2GHRA

Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
269
Chain Sequence
EENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGNTPLQLDVHLLHMESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFEHEVREQHVKLLQGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFKHDNPNEKPLVRWRSHGNLLFSNWLNYYVYQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of homoserine O-succinyltransferase from Bacillus cereus at 2.4 A resolution
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
molecule keywords Homoserine O-succinyltransferase
total genus 83
structure length 269
sequence length 281
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04204 HTS Homoserine O-succinyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ghrA01
3L4EA 1PE0A 1R9GA 2GK3A 3TQIA 5SY6A 1J42A 1P80A 1QWSA 2ZUVA 4N12A 1CS0B 1PDWA 3F71A 3PQ6A 1T36B 4ENVA 3BHNA 4ZGGA 1VCNA 3P9RA 1I1QB 3UMMA 2R1UA 3M3PA 4UZSA 1CE8B 5SY4A 4ENTA 3TTWA 1IPHA 1G2IA 2ZUUA 3OT1A 2LXNA 4R7GA 1QF7A 3NONA 4MGHA 3TTVA 3PQ8A 1SOAA 3L7NA 2RK4A 2YWDA 4RKYA 3GRAA 4Y1RB 3ZJ4A 3TTYA 5BV2P 3EWNA 4I2NA 4UNIA 2R1VA 2NV2B 3CZAA 5IP5A 1GGKA 4BTEA 3TTTA 1OI4A 1ONSA 3EFEA 3P9PA 3R76A 2YWJA 4UOQA 3NOOA 1I7SB 1GG9A 3WFZA 1O1YA 4P5PA 3B3AA 1P7YA 2IUFA 2VRNA 5SYAA 3TTXA 2R1VB 2ZUWA 2NV0A 3NORA 3SOZA 5JZMA 4GE3A 4P35A 3RHTA 4AJ9A 3L3BA 4S0ZA 3NVAA 4GUDA 1M6VB 4OJYA 2GHRA 3N7TA 2RK3A 4LGYA 1BXRB 4OGFA 3ZR4B 4B31A 3D54D 3OT1B 4AUNA 4B2YA 2YWBA 2AB0A 2ISSD 4B5KA 4ZDKA 3KKLA 5E9AA 1KWKA 4E08A 4Y1GA 2XF2A 4MNTA 3PQ3A 1VHQA 2H2WA 4AUMA 4ZDIA 5JZOA 1GGFA 4ENPA 1IZYA 3NOQA 2VKTA 4OQ4A 1GGJA 1OX6A 1KA9H 1JDBC 2WJZB 4GE0A 3ER6A 4I46A 4OFWA 1P7ZA 1VCOA 4B7AA 1FY2A 4P2GA 4AULA 1L9XA 1CF9A 1FYEA 1WL8A 3EN0A 3UGJA 4WXYB 4B40A 1UCFA 1GPWB 1OX4A 1P5FA 2V4UA 5K4AA 4HCJA 3MIIA 4MTCA 3L18A 2AD5A 3PQ4A 4RKWA 1QVZA 3FSEA 1KWGA 3B36A 4L78A 4UCFA 2VDJA 3P9SA 4BIMA 1C3OB 4Y0NA 4OGGA 3B38A 1GPMA 3MGKA 4N0MA 1OY1A 3F5DA 1PDVA 1PV2A 1VCMA 3UK7A 1T0BA 1T3TA 4OIFA 3TTUA 1QDLB 1K9VF 4AUEA 2W7TA 3PQ7A 3CY6A 4ENUA 1QVVA 2A9VA 3FIJA 3P9QA 4BFLA 2R1TA 2ZUSA 3BWEA 4ADSG 4PXYA 4Y1FA 4P34A 1P81A 3CYFA 4XLLA 4P36A 2R1TB 3R74A 4L95C 2ABWA 4QYXA 3EJ6A 4WINA 4ENWA 4ZDJA 1N57A 1OX5A 5DFAA 3ZJ5A 1IZZA 4E5VA 4I4NA 4L8YA 1A9XB 4ENSA 3UJNA 1KXJA 4JQSA 4K2HA 3CZ9A 4Y1EA 1GGHA 4Y1RA 2VXOA 4L7QA 4L8FA 3VU3A 4UOZA 3EZGA 1GGEA 3TTSA 2FEXA 4D1YA 5LIRA 2OR3A 3SF8B 1SY7A 1Q7RA 4L8WB 2YWCA 1JVNA 3CNEA 1C30B 4QYTA 4LRUA 1Q2UA 1KEEB 2VPIA 2ZUTA 1I7QB 1U9CA 3SF8A 1S1MA 5SY9A 3UOWA 3PQ2A 1OX4B 3R75A 4ENRA 1QVWA 3NOVA 4ENQA 2RK6A 2D7JA 3PQ5A
chains in the Genus database with same CATH superfamily
5CFLA 2BN4A 1UZNA 1KJWA 2VNAA 1J42A 4QPCA 1PFYA 3CHYA 3H2IA 3HU5A 2QJRA 3DM5A 1VC2A 1G3QA 1XQVA 5MFZA 1DAOA 3SHWA 1CEEA 2PKCA 2WAXA 4TMTA 4AK9A 2IX3A 1VPWA 3QX9A 1C80A 1HDEA 2PG3A 2Q3DA 5FF9A 1JHQA 1Z34A 2G1UA 3HJNA 4PNHA 3RJ9A 2GFQA 2VG8A 2GNPA 2HJSA 3OT1A 4M8NE 5DOZA 4B3TB 1Y5LA 1WD5A 1EM8B 1T15A 3RT7A 2CXQA 3B1FA 3EVBA 1NTRA 4Q4CA 2E37A 4IDOA 1U0HC 3FNBA 3CMMA 4DMRA 4JLOA 1DV2A 1Y3BE 7ABPA 1SBZA 1H94A 3HGQA 1EJ6A 2WA1A 2O8EA 4BTEA 5DGDA 1BHSA 5AR1A 2XVAA 4BVJA 2TMKA 5CT8A 5B1EA 3C5HA 4WFIA 5JTTA 4OH1A 1H2EA 2ILVA 2B21A 4RVOA 4F2WA 3PFHA 2VP0A 1T2NA 1Q3TA 1OFVA 2EYUA 4PQEA 1BE8A 3GDFA 1CT9A 3ADKA 3OQNA 3L3BA 2II6A 3DPSA 1B0ZA 1UQUA 2EZUA 2YZMA 1M6VB 1R88A 1GEEA 1V8BA 2BUBA 2UVPB 1EFLA 3K72B 3QP9A 3QWIA 4FR0A 5B7GA 2C7GA 3AEQB 1DEKA 1EVKA 2YDXA 1J39A 3BIXA 1R5BA 3GGSA 4XYGA 4DREA 1TK2A 1IBKB 3ZW7A 5IDVA 2JLAA 3BPSA 3EEFA 4D4GA 2VHEA 4BX0A 5AT1A 2HF9A 2IYAA 4Z3OA 5MGBA 1TTTA 4JEHA 1R9NA 4QDJA 1T1IA 4WAUA 2B30A 4RLSA 1N33B 3N74A 5C1BA 5JALA 3VKGA 2H57A 1E3IA 1SCQA 3I6YA 2IT1A 3K4HA 4XIIA 4V2UA 3IGFA 3WIEA 1IQUA 5JNRA 5CDYA 4L16A 3PIDA 3KTAA 4QULA 1U7ZA 4N54A 1YZLA 2FQ1A 5HIKA 2ANCA 4KQ2A 4WJKB 3UOAB 1GU1A 4MGZR 1YL7A 3ZD9A 4JBNA 1TT5B 3UMBA 1HT1E 1A5BB 3R77A 1UAYA 1YIDA 4YYEA 2EHJA 5JISA 2IS6A 4PXSA 3GAMA 3EQZA 5IUKC 2QP3A 1MAVA 1NYQA 4OSOA 2YVUA 2IZZA 1O6CA 1ZAKA 1XEFA 3N07A 3SAJA 1Z6XA 3MRXA 2PMKA 3WDSA 4H3VA 3RK4A 4BO3A 4Q1FA 3P2MA 3T7KA 5LA6A 1DKMA 3A4MA 2ISCA 1FEZA 4JY7A 1ECFA 1C7IA 1Z6GA 2UYOA 2W90A 3K1JA 2FSSA 1WXXA 4IUYA 4MRAA 4YR9A 1JR4A 1Z6AA 3R6DA 2BBOA 1NXXA 2HRQA 1WXGA 3EJ6A 5IM4A 1V2GA 1KXZA 3NWJA 1KDZA 4ND6A 2YV2A 1V1JA 3FMFA 3GT0A 1EX1A 3CZPA 3M6XA 4CT5A 4IH1A 4TVKA 5J5CA 5LXTB 3SR3A 1CRPA 2MJLA 1A8HA 2XUIA 4BO1A 4PPFA 1HM5A 2X0EA 1Q7RA 1DKQA 1KU6A 2DQ4A 1C30B 2EGGA 4GGOA 1SCUA 5I7VA 2NYAA 2FK7A 3E18A 1KSFX 1MN6A 3FUXA 4J29A 1WXDA 2ZZMA 1SB8A 2AXQA 3CTPA 4GWLA 4GZ5A 4Y2QA 2XMDA 2H4YA 4TL7A 3DL7A 1EXVA 1U8YA 3TLKA 2NT3A 4DY4A 3U4MA 3FLBA 3I9KA 4KIFA 3TMKA 2IH2A 4LKRA 1C7QA 1JPUA 1FYWA 1ZMOA 1BS1A 3H2KA 4PGAA 4U2EA 4YAWA 3P9RA 4WADA 4YJ3A 4JNKA 2O4UX 3NZEA 5LOVB 1N2EA 4PINA 2PUCA 4XX1A 2RHBA 2ZB3A 3GLQA 2A35A 3I9FA 3R3UA 1DPGA 3KVVA 1JKMA 4RCYA 3RT1A 3T5TA 2VP2A 4BNUA 3GLFA 1XNGA 1LC0A 3HB5X 1XELA 1Z6TA 4MQEB 5A62A 2XWQA 3Q7PA 1P4JA 3EQ7A 2J9XB 3L01A 3LKVA 4L15A 3P94A 2VHXA 2ZB4A 1NM5C 1T8TA 2V7BA 1R8YA 2QD2A 2R7KA 1XNJA 5FCDA 4KFTA 2VQ6A 3BRWD 1KOGA 1UKEA 1XB2A 4P8RA 3FCCA 4X20A 4B87A 1KMQA 4CDGA 4EJ2A 2YY7A 3REOA 1Z7WA 3UAYA 4P3PA 2JBWA 4MSUA 3THWA 1J70A 1NVFA 3I6IA 3K9NA 2PRSA 1C0EA 4NZPA 4DPKA 1AO3A 1SKAA 3IRVA 3Q1LA 4LC0A 4CKBA 3D6NB 1MIOB 1UT6A 3A7DA 5D01A 3A04A 3I8OA 3O47A 4BWFB 2WWFA 3W8FA 4I8XA 4NZNA 1PX2A 3Q8KA 1W5TA 3WK9A 3EVGA 4B3IA 1IPEA 4BTLA 4B85A 1Y33E 2CZCA 3PC8C 1N8TA 2QL5A 4JB2A 4FGZA 4S2EA 5EY5B 3WK5A 2ZIGA 1KR2A 3IO5A 4ZVOA 2P9CA 3FKQA 2I6FA 3LYLA 3QF7A 4FHDA 5GOTA 1XJ5A 3DZIA 5F5LA 1QWOA 3STTA 4S05A 1KR5A 5JO0A 3HP7A 1JDNA 1FE8A 3KQKA 1RAIA 2WMOB 3OFVA 3CX6A 3EN0A 4I1SA 3H1FA 3DAOA 2N9UA 3D4OA 1HI9A 1LSOA 1P0CA 4I3GA 5CPBA 2VSQA 1U5CA 2YICA 1HMPA 3F67A 3RFUA 1AN9A 4V0NA 2BVNA 5J2UF 2I55A 1WX1A 2F8TA 2EV9A 1EWYA 4HRYA 4PIMA 3P97A 4DCJA 3K70D 3QMVA 3LCVB 4MI3A 4DUYB 3B1VA 1RXCA 1JAYA 1YQQA 2Z5VA 1LDYA 1HY3A 2WKSA 3LDGA 5E4TA 2INGX 3WLPA 4EMTA 1B4DA 4IDQA 4YHHB 2G07A 6Q21A 5F4ZA 1GNTA 4NPHA 3WGTA 4KFUA 1XQWA 1GPDG 1GGVA 1Z3CA 1AGYA 1I3LA 1XCBA 1C8BA 4BLWA 3G9UA 4PQRA 3I53A 1XDDA 4N5HX 1JVBA 1RBQA 4XR9A 4Z2YA 1YBVA 4G4IA 1K0UA 4HAYA 4A82A 3HCCA 4HATA 1QLWA 4OJNA 2D0PB 2EIHA 5GJCA 3SMVA 1L4NA 3K4QA 2FF7A 5K0CA 1N5RA 1VKZA 3IILA 4MP8A 4B3BA 2RHLA 3D2CA 4U0KA 4IWXA 4LXYA 5CBPA 3AUJB 5HUJA 2IPNA 2BHNA 1G8GA 1I7QB 5I3ZA 4MVJA 1Z35A 4D7AA 3WP0A 5DGTA 1OX4B 1WF3A 4KC0A 4LPSA 1LJUA 3OJEA 4M8KA 5E4JA 3H5RA 5IDWA 2WMDA 2EJBA 3I9NA 5DIZA 3IXMA 3DOFA 2WJHA 1FNSA 2EL7A 4BNDA 1N34B 3RT9A 1DDOA 2BCGY 1PVVA 4TKVA 1K7SN 4LJ5A 1VM6A 3IAFA 3F8WA 2FFQA 5JXHA 3F71A 4EEXA 3FMGA 4RM3A 5CJPA 3BL8A 5T8KC 4MMYB 2E4VA 3GROA 1CQXA 2JHPA 1E2DA 3V7UA 1UBRS 3AKDA 3S8MA 4ZMRA 1LNZA 2D0OB 4B8WA 4RTMA 3VKVA 3AG6A 1L4KA 2DFLA 4RLFA 2QE6A 2REXB 4ESVA 3VU9B 2QTRA 2BFBA 3DUWA 3HB1A 3IUNA 5AVXA 2AN4A 4BNNA 2C1XA 1N9GA 3QFFA 1A7JA 1FUIA 1ZY2A 1K2VN 2QV0A 4YQYA 2O2YA 3RF6A 2ZPUA 3HQ4O 3N8KA 1J1UA 1TU4A 2ACEA 4MWDA 5MN5A 1SC4A 1RYFA 2D2XA 3GGOA 3QY0A 1V11B 4RJTA 2H85A 2QLTA 4JDPA 4BVHA 3G9TA 4K7JA 3UN1A 3PX2A 3GXBA 4J91A 3ONEA 5DM1A 1EKXA 4OXKA 3V8QA 3QVWA 1N6KA 1N6PA 2O2IA 3WB1A 3I92A 1WBDA 3OPNA 3V7FA 3GGGA 3Q2IA 1FYVA 2ZJ2A 3FOAA 4RZSA 4A5SA 4A5OA 1QANA 2HX1A 2XBLA 3LS2A 4RD0A 4ZPJA 5EMHA 3WBJA 3ZE7A 4JJEA 2GK6A 3CF0A 3L8MA 4V0SA 5GJWC 2W6ZA 3FVQA 3LFTA 4MQFB 1T9DA 4RDHA 2ORIA 4X41A 4P3XA 4LJ6A 4DQUA 3U7JA 4L3OA 2W2MA 2CNNA 1KH3A 2QZSA 3CJQA 3HA2A 1G21B 4AJIA 4Q9HA 3IH5A 4M0FA 1CSEE 1YE3A 2MSLA 5F4BA 1UFQA 3HK2A 3B1XA 3WAJA 2FPXA 1V3UA 5J2UB 3HPQA 5LKRA 4Z2AA 1XSEA 1ECJA 1GPWB 1QVRA 2HBYA 3GEEA 3B6JA 3H1AA 2HR1A 2O8CA 4FPXA 4JL8A 4RL4A 1KMMA 3DHYA 3CFYA 4JWTA 2VTBA 1JEOA 4KHPB 5HXAA 1V1RA 2EERA 3I05A 4Q6WA 1UOPA 1XP5A 2WU3A 3P52A 3DBHA 4RY8A 4FKZA 5G4LA 4F12A 3AOGA 1VSTA 1ST2A 3KZ1E 1X7XA 2IHVA 2QQ0A 1G17A 2HHLA 5BQOA 3RF7A 2ZRCA 1KBZA 3K9BA 4CFYA 1E6KA 3O5AA 4Y30A 3ADPA 3EJWA 1QIKA 2A9VA 4D9FA 2I6QA 5TPWA 2W70A 2O9JA 1WW2A 2HF8A 3WRYC 3M2PA 4BGVA 4HV4A 4CMEC 1X7DA 4G8DA 1SOVA 1WU8A 1SBHA 1WXIA 2AOUA 2G80A 3FZQA 5EUBA 3CVVA 4UBIA 1H66A 2ZTLA 4G89A 3UG6A 3HLKA 4TMZA 4FQ7A 3REQB 2GXQA 3EOZA 2JKVA 1W0KA 3MPUA 4ES6A 1Y6QA 5EOVA 5K0NA 4PSCA 3AZPA 3FAZA 4RADA 2J6HA 4M0KA 4O25A 2ZWAA 1U9IA 3IHWA 2VZ9A 4KWEA 1M73E 1QIIA 3KQVA 2QXTA 4PZ9A 1SA0B 5EKTA 4PAWA 4AX8A 3NDBB 5BSRA 4ARZA 4HOYA 1EE1A 3C6QA 5JS6A 2YNMD 3MTBA 5AM4A 1UJ2A 1JQ5A 4UEQA 4Q3KA 1S3IA 3PE3A 4MV1A 4B7XA 3QI7A 3TXYA 4D9MA 4MRPA 2GPSA 4F2DA 2RH8A 1X7WA 3CPEA 5H80A 1BE0A 2W2TA 5M7EA 3DL0A 3AM3A 1J21A 1U1DA 1UM9A 2XIJA 2OAQ1 3A1VA 4OHVA 1EP2B 4L5IA 1T91A 3KSBC 5AJWA 1MUUA 1RZ3A 3DDOA 2J31A 3G7SA 1SHUX 3H2YA 1OHHA 2X5JO 3PL5A 4L2IA 4ZV9A 5HPYB 4DA8A 2PRYA 3ABRB 3CGGA 3OQPA 4YRMA 1V4NA 2ECFA 4YAEA 4W5TA 2VYFA 1CULC 1YKSA 2HMUA 1JIQA 3TTYA 2I3BA 3W6OA 2DQYA 2MMGA 4MGEA 1BHQ1 2VDQB 4MR7A 4B3RB 2D5BA 2FLKA 1JEJA 3ANSA 5ECYA 1COWD 4UE6A 2ZT7A 5D1HA 4RIEA 4R5HA 3EIEA 1N2IA 3K0HA 4M1EA 1KGDA 2AC2A 2XUPA 4GP6A 4Q7LA 1YDFA 4AC9A 2I4MA 4BNXA 2PQ0A 2LCIA 3NIDB 5EQTA 3FKJA 1L7EA 3WYNA 2WC1A 3DXXA 4M54A 4BY9E 1YCGA 1DJPA 3H18A 4R31A 2BSQA 1MB4A 1XKXA 2ZIZA 4B4OA 1EP1B 4LGYA 4BMDA 5CG2A 4BFZA 1GQRA 1PZXA 3D54D 1CWUA 2Y0CA 2ZANA 2G7ZA 4KUEA 2IOHA 2WTXA 4XSGA 2VNHA 1JAZA 1QX4A 3PSHA 4LY9A 5H3LA 2PMEA 5C5EA 1XVIA 2JAXA 1SG9A 1ECLA 2K6GA 3BFJA 4HN2A 5C1PA 2JHFA 2RMKA 5CYGA 5LSAA 4E7PA 1I1NA 4TRRA 2PKWA 4JYAB 3WNQA 1BRTA 3R5SA 4WVFA 4FE4A 1ZMBA 2IHBA 4PGGA 3VOBA 1SGWA 3P9CA 5GONB 3PC6A 3Q88A 3W05A 2UAGA 2EJTA 3K1AA 3W77A 1AXRA 2C84A 3ZV5A 5K4AA 4HCJA 3MIIA 4XYLA 4GZ6A 3SJUA 5AVVA 1T13A 4Q7MB 4TLAA 6AT1A 1X15A 3O31A 5TY0A 3PRYA 4TQGA 4DV5B 3FB4A 3VPHA 5LN1A 2PGXA 2OORA 3TNYA 2LIVA 3FYTA 2BGRA 1PGOA 1F3OA 1T9GS 2WG0A 3MF4A 5TQ0A 2PXAA 3ADCA 1T1EA 2WTNA 3QEKA 1E9DA 2DTDA 3E0XA 1XD2B 4AUEA 5F77A 3CY6A 3T12A 1ILEA 4BGEA 4KDEA 2ZRAA 1OLXB 2I6XA 3ZD6A 2FY8A 3NAGA 1GWNA 4OAOA 1RR6A 4NH0A 1E9AA 3KJIA 4URFA 5DM0A 1AQNA 4UU0A 5JD4A 3PC2A 2VCYA 4JGGA 5CVJA 1HRDA 5A4FS 1CR2A 2RGEA 3RVDA 4C0QC 1E1RD 2FEKA 7MHTA 1J8FA 3DT8A 3AUAA 3JALB 4QC2A 3E5MA 4O0LA 4JKYA 2A5YB 3ZK9A 3G8DA 3LQQA 1S3SA 3DVQX 1S2IA 4DC9A 5CBKA 1P29A 4I4CA 3FHLA 1NMZA 1SY7A 3PNSA 3UW1A 4Y2YA 3ZE2B 2OXEA 2FPLA 1UK9A 1UK6A 2FPUA 3E4DA 4R9RA 1XL0A 3CONA 4MA0A 3WAGA 1K63A 1TM5E 2M6KA 1NXWA 5K05A 1T29A 3DVAB 1VJGA 1MR3F 2X9NA 3QYPA 4BE9A 1NWCA 1MEJA 3THXA 3ZUGA 3TUJC 5BWNA 4IGEA 2XOEA 3BD7A 3WHPA 3OU6A 3P4UA 2Q0XA 2B8WA 3BIOA 4UNQA 1W4RA 4KKVA 3CIOA 3NHZA 5IF9A 3G59A 1YRLA 5DVZA 1J97A 2AI2A 4IWNA 5TXGA 2AJ8A 1ORWA 2NVOA 2V0NA 2XDQA 2YBDA 4PF1A 4EO4A 5DDIP 5FO1A 3ASVA 1CYDA 2VTKA 1LBTA 4LHSA 2GEBA 4REQA 1OKKA 3LOPA 5LZ9A 2HKIA 4BZXA 3D2AA 3GZNA 2JIDA 5CA0F 4UUMA 4LCEA 3SVTA 1QTRA 1TC1A 1W2HA 1XZKA 2ZUBA 3FUTA 3B2NA 1A69A 3BKXA 3JALA 3DP9A 4GPZA 3VC3A 3HVIA 3VYRB 1PJZA 4DTIA 1NJ2A 2GN8A 3PHLA 1BH6A 2CCGA 2OCAA 3GYGA 5JHHB 1MO3A 2R8XA 3JW8A 4ZRDA 5J2TF 4U7GA 1TCVA 3DFFA 4FR5A 1RNLA 2QK4A 3D3WA 5ECGC 1MO2A 5EIBD 3IUYA 3DZGA 3F47A 3KOXA 5E2IA 3RQIA 2QRMA 4R2MA 3OZAA 2DR0A 1RYNA 4HHEA 4Z4QA 3FRIA 5JH7B 4G84A 3ZGZA 3EIUA 4HYTA 2ECPA 1T5BA 4P35A 4K87A 4F86A 4O1HA 1PZFA 2VHVA 4F9FA 3CLUD 2C9MA 3BRCA 4AP5A 2X13A 1YRQA 2FJUA 2OY0A 5B1SA 4FQ5A 3KIPA 5EERA 4A6EA 3HRHA 2IH5A 3QNUA 1GG2A 4KBGA 3KZMA 1Q0PA 2BUAA 1XUOA 3WWYA 1NY5A 1RM4A 1CV2A 3KR1A 4UNPA 4A8HA 4QXRA 4N41A 5C52B 1H22A 2Q6LA 3H86A 3L1JA 1C14A 3S99A 4B79A 4D41A 1AE1A 3FCEA 2A84A 1ARZA 1E66A 1JFRA 4D3FA 1SXGA 1JHRA 2QQGA 2GX6A 1M1YA 2XUGA 3LNTA 3UK2A 4CHTA 4DSZA 1XTSA 2JD2A 1B2LA 2H0RA 1GCGA 3KV3O 5KOHB 1MQSA 1JB1A 4HEA1 4Y6LA 3SKVA 4UD6A 2P9FA 4FDTA 1UADA 4AG5A 1P1CA 4E07A 2Z2KA 5AVYA 2AFIA 2PO5A 2O8BA 1VE3A 4BIMA 4Y0NA 13PKA 4A8JA 1UOEA 4GRIA 4PHTA 4JIMA 3GRPA 4GOOD 4L3WA 1Y1QA 1QV9A 4J1SA 5B2EA 3TJZA 1P3JA 2GXSA 4QJ5A 1JSRA 2BHLA 5CNIA 1QDLB 3CR7A 3OFND 2AXNA 3ZHYA 1AXGA 1J1ZA 1GCAA 3ELBA 5T3UA 3G2KA 4Y7CA 1BCRB 3N0RA 2QAGB 5JRJA 3N3AC 4MUJA 3RFVA 2Z56A 2UV8A 4RNDB 1W46A 1XEWX 4E21A 5KQLA 3OTOB 5CA0A 1EINA 1V45E 3UXHA 1YA6A 1RJGA 2AS0A 4GBJA 3SHQA 1Y6GA 2REOA 3AY6A 3SQOA 2J0UB 4H6VA 1ZJZA 1GO2A 1RWVA 1RABA 2BAGA 3KU4A 4QUIA 3TBHA 4AJLA 1QF6A 2QYSA 2AOTB 2IPMA 5HOQA 1QIHA 3GUUA 3MTIA 3A58B 2WF7A 4PG6A 4PS0A 2W2LA 3DL4A 5A5DA 3Q3GE 4EHJA 2IXEA 4UULA 3DMNA 4AY6A 1RKVA 4J0IA 3KFXA 4O08A 3PHHA 3KOYA 4BECA 2FGKA 3GUHA 4AMGA 3UWPA 2VJNA 4RMGA 5IAKA 1E9EA 3HDVA 2VKQA 1TCUA 2HO5A 1RCFA 4Q3AA 2Q5EA 3N2ZB 2C83A 3MXOA 4IRUB 3WZMA 3WMWA 4C6SA 1A7AA 3KRTA 3NDIA 3PI6A 4ZTZB 2VAMA 2BKXA 3B20A 1HFEL 1T3LA 4HWKA 4C3ZA 1R4MA 4F96A 2P3SA 3LXRA 3OOJA 1TZJA 3WIVA 2QIOA 1Q0SA 1TZCA 4X93A 1QHFA 2Q6KA 1ZISA 1M2VA 3GXOA 1FP1D 3I8XA 3QVKA 3N6RA 5AJHA 5DK4A 5HZKA 1O03A 1IXRC 2W2LD 4M1QA 3WQBA 5IAAA 5EQJB 4D79A 3I5MA 3F7TA 4H77A 2R79A 5FWNA 1RQNA 1WUYA 3KE8A 2CLDX 4QOGA 4B6QA 4Z4CA 1V3QE 2HW8A 2QVZX 5KHLB 1XDSA 3MAGA 4FCTA 1CS0A 2O0HA 2KI5A 4RH0A 2YWJA 5BSUA 3GF4A 2ZR0A 5COAA 4ALMA 3DFIA 4UDXX 4E13A 4RA9B 1CQZA 2HV8A 4JK3A 1Z16A 3NWEA 4RJ2A 4UATA 4FMCB 1OYYA 3SHVA 3C98A 1L6IA 1DBRA 4YAJA 4MUBA 2RGNA 1QYVA 3ZLVA 4RLHA 1VXRA 2AI3A 2R6CA 4EY4A 3A9RA 2ZQ5A 1V3VA 1ACJA 1XXHE 3CS3A 3H2GA 1H0RA 2DWQA 5F21A 1EFDN 2XVZA 4NEHB 1HNNA 2IELA 3DHEA 3O4VA 4GLLA 1D2GA 3R40A 4LXTA 2X5XA 4OJTA 4HVLA 1W94A 3OETA 1JA0A 4FD3A 2Z1MA 1NA5A 3FCXA 4AF6A 4GC9A 3TOSA 1I51A 1WXQA 5AIAA 3F73A 3CA8A 3OX4A 4CQMB 3JR7A 4WN9B 1XMOB 1N5IA 1EUQA 1EIZA 1T4CB 2I2CA 3QEOA 5B53A 1X7GA 4IHKA 3DV0B 1Y3AA 3OZXA 2HHCA 1DC4A 2J9GA 3L06A 3WTBA 1NJSA 2XMRA 5ITWA 2QTTA 4V02A 2WF6A 3D3QA 5SYMA 3FSRA 4UASA 4V0MA 5TPZD 3ZHQA 4G9BA 1Z4JA 1G5PA 4RANA 1OUMA 2JFVA 2VCHA 2WVAA 2ZG6A 3DE4X 3UICA 4A2WA 3ABIA 5CDSA 2H1RA 5IFLA 5LFAA 4UAJA 1Z4MA 4LUCA 5JAPA 3LUPA 3Q7RA 4HDSB 5FTKA 5JCOC 4OGLA 4IJ6A 2GBLC 1E1MA 1W4ZA 2F17A 1K8XB 1CJTC 4QGBA 4GX5A 4BZQA 4EX7A 4O2BB 1SHKA 4U6NA 4RLQA 3UVEA 1XV5A 1H2RS 1KZYC 3KZVA 2GRAA 1KARA 2Q0SA 2YMQA 1FU8A 3AF1A 1WP9A 1ZNZA 3FNFA 3ORRA 1Q3KA 4ID9A 1VJ0A 2AEJA 4BFCA 2ODPA 1NV8A 2H0AA 1MC1A 1OLUB 3B6EA 3U9TA 5C4IA 3PC4A 2AFHB 3U31A 5JH7F 5ALRA 3RCBA 3FOWA 2O4CA 5DNDA 1B43A 3TR6A 2JK1A 4Z3KA 4YLGA 1M2VB 5JSZA 1NN5A 3H1TA 2SCUA 1U3WA 3KAKA 4P31A 1ECGA 1NF8A 1RQ7A 2DCUA 2I4IA 4O4JB 2H2HA 1KAEA 1MJHA 1WEHA 4EMSA 4C0BA 4ZO7A 4N6OA 2ZJ5A 2OGUA 5DNUA 4Q7EA 3F7OA 2DH5A 5ENZA 3OM8A 4DMKA 4MKRA 1AQLA 2QJWA 3NHWA 3U39A 2EC5A 3E3NA 4RFLA 4ENQA 4MLPA 4B74A 4L22A 1UANA 2ZAOA 1KNQA 2E6UX 2XNCA 4TL9A 2Y1KA 5T4BA 1UFOA 1OYOA 3COVA 4NJEA 2YRFA 1ZEMA 2UYQA 1VLMA 2OMEA 4S1NA 5GZ1A 3U4HA 4D0NA 2GERA 1TUBA 2D13A 3HMQA 3R41A 1UIRA 2HXYA 2P41A 3D3JA 1L5HB 1Z82A 3IERA 1D1SA 3KCNA 3DTVB 2UZ4A 3G9XA 4H3KB 3PR1A 2IY9A 1WS6A 2CLLB 2Q7OE 1YB4A 3R7WB 1LI4A 4QDKA 3W90A 3GZ4A 5B2ZA 5JJBA 1PN3A 3B9QA 3EGIA 3EYWA 2Y93A 4CM3A 4IAOA 2VYCA 4D99A 4UBMA 3EDRA 1MNAA 2BFCB 5KNDA 1RDFA 1PWEA 2EFJA 2HJWA 2VT6A 3E27A 1WKBA 1KC3A 1Y1PA 2WUVA 2XE7A 1F2TB 3H6KA 3DYIA 4P7GA 4YT5A 3O73A 1TYBE 2H2IA 1I4WA 1A27A 1U2QA 2DPMA 3A4LA 1RTKA 2WKPA 1F14A 4XUDA 8ABPA 3W2EA 1PF7E 5AWFC 4R54A 3H1GA 1KBQA 2XA2A 2AC7A 3RAJA 1GUDA 5JQGB 5IAOA 4M86A 3KLPX 1I2MA 2D59A 3IDSA 1FRFS 4FT2A 1U0EA 1YULA 1U1FA 4EK9A 3F9RA 1D7OA 5I9TA 3Q85A 5ALEA 5CT6A 5CFRA 1TO6A 1A9OA 2XW6A 1WLYA 4RH1A 4YMGA 3CT6A 4MNTA 1N3IA 2RH5A 3B6ZA 3SCZA 4UUBA 4I99A 4CVNA 1GUYA 2L2QA 3BGVA 2XMQA 2CXPA 5FOWA 4WKGA 4S1WA 4PC6A 4R8RA 1NDHA 2FMUA 1M8JA 3ND5A 1KETA 3UT0A 1PBTA 1WL8A 1IY8A 4FHFA 2NVUB 4FBLA 3UGJA 2F3UA 5BN5B 1CEXA 3WWDA 3GRZA 1OU0A 4LVNA 3UMRA 4YR7A 4YRJA 1PJ3A 2DKNA 2CDCA 2LKDA 4BVLA 2O7VA 4E2ZA 2CY0A 3V1UA 5BUQA 3EZYA 2C3OA 1I33A 5CCBA 5AM1A 5H16A 4KR6A 4AU1A 3AT1A 4DLSA 1NMEA 5FYQA 2IY7A 1GZ6A 3N39C 3RFFA 1P60A 3WE7A 5HKOA 1Z0SA 3LQFA 1E2IA 3SU8A 4I55F 3WICA 2PA0A 4FDLA 2JATA 3K0FB 1YS2X 3E23A 3KZXA 4HNTA 3T7IA 3EQ2A 3E1SA 1YRHA 3LPNA 3RFCA 1HSOA 2FEPA 2GGSA 2P6PA 4LV6A 4NMMA 1TZBA 3ZVNA 1ZR4A 2PVSA 3LA6A 1JYEA 4OCZA 1MA3A 4TKZA 5IX8A 2VK8A 121PA 1XXLA 3AERB 3B13B 2XH8A 4N8SA 2P6NA 2JARA 2MINB 1GGEA 1TRHA 1IMOA 3H0CA 4M21A 1PR4A 4M9XA 3IP1A 4B45A 3DOIA 1H23A 1M10A 2QUIA 4G5XA 4HR7A 4XPZA 5IMSA 4A6XA 1D1TA 3LPCA 2ID9A 3KEQA 4M7WA 1M2NA 3IJEB 4F46A 1DOAA 4QUGA 2FN9A 3WYAA 4B8YA 3D02A 3OY7A 3PS9A 3UPDA 3VR3A 3PGMA 4TRJA 3SYTA 3GMDA 2VH5R 1FFWA 3VYSB 3RVPA 3VDNB 4H3HB 3QGMA 2FDRA 3AFOA 2NXJA 4FZ5A 4WZBA 1BFKA 1F2TA 2PRJA 4KIUA 3ZD8A 1B2RA 1ZNYA 2O8NA 2IYYA 1MOSA 3R2JA 3LUGA 1M6YA 4D56A 2IEDA 3WXMA 2EFYA 1R00A 1L7AA 1YHYA 4HVCA 2YFHA 1B1AA 3QPUA 3KXKA 2QW0X 3NBYC 5AOBA 1SU8A 1JTVA 2DYKA 3I5AA 4Q9AA 3MQ4A 2YJ6A 3ZHVA 1BWSA 5IT9A 3UXYA 3NKFA 3SYRA 4OLBA 1WTCA 3MUNA 3AHFA 4TYWA 2X77A 3L8FA 1SK8A 4UBJA 4CEIB 1KJQA 3UJHA 5EJ4A 5KS2A 2H1FA 2UUPA 2FA9A 2YWXA 3FF1A 4IJKA 1L1EA 1Y98A 4BATA 3DAPA 3CRVA 1E3WB 3QBJA 4N82A 3EPHA 2YL2A 4ZEXA 2LRHA 1ZKDA 2XWSA 1DO0A 3Q8WA 1PQYA 3OQMA 4CNBA 2C7QA 3OLCX 2HCFA 2ZAIA 5TMDA 2NZVG 3DGEC 4GE3A 1XJCA 3O2QB 3SM3A 4TLDA 3FKSA 4L5AA 5G3YA 3RJZA 3T1QA 4ARZB 4QVGA 4O3FA 3MMNA 4MI9A 1YZUA 3I1YA 2I1VB 2KS6A 3N70A 5BR1A 4B35A 3RTGA 4NOKA 4QDUA 1KDOA 1G8SA 3OJCA 3ADDA 4RL6A 3SQWA 1UDWA 3R7AA 1AZWA 3K1AB 4QXPA 2F8SA 2C04A 1WZUA 3DE1X 3Q6IA 1Q1AA 3HYTA 3RRFA 5CDHA 2YV5A 1IN7A 4G41A 2YCBA 3FPKA 4HS9A 1E2HA 1JFSA 1HQDA 3L05A 5JUWA 1MKYA 4OM7A 1ZD2P 2P9YA 2ZR8A 4R7ZA 4Y0VA 4YP7A 3RABA 1G1AA 1Z0JA 1ILWA 3IAS1 1CRZA 4TM7A 3RLIA 3DLHA 3DJYA 3PXDA 3OC6A 1POWA 1ZMRA 4MV7A 4N1AA 3WLLA 2EKPA 5DW3A 1HDOA 3CG4A 1GPMA 2PX3A 5ABPA 2G4CA 5DI3A 1TGVA 3KT6A 4BMYA 4HC4A 2C42A 1DFGA 1EDZA 2AHOA 4KHZA 1M1NB 4Z9FA 1XRRA 4AYWA 3C5EA 2BCJQ 2RHCA 3OFKA 5FWDA 2YBEA 3TTUA 2E9SA 5LVAA 3B8EA 2P0YA 3VI3B 2Q2NA 4EHFA 1LXCA 3WLTA 4CIVA 3G9QA 5A03A 4IYRA 3W5BA 2GJ9A 3QBDA 3TGWA 2NO0A 4KB5A 1I4LD 2E1RA 1ZUNA 2JKZA 3CPJB 4URHA 1TLFA 4BO0A 4BTVA 1PIWA 5CX1B 5CT4A 1RCTE 2HA0A 4FWBA 4DLRA 1C4XA 5K2MA 3JYLA 1YCDA 2QN9A 4EFDA 5A4AA 4QYIA 1ZGBA 2B37A 5E1OA 1X42A 3OU7A 1N5MA 2NTYC 4NSNA 4R98A 3K16A 5JCJD 1IH8A 2D2EA 4RY2A 4BNWA 5KTNA 1FP4B 4EUNA 4I4TB 1SN7A 3EMVA 1Z33A 1NQWA 2CK3A 2OAEA 3NTXA 4CGYA 4MVCA 4RPKA 2WUEA 3S40A 1KVSA 2FZLA 4G0MA 4KRFA 4ZT2A 1ZVVA 1RIIA 2WT4A 4GVXA 5EPEA 3VR0A 2G04A 3OOWA 1BD3A 2VHCA 3IJRA 5TIIA 1J7KA 2FMFA 2HJVA 1PG2A 1UJNA 2FSIA 4CQMD 2O52A 3KWMA 4AI6A 4ZGGA 1NBWB 3FWNA 4QTYA 3P27A 4TV8B 4C4TA 3IPLA 1A8PA 2GN2A 3NHBA 1GV1A 1T2DA 5L4SA 4GICA 1WCIB 4MKGA 3LSYA 3NVDA 5F5NA 3ABSB 5ALFA 2HEGA 1WOYA 4F7DA 1YFLA 4OI2A 3U44B 1FTWA 4L9WA 4CWAA 1QCZA 1GSAA 1XGKA 2RHTA 3AUYA 2Q6TA 5DP1A 1FJHA 1XRNA 2DT8A 3HHPA 4XJXA 4YP6A 4B2PA 6REQB 3EE6A 2FP4B 1E7WA 1GGKA 2QTZA 2OM2A 4LV5B 1N2BA 1S02A 3I9V6 4O4JF 5JXGA 5K0BA 3OZ7A 3IYLW 1K1EA 2NSLA 5FBLB 3I34X 4CM8A 3PUHA 3QTBA 4PGFA 2YOGA 2PDAA 2Q2WA 4D82A 1F8UA 4QEZA 2WP8J 3ANXA 3CNBA 4NDNE 3UJDA 1Y48E 2E2WA 2JFYA 3WKEA 1VCIA 1I2BA 3DC7A 2I4NA 1KNXA 3DLPX 4XWAA 1K7YA 1DP4A 2QT0A 5CJJA 2WWVD 1DQNA 1A97A 3D6VA 4HN9A 3WLMA 3WRXC 5IYZA 3UPUA 2FEAA 1CUSA 5CHYA 3EH1A 3M4XA 2HTEA 3DFUA 1FYEA 1Z8HA 3HYRA 4UBLA 5DM2A 1NVEA 3Q9NA 4ETIA 4LF8B 1CR6A 1P5FA 2B0CA 5A06A 3GJ6A 2O2EA 2Y1CA 5DTIA 2ZWOA 1XLWA 1DKNA 1Z2EA 2JGAA 3PUWA 3TLMA 5DNCA 3H83A 2VF5X 1E94E 2AZMA 3NBKA 1RMQA 5TC4A 1V43A 5E9JA 1ZW6A 4NF2A 3AFMA 3F5SA 2V65A 3AR5A 2MSWA 4DLWA 2I2XB 3B3FA 4MVJH 1RRPA 1Z88A 2YXNA 4OPMA 1KK1A 3VSEA 4JXKA 4UBKA 1AHIA 1THTA 4RJLA 2HTFA 3UMCA 3VDXA 3PC7A 5ITSA 1JSCA 4YJKA 2YWFA 2H5EA 1RMTA 1YBAA 2QXUA 3DW1X 1PJRA 2ZBVA 1M1ZA 3QE3A 5I7RA 4HAUA 3Q8XB 3T0IA 1N9GB 1TM1E 3PNOA 4UQOA 5GY7A 1R5NA 5IBCA 3QE4A 4Y1EA 1P1KA 2PZBA 4MWSA 1SBIA 1JQEA 3ESXA 3KDPA 5GZ3A 1WQ4A 2G0AA 4AQ7A 1KYTA 4NBKA 1RYDA 1GNLA 3TIIA 3NNDA 1QGZA 3MGBA 3IAAA 4X45A 3GLHB 4BNKA 4DQDA 3PITA 5C4MA 2FZVA 2WHRA 2XMSA 3GQBB 5CX4A 1XK6A 1RKXA 5JATA 4UU7A 2IXDA 3UB3A 2J3QA 3RANA 2FPPB 1I3MA 3C5CA 3DH0A 4M3NA 5EIOA 2WD7A 5FTMA 3HJFA 2ZB7A 2J4CA 2OOKA 2VN8A 2FMTA 2HN9A 4F60A 4X20B 3GFTA 1A8UA 1UUFA 3C45A 3OECA 3UWSA 4R3UC 3DZBA 1QCDA 1E6LA 4BPBA 4TTJA 2D2FA 1E7QA 1PG0A 2ZSKA 4OHPA 2HNKA 4LYGA 2X4IA 1JE1A 5AO9A 4K81B 4KN8A 4HDCA 5AICA 4HDKB 1MIHA 2IIPA 4ZJZA 4X94A 3T1NA 2G17A 2ETVA 3H9BA 4QNMA 4YH1A 4FB5A 3SN6A 2ZTHA 3NI2A 1O96A 4JCCA 1R27A 1L9KA 4EZIA 4BFSA 2PUVA 2OENG 2XD4A 1ZW1A 1HF3A 2CE7A 3I0ZA 2BM1A 3UJ8A 1JPVA 2XECA 1DT3A 1EDEA 3VYVA 4ZVRA 2VSOA 2X19A 3C5WP 4HB3A 1WOMA 3WA7A 2ZK7A 1Z13A 2ZDQA 2CD7A 1G2OA 3N1UA 1XAIA 3N87A 3BMOA 2X8JB 2PQMA 5JS1A 2BMAA 3WMFA 4FGWA 1A7KA 4WNAA 1CY8A 3PT9A 3O93A 2VQSA 3F6YA 1OAAA 1H4VB 2FPIB 3KR9A 4EPRA 1GG5A 3ECAA 4HTFB 4TUYF 1QH1B 3QU4A 5DN9A 2V7VA 1VSVA 2J4FA 1KPGA 3ABQB 2UUCB 2XDWA 4FDMA 2GVNA 4DYDA 2WTEA 3TDMA 4MWBA 4BQSA 3JQ9C 5JAZA 3E2MA 4GR9A 1FUUA 1UBOS 4K6CA 3UCFA 3X1MA 5KNDH 1XD9A 3I9OA 3M89A 4HXYA 4IVPA 2EARA 3TINA 1T0UA 3AEZA 3JD1A 4IRMA 1VHQA 3EIXA 4OXIA 5IJZA 3F90A 4IDAA 3VR4D 3X2FA 2XWJI 4AAYA 4CM9A 4LG1A 2ZWIA 3EVEA 4ZI7F 4FNMA 4PHGA 5BV0A 1DINA 2WHQA 3KG2A 4I7EA 1ODFA 2FF5A 4YI5A 5ESWA 1VZ2A 4XDYA 4YRKA 4GKKB 2BEVA 4QQNA 2VP3A 3K53A 2GJ4A 3V4PB 3A4IA 2A59A 3OY2A 1YTUA 2H07A 2Q5CA 2NWQA 3BSWA 3H97A 1BXZA 4UZFA 1D7AA 3BWVA 3VZQA 3M83A 2ZYDA 2YUTA 4DLLA 1IN8A 1BMDA 4XDHA 4TXHA 3S55A 1M54A 3P0EA 3RTCA 1PJCA 4DLKA 5JRDS 1C3OB 2GPAA 2BGKA 4P7KA 3W6NA 1TNDA 3LYHA 4ZQIA 3A06A 1MB3A 2QT1A 3LCRA 4D0LB 2FKAA 2X6TA 1CJCA 4MQ6A 4C7VA 3K0AA 4ZVPA 4EA6A 3ZYZA 2G06A 4FFPA 2Q62A 4OA8A 2OFOA 3AMVA 4MKHA 3UB2A 5CU7A 1ZO8A 3SJBA 1DC6A 3L1VA 3TVYA 4GX0A 2VUIB 4K5QA 1GPYA 2FUKA 3CNLA 3TNLA 1KQOA 3OKAA 2WMYA 3DLTA 4RF4A 3EF3A 2WU1A 4FE7A 1UDAA 3I2JA 4JVSB 2ZOSA 3IV7A 5A6VA 3VU3A 3LV8A 1KAHA 2R48A 1G42A 3GNLA 2ZBEA 4XM0A 1B8NA 1C0LA 3T1HB 1FXWA 5GP1A 3K9FC 1YWGO 2GAOA 2I65A 1CNEA 4GR5A 2DVMA 4KP7A 3L6EA 2HM7A 3QWHA 4RPLA 2FTKE 5D85A 4ENRA 2BH2A 3LUDA 1NVAA 3VPAA 3GPCA 4EJFA 5HBRA 4C14A 4UAVA 2FE4A 1NRJB 1RYZA 4QBKA 4MA5A 2VRWA 4XB6B 2Q5QA 1GPLA 3AEYA 4G25A 3WV5A 4BEJA 4C29A 2I9PA 3DZDA 3LRPA 5HIAA 4LY6A 1KS2A 2PZFA 4XTRA 1F2VA 3K8QA 1AKUA 5LKAA 1E1RA 4GPD1 4OIMA 2ZCJA 1UF9A 3TZLA 1U8CB 1DOZA 1G4UR 1YI1A 3LUBA 2A0XA 1XZQA 2IQ5A 3PB3A 3BMCA 5FD8A 3TTWA 2CBGA 4RZXA 3WX0A 1FFGA 4REOA 3VJKA 1RXWA 4WBXC 4ZEOA 3U3KA 3VC7A 4FJ1A 3R0IA 3RJ5A 2I2AA 1LQTA 1KIFA 5H3HA 5IBPA 3TM5A 3OQIB 4YY3B 2P2ZA 3LUCA 5BXYA 1TW2A 3ODGA 4OK3A 4CU5A 1H8HD 3G8CA 1FNBA 1F06A 3NALA 5DTEA 5KWJA 5LMUB 3PIRA 1ICIA 2OFXA 3SE0A 2O3QA 2FXVA 4LZPA 1RMYA 1Z2DA 2ZRFA 4K9SA 3CX7A 4DA4A 1W25A 1NKSA 2AEFA 2XUJA 4PV7A 4DHEA 5K99A 2GTHA 3NOOA 4PTZA 5DHRA 3ICQB 1NPDA 1ZH2A 4UVEA 2R8OA 4QXQA 1OFGA 2G76A 3DMPA 2O7NA 4JLNA 3AJRA 1T24A 5CHEA 5KQPA 1SUIA 1Q6YA 1KKLA 1WSDA 1OVGA 3QOXA 3SYMA 3ELUA 1XTPA 4WCFC 4N3BA 1PR2A 2J45A 2RHOA 4WCFA 1I0IA 4GVLA 3T06B 1MRSA 3GQBA 4BP9A 4NYMR 5FRDA 4DILA 5K5EA 1YQEA 3LYAA 2FEMA 4IHQA 2H4JA 4N01A 3Q2KA 4NNOA 5JS2A 3WRVA 4B31A 4PTLA 2VF7A 4YACA 1VJCA 3UUEA 4M1TA 1Z39A 2HWWA 1AS0A 3AVXA 5HE9A 1KRWA 4HGRA 1N2HA 1IY9A 1ESMA 2VYQA 2NZJA 3I8SA 3UA3A 1NOKA 1SXJD 1YFKA 2NO7A 3QRWA 5IN4A 3FTEA 1CRQA 4K28A 3TPZA 2VYNA 2P3LA 2OBXA 3G6KA 1QZTA 3I04M 3ASYA 3KQLA 3F2VA 4CG1A 4AZVA 5SZJA 1XZBA 1BOOA 4TWZA 2CVHA 4LYDA 4F9TA 1NDQA 2X5OA 3DF9A 1M33A 4KEAA 5C81A 1N7JA 1NI4A 3QVJA 4IQ4A 3SYKA 1T2CA 1V7QA 2R5FA 4HDSA 4WK4B 1OAOA 2C2WA 5DBIA 2A1TS 3GLHA 3HKEA 1U0TA 2Y0PA 3O75A 2LV8A 5HMLA 3UMVA 2ECKA 4TZTA 2O7SA 1I3OA 4X66B 2YRXA 5B1HA 3WGYA 3AQ4A 4EJ6A 2NZXA 1E2KA 3JTEA 1X74A 1AKWA 1OT3A 1U4SA 5G53C 2R11A 3M9XA 1EK6A 1H3EA 4C2AA 2Y1FA 1AKYA 5DV9A 1OBFO 1RXUA 2HMYB 1R0CA 5EEGA 4D25A 4KDFA 2ABWA 1VG1A 3VR5D 4MUIA 1PJLA 1G5HA 5CH8A 3VZDA 4C04A 2O0KA 3IT2A 4I4NA 1H6CA 2CNOA 3K5WA 3LIIA 2CLCX 3S3TA 1AG9A 2PWBA 2NU7A 2EYQA 3O83A 3PJDA 3IVXA 2QVGA 3H87A 4D1YA 1RC0A 1CC1S 4C03A 3VJRA 4L5CA 2ZVJA 4WIAA 3R9IA 1W6RA 2A7QA 2YC2C 4NAVA 5HOEA 3EG9B 1V35A 1VMDA 2PWPA 4HMOA 2CHQA 4DDVA 2NPOA 721PA 3PDUA 4ZOLF 1IK4A 3C3DA 3G1WA 1R0RE 5B7NA 3PIIA 4OGKA 2G72A 2K2QB 3KZKA 4H7KA 5JXWA 4NZOA 4LVUA 4RS3A 3Q7QA 1KZ6A 2DECA 2I6GA 3NRBA 4GGMX 5T3YA 4WHMA 2GHQA 1R6VA 2OZEA 5HQ3B 1X2BA 4KXYA 3HB0A 5CXUA 1X70A 3HJRA 3CRMA 1N5KA 3N6XA 4C22A 4DR5B 1Z8NA 1LWOA 3K0KA 1ZEJA 4DQXA 2XEXA 2GCPA 1ZD4A 2RHJA 3IHTA 5ITZA 3VJMA 3KKZA 2LKCA 4ENTA 4FFVA 5DYYA 1CETA 3R6TA 3VU9A 3P32A 1ZNQO 3AJEA 4FWIB 4O02B 2KWIA 3KP1A 2OEPA 2V5UA 4UUQA 4E2FA 4DW8A 5BYKA 4F8EA 3O9ZA 1I7NA 1IWOA 1M2GA 1RC8A 5LMZA 1LLDA 2WF8A 5ILGA 1KSGA 4NNJA 1EVZA 1ZA2A 5IS2A 3L7NA 1C5KA 2RI6A 3LRXA 4DLZA 5HS4A 1E2EA 5BMVF 1M2WA 4KG7A 2GHTA 4YJFB 4TWRA 5GVRA 4I6JA 2YYSA 3RBAA 1ODLA 2ZIXB 1IE3A 1YO6A 2GNOA 3LIPA 3QENA 2OV2A 4DNFA 4FCVA 4KR0A 1DUVG 5H5JA 4UZEA 2PUFA 2Y68A 3I64A 4OK6A 4UTVA 1RWWA 1RXIA 2AIRA 2XKAA 3JXEA 4PBRA 5IZ4A 4B9EA 2IYWA 2VQEB 1QAQA 4CETA 1WNTA 1ACLA 4DY6A 2H92A 4OXQA 4RETA 1HDCA 4UJ3A 5E4YA 2ZI5A 1BE1A 3ACBA 1UXKA 4I4TA 3WLRA 1JILA 2FHPA 2GO7A 4ZYYA 1ISRA 4QUDA 3D8RA 4RVDA 4WLVA 3O9MA 1R6TA 2VEDA 4JA0A 1QIEA 1QORA 1XZGA 4C2TA 1NVVR 5DASA 3GP8A 4WJLA 1LPPA 2JKYA 5T57A 1ELOA 1E89A 1I32A 1WXEA 2GF0A 1FB5A 3UYLA 3RSLA 3PPWA 4YAOA 2OV6A 2UUAB 1J2RA 5FDFA 1XLUA 4XA8A 4HDNA 2C98A 4BBZA 2I99A 3TLEA 5EVJA 4QLBA 2FN8A 3BG5A 3EVDA 3ROEA 1F8XA 4GXTA 3SGLA 2G3YA 3P0RA 1RAEA 1F5SA 1WETA 1GN9A 1OOEA 3GD5A 5ILOA 1ZGAA 1E0KA 3TUIC 1SQGA 4D6XA 1HYEA 2C20A 4EO7A 3KTOA 3U4GA 5LDHA 1A0OA 1E9RA 1WPXA 2WYWA 2RGAA 2GETA 4H16A 3B70A 1ZONA 1PL6A 1WCYA 2W2XA 4OIFA 4NQZA 4UHCA 2CWWA 2FX2A 3ZW8A 4BFXA 4BS9A 1NUUA 3LE8A 3EUWA 4E2XA 1USIA 5KUTA 1YZTA 4KFRA 1G1MA 1E4EB 3L5OA 2ASVA 5DGIA 5K7SA 3A2LA 3O95A 1M3SA 3LGAA 3U7QB 4TXJA 4QJBA 4HFRA 4C7BA 2GN0A 4OXRA 3KSRA 3P2OA 1KXJA 2C3UA 3RSSA 2G1PA 2B7LA 1WMSA 4KTVE 1M8KA 1L4EA 1PL7A 2WINI 3VPXA 4C6HA 3AKYA 1C81A 4G09A 2ZE5A 3A14A 2B2CA 1U4NA 3A31A 4WLOA 1GRQA 1PKEA 1THGA 1YK1A 2P4HX 1UBSB 2X86A 4JVMA 4U3JA 4AIRA 4DL9A 5IXYA 4Z51A 2CXRA 3M0EA 1N7HA 4G8JA 4GWKA 4Q3NA 1HFWA 4E1VA 3W5CA 2NV6A 4KQCA 3RS8A 1CK4A 1QVWA 1BVRA 1NU8A 4GF5A 3C3XA 2QGFA 1G3RA 1W36D 3DM9B 1G63A 3MM4A 2BY4A 5JHGB 2A0WA 2AE1A 1KEWA 2RC6A 2UVQA 3ND7A 3PUKA 5C8YF 2OPBA 1FRZA 2FFRA 3EWAA 3R5KA 4MW1A 4N12A 3L7AA 5J47A 2QLBA 4LS3A 3T9CA 1D6NA 4LFCB 5BQPA 4F2HA 2I2WA 1XCPA 3N2NA 4H4CA 1JNXX 3LGXA 4MRVA 1EBUA 1K8YB 3KFLA 1SUPA 3PVZA 2TYSB 3A0RB 4UHFA 3EAQA 3GGDA 4PC7A 3HB9A 3EPLA 3QHPA 3HTXA 1SVOA 1V8ZA 2V7WA 2GPNA 2VBFA 3NTRA 1U2RA 5BWCA 4REQB 3VR2D 2BGWA 4OO3A 2OCKA 3G0GA 4US1R 2VP5A 4Q4HB 5DRTA 3SQNA 3HNRA 2ID7A 4F1KA 3HJHA 4G4JA 2VBGA 1REQA 4W1RA 2PGJA 3HA7A 4RMHA 2CYCA 3OWOA 2EDCA 3CEJA 4RVGA 2DBYA 2XAAA 2Y05A 4GM0A 4E1BA 1HE1C 2FUCA 3AHEA 3D7NA 3DQZA 3E84A 4RZIA 5LBUA 3TCNA 3BYZA 1KEPA 1V5FA 3RIYA 3RVSA 2CNWA 2Q3HA 3D2BA 1PJ2A 4RTRA 2QUKA 1YR7A 1Z15A 4B80A 2IYRA 2QRZA 1KGSA 3NAMA 3TGPA 3MWFA 1EZZA 3K8YA 1GADO 2QTFA 3NNSA 4HADA 1ZHFA 2ZTSA 5E9AA 2VJOA 5EIWA 4G1CA 3GR6A 4RZHA 3VR5A 3ST7A 1G3IA 4ND8A 5LXTA 2GN4A 3L6DA 3N2LA 1U11A 2BJVA 3GL9A 4WZBB 4D4KA 3NKLA 4DLTA 3GDOA 4KXWA 3FNIA 4P1ZA 2RG1A 3VUEA 2ODEA 3NW9A 4DMMA 1XD8A 3FLEA 1HG1A 5JAOA 4JXZA 2CVZA 4P3NA 3DC2A 2KQUA 4JELA 5DN6D 3CVYA 3IKJA 5IWAB 1EWKA 2XCLA 1V6CA 3FYUA 4ND1A 4QO8A 2QUJA 1GTMA 4YROA 1UFRA 2BFMA 1G8AA 3NHAA 1VGQA 2QM7A 3IP6A 2B4RO 2IPXA 4UM5A 2ZYIA 3AFHA 4W5JA 3QTTA 5DZSA 3SQLA 2OB2A 1JH8A 1S96A 2IEZA 4MDHA 1XYGA 1KKUA 1QP7A 1AMNA 3KQUA 2F1HA 1ODIA 4PRZA 3G5AA 3GO4A 1BJRE 1F3LA 2X2EA 3KT0A 3L93A 5DWQA 5KYUA 5J3JA 1X1BA 2YMPA 4UXJA 4ZAXA 5JROA 5FTNA 3NFRA 4O4HF 2NXEA 1KY4A 2GR9A 3AILA 4U5QA 2C7OA 2RJ3A 3DNMA 5BWMA 2I3GA 2JGMA 2XHZA 3NT2A 4N5MA 4N39A 4H18A 4WVLA 5JAIA 4UD2A 2XYRA 4WBNB 1SHLA 5BP7A 2EFHB 1SCJA 1LRKA 5DFAA 5KZMB 4BDSA 4CKWB 1ZJWA 1SWWA 3KSUA 2GDZA 2JA1A 3ZG6A 4FNOA 4KITB 2LP4Y 3EXG1 4LIPD 4BMOB 3QPWA 4JP1A 2W37A 1MJGA 3K9HA 4KAAA 4MS3A 4YLEA 1H05A 1ZVKA 4YMUA 1JFFB 2RAVA 2ZATA 2PT5A 2R4TA 3HDGA 4CL3A 3TLGA 4C4ZA 4MS1B 4Q9KA 4XYMA 5AOVA 5FNZA 4H17A 3TNDA 4DCVA 3FNGA 4GG1A 1AGNA 1N5OX 1O6FA 4UVHA 4GPBA 2AEMA 4CM6A 3H65A 3KDAA 1XALA 4G4SP 3FGPA 1Y7TA 4M22A 1WDLA 4KO3S 4CI0B 3TLJA 1QRUA 1R9MA 1K66A 1RYBA 3GPDG 4E5NA 3B82A 3EX7C 4Y6RA 2UYCA 4WERA 5U1PA 4LK3A 1ZK2A 2VPTA 3DWGA 4KYUA 1T36B 3O90A 1H3NA 1NAIA 3G2OA 1Q19A 2YFQA 3HWWA 3SQXA 1AUPA 2BGUA 5C3MA 4R1UA 3V7YA 4MS4B 5BQ5A 4JOSA 4P5DA 4XLZA 2X8WA 4KPUB 2F55A 2PZEA 4YRCA 2IUUA 2VCEA 4TTPA 5DSZA 5GGYA 2Y77A 1TYZA 1U8XX 1L7QA 3DDNA 1Z2PX 1QH1A 3SBDA 2IUTA 1GYRA 1SG0A 4R3WA 3CZAA 2BV3A 3R0QA 4ZCPA 1OTHA 3AEUA 4NEGA 3PUZA 4ZAYA 2OYRA 4AZSA 3AY0A 4EH1A 3T94A 3G0IA 4Z4FA 1QV7A 4RM2A 1MOQA 1T8SA 1JJAA 2B8NA 2H3EA 3SX2A 4WTOA 1PUIA 1MCZA 2YQ4A 4Q12A 4TMVA 5EP3A 2RGXA 3VR6H 5F73A 2Q6OA 1MTZA 1LLQA 2G6BA 1NXQA 1BYUA 3MJDA 3RBXA 1XLTC 5EWJA 1FTSA 4KR2A 5AQ1A 5E4FA 4GWGA 5FADA 1YIOA 4BO9A 2O19A 5J5VA 4FIDA 4RCZA 3MERA 2G0TA 1FMTA 2X0RA 3J81k 3KD3A 2XIQA 2YN0A 1W5SA 4NCXA 2Z0MA 1DCTA 1KWKA 1CE8A 1R15A 3DZHA 4K8RB 1CX9B 3OQOA 4BMCA 4EITA 5HCUA 1HDGO 1Z7GA 3OPYB 3H1EA 5AI0A 4LXXA 4K6OA 2XD9A 1NBIA 3TPCA 3VH3A 1SVIA 3RUDA 3ZDEA 4R1NA 3BRWA 2JLYA 4U7DA 4Z8XA 1GPAA 1F2DA 1WB4A 2P9EA 2D3WA 4M8SA 4LQCA 5EWMA 1V9CA 4YUXA 4RTNA 4J75A 2VJBA 3QV2A 1RLIA 1TADA 1Y4ZA 3K1YA 1YZNA 2GT1A 5AHKA 2VNIA 5A9SB 3I76A 1U2GC 3SZ3A 3W2GA 3L8HA 3OQBA 2ZRPA 3FPGA 4TMYA 2BP7B 2Q5HA 2W6MA 4JT2A 3A7EA 3IV9A 3KV1A 3T4EA 2O06A 4O29A 1YZ3A 3KQHA 2CBXA 2W7TA 4BO4A 4D80A 2ACVA 4JP3A 5FPYA 3DBIA 4X1IA 1BKSB 2ZE7A 3H5VA 4FU0A 1XN4A 3E70C 1HSZA 3U3JA 4E2WA 1T4CA 5KQGA 3NGXA 4DHWA 1W87A 4C7OB 3QW2A 4IZIA 5PGMA 1VJRA 4JT8A 4TS4A 5CXXA 3TIXB 5JEEA 1ZGCA 5DGHA 4UOZA 2P0AA 1MC8A 2IXGA 1ONPA 3DR3A 4K9NA 2VR1A 3B48A 2BPOA 3CCFA 1KZGB 2WG2A 1GR1A 2WSLA 3NNNA 1HDYA 3KLNA 2CCKA 3NFYA 3PQ2A 5BW4A 1RIFA 1UMDA 1U2ZA 3QFCA 5JWRA 3BK7A 1V16A 2O59A 4LF6B 2WFLB 3T7EA 2C95A 4ZQEA 2CNBA 3L8CA 3DEIA 1RP7A 1SURA 2ECOA 2ZBGA 1H6BA 2QRJA 3OIYA 4TWJA 1U4OA 3IKVA 5EP1A 3UK0A 4K0RA 4HQLA 3UTCA 4JUAA 4L7VA 3PGLA 5B57C 5KJEA 1E3QA 3IAXA 4MI6A 4BLTA 4CODB 1GRRA 1RVV1 3NETA 3E0QA 2HIMA 4R7TA 4JYCA 3W4IA 3WNZA 4BNJA 4ZCTA 3AI1A 3LLVA 5J2TA 3INGA 4MKZA 1TAGA 1TFRA 5DCWA 2VJMB 1RHMA 4HY3A 4YAUA 1CR0A 4JLBA 4ZVVA 2O3JA 4MW7A 1AKRA 1YOVA 2Q9CA 2WKRA 4AZ3A 5CEEA 1E1QA 4PW0A 3AU9A 4XXHA 3OSZA 2ZYAA 3L8GA 1ENZA 4LGMA 5IP5A 3U26A 5FPPA 4J7CA 2QMHA 5LP6F 1QTNA 1CJKC 3UGKA 2HYIC 2NPIA 2CXHA 5K0LA 2VIIA 3PF9A 2B9EA 3E3MA 3LT2A 2IU6A 1PT7A 4YJFA 5CNJA 1XDGA 3JQ7B 3DS8A 4K46A 4W8HA 3LWZA 2CBZA 4KIWA 2FXIA 1IMJA 3ZGXA 2VUTA 1E6WA 1WBJB 2HLPA 4OMUA 5IVPA 3RAFC 3VR4H 1D04A 2BKVA 2QRGA 4L0DA 1BXRB 4JI1B 3V4ZA 3I6BA 3LM8A 2W2NA 3R5XA 4IFTA 5F3DA 3MB5A 1Z4NA 3O0DA 4TKMA 2IA5A 5CT9A 4B75A 1LVUA 2WD8A 4F04A 3WHKA 1KSHA 4EUFA 5FHQA 1C9JA 1RSZA 1QIDA 5C8ZA 1CF2O 5C80A 3HU3A 2WZQA 4PWYA 1LX7A 5AW0A 2AE2A 2GBCA 1DKOA 4ZHQB 2I8LA 2Q3JA 3AU8A 1KI4A 2WFLA 2QU7A 3F4BA 3DNPA 2AH5A 2XR1A 2FW7A 3A4YA 4NECA 5AKIA 4FYPA 1VRVA 2VP4A 3ZZUA 1S7GA 3FROA 1ES9A 3AHGA 1CRWG 4HH1A 1SUAA 1TU3A 1RYMA 3DE2X 4GPTA 5I8WA 1EK5A 4RSGA 5BPFA 3ZZ1A 1I4OA 1PRYA 3HKBA 1G8FA 4YMLA 1QGUB 2O6LA 5PNTA 3PTLA 1SBQA 4TLBA 1OFUX 5LD2C 4B6FA 3PJFA 1EGMB 3P0HA 1AUXA 4DJTA 5EZ5A 2HIGA 2A3NA 3K94A 4M8LA 1WMEA 1M1YB 1MAAA 4DCOA 1GTRA 1ZUNB 3EBOA 1FMJA 1EK0A 1L7BA 1TYEB 1EG7A 1OI7A 5CUQA 3SWWA 1UWKA 3H5TA 4BQPA 4XM2A 3OESA 1LBEA 4C0AC 4PXAA 1C1YA 1H1LB 2PANA 2RBEA 4LXIA 4FINA 1EFUA 4WZ6A 4BBAA 3GBVA 1E5TA 3QX8A 4MVJI 4W9NC 3ZKWB 1Z0IA 4D5EA 2GBGA 2YW2A 3HFGA 4E88A 1ZUD1 2A7XA 2PPLA 4J43A 3A1WA 5HKKD 1KBOA 3ETGA 2OFWA 2CMHA 3BGWA 5JVDA 3L0ZA 4X91A 1AHNA 2IW3A 1Z62A 5FOXA 3WGKA 3CZ4A 3WLNA 3MFYA 5EZYB 1QK3A 4B2LA 4F85A 5M2QA 2AYYA 1JJIA 4MYCA 1GNSA 1O7JA 5JPIA 1QH8A 3OIVA 3C4VA 2WILA 4I5DA 4GDMA 4AO7A 5LZ8A 3H5NA 1G8HA 4PHCA 4WESA 2J9RA 2FWAA 2PRKA 3MT0A 4WK6A 5AXCA 4PLYA 3ZTWA 1XEXA 4QX6A 4DG9A 2NZUG 5EJFA 3F97A 3OQJA 2ZIUB 3U1VA 2ZSEA 1N3LA 4DV3B 1TYCA 5DRYA 3KPWA 2YFKA 4WKOA 1G19A 2CVQA 1NUHA 4EHLA 1NNSA 3WC4A 1HQYE 3ISTA 3HWRA 3N75A 3IIIA 5B12A 4DMHA 1LPAB 2AG8A 5K1ZA 5K0JA 1HDZA 2FZ4A 4YMIA 2ODBA 4NMLA 2NTVA 4Y9TA 3KUDA 1Q1NA 2PMFA 4DM3A 4JSRA 4XQCA 2ZRLA 3O8DA 3IESA 4P4TA 4UVGA 3X1ZA 3ZDYB 3HH8A 2F3TA 3N0WA 3F2IA 4LEIA 4O59O 3FH0A 2O8FA 1STOA 1PFKA 2WJAA 3PE4A 4EKYA 2YYAA 4I1RA 3AEUB 1PR0A 1VIDA 2BMFA 2DE0X 2GASA 4NBLA 4EJ0A 5LBIA 4F4IA 4HPXB 3C3BA 1YZVA 4MPPA 4QJIA 1DIAA 1F8FA 3T99A 4B5LA 3UGQA 4NX2A 1V7PC 3GHHA 2BJHA 4I66A 5EJ8A 2QA5A 4H6XA 3HABA 3V4VB 2ZSUA 5JSHA 1H65A 5GADl 4DJJA 2Z09A 2WJPA 3L6OO 1CUFA 1T26A 2HZBA 4LNUA 4NZ9A 4Y1GA 4KMRA 3AV0B 3SDSA 3ZK8A 2VYVA 4LX0A 3RC9A 5AFSA 1CUUA 5A3JA 3T3EA 1CIPA 3W7AA 1WE2A 3IQEA 2OVBA 1L8AA 4U00A 1Z2CA 4L9AA 1OWLA 4HI0E 4B71A 1EXNA 1P7ZA 2ZWMA 2P9JA 3OSUA 5EKSA 4BNFA 3H19A 3UK1A 2O8FB 1PVDA 3K6RA 1W7AA 2CDRA 4M1YA 5ALHA 1Y1TA 2J9FB 4MYRA 4BKMA 1D9XA 2ZXUA 1C41A 1OWPA 2WAAA 4QODA 4R1SA 2H9AA 4W7SA 3LP8A 1MOZA 2VDVE 3IQXA 4ZARA 5JXIA 3K70B 1OXKB 1SQ5A 4JT9A 1B3BA 4MYSA 3SNKA 3C74A 4J2OA 4CMAA 1MT3A 2G4VA 2XBUA 4RVHA 2GPYA 4ZKDA 3R7SA 5HQTA 4KLRA 5ULLA 1Z36A 2NTNA 4MKIA 1N2CA 1P1BA 3IQDB 4LI3X 4KVGA 4D4JA 2WY2D 3WKAA 1QU3A 1N2OA 2IBMA 5EWJB 4JQZA 2HLHA 4JHLA 5C37A 4PX3A 5DHQA 4JBYA 3L0IB 5CW1A 3FSGA 3RRXA 3TOVA 2WD7B 4NPCA 4OV6B 4LF4B 2VWQA 1ND6A 4MAAA 2HJHA 2Y6UA 4Y0AA 1NVXQ 4FYIA 4TV9B 1W2WB 1W93A 5FUWA 1LY1A 2J5BA 3R7LA 3ZXYA 3HXQA 3OZDA 4EHHA 2IHNA 1TF5A 3ORQA 3QX3A 3TZQA 5K6TA 3CV3A 3STXA 1NPTO 3MWGA 4E2YA 1GQYA 2NSHA 1KI6A 5JJ5A 2BTEA 3PGKA 4UAGA 1D4AA 2QRQA 4E51A 2B5WA 2O54A 4RTSA 1ZBDA 1H8HA 2YS7A 4FZJA 1XMPA 5F7JA 3NG1A 5FUYA 1ULAA 1ZOPA 2GKGA 2NSYA 3VKWA 1PSDA 4OP2A 1PZEA 2FR0A 4IDFA 5THKA 2AJCA 2IWHA 3W79A 3TR0A 4QUKA 4DC0A 4ND7A 1J8MF 1FXWF 4ZGBA 3W1WA 5JD5A 3QITA 4LDJA 3RHZA 5HUHA 1LH0A 2R6DA 5KJ6A 4KH0A 5DK6A 4IVRA 3UT6A 3NGMA 1VE6A 3B52X 4H1TA 1BN7A 3PENA 1ZK4A 2HDNB 3CISA 9LDBA 4CN8A 5D5HA 2X3YA 1E0SA 4IQFA 3L4KA 1U8FO 1II8B 5LC1A 3IMFA 3HM9A 4O2AB 5DBGA 3U3XA 1Z63A 1VA4A 1V8DA 1RM3A 1FNMA 3LXUX 1V95A 2IBTA 1BFUA 3RBZA 1AXEA 1R6DA 2EBUA 8AT1A 3TQCA 4YX9A 3UJAA 1VB5A 4OB7A 5AM5A 1PT9A 4ZXPA 4TTRA 4ALJA 2IZ0A 2HSJA 3DCIA 3QLEA 3R4VA 1K5HA 1VHJA 2GA9A 4TT8A 2IL1A 5CVCA 4YPOA 4R1TA 5CB0A 2KSQA 1FFBA 3KOWA 4PCUA 1P7YA 2G67A 2R5WA 4OHRA 1GTJ1 2NV0A 4KV7A 2QUBA 1LF5A 2VI5A 1EYZA 3BFKA 4GZ3A 2ERXA 3VC1A 1Q95A 1NRXA 2R751 5NULA 2IDZA 3IMGA 5KI6A 2FPWA 3IPCA 2DHRA 2J3MA 1US8A 3KTFA 4XUCA 5LP6A 4QUHA 3DMTC 2OV8A 5JFOA 1XKLA 1JKXA 1BXGA 3UAZA 3Q40A 1VGRA 1N2JA 3FBWA 1U3VA 3QA3E 5ICSA 1L5HA 5F3RA 3OPMA 5DXAA 4AP9A 2C29D 3REQA 3SZOA 2OXCA 2AUMA 3IQFA 2PZLA 3VR2A 1Y0BA 3UFBA 1TE2A 5AI5A 4RD6A 2YZ2A 3T7AA 1E3JA 2AVNA 2QMOA 4RQAA 4KDCA 3ZWKA 2BEUB 4GDFA 5TS3A 1U8TA 2HIAA 4LRTB 5EHZA 2FP4A 4ZEVA 4OB8A 3PGJA 3VV3A 2EFEB 2PKRA 1GT6A 1FUYB 3AINA 3JSXA 3LVBA 4MK4A 3PI7A 2R6FA 1JQBA 4IVNA 5JTUA 1GTVA 3LZ6A 3BZWA 1P1IA 4DA9A 1IEVA 3F3SA 1L5MA 3T6KA 2GSWA 3FPAA 1GU7A 1YAHA 3SJZA 3PV0A 1SQSA 5DPMA 1LDEA 1WUTA 3AL0C 4M0CA 2MTBA 4DDMA 3KKKA 3LWNA 5CVDA 3PDIB 3MGAA 1RRVA 1DTWB 2HK9A 2Z2IA 3M4ZA 1EGVB 4LHZA 1JAIA 2IH4A 4YHBA 2OD2A 4JX8A 1ZA1A 3DKKA 5B1IA 1WPQA 1HNWB 2MHCA 2BL4A 1R4ZA 2OK8A 3EGVA 3HACA 1SUSA 4TUYB 4B7UA 2W83A 1N1GA 3VOTA 3KSAC 5TF4A 2IYZA 3IDFA 4YAGA 4IILA 1JN0A 2H8KA 4YBRA 4D6PA 3T5AA 4QU9A 3D6TB 2M6RA 3HV0A 5IRCD 3FOEC 1XRSB 3NKVA 2JVKA 3JD0A 2YS6A 3NIGB 1KOLA 3HO6A 1X80A 3CUKA 3G2JA 1MJNA 2AG5A 3VYWA 2AKYA 4F4FA 1OBCA 1S2LA 5F23A 2FG5A 1ZM3A 2O5RA 3TEFA 3AVUA 3I4FA 1GDDA 4NYIR 4L08A 1QV6A 3TXAA 4BKQA 3VSCA 1T0JB 2BKAA 4DIDA 4YUWA 2DBRA 4RMJA 1KE2A 1PJBA 2HMWA 3WK4A 2NOAA 4MIEA 3HYSA 5AI4A 1LZLA 5DYNA 1Z6QA 1G4HA 1RKUA 4UMVA 1U2EA 5D1NA 4RVUA 4C0XA 3WWZA 4D8YA 2WSSA 4IJQA 2O0MA 3ITDA 3AR3A 4W6ZA 3AVYA 2I80A 1BN6A 3JYOA 4Y1RB 1EP9A 4BQIA 4LXQA 2QTNA 3ESBA 3CE9A 1TUIA 5E7MA 3MJFA 2R65A 3MYRA 1HNZB 2EFCB 3U09A 4KFSA 4C2UA 3P9PA 2JGRA 3FNQA 4NG4A 2CNLA 4BLRA 2W6OA 5KWSA 2SKEA 4NPAA 2QPLA 2JJ1D 4ZYVA 1SO8A 2N0SA 2BEJA 2VT2A 3EAFA 1N92A 1C3JA 4GSYA 4ONEA 4C4PA 3PFKA 1ZOSA 3C2QA 4HQRA 2NUAB 2B2NA 1EHYA 1BVYF 4HZGA 2MR6A 4TMFA 1ZCZA 1U99A 1ZIOA 1QJCA 5L4LA 4KGXA 4UHBA 2X5KO 1JMKC 3RROA 1JR3E 2FZGA 4S0ZA 5B7PA 3RRZA 2OVFA 2JS7A 1IC6A 3AWIA 3HU2A 3NBQA 4BMSA 3DOEA 2GF2A 3N7TA 3L40A 4F3RA 4MP6A 5CBPB 5FA8A 2PL5A 1WD7A 1Z25A 1UBEA 3GRCA 2OA0A 4F3TA 1HR0B 3DULA 2FQQA 2XF2A 1Y3FE 2OZKA 3RLFA 4V3BA 1SVWA 1A8QA 3BHIA 3O2SB 3NUQA 3V4LA 2ZITA 3LBYA 1NSFA 1YONA 3V4FA 4ZV4A 1F6DA 3NXKA 3UANA 2VXYA 2NXWA 4IDGA 2MR5A 3LLCA 3EG5A 1RHKA 2C4TA 2PXXA 4FNGA 3TZKA 1PNTA 1P4GA 2A57A 3M5CA 3ZGYA 2QAIA 1QHEA 4KN9S 2HEIA 3RWMB 3TD2A 4BMPB 5BV7A 2R6AA 1O9GA 2NAFA 4DUGD 2J7KA 1GNVA 2JANA 5ERXA 3H7AA 3HZHA 3EG9A 1EP3B 4IFIA 2OSBA 4K40A 4OQQA 3SZLA 2DBQA 5J1SB 1FSZA 2AF4C 1I7PA 1ZIYA 4GPEA 2REQB 5AMXA 3EYAA 2CKMA 3IODA 3WQRA 5CX1A 3O7MA 1MVLA 5D5QA 2DLCX 1NTOA 3ORYA 1OCEA 1K5PA 1YU6A 4HAIA 5J4VA 1FLDA 4LVOA 5FR2A 1TL7C 5K0FA 2F43B 2C77A 5KNCH 1XNHA 3ED1A 1TIKA 3NIWA 3A1CA 4NXNB 2GJKA 1E2GA 1GNRA 3BBPA 3UAOA 4CT4B 1JV2B 1OFUA 1C4KA 1R18A 1BH2A 1JQAA 4ZJPA 3U5ZB 4LFBB 2I76A 4ZO9A 5ALUA 2YN2A 1ZNXA 2I2FA 3FZGA 3GGPA 2ZPTX 3MBKA 3QEMB 5JSKA 2YUIA 4LHYA 5AQEA 1V7ZA 4GI3A 4RGQA 1RC1A 3T9FA 1E9CA 3G79A 3F7MA 3HWSA 4FQ8A 2ZUTA 3S2SA 4YRFA 5EZ6B 3PWKA 4H1UA 3KPVA 3T3HA 1YTLA 4UBNA 3A2KA 4HGOA 1QGOA 1WMBA 4LJ7A 3Q72A 1M76A 1MPTA 2PBZA 3N0VA 2ZSFA 3T0FA 3TRIA 4EY3A 5CB4A 5IKXA 5CM9C 5BN3B 5FNVA 1OSNA 4WWHA 3Q8LA 4BJ1A 3RSCA 4BYMA 1RRMA 3F8SA 2VHZA 1LPMA 2ONJA 5GVSA 4RVSA 3RWOA 5DLQC 1RHQA 2J9YB 2OHOA 3QQ5A 2G0NA 4K6HA 3LZCA 3BCSA 2ENUA 1EFPA 3JQQA 4MUKA 2ERYA 2AJLI 1EWRA 4OL0A 5LUBA 2XQJA 3RARA 5CA1A 1TUGA 2C5GA 5U4QA 2C2ZA 3BB4A 2JGNA 2BFWA 3KFVA 4DRZA 2GM9A 3UC9A 3GLFB 4G5OA 1QLHA 2F1KA 4NKRA 2DTXA 1HTTA 3BBLA 3ILHA 3NONA 4RPGA 4AJNA 1Q0LA 2HRRA 1A96A 4LV8B 4K88A 2NNLD 1W36B 4DKXA 3DPUA 3THWB 1MW8X 4ARAA 3TLAA 2AJBA 5JCJA 1V5IA 5KQMA 2PJDA 1UWLA 2EWWA 4RULA 1LNSA 3WHLA 4MARA 2OFFA 3ZY6A 3AUXA 3RIHA 1RJ9B 2FWBA 3D4PA 3P0JA 2P8SA 2JNWA 1J24A 3F5FA 5DCLA 1ZL2A 3DG9A 3SQDA 3EVTA 1ITZA 3ESYA 5K2OA 3V8MA 3TAUA 2XKJE 2OCIA 3E3AA 3OD5A 1NW9B 2HA2A 1NVBA 2CLKB 3HXKA 4QYSA 4MLDA 4MIKA 1N6HA 4AUNA 2P62A 1GGNA 2TRSB 1RRKA 3DA8A 5E3IA 5JJLA 3GELA 1T0PA 1IB0A 3C3CA 4FOLA 1HYQA 2GILA 1VMEA 1D2AA 4PZDA 2A1UB 3ZE6A 4EY7A 1HDIA 1USUA 1XMIA 3IR6A 2GO1A 4ZICA 2AOVA 1U1GA 4LSMA 3W5SA 1E92A 4C1BA 1CF9A 1JUDA 4OI1A 1ZI8A 3Q7IA 1U2PA 2B34A 1WW8A 2PD4A 3A4VA 1ULTA 1UCFA 1ZM9A 3DAGA 3EZ6A 1DC8A 2N1MA 4XIJA 4XTCS 2DF8A 1JBEA 1T3GA 3JX9A 4BASA 3HRIA 3JQ8A 5FFNA 3DGFC 2PMBA 3RS9A 5KREA 1DBWA 4FCWA 1Z0KA 2J0VA 4RXUA 1KJJA 4YQZA 2VJDA 2Y4OA 4JUDX 5G1PA 1RFLA 4MZXA 4Z86A 3USES 3MNFA 5M3BA 4YCJA 3UHFA 1MRNA 4KXVA 1DVRA 1VIAA 2OO5A 2ONCA 3R20A 4JUCA 3ZDQA 2L0XA 2WWXA 1BU5A 3CVWA 9MHTA 2MYPA 1I6KA 3RK1A 5BRNA 2JZNA 3VNRA 5HK8A 4HEQA 4PXYA 4BC1A 1YIAA 1PFWA 2F64A 2Y92A 3DMHA 4EPYA 1E9SA 1RCUA 4GYJA 4MPTA 2TMYA 3SEAA 2IZ6A 5LA6B 4EA7A 2XUAA 3EXEB 1Y6RA 2P5UA 3BIWA 4N0EA 4C3VA 3RRMA 2PXCA 1ZWLA 2D3TA 2GRUA 3PCTA 2CYBA 4U8HA 2FZ5A 1CUHA 1MHTA 4G0UA 2LCFA 3TJMA 2JD1A 4U7FA 3Q7TA 3A05A 4IX9A 3L7YA 4WKNA 4WDRA 2ZULA 2V7XA 1IEQA 4BNHA 4AJOA 5F1YA 1PZHA 4RC9A 1FX0B 1T8PA 1X2EA 1TX4B 4IIJF 4L0QA 1H42A 1MQAA 4IYJA 3QVSA 4WESB 4R51A 5TS2A 1GU0A 2QLJA 4DDWA 2XRYA 1QWSA 2Z8YM 1NHWA 3IUJA 4OMCA 2V59A 4IZ6A 2Z1DA 3QEJA 1DJQA 4BU1A 3IELA 5AKKA 4LDNA 3W78A 5BOSB 1X9HA 4C4RA 4CUJA 2GFIA 7AT1A 3AEQA 2XYHA 2J9ZB 2AW5A 3DB1A 4FLFA 1EFVB 3SF0A 4OYHA 2GPTA 1XF1A 4LYHA 3LO8A 3RAPR 3CRQA 1JKJA 1UFVA 2OKGA 3K71B 5GMOA 3CLTD 3HUDA 2GFHA 3OZUA 4RESA 3LT1A 3B2EA 4QOHA 4TKLA 3K0CA 3OBIA 5CGZA 3VZBA 4IXWA 1QHNA 3REFA 3TFQA 4EWLA 4W5OA 4ZMSA 1UP7A 4X44A 3LUHA 1LK5A 2VUUA 4MR9A 1WDKA 5K3BA 1V47A 3O6VA 5FBWB 4LX8A 2XB8A 3HUTA 4ZHSA 4FYKA 2FN3A 4R3NA 1IEWA 1T35A 1FIUA 1PGQA 1FRNA 3LX6A 4HUQA 4EQZA 5HZHA 3OJ0A 4UEKA 4D44A 4RZUA 4WNYA 1GL6A 1KJ8A 2IYXA 4JWKA 5J4HA 1RI2A 1VDMA 2VZLA 4GOMD 1BSVA 4U8GA 1OXUA 4BYGA 2ZVDA 4DIFA 4ZYUA 1Y8ZA 1SKMA 4I08A 2PSHA 4YREA 1IHYA 2YXEA 1G8YA 4AUMA 2QW8A 1KVTA 4HB4A 3EMBA 2BBSA 3VBCA 3W4JA 4C20A 4ZO6A 2LD4A 3F96A 4ARIA 2CHGA 5D3KA 3EASA 2WJJA 5K3DA 2AYZA 4KI0A 5SZIA 4GM4A 1U1CA 3WFJA 1USGA 3QPVA 4R0NA 4XFKA 4BX9A 5AVWA 2B4AA 3BTSA 1UAAA 5EUCA 1IJKA 3ZY4A 1QG2A 2QU8A 1CY0A 1EFCA 1Y5IA 4K9OA 1O5OA 4I8IA 1BAPA 4AZ3B 5EXXA 5DT9A 1XA3A 2A78A 4Q01A 2PUDA 3NEPX 1NASA 3P19A 1E4VA 2PTHA 3RVOA 4EECA 3MGKA 3GEGA 2FCRA 2HC9A 3LLSA 3E9CA 3EPKA 2MYNA 1SXJB 4II7A 4ECAA 1EGHA 5HG0A 4YYZA 4X9XA 4RF5A 2X1HA 1UXOA 2PGAA 3Q10A 1M0SA 2DLDA 1UR5A 3PXUA 4IJUA 1SZCA 1O4VA 3VSDA 5JY1A 1H6DA 1PLJA 4B33A 3BZUA 3KVRA 3QV1A 2JGDA 4FGLA 5CRIA 2SKDA 5E0OA 1EXDA 2XAUA 2NO9A 1JKFA 3L9XA 1GCUA 3MINB 1DFHA 3QLUA 1N57A 2PEYA 2WT8A 4II2A 4EBFA 3U1BA 1G8MA 1K97A 4Z4EA 1KEZA 3SXUA 1UIMA 5C35A 3NHSA 1NU6A 2R4UA 1ENOA 1AF4A 4UHEA 1KE1A 4PQYA 3PXGA 3OAAA 4RK4A 1WSBA 1LRJA 3WWOA 4HKTA 3LBIA 1D5CA 2VBCA 1SCIA 2DPLA 3IIKA 1USWA 1Q11A 4QELA 1W4CA 2QLMA 3FBGA 3R3SA 4EVIA 3T38A 16PKA 5SY9A 5BWLA 5BYAA 3R75A 1MHPA 3I2GA 4PONA 4JOBA 3C0KA 3KU1A 3TNJA 3QUQA 3OIWA 1ISJA 4CTOA 5I5GA 1J2UA 2JLCA 4JJIA 3SR4A 1Z75A 4DM4A 2BEWB 2B1IA 4DNOA 4G2TA 1U81A 3I3SR 3NM5A 1NNEA 4P38A 2WHYA 1GXSA 4LWOA 4MVJF 4C07A 4K9KA 5DTJA 3IS3A 3EGOA 1JL3A 2VNJA 1GPUA 3O1IC 2ZUUA 1A9RA 5GJBA 5H8WA 2TMGA 1VJ1A 1J25A 1OF1A 2EBHX 2PUWA 1A4XA 2O0JA 2ZU6A 1YE5A 3HKEB 4ICIA 4HAXA 1NATA 3KPJA 4OLHA 4J49A 4RW0A 5FA6A 1HX7A 4CIWA 2RK4A 3MMZA 2CFRA 1WHTA 3SMQA 2IYNA 2ZTMA 3L6UA 3PRKE 3T5GA 1XU7A 5P8WA 4DZT<