KI6B 1SUDA 4K6HA 5ALLA 5CIYA 1G16A 3L0PA 4D8VA 2IZ6A 4Y9SA 4MRSA 5K1ZA 3C3JA 2GD2A 1ZXBA 2QUKA 4KFUA 3JCZA 3HM9A 4JV5B 1S8AA 1TM2A 1NVTA 1QMPA 1QYVA 2C4TA 3RG2A 3R76A 4ESHA 1NQUA 1FW6A 3R5JA 1W5SA 4MRNA 4HSEA 5IDVA 3HLYA 4QPCA 4UKDA 2YY5A 4QE3A 8OHMA 1ULTA 3GCZA 4PR3A 4MJLA 2ODBA 4YJFA 1E1RA 3BBPA 1G9TA 1EHYA 2A0XA 3ZHYA 2CCKA 2XGGA 2YINC 1ORVA 2P2DA 3OCXA 3QELB 2WUEA 1JAYA 1CNMA 1V4NA 4URYR 3ZU2A 1RBMA 5BUQA 3B9BA 5KTNA 5H8WA 3CT4A 5JS7A 1GPLA 4UM9D 1HE2A 2AW5A 2H52A 3ECAA 2OWDA 1DXHA 3OKFA 4JGIA 5DTQA 4AF7A 4EVQA 4KQXA 3SF0A 5FWYA 1D03A 3KAQA 3K1AB 1YE8A 3GBSA 3H87A 4GS5A 4F7WA 1YBFA 1VKNA 3AETA 2PXXA 2J6HA 1DLIA 4Q02A 1T2AA 4P8RA 4D99A 2ID4A 3LX4A 5DEOA 1WDMA 1OAAA 3EIUA 2YFKA 4M8IA 2CT8A 4KRFA 3TVDA 3DBRB 3NVAA 1TKBA 2GD1O 4DGQA 1G5RA 2X22A 3GGCA 4TS4A