3WI7A

Crystal structure of the novel haloalkane dehalogenase data from agrobacterium tumefaciens c58
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
291
structure length
291
Chain Sequence
PHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 106
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wi7A00
3JYHA 6YASA 4HAIA 5HF8A 3VDXA 4UUQA 4BP8A 4C4ZA 2WFZA 1A7UA 2OAEA 1CUXA 4MEBA 4GWLA 5AK6A 1XLWA 2HU8A 3R3UA 4H7IA 1ZD5A 4CG3A 4Q82A 3UUEA 1YA8A 4DSZA 4X6XA 3F96A 2EDCA 5ALGA 3D59A 1EDDA 2QMQA 4FMPA 3D2BA 1SOMA 1GPNA 3G0DA 3K2IA 4KAFA 4BVLA 2B61A 4CIAA 2GYWA 4EY5A 4YX9A 3FSGA 4M0MA 4O08A 1DTEA 2HA5A 3BDIA 5EHZA 4H35A 2I03A 1XZAA 5EHQA 5JD6A 1Y37A 2WFMA 3I2IA 2NW6A 3STUA 4ITVA 4A16A 4QWWA 2G63A 3KXPA 2GBCA 4ZXFA 1EDEA 3YASA 4M0EA 3QM1A 1A8QA 4B9EA 3OURA 1WCYA 1J2EA 2ZSHA 4UFNA 2WTMA 4Y2RA 1YS2X 4F5ZA 1L7AA 2FX5A 4ZI5A 5JZSA 4BVJA 1JT2A 3HI4A 1NU6A 1ZIYA 3F8SA 4X3CA 1CUEA 5ALWA 4Y7DA 3AINA 5JAHA 3LIIA 5I8PA 2DHEA 2I78A 4CCWA 3HACA 2XUFA 5AP9A 4D9JA 4KYVA 1MAHA 3N0TA 3STYA 2AJDA 5BWCA 4E11A 2G5TA 3I2KA 2XDWA 4YK7A 4WJLA 5E4YA 1FSSA 1XQVA 2XMGA 5HZGA 5DYWA 4BZZA 2QM0A 1CUVA 1HKHA 3RLIA 5AKKA 4QLOA 4OB8A 4OPMA 3EQ9A 5I9IA 2W22A 3X3HA 1CRLA 2YYSA 3F98A 3IB3A 1UFOA 2D5LA 3G0IA 3STTA 1BE0A 2IIVA 1H23A 3KDAA 1UKAA 1YCDA 2XMQA 1B41A 4IH9A 4EHBA 1DT5A 3ESAA 3SC2A 5LZ2A 5A2GA 5AIBA 3FYUB 4B6GA 3P2MA 5HF6A 5AO9A 2BGNA 2VAVA 3VJKA 5KWJA 2WIJA 5E4TA 3FCYA 2RHTA 5ALSA 3C6XA 4XWGA 1EK2A 1CUFA 1WB4A 5LKRA 3MGAA 3IBTA 1TCCA 1XKLA 3EF3A 1R3DA 3EIOA 4WY5A 1E8DA 1VKHA 1HDEA 3RARA 5A7HA 1MTZA 4UBNA 5AOCA 4NVRA 4UBKA 1AKNA 1XRRA 1P0IA 3C43A 1C7JA 2WUDA 4WDRA 4KAJA 1E89A 2BGRA 2VEOA 4H7DA 2Z3ZA 5ALOA 4DNOA 4YASA 4BE9A 2QKYA 1XROA 3WZLA 4EY4A 2XUGA 4DGQA 1SC9A 4BRZA 2HFKA 2UZ0A 4BVKA 2VJBA 3WK5A 3O4IA 4ARAA 3CN7A 1XRQA 5LKAA 5DNUA 4QDTA 1XZFA 5A7FA 1YSCA 1MNQA 4BP9A 3PUIA 3B12A 4IHAA 1K4YA 3G9UA 1JKMA 3A2NA 3VVMA 2DQZA 2HDWA 3HSSA 4EY7A 1CQZA 3WJ1A 4X91A 4RPCA 3W04A 2OCGA 1IVYA 2AJCA 2AXEA 2ECFA 3VJMA 2JGJA 4DNFA 4B85A 1CUGA 2WKWA 3IURA 4BAGA 5K3DA 3TGLA 2XUOA 4QDZA 4WCVA 5EHNA 4CCYB 1WOMA 3BIXA 4OCZA 3VKFA 2XUAA 5DJ5A 2PKYX 1DWPA 2PSDA 3HC7A 5DYYA 1AMNA 2QJRA 4BAUA 2WM2A 4PV7A 4HXGA 4G4GA 3VJLA 4Q05A 4CG1A 4Y2VA 1ZD2P 5K3CA 1H2ZA 3ZLVA 2ROQA 1EX9A 3C6BA 4KAAA 1R9NA 4J0JA 1QJ4A 1BEZA 1JJBA 3C6ZA 3K9BA 4BAZA 1DU4A 4DNQA 4J0IA 4AO6A 2Y1KA 3M81A 4NS4A 4C88A 1Q0RA 4OYYA 3A2MA 3R3XA 3AIOA 3WIBA 3WA6A 5C8ZA 4UBJA 2EDAA 4FOLA 2VJCA 3ILSA 4UHFA 1VXRA 1AZWA 3O95A 5KWIA 4UHBA 5AKLA 2O7RA 1EA5A 4DNPA 2HA6A 3WA7A 2XMZA 4TGLA 4G8CA 5A6VA 3G8YA 1AQLA 2I3ZA 1LPAB 3BJRA 1ZOIA 1VLQA 5T4BA 4C01A 2PBLA 2ZJ6A 1CUIA 2X76A 1XKTA 4LIPD 5EIEA 3O9VA 1T4MA 3G02A 1R88A 2O7VA 1N8SA 2HA2A 1CR6A 3DOHA 4UBLA 1R1DA 4OSEA 3H2HA 4H7HA 1IZ7A 1VXOA 5CH3A 5EIAA 3BXPA 3IUQA 4OB6A 2Z3WA 2ORYA 2XUHA 2JEYA 1PFQA 4ZRDA 1ZICA 1CUAA 4J0DA 2WJ4A 3PICA 1QIEA 1LPOA 3JWEA 4W9RA 3F9CA 1JJIA 3RKSA 4J7AA 3R3WA 4WDQA 3FVTA 2RAUA 5ALJA 3KD2A 1CPYA 5AKEA 4P9NA 1MPXA 3AIKA 4TVKA 1UK6A 2IX9A 4B0OA 3AZQA 4RGYA 3CCBA 1I6WA 1QIKA 5D3KA 1W52X 1O6GA 4EB0A 2QXUA 4Y2JA 2JF0A 3OM8A 1LPNA 1HL7A 5FP0A 3DKKA 1CUHA 2QTBA 4L0CA 3DJYA 4X97A 1W1IA 1EVQA 2ACKA 2BUCA 2I3DA 2ZYRA 4KACA 5JATA 4BATA 3HEAA 5FKJA 3RM3A 3DL7A 3E3AA 2WSLA 1THTA 4H7EA 1ETHA 4K5QA 4W1SA 4XVCA 4F0JA 2V97A 4CCYA 5ALVA 4B83A 2OQIA 4ZWNA 4BBZA 2JGFA 1CUWA 3PF9A 1L7QA 5ALNA 5FUMA 5K3EA 3HZOA 1JU3A 3WKEA 1AURA 1TAHA 3I6ZA 1TRHA 4GHWA 4QLAA 5AM3A 3U0VA 3O4HA 1BS9A 2OGSA 1XRLA 1MAAA 1XLVA 5IKXA 2GBGA 1JJFA 2W6CX 4FLFA 2V96A 3AUKA 5AK4A 3C5WP 4I4CA 2OAGA 4JEIA 5CT8A 4DMFA 1UT6A 5AKYA 3V1LA 1QIGA 1B6GA 1QO9A 1VA4A 5D3ZA 4KRXA 5CTAA 1N5MA 1ISPA 4N8SA 4PNZA 4FBLA 1AX9A 4OU4A 2H7XA 4FFWA 5AK5A 3A70A 3WL5A 1QIHA 1LBSA 3OG9A 5DTJA 1H2XA 3IA2A 4QWMA 5ALPA 2HM7A 1XRMA 2PU7A 3PUHA 2WU3A 5CW2A 1LGYA 2DHCA 1DX4A 1XRPA 1SCKA 4L9AA 2OGTA 4KRYA 5LZ9A 5E2IA 4EBBA 1TCAA 1Q83A 3BJMA 4X00A 1VE6A 5AM2A 4U2DA 3IUJA 1LPMA 2WU4A 2WFLB 2ZJ7A 2J3QA 3STXA 5IVKA 3WIOA 3QMVA 4M0FA 1QFMA 3GUUA 1LBTA 4BB0A 1UZAA 4V2IA 1XZJA 5KBYA 3I1YA 2WIKA 4DIUA 3PF8A 3R3VA 5AM1A 3WL7A 3WKDA 5LLSA 1GPLA 2OLEA 5EIHA 3WWDA 1R4ZA 1WHSA 5T4HA 5FXMA 4FLEA 3GA7A 2VJDA 3O0DA 4OYLA 4QDUA 4DMCA 3BWXA 3AJAA 4AN1A 4QZVA 1Y7IA 3DQZA 2HIHA 1XZIA 2HADA 2X8BA 5AK3A 1YR2A 4WFJA 5JZ9A 4E14A 4UPDA 4X93A 4AMYA 2OCLA 3FOBA 2WIDA 3H1BA 4W1PA 2BAGA 4DM7A 4H7JA 1SCQA 3WKBA 4OUKX 4X71A 1XQXA 4S0XA 1DQYA 1MX9A 1FFBA 2XUDA 2CEKA 4G9EA 2XE4A 1IUPA 4G8BA 4MWTA 2OCIA 1F0PA 3FNBA 4ARBA 1H2WA 5AI6A 1N5RA 1CV2A 3D3NA 3DCNA 1C4XA 3D4LA 2BCEA 1XZLA 1GKLA 3V48A 1D07A 2JGIA 3OTQA 1LPBB 3CN9A 4UBIA 2VAXA 4DLNA 3QVMA 5BV7A 4FFVA 3QPDA 4Q3KA 5BWBA 3DD5A 1EINA 2C0QA 4GBGA 4P92A 3ZPXA 4K6GA 2H7CA 4QDOA 1AGYA 2J4CA 4B82A 3O4GA 3Q8WA 1CFJA 2D0DA 5ESRA 3RK4A 1C7IA 1QOZA 3WK4A 3BF7A 5D6OA 3PDCA 2Z8ZA 2ONCA 4DYHA 4U2CA 3DKRA 3KSRA 2WJ3A 5BOVA 3ZLUA 2XQIA 1K8QA 5JAOA 5FOQA 4ROTA 2GYVA 2O2GA 3H2IA 4X92A 5DNWA 4OB7A 2CJPA 3STWA 1CUUA 3IIIA 1E5TA 3WWOA 2WUFA 4EY6A 1EH5A 5K5EA 4UBOA 5AI4A 5AKXA 3R40A 1P0QA 1E8NA 4FWBA 1XQWA 5AKIA 4X90A 3ICVA 3O4JA 5YASA 1EDBA 2HU5A 1KU6A 1G4HA 1DX6A 3QBJA 5AM0A 3D5EA 1XZHA 4BTLA 4KE9A 5A71A 1TQHA 5SYMA 2OG1A 2FJ0A 3I6MA 3FLEA 4Y2SA 4BTVA 3LCRA 4DTCA 3VVLA 2VATA 5CURA 1FJ2A 2WFLA 1WB6A 4X7BA 1U8EA 2CMFA 1SCIA 3W06A 3AILA 5AIAA 1NX9A 3QPAA 5ALLA 2VSQA 4AQDA 2Y2UA 5LZ8A 2XUQA 3ANTA 4AXBA 1K63A 5ALIA 1UK8A 4MXDA 4F21A 1YASA 3HYSA 5D7BA 3O9MA 3AZPA 2VT7A 4PF1A 5SYNA 1IMJA 5CT6A 1WPRA 1EXWA 2WG2A 1UXOA 1M33A 4N5IX 5H3HA 2HFJA 5AI9A 4JH0A 4XX1A 1X2EA 4HRYA 2JGKA 3IUNA 1THGA 2FUKA 4UHDA 3D2AA 4DMHA 3WWEA 3C5VA 1WM1A 3G9ZA 2LIPA 3C8HA 2IITA 2K2QB 2PX6A 4BDSA 1VZ2A 1XZBA 1GZ7A 2JEZA 4RE6A 7YASA 1EHYA 4Y2TA 2XMSA 5AM5A 5AM4A 2XT0A 3WQHA 1XFDA 3I28A 3DS8A 4JUIA 4MJ3A 2J4FA 3WKCA 4HTAA 4B84A 2XQJA 2AJ8A 4MQLA 5HQ3B 1K6EA 3WZMA 2AJLI 1JMYA 1CUJA 1ZI9A 4INZA 4ETWA 2WTNA 3I6YA 5IVIA 4IQ4A 2RI6A 4L3WA 3ZWQA 4U2BA 3OOSA 3DYVA 2YXPX 3FCXA 1XLUA 3NWOA 3GROA 5K3FB 5EGNA 1MJ5A 3V1MA 3FYUA 5HF9A 4JYMA 4W63A 4OU5A 1G42A 2R8BA 5ALKA 1GKKA 4QE3A 2XMCA 1QLWA 4RE5A 3JW8A 4GDMA 1XQYA 4Y9SA 2E3JA 4ZV9A 1CUZA 2PPLA 5ALZA 2V9ZA 3HLKA 1E66A 2QUAA 1UKCA 5AKGA 2B4KA 5CT4A 4Z49A 2H1IA 4P08A 4TPKA 4C89A 1BCRA 4AO8A 2JGMA 3H18A 4Q1VA 2JGLA 5CH8A 3GBSA 3G9XA 4KEAA 4B0PA 3V1KA 2HA4A 3I1IA 1UOPA 2XQFA 4J03A 4FKBA 5C81A 3G0CA 2O2HA 1CUDA 3NUZA 3I2FA 3NGMA 3U1TA 2Z8XA 2WUGA 5DNVA 3QH4A 1QIFA 1CIJA 5CRIA 4C4YA 4MYSA 1IZ8A 2P8SA 1QIMA 2RONA 3DDUA 4PQEA 4XIIA 2O2IA 3FLAA 3QZUA 2C5FA 3C6YA 3UUFA 4BCCA 1QO7A 2HA7A 2HA3A 5HF5A 3T4UA 2QOEA 5CT9A 4LKOA 2WUEA 3H1AA 4EZIA 3IVMA 1H22A 2VTVA 3R3YA 2RHWA 3M83A 2WIGA 4XJVA 5AH0A 5CXXA 2VJAA 4FNGA 1JI3A 1QE3A 2QXTA 3IULA 3H0CA 4PSUA 4WY8A 3ED1A 3V1NA 2JGEA 1HLGA 4BRSA 2Y2VA 1ZJ4A 2OQVA 2DHDA 3R41A 2PSHA 2ZYIA 3QPCA 1R50A 5JAPA 4AX4A 2XQKA 1GPKA 1GQSA 1ZGCA 3F97A 1CUYA 4FTWA 5HKAA 2XMRA 3DEAA 3E0XA 5FDFA 4N5HX 3LP5A 5K3BA 2GZRA 3IDAA 1DWOA 2JIDA 1DQZA 1W6RA 1J06A 3AIMA 4AO7A 5AKHA 4BC0A 4GI1A 2G5PA 4IH1A 5JZBA 1VZ3A 5T4EA 5EHXA 3WYNA 4BC1A 5AHXA 1G5FA 4GW3A 4EY8A 3GELA 5HKBA 2QT9A 3I2JA 1LNSA 2PL5A 5C8VA 4OD0A 3QMMA 4Y2QA 1FFDA 4K6KA 3TJMA 3B5EA 1EB9A 1EVEA 1DINA 1PJAA 3S2ZA 3WLAA 4MYDA 5KREA 4J0KA 5K3FA 1ZI8A 4BCDA 1ZI6A 2WIFA 1NU8A 4G1FA 2CBGA 1XRNA 1OXMA 3LS2A 1Y7HA 1EI9A 1ZIXA 5CMLA 4H0CA 4AB1A 5ALFA 3PFBA 4KE8A 4MWSA 4J3JA 2WG0A 1MX5A 2PSFA 2X5XA 3ESDA 1IUOA 4Y2YA 4GECA 1KEZA 4KR0A 2VF2A 3AFIA 3DOIA 5LZ4A 4X6YA 4MQMA 1QGED 2XUPA 2WG1A 5ALMA 3FLBA 2J3DA 4Y2XA 3WKAA 4C87A 4W1QA 4HS9A 4CI9A 5CH5A 5JD5A 1TK3A 2OXEA 4FNMA 2DFPA 1A8SA 2BUAA 5LIPA 1HQDA 5CBKA 4PO3X 3CXUA 5DWDA 5ALHA 1QONA 5ALYA 2ZYHA 5FPPA 2FJPA 1BROA 1FFCA 3VXKA 1H2YA 3ICWA 4BDTA 3A6ZA 4LHEA 4B81A 5JAUA 3QMWA 5AOBA 4JYPA 2RIPA 5AICA 2XUIA 3WWCA 1CQWA 4KE6A 2BKLA 1ODTC 3KWJA 3W9UA 3OC0A 1G66A 3MUNA 3BDVA 4ZV7A 4PSCA 3UMJA 4U2EA 1WHTA 2ACEA 4N8EA 4BYMA 2CZQA 4YPVA 4UHEA 3PE6A 1VE7A 1MNAA 5EFZA 3H2GA 2C58A 2VA9A 5ALRA 1ZD4A 5JANA 5JALA 3M3DA 4J0GA 5LZ5A 1VJ5A 2ZYSA 5IVDA 3BF8A 1ODCA 5AI5A 4B9AA 1TCBA 4X85A 4G4JA 2PUJA 3ZLTA 3BIWA 2Y6VA 1MN6A 4EUSA 1U2EA 5DLPA 2HRQA 1P0MA 1XZMA 3W05A 3A2LA 3FVRA 3ZV7A 1ZJ5A 3F67A 3W9BA 2GZSA 3E1GA 2EEPA 2HU7A 5EI5A 4DMKA 2HRRA 3HRHA 3VISA 4A5SA 4X6UA 3FBWA 2H7YA 1Q0ZA 5AI8A 4NMWA 4JNCA 4E15A 3D7RA 4W1RA 4Y2UA 4AZ3A 5DTIA 2C4HA 1QIDA 5ISMA 1XZGA 1ORWA 4Q3OA 1KU0A 5C8XA 5E4JA 5HCUA 2WQZA 1VA5A 3V9AA 5CXUA 4Y2PA 3L1JA 5A62A 4LYEA 4K2AA 5AI0A 4LXIA 1YAHA 5JYCA 2QJWA 2C5GA 1YB6A 1LZLA 4AMZA 2PM8A 4E46A 1ACLA 1XZEA 2GBFA 4UFPA 4H77A 2CB9A 3WJ2A 1W75A 3FWHA 1CUSA 1EK1A 1QIJA 4U2FA 1CUCA 2HA0A 3QYJA 1E3QA 3S8YA 1MT3A 4L72A 5ALEA 1YS1X 3G9TA 4FBMA 3LLCA 5K3AA 2PU5A 4NZZA 1OCEA 1MX1A 4C4XA 4LXHA 3ZI7A 1CLEA 4HZGA 2C0PA 1E8MA 3WK8A 1T2NA 1ACJA 3H2JA 5FLKA 2WHPB 2JBWA 5JIBA 2XLCA 5FPQA 3DYIA 4PW0A 1UKBA 3G7NA 3WL6A 2OCKA 1VOTA 4FLMA 3ESBA 2WLSA 4G8DA 3STVA 2C7BA 4AZ0A 4QDXA 3WI7A 2Q0XA 2DCMA 2OGZA 5AKZA 2QZPA 4K6HA 4UFOA 1HPLA 3WYDA 2R11A 1GGVA 2QVBA 3L1IA 1BN7A 5IVHA 2QR5A 1RYYA 3AZOA 5HK9A 3EQ7A 1Q84A 1HBJA 1ODSA 2XI4A 4F60A 1A88A 3BE8A 1QTIA 2ES4A 1X2BA 3MVEA 1TKRA 2RGUA 4Q34A 3WMRA 4BE4A 1UK9A 3NOXA 1UWCA 2WHRA 3WK9A 1Z68A 5CT5A 1BRTA 4CFSA 4QEKA 3GFFA 5HK8A 4WFKA 4G5XA 4GLBA 2XQGA 2ZSIA 4X94A 3HJUA 1AUOA 3H19A 5ALTA 5LZ7A 1MO2A 2DR0A 3T52A 3HXKA 4HVTA 5A7GA 2YH2A 1BU8A 2WJ6A 3OPMA 4IO0A 5ALXA 2GYUA 2YASA 5I7UA 4RNCA 1WB5A 3SWWA 1MU0A 1PV1A 1ZGBA 2V98A 3I2GA 4GEGA 2HHAA 2DQYA 1YA4A 4BCBA 4FDMA 1F8UA 1YB7A 1ZD3A 1QIIA 2G4LA 1DT3A 3W2TA 2B20A 3DLTA 1BCSA 1FFEA 4I3FA 5DYTA 2VQ6A 1JU4A 3WK7A 3DNMA 3WK6A 4EA6A 3EQ8A 2XUKA 1UK7A 1W76A 3QITA 1N1MA 4MEAA 1F6WA 2Y6UA 3FSGD 4G9GA 4CIBA 1GT6A 3I2HA 3KOOA 1QTRA 5HFAA 5FRDA 1K5PA 1UOQA 4ZGBA 3C87A 3SK0A 2XUJA 4J0HA 3Q0TA 4H7KA 4C6HA 3B3QA 3WL8A 2XB6A 5T4FA 3DL4A 2XLBA 1UOOA 3FYTA 3PI6A 1WPXA 1CUBA 1GQRA 1X70A 4FHZA 5JASA 4DSAA 2DSNA 3HABA 1LZKA 2HL6A 3D2CA 1FFAA 3ANSA 3ESCA 2ZJFA 1ORVA 1U4NA 3IUMA 3TRDA 5C7YA 5AJHA 4UHCA 1USWA 1DWQA 3FYUC 5JADA 4A23A 5AOAA 1JFRA 1XZCA 4H7FA 2WHQA 5LP1A 2PSEA 1U65A 3WWPA 1CVLA 2QS9A 4X95A 1QFSA 4ZREA 1LPSA 3E4DA 4GXNA 5JARA 3EBLA 1A8UA 3H17A 4KJXA 2XMDA 3K6KA 5HFNA 4I19A 1QZ3A 1J1IA 4QNNA 1J07A 2CKMA 4HXFB 3R3ZA 1L7RA 1S8OA 2BJHA 5ALQA 3H04A 3M82A 1LLFA 3C45A 2WHPA 3L1HA 2XMBA 5JD4A 1O6FA 4P93A 2AJBA 2PVSA 2QUBA 3LIPA 1R9MA 1JMKC 2BUBA 4J0CA 2WILA 1YAJA 2ZVDA 4LXGA 2QRUA 3KWFA 4UBMA 5ALDA 4QA9A 3G0BA 1CEXA 1RWQA 1GXSA 3CCCA 1F0NA 1BN6A 1W4LA 3GZJA 2PSJA 2GBIA 3C8DA 2OPHA 4HRXA 4H18A 1TIBA 2B9VA 2CUTA 1RP1A 2Z5GA 5AKJA 4B80A 1XZKA 3C70A 5LYYA 4AN0A 1AC5A 1SFRA 2VT6A 4IH4A 3TEJA 1P0PA 5FV4A 4N8DA 2BFNA 3FAKA 1OILA 3D0KA 4BZWA 1EB8A 1BEEA 4HXEB 1LPPA 5IH7A 1IUNA 4G4IA 3H2KA 3PFCA 4UHHA 5F4ZA 1XZDA 4CG2A 2PUHA 4KE7A 3MUOA 3R0VA 4WFIA 3BL8A 5HQ3A 3SX4A 4U2GA 3G0GA 4LYDA 2H9YA 4PSDA 4Q3LA 5ALUA 5J3JA 4B7ZA 3N2ZB
chains in the Genus database with same CATH superfamily
2P4HX 1KJZA 3JR3A 1QP4A 1L8XA 1U31A 3PUZA 3V4OA 1LVGA 5HF8A 1N1EA 4M1KA 1I0ZA 3FB4A 1LDGA 4R2IA 2AIRA 3ZZNA 4EHIA 3OQOA 4RIGA 5BSUA 3QLJA 1QYDA 4ZMSA 1T5IA 2MR6A 4FFOA 3UXHA 1E9SA 3AERB 2LCQA 4EMBA 3RFVA 1KVSA 5A0VA 1CUXA 1XR3A 4KPUB 4U5XA 4RULA 1TZCA 1NVXQ 2JFXA 4TS1A 3HMKA 5B2ZA 4AF7A 5HZKA 1WETA 2O06A 1LI7A 2FG7C 2I2XB 1TJYA 4C7OA 4R40A 4A0SA 2FEPA 3MS2A 5DO9A 4Q82A 4YAOA 2W6MA 1H69A 2YWGA 4X6XA 3LJKA 1X1RA 4AVYA 3F96A 3LHFA 1LH0A 2HCBA 2HCJB 2BD0A 2PX0A 4LBYA 4N54A 1YJ5A 3SYTA 1ZXXA 1QORA 3L82B 1ABBA 4I3HA 4PQRA 1K27A 2EDCA 3WYCA 2Q5HA 5IMBA 3DZGA 1Y48E 4QVGA 2ODWA 1S01A 1S96A 2DFLA 1E1NA 4Y6QA 1F17A 1P7CA 5GZ3A 3K9FC 4GPD1 1DWUA 2B8WA 5F33A 1GPNA 2C2OA 1Z39A 3G0DA 3RG8A 1FYVA 1O57A 2CW5A 2DTXA 1W1WA 3PZBA 2AFHB 1T24A 1XVLA 1MW9X 5DGHA 2B61A 3W7VA 3T94A 1GSHA 2YJ4A 1IWBB 1HWYA 3LVFO 2M6LA 2RB4A 1UP7A 1JIIA 4G1UC 4QJBA 1YZKA 2J87A 4OAOA 3MN1A 4YX9A 3DBRB 4K9MA 3EEOA 2FDCA 4YRKA 1H1DA 1BXRB 2XWPA 3NXKA 3CBGA 4B76A 4O08A 4MHOA 1DTEA 1L4FA 4C0QC 3R9KA 4CKXA 3BDIA 1JE0A 2CFIA 2FUCA 4FIZA 1Y34E 1OYYA 2A5JA 3GR6A 4URVR 3GZNB 9LDTA 1UXGA 4MW9A 3ZCQA 5EHQA 3G8AA 3IEKA 3SLGA 5JVDA 1A4IA 7REQA 3TG2A 5CYFA 4NMMA 1ISMA 4YC7A 1G3UA 2WFMA 2F9FA 5FWNA 4YMVA 2IFTA 2OBNA 3DMRA 4JT9A 5K0CA 4PYLA 2IU6A 3OPQA 2OMEA 3LWNA 4F85A 4S24A 2L69A 4QWWA 2SCUA 5HG0A 2H5IA 2Z9DA 3N2GA 4GM4A 1CJUC 3QHAA 3AF5A 4RD2A 3V97A 3VR0A 2ADMA 1A7AA 1W8IA 1X1EA 3GRPA 2ODTX 3K1AB 4ZXFA 5J58A 5K8JB 1KPGA 3YASA 1QVZA 5CA1B 1JDZA 4M0EA 3I9V1 2DFNA 5LMUB 1H94A 3CF4A 4ZO8A 3UMSA 1A8QA 3EDQA 3M6XA 1IM5A 2YY7A 4QEZA 3C1TA 5I7HA 3M4XA 5J2UA 2ZSHA 2D6FA 4BEVA 3GAAA 1YRAA 1YS2X 3Q3IA 1J0CA 1T9CA 3I5MA 1IIBA 3W79A 2QLJA 2QLBA 4EG1A 4QPNA 4Z1MD 2PZEA 1C9YA 1YIAA 2AEFA 3IT3A 5GONF 1ZIYA 5HIJA 4LJAA 3REQB 4X3CA 3KTFA 1CUEA 2Q6TA 3GJ3A 2X2OA 4FEEA 1QANA 3GVIA 1HG0A 1XCBA 2XA2A 3KYIB 3QVTA 4P34A 2EP8A 2HBRA 2REXB 3PT5A 2YZGA 3HO6A 4CLDA 1P9RA 5DP2A 4N47A 3E3MA 3ZHOA 2EX1A 3DC2A 4YDRA 3IXQA 3FI0A 3MTBA 1LTQA 4PXYA 1Z0IA 2VPXA 4UMFA 1Q0HA 3ST7A 4ZK2A 2H8GA 4O0MA 4CCWA 2BPOA 3HACA 4YJDA 3KQUA 1I10A 3A1NA 2G82A 1J7JA 2H4YA 3IL2A 2D2XA 3CEJA 3R6LA 2E18A 3PKJA 4J94A 4TWJA 4URYR 5DLEA 4F2DA 1P5HA 1PWZA 3C3KA 3F7OA 3TEFA 1MAHA 1VIAA 2PJZA 3JQPA 1WDWB 5DHFA 4L22A 1VRWA 4J29A 1G9TA 3PNPA 1DV1A 1PR6A 1Z16A 2PX2A 5BWCA 3QQPA 2Q1WA 3FNFA 1J9GA 1KMMA 3HDTA 1JDJA 3WIDA 4E11A 2GPAA 3FMGA 2W5UA 3GAFA 5BN5B 5MN6A 3I2KA 4Y0AA 4ENQA 1KSFX 1C9KA 1KHHA 5IANA 2P62A 2O07A 4NV0A 3KZCA 3TPZA 1UKZA 1ISHA 3VC3A 4EJMA 1DRJA 3IVCA 1MX3A 2R79A 3B48A 5E4YA 2XMGA 2Q07A 5HX7A 4P83A 4HD8A 3ZWXA 1XDGA 3JQ9A 4M22A 4WESA 4O1HA 3VKUA 2IYRA 4JY7A 2ERCA 3GBPA 3NWBA 3TMYA 5IAEA 4B3TB 1CJTC 4HFRA 3H9CA 4LWPA 1LTHR 2ZBGA 1TVEA 4ZT3A 1QUEA 1X7DA 5IBQA 3TPCA 5I9IA 4ZK6A 2IYXA 4RKQA 5FR1A 2W22A 3ADCA 3JQQA 1JHOA 2O7QA 4TUYB 3F98A 4KFCA 3ND8A 3I04M 5A4KA 2D5LA 1BVRA 1M8PA 1BE0A 4CQNA 2PX3A 1GDTA 4DS3A 5JNRA 1HYBA 3TXAA 4H6XA 3NH9A 1P1KA 3OVMA 1V3QE 5HIKA 1W30A 1SKYB 1BD3A 4TRRA 3HYTA 3OA2A 2Q4TA 2ECKA 1UKAA 1XTKA 3QU9A 4G9BA 3T9DA 3WHIA 4D6YA 5JH7A 1XWWA 3G5TA 1Q7GA 2VAWA 2Q1UA 3N5KA 4IH9A 5TQJA 4EHBA 1DT5A 1U3UA 7ABPA 1TQ2A 4RSGA 1Z37A 2HPAA 1PQUA 1PR9A 1T26A 3KR1A 4NFYA 5A2GA 5LZ2A 4UPVA 1RRGA 2GVNA 1PT8A 2BSAA 4OXIA 4PLCA 4NPCA 1QO0D 1JHDA 4B6GA 3TXYA 1NVVR 1Z13A 1XDZA 3RF6A 3AU9A 2WD7A 4BHTA 3KPJA 1QRTA 3E9CA 3SHWA 3ZS9A 2GN1A 2BGNA 5EAIA 4YFYA 3VJKA 4PIPA 2OEPA 2RAPA 4RH1A 3LLMA 4WN9B 1JZQA 1UMCA 5KWJA 1GZ6A 2OL4A 4Q9AA 5BYJA 2P7HA 4ENRA 1S6YA 2YICA 1DOHA 1WZUA 4UE3S 2RHTA 1N2HA 4FB5A 2QIOA 5HE8A 3LGXA 1P62B 1L4MA 3PL5A 3C6XA 4XSVA 3RODA 4JVLA 2H1VA 1CUFA 2CNKA 4PC1A 3LQ2A 3AR9A 3OICA 3MGAA 4ENUA 2E82A 3I5XA 1ZWKA 5E9WA 2C42A 1H65A 4NYMQ 1JQBA 2QORA 1WCIB 1XDWA 1R6UA 4LY3A 4ZVRA 2YWRA 2WA1A 4KH0A 4RY2A 1ZPDA 2OPBA 1R3DA 1V16A 2VRBA 2RBKA 3W8FA 1GRRA 4WY5A 1QQ6A 1D1PA 5CX1B 1HDEA 1F2TB 1XU9A 3GLRA 3SXJA 5DWVA 4BGEA 3UUWA 1JG6A 3R5FA 1URPA 3F3YA 3HG7A 1REQA 4FDUA 4OQQA 4QODA 3CVJA 3NM4A 4UBKA 1XRRA 1P0IA 3C43A 1CZKA 1GTG1 2AW3A 3CWQA 1R8SA 3COPA 3HV0A 4JP2A 4WDRA 1YZVA 5JHHB 1V5GA 3MGGA 1S1CA 4KAJA 4LXTA 4IRMA 1X9IA 3LWDA 3Q3JB 1U80A 1X6VA 2IBMA 1COWA 1WXDA 2VEOA 2X13A 1B6TA 1YZTA 4ND5A 1NJ1A 1RQ2A 4WRRA 4DKXA 3QG1A 5FEUA 4YASA 5EUCA 3VYSB 1XROA 1VE5A 1K8XB 1YJQA 2O3JA 1K5DA 3WZLA 3VJRA 3PFNA 1EWVA 1WMBA 2B34A 2ZVPX 3DSRA 4LTMA 4MA5A 4Q9IA 1PG0A 3G9QA 1KVTA 1IRXA 5K2OA 4KVZA 1OYVA 3KJNA 4MPDA 5LDGA 2UZ0A 3PXDA 2P1ZA 5LMCA 4PG4A 3GJ6A 4II3A 2QZJA 1G7CA 4FHFA 1E0DA 5B6IA 1H0SA 1YR3A 1THMA 3FMPB 1HTBA 3IIEA 3K2EA 4EVIA 1E2BA 3PA6A 3B70A 1XZFA 3S40A 3C8UA 5A7FA 2ZCJA 1TK2A 2BISA 2G07A 3B7WA 4HDSB 4OI2A 5TVGA 4KQ6A 1K4YA 2ZKLA 2NZ8A 4PZUA 4BLPA 4E5UA 4E5KA 3ZE2B 2P9JA 3V6MA 1CD5A 2I1LA 4ZQHA 1SC3A 3E4CA 3CT6A 1IJBA 1O9BA 3C15C 3VVMA 2BVNA 3GLKA 4MJXA 4D56A 4OLAA 1B15A 3VNVA 3A1DA 4K40A 2Z1DA 2ZI7A 3WLPA 4XVRA 5JYBA 1AGXA 1KC3A 3SR3A 3VJMA 1JXAA 2YVAA 4EPRA 1NT2A 2C04A 4DNFA 2BBWA 5HDBB 1SMKA 1LJUA 1SK8A 2AD5A 3K0CA 2AOVA 4R4JA 4J0QA 2WKWA 4FI3F 3IURA 4R2HA 3N07A 3VA7A 4URWR 3HCEA 2Q1YA 3RFTA 2W93A 4MUAA 1B0ZA 3CNEA 1A77A 4QDZA 4LDZA 2Q9CA 2QK4A 5KWSA 1ZNQO 1EE9A 1I2BA 3RVPA 4EKEA 1S5PA 4PSAA 2QYTA 3SVLA 2RHMA 2JARA 3UT0A 2XUAA 5IX8A 1PX0A 1C8LA 1RYHA 2QTVA 1E5DA 2FYTA 1MO3A 1RIFA 2C94A 3TAXA 2VK8A 5LR6A 5GADl 3WJ2A 1QVRA 1KXZA 4MVCA 4KYTA 3RAGA 3HC7A 2AMJA 2XAAA 3F6YA 3W5HA 1AMNA 4Q9JA 1HQCA 2PLAA 1XMOB 4N0MA 3CLTC 3AESB 4AICA 2JFPA 3VJLA 3PC4A 2ALJA 1H0RA 4Q05A 2Q4RA 1O08A 1OBHA 2HK9A 2OP1A 2XRYA 1I1OA 1F1BA 3H13A 3KALA 1O94D 1OKKD 1KK0A 3A37A 1Y9JA 4I50F 4O2BF 3GRZA 4UU7A 5A02A 1G41A 3BK2A 4G3XA 1KOFA 4M8LA 5K8LA 5K6TA 1ZXLA 1AKRA 3P2KA 2O8DA 3IOBA 4X44A 4NR0A 5DEOA 4A26A 4KAAA 3ZWOA 1OASA 4I9HA 4FGWA 2YJ6A 1GZDA 1O6ZA 3LLUA 3MOSA 2A67A 4KL8S 3B52X 1R9NA 1FLNA 2XTJA 5LXTF 4YYEA 4AY3A 2FEKA 3VVBA 4P7GA 1QRSA 1VHDA 3J7AC 3R6TA 1TZBA 4M53A 2OZEA 4J75A 4XW2A 2NSHA 3K9BA 4P3PA 3JTMA 4WMLA 2PQMA 1JXQA 1A97A 4IFTA 4P4GA 3RU3A 4CM1A 4ER6A 1J0AA 4JS0A 4E0BA 3UHJA 4JBIA 3ZJ4A 4DNQA 3FYSA 4BMPB 3DO6A 4J16A 1XT6A 4KFSA 1FPMA 5EWLA 3PC6A 4AO6A 2OFOA 1I3NA 2QTHA 2X0IA 1PW7A 4HYYA 1WOYA 5JRZA 2E4VA 1YZYA 3V7FA 3BGOS 3VUFA 1VECA 2Q99A 4M60A 4WK2B 5G4KB 5B2EA 4IIXA 2WJYA 1E2IA 5ECWA 1QYXA 2EDAA 5LUAA 4JA2A 4C7MA 4MLCA 2EJTA 3SZRA 5BYAA 4ZHQA 2NIPA 3JYLA 5DZSA 4YRZA 2EFDB 4D45A 2EJBA 3ONFA 4GIBA 1VXRA 3IBCA 4J07A 5C37A 2EJCA 2BZ0A 3HDHA 3M3HA 4LZNA 4FOOA 3RAEC 4FT2A 1PS0A 3SBEA 1RWVA 1ECCA 2RMKA 4C7JA 5E95A 2OXIA 3A6HA 1WMFA 2GZDA 2PUVA 3KM0A 3MYRA 3DE4X 4ZEVA 3L6CA 2XV1A 1B43A 2FHPA 5BMVF 3S99A 1L8AA 2WK1A 1DAPA 4L5IA 1ZK4A 3T5TA 3AF0A 2C7RA 2Y27A 4WZZA 3T4EA 2EKBA 2XUZA 5G41A 1SY7A 3W5IA 3HLYA 1NJ2A 2VTDA 3IHTA 2I3ZA 5D1HA 4C6RA 3K1TA 1UFQA 5L4SA 4QNRA 3RIGA 3T7RA 2W42A 5I01A 1WEHA 2JVJA 2ZSDA 4OOEA 4X84A 5EE3A 1OWMA 2EFHB 2AFVA 4XM1A 4EJ0A 2EL9A 1M54A 3UB2A 1ZOIA 1VLQA 4PLTA 2HW8A 5BR1A 3VZDA 3V4PB 3UWSA 4BNXA 1H2FA 4INJA 2GHTA 2F3SA 4D8XA 3DEYX 1JQEA 3GGOA 1XKTA 5CDGA 5IJ0B 4BMYA 5B2FA 4G5OA 3UAYA 3AY3A 1VPWA 1T4MA 3G02A 4MYTA 4PGGA 5EMKA 4HJXA 1N8SA 4KQ1A 3T5CA 3TI9A 3GLVA 3G2IA 3K6RA 3DOHA 4LVNA 5E3IA 3O21A 2ZKIA 3UV7A 1U8FO 2DTDA 2VF8A 3M4YA 1NTRA 1RSZA 2CNWA 3I8XA 3U80A 4F6RB 1VLLA 4YJ2B 3IJ5A 4K9PA 1WKBA 4K2HA 3EWNA 4H1HA 1C0KA 4I5EA 2FE4A 1QAQA 3RTAA 3WBBA 2XIJA 4PG5A 3PQ8A 2Q1TA 3IUQA 4D9GA 2QRMA 1F14A 1Q7BA 1SGWA 1UCFA 3OCJA 1K8YB 1P4SA 1U2QA 4L8VA 4EA7A 4DYVA 3W4JA 5JZVA 1RRFA 1CKEA 3DKVA 4NICA 4ALIA 5FJJA 1CUAA 1KI4A 2GAAA 4MVJG 3FZGA 5F1OA 2HHLA 1G2PA 1VPEA 1IN4A 2WJ4A 1JJAA 4FKZA 2CDBA 3ZDFA 4M0PA 3WRYA 1QIEA 2A78A 1LPOA 1WWKA 2AFHE 1NONA 2AYZA 2VXCA 3NTQA 3VKVA 3PX7A 4Z86A 4TVBA 3H86A 5DBOA 1DELA 4C06A 3D1VA 3F9CA 3WHLA 2ZZMA 3AVQA 4PNHA 5FPYA 4FS3A 2Q2OA 4WJKB 2J0VA 1IL0A 4DQ0A 1VYUA 4BU1A 2R6JA 5HWSA 5KYKA 1ND6A 3U9SA 2BEUA 3HGQA 5B3JC 2NO9A 3WYGA 2QB5A 3FSEA 1K1EA 2NVWA 3EC2A 1X7WA 4P2GA 4ZEXA 3TW8A 1ZO8A 4BU0A 2NV2B 3LAWA 3CNLA 3K9LA 3Q3GE 3MTQA 4YROA 3BILA 5ALJA 3DBOB 1VRCA 3CF2A 4KQCA 2B1IA 2GT1A 2CXRA 1UMDB 4P7JA 3CUKA 3ANXA 5AKEA 3REGA 4O25A 5HGJA 2HTEA 2GPNA 2IX9A 3EIQA 1KORA 1ZDMA 2AR0A 1KE2A 1TU4A 1XD9A 5L45A 3AZQA 1J49A 1GR1A 3QU5A 4RGYA 1JHVA 1E9VA 2JFNA 2R6AA 2I7CA 2W0MA 1P4JA 3MJHA 2DB3A 2JFYA 3GLTA 1HT3A 2XA1A 1FRVA 3D5TA 1J24A 3P0JA 4UUAA 4K9KA 3NU1A 3OTHA 3RYHA 5I9SA 4HG2A 4D9KA 2Z83A 4OI1A 2UZ4A 2H85A 4MV1A 1J1UA 3TVYA 4QEDA 4TM7A 1IZZA 4NPAA 5ER9A 2J0SA 2GEJA 4W99A 1CUHA 2YVLA 3G5MA 3O31A 2PJRA 4CM8A 4K6CA 4L0CA 6GPBA 1SBZA 4NNJA 2CHFA 2BT4A 1D2GA 2O2SA 3C4VA 1W2WB 4JIGA 2AKEA 4UNQA 1XTQA 4FEYA 5CB4F 3IKVA 5E8JA 1NKSA 4DLZA 3MSXA 1SU4A 1W1IA 2G36A 1EJBA 3SHOA 3PLAE 1EVQA 1SCNE 1U8TA 4N40A 1BNCA 3LUJA 2CLKB 4X66B 1JHXA 4KACA 2GARA 3MILA 3C3JA 1Y1TA 3QA3E 3TTUA 1AF7A 5DNEA 2IELA 3D6FA 1RZVA 3E3AA 3JRXA 4NOMA 4L5YA 4R6XA 3TL3A 4EGCB 2WSLA 4TMXA 1ETHA 2X1LA 1T9AA 4PX5A 4FZVA 4R1LA 3RBZA 3HJTA 4LGMA 2GWHA 3M1LA 4F2HA 4W1SA 4AG5A 1USGA 4K28A 5KHAA 3SHTA 3A9VA 2NMVA 4K46A 3KCQA 1AHIA 1O5TA 4CCYA 3ADDA 3IDFA 3OFND 5KWVA 2IPMA 1AQNA 4QGGA 3G5LA 2FP3A 4UOEA 3DL0A 4Q6WA 3K7EA 3AGPA 4NZMA 5ALNA 4DIDA 4N7MA 3HZOA 4GM0A 3E27A 1H4SA 1IZ9A 3OQIA 3HVKA 1IEWA 3TNDA 2CDRA 3WKEA 4AX8A 5BV0A 4DB4A 3SIRA 2WJVA 1NRJB 3HU2A 4E2ZA 1X80A 1RKVA 4X6LA 1RRCA 2QTAA 2IPOA 1ZKDA 5KYWB 5TQVA 4GHWA 1HK7A 4XIJA 1PJCA 2IH5A 1D4AA 1UDXA 4TMZA 4D82A 3EUWA 4HI0E 1ZY2A 2FMUA 2HO5A 1K2WA 3COYA 4EA9A 4OHUA 5KDLA 1EUYA 3QIAA 3DR5A 2AMLA 4MRNA 3DP7A 2OGSA 3GPIA 3V8QA 5LQSA 3U17A 3H5NA 2H29A 3LX6A 1KO5A 1P29A 3JD3A 3RSFA 3P2IA 4EG0A 2Y92A 1P31A 1ENZA 4F04A 4ZCSA 3F8TA 2W6CX 4B4OA 1JKFA 2CXOA 1B74A 2JI9A 2RGGA 3C85A 3MTJA 4FLFA 4GMGA 3H8SA 4WZAB 4ZVOA 2V96A 1J21A 4GBJA 4DOMA 3AUKA 4G5SA 1HE1C 4Q21A 1P7YA 2PLFA 3KOWA 2BTEA 3M2PA 4I4CA 4JEIA 1M66A 2NUPB 4W5HA 4LMRA 4YN3A 4G8JA 4WNAA 3ZGXA 5BSHA 3RAPR 1E69A 3FNIA 1ICIA 1V2HE 1UJMA 1WXGA 4QXPA 1N5IA 1N7JA 4ZGWA 3V1LA 5JISA 1QIGA 1TJ3A 1FXSA 1WUYA 2PRJA 2VPIA 3HWRA 3K20A 3QPWA 4R2MA 1QO9A 5FBZA 3HCCA 5JE8A 2AW5A 3VPXA 2NVOA 4QM7A 1N6OA 4W7IA 4EW2A 1Z26A 2ACVA 2O6LA 4Q3AA 1SD1A 1LBIA 4XEHA 4P53A 1HTTA 2DR2A 5M7EA 4DLYA 1QHEA 1JSCA 1YVPA 3BD9A 5EZ5A 4F91B 3GGCA 4DR2B 1XTRA 4QUHA 4GWKA 2DQSA 4YREA 3OIDA 2X0DA 4AZSA 4C0XA 1D2EA 3L40A 4CL2A 1AX9A 1H6CA 2H7XA 1H8ED 1JHZA 1SB9A 2PKEA 2CYBA 3A70A 2GK4A 1PL8A 4FJ1A 1P5ZB 3A9SA 4L0MA 4ZQEA 4B6JA 1LBSA 5HW0A 4I8IA 4RMJA 2CJWA 3FYHA 3HCBA 2ETVA 2CJFA 4U02A 1DPFA 1KERA 4Z0TA 1GTMA 3ASZA 3F3KA 3P7MA 3IA2A 2IS4A 5EIOA 5DH9A 2CK3D 2A0KA 1NN1A 2P9YA 3HFJA 4PZPA 2GXQA 3PUHA 4OQLA 4BGUA 4EM6A 3VU0A 1H1LB 1I4EB 1QKIA 2PZMA 2IEAA 4UZEA 1I5RA 2RHOA 2YCLA 3A3KA 3FLMA 1FSGA 1DKMA 4TV8B 5DU2A 1VP3A 3T5BA 2C3YA 1E4EA 3AR7A 1HLPA 4YMIA 3G5UA 3GT7A 5TF0A 1PNQA 1L5WA 4IS2A 1HY3A 2Y1GA 1A9OA 4QPJC 5L40A 3PHGA 3LY5A 4AJOA 3IODA 3H9EO 5JCJA 1YK0A 4LQ4A 4MO9A 3RU9A 3P52A 3WGVA 1CZOA 3AC0A 1O58A 1JG7A 1TCAA 2Q2NA 2W70A 4LWZA 1Q83A 4HDNA 5I7AA 5IJ9B 3KXIA 1VE6A 2C03A 2IHBA 4L28A 4QTYA 5JNUA 5LJLA 1G2QA 3GEGA 5G40A 1CC1S 4ER0A 4MS4B 4ZI3A 1OLUB 3WLKX 2D4AA 3R3HA 3DE1X 1TI7A 1T8RA 3ZX4A 1W29A 5DI3B 5EG5A 3SHFA 3AVTA 2J67A 2EYUA 2C5SA 2WFLB 3KAPA 1H85A 4PX9A 3U7GA 2ZZKA 3WBKA 1E2QA 4A91A 3NTVA 1G9SA 1ZVVA 1GLNA 1S3FA 1V6CA 3OCXA 1I4DD 5CFNA 4H3SA 2JDID 1RAAA 3KWMA 4N6OA 1RT9A 1RVV1 1FYEA 3ACCA 3AOEC 5TXGA 3W0LB 4ZJYA 2PANA 1K7CA 2V8BA 2ZJ2A 5BRAA 1LC0A 2PNFA 1Q91A 4YDHB 4Y1RB 3VR2D 1RRVA 5HUJA 2EBHX 1TJPB 1G1MA 4B3DA 2QR3A 4FHGA 1OH6A 3C6KA 5DHTA 4A4DA 2CNDA 2G9UA 3LGSA 1PU2A 1E2HA 1LC3A 1CZHA 1W2HA 2ODEA 2Q2VA 5L7YA 4GU5A 3ZIAD 1BHQ1 5DISB 3AEQA 3T3NA 3L8YA 4P38A 1EFVA 1W87A 1HMYA 3MJSA 1F38A 1JSXA 3LFUA 5CLHA 1FUKA 1VKZA 1XJ0A 3HXLA 3WL7A 4E5YA 1FFGA 2OSBA 1N9GA 2R84A 2Q29A 4IJ5A 4EAAA 3IEIA 4EGSA 3OTOB 1NC3A 1W59A 2N0SA 2BFBA 1QCDA 3AW8A 1WHSA 1XRJA 2DJIA 4IFIA 2CF5A 5D2CA 1DC4A 1RP7A 2BGKA 3MA0A 4MSUA 5KNLA 3HP4A 2QW0X 4CKCB 2UUAB 2VJDA 3O0DA 3Q85A 2QRLA 4F71A 3IMKA 5ABPA 2ORWA 2ZZNA 1U0GA 2ZIGA 2WQ6A 3CVXA 3ULKA 5C46F 4QZVA 4RMGA 4TL7A 3DH0A 3T3HA 1FVXA 1SQFA 3KXLA 3QXJA 4XIYA 2B4YA 1L0BA 5H82A 3BWCA 3ZK7A 3K94A 4ES6A 5KOHB 4WFJA 5KNCA 5JZ9A 1ORIA 4OFBA 4E14A 4DG5A 4X93A 3U7FB 2BFCA 2GPJA 4HWGA 1WSBA 3K92A 1VE3A 4IJMA 1JZTA 1G3MA 3GPBA 5ITWA 1WMSA 2CMDA 2FMXA 2P9BA 3AOGA 2IUTA 3NI2A 2HPVA 4H7JA 1SCQA 1GFZA 3CLUD 3NJ8A 1JF8A 1WDMA 4GUAA 3CVWA 2BHTA 3UCEA 2DLCX 4X71A 3TJZA 3GDFA 4XCVA 4AQYB 1Z2OX 4D97A 3GEMA 3EQZA 1J0DA 1WD5A 2CEKA 3B1KA 1IUPA 1X7YB 3OE4A 4NSNA 4ASUD 4S2UA 4EK9A 3U6KA 3PQ3A 3K96A 3IAS6 2VDRB 2X4IA 2YWCA 1RWBA 1CDZA 2HF9A 4RJJA 3LF1A 2P7IA 2LR0A 1H2WA 2ZUBA 2PGIA 5BORA 4H1TA 2QBYA 1UDRA 2ZE7A 1FYXA 1PEKE 1M2VB 5CW1A 3AEKA 2YMQA 1E96A 4X20B 5U9CA 3GLFA 3ZV4A 3NS7A 4GG1A 3W7BA 4CM6A 1UKEA 4JUBA 3H3FA 4F96A 1GKLA 5D01A 2A9QA 1ECBA 1ENPA 1V1JA 1LEHA 4C6TA 2QP4A 3EGCA 4WLVA 2F1OA 2XRMA 1MQ9A 5DRTA 3FVQA 1JQKA 3V48A 4JOBA 1AHHA 4EI7A 2O8EB 3BJZA 2QGFA 3CN9A 4UNRA 1ZRMA 5EFOA 1RYEA 1TRKA 1KSGA 2Q4BA 2MWMA 4KC0A 1Z7GA 3QPVA 3HZZA 4FYHA 3KBBA 4TKVB 3VDQA 4C78A 5E1BA 3QVMA 5JWOA 2BKXA 4UDOA 3BSYA 3G79A 3THYA 3TIVA 3TRIA 5GINE 1BDIA 2VUHB 2V3WA 4LY6A 4R2KA 2R8OA 4O29A 4D41A 1BCSB 2NVUA 1SWWA 5L7WA 3C48A 2VSOA 2Z09A 2V7QA 4PYRA 3HFRA 1E7YA 1VGRA 2QM3A 4GBGA 2X1MA 2SKCA 3T34A 4DLLA 4P92A 1N3YA 3B1FA 3JQEA 3IX7A 3U4IA 5DEIA 4FFLA 3ZPXA 1P4HA 2HF7A 2VHTA 3DBLB 4BO1A 2VNAA 2J4CA 5FHRA 1AY0A 3VR5D 1ABEA 3VAAA 1BD4A 4JBYA 1E79D 1TKAA 5GIPE 4V0KA 3N2NA 3O4GA 1KRHA 3Q8WA 4XJTA 1CFJA 1LSUA 5C34B 1C7IA 2F48A 1PSWA 4NOJA 5D6OA 2DFDA 2DBRA 4C6SA 2CFSA 3PDCA 4ENTA 4CGZA 2REQB 1IEVA 3KLMX 3L6UA 4IZIA 1F4VA 5U4XA 3O8RA 4XIFA 3NEYA 4DYHA 2CXNA 1YRQA 4NJEA 1XDBA 1UPFA 2HQSA 3H83A 4R1TA 4ERNA 1XOIA 3LBYA 1UEIA 3KSRA 1P80A 3C3EA 1NZJA 1X8XA 2ZJYA 1YJBA 3EXFB 1T1IA 3R0ZA 4U2KA 3W2EA 4Z5XA 3O8OB 3JQ9C 2WINI 5GMOA 4YRLA 1C29B 4ROTA 4NCHA 2GYVA 1I33A 1G55A 3BB3A 3BTVA 2NUTB 1C8VB 4QYSA 4OB7A 4TTJA 4ZEWA 3V00A 4NAVA 3TNLA 2I8AA 2R85A 3EXHA 3Q10A 3ZZ0A 2CJPA 3CWZA 3DVAA 4CIXA 3OEWA 3H75A 2X22A 3PC7A 1QVAA 3L46A 4GZ5A 1EIZA 2I87A 4IIYA 3V3KA 3MWFA 4B44A 2WUFA 3Q87B 4HPWA 4PRLA 3E48A 1OF1A 2I1VB 4OV6B 4ND8A 1U8YA 2O2ZA 4LVCA 1NUUA 5CVEA 5I7WA 2E5WA 2H7VA 3N87A 2ZRPA 4FR2A 1WSAA 3I6IA 4TUYF 3ZZUA 4E2YA 4E2WA 2FP4A 3NUQA 3BMNB 4U39A 1C7EA 3IO3A 4UDXX 3M9WA 4PAMA 2HSDA 1JA9A 2BONA 4OXYA 5IUJC 1H2AS 1NNLA 3K0FB 4TN5A 2FMHA 5BSMA 3SYKA 3TLBA 3UC5A 2XH8A 3IMFA 3KWLA 3GGGA 3SZUA 2OV6A 2P27A 3O91A 4FWBA 3X2EA 2HKIA 1Z5PA 4PS0A 1Y1SA 1VIYA 5AKIA 4WUTA 4TYYA 3TQHA 3ICCA 1C9MA 4R98A 4YAGA 1Y3BE 3ADKA 5JBIA 5KYUB 3RTEA 3QNUA 5D00A 4E13A 3O4JA 3VVCA 3L8GA 5YASA 4IVQA 4RH0A 4JOSA 5K0LA 1QB8A 2YCBA 3CSSA 1M10A 3IHLA 4C5CA 1D4OA 1E7MA 1CB0A 2WT9A 4TMYA 5DIFA 1O0BA 3DXZA 4EYKA 1C7RA 4B3MB 2A9OA 3SVZA 3P94A 5A71A 1TQHA 4DLWA 1K3TA 3BN3A 1L5GB 2JH8A 5LBUA 1VM6A 3V5NA 3WSTA 4R8RA 3X2SA 4F4FA 4TLLB 5CIWA 2X2FA 4ZTBA 5B6PA 1NQWA 1GRNA 1Z7BA 2XD4A 2O3QA 3AY6A 4Q00A 2IYSA 4KQIA 5AW5A 2QJFA 1QG0A 1I7SB 1BVHA 4D4LA 5DF1A 1TO2E 1BX3A 3G5AA 1AE1A 2UYOA 1F8XA 4Y2SA 3WP0A 4BTVA 4BKQA 4BTEA 4H4DA 4DTCA 4RLQA 1O8BA 1XX6A 1DBVO 1CTQA 3H2YA 5BURA 1P17A 3A14A 1ECJA 1E9CA 1U8EA 1K7FB 3M7IA 3QJYA 2IYPA 1NURA 1E5VA 2A1UA 1G6KA 2BGTA 1ISFA 3EARA 1Q6YA 3ZU4A 5M04A 1UFKA 3LQKA 2JEOA 2RJOA 2VSQA 2GHRA 2QQFA 3CRQA 4KXFB 4JJEA 1NYLA 5HDQA 4TQGA 1JS1X 1IQUA 2YNMD 3IS3A 3UJHA 3S70A 2JLUA 1CJKC 3QF4A 3U7JA 5B7NA 2P75A 5CA0A 4ID9A 2VDMB 2NQTA 1K63A 2C3OA 2R6CA 4TOIA 2ZRNA 1NSTA 3DOOA 2V3VA 4BNJA 3A1TA 2GSWA 1KNXA 2CB0A 5F35A 4TKLA 1E98A 1JJ7A 3AZPA 1MA3A 1E58A 1Z36A 2VT7A 2ZAOA 2ZE6A 3HUTA 4M38A 4NXMB 4IIHA 3TR6A 3JRWA 3PTAA 3NMUF 2XEXA 1HT1E 3L05A 1GPAA 3PC8A 4GMFA 4R7ZA 1J99A 2GDZA 3T0GA 2XSZA 4CEHA 3UJ3X 1YWGO 2B5WA 4NDNE 3GH1A 2PGNA 4I4NA 3GJ5A 3AVWA 4X1YB 1GGEA 3PXUA 2FMTA 3Q8MA 2GM9A 1UXOA 2DM6A 4PZEA 3VDRA 3W3AA 1B0PA 2VDWB 4HC4A 1NI5A 1P6QA 3HKDB 4BFCA 2NU6B 4GQAA 2FVYA 2XCUA 1GNLA 3WLTA 3PJRA 3MJVA 1EYZA 3KQHA 5LM3A 2C31A 2IF2A 5FEMA 5H3HA 3RAFC 5AI9A 1T8YA 4H1WA 3M6AA 4K1LA 4RZXA 5A3RA 2PTHA 4EI2A 1GXSB 3CG0A 4JH0A 3LSTA 4WLEA 4XX1A 4HRYA 5COBA 3RSLA 2A35A 2QN7A 1K08A 2H48A 2RBEA 4ND3A 4FHEA 4DXHA 3K5PA 2FH5B 5FNVA 2BRUA 4G41A 1DKPA 4ALKA 5K0JA 3WIEA 3CA8A 3L84A 3BZWA 1BHSA 2PKRA 4JOQA 1HFKA 1I3CA 3WGZA 3OZIA 1SKAA 4JR2A 4HDMB 4MPJA 1XMXA 1SPXA 2B7CA 2OFXA 1QCCA 2BZGA 3KOUA 4Y8VA 2QX7A 4G36A 3N0RA 4OTZA 3WO1A 3K0CC 4N1AA 5DMXA 4UU8A 5IYZA 1PGJA 4ZPJA 2PX6A 2V59A 1GZ7A 2HLDA 3KUXA 5EN4A 1NZDA 3P2JA 4ESOA 5KX5A 2X0RA 4R8SA 4WZAE 3TOXA 3NIDB 1I51A 3X1DA 3GQBA 3RIMA 3WQHA 2WNSA 3JXEA 4FW9A 4WAUA 4X64B 2Y1FA 2NPOA 2W7TA 1NOKA 3EIWA 3RSQA 5MF6A 2O8CA 2IIPA 5HS4A 2Q5EA 3LSYA 3HDGA 3DS8A 3K9QO 3QE2A 4M21A 5EP3A 1OD6A 4C9BA 2ZM5A 4F3KA 4B6OA 3WKCA 3I72A 4HDOB 5HQTA 1KEWA 4HTAA 4X8LA 3WQSB 3AHHA 4LJ5A 4N82A 1Y6JA 2XCQA 4EW3A 2XQJA 4DV0B 1B1AA 3HBAA 1VI5A 3T35A 1GVHA 2GEBA 4MQLA 1Q15A 3HY3A 1EM8A 4UCXA 3WZMA 3SEZA 2AV6A 3THWA 2XY4A 1JMYA 2E87A 1CUJA 1UJNA 1ZI9A 1YDMA 2H2IA 1XXHE 4INZA 4EGQA 4HY3A 5L7TA 1AV7A 3LM8A 4LEIA 1GTZA 1QTNA 4Q0MA 5CCBA 5F3WB 1KPHA 5IVIA 4PPFA 2RI6A 4D46A 4ZMBA 1YR7A 2XD9A 3HDVA 5LOVA 4MW1A 3A0UA 4OXKA 2GOYA 1N57A 2J9FA 1SUBA 3OOSA 2JFZA 3OLZA 2YXPX 5EKDA 2BTQA 3DPIA 4CMAA 1Y1KE 3ZDRA 5AUPB 3GROA 1QH1A 2H4HA 3HBJA 4OKSA 3D4OA 4V0NA 5H02A 1SULA 2RAVA 1SBIA 4KWEA 1RAIA 4BNDB 3AVVA 3F3SA 3ZHCA 2XDYA 5EJ5A 1IPHA 4IGKA 1E4OA 1DOAA 3L0ZA 3CNQS 5JXWA 4IOJA 4U9IS 1TMKA 4UEOA 1DRUA 5EZ6B 3THOA 4GLFA 1PJQA 4QE3A 2CV1A 4J16C 1Z0SA 2JA1A 4KQJA 4RQTA 1XQYA 4Y9SA 1LDNA 4JP3A 4OGWA 1EX1A 2F1JA 4ZV9A 3GFPA 1C3EA 3DJFA 2K2WA 3IQEA 2RH8A 4G97A 4ZVMA 1KYZA 1E66A 4KZKA 2FW7A 4Q01A 3M9XA 1FJGB 5L3QB 1H2HA 4CHGA 1PEDA 2B4KA 2C2XA 4LDRA 4ZT7A 1CY0A 1GKIA 1UM9B 4IXNA 5AVUA 3TVTA 3NALA 3UKDA 1PUJA 2VDQB 4TPKA 2B2NA 4CVNA 1Q2UA 1RI3A 1JPVA 3A7DA 3MCVA 1C41A 7AT1A 3UGJA 3KKEA 1BCRA 2YFYA 4R1QA 2OOSA 3FDFA 4CF4A 3T5PA 1SA0B 4HR7A 2A57A 4MH0R 1MEEA 4CQMD 3DWGA 1GV1A 1PKXA 2M1ZA 3B7PA 2JGLA 1ZRNA 2WA2A 3D1JA 3RVKA 4LF6B 3SJCA 1QH8B 4B0PA 1MGOA 2HA4A 3C1AA 4L2IB 1MQSA 2X8AA 4W5JA 2GXSA 5BSRA 7REQB 1FB5A 1KFKB 1T36B 3OZFA 3IR7A 1M3SA 1R00A 2HIGA 3K1JA 1N34B 3W78A 2B82A 1J2TA 1G20A 1L1EA 2DUMA 3EGWA 3KPYA 3S2YA 4JBWA 5JW6A 1Z2CA 2IHUA 5DHPA 1W4BA 1TZMA 5F23A 2EZTA 1BRMA 1XNQB 1RJGA 4N9QA 4DANA 3A9CA 3DHYA 4J7CA 4JEHA 4N0QA 4ABYA 4Z3OA 1P39A 1XD2A 2GLTA 1H8HD 1WJGA 2ZJ1A 3DWIA 3VR5H 4CQMB 3U1TA 4LNAA 1MMFB 1NMXA 2ZUSA 4O59O 1V9LA 1BEUB 1RAGA 3CCFA 1MJGA 2FN3A 3OZSA 1DHRA 4KN6A 5J4YA 2AQIA 3D8UA 4JL8A 3QXHA 3SJ7A 2YTZA 5JO0A 2DPYA 1E3IA 3M89A 3ZK9A 2Z5FA 4MYSA 5AW8A 3TFQA 1JKJA 5DKFA 5FUWA 1IZ8A 2P8SA 1NLMA 4HSGA 4OLHA 2C83A 3TLYA 2AR7A 2RONA 5AOVA 2P3OA 5C3MA 2BP7B 4E08A 4CDGA 1S89A 1U2TA 2ODPA 3F5FA 3VDNB 3R74A 1NN5A 1RWXA 2OZKA 4FZJA 3C6YA 5TMDA 4CR8A 1FMLA 2WDPA 1QO7A 2HA7A 4YJ2F 3CUUA 4WE3A 4ND2A 4R3WA 1Z4MA 3ONWA 5KTRA 1B8VA 3L92A 1QVWA 4LOLA 1GNPA 1H93A 1MDBA 3H8WA 4PHGA 4BECA 4O02B 4UMEA 1JL3A 4LKOA 5C3UA 4LJKA 3OTIA 2QUKA 2GEVA 1JR2A 2WUEA 3GUHA 1IXYA 1DEOA 1WCWA 3PU6A 4NBTA 5CXQA 2OG2A 1AQIA 1JG1A 3B38A 3WRYC 3GFRA 1Z8NA 2UVPA 1MFZA 2VTVA 2N46A 1VPVA 4YXFA 5DHAA 2GD0A 3DM5A 3L4BA 2WIGA 5IN4A 1UADA 2QHXA 3D0RA 4GI5A 2YHBA 1ZBQA 1D9ZA 2PKXA 3CTMA 4U6QA 5CXXA 1G98A 4PFJA 4TQAA 1EK6A 1PNVA 2P2YA 2BFPA 2QEQA 3WTCA 1SUDA 4C2AA 2P5SA 4DAEA 1Y5LA 3E7WA 2OAP1 2ZIZA 3OTGA 4RHTA 5AXAA 1NNEA 1BMFD 3ED1A 4RANA 2FQYA 3EVAA 3HCOA 4P5DA 3ROQA 2JGEA 3V1NA 4HVCA 1EUZA 1HLGA 1RE1A 2IXFA 3FKSD 4CTOA 5FUBA 2XGMA 1RYNA 3DZIA 2W4IA 2P1RA 2HNBA 4YRAA 1AHPA 4YMTA 2OQVA 5AVTA 1T0PA 3FRHA 5K3OA 2BH2A 5JMOA 4DIKA 5KJ6A 2ZWPA 1JHAA 1SXJA 2BDTA 1W96A 3BEOA 3JATB 3QPCA 3J80A 2SHKA 1E94E 2NACA 4I0WB 2O8FB 4C0HA 3PYMA 1T2AA 3RSZA 4Z4FA 5JAPA 2FEAA 3LLVA 3ROTA 3W6PA 2WAAA 5JBNA 2XQKA 4O4LA 1DUSA 1ZGCA 3PNBA 4NOLA 3F97A 4CZ2A 1YBHA 1UJCA 4L3OA 121PA 3IBSA 3MWDA 3A28A 5EIWA 1USVA 4FEAA 3SQMA 3JY6A 4OM8A 2D1FA 4LSMA 5B36A 4UNSA 2ZTLA 4A82A 3H5AA 4ENVA 1ZIDA 3R23A 1JNXX 1MC5A 5CJ2A 5FDFA 1NQXA 4JI6B 3LP5A 5K3BA 1YB1A 4QECA 2D7CA 2OGWA 5EY5B 5B4VA 3IDAA 2C8LA 4KQMA 3A2KA 1QYIA 1WW2A 3JWHA 1EVZA 3QFCA 3URMA 1RXEA 2JIDA 1DQZA 4J3FA 3CHYA 1U6IA 2QSUA 2R7NA 1CSEE 3ZZ1A 4GI1A 3U31A 2XYRA 2RCNA 3MUFA 1IMOA 4OHFA 3VRHA 4DCVA 3E7PA 4HLDA 4Z4IA 2HMVA 2XE6A 3GCWA 2Y99A 4GGMX 4WBSA 2H1SA 3IR5A 3U37A 2R0QC 5HJ5A 4F5DA 1T8SA 1FJHA 1GZVA 3WLFA 3RVOA 3FKQA 2ZJ8A 4G0MA 1U1IA 1J97A 4WIAA 1KQNA 2ZIXA 4DZRA 3UMMA 2POCA 3QEOA 4BC1A 5AW9A 5GV7A 1SUPA 1D4FA 1I3OA 1NL3A 1EGHA 3OT5A 4Q9LA 4F93B 4CEJA 1JEJA 2FVXA 3HADA 1SZCA 3OEEA 1V16B 4IV5A 2EWMA 3GELA 3DMGA 5FUVA 2X4GA 5HKBA 4MCJA 1TTTA 5LYJA 3A4LA 4DUPA 5EJ8A 1DP4A 2PL5A 3KD3A 4PY2A 4N5LA 3A1UA 3UWKA 4BS9A 4MVJD 3LT0A 1LF5A 3LK6A 3VV2A 2RHHA 1FS4A 2PLRA 3ITNA 1C80A 3QGMA 4M0CA 4QFMA 1P1HA 2G71A 2IOHA 4MKIA 1JA1A 3AP2A 2EGGA 3GGSA 4IJ6A 1C30B 3TJMA 1HZZC 1D4ZA 3HVUA 1BWPA 5LWQA 1P4GA 1GNTA 3AM4A 1NY6A 2JAQA 4LSGA 3PQDA 1PL0A 2WYWA 4XDHA 5TB5A 2G4VA 4KUHA 4I8DA 2H1RA 3JQAD 1YDGA 3UKOA 2E85A 3C7TA 2EQAA 1LRKA 4NMXB 3UFBA 5UKDA 2WIFA 5TX7A 3LY7A 4YV1A 4RSRA 1M8FA 2CBGA 1TQ8A 2FPLA 4FN4A 4B71A 5IC5A 1DIOB 3VR4D 5CEFA 5CMLA 3H84A 4BASA 3MWEA 2LKDA 2CDCA 4QUGA 1V26A 4CV0A 4HMQA 2N1MA 2WG0A 4AJEA 4MW4A 3BB1A 3JQAB 2ZSBA 3SG0A 3L0CA 5ETJA 2X5XA 1JG2A 5IJXA 1A76A 3ESDA 4NOKA 4Y2YA 1YUNA 1OU4A 1P81A 3NRCA 4GECA 5E7QA 1HE5A 2PWAA 2QD3A 2QVZX 2VF2A 1ZZEA 4XYMA 3DUWA 3L7CA 5LZ4A 1FRZA 1MF7A 2VHWA 4G2TA 4AYWA 4F3YA 4DEXA 3NHAA 3RYFB 3ETCA 3PVSA 4MB0A 3TNYA 5EJEA 5KHOC 4R5MA 3INRA 1KFCB 1PGNA 1YDFA 2PMFA 1P9NA 1QF7A 3BXGA 3GL9A 4NEHB 1Q2XA 5ALMA 4F3CA 2ZWMA 2NUAB 1ZD9A 2J3DA 3GVHA 3ZJUA 4LJ7A 5DWQA 1Y98A 3WKAA 1PLLA 5AW1A 1TF7A 3ENKA 3TTTA 1V5WA 4C87A 3SFTA 4YT4A 3K32A 3PDHA 4H59A 1G5IA 4QOHA 1Z4KA 821PA 5CLGA 4TSFD 1JQ3A 1UBOS 4OOFA 1E1LA 2OXEA 3N74A 4FNMA 3FPJA 1Z83A 3MJTA 4IIVA 4CMIA 1O87A 2I7TA 2XITA 4RPHA 3INGA 2AF3C 3IR6A 1QE5A 2WWGA 3VNRA 3O2QB 3JR7A 4JAVC 1IOWA 1U3CA 1KRXA 3EN0A 4QICA 2R8RA 1F48A 2D13A 1NVBA 3P5SA 5CBKA 3FJOA 1N6IA 2JLBA 5DWDA 1F12A 1DRWA 1QONA 1QXSA 4X8OA 1QS0A 3SSNA 3CYFA 3VUEA 4CCSA 3TR0A 1KP2A 1FFCA 1D7OA 3KDSE 1M6YA 4YLGA 3KZMA 4TV8F 3W7AA 1IOVA 1GUDA 2FXVA 4Q4AB 2XHZA 3UK7A 2FW8A 3AI3A 2OO5A 1JR3A 2YQ5A 2HF2A 4BV3A 1PZHA 5H1YA 1Z6TA 4MUKA 5GY7A 2C2ZA 2P68A 3F7MA 2HK7A 1UC5B 2JD1A 2O5RA 3DDZX 2D0OB 4PYIA 3UV6A 3WV4A 4MUXA 4MQ6A 3ZCSA 3FWNA 2DY0A 3GRYA 3PGXA 3ZDYB 1RI1A 4EFMA 2C57A 2RIPA 1P3DA 2NQ8A 3VI4B 3WWCA 1E1YA 1W9HA 4PRZA 5DW3A 3OEHD 4DVJA 1KMHA 3IT1A 4JODA 4BO0A 2Y68A 4QXQA 3RG2A 4PIVA 3SDZA 3W9UA 2R86A 2CLMB 1XJ5A 4XGQA 2ZRCA 3B85A 1TIKA 3Q7EA 4OHOA 4U2EA 3UMJA 1YE8A 2UYHA 1MOQA 4HQOA 3ZNQA 4GL2A 1KJQA 2AGVA 3F0TA 1M2NA 2CNNA 2XWQA 3CUSA 3SM3A 1MNAA 4RDCA 1ZSVA 1DX9A 5D51S 1D6JA 3H2GA 3HEBA 2HJHA 2VSXA 4KQXA 4B33A 2J8ZA 1DQRA 2KW5A 2WF6A 5ALRA 5GWXA 2PR7A 5JANA 1IJFA 1SC1A 2IVZA 1J4AA 3M3DA 1K3UB 4C1NA 4J0GA 3P9XA 4K9QA 4D44A 5FLXA 2HIAA 5CAEA 3TGPA 1KO1A 1VJ5A 2H4XA 4PC7A 3ML1A 1K06A 3OE5A 4B3GA 4BZQA 4EFKA 1JEQA 4HX9A 3Q8KA 3ZTTA 1FP4A 4UKDA 2W2NA 3W3ZB 3PUJA 2YZMA 4KV9A 4ODIA 4B9AA 2B1RA 2PXCA 2FSPA 4PYQA 4G4JA 5A5VA 3D8TA 1VLHA 4PICA 2Q0QA 4MO2A 1QB7A 4FUQA 2AC7A 3Q40A 1T4BA 1S2IA 2XODA 2YWHA 3ETNA 4LOHA 4DCGA 1U81A 4R8MA 3LHSA 2XCRB 2WHYA 1JQ5A 1EFRA 3CRW1 4RPLA 2JFWA 3L93A 3L06A 1US8A 5FOTA 3DHNA 5G0UA 4GL4A 4XGNA 4WXMA 2DEUA 1XZMA 2AK2A 4MVJM 4CF7A 1Q3TA 3W05A 4R16A 4DCOA 4OFWA 2IP2A 1WEKA 3THXA 4IJQA 5EE9A 3ZDQA 4AD8A 3F67A 3OQJA 1K0FA 1KY3A 4IHJA 3PCRB 1ADJA 2AOTB 4MRRA 3W90A 5EI5A 4U5QA 5B37A 2HRRA 3MMNA 4TMWA 4PCAA 4YJHA 4B3HA 3WLQA 2EKZA 5IT5A 3E7FA 4GM1A 2IP4A 1PP4A 4MDFA 3S4YA 3EDYA 1H66A 2H7YA 2HK6A 4X5OA 3TDNA 2QXYA 1Q0ZA 3O3NB 2EZ9A 3PGLA 4NE7A 3V8MA 2R1VA 4TYNA 3NYIA 4JNCA 1HDCA 2GETA 5EUBA 3FGZA 3D7RA 4W1RA 4L85A 2SNIE 4UM8B 1BJTA 4Y2UA 4EWLA 1IONA 4FE7A 3CV3A 1C1YA 3GP5A 4P81A 5C31A 4C21A 4ZZIA 5B7QA 5I48A 1MXHA 1SHUX 2UVDA 2YFKA 2Q3MA 2LTAA 3NWEA 1FW8A 2O8CB 1UBTS 3OZDA 3ZBQA 3DBHB 3E0QA 2FQXA 5DP1A 1Z0AA 1KZGB 1U7WA 2KLBA 1IBRA 5ISMA 3JPYA 2E6UX 3GLHA 4Q3EA 4DWOA 1GVNB 5C8XA 3TDKA 3RNOA 2Q2QA 2RHJA 3PC2A 5D3MA 5E4JA 1M75A 1U7HA 2ZJZA 1GU7A 1S9HA 2EHDA 2IGBA 3AKCA 4G84A 4NCAA 2QAGA 2WQZA 3N2KB 1KFBB 3I0ZA 4BB6A 2O0HA 4A15A 1O8CA 3BWMA 4GZ3A 3HB0A 3ZX5A 4YNBA 3WAKA 3AHCA 5AI0A 4LXIA 2A14A 3K2QA 1YAHA 2P9QA 2C8KA 5DHSA 5J4HA 5KC9A 4QPCA 1EJ6A 3BXEA 4DSOA 1IXZA 2IYNA 1VCOA 2KBFA 1RAHA 2FEWB 2J3EA 3ZHTA 4IUBS 3EW9A 2EBUA 2HUNA 1A71A 3NB0A 1LZLA 1Z15A 1ZH2A 3OJWA 3DZ8A 4MAFA 4AMZA 4DQLA 4ZKDA 1XZEA 3L41A 3SYMA 3U3XA 1P2DA 1ZWLA 4UFPA 4HQKA 3UNXA 3FDZA 1OI2A 2BELA 1TYEB 2CSUA 4GVLA 4H77A 1XN1A 1R2QA 2C59A 1JHRA 1KH1A 3TW8B 3A3OA 1VMEA 3JWGA 1GPYA 1E6MA 3Q9UA 1ZRSA 1WA5A 3DVQX 1C2TA 4OXRA 1S0UA 2F1HA 3IQWA 4FFSA 4U2FA 1FLAA 3GEHA 2NO1A 3P26A 1YRWA 1DIRA 2HA0A 2E89A 5EKXA 1GUFA 4DYDA 4G07A 4P4SA 4J1NA 3K5IA 5FCDA 3SS7X 2YKGA 3DXYA 4OLJA 1T3SA 1R8YA 5FI5A 2VYVD 5B55A 5KDOA 3FCOA 1HT2E 1E6WA 3KB2A 1JDBB 2VPPA 2WV9A 3UBMA 1NBAA 3QLVA 1RJFA 1S8AA 3QA9A 3H5LA 1MX1A 2WF7A 2W2VA 4S35A 4TN1A 2AB0A 4LXHA 5HKKD 5HIMA 2P2ZA 3ZI7A 3NYRA 3ND7A 1M6VB 4HZGA 4UQPA 3CKMA 4A8JA 4XJSA 2IZ6A 1T8WA 1W9MA 3DUFA 6ADHA 1RQNA 2J6IA 1EVLA 2Z56A 3EYAA 3KDPA 4KN5A 2BZSA 1BKDR 2VRCA 3H2JA 3W9YA 3NDJA 1IRIA 3DEJA 5E7JA 3SZGA 4AW9A 1E2KA 1RI5A 2PIAA 1IY8A 3QVSA 3SZLA 4BO2A 5KTTA 4RW0A 3VH2A 2JC3A 1FFSA 2XLCA 3LBFA 3LPAA 4UUNA 1G63A 4CF3A 2DWCA 2Q5FA 1D1QA 3HPRA 1UKBA 3DULA 2J3IA 3F74A 4MV4A 4CMEA 1E1DA 1I9CA 2BFEB 1UDWA 1SVOA 3A4VA 3HBFA 2EAUA 1OJ7A 4M9RA 3MWJA 4EO7A 1U94A 2WI8A 3MB8A 3DMHA 4G8DA 1GTL1 1XMVA 3GWGA 3KLPX 1DRKA 5DFAA 3B2QA 5IF9A 2WSSA 1L7OA 1C9JA 4PG6A 4UVGA 4QDXA 2Q0XA 4EHLA 4R2WA 1SOUA 4PLPA 1WDLA 2ZATA 3FPEA 4TXLA 3PXGA 4TMKA 3A25A 5AKZA 2HO4A 2QZPA 3C16C 4IIJA 1OB2A 1R9JA 2R11A 2PH3A 3BMQA 2R4UA 1QNLA 2BI8A 2FETA 2QV0A 1GGVA 2YXEA 2ZRFA 1P6UA 1U9ZA 2C82A 3AF2A 2QR2A 4RHEA 2ZUTA 1IH8A 2BM1A 1OSNA 4L75A 5G3YA 5IVHA 2ZULA 3K9WA 4NZNA 2FPIA 3I45A 1OA1A 1TZ2A 3VSCA 5JNVA 1CERA 3IOYA 1ODSA 5FBWB 4O3FA 3H11B 5JDCA 3GVXA 1ZSYA 3NT5A 3VPFA 4F60A 4HUTA 1A88A 2ZR7A 2FOIA 5HRUA 2VDPB 1QWOA 2P6RA 3PG5A 5I7SA 1E64A 4KO8A 4YGXB 3E8XA 4TZTA 3T15A 4BE4A 2VDNB 2F4NA 2BFMA 1UWCA 2WHRA 4RVSA 4UXJA 1OPRA 3S2FA 4DADA 3QJ5A 3HVJA 4G5QA 4XWYA 1JECA 1BRTA 1WAMA 1MKYA 1E6CA 4NQRA 4B4WA 2XCTB 2C3MA 2JANA 2X7XA 1FFHA 2N1BA 1OI7A 4WFQA 1PLJA 5B7PA 5LQAA 2RGBA 3GHHA 2GCGA 4QC2A 1B2RA 2ZSIA 1R0YA 1ZNZA 4K9DA 5C52B 4OJQA 3WAJA 3I5YA 1AUOA 4ZICA 5CPFA 4HH1A 1VDZA 2J9GA 4Q5IA 3W5JA 4I8XA 1SXIA 4RTMA 5B3AA 1XO1A 3LBAA 3UJ6A 2W2KA 4JL6A 2DR0A 2PD3A 2YC4C 4IMRA 1NIPA 1KYTA 3EEIA 4V3CA 1A9XA 2DKFA 3G82C 3KHSA 1NXTA 3O2JA 1P6XA 4MYHA 4MQEB 5EXEA 4C3OB 4EB8A 5CFLA 3DT6A 3OPMA 4GUDA 3J81A 4OP1A 4A0HA 1R66A 1XYYA 3CRMA 2FMFA 3O0TA 3PNSA 5ALXA 5EUMA 3BC1A 3K8ZA 2LZ0A 2NVBA 4QTTB 5EUQB 3T38A 2C7PA 3BE5A 4FFBA 1OX5A 2ZIEA 5BR4A 3AF6A 3SWWA 3E35A 1MU0A 1CDOA 4RK1A 4FGKA 3PC8C 4ZXPA 5I9MA 4B5LA 2IH2A 4GEGA 3MW8A 1BHO1 2IDJA 3QHQA 5K8CA 3E3NA 2DQYA 3K3PA 1RHUA 4BCBA 3T3IA 4JSTA 1HNNA 4WADA 4PLZA 1F8UA 1YB7A 2H1WA 4JASB 1YVRA 3DTYA 1FDRA 3W2TA 2RHRA 1EWTA 1X1TA 3N0VA 5BQOA 1FFEA 1XEXA 5FOUA 5G0VA 3SP1A 4I3FA 1AG9A 3QKTA 4MVYA 4F86A 1QYRA 3KL2A 1RFLA 4KQKA 5J2UF 2VQ6A 5LU9A 3G2KA 2D2FA 3HU5A 3QMPA 2CL6X 3W6OA 5LP6C 4BMDA 1T15A 2FZWA 3O84A 3EQ8A 2JH9A 2IV3A 5HCNA 5EMNA 3ZK8A 5JBQA 2XIQA 1AKVA 2AX4A 3OOEA 5KVCA 3IDZA 1UK7A 1N4AA 1VPDA 2XZOA 4MEAA 3BBLA 3D02A 4RFSB 2BRUC 2GASA 1AU9A 3M5DA 4PYNA 4C4SA 3Q7QA 1M7HA 2Z8YM 2Y9MB 3HDQA 3OKFA 3E6AA 1SQ0A 2ZYDA 3RYCA 4H17A 5JAZA 2VHXA 1P3Y1 3R4VA 3IMGA 3M4NA 2PZFA 4BQNA 1L5HA 3I2HA 2MINA 2HDNB 7MHTA 1A9RA 1QTRA 2QRQA 4XWKA 3MBKA 4CLXA 3IVRA 3EY4A 4UM5A 5FRDA 2W98A 1F20A 2GAIA 3TD9A 1O96B 1G7SA 2TECE 3T7TA 2G9VA 3V8PA 2D8MA 1E9FA 1IG0A 3CVUA 5EJ2A 3KAKA 1U2SA 3GLSA 2JKVA 3F8WA 1X42A 1PJ4A 1Z75A 3LXXA 2RGXA 4G09A 4TWAA 4GLOA 4H7KA 1H9BA 4HGQA 2H4FA 4LCJA 2HNKA 4RX1A 1DO2A 2VJQA 4MVJE 2JHFA 1KJNA 5CDFE 1QP0A 1X13A 3ZXSA 1SHTX 3PGMA 2FA9A 5ES4B 1YZHA 4YMGA 3GMSA 4Z54A 1R7RA 1XJWA 1E2DA 2ZR8A 1SUAA 3BMCA 3PI6A 4L50A 3HKEA 3PXBA 1SOVA 1PV4A 2XDQB 4LRWA 4D43A 5ITZA 5JASA 1N2SA 2HB6A 2DSNA 1U1CA 2JIOA 1QV9A 1FNNA 2QTZA 4BNUA 3G3EA 2UUCB 4I46A 1RDFA 5CDTA 3GX1A 2W6JD 3LW8A 2C9ZA 1MD9A 3A1CA 4NAHA 1DLJA 3FYCA 2IHKA 3OBBA 3DL2A 1ESNA 1DAEA 2RHDA 4L15A 4P32A 4Q3DA 2HRDA 4S0ZA 2ONKA 4NFLA 1KIMA 3QYFA 3RW9A 3RYIB 2YVUA 4IV8A 1ISGA 4WA7A 1G8PA 1ORVA 1V7QA 4DSUA 4R2LA 5MN4A 5DBHX 1JKXA 3DR3A 3PK0A 3RABA 4QQ8A 3BRWD 3AR8A 3IUMA 3K35A 5EGSA 1EFVB 3CLHA 4C2BA 4LI0A 1TQ4A 5HXAA 4KMSA 5AD1A 3KSDO 4UHCA 4Y7CA 1N9GB 1DWQA 1BMQA 4QFDA 1XHEA 3UEOA 2V7XA 1SD2A 1KFJB 4MV8A 1P2GA 4DR6B 2V7GA 4KLNA 2MU1A 5K8VA 5IWCA 1PJBA 2QPOA 2GPYA 1VJCA 2I80A 3HA7A 3HYNA 1ORHA 4YALA 2QS9A 2CLOB 2GJ9A 2NU8B 5ICGA 1WCXA 3L4SO 2OCXA 3E4DA 2HMAA 5AHKA 3TIGA 1KDPA 3LX8A 1LKZA 3CR3C 4DEYA 1WU8A 2EBWA 5KOJA 4IDQA 3NXSA 4INPA 1CZRA 1N3IA 4WLUA 4OY3A 4UTXA 4J6FA 1R3UA 2CVPA 4RD1A 4CCAA 4GSYA 3EVNA 3QBTA 1Q3HA 2V6JA 1Z4JA 2I66A 1V1RA 4FFDA 3IV9A 1NDUA 4FDLA 1JFFB 4JLAA 4RSHA 1JDVA 4KGZA 1AHNA 2VBFA 1QZ3A 1IK4A 2HSWA 3AFMA 4CN9A 3NWJA 1TGYA 1V1MA 2WSMA 1O4WA 1XCJA 4NJOA 1L5VA 1FS6A 4UXIA 5D5QA 4UTOA 4H1UA 3T7KA 2WJAA 2OP0A 4P0QB 1WUKS 4BMCA 4PHHA 2K87A 4CGYA 1DKRA 2ZIFA 1SUCA 4E21A 1E7RA 1W94A 2D1RA 1G17A 1W0JA 1YL5A 3R7SA 3CPJB 5ADWA 2XMBA 4LBZA 2V74B 4LS3A 3LOUA 4ZOEA 4YRBA 3KUKA 5SZHB 3ANYB 5IEJA 5KKCA 3QI2A 4HQ6A 3H3XA 1A7KA 1UXHA 3QKRA 5F5LA 5HA5A 3DC7A 3ESRA 4BWVA 5JVDF 1Q0PA 4YDSA 3AWIA 3AXTA 4I55A 2GH1A 3LIPA 1GPDG 2GS9A 5KJEA 2I0FA 1N2IA 2HZBA 421PA 4R54A 1GADO 3ROPA 1X9HA 4BVFA 1VRVA 2YWBA 5AR1A 3VPGA 3KEQA 1PUIA 2Q5OA 3BCHA 4JKYA 5AVVA 1T9GR 3I58A 1U3WA 3LH5A 2B35A 3F47A 4AYTA 1LVUA 2ODQA 3KWFA 3LVRE 2HR1A