2F9FA

Crystal structure of the putative mannosyl transferase (wbaz-1)from archaeoglobus fulgidus, northeast structural genomics target gr29a.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
166
structure length
166
Chain Sequence
VETSKFKFKCYGDFWLSVNRIYPEKRIELQLEVFKKLQDEKLYIVGWFSKGDHAERYARKIMKIAPDNVKFLGSVSEEELIDLYSRCKGLLCTAKDEDFGLTPIEAMASGKPVIAVNEGGFKETVINEKTGYLVNADVNEIIDAMKKVSKNPDKFKKDCFRRAKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords first mannosyl transferase (wbaZ-1)
publication title Crystal Structure of the Putative Mannosyl Transferase (wbaZ-1)from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 57
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2005-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2f9fA00
1QM5A 2XCUA 4GYYA 1P29A 3NP7A 1L7XA 4LEIA 3BDAA 1M5RA 3CX4A 3T5TA 1Z8DA 3OTGA 1NOJA 3L7BA 1B4DA 5IKOA 3T3HA 3EBOA 4FZRA 1XOIA 1Z62A 4EKYA 5LQDA 4YUAA 2QLLA 3ZCQA 1FTYA 4YI5A 5TMBA 4RELA 5DXFA 1Y6GA 2G9UA 1F6DA 1PSWA 3D1JA 2VCHA 3MRVA 2FFRA 3RHZA 2XGMA 4MRAA 4BQEA 2QRGA 2R4TA 1JIUA 1PNVA 2HY7A 1QKJA 3MBOA 3OT5A 2F3PA 1FU7A 2XA9A 3S27A 3D0RA 1IIRA 3HBMA 2F3UA 4M83A 3C48A 3Q3EA 3ZCSA 3HBJA 2VSNA 3MRTA 4N3AA 3MTBA 4MI3A 1GZ5A 1L5QA 2ASVA 1NOIA 1P4GA 5DLDA 2WTXA 3MS2A 3DDSA 2X6QA 3OKAA 2X0FA 2FETA 5TVGA 2KS6A 1V4VA 3MT9A 2PYIA 1FU8A 2QN9A 4KQ2A 2C9ZA 4AN4A 4G2TA 2QN7A 2H1HA 3WC4A 2GPAA 4RIEA 3DD1A 3DZCA 4AMBA 4X7MA 1NLMA 4KQMA 4EL5A 5JTUA 3NAZA 2F3QA 4X7PA 2IV7A 1J39A 3S29A 2YJNA 3S0JA 2BGTA 3ZCRA 4BFCA 2ZB2A 3G2IA 2JLBA 4RIFA 4GPBA 1FTWA 2IYAA 2BISA 3OKCA 1WW3A 1Z6QA 2QRMA 3H4TA 5D01A 1JIXA 3S2UA 1JG6A 2ACVA 3CEMA 1RRVA 5BNWA 4WADA 2VCEA 4MI9A 2XMPA 1Y8ZA 1WV0A 1K08A 3Q3IA 1LWOA 4NC9A 4W6QA 2Q6VA 4HWGA 7GPBA 4CTOA 1GFZA 1RZUA 3OKPA 4CTNA 2G9VA 2R68A 3Q3HA 1P4HA 3BCRA 1FA9A 2GEJA 1FU4A 1C50A 3C4VA 3NB0A 1C8KA 4MHSA 3VDNB 4M60A 4KQ1A 4X7RA 3RT1A 2SKEA 1RZVA 2H1FA 3COPA 4NESA 5GPBA 2PQ6A 4WACA 1P4JA 2QN2A 5IKPA 1L5VA 4NEQA 3MTAA 3BD7A 3NCHA 2IV3A 3UYKA 4Z5XA 4M7PA 6GPBA 3G2JA 1ABBA 3MSCA 4MHOA 3MRXA 2X6RA 1XC7A 4REMA 4RBNA 2JZCA 3OTHA 3CV3A 1F0KA 2QN1A 4BQIA 3CUUA 2AW3A 3PE3A 5C1DA 3VUEA 1A8IA 3MTDA 3G2NA 3BD8A 4XIFA 3FROA 4CDRA 3S28A 2R60A 3CUVA 5HXAA 2VSYA 1Y6FA 4N3BA 4HLNA 1JG7A 1AHPA 3CEJA 1XKXA 3CUYA 5TMDA 2QN8A 3G2LA 1WUYA 3RSZA 1NVKA 3VDMA 3E3OA 1E4OA 1FTQA 3NC4A 1L5RA 1C8LA 2R4UA 2JJMA 4X6LA 1EXVA 3MQFA 3WADA 3TSAA 2IEGA 1UZUA 2GM9A 1GPBA 1L6IA 3MS7A 3O3CA 1YGPA 2ATIA 2F3SA 4EJ2A 3L7CA 4MI6A 2GPNA 3L01A 2XA1A 1KTIA 3G2KA 1UQTA 2QN3A 3BCUA 4N39A 2ECPA 1NOKA 4QLBA 1FC0A 3MT8A 2PYDA 8GPBA 1UQUA 5JTTA 2QZSA 3IAAA 2O6LA 4RIGA 2G9RA 3ZCVA 1IXYA 1JEJA 3ZCPA 2GPBA 3VUFA 3EBPA 1GGNA 4F97A 1Z6PA 2AV6A 4XI9A 4GZ5A 4GZ3A 4AMGA 5I45A 2IEIA 2GJ4A 1HLFA 3OTIA 9GPBA 3ZCTA 3OY2A 2AZDA 3PE4A 2C1XA 3BEOA 4WHMA 5TMEA 2XA2A 1L5SA 1P2BA 2FF5A 3HBFA 4RENA 3SYRA 4RIHA 1EM6A 3T3EA 4EL0A 2SKDA 1BX3A 3RSCA 2QRQA 3QHPA 4AY5A 3MS4A 1K06A 1NZFA 3TAXA 4N3CA 4FKZA 2ACWA 3NP9A 3G2HA 4GYWA 2GEKA 2SKCA 5DU2A 3T7DA 1SXQA 4L22A 2P6PA 2G9QA 1GG8A 4RIIA 1FS4A 3SYMA 3HBNA 4YI3A 1XL1A 2F9FA 3E3NA 3WAGA 3T3GA 3E3LA 4MICA 4BQFA 2IW1A 1WW2A 2IUYA 2GT1A 4PQGA 4CTMA 2QLNA 1VGVA 1AXRA 3NPAA 2QNBA 4GZ6A 4F9FA 2R66A 2VG8A 3MT7A 1LWNA 1L5WA 1XV5A 2XCIA 1E1YA 2QRHA 1H5UA 3L7DA 1P2GA 3CUTA 3GPBA 2PRIA 3AMVA 3L7AA 5D00A 3D0QA 3L79A 4F96A 5ENZA 3T3IA 3GUHA 3QKWA 4LDPA 1O6CA 1GPYA 1NZDA 2XGSA 3BD6A 2BGUA 1SXPA 3OY7A 2C1ZA 3BCSA 1XL0A 1C3JA 3CUWA 2IYFA 1WUTA 2PRJA 1YA6A 2C4MA 3C4QA 1WV1A 2X0EA 3DDWA 1JIVA 2QLMA 3H4IA 4N9WA 3IA7A 2AMVA 3ZCUA 1PYGA 3CEHA 2XGOA 1GPAA 4AY6A 2BFWA 1PN3A 3T3DA 2QRPA 1P2DA 4EKEA 3TOVA 3UYLA 2OFFA 2X0DA
chains in the Genus database with same CATH superfamily
3G68A 4KOAA 2VUUA 4NBTA 2OSVA 3ZI7A 2J6BA 3JPWA 4FR5A 4ZVMA 5TGZA 1SUBA 5LXTF 4LEIA 5KQPA 1AZWA 3QGMA 3COVA 3QP9A 5JZVA 1YB4A 2I99A 3OOSA 5DNYB 1XQ6A 3BGOS 3K71B 1RYZA 3VR2A 3IE2A 5K3FA 2ZE8A 3IXMA 3PF8A 1N3YA 4WOCA 3A2KA 1QF6A 3OX4A 3VU3A 4YONB 4IZ6A 4O1HA 4GBJA 2OHOA 4UD6A 1RQXA 3MJSA 4UNIA 2QE7A 2O0KA 1JTFA 3W8EA 3H5RA 2V6FA 3O1HB 5BR7A 2FOXA 1PQWA 3CO0S 2ZBPA 2GO7A 2ZJAA 3RRYA 3CZAA 3QOYA 4LK2A 5DEOA 1AUXA 3I9JA 2FVXA 2IOYA 4MQUA 2UUPA 3KFLA 4TQ9A 3X1YA 4Z9FA 3WZMA 3J7AC 4IFBA 2O5CA 1G66A 5FBKA 5DN6D 1U2GA 4V0QA 4CNQA 4YRCA 5JCJA 4II2A 3ZE1B 1Z75A 1FNNA 1G18A 3KPYA 2QZZA 2HCFA 2BFCA 4C0HA 5LOVA 4JI5B 4WI1A 1X0VA 1ZIXA 5KTPA 3E81A 3KB6A 4C0WA 3IAEA 5DW0A 5TNXA 1JIUA 5DHPA 1I5EA 1RYBA 1QKJA 4S1VA 4AZVA 1EFVA 1TJ4A 4TVBA 4QG7A 1CD5A 2FGKA 2IA5A 4EI8A 4H08A 3PUZA 1ZOSA 2ZI7A 3CCCA 3BMOA 4ODIA 4BV8A 2E2WA 4EGJA 2I7TA 1YFZA 1MIOB 3FPFA 1LW6E 3AUXA 5BWNA 4JLMA 2Q46A 3A7DA 2WHYA 4RJTA 5JU6A 1T8RA 1LJLA 1TMKA 4WZAB 3IMKA 1DKLA 1AQLA 2EZ9A 3IDQA 3QUTA 3ZWWA 1W9HA 4TYNA 3HBJA 4BHTA 2J9FB 1SUIA 3K6SB 3OIUA 4AKHA 4DFDA 3WTCA 4E4YA 1IIBA 1MOSA 1QGZA 1O9BA 2DPMA 2LWIA 3SZLA 3NHPA 2B5VA 2C8LA 1EMDA 4DWJA 1SHTX 3X2FA 2QVYX 1SUAA 1MO4A 1XYVA 2NTJA 2VNHA 4I0WB 1D9XA 1F8YA 4RTKA 1L7AA 4FDMA 2I7CA 4UCFA 4DLPA 1S8FA 4Y9DA 5FIUA 2B20A 2DFNA 3UVEA 3ZDYB 2UUOA 4XX0B 4EZIA 4ND2A 5E1BA 1JE0A 1SKBA 2BCGY 5KWIA 5JR3A 4FYMA 1ODLA 3F5SA 4POAA 3HJHA 4Z1MD 5IC6A 1GL9B 4TZ6A 2JPDA 4YAEA 4P3PA 1RXIA 4CEJA 4ZO4A 4IDBA 3VGPA 2V7EA 2EIXA 3NRBA 1PJ8A 5K6RA 3L0ZA 4CIXA 2P68A 1BXGB 1SCUB 5AIBA 4MULA 1G5RA 1CCWA 1P8AA 1R6XA 2WNIA 3NVKI 1K5PA 1YL5A 1R10A 2MYUA 4E46A 4MRNA 1NYQA 1VP3A 1YIOA 2E82A 3O47A 3LK6A 3UK7A 4ZTUB 2I33A 1PLJA 1JQLB 2QSZA 2PZBA 3GBPA 5KVVA 3WLLA 4KRGA 2V3WA 4U8GA 3GVHA 3KTAA 3JATB 4KAXA 3PFNA 1T4BA 1IQ0A 1FDIA 1Z5OA 2VYVD 3B52X 4UHDA 4YACA 4NARA 3TZQA 5GJVC 2AQ8A 1PR3A 2LPMA 4HRYA 2X42A 3WK5A 2D0OB 4M55A 2GZ2A 1R6AA 3NTRA 2FB9A 1ZM9A 1ULHA 3RKRA 3BM5A 1Z6GA 4OYLA 2REQA 5B30A 1BMFD 2J3HA 3ZH2A 3AJAA 4O4IF 2IOFK 4YPFA 1QGAA 5HEKA 3SR4A 1HT0A 1V43A 5I4BA 3UBTA 2PUCA 1ZIOA 3RU9A 1JXQA 1QYWA 1I1OA 1RIIA 3MB8A 4MI9A 4OQXA 5K4AA 4B31A 1VKJA 4ICIA 3SJAA 3V2IA 2CUNA 1YXMA 3GB9A 5CYGA 4NC9A 4CM7A 2CEKA 3I3SR 3B38A 2BHNA 3TZKA 3L92A 3QELB 2JAUA 4BL5A 1FDUA 5AM3A 5CM9C 3ZJ4A 4IV5A 3LCMA 3FMIA 1RZUA 1UJ4A 1VYTA 1WHSA 2X14A 4PLCA 5D3MB 2IC5A 5ALTA 3ZGOA 4Q4DA 4LOJA 1UBTS 1KL7A 1M5TA 2BR3A 2COKA 2G5GX 2RG7A 4N0PA 1V16A 5H80A 2H59A 1ADGA 4JUFA 1LXCA 3AH8A 3FNGA 3NT4A 2IYRA 4MWDA 1PZMA 2O23A 4OFZA 3URMA 4NABA 4RXUA 4HDKB 1WCWA 3LC7O 3LJKA 2Y1LA 3HJAA 2FW6A 3EGDA 3LQ4A 1H8EA 3QLVC 4J0DA 4BGVA 2V9CA 3WL4A 1PR2A 1VC2A 3P9ZA 3SBDA 3A1TA 2W11A 3UGKA 3G6WA 1U7OA 3KKMA 4NFSA 4QAQA 2ZJBA 4G0WA 3HJFA 4E5NA 3ROXA 1XR3A 3GLKA 4X1YA 3WJ1A 3WGJA 3WNVA 1TVMA 1MABB 1T2NA 1FSGA 2GAIA 3H84A 3EDMA 4NTZA 4RY0A 1L4MA 5FDFA 1IEVA 5GPBA 2PQ6A 2YRXA 4Z4EA 3GMTA 1U2DA 3LO8A 4TTIA 2B4TO 3L6UA 5FBRB 4EA7A 1CDDA 2C0QA 2JFWA 4B6FA 1J0DA 4RVDA 3OURA 3KSUA 2B0CA 3RWMB 4NEQA 4EHLA 2VSFA 5BWCA 1F3OA 5AW8A 4KXLA 4YYZA 1PL8A 4LC0A 4MUYA 2WIDA 2XMRA 1QPBA 4OQMA 5CCXA 1L2TA 5KJ1A 1XQ9A 1Z16A 3UIEA 1QZZA 4BYGA 2QQEA 4U7WA 3RF6A 3PDHA 1DB3A 3A31A 3CU5A 3C4JA 3BXEA 3SM3A 3P96A 4WBNF 4DLKA 3IBCA 1G8HA 2NZVG 3A8TA 4D41A 3T99A 4Q3DA 1U2PA 4HN9A 4PEVA 3GGJA 4EKNB 3AUSA 1JZQA 4GRAA 3CUUA 4JVLA 2OOSA 2OHVA 2VQDA 1CUFA 5B53A 4AWXA 3IKJA 4WFJA 2Z9BA 1ZCJA 3M5PA 3G2NA 5E6SA 3TZLA 3D2LA 3BMCA 5JFGA 4M0CA 5T6MA 3IELA 4TWZA 1MV5A 3R9XB 3CPSA 1JHVA 2V6JA 4M1TA 4X6UA 3L7KA 2RHOA 5C8YF 2ZBRA 4AWBA 3WGUA 1FJXA 3ERCA 2JIDA 1VKNA 2O4UX 3J81A 3GAFA 4W1PA 1I6WA 2WVGA 1D03A 1PJBA 1B1AA 2ZYTX 4O8ZA 1FXUA 1Y4DE 3RJMA 1NSYA 4HZUA 1ZH4A 2PV7A 1A2BA 3QOXA 2VHZA 3DWEX 5B57C 1OSNA 2Z5VA 4X54A 1K0UA 1XFDA 4FONA 1OXTA 3QJ5A 5ANRB 1A8QA 1S6YA 1MT3A 1NJ5A 3BZBA 1Q6YA 3ENKA 1ETHA 3MQFA 3PENA 8ADHA 4DUZB 1EFAA 5LOVB 4H9GA 2ODAA 1S4MA 3SKXA 5LZ8A 3MJFA 1FTGA 1Z82A 2WUVA 4KXFB 4RU1A 3DEYX 1YGPA 4DM3A 5IXYA 1ECGA 3TLAA 2P6UA 5JJBA 4XQ9A 5DM0A 1XNHA 2EYUA 2NV6A 3MGCA 3O4GA 4X62B 5BN3A 2R5FA 3NYQA 3CVYA 1FX0A 1ZBDA 3IP9A 1NTRA 2NG1A 1KVRA 1UPUA 5ALVA 1EP3B 1DWOA 2BY4A 3GA0A 3DXZA 1QE3A 3BMOB 4ZWNA 5I7EA 4KL8S 4QGGA 2FZGA 4ESEA 4BDSA 3PITA 1KTIA 2FMXA 5DTIA 1Y81A 2Q5QA 2OO3A 2WYWA 2PMFA 4LMAA 4ZXPA 3WBFA 4G63A 4B34A 1RXEA 5KAPA 3R09A 4XUCA 3K0AA 1Z39A 3PEYA 3GGCA 3ZGLA 4DHEA 4KTVE 4YQEA 1A9TA 1V5GA 2BF7A 3OESA 1OR8A 2Z4SA 1YKSA 1JTVA 3AW8A 3NPMA 4KO4S 4RIGA 2G9RA 1MO5A 1TC1A 1YB6A 2WWYA 4H4CA 1T8WA 3HACA 4PPYA 3R7BA 5COQA 2E5FA 2XKJE 2WNSA 4JSRA 4WL0A 2FX5A 3K4QA 2C3PA 4OQLA 4URHA 1GGNA 5IH3A 1N3LA 1YULA 2HU2A 5GONF 2GLXA 2PMEA 5IHPA 1CUJA 1Z5ZA 1UP6A 2X9NA 4BS9A 3CSDA 4J3FA 1FP4A 3B13B 2OYSA 4C0SA 1QO0A 5FTWA 3VR5H 5DBIA 1WLSA 4HHEA 1F1BA 3S8MA 3CKLA 1CZOA 2G71A 4BWFB 2VP4A 2BFBB 3KZOA 1U31A 1SPBS 4BO0A 4FHDA 4CEJB 3GEHA 1U1IA 3AXTA 4A1OA 1OTHA 2GYUA 1Q0HA 2Q28A 5BP7A 4Z3DA 1JWBB 3CGGA 1SRRA 1WPQA 1MB3A 5COAA 4EGFA 4FGSA 2PRSA 4LWZA 1J20A 2HEIA 4QLOA 3QFRA 2ID9A 1DUIA 3KUDA 1NR5A 3RTEA 4DA0A 1E2UA 1ESCA 4EL0A 4RUKA 4G0MA 3A1UA 4KR0A 2J5BA 1CEXA 3ZD7A 1U8UA 5GJWC 3IQWA 3QUSA 4PHGA 2X3UA 4PQFA 2IUSA 4ZVLA 2XMBA 2LE0A 3UJ9A 4UHHA 1X87A 3KTAB 1E2BA 1TXGA 1NZFA 2C4HA 3RHSA 2PUDA 2IYUA 3CVWA 2YW2A 4U0KA 2WUDA 2P4SA 2ZRFA 4LHWA 4N5LA 1PJTA 3MLBA 1C0LA 1QF9A 3LKZA 2WSIA 4J0JA 1O6BA 4KIGA 3MGKA 1PFYA 3ZYZA 1QFZA 5K3OA 3JX9A 2REQB 4UBIA 4HEQA 1T3SA 3FPSA 5AYVA 4EVSA 1NU8A 1GG2A 1Y4SA 3I1YA 1XTRA 3DEZA 2ZRQA 4HDRB 3BVPA 4I5IA 4NZ9A 2YV5A 1OB2A 4UUQA 3L7IA 1G4UR 1NLYA 4QC2A 3RUAA 3RWBA 2TECE 5DTJA 3G9XA 5JIBA 1RLJA 2CK3A 4TKZA 2DWQA 2OO5C 4BFTA 4P54A 1V9LA 5AVXA 3D0OA 4QECA 1SCNE 3GFGA 5M29A 1T6BY 4NYMR 3JZAA 3MGGA 1K7EB 1TZMA 1AXRA 4L9WA 1WHSB 2OBNA 4B35A 1CUWA 2VDWB 4JS0A 1PQPA 1ZNXA 4F9FA 4LF9B 4GLLA 3ELBA 5CJ2A 3TQHA 4UHFA 2FXVA 2PM8A 4R69A 2ADFA 1GNVA 4IIUA 2YWHA 5DPMA 2WOJA 5A6VA 1FMCA 1EE9A 1JS1X 3GIDA 4ZRNA 4OHFA 2E3JA 2VJDA 3ZLVA 3TSCA 8OHMA 3O2SB 3REFA 4B33A 3QH4A 2FN3A 3H8JA 3KU4A 1YH3A 1ZEMA 4KX3A 1TO2E 3VH2A 1CXZA 3AEYA 3ITNA 2D1YA 3DAGA 2QYOA 3O93A 4D7AA 3JQBA 4G8BA 5HRUA 5HRAA 1VHWA 5JNUA 1P2GA 4CL8A 3NETA 4PF1A 5KNDD 1ZAKA 1B8NA 3D8UA 1AE1A 2C78A 3K1AA 4X1YB 4ZEWA 1REQB 4QBHA 3USCS 4ZCRA 5LLDA 1H66A 4GGPA 2E5WA 4V03A 5A3SA 2Q0XA 4CKYA 1WXQA 1G21E 3VA7A 1ZP6A 3G2OA 3KG2A 4LF6B 3KQYA 3QG1A 5AVJA 2UZ1A 1G5HA 3JZDA 4UE3S 1E9CA 2ES4A 1XEWX 1LK7A 1XZGA 3HDGA 5E6UA 3ELUA 1I7NA 1YNSA 2Z2YA 3KOYA 3THYB 2VBFA 1UEIA 3G5UA 2BMEA 1Z6XA 2D7CA 4P98A 1O97C 5SYMA 1X7YB 1SUCA 3JQ6A 1MGOA 4BGDA 1FBTA 4J4HA 2O6HA 2OC9A 3TBKA 2P65A 4OV6B 4TTTS 1T9GR 5CD9A 1ESEA 3L8ZA 1C7ZA 1AXGA 1JEEA 4OCZA 2OB1A 1D0IA 1XRPA 3K31A 4OYRA 4R1OA 3W34A 3W77A 5REQB 5FOQA 3ESAA 3KWFA 3WSVA 3F49S 1Q1GA 4ENRA 6Q21A 2YMLA 4IGAA 1A4UA 5FLKA 4PAGA 4A26A 4Y6LA 4M36A 2N47A 3WY9A 1PGQA 3F3SA 3H5IA 5JJCA 2GJ8A 1ZRSA 2WIGA 3BMCB 4HDNB 4M4SA 4LFCB 1JR3E 1M33A 4TPKA 1MBZA 4R9UC 4KMMA 4DDUA 1KO7A 1CDEA 1HLDA 2CXHA 3ZEIA 4AY6A 3EJWA 4KNVA 3T3DA 2JD0A 3KJXA 3WHPA 2HJHA 1NBEA 1MB2A 3M1AA 1XJ0A 4ES6A 1P7YA 1YRBA 3LQKA 4KWCA 3D3EA 4QRDA 1LLQA 3N7UA 3TOVA 4EBBA 3AZPA 5FA5A 1H1DA 1I4DD 3USZA 1Z18A 4AZ0A 2ZIXA 2Y1FA 3LUGA 2QGZA 3EVFA 3NNSA 1XVVA 4RH1A 1RLOA 1UKBA 4WX2B 3EMBA 1CULC 1T35A 1S01A 2XYPA 4HZUB 1P29A 1MX5A 2R8XA 1MFZA 2X5JO 1RDFA 4MUGA 2PSDA 4PO1A 4OI0A 1E5QA 3OPYB 3GJ4A 3R8XA 1UPBA 3JVUA 1ACLA 4S2EA 3TYXA 3VV2A 2FEOA 1V5FA 4N82A 5L6MB 3T5TA 5BW8A 3KB1A 2UZ4A 1W2WB 1ZHHA 1RM4A 2PZAA 4F2DA 4HT3B 3H6GA 1LBSA 1L4EA 3IBTA 1R6BX 1EBFA 2COUA 3K6KA 3L43A 3TOCA 4PLPA 4CMIB 1KQGA 1Y42X 2R8EA 3D3WB 3PUJA 4J4BA 4JP5A 4TQAA 1RRGA 2H2IA 1SUSA 3EGWA 2QLBA 1Z0ZA 5BN3B 2J59A 4HPXB 4JNCA 1ZW6A 4AZ3B 1W36D 1FQKA 3DOJA 4CI9A 2NU7A 5HIIA 1N8TA 3ZUPA 4BKMA 3W04A 2VJKA 2FHPA 3AWDA 2GN2A 5PNTA 1AV7A 1H8HD 1SUFA 3K5PA 4R9NA 1Y1KE 1EJ6A 1TF5A 2XQGA 4W8OA 4FCCA 1CQWA 4EPWA 1PSWA 5LQKA 1KKUA 5E4FA 5JECA 1TA0A 1TE2A 1EK2A 2ONZA 2QV7A 3CGWA 5C3MA 1II8B 3P9PA 4ZQCB 2QRGA 3WI7A 4KQEA 1H2EA 4KQJA 3GJ6A 4EJ6A 5J23A 1RMQA 1UKAA 3Q7QA 4IDOA 3BWYA 1X1BA 4B46A 3LBNA 4DYVA 1G5PA 1SIBE 3ZX4A 4UTXA 5FBWB 3FHTA 3LTEA 4HC4A 4RPIA 1RAFA 3NT5A 4I1SA 2GCOA 1YZHA 1P6QA 2FW7A 2YJTD 4IIJF 2B1RA 3E5NA 4I7EA 3RU2A 4BV2A 5HFAA 3B7WA 5CFOA 3ZG6A 2AYYA 1GSHA 4I81A 3P8ZA 4PZYA 1Z73A 1PUJA 1T2EA 2B8JA 3M9LA 1R3UA 3IL2A 5TS3A 1TD1A 4JELA 4YP5A 3Q9SA 3SICE 3HPRA 1N6IA 3SLGA 3D6MA 1FFWA 2XUJA 5J40A 3VKHA 2EXXA 3RUIA 4ZHQF 4M8SA 3CN7A 3HKEA 3MRTA 5K0NA 2BUCA 3DF9A 4JBGA 3I92A 1PTJA 4OHKA 3RG8A 5A3VA 3WE7A 1WVGA 4N0EA 3SAJA 3L49A 1OFUA 2ZYWX 2BYTA 4OBWA 3O8OA 5J4YA 3LFTA 3C87A 4OLBA 3M5CA 1LH0A 3M4NA 2O1WA 3FHOA 1F48A 4G81A 4QM7A 4TT3A 2G3YA 4FD3A 2V6BA 4PM4A 5D3QA 1NV9A 1KVUA 1G6HA 5EFZA 3TX6A 2XT0A 3BIXA 3VR2D 2HSEA 1Y1LA 1CQJA 2OBBA 4G89A 2YIDA 1OUMA 4AKGA 2YHSA 3EZ6A 4GI5A 2QTLA 2RGEA 1BG6A 4OLHA 1JQAA 1U9YA 2X41A 4H18A 5G1NA 3RTAA 1M6VB 1F9AA 1PR4A 3NYWA 1AKRA 3TQIA 4AN4A 2XQKA 3REGA 3AY7A 4FYJA 2GXQA 2QT9A 2ZWPA 1CWUA 4FQ5A 4NS4A 4QTTB 4XA8A 4YJ3A 1G4AE 1KU0A 3UTCA 2F1OA 2OBYA 2GM4A 4IO0A 2HJRA 1GUAA 4HK4A 4EUEA 1NFQA 4JKYA 1IMJA 1BKYA 1ZO8A 4OHPA 1YFKA 2AKAB 3JZIA 3ND9A 4LXIA 2CE7A 2ZT5A 3REOA 2O54A 2R8ZA 4KQMA 4NICA 4PRZA 1E0JA 2QX6A 4D3DA 3CRQA 5EMJA 2RHBA 5EVJA 3FVTA 4M7WA 1YJXA 2GM3A 1N5IA 3L93A 2ECQA 4KH1A 1T0HB 5ELXA 1XAGA 1SC1A 1U94A 2I4OA 1L5ZA 3G2QA 1J39A 1QFJA 4LYAA 5DLEA 1DAGA 4IPTA 4W8HA 2NP6A 1QDUA 1CVLA 1JIJA 2WWTA 4E70A 2A9VA 4ADSG 4F6RA 3H17A 1DEOA 2ID8A 4I55A 2QZPA 1DKUA 1U11A 2GZRA 3KAKA 4JUIA 2EKZA 2ZB2A 3TF5A 3FRHA 1Y1TA 5D1HA 3FRJA 3EXAA 4CG2A 1Z7GA 1SCBA 3M82A 4EG7A 1ZONA 2ORIA 1MRNA 1XZAA 2YCBA 1Z33A 2VQEB 4HPWA 3BH6A 5JSZA 3ZLJA 1BVHA 3S2UA 4AS1A 2XB6A 1AS3A 1GDHA 2I1QA 3I8SA 1TUGA 1YZLA 1CRQA 3NEJA 4MGKR 4OU4A 1FFCA 4PO9A 3VAAA 3MIIA 1WULS 2C77A 3WNBA 4JVOA 1I3OA 4FNAA 2VP5A 4M54A 3WMFA 1BVYF 4GICA 4AF6A 5AQEA 2B69A 2JLQA 1XMJA 3DL2A 2H7VA 4ZZIA 4BFXA 2A2ZA 3TQRA 4MA4A 3K1AB 4OKSA 4V38A 2ZRIA 3HB7A 2HMWA 3IAUA 2CYAA 1ZNWA 7GPBA 3HDYA 4GPZA 4M1KA 1OX6A 3FFBA 2IK8A 1XD8A 4JD5A 4MINA 2VZEA 3VR6D 2PY6A 2IVFA 2X4LA 5AI8A 4ZAWA 3HVJA 3TRJA 3HCNA 3THSA 2XECA 2WE7A 3AUUA 2PZKA 3D1VA 2ZJ2A 2R68A 3F97A 4QBGB 4WDRA 5E6UB 4COKA 4D3FA 3DV2A 2YXLA 3EQ9A 2W6ID 4ZVRA 4ZVNA 2H51A 1EDBA 3VV3A 2FZ5A 3ROPA 4B6RA 4FN5A 3VU8A 2ZM5A 4DR3B 2O7VA 3S1LA 5EPOA 4KQXA 1RTTA 1PJLA 1AKUA 3NB0A 2BELA 4Q1VA 4WZBE 3VVMA 1LBQA 1IPEA 4TXNA 3BQNB 5FT9A 3VAZA 4MWCA 2NTNA 2XUFA 1J2UA 1N1GA 5TGDA 1OA1A 2QP4A 4KPUA 3LSYA 4A0SA 2FSVC 2H63A 1S2IA 4X7RA 1PLKA 4WESB 4BRSA 3RT1A 2JIZD 2OO7A 4YCSA 4P5EA 1IBSA 2R86A 4NE7A 4A2PA 4JGIA 3QFSA 3O4IA 5ERGB 3KDSE 4BMCA 1QHSA 2RARA 3NC0C 3D4BA 4UNRA 2BJWA 1Q3KA 3HGQA 2QN2A 4MA5A 3BHNA 4BZXA 5IKPA 1G3IA 1L5VA 1E2MA 1O96A 4KBFA 3MTAA 5FUVA 3TTVA 1VB3A 4K9SA 1ZOLA 1X42A 3CLTC 3NCHA 4BO1A 1RC0A 3LUJA 4E09A 2M32A 4LF5B 2A5YB 4C7OA 3QEBZ 1W76A 2QX9A 2W71A 3IJRA 4D0SA 4AZ0B 4KR3A 1J0EA 1E5TA 2ZIXB 3G1TA 3RIXA 5BUSA 3G9QA 2VBCA 3H1FA 1FVOA 1HLPA 6PFKA 5FQOA 1N33B 4GW3A 2HCTA 2AW3A 3V4PB 3K73O 4HDAA 5C7LO 2I2CA 1WMBA 3DE5X 2VRBA 4WKPA 2I9PA 2A9OA 3CNHA 1BH6A 1MJGA 3LC0A 1VKZA 2AQIA 3I12A 4M2LA 1FUKA 2ZRLA 4XWOA 1HGXA 1RAGA 1UAYA 2I1LA 4RFLA 1VQ1A 2HRBA 2R0QC 1K4YA 1RI1A 3TG8A 1U99A 4ZAGA 1SN7A 2OCXA 4G0NA 4K9KA 1VG0B 3W5DA 3D64A 1J4AA 1JG7A 2W4MA 7ABPA 1J7JA 1D4AA 4XYMA 4J7XA 3HR8A 1T4CA 1VL6A 2PTGA 2NU7B 4B76A 2AEEA 3SQNA 4Z51A 4JENA 4WUTA 1W5TA 2G63A 2I78A 3FLEA 3PXCX 1EK0A 1X74A 3F98A 1JR4A 4QASA 5KYGA 1QR2A 3WNCA 2WT9A 4EA9A 1WDTA 2IRWA 2G6BA 3HUFA 4DSUA 1FFGA 1H8ED 4X6LA 2J6CA 3V00A 4DQ0A 1AGPA 4OYYA 1ZGCA 3NKFA 2OQIA 2D00A 5FTKA 4EPYA 1XYGA 2GJKA 1A5SB 3OZDA 4G1CA 3PSHA 4DV3B 5J58A 1GA6A 1NI4A 2C59A 1B6RA 3ES9A 1LQ2A 3I2JA 3OHPA 4IRXA 1ZOOA 2BWJA 1Z2EA 4KLNA 4PNZA 5FBHA 3UANA 4B9EA 1PR9A 1FVFA 2ZAMA 4XDHA 4YAWA 1BHJA 4X61A 3SI7A 1ZH0A 3B3AA 2BC9A 4JYPA 4P4SA 1UZMA 1MX3A 2VBGA 2GCOB 1R18A 3NGMA 1N5OX 1ACJA 3JYQA 3BGVA 4AQDA 1JLKA 1JEQA 4LMBA 4R2JA 2XUIA 1NLUA 1YR1A 3JWGA 4BIIA 1AQYA 2OHIA 2RGUA 1IVYA 1MP0A 5B5SA 5GM1A 4YJ2A 4OOFA 1U7DA 3AF3A 2AJCA 3IEPA 4OG2A 4D1YA 5LJLA 2GS9A 1BZYA 1U80A 3TR0A 3IVGA 4NPHA 4O4JF 3N2NA 2OGZA 3TK1A 4QUDA 2CVOA 5AI4A 4DMKA 3MT8A 3HKEB 4LJYA 1HNXB 5E1DA 2ZB3A 3IAAA 4E5UA 5JW6A 4G07A 3G8CA 3DTVD 3I5AA 1BIFA 1YIAA 3K1JA 4LJ7A 4P31A 4Y1GA 4ILKA 1GGFA 1T5SA 2YVUA 4Y2GA 3SE0A 3QXJA 3O8OB 5F5LA 3KQUA 4J1QA 5CCDA 2Z6QA 2YVKA 3RS0A 3AJDA 2MIIA 2W4IA 3EBPA 2ZYDA 2P67A 3AM5A 3WHLA 2AV6A 3DF7A 2CV0A 2H29A 1P0MA 1GKLA 5H4HA 3O2JA 3SNHA 3VZPA 1MORA 1CQJB 2Z2KA 3E4DA 4HSGA 5KOHA 4CMGA 4NOJA 2QAIA 2WJAA 4BTVA 1JJFA 3GEPA 3T3OA 1DAMA 4RZIA 3WYBA 1M8JA 4CG1A 2IQ5A 1FYEA 1P7WA 4FHFA 1PX0A 1P5JA 1E2QA 4MRMA 3SR0A 1PZGA 1W35A 2WKWA 4YJ3B 1AURA 1E1KA 1KKLA 3E82A 1PT7A 3A1DA 1ORWA 5EIWA 1YDFA 1EVQA 4BBJA 5HKOA 1P9WA 3EC1A 4NWIA 4QDKA 1G8YA 4PYIA 5EMLA 5A5VA 2Q4TA 1EIWA 1E18A 2FSFA 4JJ8A 3IHWA 4LXTA 2C5FA 4OP2A 5FI0B 4WKGA 3TUJC 2ON6A 4EH1A 4YY3B 3Q15C 1NXSA 3W90A 4L9RA 2QTBA 4D74A 2O7NA 2WINI 4KGDA 4BMVA 4IOJA 1PT6A 1QTNA 1R64A 2FR8A 3GEBA 3N2EA 1TOAA 4OA5A 4OGFA 3A28A 2WIBA 3EGXA 2Q5CA 2ZIWB 3GLRA 3NNDA 3R41A 3RO7A 2BFFB 4TMZA 2ZR9A 1WSDA 1WB5A 3QHPA 5CFNA 4UJ5A 3JD1A 1W34A 1E62A 1T9AA 4F6RB 4Y2QA 5HKLA 4FGWA 2V7BA 4QTXA 3TAXA 2PGNA 3FH0A 4IMPA 3ZDXB 4ZDIA 2VF8A 2ACWA 1WUIS 4RABA 2NV2B 3CY6A 2GVDC 1DZ3A 4U39A 4PN3A 4TMKA 1I5RA 3MC1A 4L22A 4Q6WA 5E8RA 5A7HA 5JALA 5TIIA 1YBHA 4BE4A 1A1SA 2FUCA 4C7JA 5SYNA 1E1LA 5JSZB 4KSBA 5BQ3A 3A3PA 4C88A 1DBWA 1JJIA 3LY7A 4LA4A 1GGVA 5BSHA 1QG2A 1VHLA 3L4BA 3SHWA 1YJ8A 4KZPA 2G7ZA 5IAAA 2X0RA 4OIFA 1HWYA 2PRYA 1XGKA 3QEJA 1DAPA 1PE0A 2HT1A 5BSRA 3HABA 2C9MA 5A4FS 1AKMA 5JS7A 3NCTA 3LRPA 4ZC8A 3RVOA 1NR7A 3VC7A 4MQBA 2ZPUA 3WMXA 2XBUA 2X3YA 1PFQA 1BU5A 3LP8A 3RSFA 3TS1A 3ZLUA 4E88A 4ZGGA 5BW6B 5K7SA 3DFFA 2LIPA 4TLEA 2VYND 2FF7A 2C9YA 1KGDA 3QF7A 4PFSA 5IDVA 4EABA 2WWXA 3U0BA 2CMGA 5JZSA 4EF6A 3Q7IA 4X93A 1LWNA 4WEOA 4BO9A 5BSEA 5KTNA 4R6XA 1XV5A 1BFDA 1W2GA 1T3LA 4P83A 3ZHSA 4BVLA 1GFSA 4IF6A 3WFIA 3EF0A 5C5EA 1YJAA 5C51B 2R6DA 1D3AA 3E6AA 1I4WA 3TE7A 3U3DA 4C6TB 3IAFA 4CLOA 1E7WA 1CRLA 3B3QA 3QPAA 2E0IA 3ND6A 4ID3A 4KPUB 3TQTA 4Y6GB 3VX4A 1SHZA 5E4JA 4F3NA 3RHTA 3ZU4A 2UYYA 5BYBA 1HDZA 3PHLA 2H57A 1IEWA 3PYLA 2JLZA 2RJNA 1O6CA 2WSLA 2BONA 1RZRD 4K6HA 2QM3A 1K1EA 1Y8RB 3ACBA 2FEAA 4L4ZA 4NEHB 2FEPA 4JH0A 4QWWA 1PNOA 1NBHA 1Z5PA 4QBTA 5FBLB 1YKFA 5KYNA 1TX4B 1P73A 3L6CA 4QZVA 3JQGB 5AKJA 3U37A 1DBRA 2BSXA 2QKYA 2EP7A 4QDZA 4XWGA 3FYCA 2WIAA 3KX2A 4C7OB 1Z29A 1FDOA 1T5DX 1TQ8A 3GG2A 5GINE 1D2MA 4CU5A 4ACAA 1YOBA 3I76A 1PHPA 4R31A 2WG0A 5EMNA 3MINA 4CQNA 3R1IA 3WV4A 3V4VB 3X1WA 4M87A 2HF2A 1PT9A 2X5NA 4EY8A 1ULAA 2FZVA 3IURA 1KZHA 1QZUA 5EERA 2R00A 2W2MA 2XGOA 4LXXA 7MHTA 4OHUA 3OQOA 2NT4A 3NHUA 3KRTA 1SBIA 3YASA 5INTA 2EJWA 3LLMA 2CK3D 1O95A 3VR1A 1TADA 1U0LA 1UBEA 2X7JA 1NQAO 1O87A 4Q01A 4B3CA 2AZMA 3FFTA 4C01A 3NH6A 4NH4A 1FQWA 1M73E 3JCZA 3QKTA 5HBRA 1T4CB 3DOCA 2ENUA 3PKZA 4RCVA 4B8ZA 4KPYA 4LY6A 3G79A 2H7CA 1D1PA 4TGLA 5EQTA 3NTOA 4L5IA 4L57A 4D8XA 3CEAA 3NP7A 4DAEA 5FBZA 1V71A 3LBHA 3ZHVA 2IJGX 3H0KA 3NR2A 3R3XA 4RL6A 2A9QA 3PCRB 3FTNA 5AO9A 2JD1A 5EYPA 3DW1X 2N9UA 4CMJA 2AFVA 2JC3A 3AW9A 3TW0A 3H8SA 2F62A 3AHDA 4D98A 2C4NA 1N9GA 3V2GA 3IHTA 5LM3A 3JYHA 1EDZA 1XWFA 3GDFA 3NHFA 3O4HA 2GEUA 4DQKA 4KFSA 2PGDA 1B8PA 4WOJA 4GMXA 1LLUA 3OZWA 3UY4A 3D6JA 2BW0A 4OQFA 3D2AA 1OAOA 2BFDB 2P0EA 3UJ6A 3B8HA 3RC1A 4LG1A 5LQDA 1VBFA 1QHYA 1H0HA 2QG9A 3LY5A 1WP4A 4P35A 4TMVA 2D3WA 5HQ3B 2UZIR 3TD6A 3GN1A 1IBLB 4Q9AA 4J29A 4ZMRA 3QA3E 4RW0A 1JEQB 1PI3A 4HNSA 1CIVA 4O2RA 4QGAA 3RT9A 1NJSA 3ZZ1A 4B43A 1ZX1A 2LV8A 3LOUA 6AT1A 4YJ2B 5JH7B 2E1PA 6NULA 1J33A 4TYYA 2CHFA 2JIMA 5EP1A 3MCZA 3NX4A 5GZ1A 5J2UA 1VIMA 1BA2A 2QMOA 2BHSA 2FFRA 3HXTA 3GMSA 3RWOA 1A76A 5C4GB 3ZE2B 1L7NA 4R1SA 5C7IO 1DBQA 4DM4A 1EFKA 2D1QA 2G8LA 3GJRA 1P1CA 2K4MA 1KKMA 1P81A 1NWHA 3DZJA 3CINA 4RANA 4EFLA 3ECAA 4KE7A 5PGMA 2QVXX 1RHUA 1XRJA 2ZIVB 4QUGA 3WXMA 3LWBA 4OVKA 3LLVA 3KYJB 3QMWA 5FUXA 2JAQA 5HF9A 5DGTA 3KT8A 4JHXA 3WMRA 4DRXA 3FMPB 4LQ4A 2IHKA 1S9DA 3ZVRA 1NNSA 5A5DA 1G20E 4B4DA 2H1CA 4W9NA 1E3QA 3F6CA 3R20A 1COWD 1U0HC 3FTPA 4MJLA 2H17A 4GSLA 1JJAA 3AB3A 3DV9A 4JC4A 5ER6A 3NIGB 3UB4A 4LOLA 2OT3B 2IYLD 1TYCA 1SIOA 4I4IA 3MTBA 4M53A 3FVVA 4J1TC 5DBOA 2D0IA 2O1SA 4NR0A 4BNMA 4FZ3A 2I9KA 3OZVA 3NLLA 3F90A 3SLRA 1F0NA 1JAHA 1X1DA 2PX0A 3HO6A 4BKRA 1T0IA 3TLBA 4X65B 1GRNA 2Q0HA 3OD1A 1W6UA 3A14A 1NDUA 1J1UA 4ZRMA 5LMCA 1V5IA 4CN8A 1ECJA 1PDVA 1G5QA 4FCTA 4WXPA 3VR5A 1ZCZA 3ZZ0A 1TEZA 1U0BB 3GELA 3R3JA 2NV0A 2WLTA 2CVHA 4JI4B 4JVNA 1OFVA 1WZUA 4L85A 1X8JA 4N18A 5BN4A 3FWNA 5CH3A 2YXDA 1P60A 1T0JB 3EMDA 1UT5A 1X19A 2VWQA 4HNGA 4AC9A 4UVIA 2LXNA 2H2AA 4DMLA 4P0TA 2WWFA 2Y1WA 1HK7A 2A3RA 3BA1A 3CLSC 3I4CA 4K9NA 3G85A 1LNZA 3BD9A 2WKPA 3V7NA 4FZ5A 2PZEA 1L4KA 2NYVA 4HL6A 3PX7A 1NXQA 5K3AA 1NLMA 2CXTA 3KJNA 4LYEA 3E5RA 3ZQ4A 4FE7A 4D8UA 3PEWA 3AHJA 2R4QA 4PZLA 5HCIA 4FC7A 3EDQA 4RPLA 2IV7A 1EWRA 1OKKA 2PXCA 3AEUB 4JB2A 4QATA 3MN1A 1QLHA 4GVPA 5FOTA 4UUOA 3CT6A 4UBOA 2BTQA 4Q3CA 2FJUA 4YCCA 3FLAA 1IB0A 5C4IA 5B58T 4CF6A 1M54A 1U0EA 3LBYA 5HDBB 4C0AC 4BNLA 2H2FA 3RGWS 3O8BA 2BV3A 3X44A 4US2R 3EZ9A 1LUAA 4DLSA 2P9GA 2LD4A 2UAGA 5I7AA 4LE2A 4B7AA 4BX0A 4CFSA 4L02A 3V8MA 2WHRA 4GPBA 2B0JA 2IYAA 5DYGA 1QU2A 5BSWA 3VH1A 2X8JA 3L4JA 5LOVF 4R2HA 4H7EA 4WSOA 3TGWA 4A0HA 3WGQA 4PGFA 2PCLA 1CF2O 4E5YA 5BRJA 1CF4A 1Z47A 2PQ0A 2ACVA 2Y0BA 3COWA 2FMFA 2NSDA 3SS7X 3QNMA 3SDZA 4LYGA 2XQVA 1UWVA 1ZJJA 5B55A 3TFQA 3L07A 1RKBA 2NAFA 3GT7A 4C04A 4CQMA 3ADPA 3F6RA 3NWBA 1QFYA 4V2UA 1K08A 2VP6A 2LCIA 2DCMA 2DG2A 5C8XA 1KK0A 2ZAOA 3TOSA 1QRTA 3EJ6A 4NZYA 3P2IA 1QG0A 4IHAA 3LT4A 2XDYA 3BDIA 1A7KA 4G41A 4UJ3A 4M7RA 1E79D 1TM4E 3B7GA 1UBNA 2I4MA 2VDPB 2OENG 3IB6A 5KSYA 1BMTA 1KP9A 1G63A 2Q5EA 4TT3D 3D7SA 5IF3A 1MVNA 2JGIA 2R6GA 1XQ1A 2AQKA 4MKRA 3VR4D 4H7HA 3PQ2A 3Q3HA 1L7QA 3GV0A 3E8XA 1LB1B 1HI9A 4B3IA 1D6MA 2A9PA 1I7PA 4XTCS 5DLPA 1JUDA 1HZJA 4L2IB 3ROTA 1XIVA 4L72A 2RI0A 1QDEA 3UFXB 2NACA 3I83A 3EH2A 3G0IA 1QVZA 1U8TA 2QRZA 1KFKB 3GFOA 3NIFB 3VHLB 5T7BA 2G77B 2H54A 1FMLA 2Y9MB 3TQQA 1P2TA 5GVSA 3MINB 3OC0A 1XLTC 2FZCA 2OAP1 4U7HA 2V7UA 3OEHA 4N76A 1D8TA 1OYOA 3G5MA 5K05A 3BSWA 1UEXC 3OM8A 2FTKE 1P6XA 1VTKA 4E1BA 2K2WA 4J0QA 4X6YA 1M75A 1H6AA 3UV6A 4IWXA 4N5HX 2ZVJA 1QV7A 1U1CA 2EZUA 1AN9A 3OTWA 4LMRA 2JFZA 3FPJA 4OXYA 3WIUA 4UM8B 2QR2A 1K7FB 1UMKA 2RGBA 3HI6A 5IU6A 5IK2D 1G5FA 1GYQA 3TRDA 3WKDA 4DCNA 5F2NA 3U7FB 1UPXA 5FI3A 3W78A 4OXNA 4RBNA 4DLYA 3OTHA 4Z4QA 1ZK1A 5D3KA 2V1UA 1FSSA 4FFBA 1Z38A 2OHHA 4G65A 5DV9A 5IUNC 1NBME 1T0BA 2C4WA 3M9XA 2GGSA 5EYPB 3SBOA 2ZWAA 3GWGA 3HDQA 4CMEC 2I7VA 5LVAA 2FUG1 2GEFA 4RD1A 1CY6A 1B43A 1NA5A 1N9GB 5BV8A 3PD7A 4Q9KA 1YGYA 2A14A 3ZV3A 1M3SA 4TM8A 3RYHA 5BOSA 4IGFA 4EUSA 3N5CA 4BVHA 1MQ8B 2GK7A 3AKZA 1XI2A 3CEJA 2GBIA 1S96A 1VLHA 4HN4B 1WETA 2YQ5A 3CUYA 4FX5A 3CVOA 4NBRA 1AZLA 2HB6A 5JS6A 2R1TA 1LGYA 1B8UA 2CJWA 3SYKA 2MJLA 4MZDA 3V1TC 4C1NA 1USVA 1SU7A 2G40A 3IAM1 3HM2A 3MJHA 4JJEA 5DK6A 3N0RA 3U61B 1BQ3A 2VJMA 3MCWA 1NVVQ 2HDNB 3SC3A 3GLHA 1G9XA 3ITEA 3NC4A 1L5RA 1HXHA 2OCPA 1RPJA 5J2UB 1UJBA 3X2SA 4FGZA 3RC3A 4B3JA 4DWVA 4UU7A 2W00A 1N2OA 3WKCA 1IATA 2ILTA 2QR3A 4OLFA 2CHQA 1Z88A 3EGCA 4PYKA 3VBCA 1U9JA 1UC4B 4IIGA 1XDWA 3H5TA 2H16A 4PVCA 4BWYA 5HK8A 1ZVJA 4YS6A 2VF2A 4UTVA 4Q03A 4DCTA 1AK2A 4NK4A 3X1KA 1ISRA 1XDUA 3RREA 2EHJA 1K27A 2OAEA 3KNZA 1IUKA 2C7VA 1U3UA 2OUKA 3ME5A 3QUQA 4A7PA 4PO3X 3S2YA 1SM4A 1FNDA 4PCLA 2C83A 3FAZA 1YTUA 4XR9A 3KL2A 4CF7A 3G2KA 2PD6A 2LDBA 3EVTA 3O1LA 9ATCA 1WCIA 1O77A 3I01A 4DCGA 1JT2A 3PXUA 4JR1A 4DF3A 4JJIA 1FC0A 3ZXXA 5DWDA 1RYNA 4GLFA 3ORSA 1SOUA 1YI0A 1QKIA 4LZPA 1S3IA 1L1RA 4FNGA 1XT6A 4R3UC 4N01A 4RK6A 4I4TA 3NC1C 2DQKA 1I24A 1RP7A 2Q2QA 2WE8A 3A1VA 1XTJA 1K89A 1Q7TA 4X0EA 3HADA 3SHTA 1HYQA 4IXDA 5EJGA 2H1IA 2ZPAA 3T41A 4B4KA 4P08A 4EHNA 4TS3A 1D1QA 1T8YA 5FA8A 4FOOA 2Q5IA 4WIAA 1ADFA 5L4LA 3GEDA 4IXWA 1JKFA 2C3OA 5THQA 4GZ3A 2DWCA 3HZOA 2OM6A 5EHNA 2HXYA 2OBLA 4BJ3A 3QLEA 3C98A 4G1BA 2DBVO 4GR4A 3RC2A 2VNJA 3FIUA 1DCKA 4Z9AA 2FQWA 1E9EA 4AZTA 2AQHA 4AY2A 2IE8A 2PGLA 3L0DA 3BPSA 4YFVA 3JVDA 2J7PD 4JL6A 1V11A 1Y5RA 4WOBA 2Z56A 3HGTA 3P52A 3DNPA 3JTMA 4FFPA 4PTYA 2R47A 2EJCA 3WRWA 2GBCA 2ZKIA 4RACA 3ZV6A 1DQYA 4GLOA 2X2EA 1NAHA 3RABA 1M74A 2K2QB 3RSSA 3FDZA 1M2FA 3PZBA 3EBLA 1XJCA 1CZNA 2OYRA 2BTQB 2XKAA 4TL6A 5TF0A 1UK7A 1MX1A 1Z25A 5LP6C 1P0QA 4HS9A 4UUNA 4P0PB 4A8HA 1NAIA 2WFLA 4L0CA 3ELWA 4DY4A 2CLOB 3B8EA 1LC0A 2C2WA 1NN5A 1FLVA 2A5FA 2PX6A 3GXBA 3NS7A 3UEOA 1ECBA 1A2KC 4DGSA 4DCOA 1NZJA 4R5MA 1FFXA 1EXMA 3WZ2A 1LBHA 2X8JB 3QBJA 3E8SA 2AK2A 2ZI6A 2Y8EA 1FYVA 3EDOA 4G23A 2OV1A 2ZUCA 1XRSB 3IODA 2BSQA 5JS1A 4C21A 2I8CA 2A1TS 1X1RA 4UVHA 5HMMA 1X86B 2RAFA 5DP1A 1KDOA 1P4AA 4JROA 1RD4A 3NHLA 4WNIA 1ESNA 2HA6A 4YRIA 3VR3D 2ZRKA 2VJQA 2ZULA 1U3FA 3W2TA 3QYPA 1WW2A 4JJFA 4XWAA 4PQYA 4IM7A 2I29A 5JSFA 5BQXA 3NYRA 4LWOA 1CR6A 2VF7A 4ZALA 4H6WA 1I33A 2AMFA 3HA7A 3ONEA 2WTEA 3SJBA 1GEEA 4RPJA 5A06A 1P1JA 1HO3A 4EPVA 1RW4A 3E53A 3LYLA 1QLJA 1JJVA 3UMBA 1CUYA 2ILVA 2Q2OA 4L8VA 4DVGA 4Q15A 2ZJ5A 4X60A 2QPOA 5A2QA 3FSRA 1AG9A 3DM5A 2FW1A 2AC2A 1XZBA 1H3NA 4ARUA 1KR2A 1NQTA 4YRTA 3BB4A 5IAEA 1O5TA 4R7ZA 1WSWA 3U9TA 4WY5A 1YQQA 4ZAZA 5FWXA 1JQ5A 4P7BA 4QPPA 4WCFA 3TPCA 2XSZD 5KSZA 4PG6A 2VAWA 1XMSA 3UB2A 3MPUA 5KWSA 4FI3C 3GROA 2XXAA 2GZHA 3LCVB 1PG5A 2ZVDA 2G1JA 3HH8A 1E1QA 3P26A 4NZOA 1G3UA 5EP3A 3SJUA 2QOEA 5LU8A 1F12A 2FFQA 4TXMA 3A6PC 3GAMA 1K7YA 1U28C 1WZNA 1HRKA 4URYR 4YCLA 4GPEA 5KCZA 4F5ZA 1VRVA 1UJMA 1FYDA 2IYFA 5EJIA 2Z08A 4IAOA 1NVEA 1TJNA 4I99A 1A0OA 1DIOB 5DX8A 2H9AA 5CX4A 3T5DA 4G1VA 1ODKA 2C4MA 3IRVA 5IULC 5H7XA 1NG9A 2K5UA 3Q88A 1CZRA 3D8SA 1JMVA 1LDGA 3T1OA 3IA7A 4IIBA 4YBRA 5I9MA 4DLLA 4Y9RA 3O73A 4KWIA 5KINB 3M83A 3CEHA 2CLHB 5HF8A 1HL7A 2HWUA 4OMFG 3AQ4A 4ITUA 5KX5F 3HBLA 4KREA 4C7XA 2XAUA 4BY9E 4WWHA 3E8MA 4C76A 5BOSB 2FLWA 1ZRHA 3WWEA 1MH9A 3SZOA 1A9YA 2HLNA 2ZBGA 5AVYA 2FPSA 4NV1A 3RKUA 5AR1A 1D5WA 1GITA 3BSYA 5A4DA 3TCKA 1JQEA 4NG5A 4FEAA 1TTQB 3RRZA 4RA9A 4HQ6A 2IH2A 3V33A 1F0YA 2JIBA 1ZL2A 5LCXA 3IP7A 1HKUA 3NHBA 3RIYA 1K9SA 4KQIA 4LJ5A 3T4EA 2VJMB 3NV9A 1DPFA 3UMFA 2AMLA 1EQAA 4DA9A 3P5SA 5IX8A 3LM8A 3CH6A 4KQWA 1ZNZA 4UVGA 5HCNA 1A82A 5SZIA 1L3BA 3PTAA 1N0HA 3NTQA 4RTMA 2CLFB 5CVJA 1L5FA 3EF3A 5MN4A 5AKGA 1ZM4A 2RGGA 4LZOA 3TWOA 2Q4OA 2DMRA 4J0IA 4EB6A 4MRPA 2C2GA 2CJFA 3SC4A 1VMEA 3AY0A 4RD4A 3W5UA 5KTKA 4KV9A 4L9AA 1FXSA 2HYIC 3LPNA 3DAHA 1CUAA 2JGKA 2WU4A 3BXZA 1Z62A 3TLYA 4NMXB 4FYIA 1MR3F 4GRIA 1ZM7A 5D5PA 5FWYB 1VPDA 2EL7A 2P6MA 3KTDA 2VPZA 2RMKA 3QYFA 4RELA 2RCNA 3H18A 1DWPA 2Y71A 3LYAA 2R5WA 3WIOA 3CVVA 3P4XA 2J5RA 2PX5A 1RWXA 3VZSA 2FNAA 3K0EA 4YCJA 1SZCA 4B85A 4JSTA 3WG9A 2IL1A 1H0KA 2V54A 1QH0A 1WCIB 2B9EA 1J8FA 1K7CA 2PN1A 3NGXA 4NCKA 4EO9A 5BQPA 3LUCA 4MEAA 121PA 2VK1A 1PQUA 1T5LA 5BMOA 2FPGA 3IOYA 5BNTA 3W2GA 4ENVA 2MINA 3D8BA 5TR9A 2HRQA 3P9XA 2WUGA 2SBTA 1E7MA 3E5HA 5DISB 4RQAA 4C2AA 4NBKA 3P9SA 1L5YA 4PFJA 1LVHA 3H9CA 2R1ZA 3HCBA 5KQGA 3GEEA 3OIDA 3SK0A 1JPUA 3RVRA 5AICA 4IDAA 2F8LA 3QZUA 1MC4A 4BP1A 4C4AA 1W0JA 1EFDN 2BKVA 4D8YA 2F3UA 3IP6A 4WFIA 2EDAA 4NBWA 3UMSA 2OVBA 4RZSA 2FN4A 2ID4A 3L7OA 2YWFA 2AH5A 2G36A 2QL6A 3FB4A 3C48A 1VE6A 1HFEL 4JMLA 2PKEA 2RGAA 4MEBA 5BXQC 1JDTA 1W5EA 2RC6A 4Z2YA 3G0DA 3R4VA 1U8CB 3F7NA 5AOAA 1VLJA 4BB6A 1F8UA 1P4GA 1V11B 4GMKA 4XAQA 1FFHA 4OH7A 2AW5A 3P2KA 5F35A 4DCVA 1QP8A 5F23A 3PUKA 3ICEA 3M70A 4HD8A 3R8FA 2W7TA 1EGQA 3DNMA 4PY2A 4LYJA 1Q0UA 1KPGA 1QH8A 1MO2A 2PA3A 2Q1XA 4HAIA 4LKRA 4PFKA 4PXYA 3SSMA 5FWAA 3TTXA 4DC0A 5B6IA 4U7GA 1C7QA 5LKRA 2QLTA 4G09A 3Q6IA 4ZYUA 4URXR 2AOWA 3FDZB 1YR9A 1KOLA 4KB5A 1BXKA 2FLKA 4ZOEA 1KAGA 1T3HA 1ULUA 4J16C 1JHAA 4WGGA 3F74A 4D9JA 5KC8A 2BD0A 3E4CA 3G59A 5KYVA 4GM0A 4AKEA 1LKZA 2WFLB 3L8MA 3O7MA 3FNEA 4Q47A 4B4UA 4G2TA 5K0CA 4Q3LA 4TSRA 1UKYA 1QIHA 4HRVA 1WUJS 4INOA 2OEPA 5E6RA 1T1EA 1EI9A 4H6PA 3K4HA 3V2HA 3HBAA 2OKGA 4LOAA 2ATEA 2DF8A 2GAFA 3ABSB 3M6MD 2EBUA 2QU8A 4ISCA 4DA7A 1ADYA 5T8KC 1RWNA 1T1IA 5JTUA 1FFBA 2VFAA 1KQNA 5LMZA 2VDKB 1NIJA 5EESA 2FJ0A 2O3RA 3CF6R 3MK31 4NE9A 3V8PA 2F3RA 2IUFA 2X9GA 3KOUA 3NJ8A 4G9GA 4GBGA 5DNAA 1CFZA 1SURA 4CE6A 4QNMA 4JBWA 4DILA 5FEUA 1P1RA 3K53A 5IUJC 2PO5A 5EJFA 4LHXA 5U1PA 3S0JA 1SHJA 3EVGA 4JWTA 4OUDA 3KTFA 2JHAA 1ZOIA 3AFGA 2HTEA 1NWCA 2NU9A 1GAEO 5EVCA 4GE3A 3N75A 3UJHA 4MCHA 2FQQA 4CLHA 2KLBA 4IEEA 1UJ5A 1AKEA 3R7DA 2G4VA 4AUEA 4FW9A 3B1XA 4Q39A 4YQYA 3MUOA 4RZUA 3ZVLA 4AM8A 1GM5A 4C7KA 3MJCA 2H8KA 1U3DA 1PQYA 4EDFA 3NEPX 5C3UA 2IDMA 4AJLA 4HJRA 4EJSA 2VCEA 3HCAA 3N8DA 4KW7A 4M9CA 5FPTA 3KOZA 1QQ7A 1TAGA 2QEQA 5AKLA 3ADDA 3LPAA 5BSKA 3DMPA 3PGVA 2XWJI 3JR7A 1KY5A 2NZXA 4RLSA 1DV2A 4WCFB 3WOHA 4LDZA 1YQWA 3HV2A 1UT6A 4G5HA 3KAPA 1YCHA 1T3GA 1XK6A 1VYVA 3LI2A 3P2MA 3PFBA 4KUHA 4AP6A 4TLDA 3PFHA 4KYUA 2N1BA 1FVHA 3RVJA 3PT9A 3CB2A 3ZX5A 1ZUD1 3ED5A 2ISCA 621PA 4RAOA 3Q9LA 3QKUA 3D3JA 2I0FA 4LJ6A 5DOVA 4B3SB 2I91A 1KC3A 4PX9A 3RW9A 4J3JA 2FWRA 5B3AA 2G82A 2O2YA 3AF0A 3GLTA 1M2KA 1L5OA 3FOEC 3Q9NA 3WAKA 1G8JA 2PLAA 3AIMA 2P3OA 3B6JA 4Q4CA 2ZEJA 4X97A 1SVIA 1Q0TA 5IDXA 2R2AA 1X9HA 3LA6A 3IUJA 1Z6AA 1OTXA 3QWBA 4KQ1A 2JKZA 4WD3A 4M0MA 4WOKA 4Z2AA 2O8DA 1KO5A 3P0JA 1QOPB 2Q9CA 4YAJA 5J4LA 4MAMA 4KDFA 2TMGA 3PXXA 4J94A 1C4XA 2PBZA 2YYZA 4X20A 1Y9AA 4UXHA 3ZWBA 5IHXA 4WACA 1RNLA 3A4IA 4Q1EA 4TRRA 2A7QA 3EX7C 2XF8A 1P8JA 3DE3X 2C7BA 1UL1X 2UDPA 4V02A 4YJ3F 4E3WA 1OKKD 1UP7A 2XWBF 1P0PA 3VPBA 3B6KA 3A25A 4GKBA 4YMSA 3V6MA 3SF0A 4OJKA 3HVUA 2PH7A 1C7EA 4F6CA 2AFIA 1V8BA 1IDOA 3M2TA 4GP7A 3CG0A 4IBOA 5FTLA 1P61B 4ZKDA 4XXHA 3T0GA 5CT5A 1NX6A 2ETVA 3VZBA 4RA9B 3AEKA 4UKDA 3QYJA 5JJ5A 3AETB 4L6IA 4AG6A 3KEOA 4CT5A 3KQHA 3WLJA 4IIYA 4KDEA 4EI9A 2YHUA 5KYUB 2GERA 5BMVA 4RYLA 4TMFA 1Q44A 4GOND 3O0TA 1USWA 5K0FA 1JHZA 4C4RA 4X90A 3UK6A 2DT5A 1P17A 2P9FA 4WJKB 4BUJA 2IZ5A 4MVJH 2ZRAA 2ZS8A 3D6TB 2IQIA 4CQMD 2R60A 9LDTA 4BQRA 3M4JA 3USES 1UOPA 3VKFA 1LRLA 4OKNA 1S7GA 2OG1A 1TM1E 3I9FA 5ED0A 1R4MA 1GPUA 1E63A 1I2CA 4C20A 4ON9A 4G36A 2QN8A 2R65A 1GQYA 2XDAA 2AG5A 5LNK1 2Q0QA 2R79A 3UC9A 4W63A 3HKDA 1SGWA 3KUKA 4U2CA 3I9LA 2J0EA 4OHCA 4GQAA 1MAAA 3QTTA 2CL6X 3ZWPA 2WJ6A 5LZ9A 4FJ1A 3NBFA 4LYDA 4NU8X 2O57A 1BU8A 1SU6A 5E9AA 2R7MA 3Q8LA 3LUKA 4L27A 1UDCA 1GUZA 1ZN9A 3DMDA 4P4GA 2BKXA 1M2VA 1DAEA 1FNMA 2P3SA 2PKYX 1OU0A 1ACMA 1T8TA 1I0LA 2EKLA 1NE7A 3ZNOA 5IMSA 3A2LA 1UZUA 3Q1LA 3V9AA 2JFFA 2FPGB 2WU3A 3LQRA 1KP3A 4D8WA 1NVVR 3R0JA 3C5HA 4QXPA 1QCDA 5H9VA 4US0R 2ZR8A 2QVBA 3ZDZB 2QTCA 2PVSA 1WM1A 3OEHD 4A27A 4HDMA 5HA5A 3NRCA 1NT4A 4K8RB 4DLAA 3CUKA 3L4SO 3LXMA 3U4HA 1JB9A 4L7VA 4P4LA 3L8YA 2VZ9A 3O4VA 2RH9B 1RM0A 2RK6A 3FDJA 5DM70 1Q0PA 5JBQA 5LC1A 2P2ZA 2X23A 2J0VA 3SKYA 9LDBA 2DSNA 2AVDA 3TEMA 4URFA 4DMMA 1CSEE 2G07A 4MDYA 2ORWA 1T1RA 3EQ7A 4K9RA 5F21A 3SC2B 4TLCA 3SVZA 2YN2A 3ODGA 2Z4TA 2ZYIA 3PFGA 3WNQA 4BCCA 1X14A 4MCIA 4JT2A 2WJPA 1J1IA 4ZCLA 3PQ3A 5ILOA 3JQAA 3GGDA 1W59A 1BEUB 1B3BA 1YE8A 2HA2A 4P9NA 4ZVTA 2ZFUA 4HCJA 3LTNC 4TSFD 4O02B 1Y1QA 1TZ2A 3KPWA 4G4SP 3AC0A 3I37X 1QH8B 2VDJA 4X1KA 4BAGA 3SWWA 3FPBA 4E5DA 1YUBA 3BGIA 4XI9A 2IUTA 4D45A 3PIDA 1JAYA 1LPBB 4KNWA 1O9HA 1RCTE 2G6TA 5A6SA 5EN4A 5JLJA 2OVFA 5J5CA 2R7LA 1G9SA 1BFKA 5H02A 3T06B 1DIBA 1GHTA 1SB9A 2JEZA 1XD2A 2SNIE 3OOWA 3B1VA 4LSGA 4LQCA 3X3HA 4DB2A 1VIDA 3WJ2A 3WNZA 4DA4A 1Z9BA 1SUPA 3ZCTA 2W42A 1WXHA 4W1QA 3NXKA 4N47A 5J43A 1EDOA 1HDEA 4LOIA 4WEQA 5CXXA 5E6RB 5ENVA 3FTQA 4BNIA 4FC6A 2FV8A 3VI4B 2PUFA 1FMFA 2ZG6A 2ZWIA 2A57A 2W2PA 4EF5A 2EFHB 4OAPA 2R6HA 3MJVA 4NJMA 5ULLA 4OMUA 2DOKA 1Z4QA 4M9RA 3R75A 3ROEA 3WNDA 4I1VA 1HMYA 1KXJA 1PKXA 1SHKA 1VHDA 3W1VA 3VHXA 3GDOA 5A0TA 1XDZA 2GSDA 2IY9A 1BX3A 2XVZA 5BVHB 1ZWKA 1EGVB 3QXGA 2EGHA 1MO3A 4P3NA 1I01A 2QRQA 5TY0A 5TC4A 5IAOA 2NN3C 3FPLA 3K8QA 3SZMA 4UCXA 1RE1A 2FWAA 2H31A 2J9ZB 4BB5A 3OQHA 4LDJA 2I5PO 1XROA 3DCYA 2YWEA 4O08A 4OUDB 4RWZA 4TWBA 2RHCA 3TPFA 1AD2A 1PP4A 2NU9B 1LS1A 2FCRA 2A84A 5LR6A 1C2YA 3T7DA 2YJ3A 4YGXB 4LZAA 1DUVG 4DOMA 3LWNA 5JWHA 5AM5A 2XD4A 5DM1A 2Q3DA 3L5KA 4DG9A 1JEYB 4F8EA 3GDHA 4DQLA 4ZV4A 4L3WA 3AUYA 1QC5A 2RE8A 4JX8A 1CT9A 1W4LA 1I3KA 2DCUA 4TLBA 3DB1A 4EJSB 3X1MA 1Q7BA 2X4GA 4CKBA 5CM8B 1B2RA 2PZ8A 5HG0A 5A02A 1WNFA 2XNSA 4MICA 5CHYA 3JXEA 3LUFA 1I4LD 3ASZA 4J0HA 1Y37A 3O90A 4UREA 4N0DA 3FUCA 1ZGAA 3IOBA 4Q37A 3V48A 5KYTA 5JH7F 4YJ2F 1A69A 4K7JA 1DXOA 2I2WA 1DQZA 2CBZA 4R9SA 3ER9A 1NNLA 1QZ3A 1VL8A 2CDBA 5HNKA 3EXEA 1CUDA 1EUCA 4XE5A 5IJXA 2MSDB 3PHCA 2QXYA 4PPGA 4B2YA 1XTZA 2ORED 3P27A 4F3CA 3O2NA 3EA5A 4GL4A 3V4RA 1IXKA 4HDCA 3PRKE 4QBFA 5CR9A 1M2JA 4GC9A 4Q4AB 3M3DA 1NF2A 1NW7A 3RS5A 5DHFA 1RXUA 4KI7A 2GPJA 3ESCA 4EG8A 3U6BA 3ZJVA 1Q50A 2BR5A 1N2SA 2QU7A 2WTBA 3QPUA 3JY6A 4OI4A 4UAGA 1MPXA 1QGYA 1H5UA 5F1YA 3PLNA 1F9EA 3S1AA 1X70A 2EGUA 3AMVA 2YICA 3ETNA 4M99A 3W7AA 3IIEA 1VJDA 3GLIE 3SQWA 3HUDA 4UHJA 1LJUA 4EMUA 1FW6A 1KEPA 2ZBEA 3ZTWA 2ZYVX 2BBTA 4BO6A 3IMCA 4BVFA 3H11A 1H69A 3OBBA 4X20B 4B6JA 4CMCA 4E33A 2WYIA 3BD6A 5HM8A 4EY4A 2O06A 4OATA 2BGWA 1U1FA 1XXHB 1F7UA 4AIRA 4BN0A 3FPAA 3LT2A 1ZRNA 1YB7A 3CSSA 4LGVA 2PO7A 2WJVA 2EVWX 1RC1A 3QPDA 4KCGA 4AFNA 2C5EA 4CHTA 2A5LA 2EOAA 3OJFA 3C3DA 2AFIB 2O2EA 5DLYA 4JC8A 1J8DA 1FLNA 3B6MA 3DOHA 4WNAA 5DO9A 2OCYC 3ZE9A 3ZY6A 2B1GA 4YAIA 4ZGWA 2IX3A 2PX8A 2HADA 1D2RA 1P4SA 2POQX 3AEKB 4ZZ0A 4FINA 3RYFA 4D0NA 2WV7A 3BTVA 1N2CA 5EWLA 3H7AA 2XJ4A 1VBKA 2Y1CA 4G2NA 1JIVA 4HDQB 4V0SA 1BDMA 5CDFA 4V0OA 5BMVB 4Q4JA 4HNTA 1G38A 3DBIA 3EPHA 4QODA 2OQ2A 3B3JA 3GFTA 3R3HA 3QSYA 2BP7A 3P0HA 1HSZA 2GJ9A 4HRAA 4IVQA 5HHTA 2MMGA 3V8NA 3VU0A 1QP0A 1YZGA 1GPAA 1ZK0A 1QP4A 5F3WB 1XZMA 1SXJD 4G5XA 4DEVA 4D9EA 2ZAIA 3DR5A 4NH0A 3TFOA 3NH9A 1R4MB 1QWSA 5HJ2A 4IKPA 4HZGA 1I32A 3HO8A 2Q5FA 2WB4A 3CWZA 5BUQA 1IN1A 4YRKA 4MI1A 3ZWKA 1I9GA 1QM5A 2EZTA 1TVKA 2J41A 1YR2A 4AURA 5IRCD 3SHFA 2HMVA 3HKDB 2JCVA 4AJ2A 4F3KA 3UUEA 3G3EA 2QRVA 3TDNA 1M34E 3DOIA 3OX3A 4ZQEA 3IMFA 3W6PA 2HIAA 1M2VB 2RHLA 2WFAA 3PZRA 1T29A 4WPGA 1SOWA 1FXWA 1LZLA 2WM2A 4JLUA 4WY2A 5AT1A 3DKRA 4HQ0A 4F85A 5FKJA 5K20A 4KUEA 3NALA 2XOEA 3TNLA 2UXDB 2GQ0A 3B5EA 3BERA 4IWYA 1QLWA 4DLBA 5ESWA 1C30B 5GZ6A 3GFPA 3CKKA 4J0CA 4HDMB 3ZV7A 1NJ8A 2P1DA 3JVIA 1E1QD 2IDKA 4KV7A 2Y05A 1HT3A 4X92A 2DEUA 1TT7A 3HHPA 1DEKA 1EDEA 3AO0B 3O4RA 5TMBA 2C98A 1SZJG 3AK4A 4HEHA 4BNZA 4CDMA 4MEJA 1IBMB 4BKPA 2XI4A 1JQKA 1ZVQA 3KEQA 4LYYA 4ND5A 1KYZA 1LK0A 2BZGA 1OFHA 3NW9A 2BHTA 5CPBA 1X6VA 1GAXA 2HHHB 4X44A 4AWAA 4HG2A 1OASA 3KQWA 3RHZA 3O84A 1T15A 1P5ZB 2MDTA 4KFUA 4XIGS 1E3SA 1UBSB 2AS0A 3T5PA 1B6SA 2WJIA 3K0KA 3JZMA 3RTCA 3LU1A 4GG1A 1ZD5A 4YHBA 1PNVA 3PUXA 4AUKA 3J81k 3BMNA 5A0FA 1WRBA 1QKKA 1VRCA 4M1YA 4UU1A 4FFDA 2Q8PA 2WT4A 1TM7E 3FCYA 4FDAA 4JA2A 3LSTA 2CZQA 3E0XA 4Q4HA 4QQ8A 1BW9A 4PC7A 5CDGA 3ZU5A 1CR1A 1Z37A 3TCXB 5KWEA 4U7DA 2CVZA 2D2XA 3W3AD 1RAHA 1NQVA 4M88A 2WY2D 2HCRA 5KYKA 5A6SB 3HBMA 4RPKA 3QPCA 2WQZA 4NENA 1W5FA 1XD2B 5CURA 3FGNA 5DYNA 5F64A 1Z7WA 1CJBA 1ZGJA 3QM1A 5TARA 2IZ7A 4B8YA 1ZK3A 4B0OA 3BF7A 3EF1A 3F5MA 3NEAA 4YV1A 2HRZA 2QPLA 3TW8A 3PRYA 4YMLA 4KLRA 2QA5A 1L5QA 1TZBA 2CLLB 4RVSA 3IQXA 5BT8A 3KYBA 1ST2A 2VHCA 1GADO 2PUBA 4HN2A 3MUEA 2GEBA 1QO9A 1QQTA 4GT1A 4NJMB 4UM7A 5JMOA 2FJPA 1R0CA 4PR0A 2Z4RA 1E2HA 1RRFA 4IEIA 4UU0A 1SCQA 3L06A 4M9XA 4D44A 4F7WA 3UFBA 4OF4A 3D43A 2BM0A 4WBXC 4I8XA 5K01A 2ZIZA 1PYOA 3B6ZA 3IVRA 3N2GA 2W98A 4HUQA 5DXAA 3HCDA 4R8MA 4ZODA 2OG2A 2YOGA 2YJ6A 4NPCA 3GVIA 1O5OA 3ANXA 1AGXA 1WA5A 3EHDA 3GHYA 2QW8A 3MD0A 2B3TA 1OBHA 3NBMA 1FJHA 5G0SA 3O1JC 5K0ZA 2PS3A 2QUIA 4CV2A 1A9RA 2JI6A 4N03A 4MIOA 3LCJA 5H81A 3QNWA 2MWMA 5G02A 2VNAA 2RAPA 3IP8A 2P62A 1DG3A 1M7HA 1ZLXA 1EK6A 3EODA 3D4NA 4LV5B 2A58A 3PNSA 1KJIA 1QC5B 2Q4DA 3HVIA 3ICCA 1PV2A 2IYWA 5B2FA 2K7FA 3A6ZA 3U80A 1L7EA 2JA1A 5K6AC 5KQMA 2E48A 3P97A 2RB5A 2UUBB 1SBZA 3WRYA 1V1RA 4CKBB 2OCAA 3ABOB 3B9QA 1BHO1 4UTZA 3FRIA 2Z9CA 2BFEB 3DBRA 2GLUA 5K3BA 1WEHA 2HPVA 5ES4B 2BFPA 1H42A 3AFHA 3MLAA 3ZJUA 3H9QA 1VIAA 4RGBA 4OH1A 2ZS9A 4PHTA 2XTJA 2PGAA 4N7MA 3EGVA 2I76A 4EG6A 1ZU5A 3R0XA 5J2UF 2G5TA 5D1NA 1A4IA 3EXEB 1EUCB 1Y7PA 3AINA 4UD2A 5AXBA 5JADA 3BC1A 4GDFA 4GOMD 2DQSA 3OQIA 4KVFA 4XYBA 3FUXA 1TTHA 1BCRA 2OXFA 1QU3A 3HN7A 5CX1A 4M8IA 1E8MA 1FUIA 3QI2A 4MWTA 1HA3A 4PNEA 4FBLA 4HS4A 4KEAA 3AIIA 1S2DA 2P91A 2I3GA 4XH9B 2C4TA 3A6KA 4FGJA 3DVQX 5EA2A 1JHYA 3MG9A 1KERA 1R15A 2A9KA 1RSZA 2X0IA 2ZR7A 2B7BA 2JFYA 3KCQA 1WV0A 2JNWA 4P1ZA 1DUSA 3S1AB 4EFDA 2OZEA 4HKTA 3AR3A 4W6QA 3SQMA 1DJMA 3QLTA 3K05A 5LA6A 2IWHA 4MQ6A 3TKLA 2VRCA 3UV7A 3ZHXA 1TDJA 2AC4A 2V59A 3PFWO 1ESDA 1NY6A 5C37A 1SVKA 1Y5MA 1MEOA 5LZ4A 1U0FA 4A8JC 4H77A 1C7FA 1XRLA 4KACA 3T52A 3E7XA 2B4YA 2EGGA 3LLSA 3UK2A 3KKQA 4P36A 1EVIA 3AI3A 3W8RA 4LJ8A 3ZCXA 1L7PA 1M7BA 4TKMA 4AF7A 1M2NA 4FYHA 4NIMA 4TXLA 4F5EA 2PEZA 2Q29A 1DQPA 4MHSA 4W5RA 2JDID 2G76A 3EHEA 4BTLA 3O03A 1FPQA 2CXNA 1RJGA 4U4AA 5EXTA 1WOMA 4F91B 2YXNA 3TX2A 2YYYA 2C3UA 3RYFB 3L05A 5AJHA 1N2CB 4PGGA 5EWLB 4BXOB 1TYBE 4YMTA 3C5VA 1ZVVA 2PFSA 3SVLA 3CJQA 4Q4JB 1Y3IA 3RSGA 1V7CA 4P7FA 2RHDA 1DXQA 2YWDA 3QOWA 4RD6A 1T9DA 2OLJA 3ILXA 1U8FO 3LP5A 2WWWA 3K0CA 4KVGA 1E1MA 5BYJA 3C7TA 1VL5A 3HY3A 3DGEC 4MROA 1XHLA 5EUBA 3GVPA 4FIZA 4QICA 4G8DA 4LYFA 4B7ZA 3I28A 4C7MA 4DMGA 5ALYA 3TR5A 4KOEC 4C3OB 4Z7QB 3UJDA 3MRXA 5EKXA 5ICSA 4MP8A 4EUNA 2V45A 4W1RA 2BL4A 3DKVA 4KIJA 4RE5A 3RVLA 2HU5A 1TVKB 3KYCA 2O59A 2PD3A 3NNNA 4KDCA 1VECA 4BFYA 1TCVA 4QEZA 1KEEB 1LPOA 3DE2X 4ND7A 4CM4B 2QN1A 3SMQA 5JAZA 4D9CA 5E4YA 2HHLA 1FRZA 1JVBA 1N9ZA 1PJAA 1N6KA 2QRVB 4HLUA 5AD1A 1XPRA 2DERA 4HGRA 2WPNA 3VU1A 1TK3A 1TZJA 2UVQA 1ZR4A 5CBKA 4N5MA 3JQDA 3T15A 1WD5A 3EY4A 3L40A 2JLYA 1MVOA 2CL0X 1Y7TA 3PWTA 2BMDA 5AVRA 3L0CA 4YPOA 2BE7A 2W22A 5JBIA 5TF4A 1P5RA 3W5HA 5K8IA 1LCIA 2XEDA 1WBDA 3L0PA 1HL3A 1LFDB 3C3WA 1XKXA 3JTEA 3MBKA 5KSOA 3TXXA 1NBAA 4DWWA 3R6GA 1SC4A 3NG1A 1DARA 5FA6A 5GADl 2FUEA 3ZDDA 4FE4A 4NLLA 1LVUA 2AA3A 3D7MA 3NHKA 1JG2A 2DU8A 2QROA 4LPKA 4EHBA 2QPAA 5CG1A 1H2XA 3C1UA 3OM0A 1SMKA 3ASVA 2VZLA 2MCFA 1FZTA 3A9SA 3LMKA 1FPMA 1Y5NA 4TM7A 2L19A 4WTOA 2ZSKA 1R0XA 1ISJA 3QSGA 4U9HS 4QJ3A 1HBJA 3LG2A 5AM2A 3AKEA 3OQPA 5HGXA 4P3OA 2PGJA 1K8ZB 3AR6A 5ECYA 4EW3A 2GYVA 2RGRA 2PH3A 4EG3A 3QX7A 1D0VA 1YS7A 4G24A 4O33A 1L4GA 2VQ3A 3VNSA 1V3VA 3BMNB 2A5DA 4KSYA 2XE4A 2XHEA 2FRXA 3MXOA 4P58A 4RQUA 3SEFA 1MLDA 4Q4HB 3G89A 3CZ5A 3O38A 3W4JA 3K09A 2W8BB 2H2HA 2IIPA 2C00A 2X8AA 5JVDA 4OQPA 3DT9A 1GQFA 5BV7A 3RAFC 2VH5R 2F17A 1NURA 4BMZA 1UQTA 4XIYA 3K70D 3BXHA 4DCMA 1J23A 3QX3A 1KYQA 4NENB 2RH8A 1OHHA 2H7XA 2JHFA 1S8AA 3I9V6 3RYCA 1EGHA 2LKCA 5FP0A 3FWKA 3VJRA 1GTJ1 3IJ5A 4PNHA 1G5TA 1UQUA 3D6NB 1CUXA 4Y6PA 3DG9A 1FTSA 2LW7A 4F9GA 1IXYA 2IXEA 1ZITA 4KFCA 4P4UA 2VQSA 1YBMA 1ZXBA 3HXMA 2C7PA 4LHYA 5CAEA 5CA0A 1F2DA 1VXRA 2PWAA 3IS3A 3QLJA 4OB8A 4YBZA 4AMVA 1ILWA 4GKKB 1P9LA 4DIKA 2J85A 4D3YA 5L3VA 4PG4A 2VDVE 2V97A 5K45A 2JFUA 3U3OA 1N5MA 4B81A 2FAXA 2BZ1A 4HVAA 5C5DA 2PPVA 2WI8A 3CT4A 4HUQB 5FRDA 4OX9B 2W6NA 1LDEA 2D5CA 5U9CA 4NCAA 1DTEA 5I47A 3PWSA 4WLNA 4ZQFA 2B5WA 4N7BA 4MQMA 2HBYA 3TI9A 3DEFA 5BSGA 3ZBQA 3CF4A 4NRDA 4JC0A 4AG3A 3N8IA 3D1LA 3KV1A 5E2BA 4HWPA 3NAQA 2XWPA 1UKCA 4EAAA 1DDIA 4C5CA 1YS2X 4KQ9A 3COZA 3FE2A 2XJ9A 1U98A 1AGNA 1ITZA 2HMSA 1TECE 4NYIQ 2GD0A 3OEEA 4R7GA 5JXIA 1VCOA 4RIHA 5EJMA 3OLVA 3SXPA 4QUHA 1N2HA 1YMUA 2GFQA 1HKHA 2WVHA 4PSVA 4XIJA 5SZJA 5HOEA 4A2QA 1G7RA 2W2KA 4NDNE 1G1AA 1T13A 2DJIA 3AEXA 3ESDA 3MMPA 1XALA 3HRKA 3L02A 1YFJA 3A2NA 2NU8A 2XMZA 4BNJA 4Z86A 4PZ9A 1H22A 3QU9A 4BO8A 3AF1A 5A3QA 4DUYB 5I51A 2HIHA 5J63A 3WL5A 3ZLBA 1G2OA 3LQYA 1PBNA 2YS6A 1EX7A 8AT1A 2IS1A 1QQBA 2GLTA 1OI4A 1WY5A 2AN1A 2GOYA 4G0VA 2QNIA 5DNCA 4GZMA 2XWSA 3WA7A 2WJJA 4ZFNA 2GN8A 1OWMA 2MMCA 4I9FA 3AILA 4PIMA 3UMYA 4F3TA 1A5TA 1BCRB 5TT0A 1PVVA 3I0NA 1LJ8A 4I19A 4MB6A 5ABPA 3LW7A 1NGSA 3Q8XB 4QREA 3DOOA 1TK2A 2XUPA 3MM4A 3F9CA 4QJ4A 1P2SA 5DVZA 5HF6A 2ZSFA 4BMDA 2QZ9A 2XCSB 1OXBB 2HK6A 2X86A 3B51X 3PC3A 4GM4A 3RRXA 3LZ6A 1RQNA 2OB2A 4MPRA 4AAYA 3E3LA 2HX1A 3S70A 1OH7A 4DUGA 2P4HX 3JQAD 2HJGA 3ZS8A 1MA3A 2BEUA 1WIWA 1YA8A 2GT1A 2IUYA 3MTQA 4X8MA 2FPRA 5LA6B 4BZWA 1G0NA 4ZEVA 3GP3A 1H4SA 3N8GA 4KH0A 2AWOA 2F48A 5IASA 5A4IS 5I4CA 4KGVA 3KJGA 2CMHA 5AUPB 4LN1A 5KREA 6REQA 4CEHA 4L50A 1OZFA 2ZXEA 5K0LA 3S2IA 2HF7A 5JFTA 3UUGA 4P34A 3TL6A 1PS8A 3CLTD 1G6KA 3LVBA 1Y9DA 2J09A 4MO9A 5EIHA 1T9BA 4RNCA 5EWJB 1GRVA 5KTYA 2AYXA 3R3ZA 3NBYC 4IFIA 3SSNA 5DT2A 2H1VA 1G59A 1ZUNA 4Y2VA 1RYYA 3E2MA 5LD2B 3SC2A 3E22A 1U2DC 4E7PA 2Q3FA 2YFYA 3ZE0B 2CUZA 3K8YA 2EKQA 2I6QA 2WYVA 4ND6A 3ZDAA 1HT2E 3A27A 1IK4A 1W46A 4S1PA 4C30A 1JDJA 3F3MA 1R8XA 5FNZA 1WSAA 2YWJA 4D43A 4XJTA 1PJ4A 2JLSA 2XYVA 3CTMA 1OLSB 3M49A 3OOJA 3VSCA 1KMMA 4ZDKA 4O2LA 1TLTA 2A1TR 3KDPA 4HNVA 4KO2S 3OZEA 3B20A 4LNHA 3QX9A 1V8DA 4OPMA 5E8JA 5TQVA 3G2MA 2GARA 5DCUA 1H9BA 4I5FA 2CHVA 4EB3A 1IULA 2V6IA 3KYCB 3ZVNA 4YRFA 5IZ4A 3L1VA 3PGKA 3ZDBA 2X0EA 3MELA 3UPTA 4V0KA 2FSUA 3ZXUB 1M7GA 1N1MA 4MRRA 4YQZA 1W36B 1AOXA 3H4IA 4F4UA 3S8EA 2CJPA 4LHVA 4YP0A 1LPPA 1KYIA 4N9WA 4MS1A 5EE9A 5TSDA 4G5OA 4CRWB 5AHKA 3UG6A 3IEUA 5D84A 4AN1A 2H06A 1VE9A 3FOWA 3OCVA 1PW7A 1I51A 2HSWA 4HO1X 5C35A 3F2VA 4EEZA 4RHYA 3OZCA 5AKEA 4ZN6A 2G67A 1NVXQ 4QO7A 1CNMA 1JMKC 3JYLA 3K35A 1V39A 4FBGA 5CDTA 4R8VA 4ALLA 4YXWA 1D2NA 1TM5E 1Z2NX 1YDEA 4TWRA 1V8ZA 4YTEA 2HH9A 5DZSA 5DJ5A 5I01A 1CUGA 1BDJA <