3WI7A

Crystal structure of the novel haloalkane dehalogenase data from agrobacterium tumefaciens c58
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
291
structure length
291
Chain Sequence
PHSAFGDGAKAYDVPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPDIEYTLENQQRYVDAWFDALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal structure of the novel haloalkane dehalogenase DatA from Agrobacterium tumefaciens C58 reveals a special halide-stabilizing pair and enantioselectivity mechanism.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
total genus 106
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3wi7A00
4QNNA 5C81A 3F8SA 1R9MA 3CN7A 4GXNA 1XZAA 2HA2A 2JGIA 2WUDA 4PSCA 4XWGA 3STYA 5C7YA 3WK8A 1Z68A 3OOSA 5HCUA 3FCXA 2BGNA 4TPKA 3OC0A 4UBLA 3LLCA 4DGQA 1XZMA 3G9ZA 1UK9A 3Q8WA 3O0DA 1JJBA 3PE6A 2ORYA 4FLMA 3FSGA 4DMKA 4N8EA 4M0EA 1F0PA 2RAUA 1CR6A 5D3KA 5K3FB 4ZREA 1NU6A 1K6EA 4BVKA 3DCNA 3WWCA 1ZI8A 5AOCA 3PDCA 2WIFA 3BDVA 2AJCA 3D4LA 2PSDA 4C6HA 3KXPA 2JBWA 3E0XA 1XZDA 4W1QA 2FUKA 1LPPA 5AP9A 3QVMA 4IQ4A 4KJXA 4L72A 1ORVA 1QLWA 4C01A 4C87A 4X6XA 2GYUA 4PF1A 3G8YA 5I8PA 5AOBA 3HZOA 1TIBA 4BVJA 5LKAA 4L9AA 1WHTA 4KAJA 3K6KA 2HA7A 4KACA 5EFZA 5AKXA 3STXA 1UOOA 3B5EA 5ALOA 1L7RA 1QFMA 2OCKA 2XQFA 3IBTA 5LZ7A 4H77A 3WKAA 1X70A 1MX9A 4UUQA 5C8XA 3TRDA 2JGFA 1KU6A 2VA9A 2BJHA 4AO6A 1YA4A 3I2JA 5ALXA 3AIOA 4BCCA 4Y2TA 4AN1A 3CN9A 4QWMA 4OYYA 1THGA 3T4UA 4J7AA 4Z49A 2PBLA 2XMSA 1O6FA 5FRDA 1ODTC 2V9ZA 2G5TA 1GXSA 3FOBA 1DWPA 1EX9A 4DNPA 4WFIA 2JGEA 4EB0A 5LLSA 3G9UA 2DQZA 3JW8A 3N0TA 4J0KA 2ZVDA 4NMWA 3OTQA 3BJRA 3ESCA 4JH0A 2WIGA 4ZV7A 2FJPA 5D7BA 3VXKA 5D6OA 4PSDA 2VJCA 1LBTA 1MAAA 2WU4A 4U2GA 2WIKA 4CI9A 1XQWA 1UFOA 5ALRA 5JZ9A 1S8OA 4BZWA 3R3UA 5EIHA 4IHAA 3FLEA 4B81A 1CUFA 3JYHA 3HC7A 4HS9A 1VOTA 3QPDA 1P0QA 3C43A 1ZOIA 2WG1A 3DDUA 2J3QA 3FWHA 2JIDA 1WM1A 4C89A 2XUAA 2XQIA 3ZWQA 3RLIA 1AURA 3FYTA 3WK6A 5AKEA 4EY5A 1QIEA 3R40A 5AHXA 5DNUA 4AO8A 4NZZA 3D2AA 1ODSA 3BF8A 3W9BA 4RE5A 1E3QA 5IVIA 1LLFA 3HI4A 5ALSA 1EHYA 1DWQA 3H19A 4BP8A 1XZFA 1CQWA 4X95A 4CG2A 3IURA 4Y2XA 3I2HA 4GBGA 3MUNA 2ZYIA 3O95A 2XLBA 2WHQA 2WLSA 3H2GA 3O4JA 3F9CA 2XLCA 3VVLA 3DOHA 4N5IX 2DR0A 4JUIA 3O4GA 5IKXA 4K5QA 4F0JA 3K9BA 4ZV9A 2YYSA 3AZOA 4HVTA 1IMJA 3RM3A 4HRYA 1HBJA 3WK4A 1HKHA 5AK3A 3IA2A 3C6ZA 3AZQA 5JADA 5CXXA 1F0NA 4PSUA 4XX1A 4AB1A 1AKNA 2ACKA 4XJVA 2ZJ6A 1WPXA 2OG1A 1A8UA 5E4YA 4UHFA 1BN6A 1G5FA 4P08A 1JMKC 5JZSA 3V1NA 2QM0A 5AM3A 3V1KA 2ZYRA 5EHQA 3DEAA 1QIMA 3L1HA 5EGNA 2AJLI 2I03A 3W04A 5LZ4A 1R1DA 1VKHA 4U2BA 2X8BA 1H22A 3H2HA 5AH0A 2B9VA 1EK1A 3WL6A 1SC9A 2CZQA 2WQZA 1N1MA 3QBJA 4ZXFA 4KE6A 4Q34A 3HACA 3BIWA 3OM8A 3QM1A 4J0JA 2PSJA 2ONCA 3M82A 4ROTA 4H7EA 4ETWA 5FV4A 1VE6A 5AKLA 5ALDA 4PW0A 2WSLA 3M83A 2B4KA 2XUKA 2PX6A 1BRTA 4K6KA 2VT6A 4NVRA 3C70A 4X90A 4QZVA 3EF3A 3K2IA 1TRHA 4FKBA 1CIJA 5AKYA 1LZKA 4K6HA 2PU7A 4H7IA 2HRQA 1E8DA 1ACLA 5ESRA 5E4TA 1QIKA 4PQEA 2D0DA 1EI9A 1TCBA 3D3NA 1E66A 3C8DA 2PUJA 4C4ZA 1TK3A 1XRNA 2H7CA 4OD0A 5K5EA 2AJ8A 1QE3A 2PSFA 4LXHA 3F98A 2C4HA 3DKRA 5D3ZA 3C5VA 5FKJA 1LBSA 2WIDA 5HK8A 2I3ZA 4DYHA 3R3WA 5YASA 3F97A 1CUAA 4B9AA 2XUFA 4ARAA 2EDCA 3F96A 5FXMA 1WPRA 1TCAA 5IVDA 4BAZA 3V9AA 2XUOA 4AMZA 4RPCA 3PF8A 3IUMA 4X3CA 2OAEA 3HEAA 1ZD4A 2DSNA 1LZLA 4QDTA 2K2QB 1CUGA 1MNQA 3I1IA 1EK2A 2C7BA 4MEBA 5K3BA 3JWEA 4YX9A 2OGZA 2C0QA 4AN0A 2IITA 1P0PA 3H2IA 5K3FA 2C0PA 4BE4A 1G4HA 1GKKA 1AQLA 2XUIA 3A70A 3BXPA 3WL7A 5HZGA 4B83A 3W06A 1CLEA 4LXIA 4AO7A 2WIJA 3QPCA 1P0MA 4LHEA 4LIPD 1WOMA 5CMLA 5AI5A 3I6YA 1YB6A 4K6GA 3I2IA 3E3AA 3WA7A 1EDEA 1XQVA 3H2JA 5ALIA 3WYNA 4BDTA 3AZPA 3P2MA 1MT3A 3AIMA 4AXBA 4KAFA 1W76A 4Q3OA 3WL5A 4H0CA 4V2IA 4EHBA 2OCLA 1ETHA 2H9YA 1BEEA 3WMRA 2C5FA 4DMCA 3IULA 3GUUA 1CFJA 5T4EA 4BB0A 3D2CA 1DX6A 1ODCA 1FFCA 4PV7A 2O2IA 3D59A 1UOQA 4UHCA 2DHDA 2CUTA 5AIAA 3ZPXA 1ZICA 1HQDA 4BAUA 3M81A 4IH4A 1SCKA 4UPDA 3L1IA 3ICWA 4QDOA 3BWXA 5HF6A 3H0CA 3NUZA 4CIBA 4B6GA 1JT2A 3EQ8A 3I28A 3QMVA 2DFPA 4BCDA 5EIEA 2JGMA 4CCWA 3O9VA 5I9IA 2OQIA 3ILSA 3I2KA 3BIXA 1QIJA 5EHXA 2J4CA 5A7FA 4X7BA 4OU4A 5CT5A 5ALMA 5AJHA 3FCYA 3H1BA 4FHZA 1BN7A 3WYDA 2V96A 2HIHA 4U2DA 5AM2A 4QEKA 4WCVA 1EB9A 4JEIA 5CH5A 2CBGA 3WIOA 4XVCA 5DNVA 1DTEA 1HDEA 5ALNA 4X71A 3NWOA 3E4DA 1VZ3A 1EDDA 4P92A 4J0HA 4AZ3A 2R11A 5KWIA 3H1AA 3M3DA 5H3HA 3D7RA 1R88A 4IH1A 4KR0A 5CT8A 3LP5A 1IZ7A 5BV7A 4KE9A 4A16A 3ZI7A 1BCSA 4EY4A 4KRYA 5A62A 2BFNA 4Y2QA 1XRLA 4EZIA 1AGYA 2QT9A 3A2MA 1LPOA 2J4FA 4NS4A 3WK9A 3DS8A 1YAHA 3KD2A 3TJMA 4W1PA 3AFIA 3O9MA 3WWEA 3B3QA 2B61A 4BATA 4J0CA 3BJMA 2HFJA 3G02A 4H7DA 5AM1A 2WM2A 4C4XA 4FLFA 3KDAA 2Q0XA 1UOPA 4Y2JA 4GEGA 1EXWA 1OXMA 4KYVA 1CUBA 4FWBA 5KBYA 2EDAA 4L3WA 4BRSA 2I78A 4DIUA 4DMHA 4U2FA 1EB8A 4JYPA 2XT0A 1RP1A 2WHRA 3EIOA 4FBLA 4H7FA 4BP9A 1IUOA 2ZJ7A 4BVLA 2RHWA 2GBCA 1UXOA 5K3DA 4M0MA 5CH3A 5CT6A 4K2AA 4IH9A 1XRRA 4HRXA 5AIBA 2HFKA 3F67A 4Q3KA 3WWPA 3QMMA 1R3DA 3TGLA 4BRZA 2WFZA 3HLKA 5ALFA 1J2EA 1UK6A 1IVYA 1XKTA 1DWOA 2OCGA 3G9XA 5HK9A 2VT7A 1QIHA 4B85A 4MWSA 3WWDA 4QWWA 5ALLA 2QJWA 1PV1A 3GFFA 3RARA 4EY8A 3QH4A 3R41A 5LZ8A 4X94A 1LGYA 3QITA 2V98A 4OYLA 3AJAA 5ALWA 2I3DA 4W9RA 1U4NA 1MPXA 3IVMA 5JATA 4FOLA 1CUYA 2EEPA 1EDBA 3D2BA 5FOQA 2NW6A 2HU7A 1AX9A 1LPNA 5ALZA 4JNCA 3STTA 2OCIA 4OB8A 4G8CA 4BTLA 2BKLA 3ED1A 1TAHA 3A2NA 1P0IA 1E8NA 2QJRA 3ESBA 2Z8ZA 3PF9A 3FYUC 4LYEA 2QMQA 2QKYA 4ZWNA 1YA8A 2QOEA 3O4IA 2VJBA 4B0PA 5K3EA 2GZRA 3AIKA 4CCYB 1XZBA 5JAUA 2G5PA 3H2KA 4OCZA 1CRLA 1XLWA 1VJ5A 5SYMA 1GT6A 1HLGA 1SCQA 2G63A 5A2GA 2CB9A 4N5HX 4HXFB 1DT5A 3KSRA 3NGMA 4WY8A 2HADA 4G5XA 3BF7A 1A88A 3STWA 2HL6A 5HQ3A 4PO3X 1ISPA 3R0VA 5ALVA 5LIPA 4FNGA 5HKAA 4OU5A 1Y7HA 1YSCA 4MQLA 2C5GA 5HFNA 1YS1X 1MNAA 4FNMA 4ZI5A 5AKZA 1CUVA 3VJLA 2WHPA 4MYSA 5DYTA 3A2LA 1EVEA 1ZJ4A 4N8DA 5A71A 4UFPA 5AOAA 5ALQA 2H1IA 1CUXA 5BWBA 5LKRA 5ISMA 1H2ZA 1DQYA 3DD5A 1H2WA 1F8UA 1R9NA 3WKEA 5C8VA 1LPMA 4I19A 2WUEA 5HKBA 5AI6A 3B12A 4U2CA 1ZD3A 1U8EA 4FBMA 3U1TA 1T2NA 4Y9SA 2WJ4A 1L7QA 5AICA 3WIBA 4XIIA 3STVA 2PSEA 3H04A 1HL7A 5AKGA 1C7JA 5JIBA 2BGRA 1ZD2P 1ZD5A 2PM8A 1J07A 2ZJFA 5JYCA 1MJ5A 3GZJA 3OPMA 4DNQA 3I2GA 4S0XA 4ITVA 2AJBA 2HDWA 3WKCA 1E89A 3IDAA 2XB6A 3G0DA 1XRPA 2WTMA 2PSHA 5IVHA 2WFLB 2Y2VA 2XMCA 4KEAA 3ZLUA 1EVQA 2ES4A 2VJAA 3HRHA 4WFKA 3ESAA 1CUJA 2BUAA 1GPKA 3OG9A 3W05A 3FBWA 1XQYA 3BL8A 1CUCA 2OQVA 1VZ2A 1QJ4A 3GROA 1PJAA 4GWLA 4DTCA 1USWA 3WQHA 3VKFA 3PI6A 3IIIA 2VF2A 5A7HA 1CV2A 1QO7A 2Z3WA 2WJ6A 2HA0A 3PFCA 5HQ3B 1XRQA 4MEAA 3WL8A 1BROA 4GDMA 1XROA 2X76A 3C6BA 1ZI9A 3HJUA 3C8HA 5ALPA 2WFMA 3D5EA 1QONA 1FJ2A 5CTAA 2XMZA 4A5SA 3G0GA 2V97A 4BAGA 2PU5A 2WJ3A 5E2IA 4RGYA 4OSEA 3LIPA 1UWCA 4CG3A 2WHPB 5ALYA 1H23A 4FLEA 5J3JA 1KU0A 5JAOA 1E8MA 3EBLA 1VXOA 3G0CA 1PFQA 3TEJA 1XZJA 4J3JA 5JZBA 4F60A 4BTVA 3I2FA 2ACEA 1X2EA 3V1MA 4DM7A 4EY6A 1XQXA 3MGAA 4EA6A 5JAPA 1E5TA 5AK4A 1O6GA 1XZKA 2XUPA 1WCYA 2PKYX 2G4LA 5ALTA 4DSAA 2J3DA 4X85A 4H18A 3VDXA 5KREA 1J1IA 3CCCA 4QA9A 3FAKA 3LS2A 4Q1VA 1AUOA 4B82A 2ZSHA 1Q0ZA 2XQGA 2C58A 4G9GA 3VVMA 6YASA 7YASA 4G4IA 3WK7A 2XDWA 1K8QA 1QFSA 5CW2A 2H7XA 5C8ZA 3KOOA 5CXUA 4G8BA 1YS2X 2WTNA 4HXGA 2WUGA 1QO9A 4QDXA 4C88A 1QIGA 5KWJA 4X6UA 3WZMA 2QTBA 2HM7A 1FFBA 1ACJA 1X2BA 3SK0A 4UBKA 1IUNA 1UKCA 2XUJA 2XUQA 3ESDA 1RYYA 5CT9A 2JGKA 4X92A 1GQSA 2FJ0A 2WILA 1YAJA 4DLNA 4RE6A 3AINA 4J0GA 1ORWA 2VAXA 3A6ZA 2VATA 3KWFA 5ALEA 2CEKA 3HSSA 5AM0A 1JKMA 1MTZA 5AM5A 4C4YA 4GECA 4Y2SA 2HU8A 2CKMA 3OURA 4F21A 3UMJA 1XLVA 4FFWA 4MWTA 2DHEA 1CUZA 4UBIA 3D0KA 4DSZA 3EQ9A 1VLQA 3U0VA 5FPQA 1AMNA 5JANA 2QUBA 3FVRA 4OUKX 4WFJA 4QDUA 3NOXA 4X00A 3DNMA 4AX4A 1N5MA 2HA6A 2W22A 3ANTA 5DLPA 4QLAA 1QIIA 3R3ZA 5JD6A 1BCRA 4BC1A 1IUPA 4PNZA 1MU0A 1L7AA 5SYNA 3SWWA 1QTRA 2X5XA 1UK8A 1UK7A 3PUHA 1EINA 3LIIA 1W75A 4X6YA 4DNFA 2UZ0A 1U2EA 3CCBA 3N2ZB 2JF0A 2OAGA 4W1SA 1UT6A 1FFEA 3WK5A 1FFDA 2OGTA 4J03A 4BCBA 4E46A 1GQRA 2QXUA 2CMFA 2OLEA 2GBIA 5ALKA 2O7VA 1THTA 1IZ8A 2PL5A 3FLAA 2HA4A 4AZ0A 2RI6A 5FPPA 5T4BA 4BZZA 1U65A 5HFAA 1GGVA 5FLKA 1ZIYA 2XQJA 2Z8XA 1A8SA 5AKJA 2QZPA 5CT4A 1KEZA 4Y2VA 2W6CX 2GYWA 3DLTA 4MXDA 4KE8A 2RONA 4HXEB 3VJKA 4H7HA 1RWQA 4CCYA 2PPLA 1XKLA 1XZCA 3O4HA 5K3CA 3W2TA 5JALA 5AK6A 2P8SA 2RGUA 4Y2YA 3WA6A 4Y2RA 1WHSA 4J0IA 1YCDA 2RHTA 4UBOA 3V48A 1JU4A 1BEZA 3QYJA 1F6WA 5EI5A 2YXPX 1DU4A 3HXKA 3E1GA 5E4JA 1LPAB 4QE3A 1GKLA 1XZLA 2BCEA 1UKBA 5LZ9A 4WY5A 1TKRA 1MX1A 2WUFA 4UBJA 2Y2UA 1VA4A 1ZGBA 3ZLTA 5AKKA 1DX4A 4GLBA 1W6RA 2WKWA 4KAAA 1DT3A 1EH5A 1R4ZA 2QVBA 3H18A 4N8SA 4W63A 2OGSA 4HAIA 1QZ3A 3QPAA 2BUCA 5AK5A 1YASA 2AJDA 4TGLA 3PFBA 1BS9A 5LZ5A 4LKOA 3GA7A 5JD4A 1CQZA 3DL4A 2PUHA 1Q83A 2ZYSA 3G0BA 4UHEA 3WLAA 4JYMA 1CVLA 2B20A 4G8DA 4EUSA 4H35A 4E14A 3STUA 3MUOA 4UBNA 1N8SA 1C4XA 1MAHA 3QMWA 2XMBA 5LZ2A 3PUIA 1NX9A 3DYVA 4FTWA 1QOZA 4EBBA 3ICVA 3R3XA 2BUBA 2XMRA 4CFSA 3I6ZA 1J06A 2VSQA 2ZSIA 4G9EA 5LYYA 3I6MA 2QXTA 3DOIA 2HRRA 2QUAA 1MN6A 1SCIA 5JASA 5ALUA 2WFLA 3EQ7A 3FNBA 5FP0A 1SOMA 2XUHA 5DTJA 2LIPA 2Z3ZA 5DTIA 2XI4A 1LNSA 1JFRA 3ZV7A 1OCEA 3IB3A 4YK7A 3C87A 1VXRA 3MVEA 3R3YA 3W9UA 1XLUA 5F4ZA 5A6VA 2HA5A 3AUKA 4G4JA 4Y2UA 2AXEA 5CURA 4MYDA 1CUSA 4I3FA 5AKHA 1LPBB 2Y6UA 3RK4A 4KE7A 5AM4A 4B9EA 4GI1A 4AQDA 2HHAA 4G1FA 2R8BA 1JMYA 1XZIA 1XZGA 1YB7A 2JEZA 3V1LA 4QLOA 4YASA 1N5RA 5I7UA 3IUQA 5EHZA 4E15A 4RNCA 1Y7IA 5HF5A 5CRIA 4CIAA 3WJ2A 3YASA 5ALJA 4ZRDA 4UHBA 2Y1KA 1W1IA 3WKDA 5ALGA 1TQHA 5DYYA 2FX5A 3I1YA 1WB5A 3GBSA 4TVKA 5CH8A 3UUFA 1ZIXA 1UKAA 2DHCA 1CUEA 3WWOA 3G9TA 4I4CA 1QTIA 2OXEA 2XUGA 1JI3A 5CBKA 2QRUA 2O7RA 4UHHA 3H17A 4YPVA 1AZWA 4A23A 1FSSA 2XQKA 4OB7A 3R3VA 4WDRA 2E3JA 2VTVA 3PICA 2H7YA 3IUNA 1OILA 2O2GA 3BDIA 1QIDA 3ZLVA 3G0IA 4H7JA 1BU8A 2QS9A 1W4LA 3G7NA 1A8QA 3DQZA 5AI0A 4BDSA 1EA5A 4BC0A 1Y37A 4F5ZA 4ZGBA 3LCRA 2IX9A 4LXGA 5BWCA 4B84A 4WDQA 1BE0A 3QZUA 4D9JA 4J0DA 2XMQA 1Q0RA 2WU3A 4BE9A 3HABA 3DYIA 1SFRA 1LPSA 2HU5A 4MJ3A 4HTAA 1JU3A 5T4HA 5JAHA 3WI7A 1G42A 2GBGA 1XFDA 4Y7DA 3C6YA 3WZLA 5IVKA 3DKKA 2IIVA 1CPYA 1QIFA 2ZYHA 5ALHA 4WJLA 1CUHA 2JGLA 2JEYA 2YASA 4P93A 4X91A 2D5LA 1DINA 2GYVA 1M33A 4FMPA 3RKSA 5A7GA 4UFOA 1B6GA 2YH2A 2ECFA 4INZA 3VISA 2WG2A 3VJMA 4AMYA 2CJPA 3C5WP 3T52A 4DMFA 1QGED 3AILA 2O2HA 1I6WA 1VE7A 1GPLA 2XE4A 2VAVA 4QDZA 4FDMA 3FYUA 5EHNA 1ZGCA 1JJIA 5T4FA 3SC2A 5DWDA 5FUMA 4Q82A 1K5PA 1GPNA 5AI4A 4B0OA 1CUWA 3GELA 5FDFA 3S2ZA 2BAGA 2XMGA 2RIPA 4HZGA 1JJFA 5BOVA 2GBFA 2VJDA 5LP1A 5DNWA 3C6XA 1FFAA 4MQMA 1CUIA 5JARA 3DL7A 1GZ7A 3C45A 4EY7A 3UUEA 4IO0A 4G4GA 1MX5A 5DJ5A 1W52X 1XZEA 3IUJA 4B80A 3FLBA 2HA3A 4U2EA 5AO9A 5AKIA 5HF9A 2WG0A 4E11A 1Q84A 1CUUA 2VEOA 3HYSA 2ROQA 4UFNA 4DNOA 4X93A 4L0CA 5JD5A 4BYMA 1CUDA 5AI8A 3CXUA 1WB6A 2XMDA 4Q05A 4X97A 4KRXA 1H2YA 4B7ZA 3BE8A 4H7KA 3X3HA 4P9NA 5EIAA 2QR5A 3S8YA 4W1RA 1DQZA 1AC5A 4BBZA 1K63A 3KWJA 3Q0TA 5DYWA 3WKBA 2GZSA 2DQYA 4LYDA 1K4YA 3SX4A 4Y2PA 4FFVA 1NU8A 4OPMA 2JGJA 1T4MA 1R50A 4UBMA 4OB6A 4CG1A 1YR2A 1ZJ5A 1C7IA 3WJ1A 1HPLA 1TCCA 1MO2A 4Q3LA 2OPHA 4M0FA 1H2XA 4GHWA 2DCMA 2Z5GA 3L1JA 2PVSA 1D07A 3DJYA 3FVTA 3FSGD 1CEXA 5K3AA 4ARBA 4UHDA 1B41A 2VQ6A 5AI9A 1XZHA 4O08A 1XRMA 1A7UA 1VA5A 3ANSA 1UZAA 2Y6VA 3FYUB 1ZI6A 1WB4A 2XUDA 5HF8A 1G66A 5IH7A 4GW3A
chains in the Genus database with same CATH superfamily
4ZJUA 5IEJA 3BRQA 3NC4A 1M3SA 1KMIY 3OVMA 5SY9A 1Y33E 4RU1A 1RLUA 5DGTA 4UNPA 3F6EX 1T4CB 3NHWA 4OQQA 4P8RA 3RRZA 2VDWB 4X3PA 2O5CA 1GYRA 1FYEA 2OSVA 1IDN1 4L3VA 4RK7A 2ZS8A 1EM8B 4ZT6A 2W42A 2HA2A 2PWYA 4LXYA 1MDBA 2JGIA 4JP8A 1XB2A 5A05A 3RC8A 2GM4A 3EXHB 4E2XA 3WG9A 4C03A 1DS6A 3CUUA 1KJJA 3PUJA 1RABA 1VYUA 1YHZA 2HX1A 2J9FB 3ER6A 3A25A 4AICA 2I91A 1L9KA 4RBNA 3JPYA 1H2AS 5E2BA 3T1QA 3WK8A 3V4LA 2O1SA 3GVPA 3OOSA 1EU1A 3GMSA 3LKVA 2F3QA 3KJZA 3N87A 4XARA 2BGNA 4FYHA 4GNRA 5K0NA 2Z2JA 2Z95A 3RFXA 1IXZA 4UBLA 1CS4C 1PS9A 1W9MA 3LW8A 4DYVA 1O58A 3GUCA 1I2ZA 4ZCSA 4J1TA 1P7WA 1ZNWA 1KGDA 1M2VA 1UK9A 1V45E 2ODNA 5F33A 1IUKA 1VYVA 3O0DA 3PD7A 4FLMA 4OLJA 2AC4A 3FSGA 3K0AA 2AOVA 4JBHA 3QEMA 2D1RA 3DEFA 1H4VB 3S1AA 1CR6A 1P5RA 5H59A 2A78A 4U7FA 5K0ZA 1RXVA 1J90A 1SVOA 4KJZA 1NNI1 3TKAA 4JLJA 1D8TA 2POCA 2G72A 4LJLA 2NUTA 4YP7A 4K3VA 1GPYA 5L53A 1K6EA 4WA8A 2ZDQA 2JD2A 3KD3A 1UXJA 2IIQA 5CDFA 3ZGYA 4H0NA 4BVKA 4ZQCB 2ZI4A 1TVMA 2ZRHA 4O5OA 2IL1A 2P2CA 3IGFA 5AHKA 2BVNA 5DTEA 3J7AC 4DIOA 2VVTA 3SDZA 2B8JA 2QBYA 3D4LA 1CJKC 3PB3A 4NCIA 4C6HA 4DAOA 1COWD 2JBWA 1Z38A 1PO7A 2B2CA 2VUTA 3EGIA 3BFJA 4RY0A 5F3DA 1KNXA 3HB5X 4AY5A 5EUBA 1XZDA 2X58A 4UXIA 4G84A 1FUUA 2BMAA 1AHHA 1GU7A 2RHJA 1OLUA 2ADOA 3N2NA 3VMMA 4MW0A 2HBQA 2GJ4A 7ABPA 1ZUHA 3PXUA 3K9WA 3TLGA 1H2HA 4F04A 5FWXB 3IJRA 4HEHA 2JLYA 1I14A 2GVNA 4C87A 3B20A 1FXUA 2PWBA 4PF1A 1PT5A 4S1WA 4US0R 5I8PA 4KN9S 4FEAA 4YRZA 3O94A 2JCXA 5LKAA 3QF4A 3RHTA 4F92B 3OFND 4KAJA 4OO3A 2C31A 1AGPA 2AYXA 4BX0A 3D8BA 1UMBA 4ZMSA 3GIDA 4RTLA 1AD2A 5FPKA 1OPRA 3D5QA 1JJAA 3EMKA 4P7FA 3EB9A 2I80A 4DYDA 1P1BA 1ISIA 1IEVA 3B5EA 3OZ7A 3PQ3A 2GF9A 4OHOA 1J00A 1QFMA 4FMCB 5ICFA 4ZXPA 3PENA 4GI7A 4WJZA 3FPGA 4RD0A 2GPBA 2XKAA 2YINC 4B7CA 4EECA 1H9CA 1BAPA 1QHFA 2JGAA 3TTXA 1I7LA 3IBTA 3I30X 2J3LA 4NESA 5LZ7A 2WJWA 1AHNA 3VOAA 3G89A 5JISA 3R7NA 1DSSG 4BO3A 1VLJA 2CEAA 3LF1A 4UUQA 3Q0EA 4G67A 5C8XA 1WUYA 4KZKA 3ZXYA 3JY6A 4B4VA 2A35A 2JLBA 1O95A 2BCGY 2NPIA 2RMKA 2QDKA 4RZUA 4CZ2A 4QVIA 2BJHA 3N05A 4AO6A 1YA4A 3I2JA 3W2FA 4NKRA 1VJCA 4EVQA 3E5NA 5KOJA 2MHCA 3EBOA 2CFSA 3UHFA 2Q5IA 4BCCA 2P2SA 4XFJA 3PS9A 4R1MA 1P2FA 2ONZA 2PA0A 4OHMA 2NO4A 3KJXA 2VKTA 5BN5B 4FFPA 2O5RA 4N5LA 3RUCA 1RI5A 4GE3A 5CYOA 1X8KA 3O1LA 4M55A 3DAFA 5EQTA 3GMDA 1HT3A 4G89A 4B45A 4Z49A 3F8WA 3DFKA 1I30A 4ERXA 3CW2A 2X2OA 2F8LA 1ODTC 1K6MA 1Q50A 1ECBA 1RJEA 2GYYA 3UQYS 1RJ9B 2ZS7A 4MHSA 4B3MB 1N2SA 1BXGA 3MCZA 3OCWA 5DDIP 4PLVA 4B2LA 1JG1A 1Y4ZA 3IOMA 3LBFA 2GKOA 3IOEA 3HJNA 1Z45A 3LK7A 2C20A 3AK4A 2GA9A 1DAIA 4J16C 3FOBA 4MJ7A 5EP1A 4D45A 5EXPA 3KT0A 4KN5A 1LX7A 1TJPB 4PHHA 2Y93A 2QNIA 2UDPA 1CJBA 3DMTC 4Q9JA 1AT1A 1EX9A 1JU9A 4ZRMA 4DA9A 1GITA 4DXHA 5GIOE 4DNPA 1Z5VA 4LHWA 3UAWA 4EENA 3M6UA 3PDUA 3QWHA 2LD4A 5G4KA 2E85A 3G9UA 3BXEA 5LLSA 4R8RA 2YY7A 2JCGA 3JW8A 1E3WB 1HM5A 3CLKA 3N0TA 4FC6A 4ONEA 2Y99A 3VAZA 1VLZA 2RHCA 4HQRA 1KORA 3KDPA 1BGWA 1JAXA 3NEAA 3AG6A 1A5TA 5JYBA 5CIYA 4QIHA 2DEUA 4ZV7A 3QKIA 4CKBA 4JBXA 5EAIA 1F1JA 3KPJA 5JSZA 1LQ2A 2FJPA 3H5VA 2QD5A 2XJ4A 4TS1A 4JR0A 1FS6A 1PG5A 3LQ2A 3OOHA 3S99A 3L46A 2ZR0A 2WI8A 3H9EO 3MTJA 2PVPA 2J87A 521PA 4RAQA 2GCOA 3FUUA 1MAAA 1XF9A 5FAXA 1MD9A 3OP1A 4FOSA 3V4OA 2Q6KA 3O2JA 3OPXA 3O8QA 4QEZA 1XMXA 4IEIA 4QQKA 3ADDA 4IHJF 2C5BA 3WQSB 2GJKA 5E3IA 1IG3A 1XCPA 1A98A 3KSMA 1VCHA 2V6GA 2YW9A 3K0AB 3OWHA 4R1OA 5ALRA 4YP9A 4D79A 2GZHA 2CNWA 3ED5A 1P9NA 1WP9A 3QEMB 3R3UA 3TZHA 3W5JA 1RE1A 3S1AB 3V8NA 3PXGA 3LVRE 3FLEA 3VDRA 4V3BA 4BX3A 1R8YA 3L0PA 1CUFA 3JYHA 4WZAB 2CDCA 4FR5A 5JDCC 3SQLA 3ZWAA 1C30B 1U9IA 2Y1FA 3DHYA 4JU8A 4HS9A 2NUTB 4XGIA 1YVEI 1JUDA 1GV0A 3L5KA 4L51A 3R3SA 4HTFB 3FF1A 4UM7A 2WG1A 1FL9A 4Z86A 1WX1A 4YAIA 3L8MA 1XP5A 3DDUA 1N7GA 3HEBA 2E2WA 2H59A 3H2ZA 4XWTA 1N2GA 2TMYA 3OMLA 1TAGA 3K72B 2VJMA 3BWEA 4BS9A 1FMLA 4C89A 2HXSA 3AUFA 1V37A 3OQHA 4Z2YA 4DWWA 3CWCA 1KH2A 4OGWA 5DRYA 1OLUB 1BWPA 5IH3A 3REOA 2H9AA 3NM6B 1NJSA 3IXQA 4EMSA 4IJUA 1YS4A 1KY5A 2JLZA 3WRYA 2GBPA 1VHTA 2QUHA 3RVDA 3ZWQA 3TLGB 1AURA 5DBFA 2KLHA 3WK6A 4XWWA 1PF7E 4WXRA 3JR3A 3GLGE 3WLPA 4Z7OB 2HW8A 3V8MA 4LGCA 4TWAA 3ANNA 2VTBA 1WXFA 2Z56A 3FRJA 4LUCA 1J9GA 2XVXA 2YWDA 4BBJA 1O4WA 1YO6A 4B4OA 5HW0A 4AO8A 4NZZA 1PSWA 1ZRNA 1PYGA 4BNIA 1KEEB 2GHRA 1UMBB 3D2AA 1L0BA 3GNQA 3QV2A 3AERA 1SC6A 1SBCA 3E18A 4RE5A 3A4NA 5IVIA 3V7NA 1LLFA 1SBZA 1S3FA 3K2QA 3R5JA 3REFA 3B89A 5BSKA 2BFCA 2FUCA 1T5HX 1YGYA 5DXFA 2ZPAA 1UAYA 1V11A 1ZYUA 1YVUA 1M2FA 1JEAA 4IEFB 3G5UA 4I4TA 5H9VA 5IBRA 5BO5A 2JCSA 3G0OA 2ODTX 4QOIA 4WLVA 2JLQA 3G2PA 2EG5A 1SBHA 2YFHA 3GGGA 3QMPA 2EJTA 3BMOA 4YTEA 1E2UA 1W5FA 5FA8A 4QJIA 1OGIA 5A1JA 4R9NA 4KIWA 4Z51A 1AXEA 4OI2A 1WE2A 2H1SA 3BWMA 1FZQA 2IE0A 2ZYIA 4RPLA 1GPAA 2F17A 3HP4A 5A3JA 3P0EA 1HOTA 3LDGA 3LJKA 5HDBB 3TI7A 5J23A 3UG7A 2WMDA 4DJEC 3O4JA 3ZBQA 3QVLA 5KOJB 1J39A 1T8TA 4I1SA 5K03A 2XLCA 4YS6A 2PFKA 1M7BA 1JQEA 2PMFA 5DM2A 4ZVUA 5THKA 3T7DA 3LF2A 1OX5A 2QTTA 2AQ8A 2QQGA 2W5UA 2XHZA 1VC2A 1D2GA 2AG0A 4QPJC 2HLDD 4DQXA 3PFHA 2QAIA 2ID8A 5LA6A 3GRZA 3PHJA 4EW3A 3I5MA 3OECA 3ZQJA 3VTFA 4B3JA 4F0JA 1ZK0A 3PP8A 4Q21A 4LOIA 2YYSA 2F6RA 3DWIA 1RFGE 4NBRA 2Q1WA 3KLOA 1KJYA 3FWYA 4AJ9A 1LJLA 4WTOA 1R0CA 2B34A 4HFJA 1BXGB 4HRYA 5DISB 2D2XA 3ZV5A 1H3EA 3CLRC 3WK4A 2O8FB 4E5VA 1ZCFA 3EAFA 4K9DA 1EHCA 1US8A 4H0FA 4NWIA 3FTEA 1VKOA 4OG2A 5ARBA 2QZ9A 1IK4A 1AK2A 4JT4A 5JADA 3R5XA 3E2IA 4XX1A 4R1UA 3PUXA 3MRTA 1Z4NA 5ERXA 2ACKA 1DKLA 3B9BA 5BYKA 2WSMA 1L5RA 2ZWAA 1KMCA 3HR8A 3LC2O 4LVOA 1D5CA 3RLFA 4F72A 5DIFA 5FYQA 2HMSA 2DUMA 2RGDA 3BXFA 3OF2A 4FYXA 4KKVA 3SGLA 1JMKC 3GYGA 1E6CA 4F9GA 1USUA 1Z3IX 3P9QA 4N0MA 4PCLA 3VSEA 1ZQ1A 1ZK1A 1ODLA 3V1NA 1AKRA 2YTZA 4XDYA 3TUIC 2QTHA 1X1BA 2NTEA 4MWGA 1R00A 4NNOA 5DE3A 5AM3A 3R75A 3V1KA 1XNRB 1RC1A 1L7XA 3DEAA 3UPUA 3KM0A 2CXPA 4S1TA 1FK8A 5JS8A 4QM6A 4CLOA 3PCXA 1JF8A 1KL7A 1RMYA 2GCOB 3DAYA 2HH9A 3NOQA 5JV5A 3CEHA 3GCXA 4DHWA 1UPTA 2HO4A 2JJ2A 3D3JA 3LY7A 3MILA 3O8QB 4D0GA 2I03A 2CHQA 4C7BA 3MUFA 4MAMA 1DDGA 2W58A 5AFSA 4V24A 1X9GA 1O1YA 3D8UA 4UOQA 4K0RA 2MTBA 4Q02A 1G64A 1LC3A 4TLLB 2HPVA 1H22A 5AH0A 2EVWX 2B9VA 4QGFA 5M34A 3NWJA 1EK1A 4JJGA 4E0BA 2FI1A 2HEIA 2ZRQA 4YV7A 1K68A 2YV1A 1PL6A 1R4NA 1ZSVA 3LI2A 2RGXA 4YB8A 4ZXFA 4QT4A 4FMCF 1FZTA 2PKWA 3IPAA 3OCVA 3BN3A 4UC0A 3BIWA 3DE6X 4K81B 2R6FA 4WOKA 4KN8A 4POOA 3V5NA 3OUTA 3TX6A 2VHVA 3IV9A 1R37A 4RVCA 1C9YA 2NOAA 3UA4A 2VJMB 4O2BB 3M82A 2JG3A 3K1AA 2RG7A 2RKWA 3M6VA 4ROTA 4MV4A 3F7TA 1UBFA 3SDSA 1Z0ZA 4Z9XA 1HQYE 3B5IA 1PJQA 5EZYF 2OK7A 4ZHSA 2GM5A 3I12A 4O8ZA 5ALDA 3IJEB 2QRGA 1YD7A 1NLUA 4QXQA 1H4SA 2R2AA 4NABA 2PQ6A 3M83A 2YBEA 3R6DA 1Y6RA 4IKOA 1XAIA 2H51A 5KYUB 5ILOA 2P7HA 2I8AA 1U6KA 3HN2A 3U4QA 2QV0A 3AVPA 3KAKA 4C7VA 2PKRA 3IJPA 4OYRA 4AL4A 1PFUA 4IGAA 1P80A 3JR7A 1RQNA 2E9SA 4PRLA 5EL0A 2CJXA 1P0CA 2JK1A 1E8DA 1WQ1R 2ODPA 2WF5A 5JJ5A 5JS7A 4JV5B 5ESRA 2A92A 1B42A 2VFAA 1QIKA 2BFCB 1O3YA 4H6WA 3HGQA 1V16B 1V9CA 2BHNA 2Q1XA 3K92A 4WXHA 4I4TB 2K87A 4MP8A 2FGJA 1E66A 2Q4RA 3JASA 4ZO7A 2FTKE 1RD4A 2O3TA 5LN1A 1NV8A 4HNAB 2GILA 1LY1A 3SYNA 1M1YB 3JQRA 1DXYA 5FLEX 1R0LA 4N3BA 3SP1A 2IUTA 4DB2A 3G5AA 2IPNA 4X1YA 1F60A 1XHEA 2IWRA 2BH9A 1FFXA 2H7CA 2Q1YA 1R5BA 3GJ6A 1SCAA 4MV0A 2Q8QA 3SYLA 3HU3A 2JC3A 3BBPA 4CM9D 3EQZA 1Q1BA 1SZJG 2MU1A 4AP5A 2NZJA 3FWPA 4PPQA 2JKYA 3DE5X 5EJ2A 3T7EA 4WZBA 3WZ2A 3F98A 4HN9A 5J1SB 10MHA 5GVRA 4IJVA 2OEPA 5LA6B 4EAAA 2C9YA 1M2WA 2R79A 2OO3A 4OJKA 4YROA 2WJYA 4A0SA 2GTHA 2G9ZA 4HB4A 5ECGC 2I55A 3AL2A 4JJZA 2JAUA 4B7AA 3TSAA 1O5TA 4XCXA 2R6JA 3DBIA 1PD0A 1XR3A 5TQ0A 4DYHA 1ZK2A 2VDLB 5DOZA 1CUAA 4ARAA 1US8B 3O1HB 4B6JA 1LVUA 3TF5A 1VPVA 4INJA 4OVKA 1Z4LA 3NOVA 1SG6A 3IJ5A 4MHOA 3HE3A 1MOPA 3LKZA 2XYVA 2YWEA 1T9GR 4NE7A 4Q1CA 4X44A 1ESDA 2CFTA 3A3YA 3WB0A 2PWPA 1LF0A 1ZEJA 4BAZA 3WHPA 4UQPA 3A3OA 3PR1A 1EK5A 4KQJA 4MOWA 5C8YB 1QF7A 5IUNC 1ZPDA 3N74A 4K6MA 2AYZA 1EX6A 2W6OA 1RT9A 4WZ6A 1XNQB 3BXZA 3Q3CA 4KV7A 3NT5A 3EXG1 3GLSA 3M9XA 3IUMA 1DAOA 3OP4A 4HDMB 4X3CA 4Z54A 1ZD4A 2DSNA 3AXTA 1KS2A 1U7XA 5TY0A 4BO2A 4JP5A 3GHYA 2Q41A 3I1IA 1DJLA 5AYVA 1TJ4A 5I4KA 4RMJA 4CLOB 1SVKA 1YVPA 2JLVA 1F2TA 1KZGB 1WF3A 4YUYA 2YJGA 3LTEA 3DE4X 5K3FA 1PGJA 2P77A 1Y0BA 5TE9A 1I2DA 4V3CA 4C7KA 5GJVC 1CRQA 1KBZA 2ZT6A 4DLZA 2PGOA 4B83A 1DBVO 2PUVA 4LMAA 7AT1A 5KB3A 1BHSA 1CLEA 3JQDA 4EQ6A 1B8OA 4WGFA 3ZX5A 2PXCA 2YMQA 5ADHA 4GXTA 4LHEA 3CZCA 3HDGA 3L49A 3MOIA 1G55A 4DG9A 4EL0A 4GQBA 4R68A 1PNOA 2WMOB 1R4NB 1YIOA 1YMVA 3B85A 3K9CA 4MDYA 5CMLA 1G8HA 4ZCLA 3W5VA 4EY3A 1KTVA 1X42A 4XXHA 5IT5A 4V1CI 1J2TA 3WA7A 1CS0A 1Q12A 1UPCA 2VTEA 2GXSA 3QOFA 3A6GA 3OQVA 3H2JA 1MC5A 5CBPB 1XNJA 2E1RA 1JHAA 2AT1A 3PHBE 1V1MA 3IEKA 4QQNA 5HE9A 3ZHQA 3K1AB 4F85A 5C5IA 5EXTA 2HHCA 3AZPA 1JR3D 4AXBA 4HSEA 1F3LA 3MMZA 4KFRA 2ZGVA 1Z2PX 2VP9A 4FGJA 3CCFA 1L4HA 1F9AA 4FW8A 5K6TA 4MRPA 4KREA 1LLQA 3CRMA 1NOIA 4BLOA 4HV4A 1E1YA 1WB9A 5KYVA 1OFUX 3RTBA 3SJZA 2CZGA 1XPRA 2WAMA 4I4NA 5TB5A 1HTBA 2R751 1QTNA 4I50F 5LIPA 3G6WA 2BKUA 4EGCB 3HKBA 3C7AA 1ETHA 1C7EA 1Q6YA 2V9PA 4ZICA 1X3SA 2JLCA 2Y27A 1NXWA 4FPXA 1EWRA 1E0DA 2C5FA 5FBRB 2KWIA 4AIIA 2FR1A 6PFKA 1TM4E 5DMXA 1TF2A 2F8MA 2YYAA 2VQEB 1RYHA 3FFXA 4LSZA 3UK1A 4PNPA 3WMXA 1OBOA 2X40A 1SGWA 3GUUA 1TX4B 2H2WA 5T4EA 3C15C 5BSEA 1YFJA 4ZCQA 4O4LF 1KVRA 4Q4AA 1LSSA 4V0OA 3UMFA 3D2CA 4JI5B 3JASB 1CP2A 4GKKB 5EN4A 1X1AA 3R24A 1A72A 5ILQA 1C80A 1PQYA 4PYRA 1M0SA 1KKMA 1U3WA 4JP3A 3AF6A 4L5BA 3BAZA 2W7TA 2ZCJA 1X0VA 3ANLA 3EZGA 1V2HE 1JVNA 3JD1A 2XGJA 2IYVA 3BMCA 1DAHA 4DBLC 1W8DA 4X1YB 4TWZA 5K4GA 3LUGA 2IPOA 2C57A 1CJUC 3PQ7A 3Q3JB 2VSFA 1XL1A 3GC6A 5A3RA 1BG6A 5TS3A 4D9IA 2Y4OA 5FI0B 1PEYA 3Q7IA 1HQDA 2EG9A 3JVIA 3W2HA 1H8EA 2PGXA 3LZ6A 2JNWA 3M81A 4AS1A 2VHEA 1SCKA 1E4OA 3ELDA 4ZYTA 2CLFB 2I29A 2XRMA 2CLCX 4QGGA 4UUAA 1XVVA 2R6AA 1GD1O 4PM4A 1EVIA 1GN9A 3MJRA 4WZBB 3C3AA 5GJBA 3LHSA 3GLIA 3MC1A 2KQUA 1IXRC 5K0GA 2UUBB 3EQ8A 1Y6JA 3QMVA 3TOXA 2XIQA 3FPCA 3GL9A 3NIBA 1E99A 1LBEA 3CY6A 3EPRA 4URYR 4HMOA 4HHEA 1WXGA 3BIXA 5TQ0B 2O2ZA 5EP3A 1QIJA 1U1CA 3KCNA 3PIIA 5BR1A 3A4LA 4G36A 2EIXA 2VHXA 4HDSB 5EHXA 1EZ4A 2YFKA 2BEKA 4X3OA 2AI2A 3RJZA 5A0TA 1MTOA 5IJWA 2AZDA 2ZRLA 4Q4JA 3RSZA 1FC0A 1U7WA 1DHTA 1AB6A 1GU0A 1R2QA 3IUYA 2O7QA 2R97A 2WA2A 3OEEA 1A7AA 1V9LA 3WJAA 3ICPA 1IAVA 2IU6A 2SCUA 3OLXA 3SCZA 5IWCA 3WYDA 4CL2A 3MTEA 3EGWA 5I9TA 4WL0A 5IBQA 4J0EA 4LCEA 5T6BA 5AJTA 1NDQA 3NBFA 1W8IA 1HUQA 1EB9A 1YACA 4K9QA 5JJIA 1ZC3A 4D82A 1NVUQ 1FPQA 4DCTA 2H0QA 5CHYA 4HGYA 3UKJA 4Q7LA 3EDOA 4RS4A 4YT5A 4TS3A 1DXOA 2QTGA 5GJWC 3SSOA 3SN6A 3ZH9B 3UJ6A 5JT1A 1HDEA 2DOKA 2OCAA 2QG4A 3A58B 1FRZA 3K1ZA 4D3DA 5ITVA 4O2BF 1CIVA 1N8NA 1U2GA 1EFTA 2WF6A 3HFRA 1WEHA 1P8JA 3BIJA 1UPFA 4LY9A 3E4DA 1F2TB 4KITB 1G21B 5C9ZA 1BXRA 2I4RA 4TZ0A 4MI1A 2R11A 2IHUA 4FDVA 1YZUA 1YR1A 2H5IA 1LNZA 2OK8A 3KYIB 3RU2A 3VPBA 4MUGA 2RG1A 1NNEA 4MWEA 4NDNE 3D7RA 3ZHRA 1U6JA 3AVQA 1CBUA 1MB4A 3M1LA 4M49A 4XDHA 1TTQB 1JG7A 1GDHA 1MQ9A 2G83A 5CT8A 4DG8A 1YDFA 4QUDA 2X77A 4EI7A 3RC1A 4R71A 4KE9A 5BV7A 1JILA 4QDKA 4EQ6B 4GLFA 4X8HA 2HDNB 5JG7A 5AVOA 4C4AA 1STOA 2HB6A 4EZIA 3CLUD 4J6EA 4O4JF 4EYEA 2GXAA 1D4OA 1K6XA 1U9CA 4N12A 4NS4A 3R0ZA 1F8XA 4EVRA 1EVYA 1ZL0A 2QENA 3NVMB 1S9HA 2YZGA 4LPKA 3PGMA 3KQNA 4KTTE 1NJFA 1IIRA 4PYQA 1WW3A 4W1PA 3T7KA 4JHXA 2YQ4A 4P32A 1XTBA 2UYHA 1SVSA 1L5VA 1V1MB 4TL6A 4ZJZA 2B61A 1T9HA 5LU9A 2B8WA 4M1ZA 2XVMA 3TB4A 2BLNA 4M76B 2CYAA 1UFQA 4CFYA 1Y34E 3THWA 1T6NA 2WM2A 2BM1A 4C4XA 2RARA 1G9SA 4EJ0A 1TVEA 1P2BA 1ZXBA 2WAXA 4FLFA 4GWKA 3KDAA 4WQMA 5F3RA 5FD8A 3WLHA 5LR6A 1A9ZA 1DAGA 1T6BY 3L6UA 1CR0A 4JWTA 3TIGA 5BUQA 4W5OA 2JI4A 3ORQA 3DCIA 1XTZA 2AYYA 3OU6A 3TLYA 2WWGA 3NIGB 5TNXA 2PD6A 2IWHA 1OXMA 3ZU2A 3U61B 1ZH8A 3OKPA 4M37A 4TKZA 3B3AA 4IRXA 4WBXC 5IC6A 3IIJA 1P1JA 2QR2A 1U9JA 5D2CA 2EDAA 2ZRFA 3H1PA 3MWJA 2I2FA 1R0XA 2HQ1A 3RBAA 4DMHA 3DDCA 1SQ5A 3ML1A 1CETA 4B40A 2ZTHA 4EM6A 1KAOA 1NWCA 2VO1A 2GJAA 1NGSA 2PX3A 5HYVA 4W4TA 1TGVA 4OA8A 1KZ1A 1QHGA 3VZBA 4PQYA 3A1WA 4BP9A 3KYBA 3H5AA 1IUOA 2X9QA 3DVSX 3IQFA 2Q3FA 4KDEA 1QXSA 2C88A 3FCCA 4YRKA 2XVYA 1QE0A 3MCAA 2HJHA 4MVWA 2O4UX 1V3UA 4BVLA 3BMCB 1L4BA 1NN0A 2CE7A 2GBCA 1PAUA 1RPNA 1Y1KE 1UXOA 3PDHA 2ZRAA 4D8TA 5C8YF 3T5MA 1QM5A 4KCGA 1FP7A 3F3KA 4DMRA 4IH9A 4IJWA 3HMQA 2IOFK 1XRRA 1G8PA 2Z8YA 4HRXA 3V7FA 5AIBA 3QEJA 2VH5R 3UVEA 2VOEA 4D3ZA 2ZJ8A 4WNYA 1FLVA 5B53A 4Q3KA 3WWPA 3KQHA 3QMMA 2XB4A 1LLDA 1X8JA 2V1XA 3BSFA 3RVBA 3TIIA 2WFZA 3KKPA 3MB5A 1FUIA 1DBPA 1OI2A 1J2EA 1Z5WA 3F6BX 3IAM6 3PTZA 5ALFA 5TMDA 1SXQA 2G5GX 2KHZA 4KVGA 4B6PA 2EBFX 5HK9A 2C4WA 3OIUA 5FPYA 3CZ5A 2CFCA 2P4QA 3DKPA 2AMVA 4HKTA 1ARZA 4LJRA 3NS7A 1GQOA 4B85A 4ZANA 4MWSA 4G24A 2JAXA 3H8VA 5KKNB 2FZVA 3WAKA 5EMLA 2CUKA 5L4LA 3BMQB 2V7PA 1XLTA 2GAAA 1YQXA 4F1WA 3DFFA 3GFFA 2YMPA 3RARA 1CZNA 2VQ3A 4M53A 4Q4JB 1VCMA 3R41A 3OX2A 2IZZA 3ITNA 2V98A 1Z06A 3ENZA 3BB1A 4HMQA 4OYLA 5G2OA 2C7VA 1A8PA 4OUDB 2P27A 4TWJA 5CK4A 5M5BA 5ALWA 1N2CE 1C4OA 1XP8A 1ND6A 2G0TA 3CUSA 3N8GA 1U4NA 1DBRA 3SZRA 3U3XA 1ETUA 1BHO1 2QUIA 4JGIA 3OT1A 3ETDA 4G0WA 2Q62A 1SQ0A 1N0WA 4WUVA 2YRWA 5HCNA 2I7XA 3KZXA 3G7SA 1CZKA 3QNWA 5I47A 3RWBA 2XKJE 4W9MC 3PDIA 5BWNA 3OBBA 1WPGA 4PLCA 3D2BA 2D54A 2ASEA 4C20A 1CDOA 3C7DB 2HU7A 2XT9A 5AJYA 1VKRA 1XA4A 1LPNA 1I33A 4BO8A 4YXWD 3I5UA 1HDIA 2PFSA 4DM3A 1BXRB 1YL6A 1J0CA 3STTA 1OVMA 1ESMA 2A0UA 3OQNA 4IOMA 2VWHA 3L4KA 1UAAA 4JL8A 2ZRMA 2XH8A 1F14A 1X15A 3E8MA 4YQYA 4BTLA 1HDOA 2CFIA 3KZOA 3TVYA 1FPMA 1IHYA 4CIYA 5JXWA 2ZUEA 4IMIB 5CFOA 4ARZA 1TAHA 3S2UA 5KQGA 3AEKA 3ZV4A 3IS3A 3S2EA 4TUYA 4MUKA 1CJMA 3FX2A 2R86A 2Z8ZA 3NAMA 3FYUC 4LYEA 4R1NA 2C5SA 3M6FA 3MCTA 4I46A 2XEDA 3O75A 3SDBA 1XL0A 2QKYA 4FGZA 3R5SA 4ZWNA 2QOEA 1V43A 1GILA 1MRNA 1YE3A 4IJ6A 1R27A 5LWHA 3BTVA 3I39X 3EA5A 4UULA 1IBKB 4JNKA 5E7MA 1HQCA 3OOWA 1AU9A 1LW6E 4BQSA 2KJQA 3P1JA 2FGKA 1QO0A 1VIDA 2OLJA 3L7OA 3DE2X 3K3PA 4V02A 4CCYB 3Q6MA 2QJTA 1EFAA 2UZ1B 2Q2VA 1UBJS 4LBWA 4LRSB 4OCZA 4CKWA 4ZMRA 1PX0A 2BMFA 2KMLA 2WD7A 1VJ5A 2WTBA 3KFXA 4L4UA 3RREA 3EPKA 3C1UA 3EXHC 2OXTA 2VAWA 3O3OB 4QVKA 3LWBA 2RCNA 4NJMA 2BE9A 4IIGA 5E3HA 4BMVA 3U3KA 3V6LA 2PNJA 1ZIDA 1DT5A 3ITEA 3NGMA 2O59A 3P9NA 3DF9A 1DLIA 4WY8A 5SZKB 2BISA 1F7UA 3STWA 1Z12A 2OZKA 5C4IA 4FGKA 1QR2A 1UEXC 4H1HA 5EPOA 5HQ3A 2EP5A 4MW4A 1G0OA 4DIKA 1F1BA 1ISPA 1KKLA 4H1UA 4LXUA 3TL6A 3LP8A 4R6XA 1G16A 1LXCA 5BW5A 3K0FA 3D2LA 3EYWA 3NALA 1QHEA 3VR1A 1V9SA 1YSCA 4UNQA 1SMKA 2ALJA 4L0QA 4EGFA 5JRJA 1GPMA 1I2AA 2BL4A 2R4UA 3AESA 4YCBA 5TARA 3VH1A 5J4YA 1Z5ZA 3DB1A 4L4XA 1ZA2A 5BOSB 4OHYA 1N5DA 4G01B 1YS1X 4URZR 4Q1DA 4CMEA 3RS3A 5C1PA 4XOIA 3ZD9A 1OLOA 1JDJA 3AEUA 2QV7A 4DABA 3HMKA 3NGXA 1JHMA 4B35A 2P91A 4EPVA 2QY9A 1PIWA 2LTAA 3H16A 4H3VA 4F7DA 3DHWC 4QUJA 2PUTA 2XD9A 1U0TA 3F1KA 3SJBA 5E38A 1W35A 4WBSA 5E6RA 2WHPA 5JYEA 1PQPA 2PIAA 1LTHR 2PZGA 5ICEA 2Y1LA 4KKXB 3ETJA 2B4AA 4IRUB 1RHJA 4NU0A 1U0HC 5CCDA 1K4MA 1V8DA 3M34A 4MWBA 3ZQ4A 5F9MA 1ZJ4A 3KCQA 1M66A 5A71A 5B7NA 1C0LA 1BJKA 3EZ6A 2H18A 2R8XA 1L5NA 2IOHA 2Y71A 1J97A 4QTTB 4PYLA 2B1IA 5BWBA 5LKRA 5ISMA 3KKEA 3WRXC 4Y18A 5CCXA 1RLMA 1HT0A 4RM2A 4N4AA 3IPYA 3Q4GA 5G0SA 1VPDA 3D6HA 5C8VA 4TLMB 3N6RA 2FU5C 2XCQA 5HKBA 1EUDA 1JMVA 5IM4F 1KMNA 2ZWMA 3HQ4O 4UEWA 4C3OB 5A9RA 5BMVB 1ZJYA 5KNCD 5DX0A 1ZD3A 3QHAA 1E98A 2GCIA 3FOWA 1U8EA 2GRAA 4L15A 4AUEA 2I2WA 3LK6A 3ZY3A 4EJSA 3UBMA 4PZCA 2WJ4A 5AICA 2IXGA 3PC3A 2XR1A 1KDTA 3LECA 3GK3A 3O47A 4AD8A 2F3PA 3L5OA 1ULHA 1LS6A 4Y30A 2XB8A 2D59A 1Q1NA 2PSEA 1R8QA 3U7FB 3H04A 4ZCIA 1ZUNA 3OU7A 4MGHA 5BVHB 3OT1B 3B1VA 3QW2A 1RZRA 1KNQA 3AI2A 1JIUA 3WLQA 3ITKA 4QOJA 5MFZA 2IV2X 5G53C 1IY2A 4TT3D 4A8PA 1OZ0A 1ZD5A 3TZBA 2PM8A 3PDIB 3LRTA 1KDYA 1GNLA 3TIVA 5HXAA 2O2JA 3Q6NA 3JQCA 4BGVA 2ZJFA 2WAAA 3LQ1A 3OUZA 3ZWYA 5C18A 1Y6GA 1QP7A 1QSGA 3E84A 2R5NA 1N5JA 4ASUD 3F5QA 2H2GA 3LGXA 1FVFA 3K7EA 3I2GA 4NMXB 3K4HA 4S0XA 2C2BA 2AG1A 3FTFA 1NUTA 1V7QA 2VZEA 4L6AA 4WOPA 1E89A 3ICQB 1HDCA 4R0NA 4X8OA 5EE0A 2JFQA 1GRVA 1XRPA 1NVXQ 2WTMA 1NQ5A 4ARZB 4EI8A 5AW1A 3AEKB 3MD0A 3MFQA 1J2JA 4ZVNA 3K4QA 2ZBVA 3GPCA 3GJTA 5JDIA 1GPUA 2PH5A 1TAQA 1Y7TA 4OQNA 1RRCA 2V1UA 2OCYC 3JQ8B 3J81A 2XQVA 3GBVA 3TL3A 3HRHA 3W3AD 3FDFA 3OO0A 5A2QA 3DLHA 1MEOA 1VL2A 3AR9A 3M2PA 4X5OA 1L3CA 1K8ZB 4KWCA 4F1KA 4D4LA 4B6EA 3NDPA 1YRAA 4OL0A 3RAPR 3CR8A 1XCLA 1XQYA 4HGQA 3CISA 4UOEA 4LQLA 2PRJA 1JJVA 2QSZA 1NP3A 1EUZA 1N92A 3GDOA 5K51A 3QE3A 4JFRA 1P5HA 5FUVA 4PIPA 4U8HA 2IODA 3VU8A 3SSNA 4CKWB 4RK4A 3A9SA 4DSNA 2WD7B 2C2XA 1TGYA 1S4QA 2N1BA 2CBXA 1SQFA 4KBYA 1IN1A 1U4OA 1VHLA 5E6UB 1ZUWA 1LV7A 2B3DA 3IP8A 1UP4A 2G0AA 4N7JA 5CNIA 5A7HA 3C2QA 2JZOA 4NF2A 2IU3A 2Z5VA 1YCGA 5IT0A 2HT1A 1PR6A 1QO7A 3GRYA 4RUKA 3U37A 3UAVA 3S4YA 4A8JA 4KSBA 4R4JA 1P77A 2AXPA 2KE5A 5HQ3B 5JSKA 3QX8A 3HB7A 2Q9CA 2XT6A 4MPRA 4QYIA 1BROA 3EFHA 3HWWA 5BYBA 4J1TC 3KKQA 1P31A 3K0FB 2CCJA 2VHTA 2G25A 1TYZA 1CJVC 1QU2A 1XROA 1NJ8A 3GB9A 4FFNA 1XO1A 3QI7A 2WM9B 3SSAA 5FTLA 3AESB 3IO3A 4DV6B 5JJKA 4A1FA 4DLUA 2WFMA 4V0ME 3U4HA 1YI1A 3WS7A 2I4NA 2CHUA 4ZO4A 2M6SA 1ZHHA 1P4AA 4YFYA 1FJ2A 4F8EA 2BWJA 2QX6A 4GLLA 4NENA 4PZUA 3N6VA 3N86A 3G0GA 4PG6A 2VYVA 5PGMA 2PU5A 4MZXA 3CUEF 5E2IA 4E30A 1NN3A 3SZOA 1K6JA 3INYA 4OSEA 4CV1A 1JE1A 2P6NA 1V41E 2V59A 3A1UA 5E6RB 1YV9A 2WHPB 1FTYA 1TUEA 4XPZA 5ALYA 3VNUA 1H23A 4AG6A 4FLEA 5J3JA 2EX1A 2XODA 1EJ6A 3B8EA 1E8MA 5JO0A 5KSPA 2J32A 1VXOA 3EBLA 4TMWA 3JQ7B 1YK0A 2AVDA 5I7OA 4MGEA 5IJ9A 3PNBA 3WDMA 1WG8A 4CQNA 2O19A 1YUMA 2C8JA 4GI3A 1GUBA 3RUFA 2ILTA 2CNKA 5ADUS 3AL0C 2RHRA 2VSXA 4F60A 3W8DA 1JHUA 2JLAA 3BL5A 4AKEA 2DM6A 1NBAA 3V1MA 4JIGA 3DMNA 1C8BA 1E9CA 1EUDB 4E7OA 3G5LA 4O8CA 4EA6A 4ABYA 4QBHA 1WUTA 1D4ZA 1CF4A 2FQWA 1Q1ZA 1XZKA 4CL0A 5FCDA 4EJSB 1WCYA 4LA4A 2V6BA 1Z2NX 3RJ9A 8ABPA 2CD7A 4ZVLA 1W87A 4OF4A 2D5IA 4EUFA 2FHPA 4MWDA 3O73A 3FAKA 3LS2A 4AKGA 3ITDA 4B82A 4DV0B 1SXIA 1Z6ZA 3FMVA 5BRJA 4JI7B 1B7GO 1I4DD 2Q2WA 2V6JA 1FYVA 5EKDA 1AH2A 3ABZA 5EC8A 5JCZA 4G9GA 5KYNA 4G4IA 1NR7A 1DBSA 1E2GA 2WYIA 5JI3E 1GZ4A 4GSLA 1X92A 3BB3A 4OGGA 4QNMA 3QNMA 2IY9A 3FROA 4RAOA 4CIXA 1EESA 3VUFA 4TZKA 4CR7A 3UB2A 4G8BA 5B36A 5F7XA 4G4SP 1O95C 2ON6A 4N6OA 1J0EA 3AP3A 3TDNA 1VSQA 3VGPA 1QO9A 1VJ1A 4NOJA 4Y6LA 3FCAA 3RVSA 1KEPA 1WZUA 1W36B 1L5YA 3I52A 5KWJA 4X6UA 4IKPA 5KYXA 2Z4TA 1ENPA 3VR2A 1KR5A 4BBPA 1CB0A 5BUCA 4XR9A 3DXYA 1GLGA 2MSCB 5C37A 4UVIA 3VO8A 2PZAA 1DELA 3P9RA 2XYRA 1PGNA 2QLLA 5DF1A 2XUJA 5EP2A 5B30A 1A2OA 1QQTA 2FJUA 3E7XA 1T4DA 5I7VA 3KU1A 2C61A 2PJDA 2JGKA 4J8PA 1AS0A 4X92A 5D86A 3UGKA 3UT0A 1XK6A 2XA2A 3ND6A 5FUQA 4NK4A 1C9NA 2DQSA 1ZONA 3AINA 4LPSA 2YXNA 4MVXA 4BO6A 3WGUA 4B5KA 3DBVO 2BBSA 1T2AA 1H4QA 3U56A 4R2KA 1CY4A 4NMHA 1YU9A 2VAXA 2Q5JA 5E9QA 1HYGA 1OBFO 4JODA 4D0LB 4BTEA 4MV7A 4ZHQF 1H5UA 3RS5A 5CA1A 5M3BA 3TZCA 3DZCA 4F3KA 1T35A 5L6MB 3IVGA 3PC4A 1DIHA 4LHXA 3TLKA 4YUWA 2QZZA 2ESRA 1G5PA 4YRAA 2WY2D 2NYAA 5AM5A 4JOCA 4GMKA 4F3NA 5CFPA 4V0KA 3SYRA 1WSWA 1JQJC 1K75A 2HU8A 2AF4C 3N5CA 5CR9A 4FFWA 2FEPA 3GEBA 4MWTA 4QXAA 3V32A 4YCCA 2DHEA 2I4LA 1GRRA 5ER9A 1T3LA 2J3EA 2P2LA 4Q00A 2X0DA 4KQWA 4CLXA 2ZYAA 4OHRA 3FHCB 4A8JB 4BOYA 2E89A 3EZLA 4HQKA 4MQ4A 1R0YA 1EHIA 2Z2YA 3V4ZA 4BO0A 4C0WA 3BA6A 3F5SA 3U0VA 2EWMA 3T7TA 4PN7A 3IR7A 4QYIB 2CXUA 2JCBA 2UZ3A 4FS8A 1Z2OX 3A6DA 4UTPA 3BHIA 2QUBA 4C0AC 2ODBA 4OUKX 2ZCVA 4QDUA 3NOXA 4UAUA 4DE5A 2YV4A 4X00A 5C7IO 1N5MA 2VDOB 3KR9A 4QULA 1U2PA 1JW9B 5IBCA 1B6SA 5FFNA 3MT7A 5DLPA 1UPUA 2H0RA 1I94B 2WK1A 4UDOA 4RDIA 2G9RA 1XVUA 3JSXA 3B7PA 3G1TA 2VXCA 1U9IC 2PH3A 3NZEA 4NENB 4BC1A 3WHKA 1IUPA 3H05A 1LA2A 4RZSA 2YJ3A 2QRNA 3UK7A 1YC5A 1KFCB 3FOAA 2QYOA 3F6SA 2A9JA 3V33A 2COEA 3OTHA 3UK2A 2WYOA 3I76A 1Q22A 1V26A 1UBRS 4PC2A 1NT2A 3NBUA 1FE8A 2J7PA 2A1TS 1UBCA 3DVQX 2YJ5A 3PYLA 1DEOA 5K4AA 1KJ9A 2X5XA 3PKJA 4J7UA 1C8LA 5IJ9B 2WZCA 2WVJA 4H4EA 1EXNA 1JKXA 3U1BA 3KFVA 3TBFA 3VQTA 3KJEA 5TX7A 3WRYC 3PUHA 1EINA 3LIIA 4KQKA 2PBZA 2XSZA 4BUJA 3BILA 2PZJA 4R5MA 2J6HA 3G5MA 1NVTA 3CCBA 3FY4A 4TMKA 2OP0A 1KSGA 1PFYA 4CVNA 3UK0A 5I45A 5E2AA 3GFOA 2CW5A 3QLVC 5IVPA 1FBNA 1GP2A 2AF3C 2YXBA 5DEIA 2H3EA 5FJIA 1U0BB 4MVJI 3OQ1A 2WYUA 5F2KA 3HFGA 4A03A 1LK7A 3I72A 3TIFA 5U1PA 1YJBA 2CCGA 4OHKA 2R66A 4EZBA 3CU5A 3HSKA 3EVCA 3QVJA 4MCJA 3P4UA 3O2SB 4BE7B 1JFLA 4L9SA 5FBWB 3PUKA 3ZWNA 2BGMA 2ID4A 1RKVA 3FETA 4XYGA 1SUWA 1KWGA 1Y4UA 4ZOLA 5HMMA 5ER6A 3TZQA 3T9DA 1DAPA 4G1MB 4GLOA 1TO1E 1Z83A 2W2QA 4QBIA 3S3TA 1E6EA 1XDWA 2GBIA 4M9CA 4DADA 1SY7A 4I1IA 2A57A 3KKZA 2A14A 4IVPA 2Z6QA 2ZYGA 2A9QA 4DR5B 1NPDA 1IEQA 1THTA 4P83A 4J0FA 2IRWA 3BCRA 3MT8A 2PL5A 1YTLA 1UQTA 3ORHA 4MB6A 5AK0A 3AWDA 4CJXA 1G2IA 2JVJA 1WTCA 1U65A 2R4QA 4DR1B 3EK2A 4DFDA 4JJ7A 4BLSA 1V35A 1FFGA 3Q7PA 1U1FA 4RULA 4P84A 4EFDA 1ZIYA 3R5HA 5AXCA 3KQKA 1M83A 2P6UA 4XGNA 2VP6A 1PWXA 4YLEA 4PPYA 3LRPA 3H0EA 3T1NA 4L4ZA 1CZLA 5EIWA 2PRYA 2G9NA 4ZYXA 1FXWA 1HOXA 3NXKA 1SULA 3GFSA 4K87A 3QXCA 2JJQA 1P1CA 2W6CX 2YS7A 3V8EA 2GYWA 3DLTA 3DM9B 3TBHA 2HBRA 4J3NA 5IZCA 4BFWA 4O5AA 4AJ4A 3C3KA 3JAKA 4DBZA 3FJOA 5K8LA 4INOA 2N1MA 2FSIA 4COKA 3EXFA 1SXGA 2BFPA 3UQZA 2P0AA 4PC7A 1B16A 1CC1S 1J24A 2WJJA 3QJ5A 2EFCB 3R0JA 1WBDA 1N0IA 3FRIA 5IAKA 1TLTA 1RZUA 4NOKA 5JALA 3CNBA 4PSKA 4R01A 4ZYUA 1EP3B 5HNKA 4R3UC 2EWWA 3HVKA 2ZIGA 1KH1A 1QBKC 3ZHYA 1GZVA 1MP0A 3MGGA 3I45A 5CTJA 4ZU1X 5CA1B 4AG3A 1E1QD 1BMQA 3ENNA 1V95A 1T8WA 2JCVA 3B6MA 4I2VA 4UM9D 2VF5X 3M70A 3PRKE 4IUBS 3IV6A 1C0KA 1BEZA 2ZSUA 2P41A 2C4MA 2JLRA 5F78A 3QYJA 1K27A 4KMSA 1F6WA 1U8XX 2GVDC 1ZSYA 3OJLA 3HXKA 1VMKA 3S29A 1CNMA 1OKKA 4JLKA 2B98A 1LPAB 3AF2A 3O83A 4EA9A 4R7GA 8ADHA 2VJQA 2ISQA 1GKLA 1P19A 4ZQIA 2Q1UA 1CD5A 5DZSA 1D2MA 1WS6A 3EIHA 3I05A 4PLZA 4JSRA 4N9WA 3WHLA 4UE2A 4CMAA 4E31A 3RU9A 4CNBA 1II9A 2DUJA 4HI0E 4YAGA 5AVVA 3RFCA 2WUFA 5KYWA 3PIRA 2WJAA 4AJPA 4HDKA 1KZ9A 4DG5A 3QK7A 5FWDA 1QGUA 2EZ4A 4IV8A 5BNWA 2Q4EA 3TRKA 3W1WA 1H66A 2G28A 2JGDA 2QG6A 5JPCA 3IL2A 1WJGA 1PNVA 1YOBA 1INLA 5J5CA 2YCLA 3DP7A 3VHXB 3NKLA 1FNCA 4MDHA 5FWNA 1RI4A 4GLJA 3D0QA 5DNDA 4QM7A 4S05A 5EEHA 1NSYA 1A71A 2C3YA 3N0VA 2G70A 1PJSA 3H18A 1KMHA 1XMIA 1GKUB 4N8SA 4DR4B 3O1JC 1D9XA 3EISA 4HCJA 4Q24A 3M5WA 3VNBA 5B4UA 2XKKA 4JLUA 4O4LA 3UOGA 3DHEA 3V2UA 1E3EA 1QZ3A 1N6NA 5DT2A 3OM9A 1I4EB 2NYRA 2XOKD 5BSRA 3SQNA 3VTAA 1XJWA 1E6KA 1RM4A 1UT8A 2O0HA 4ARVA 3PEWA 5JU6A 3GLGB 1GQYA 1C9MA 3ASVA 1BS9A 2ORVA 1FQWA 1XOIA 4G0QA 5LZ5A 3S2FA 2DPLA 1RM3A 2OAP1 1K7SN 3KB8A 3OZCA 3AR8A 3PL1A 1JWAB 4MGZR 2ZXEA 4BVHA 3OLYA 5KC8A 4MKIA 1RWXA 5C1IA 3DFIA 1Q83A 4BX2A 3RI3A 3TGWA 4MARA 4JYMA 3TKYA 4XFDA 2B20A 4J2OA 3U9SA 4MDEA 4NI5A 2BW0A 2GERA 1Q17A 1QG2A 2GGSA 3UATA 2FMKA 1O7JA 1V1RA 4LISA 4WACA 3WGYA 4LSMA 5CFZA 2JARA 1RYDA 3U17A 3N2EA 2V3CC 1MT0A 4IX1A 1WDLA 4LY0A 2CXNA 1XXHE 5GINE 1L8QA 4MX8A 1JH9A 1DDIA 4PVCA 1SBYA 3OJXA 1MAHA 1IOLA 3I1JA 2B1GA 2FCRA 1WVMA 4ZYWA 4JK3A 3R6TA 4A0GA 4GNKA 3LL4A 1QOZA 4IIJA 2DJIA 4B75A 5TEVA 2EKLA 4ZOLB 4DY6A 2J30A 2AFVA 2VNJA 1GGNA 1ZHFA 3DDOA 1F6BA 1NL3A 4JD5A 4RZ3A 1L4MA 2RGAA 3DMFA 1AKVA 1BE8A 3QU5A 4G2TA 1PJBA 1P18A 3N39C 1J06A 1JHXA 1PRYA 2FPOA 4TMVA 1GRCA 4UCQA 3QXHA 3H9CA 2IHBA 2BI7A 1C0IA 2PT5A 4LSGA 3WY9A 4EI9A 2QZSA 5BORA 3GLFE 1P9LA 4R51A 1JSRA 1NATA 2VHUA 4OKIA 1DNPA 1MN6A 1UF9A 3DNPA 1ACMA 1U94A 3K15A 4IVQA 5J4HA 3HGMA 2J09A 1WXDA 1UJCA 1Z7BA 2P2NA 3GVCA 2BFOA 1XTUA 5G02A 2V5AA 1BDHA 3IC5A 5HZHA 2ENUA 1Q15A 4JLVA 4B76A 3MRSA 4POAA 4QUIA 4OBWA 4LZAA 3GFVA 2FK8A 4PQFA 2EKBA 2WFLA 2Y0DA 1SOMA 1JQLB 1HE3A 1PWEA 3R0QA 4WEOA 2W11A 1SKBA 2VKQA 3GZ4A 3EN0A 3S6JA 1LI4A 2Z3ZA 1RZ3A 3GLHE 3G2IA 5DTIA 2WF9A 1OZFA 3IIMA 3ZIAA 3VKWA 1S8FA 1WMEA 2QIOA 4N3GA 4DV3B 2AD5A 3EXFB 2AZ4A 4M1MA 1XV5A 2Q5EA 5C5DA 3ZGNA 1NVDA 1PZHA 4YK7A 1B8NA 1RHMA 2Q6LA 2Z83A 3IPCA 1OF1A 3CUWA 2JHGA 3MVEA 1FQOA 1I7NA 3C39A 2IXBA 3T3IA 2ZJ5A 4UEJA 1JDBB 2Q9AA 5A6VA 3Q3VA 1PKEA 2VJPA 3O3MB 1PL7A 4M7OA 2OYSA 3NU1A 3S5UA 2D3TA 3N07A 2ADMA 5IBPA 5CURA 3H83A 2CB0A 3KZNA 2SKCA 4JOQA 5H83A 3LNTA 4U39A 3O8LA 4TTVA 4DQKA 2O8BA 1DIAA 1T9DA 3BICA 2EKZA 2C7QA 1CUSA 1C5KA 3M4XA 4IS2A 4JA2A 5G0VA 5E3JA 1MJHA 3KLPX 5AM4A 1IOVA 1L7PA 4H59A 3I04A 2V7UA 1NOKA 2F62A 2W93A 2ZTLA 1N0HA 2WF7A 3WICA 5KVQA 1MUUA 5FX2A 5AW6A 5A0VA 3D54D 4JT8A 4G1FA 1JEQA 3W9YA 3SIRA 2BIFA 1L4EA 4YXWA 2J0SA 1NPYA 3H4VA 3ORRA 4Q6WA 1GCGA 1XZIA 3VH3A 4BNDA 3M1AA 1YB7A 4DCMA 3FOFC 3ZTWA 2G4CA 2F90A 1OU4A 4JX9A 5D87A 5KYWB 1I4OA 4JLAA 1LDBA 2PYDA 1ULAA 1R6VA 1F3OA 1AV7A 1VCNA 2I9PA 4YASA 3O82A 1N5RA 1QGUB 3LPDA 2UXBB 3CNHA 1A8HA 5F9FA 1Y3BE 1IBMB 2JGDB 4DAEA 3JD4A 5EHZA 3VYTB 2F9LA 1P9WA 1GNPA 2FMUA 2DX7A 3UB3A 1W36D 4Q0MA 3E8SA 3LO8A 2X42A 3JPWA 1DCKA 5I9NA 1XEWX 3QELA 4YECA 3RRXA 1D9ZA 4KXWA 1KVUA 3EGXA 4K9OA 4RA6A 4S1VA 3QE9Y 2WP8J 3T1TA 5B37A 1EGHA 1KMHB 3GX1A 1M2NA 3IEIA 3K2EA 4YCJA 4AIRA 2NUPB 3E53A 4C2BA 2V54A 1A04A 2XRFA 4HGRA 4HX2A 4Y6OA 2P3LA 3TRJA 4IL5A 4KMOA 5M04A 1GRQA 1EAYA 4UHBA 3ZW7A 1BIFA 1YQUA 3EFOA 1RWOA 3PHGA 3R4CA 1GCIA 1T1EA 5IKMA 2AVNA 5DYYA 1VBFA 1HE1C 1M2GA 1JKIA 4OMCA 4YY3B 1DOHA 1A9PA 4TVKA 1L1FA 5HGXA 3DHNA 2ONYA 5DHAA 2VNKA 4BKPA 4BFZA 1ZS9A 4ER5A 4LF8B 3TJRA 4BMNA 4QLBA 4ND8A 4D9NA 1K7XB 3MMNA 1OY1A 3O1IC 2I2XB 3BT7A 3HA3A 3T7AA 1KI6A 1PR5A 4PLGA 2EL7A 4BWFB 3OTWA 4X24A 5KSYA 1W1WA 3ZGXA 3FKSA 3D6AA 2G9QA 4O2AF 4R2WA 1EZZA 2VH2A 2JIPA 4OMDA 3D4NA 1Z73A 2P4SA 4LC1A 1T34A 2FWRA 5IZ4A 2F48A 2O7RA 3PZBA 2H63A 1E1MA 1QYDA 2ZU0C 3EZ9A 4MKFA 2XGOA 2A0FA 1M6HA 2WQ7A 1ZNZA 4NZNA 1JAZA 3KE9A 3NTQA 1A4RA 5SY6A 1B6TA 3BFXA 4OXRA 1FSSA 2PZ8A 2AEMA 1JSXA 4IIJB 3RYTC 3ZWCA 3IUNA 5FA5A 4OQMA 1IL0A 4TXJA 2UUAB 3CZ9A 3BDIA 2ERYA 3OE7D 3BSSA 3IBYA 3TR6A 3HPQA 3IBFA 4JUAA 3GJ5A 4MQ6A 1NQTA 4QFBA 1G6Q1 1S9DA 2DLNA 3Q7QA 3RIYA 4MWCA 8AT1A 1MFPA 2PY6A 2HUPA 1EUYA 4PZZA 2ZTUA 3N9IA 2N47A 4H7JA 5ENZA 1FNSA 2QS9A 3D64A 1W4LA 4ZQGA 4RD4A 3PFWO 1A8QA 2PKCA 3GFPA 3REGA 4Z0HO 1GO2A 1X39A 2IUEA 4F12A 5DB4A 3FNIA 1NLZA 4F5ZA 3DE0X 3AM3A 1NBWB 3H3JA 3CZQA 1ORRA 3B53X 1F5SA 4ML3A 5FV7A 4ZGBA 1BDIA 1Q20A 4PHCA 1DUIA 4KBFA 3W6ZA 1N0UA 2GEKA 2W43A 1QFJA 2HNBA 3AYXB 1RAAA 4M2LA 4OXXA 4Y0VA 4IIHA 1M75A 3KLMX 3RVRA 4LXGA 3I6IA 1Z6XA 3DMYA 3A6JA 2L69A 5H3LA 3UH1A 3GRCA 1ODFA 2VZ0A 5CJ2A 2QTNA 3NQ41 2N0SA 1KAEA 1YMUA 2EW8A 2X23A 5BQ5A 1PJZA 3GPBA 4GE0A 4MUFA 4EFNA 4PYJA 1W581 3D6MA 3KV3O 1BE0A 2XGSA 4OBBA 4OQZA 4RVFA 1F51E 5PNTA 2O5EA 4H6XA 4W82A 3T4PA 2IKSA 3DBLA 5EJMA 3HABA 3DYIA 4RLFA 3UWPA 3I01M 3G79A 1YZNA 2J48A 1KPIA 3ZCSA 4AP9A 4HNUA 1FRVA 4BNNA 2B5OA 1J5XA 2Z2ZA 2GAOA 4CMBA 2JHAA 2H65A 1YR6A 4G1EB 3W0LB 2X1LA 4FE3A 4NBWA 2GBGA 2ZROA 1Q5PA 4PIMA 1AK1A 2BTOA 5C3MA 4QELA 3F74A 2BI4A 1BHQ1 4F8JA 1E61A 4Y7DA 3AYZB 3PT9A 2ZATA 3BOSA 5MF6A 1K0UA 4RDCA 3LHDA 4D3YA 1QX4A 1U9YA 3EODA 3K6RA 5F35A 1CPYA 1P1KA 3QKSA 3ZH2A 4AG5A 4LOAA 1ZH0A 2UYOA 5FUBA 1HETA 2H5JA 2ZYHA 4OQDA 1Q2XA 3SI7A 4HYYA 5ALHA 4WJLA 2X0IA 1CUHA 2ZDHA 1WSAA 3LGAA 4GX1A 4KBGA 2IS4A 1TEHA 1T2EA 1VDMA 2YWFA 1KPHA 2GHQA 4RGQA 1OV4A 2ZWIA 4NCKA 1OSNA 2C78A 2R48A 3BFVA 3O5AA 1U2GC 3C3JA 1N7IA 3PXEA 1H9BA 2AHRA 3ZDDA 1QG4A 1Z9BA 4BNDB 1KYIA 4ZZIA 3TW8A 1ZVKA 3MQ2A 1Q0QA 1DINA 2GYVA 1XVIA 5GMOA 2QE6A 4ZP1A 2Q7OE 1EKXA 2ET6A 1KXZA 5E9AA 2I7VA 2CVQA 3MSCA 4UFOA 3VC3A 1PHPA 3GLQA 2CVFA 1E0AA 3ANYB 3ZV6A 1UJMA 4E1AA 1QYRA 2QTRA 3ZE0B 4DR2B 4ETMA 4YCDA 4Z0NA 2ECFA 3RBVA 5K1ZA 1KI2A 2QNRA 2YC2C 4IHQA 1V8BA 2TS1A 3QELB 4R41A 4BL5A 1QQBA 1M7GA 2IBSA 4RA6B 3JQAB 2CWWA 1U3CA 1ZD8A 4RF3A 2NZWA 4YP6A 2M2IA 1Y89A 1RWWA 3P2EA 2BHSA 4H1WA 3EVBA 2QVXX 2AR0A 1JIIA 2DJ5A 4NX2A 4X0EA 1P2DA 2XD4A 4IBOA 1RKBA 3N58A 1M5TA 4TRJA 2O2EA 1U7PA 4Y98A 4RD3A 1VKJA 4ZEVA 1U2RA 5JWRA 1O9HA 4Y1RA 1ISMA 4KLNA 4BKOA 4BMXA 5LM3A 1ISJA 3HJRA 3VI3B 4G65A 2IUYA 2EAUA 4TN5A 2C5LA 5EUCA 5H7XA 1E3LA 4B3HA 1ZGCA 4ILKA 2Z3VA 4GM4A 5ADWA 3SC2A 4QUGA 2FCAA 5FUMA 3SD7A 5K0FA 2QLMA 3K9NA 4YMSA 3RR2A 1GPNA 1NJ5A 1Z4JA 2YJTD 4YJKA 3SEQA 1U7DA 3UMVA 1BVRA 1R10A 2XEXA 4MHTA 3IMFA 4WT7A 4EYQA 4DT1A 1RMQA 5FO1A 1DDOA 1G2OA 1L8LA 2HCJB 4HPXB 1NTRA 1H05A 2HBZA 2IZOA 3CLHA 1OTHA 3O2NA 4OFWA 4B0OA 1CUWA 1GG9A 1R18A 2BZ1A 3GELA 3ZWXA 2BKAA 4ZVKA 1D09A 3IQDB 3WGTA 1J0XO 1VHJA 3DV9A 3IMKA 2CD9A 1FVHA 3MJEA 2JLXA 2BAGA 5K3OA 2W2NA 2P79A 1XDZA 2QYHA 4HZGA 4KXFB 4IHKA 1BNCA 4TRRA 1DEKA 4C07A 2WQ6A 3C5EA 1U4SA 2VJDA 3QOXA 1NE2A 4OOFA 4QPPA 5BR4A 1A5ZA 1JXQA 3R0XA 1AQJA 1XKQA 3C6XA 4FS3A 2Y0EA 3UW3A 1L5QA 3JYOA 2GKSA 3IEUA 2WPDD 2QPAA 3DL7A 5JXJA 3C45A 3GA0A 3VVCA 2OOKA 3U5ZB 1TPYA 3NM5A 3ZNOA 2D2IA 5BV2P 1SBNE 2YL2A 3L04A 4AJJA 4M8LA 2V7QD 2FOLA 5E9JA 3SG0A 1DEXA 2BDUA 2H1FA 2VR1A 4IZHA 2ZRNA 5DJ5A 5CDYA 3R3HA 5TPZA 1E9FA 2H1WA 2ZRIA 4PPNA 4Q9AA 3IUJA 2M1XA 1L3IA 4M1WA 3U3RA 4B80A 4D9EA 5LJIA 2PZLA 3LPNA 1CG6A 2ZB2A 3INGA 1H9AA 3N0XA 4N0QA 1AO0A 3W5CA 2FF5A 1C41A 4DS3A 1OYVA 5HF9A 2AK3A 3LUKA 2DGDA 2PD3A 2YNMD 4KUHA 4UD2A 5KJEA 3B2EA 2D2FA 4PFJA 4MLDA 2V65A 4E4RA 3KQSA 4K88A 1FRNA 5HR5A 1UFVA 5JZOA 1KAGA 2VEOA 1E1LA 3TMAA 2CDBA 4F06A 2Q4OA 3SJCA 3EQ2A 3BK7A 5AQEA 4X93A 4N18A 4L0CA 3JQBA 1TRKA 2IYQA 1W4AA 2WOOA 4XASA 5JD5A 4BYMA 3HM2A 4IO1A 1DPFA 2R68A 1TUBA 5FTJA 1WB6A 2GDZA 4ZZ0A 5LQMA 1N6RA 3DBLB 2RB5A 5CYFA 2OUKA 1EX7A 3FF4A 4R40A 1KI4A 1N2CA 2LIVA 2X8AA 3N2LA 4AS2A 1NULA 2P90A 2WHYA 3UJ7A 1RM0A 4R2LA 3X43A 1J2RA 3F47A 4KRXA 2G6BA 1XLTC 2Q8PA 3QVUA 1H2YA 2KYRA 5I7WA 5IK2A 1K97A 2HF2A 4H15A 4J75A 1U3DA 2WJIA 3TLJA 1HMPA 2PUCA 4MYRA 3PKIA 1YRYE 1B3BA 3K5IA 1ZDMA 3X2SA 4DPMA 1C3OA 1TVCA 2Q3CA 2XXAA 1FDWA 3SXJA 3AVYA 3W79A 4ODIA 3PWKA 1B26A 1TZBA 4OK3A 3IKMB 4CQJA 4LE0A 4LGVA 4RD1A 3QKSB 3BERA 1UR5A 1Q1EA 4MW6A 3Q0TA 2H9IA 4TVBA 1ORIA 4F4UA 3FVVA 1NUQA 2DQYA 3KFLA 1R9GA 2EEZA 3VR3A 4XLTA 2PGLA 1GTG1 4NSNA 2AG6A 4Y2PA 4AKTA 1B0AA 1LQUA 4UU8A 4D99A 4TYWA 3VNVA 3FYDA 5AJUA 2QRJA 2YIVX