2GHRA

Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
269
Chain Sequence
EENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGNTPLQLDVHLLHMESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFEHEVREQHVKLLQGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFKHDNPNEKPLVRWRSHGNLLFSNWLNYYVYQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine O-succinyltransferase
publication title Crystal structure of homoserine O-succinyltransferase from Bacillus cereus at 2.4 A resolution
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 83
structure length 269
sequence length 281
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04204 HTS Homoserine O-succinyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ghrA01
5JZMA 4UOZA 3PQ4A 3EJ6A 3FIJA 4Y1GA 1P5FA 3KKLA 3BHNA 3CYFA 2AB0A 2H2WA 1VCOA 3D54D 5SY9A 2V4UA 3RHTA 3VU3A 1FYEA 2R1TB 3TTTA 3WFZA 3NONA 3NOOA 1KEEB 1M6VB 1FY2A 5K4AA 1P81A 3UK7A 1QF7A 2VXOA 3P9PA 1OX4B 3TTWA 3P9RA 4P36A 1QWSA 3L4EA 4BTEA 2ZUTA 1PV2A 4WXYB 1N57A 1A9XB 4I46A 2ZUSA 4BFLA 3GRAA 4ENQA 2IUFA 4B40A 1GPWB 2R1TA 3CZAA 3PQ6A 2A9VA 4Y1FA 4ENVA 1GGFA 3NORA 4B2YA 4LRUA 2NV2B 3M3PA 4OGFA 2ABWA 4LGYA 1J42A 4GUDA 5BV2P 2ZUWA 2NV0A 4HCJA 2GK3A 3FSEA 1GGKA 1UCFA 3CNEA 4ZDKA 3UGJA 1T3TA 4N0MA 4ENSA 4UZSA 4GE3A 3TTSA 1QVZA 2R1VB 5LIRA 3NOQA 3PQ7A 4UOQA 4N12A 4XLLA 1SOAA 5JZOA 1JVNA 3P9SA 1O1YA 4JQSA 2ZUVA 1OY1A 2YWCA 3F5DA 4MNTA 1KXJA 4P35A 3F71A 4L78A 4B31A 4GE0A 3UMMA 1QVVA 4L8WB 1OX5A 5E9AA 1VCNA 4ENWA 1P7YA 4RKWA 2D7JA 1GGEA 4I4NA 1P80A 3N7TA 3EFEA 4L7QA 1GG9A 3ZJ4A 4OQ4A 3TTVA 4UNIA 1L9XA 1OX4A 1QDLB 4WINA 4RKYA 1K9VF 4S0ZA 2XF2A 1BXRB 1CS0B 1PDVA 3PQ2A 1VCMA 3SF8B 3TTUA 4AUNA 4P5PA 4P34A 4Y1EA 3SOZA 2OR3A 5SYAA 4ZDJA 1C3OB 1G2IA 4UCFA 2R1UA 1I1QB 4ENTA 1IZZA 2YWBA 1C30B 3B36A 3R74A 1KWKA 1CF9A 3ZJ5A 4QYTA 3TQIA 1IPHA 3MGKA 3L3BA 4I2NA 4R7GA 3SF8A 3EWNA 3OT1B 4ENPA 4MTCA 1OX6A 2VRNA 3UOWA 4AUMA 2RK3A 1I7SB 3ZR4B 1ONSA 4E08A 4D1YA 2ZUUA 2VPIA 4AUEA 1IZYA 1GGJA 3PQ3A 4QYXA 5SY6A 1SY7A 2R1VA 4OGGA 4PXYA 4AULA 3ER6A 4Y1RB 4ADSG 1I7QB 3TTYA 2WJZB 5DFAA 3OT1A 4Y0NA 1GGHA 2ISSD 3PQ8A 4L8YA 1WL8A 3P9QA 1PDWA 2AD5A 3R75A 1U9CA 3NOVA 4ZGGA 1VHQA 3L7NA 5IP5A 3CY6A 3BWEA 4L95C 1R9GA 1KWGA 5SY4A 3NVAA 2RK6A 4Y1RA 3PQ5A 4K2HA 3EN0A 4ZDIA 3TTXA 2YWDA 4OJYA 2FEXA 4L8FA 4B5KA 1GPMA 3B3AA 1CE8B 3EZGA 4ENRA 3CZ9A 2RK4A 3B38A 2W7TA 1OI4A 1Q7RA 4OIFA 4ENUA 3R76A 1S1MA 4BIMA 1Q2UA 4AJ9A 2VKTA 3UJNA 4P2GA 3L18A 3MIIA 4E5VA 4MGHA 1KA9H 1T36B 2YWJA 1T0BA 4OFWA 2LXNA 4B7AA 1QVWA 2VDJA 1P7ZA 2GHRA 1JDBC 1PE0A
chains in the Genus database with same CATH superfamily
3Q3CA 1KJWA 4X8LA 2IIPA 5JAIA 3HKCA 4DXDA 3QA3E 4LXUA 3ED1A 3PDJA 5FOQA 4GKVA 2VNSA 4JGBA 3AP2A 4MCHA 1YRLA 4HSEA 2WAXA 1KBQA 1VRCA 4GKBA 4CHGA 2QN2A 1KY3A 2NN3C 2UZ0A 4CKWA 3AERB 3AF6A 4Z4EA 5FTWA 4C88A 4KI7A 4CKEB 1U8ZA 2OEPA 4R1QA 1MNQA 4IDGA 4WLUA 2JI4A 3L0CA 4DXHA 4BQNA 4WL0A 3HBAA 3IOBA 3EUEA 1MW9X 1YTLA 3LQKA 2QVZX 4M9QA 3CISA 5TE9A 3ZEAA 4EH1A 1QRTA 2ATCA 2Q9UA 3TFWA 3VPBA 4WZAA 1H1LB 3CC8A 4NP6A 1AA6A 1EB8A 2Z2KA 4PLFA 3WMEA 2OUIA 5C37A 5BUCA 2VOJA 1NMYA 1JKXA 2UVQA 3DDZX 3EARA 2WKPA 4F12A 1PGJA 4UOQA 2W4QA 1HMYA 1BEUB 4CUKA 1DV1A 1EFRD 3AEUA 1R7RA 2TYSB 5E4YA 3AUKA 1XZPA 5AI8A 3LCRA 1YR1A 4AT1A 4QLAA 3PGA1 2NNWB 1I2AA 1VOTA 1JXQA 4BN0A 3V97A 1HC7A 3KXLA 1UBMS 3ORFA 4GDMA 2ASVA 4JLDA 2HT1A 5LWQA 2OB1A 4DNOA 3WOVA 2IS6A 3B6KA 3IBTA 3DE2X 3P19A 5L40A 4HVCA 4RM2A 4MYRA 2H7CA 3KR1A 4DGSA 2X9QA 5ALNA 3BERA 3AM5A 4FOTA 4JHLA 4DSOA 3ZDXB 3I01M 4EJMA 3CJQA 5HKOA 3DTNA 2FJPA 2ZYRA 4NF2A 3D3EA 1TFRA 1WW2A 4E51A 2WMNB 1GZVA 1VHDA 1IOWA 5AP9A 3BL8A 2DPMA 3E5MA 4G0NA 4DR4B 3BXXA 4INPA 2YXEA 3OEHD 4A27A 4BXOA 3S2FA 2WFLA 5KYUA 4AUEA 1RXWA 4LGVA 1LNQA 2X5OA 1IM5A 4LWOA 4RL4A 4B81A 3ZGXA 2VA9A 4KACA 4EKNB 5CEFA 1IEVA 4WZAE 5KOJB 2P4UA 2XA2A 3AIOA 2WIKA 1XA3A 5F9MA 5AYVA 1JHZA 1Z83A 4ZYXA 1M7HA 2VJBA 3BMCA 3S2YA 2QD4A 1YZKA 1DV2A 4O1HA 1B8VA 1WRBA 3EZ2A 4XYGA 5AJXA 4IO0A 3ZCRA 4JI5B 4H35A 5CLQA 5KNDH 3SZ3A 4JVLA 3TWOA 1MIOA 1S8NA 2Q5IA 4AG6A 1GYRA 3DQPA 1AKWA 1QDEA 3LP6A 2ZBFA 2ZLBA 4X1IB 5FBLB 2GAIA 3DAOA 1AB5A 2RHBA 2VKTA 2X76A 4QQFA 2OBBA 1I4DD 3NETA 1JB9A 1JJAA 4KPUA 1WOYA 4Z3KA 3SZOA 4S1TA 3RIHA 3HCRA 2ZT5A 4DB2A 2GM4A 2X0EA 2V1XA 1IZ0A 2UZ1B 1L5NA 5DN9A 2GEUA 1WHSB 3R5HA 2X3YA 5B64A 1FFXA 1Z2CA 5SY9A 3EEOA 4JMLA 2X8JB 1YA4A 3C1UA 4BNZA 2OTCA 1GTRA 8MHTA 2FEPA 4AF8A 4DNQA 1ORRA 1U6IA 4ZOCA 3NG1A 5CH5A 4LE0A 3ROKA 2Z0MA 4Z0NA 1EGQA 2P90A 1X42A 5K3SA 1JR2A 4EW2A 2B3DA 3R3JA 3RASA 5BSWA 3M9XA 1DBQA 5JCPA 1IQRA 2GRAA 3GPLA 3QBDA 1M1UA 4I5EA 4IIDA 5DM1A 1JWLA 1THTA 2P1ZA 2F1JA 3JALA 4DREA 4Q1VA 4UKDA 2GRUA 3B6IA 4TZTA 3EZLA 3UFXB 4EQ6A 4P86A 3IUQA 2NZ2A 1E69A 3K4QA 3KTOA 4J07A 1GPUA 4BVEA 4L9RA 4HEHA 1C80A 1CY7A 1NOJA 3WMXA 3UFBA 1E20A 1ZBDA 3B53X 1FFYA 2R3SA 3NATA 3OI7A 3SHTA 3OQBA 3T4EA 2Z30A 3WAJA 4IOMA 1U8XX 4XJVA 5T3UA 1Q12A 3AXSA 3VA7A 4P31A 3JYPA 1UR5A 4KIJA 3AOGA 5CXQA 4HLQB 1QDUA 2JCXA 2C3PA 2XQKA 1H2YA 3K16A 3O83A 4FX2A 1CZLA 4GYWA 4QRDA 1R0LA 2P3LA 4JH0A 5JISA 1VKRA 3CKLA 4ZVQA 3EOZA 1PU2A 2CJWA 5I9IA 1P1CA 4KMOA 4F06A 4FKBA 4FZJA 1MJ5A 1C3EA 3KR9A 2UUCB 1C4KA 4HATA 1QPGA 5HOQA 2A78A 3EXHA 2VWQA 5CFOA 4IV5A 4W5NA 3AV3A 1XRMA 1IXSB 4R9VA 1D1TA 1KS9A 2GZSA 1PJBA 1ACMA 2CJXA 4CMKA 1MT0A 3AU8A 4K03A 4EF6A 4G85A 2GQ0A 5DN6A 3HVUA 3EPHA 1LA2A 5I7SA 4ACBA 1Y4SA 3Q6IA 3O7MA 4O0MA 4Q0MA 1KEUA 1DOAA 1U2DA 4ASUA 3GFVA 3OF2A 4B2IA 1Z2AA 4N3CA 2D13A 3OPMA 5GINE 1LLQA 3UWDA 1DI0A 2HW8A 2DQYA 1JIQA 5DEOA 5A4JA 2W2MA 3DR5A 1I13A 1DEAA 1LDNA 1N9ZA 1UDWA 3BFPA 5DFAA 1RDFA 3MHPA 4N3NA 1B3RA 1ZH2A 1JBKA 2HPHA 3RGWS 3ETHA 4JLUA 3WQRA 3ZQ6A 1CRLA 4DANA 2DU8A 1H2WA 1WDKA 4YAGA 5THKA 3F8SA 2XEXA 4EI2A 2R4QA 3KOMA 2PKQO 2QT1A 2CZGA 1RJDA 2GA8A 2YWDA 5LB4A 3P0FA 4I50F 3HLYA 1FX0A 4D98A 3T54A 2HKIA 3HBLA 2ONKA 4DCGA 2R7LA 3QITA 4E5KA 1SQGA 1MO2A 1GNRA 3IP9A 2VPWA 1FE8A 1IBKB 1ORIA 1JQEA 2AZTA 4KWEA 1L4LA 3LFTA 4R6XA 5BSKA 3VC1A 4N76A 4L9WA 3UB3A 4DSUA 3DCJA 1RRMA 1Z75A 3CVJA 3LECA 4JLBA 1D5WA 3EXEB 1U7UA 5IT9A 4BGVA 2QEQA 3VH3A 1GV0A 3GZ4A 3LF2A 1HFKA 5KOHB 1U6KA 1TVKA 4L7VA 2ZYHA 5JCJD 5TB5A 2RJ3A 4ON9A 2JIBA 3NCTA 4MPDA 5JO9A 2PWZA 1C9NA 3KELA 3IOYA 5A9SA 1FEZA 2JARA 3MINB 3GZTB 4NBKA 4GZ5A 4P84A 4A0QA 2YKGA 3N28A 3E4DA 4AY6A 2ZZNA 3L4EA 5IBPA 1DAIA 2ECOA 4H77A 4F93B 3QXGA 2JEZA 1XJ5A 5KTKA 2Z5GA 3V4OA 2EP5A 1RHJA 1ZRSA 1J2RA 1ZINA 5ALFA 3GGDA 4OCZA 1YA6A 4KPYA 1U3DA 2WFAA 3KJZA 4OQZA 3WGNA 4LGYA 4QUBA 3A3PA 3FFXA 4CCAA 5C3UA 2J8ZA 1PL6A 4TLMB 5BV2P 1QQBA 2HHCA 3AUFA 1XYGA 3RIYA 2G4VA 3AERA 3CT6A 3N5KA 1OIXA 2XVZA 3NDIA 2Z8YM 1KJNA 1PNQA 2QPAA 4YCBA 4ZZ2A 4S05A 1K3FA 1NQTA 1L0BA 2PL5A 2V74B 2W6JD 4BVHA 1E58A 3A6ZA 4Z54A 2XPCA 2JZNA 3MT7A 1TXGA 1U28A 1UJNA 2QMZA 1V8BA 5JRZA 1PR0A 3F6SA 1SEPA 4WWHA 1IY1A 2ZITA 4BNWA 3GVPA 1H1LA 2BBSA 1DFHA 3EEIA 4IQFA 3QVXA 2G08A 1UM8A 1U2GC 1RRPA 1Q0RA 1JFFB 1LS1A 2FFAA 3F47A 3QPVA 4DUGD 2GASA 4ZVPA 3EFEA 3QK7A 1PVOA 1FVHA 1TM3E 3P97A 4Q39A 4DPKA 1GO2A 1KAHA 1XALA 1RTKA 3QMVA 4ZAVA 4QU8A 3G9XA 2B4KA 4MIKA 3FCSB 3R0VA 3MERA 1RQ2A 3VZQA 4BASA 5LL6P 1BG6A 2BWJA 3LWDA 1NR5A 1HYBA 1F51E 4HV4A 2OZKA 2QP9X 3NPAA 1G55A 2OCLA 3R0ZA 3NEYA 1RFLA 4IM7A 3R7BA 3KEMA 3ZE9A 4XR9A 2I91A 2QY9A 2PS0A 3TMYA 5LQNA 4MR9B 3IIMA 4U9IS 4QBKA 2IYRA 3IERA 2FSSA 4WOKA 4X1KB 3RUFA 2ERYA 4ZWNA 1XNQB 4D9MA 1J9EA 2GCOB 2PXXA 1U3TA 3VJKA 1LEHA 2JGIA 2YHIB 4WCVA 3MCVA 2IYFA 5JTUA 1JEJA 4ZKEA 6AT1A 1LSJA 3FMGA 2VWPA 2XA1A 3I5MA 3NWEA 1GEGA 1T4CB 4JYCA 4Y9UA 1REQB 3QTBA 1P5JA 2H29A 3H5OA 1FMFA 1XLUA 1ZK0A 1I4EB 2HADA 3IUMA 3H0EA 2X40A 4RPGA 3WC4A 3ZTTA 5CNJA 4U2FA 5HIKA 2IEZA 1OXVA 1SCAA 3IAFA 4UBKA 2B7CA 3T3GA 2QZZA 4UHEA 1C1XA 4B48A 2VK8A 4AN4A 3OFNA 3K0BA 5DDIP 2QAGB 2AN3A 1QG4A 4ZARA 5KEIA 5KTYA 5CK5A 4HC4A 4N7JA 5U9CA 1SCNE 2FPGA 3THXB 2IGBA 2IXEA 3RJZA 4O4LA 1O6ZA 1II8B 2QYSA 2F9FA 1ZVJA 2JW5A 2QPLA 3GJTA 3M6UA 4MVJE 4LFBB 3EC2A 5ER6A 2I7VA 4MX8A 3NHRA 3Q8LA 2JFFA 4MQ4A 3Q9UA 1ZSYA 1KO5A 4BV8A 3IVGA 2OHFA 2FWBA 1WSAA 2V4UA 2R96A 3TQQA 1VKNA 4IF6A 3CINA 1YB6A 1CHNA 3QE4A 3SI7A 1Q5PA 3S8MA 5K3EA 2I29A 4P93A 2DBYA 4BECA 1HURA 3R3ZA 2JL1A 1XJQA 3F49S 2UZ1A 3OC0A 4BO9A 2RGEA 1PS8A 4I46A 5B7GA 4RVFA 3GJ7A 2HCFA 3IVXA 4ZZ3A 1SBZA 2XWJI 1RKXA 3DM5A 4RVHA 4C7KA 3CLSC 1Z68A 2OD2A 4QSHA 4ZVLA 3N70A 4IHQA 2HSGA 2WMOB 4YVFA 2X9VA 4TXLA 2YNMC 3RYHB 3VYVA 3CW8X 4UDNA 1FP6A 1IBRA 1UDCA 1J8VA 1IWPB 1F8UA 1G6Q1 2QHXA 1JU3A 3LPMA 3BD9A 4UQLA 2OZLB 4GWGA 1PVDA 5DHTA 10MHA 3KEGA 1HX7A 4X8OA 5JD4A 3RUPA 2GN9A 1SPXA 1PG0A 3IP7A 4X24A 1VMEA 1MOPA 3PG5A 2AEEA 3RVPA 5HIJA 2QYTA 2NADA 3H9EO 4IKEA 1XZKA 2COKA 2YWCA 3EZ9A 1PWYE 5LLSA 2F8MA 5ESXA 3L7KA 4GP7A 1FC0A 2ANCA 3ZGVA 1YCFA 3T9BA 4C76A 3HR8A 3OE4A 4Q3AA 2QVGA 5KNDA 3EBOA 4RS4A 3L4KA 5JADA 2AQKA 2WIAA 5COBA 5DI3A 1N4DA 2QE7D 3MZ0A 2YJTD 2NVWA 3C48A 4J0IA 2WV7A 5JAOA 1TKRA 1XNHA 4NBSA 1ZVKA 3QSGA 3ADOA 2VFAA 5LJIA 4ILKA 2B1IA 3AVQA 1NVEA 2V7GA 1IJBA 1RPTA 2O5RA 4PLZA 5JCOA 5HG0A 3ANXA 1ZSNA 3ZJ5A 1LPPA 3TR6A 4ZCTA 5F2NA 2GXUA 2WE7A 3FPFA 3IPRA 3K6SB 2ZI9A 2WTXA 1NDUA 3IURA 4Q93A 3E7XA 1BU5A 2ST1A 3EGEA 4JT8A 5DT2A 4RXMA 3VU9B 5I7OA 3LS2A 2VK1A 3VBEA 4RPCA 3GIWA 3FPBA 2GETA 3I0MA 4LX8A 1JUDA 1NVGA 2ES4A 3WQBA 3U7JA 5CH8A 5HFAA 3H1AA 1K2WA 4IDOA 1ABEA 3MD0A 1I3CA 1JG1A 3NHMA 2J5QA 3SYLA 2UVPB 1ZMXA 1EA5A 1O94C 2FETA 2J0EA 3H1TA 3DVRX 5LM3A 1NUPA 4NBVA 1COWA 2ACWA 1E9BA 3QZUA 5AT1A 1I5RA 3RSGA 2XCIA 1PGQA 2B0JA 3P9ZA 5AICA 3MYYA 1L1RA 3GOQA 3K1AB 4Z9XA 2P2SA 3UJPA 5HR5A 3AUXA 3T95A 1M6WA 2PMKA 1U90A 1ZRNA 3AKEA 1H1TA 2ID4A 3G7SA 4WDRA 3EGVA 2C7PA 3ZIAA 3LQYA 3TS1A 4OIFA 4UMEA 2SKDA 3UJNA 4JNKA 4LTMA 1RBQA 2JLCA 4FE7A 3HXQA 3UMSA 2JLYA 5CA1B 2EFHB 2I6GA 4Z7QB 2ORIA 5IKPA 2O3UA 3C8UA 4ABYA 4UNRA 2ACVA 2VZ0A 3M49A 3HFJA 3TLKA 1J8DA 3FDXA 5GVSA 1GG8A 2ZSAA 3RFFA 3B1ZA 4JX9A 5T3YA 3FFAA 4B7ZA 5ICCA 5D3ZA 3H8JA 1TEVA 5A0FA 1SPBS 4DSZA 4YJGB 3EXEA 4DCCA 3P9PA 3HEMA 4GI5A 5DM70 1O6BA 1C8LA 2ATIA 2I03A 4KR9A 4L57A 3CRNA 1E8NA 1XP8A 3DOOA 1LV7A 1UFVA 1KIFA 1FYWA 3HXMA 1SUFA 1UXJA 4GQAA 1IJFA 3WY9A 2PXCA 3UW3A 1T8TA 3G1UA 4ZQBA 2GBGA 1MNAA 2B21A 2JGLA 4Z5XA 5U4XA 4EG5A 1G17A 2FMFA 5L4LA 5AQEA 1CY2A 3FZNA 1YIAA 2OT3B 1YR9A 5JYBA 5COQA 3U39A 2R1VB 3MT0A 1A4UA 4JUAA 2L69A 4FONA 1P4GA 1I7LA 3CH6A 3BQ9A 3DNPA 2CT8A 1LPNA 3C6BA 2OM2A 3S6JA 1LPOA 4OH1A 4MV8A 5E8JA 2HIHA 5GONF 1YKGA 2C2BA 1HSZA 1SB8A 5KSPA 5CLFA 4NE9A 4HFJA 3NHKA 2D06A 2DFKB 5F5XA 3ZGYA 3Q15C 1CB7A 1V47A 1D2GA 2XZDA 2BCJQ 3GX1A 1AQLA 1PLKA 3FW1A 1XCGB 2I5PO 3OOHA 4TWAA 3WIOA 1M8FA 1SVOA 3PKZA 2XMDA 4I3FA 1JPNA 5C1PA 5HKBA 5DULA 1YS6A 5AIBA 3DL4A 4Z1MA 4P5PA 1QFYA 4EX6A 5EC8A 2YJ5A 5SYAA 3VAAA 1LW6E 4UTVA 4K6CA 3T41A 1MIHA 3UXHA 4CDNA 1IZZA 1TTTA 3I6YA 1UMDB 4RDCA 1KWKA 2H06A 2C5GA 2O8EA 3TLBA 3IIJA 4DMMA 3HNRA 3QE0A 5AQ1A 3DO6A 1NLMA 2VUSA 1OZHA 1Y9ZA 4MTCA 4CR8A 4V39A 3CH7A 3GJ8A 4GI7A 4GO1A 1M1YB 5M04A 4MUEA 4OU5A 1B4DA 1QIKA 1BQEA 5LVAA 1XBTA 2FKAA 5FWNA 1VSUA 1EKXA 3B5EA 4I9FA 3TW6A 2PUGA 1N2XA 2C88A 3VZBA 4PRKA 4IHJB 2FI1A 4MI6A 1E9SA 5CLHA 4MR9A 2GRJA 2GPTA 4HDNB 2D0OB 4CLOA 3UM9A 4X1KA 1HLFA 4QVKA 1J22A 5JH7B 3DVQX 5K2OA 4UM8B 1XQ6A 1RYNA 1J8QA 3DMNA 1R6UA 4BCDA 2Y0EA 1OBFO 2GCOA 5DBFA 3A6PC 4PYRA 3KYIB 3V48A 3KPVA 4BO8A 4BCCA 1GVHA 1N2BA 2C8KA 3EG9B 2JJYA 2WINI 3WKDA 2F8SA 3PTAA 2CYBA 3LJKA 5DHAA 1VKHA 1A76A 1T4CA 3QWAA 1DLIA 3H2ZA 1CE8B 2VSYA 3KJIA 1E2GA 2Q6OA 5EHGA 2XRMA 2FN3A 1AS0A 2RH4A 1P0MA 2W2LA 2O2XA 2HLNA 2AW3A 3EWSA 1I3OA 3ABIA 2QN6A 3LBFA 3DDSA 3MIIA 2XE4A 5EIBD 3QLUA 3P2YA 3K09C 1Y98A 3HVJA 4NK4A 3TOCA 4CQLB 4BN4A 1Q7EA 3JARB 2H65A 4PXAA 4ATNA 3RU9A 3RRFA 2QAGA 1M66A 5F9HA 5J2UB 4B8YA 1RZVA 3FIJA 3PHIA 5I7AA 2HYDA 3U6KA 2AB0A 4PAMA 1BS2A 3NLLA 3GUCA 4ONEA 4QBGB 5HMMA 1TIBA 2JJ1D 3GCZA 3C5HA 3HV2A 4UVHA 1II8A 1DBPA 5D84A 4F3TA 4IDPA 1S5PA 1MJGM 4IWXA 5EXTA 3W2EA 2CXHA 1VIYA 1FFGA 1EHIA 2Q3EA 1E89A 2X1MA 4OB6A 4YJDA 5IAKA 1A72A 1J99A 1C0EA 1KFEB 4NCNA 4A6PA 2PDAA 3PRJA 2FU5C 1KI6B 1FNSA 4Y6LA 1CFZA 2XADA 3ZLJA 4BNGA 1EUCA 3I9V1 3AHHA 3COYA 5ITWA 4I1PA 2ECKA 5F73A 3IIEA 4CKBB 1D5CA 2D2XA 3PJGA 4GRDA 4B3IA 5DVZA 3KPYA 3DGEC 2WZDA 3VVCA 1NJ5A 2CYAA 1NNSA 1D07A 5M29A 4F21A 5I7VA 1FNMA 1DAEA 1GSIA 3QKRA 1HDZA 3NS7A 1B73A 2PUHA 1JVNA 3DJYA 3GEMA 5LP6C 1C9EA 2XNKA 1KI2A 3EHEA 1NGSA 4FPXA 4ND1A 5HF9A 4YT8A 2EAUA 2YMPA 2OZLA 3I0ZA 5JNLA 1VSTA 3FBGA 3NKLA 5AIAA 1FVXA 3RVSA 1QFJA 3MFQA 5JD3A 5FTMA 5CVEA 1EX6A 1C9YA 3BD7A 2R68A 2R4UA 3I2JA 3WMWA 2BHLA 3KOOA 3C8ZA 4R2LA 3BCRA 1MDBA 2PRYA 2OO5A 2XKAA 4LOJA 5K03A 4Q1BA 3TPCA 3KSZO 4LBYA 5H4GA 1CR0A 3ZVNA 3HKDB 2V7UA 1FZTA 2Q3BA 1YQWA 4DLXA 3IT1A 1BDMA 1TCAA 2H8KA 1LRLA 4WN9B 4GLOA 4Y2JA 5AKHA 1G19A 2XX3A 1PL7A 1QIDA 3MUNA 3QYJA 4IIHA 4L6AA 4MGKR 3HJFA 3F4KA 2OLJA 3QFCA 4JI0B 1SK8A 5CHEA 2P4EA 2R00C 3KP1A 2QM3A 3TKLA 5B5SA 2O8DA 1NI4B 2O06A 1TCBA 1JIXA 3H8WA 1EQAA 4HQNA 3GGGA 1N6RA 3QIVA 3K6SA 3HCNA 2X13A 3PCXA 1Y8AA 3NHSA 3PFBA 4MVJM 2WJZB 4HMPA 1UBUS 3NIDB 2Z6QA 2Z6VA 1BGVA 1P18A 2J5XA 1R0KA 1H2RS 2MSCB 3WNQA 3CEPB 1AV7A 3VU9A 4H7EA 2CHQA 4Q6BA 5EWLA 5IRCD 4EKDA 5CYPA 3MUEA 4HDRB 3WI7A 3NVAA 4DLPA 2YASA 4C1BA 1OXBB 3JQ9A 4KDFA 4EUFA 2MSDB 4DCUA 5KCZA 1QZUA 2FKNA 4YRRA 1P5ZB 3GCXA 3HNOA 1OYOA 2DWCA 1HORA 5KJCA 4MVJI 1OJ7A 2XMRA 4JASB 1MO6A 4OUKX 3RWMB 4WJLA 3JQAD 4WKBA 4RIHA 2A3NA 2NTYC 4JDUA 1ULAA 2JCBA 4MVYA 4V3BA 1EFAA 1E1LA 3QVLA 2XWBF 3CUWA 3JX9A 4GC5A 4B3HA 2EJWA 4YCDA 1KVUA 2JFHA 1E5TA 2MHCA 5JOQA 3NNNA 4LI0A 5FR2A 2ZPUA 3KKLA 1SURA 2I2AA 1W73A 2GEFA 3F6BX 2HPAA 3FVVA 3TINA 3LUCA 4IIBA 2ZIAA 4BMPB 4BO0A 1ZSVA 3WTCA 4NMLA 2HLPA 2RGCA 3BHIA 3CHYA 1R74A 4PR0A 3WWZA 5KQSA 1UWKA 1GP2A 2BBTA 2VF8A 4OLFA 4YHBA 1VI2A 5ILQA 1A9XB 3CVVA 1FBTA 3HS3A 4WXPA 1XD8A 2FQWA 2PD6A 1DDIA 2C59A 3Q5GA 5DM0A 1E3EA 5J1TB 4BMCA 5K3CA 4F6RB 5K20A 4P4TA 3O9VA 4HS9A 5AM1A 5CEJA 5BXYA 1TM7E 3PKJA 2ZRQA 3S4YA 4B0OA 4FMBB 5BW5A 3CZMA 4JBNA 3WSVA 2IZOA 1FQJA 4FS8A 3AHDA 2KS6A 5K0SA 1L4GA 2Y8EA 3WQQA 3S27A 4BNVA 3ROZA 2CDBA 1BMTA 5AKIA 1DBIA 2PAFA 1G42A 2VCYA 3DHEA 1UL1X 3VR6H 3CX3A 5DYWA 1N3LA 1TC2A 1O5OA 1MZVA 3P9SA 2OGZA 4UPVA 1Y8RB 5FR1A 1EQUA 2VT7A 4K88A 4I4IA 1SM4A 2FWRA 2XTZA 3HGMA 4RDIA 2P77A 2W2XA 4L6IA 1SU6A 2CCKA 1T5LA 4Q4DA 3RJMA 1H2ZA 3ISTA 1JSZA 1TD1A 1WQ4A 4TVKA 3KZXA 4Z7NB 4JU8A 1AUVA 3QY9A 2J3KA 2ZI6A 3FTPA 1ZC3A 4INZA 4WFQA 4B4OA 3OFVA 4ZYTA 2J0UB 4LYFA 4MULA 5HE9A 2XUPA 2G1UA 3LX6A 2G1AA 4JUBA 2Z8XA 4LBWA 3WHLA 4RENA 5L7YA 3MTGA 3HDHA 2ZWOA 2Y93A 1N0VC 4P58A 3TB6A 1IMJA 2V5AA 3CZ4A 2Z4TA 2NZVG 1VSBA 3ZWMA 2PA0A 4BFWA 2FZ5A 5CXXA 1HZZA 2P35A 3GDHA 5F5LA 4GL2A 2YVLA 1ZNXA 3LT4A 1EU1A 2DYKA 1PEDA 3FYDA 2JFZA 4K26A 5A62A 2Q5QA 2ZRFA 5DJ5A 4KREA 1E3WB 1UMDA 3C6XA 2J0VA 1VL5A 2WAYA 2H4FA 3WZMA 3H84A 3HM9A 1IM8A 2VP3A 4TL9A 1Z8DA 3T7KA 4CMAA 3KZOA 2Q1YA 5EMNA 1PT6A 2P0AA 1XV5A 4INOA 1KGDA 4YBZA 1ZR2A 3B48A 5J3JA 1M1YA 2HLDD 2D6FA 1UDAA 3LBNA 1JRLA 2A67A 1L7XA 4RV4A 4YR9A 1W48A 2J48A 3KJHA 2EFJA 4US1R 3HU3A 4U0KA 3UK6A 4JP1A 3V9AA 1KWGA 4Y9TA 4IHJA 1XPJA 2J3HA 3DA8A 3HSSA 5K0NA 1MXFA 2ZTMA 4HDNA 3IKVA 5D1NA 5HKKA 3U44A 2C3YA 1E9DA 1CS0A 2QI9C 4B2PA 1EWQA 1R4MB 4HWRA 2IY9A 1W93A 2B8WA 2JFNA 3RVOA 3OLQA 3UUFA 4UFPA 1HO3A 1SMKA 3KLMX 2IOHA 1VJ0A 1VC2A 3BS4A 3GJYA 4RHEA 1J2JA 3LBYA 3TLGB 2CFIA 4ID9A 4D42A 2ILVA 4HNUA 3AYZB 5CTJA 4QOJA 3DVSX 3D7KA 4OHFA 3LT5A 4QVIA 7AT1A 1UBRS 1XDZA 4IRMA 4P4NA 4YAIA 5IT0A 3H0KA 3NHAA 3V8BA 2FPPA 1SOMA 5C5DA 1CQIB 3KUCA 4NZZA 4TGLA 4WKPA 2BSQA 1ODKA 3UAGA 1L7RA 2WWFA 4WXHA 2GILA 1TE2A 1MO5A 3EEBA 3T7DA 5BUSA 1GGMA 3ANLA 1M2FA 1MRNA 2XGGA 5DXAA 5HFNA 2P11A 1CIJA 1Z7BA 3QTLA 1TIKA 4ER3A 5IHPA 5IXJA 5JQGB 1TM4E 4MV9A 4DARA 2P1DA 2ZRIA 1MF7A 4DKXA 3GZNB 3WWCA 4MIYA 1OYWA 1QG0A 4L2IB 2QN3A 2W6OA 3ZI4A 1ZAYA 2P2ZA 1T0PA 3RT9A 2XUAA 1UBHS 2GF0A 2W8BB 4OQFA 2GNOA 4WUTA 3UPDA 1M1YE 3NIBA 4DYVA 4RZXA 1LGYA 4IFIA 2CZQA 4HWGA 4WK2B 1UOEA 2EU8A 2LGJA 1A7KA 2JS7A 3AI1A 3FBTA 2QLJA 3CIFA 2ZI3A 4YGXB 5K3AA 2ZWVA 4QUIA 5BOVA 1GITA 1KI6A 4L0MA 1ZGAA 2X2OA 3RHFA 2OBFA 3HYCA 5K51A 2L0XA 3ZY5A 2B9VA 2CY0A 3SHVA 1ILEA 3NGMA 5AHRA 4LHWA 2FZLA 4BNHA 5A0TA 1KBZA 2VF7A 4G84A 4RFLA 1SU7A 4UVGA 1TT7A 4UU1A 3WS7A 3W9UA 3WRVA 1AGYA 3U5TA 1KBOA 5E9AA 2KE5A 4G6ZA 4EY8A 2P2NA 4NE7A 4OQNA 5HE8A 1XAIA 3HGTA 1KI4A 2QUIA 1HUQA 4HL6A 4ZOLB 5CX4A 5IVHA 4DLTA 1G20B 1ZN8A 2J3LA 5DE3A 3EWAA 2C5BA 1XLTC 4UBLA 2GN6A 1BDJA 3IAUA 3HMQA 3EGDA 4PYNA 1ZIXA 2PSDA 2FX5A 2NW6A 3CRQA 1SD1A 4FOLA 2C03A 2ZRDA 2R1UA 1CY4A 3PR1A 1BMFA 2PD4A 3OOJA 3UJAA 3WHKA 4G5YA 1VL2A 4UAUA 3RLIA 3T0GA 1FK8A 3D8SA 4Q9KA 2Y4OA 2WG0A 3S29A 1N5JA 1UDXA 2C7VA 4TTRA 5ADVA 1J8MF 3OZFA 1W25A 3B52X 3FYUA 4W1RA 3CB4A 3IUBA 2VHJA 4CEHB 1TB4A 1FU8A 2O3SA 3ORSA 5JSKA 3BIOA 5A5GA 3FR8A 3TGLA 1C7ZA 4BTLA 1B76A 1GFWA 1R8JA 4WN9A 3RSCA 1U3UA 4KJXA 1O95C 4ADSG 4RE6A 2IWRA 3HJBA 1XZLA 2ZI4A 1NLFA 1N2HA 1N6PA 1TL7C 1CZRA 1X2EA 3FSGA 3LSTA 3F74A 5AW4A 3FKSA 4KXWA 1RYEA 2VRWA 3T5MA 3PD0A 2GK7A 4R5HA 1MO3A 5GMOA 1WP9A 3L8ZA 2WD7B 3K8ZA 1T0JB 4EEKA 3ANNA 3SN6A 4BN5A 3PJDA 3RUEA 1BCSA 1ZMBA 3I9KA 2IHUA 2B6NA 3L41A 1FZQA 2J3MA 1UP4A 3OEED 4JQYA 4M55A 4MRNA 2OCIA 3RARA 2XDAA 2FXIA 1G63A 2Y1OA 3MTJA 3S2GA 5BNFA 1P0QA 3KD2A 5KWVA 1MQAA 2P9HA 4HDRA 2F59A 1LWNA 1YH3A 3OZVA 4EG3A 3TD9A 1G6KA 2A4MA 3IE2A 5BSRA 5SV2A 3RS5A 4FB4A 3QIAA 5EWMB 2D2FA 1QK4A 2V55B 3MJSA 3IDAA 6ABPA 1XYYA 4ZAXA 1W4ZA 2RI1A 4ZAGA 2E55A 1KZ4A 1JQ3A 4O59O 2QD5A 1LF0A 1JDPA 3G8BA 3LUJA 4M99A 2BEWB 4HNAB 4QHTA 3PC8C 4BU0A 2PEZA 1NY6A 4E2WA 5DGTA 2OBYA 3ZDZB 1QLWA 4C0QC 1JAXA 3VUFA 3T1HB 3M81A 1XMQB 3S1AA 2WNSA 2VNKA 2ZSBA 3A9WA 2J5BA 1DINA 1KPGA 5J5CA 4JVOA 5CT8A 3ZHYA 4F5ZA 3T3NA 3WWEA 1N0UA 4PY2A 5KUTA 3RC8A 1G64A 1USKA 2WNHA 4PBRA 1NXPA 4A26A 4ZV4A 1NUTA 5ALPA 3ZH2A 4RQAA 3WJ7A 4OMUA 5C8YF 5FCDA 1AGNA 4WBSA 2XIJA 1SOUA 3O5AA 5TQ0A 1YE5A 2FUEA 2YIMA 2XZPA 2YQ5A 4RNCA 5FEMA 4ARCA 1N8TA 3GWGA 2ZUWA 2NV0A 3U7RA 1EVIA 2NP7A 1UMKA 2V6BA 1SULA 1A9XA 4HQLA 3RRNA 1UCFA 4R1OA 1YZTA 3THOA 3ZWVA 1XMPA 2HPZA 4I1RA 1Z62A 5LOVA 4O2BF 4MICA 2R6JA 3DZIA 5KHOC 4JXXA 1Y3HA 2WF6A 1PWXA 4BQQA 1XDUA 2W9XA 5P21A 2V6FA 4YJ2B 1JNXX 1XA0A 4BV3A 1SZDA 2LPMA 1MLDA 1VCNA 1UP7A 1QIIA 1KQPA 5B57C 3FZQA 4FHGA 1RWMA 2YYSA 4HWPA 5LZ7A 4HTAA 1TT5A 3DTVB 2Q4RA 3W2IA 3HABA 3AVOA 1WXQA 1HWYA 1KIAA 1IAVA 1NW8A 5FYDA 5IASA 4EYSA 1ABBA 4Q7KA 2QRKA 2QUKA 2P8JA 4KJZA 4N0PA 4N8SA 4F71A 4GIBA 5LUAA 4NCAA 4FT2A 4PLYA 1BGWA 2IYNA 1KERA 3GJ3A 4OVKA 1NN0A 2FW6A 3B9RA 1YQXA 1X39A 1ZZGA 4KWTA 2IVFA 2J0UA 4IF4A 4URWR 3DF7A 1TKAA 2Z9DA 4MPRA 2A0KA 5AM2A 1FBNA 1QQAA 3ROPA 1EP9A 2HRQA 2YJ3A 3AUJB 5JDIC 4W5RA 2QVXX 3JPWA 4MCAA 3SX4A 1WOMA 3KVYA 1Y3FE 2QUJA 1GT91 4G5XA 2LRHA 4P4GA 5DBOA 1FJ2A 1QGAA 4R2HA 1EDZA 1PZMA 3QFHA 4TX1A 5AM4A 5SY6A 2AI2A 4EGCB 3WP0A 5GIPE 4ZYYA 4RY2A 1JNYA 4BVGA 3SX0A 3DPSA 2BHRA 1VGRA 2EBHX 3G2IA 1U8YA 4PGMA 1QFXA 2ZJ1A 1P19A 4G5FA 1Y5RA 4OHVA 1VHJA 2I76A 3RYIB 1O03A 3B3FA 3F9IA 3L46A 2VZEA 4KTVE 3U4MA 2EWVA 4AWBA 4C29A 4AJIA 2H4ZA 3NP9A 821PA 3FUVA 4B5KA 2EJVA 3C85A 1GPMA 4X7PA 3Q6MA 3KAPA 3SD7A 1PWEA 3AKDA 4X00A 3R23A 3VR6A 1R6TA 4RZ3A 1WPRA 4GYKA 2I1QA 1T13A 5AKGA 1W87A 3TSOA 4WLNA 1G3IA 5LU8A 4LECA 4V02A 1NMQA 2Y27A 3AYXB 1AK9A 4X0EA 4KR6A 2GCNA 4BZWA 2BFCB 3GEPA 3DOUA 2J33A 3BL5A 2GAJA 3EOAI 3P9CA 5CU7A 4KE6A 4Q3CA 4FW9A 1EUQA 1QRSA 2FUKA 2QDKA 1FLVA 2OAQ1 2H31A 5I5GA 2P9JA 5FLEX 3CKYA 4TT3D 3K8OE 1S96A 1USUA 2WVAA 4C4YA 3COWA 1LXCA 3I09A 1G4AE 2N9UA 2C3UA 2PKYX 3R3YA 1P7CA 4WOBA 4YASA 1TU0A 2YIVX 1R8QA 4A73A 4NYMQ 4GM1A 2EKDA 1Y6QA 3N6RA 3GDFA 3CZCA 1UF9A 2IYQA 1DLJA 2JF0A 4QUJA 1CQIA 3B5IA 1NZFA 3VO8A 5I7HA 1OFTA 1R50A 1T5BA 3KZ1E 5GTDA 2Q1WA 3CG4A 3S8YA 3RRXA 3LO8A 3KL2A 4UXIA 4HFNA 1V5GA 4V2UA 3P94A 5BQ5A 5JQGA 2J59A 5DHQA 2WF7A 1Y8QB 4ZDKA 1P9RA 4CFZA 3GZNA 4X6UA 3ET5A 2Y1GA 4L2IA 3EPPA 4ZT4A 2PUCA 2YV2A 2W8BA 3QE2A 3OOYA 3O47A 3QV2A 3ETGA 5FKJA 2VCEA 1A7AA 1ZGBA 2JIZA 2VSXA 4N5DA 4G36A 4MGIR 7REQB 4YLGA 5ELLA 1IQ0A 1O5TA 1R16A 1UC9A 2V65A 4U63A 2HO5A 4EA6A 3KDAA 3WNBA 3ND5A 4G1VA 2I2DA 3EGXA 5AJVB 5AVKA 4M1EA 3LC1O 1SU8A 2CFCA 4KGDA 3PTZA 3TN7A 2MOKA 4RIEA 4C0AC 1MH1A 2P3OA 2N75A 2IV7A 3WR5A 1VFNA 4PSCA 1GARA 5GJBA 2O05A 4BGEA 4F1KA 4WK6A 1PYOA 3ISJA 4TWZA 1P4SA 4UBMA 5FI0B 3TRDA 1EVJA 2WWHA 3H6GA 5FULA 5IAJA 4MINA 3FDZB 4GM0A 4AKEA 6CHYA 1RQGA 2P9YA 2PFGA 4M98A 2IUEA 1WW8A 3K32A 4WEQA 3R77A 2PKXA 4H0CA 3ZDDA 1OV6A 2Q5FA 2WJPA 2JHCA 1ZWLA 2XVAA 3MAJA 1G18A 1U5AA 3WKEA 3VNUA 3IX7A 4DR6B 2FQQA 4HAXA 2HCBA 2IXFA 3AVPA 2X1HA 3Q88A 4ITUA 4Q66C 5FBWB 1RCTE 4M7RA 4QOSA 3HWWA 3KT6A 3OA0A 5DW0A 1EVYA 3X1YA 4EPVA 3QUAA 5FL7D 5T4EA 1YASA 2G0NA 5CT4A 1O0SA 3TZLA 1L5MA 3RE1A 4CMHA 3HCAA 1H0KA 1T1RA 3QELB 1QHXA 3OM1A 5IM4A 4YK7A 3IB3A 1WQ1R 3PP8A 4HVTA 1Q1GA 1W5SA 3L7NA 1M2OA 3LLUA 4FU0A 4H7KA 3OHSX 1NFQA 1AM4D 1CUYA 2BKAA 3DMFA 3QBEA 4G8DA 3QLJA 1JHQA 3GDGA 1FLDA 4X6XA 4YYZA 1W581 5K6RA 2HWXA 4MXDA 3K2IA 2TMYA 4KBGA 4YJFA 4YMVA 5C52B 3ECSA 4YCAA 1KMHB 1RQPA 4YQEA 3L0OA 3OJCA 1FFEA 2D5CA 1CULC 1ENPA 3I2YX 4X5OA 4C2AA 1DTSA 4KQIA 5HXAA 4GQBA 3F2IA 1NBWB 2P6RA 5L3SB 5JS6A 1P62B 4WLVA 5JNTA 2FF7A 3BJEA 4IEFB 4KXMA 4QATA 3GD5A 1KTIA 1OJLA 4KR7A 3TUZC 4REQA 1CVLA 3TD6A 1Z12A 4I19A 2NU9A 3JU3A 2C54A 4H60A 3FOEC 2IHZA 3STYA 2NUTB 3AY0A 4HQ6A 5AK4A 2R48A 4HKTA 5BQXA 2Z3ZA 2SCUA 2H54A 4R31A 3P5SA 4QNMA 3WFIA 3VPCA 3KBOA 3CLSD 1SELA 3KWFA 4IMIB 1KKLA 1VPVA 4JJFA 4XJTA 5EWMA 3SDBA 2LCQA 3K0FA 3R3HA 2FSPA 1MU0A 4TQUS 2XUDA 3VI3B 2E87A 2X0RA 4KODA 1SHKA 4F3RA 1OZAA 4QFCA 1YZUA 3WIBA 3EDCA 2BEWA 2EDCA 5I51A 4AFNA 2E6KA 3GEBA 2PUEA 4DBLE 5AW1A 4MHSA 1QHFA 3RJ9A 1SWWA 1DRJA 4UULA 1MH9A 4YT5A 3OTOB 2BP7B 2AEMA 3K96A 4P33A 2CZCA 1DC5A 2WYIA 4G0XA 1R6DA 3FUWA 3IO5A 3OWXA 4IGEA 1FP4B 2PX5A 2FPSA 3OETA 2VPXA 1TFUA 3FSEA 3W8EA 4I8DA 3UGJA 3MWDB 3UV6A 1UBCA 4C3ZA 1J5PA 4LKRA 4CLEA 3ZDAA 3OQMA 4ALLA 2JVIA 1HH4A 5LBUA 1XHEA 2IPAB 4B6EA 1YONA 1X13A 3A36A 5C4MA 5EMJA 4AKIA 2CXXA 2C2GA 2YXDA 3COSA 4DA9A 2ONJA 2YIDA 4GX5A 4UHFA 1P6QA 1GGVA 4J3JA 3PWTA 3VAZA 3KTFA 1EE1A 3B5JA 4FDTA 1N92A 5E6UB 1OUMA 1MGOA 1NQXA 1Z22A 3VFDA 4BVBA 2OBNA 4GMDA 4H1TA 4M4SA 4LDNA 4UTZA 1J20A 2PXHA 5C8YA 3UCEA 1I7DA 1U8FO 4KYTA 3DVLA 2K2WA 3HLTA 3I1JA 4B6PA 4R83A 3H4MA 3GPBA 4E7OA 3W2TA 4V0MA 5FFNA 1RBYA 2XB4A 4Q7JB 1IU9A 2I6SA 3VSEA 2GK4A 4CG2A 1T5IA 5C4GB 3DTVA 1VG9B 3JZAA 3NI2A 2F00A 5MGBA 2LIPA 4WNCA 5IF9A 1VL6A 2B3TA 1CDOA 2TS1A 4HS4A 5CP8A 4NTZA 4R7GA 4C22A 3H16A 3HO1A 4LNHA 2YOHA 5ICEA 1S2OA 4D4MA 1V11A 1JEYB 1RJ9A 1TYCA 4Z0HO 1J00A 4Y6SA 1D2NA 3DKVA 4QELA 1O94D 5TV2A 5JYEA 3T9DA 3NDPA 3S7TA 3A3YA 3H42B 4RX1A 4YUXA 2NZYA 1WHTA 2COUA 1JQLB 1QIGA 2DF8A 4GMXA 5H9WA 4J91A 2VJCA 3PGLA 3TVDA 1V45E 3I1IA 2O8CA 2LR0A 2CL6X 2HA2A 3E9MA 3ILYA 4G1EB 1W8DA 3PEVA 1A97A 4CLHA 4OYHA 5JS2A 1LFAA 1JG7A 3DZ8A 4G1CA 4ZVTA 1JR3A 4EJ0A 2RI6A 4RVUA 4QPDA 3DMYA 5E3JA 4BNUA 1VZ3A 3M34A 1AIPA 3LUFA 1YF3A 1YCDA 3NTQA 4MRMA 2HQ1A 4DCJA 3RAEC 4MUAA 4V0ME 1IHUA 4KU4A 4JNCA 5HIMA 2IHKA 2J7PA 4LMBA 2BI8A 2GX6A 4Q1DA 4BHTA 2IHNA 3G8YA 5GV8A 2H1VA 3ETJA 5A0VA 2BFCA 4PX9A 4UVDA 4KLNA 1JWAB 4GOJA 3UG7A 2WVHA 1EHYA 2F67A 4XYLA 5KVQA 1Q92A 4W82A 5TPWA 4IS2A 4RTKA 4GR5A 4LJ5A 4DRXB 1V4NA 2R4TA 1ELOA 1F5SA 1YJAA 2QAJA 4D9CA 2JH8A 1VPWA 4YACA 1ZP6A 4D3DA 1XU4A 2DJIA 5K05A 4IVQA 1OT5A 4NNJA 3ES9A 4LIPD 3B51X 1Z2EA 1OFUA 1FW8A 1YK1A 5EJMA 5IARA 1ZS9A 1U7ZA 1B14A 2VDNB 1LUAA 2QLFA 4WERA 2HDOA 4M2LA 3ERCA 3BTOA 1NPDA 2HJWA 5ETJA 1VL8A 1ZMRA 1U5BA 4DW8A 2PJZA 2VYND 4HWSA 4Q4AB 5EKTA 1QYIA 1E61A 2YWHA 4E22A 1E7QA 3L4SO 4MGZR 1AK2A 3SE0A 1OAOC 3CO0S 1HEYA 5ERGB 3DDOA 3M3HA 3OQIA 7MHTA 4DZRA 3FPCA 1OU0A 4G56A 2OCKA 2GS9A 4O2RA 4OYRA 4DVJA 1LI7A 4CNBA 4LQ4A 4JLPA 3W3AH 3G5AA 1BC5A 5JNUA 3PNSA 3KSRA 2C97A 2JH9A 4H7HA 1HE1C 2R86A 3PC3A 4AI6A 1ZPDA 4BBJA 3W4KA 2BM0A 1L4KA 2PMEA 3A1VA 4HPWA 1P4HA 2J41A 5CVCA 3V1YA 3OQHA 3TXYA 5FFFA 1VJGA 2DWPA 3ZOKA 3CTMA 1SVKA 2JG3A 3UOWA 1Z35A 2PHZA 3H9BA 3BZUA 2QA5A 3PS9A 4KO3S 3PSAA 2HH9A 1XZGA 4N82A 1RKBA 1KK0A 1NOKA 4OOFA 2Q6TA 5HIIA 3EZ6A 1TVCA 3AZPA 3GN1A 3OCJA 4P98A 3FDZA 3S5JA 4LTDA 4MS1A 2NMVA 2JGDB 2Z95A 3NXSA 2XHEA 5LXTB 5CK4A 3F6RA 4KO1S 4PTYA 2JDID 3BX1A 3FNHA 4EP1A 2CJYA 2VDWB 2ZYDA 3H97A 3G1WA 5DSXA 3JYNA 3J7AC 3FMOB 4EYGA 1A5BB 3CJTA 3PF9A 2O48X 3Q12A 4IG9A 2AZXA 3P0RA 4TWRA 1GG5A 2CD7A 1P31A 3K2QA 5DLEA 4FHCA 3JYOA 3MSXA 5HMLA 4V0OA 1NXXA 2ZYAA 3HKBB 3PRYA 3ZY3A 3KT8A 4Q4CA 2QRHA 1WZCA 4QUDA 2DY1A 2ZRHA 4V3CA 1WSDA 2C57A 2GUGA 4H3SA 1JBEA 5EJ9A 3IVRA 1EX9A 4XB2A 2WSSD 1PO7A 2I4OA 4KDCA 5F3DA 1GFIA 3X3HA 1MPXA 1RLOA 1Y63A 4LZNA 3BE6A 1P39A 1WBBA 4F3YA 2BY4A 3CXUA 3ER9A 4PZEA 1WCIB 3COPA 2BLNA 1XSEA 5JBNA 4WBNF 2G80A 1IYZA 3GT7A 4X60A 4C07A 3HJNA 2IYZA 3P71T 4U7FA 5L3SA 2X0DA 1DIAA 1P81A 4QRHA 3HEBA 3PA6A 3RS3A 4CT4B 1ZXXA 3LYAA 2ISCA 1I1HA 2CK3D 3DMRA 5F64A 5CB0A 2V7VA 4XDHA 2NUTA 4NPAA 4QWWA 4JYAB 3UBMA 4BP1A 4MEJA 5IPFA 3BT7A 4NE2A 1PTJC 1K3TA 3A25A 3N58A 2RGBA 3GXOA 4EHFA 2B2NA 4HEA1 3QEBZ 3UMYA 1DIOB 3C8MA 3GVHA 2Q3HA 3PD1A 4AXXA 4AKTA 4EPXA 4ABTA 2IY8A 2O4CA 3BF7A 2ZJOA 2VBCA 3FE2A 1CZKA 4GYJA 1QKKA 1FJXA 5DYNA 4F97A 4O2AF 3TDMA 2FWAA 2Y92A 4AP6A 3VYRB 1UMBA 1O4VA 2ZJBA 4J49A 4JWKA 4C5AA 4NU8X 4CGYA 1O0CA 1Z74A 4YDSA 2BP7A 3CVOA 3VHRA 1CS4C 2YJNA 4NARA 1ZCAA 1X1SA 2DCUA 1EG7A 2B5VA 2G9ZA 1RXVA 1WNTA 2NT4A 1OI2A 3K1TA 4DUYB 4YAUA 1PQYA 3FN4A 3HEAA 3H6KA 4KRXA 4PCUA 2JLZA 3WWPA 4LOLA 3DXZA 4Y9SA 3E9CA 2ZJ8A 3TBKA 4BNLA 4EMBA 3ONDA 2DH6A 2PANA 4UM7A 5BYAA 2ZJFA 1GG9A 4HNGA 5DXFA 4UFOA 2ZJ7A 1TO6A 5AKXA 3C4JA 4LSZA 1RZUA 1W0KD 2JJQA 3C5VA 5F23A 2B20A 5J4HA 4S0ZA 2PWAA 4I4LA 3AGPA 4IEIA 2DETA 3ESQA 2NSDA 3R6LA 2CNLA 3K4PA 3QM1A 4Q05A 2EGHA 3AR8A 4NENB 1JI3A 2Z1DA 2ZB3A 1QS0B 3EXFB 4EFNA 1SQ6A 3AR9A 1WY7A 4FC7A 3WLHA 3OT5A 3INGA 2W2NA 1KNXA 2R6R1 1LVHA 3Q6NA 2HIMA 4Z51A 1FSPA 3OCVA 3EIUA 5KYVA 3TRJA 2BFNA 1U2GA 3ODPA 3O82A 4Q82A 1RQRA 2CEKA 4I5DA 3N2NA 4PQRA 4Q3NA 2JJ2D 4G37A 5M3BA 4A2PA 2RE8A 3KWLA 4C30A 3TIXB 1IUKA 4JKOA 3K70C 2DJ5A 3QV1A 1Z8FA 1USVA 2CWDA 3UOGA 1XLVA 1JEYA 3L07A 4BX0A 3KKEA 5LPNA 1IUNA 2R66A 1VHQA 4AJEA 3EA5A 4Y2VA 3I72A 3PFWO 3T3MB 1WDLA 4M0KA 4ZICA 5BSTA 1SZPA 4KQ2A 2V3WA 3PPXA 3SQLA 3EPLA 2P2CA 3NX4A 2WT9A 3DV2A 3G17A 1XR3A 4NEQA 1M54A 1XTVA 1X7HA 2V6JA 3QP9A 1QE3A 4NEGA 5K3OA 5L6LB 2XYGA 2I8CA 3BK2A 2FG5A 2GOYA 3UUEA 2OV1A 5JR3A 2B94A 4UARA 2Q45A 3NYQA 2BFBA 3Q3VA 3U4DA 4UAVA 3HU2A 4BEJA 1UFRA 2RAUA 4JJ7A 4NYMR 1NX9A 5E9QA 3AI2A 2R47A 3DJFA 2DHCA 2D3TA 1AKUA 1T25A 3K0HA 3NFRA 4X63A 4B79A 1DKLA 1XPOA 4NY1A 4AY4A 3H5NA 5I9LA 5E7MA 1JDJA 4X7MA 5B6JA 2R1TB 4WLEA 5EG5A 3WFZA 4R2WA 4MS4B 4IYJA 2UYYA 2EBWA 1N1EA 5LYJB 3JATA 1OTHA 2ODNA 4CQMD 1P3DA 2RIPA 3EDRA 3M5CA 5J59A 2ZRNA 3AHEA 4L76A 1VMAA 1Z5OA 1PRYA 4YI3A 5T7BA 1EXVA 3QMWA 4I4TB 5L3QA 2XB2A 3P4UA 1FRFS 4J0GA 1YJQA 3B1YA 4RESA 5A9TA 4F2GA 4MEAA 3KC2A 2ZAMA 2NZWA 4EFMA 3AEZA 1ZKDA 4AJNA 2HC9A 3DOEA 1OC2A 2G70A 2V7EA 3BFJA 1OZFA 3I6IA 3OKPA 4LE1A 4UMFA 4UBJA 3SXUB 4W5HA 3NWBA 5CIWA 4DRXA 1NW4A 4LA4A 1WG8A 3H1BA 4EUHA 4A15A 3K3PA 3SQNA 2P7HA 1TF5A 4X97A 4RVNA 1VB5A 5FX2A 1NQOA 1JDUA 1E3JA 3JQEA 4LMAA 4AX4A 5TIIA 1R9MA 2CL7X 5H83A 5HGJA 3NT4A 2G7ZA 4M9UA 1QGOA 1ONOA 2E0IA 3DTTA 3KEQA 1A27A 4YWHA 1PQ4A 3RWBA 5ALJA 2O7SA 1F8FA 4QTZA 3VO9A 4D3YA 4U7TB 3U3XA 3DBVO 2XF8A 3FIUA 5BR7A 1ULZA 3PLRA 3DHNA 1VBMA 2XXAB 4P53A 4I3HA 4TL7A 3VAYA 2YNMA 4AG5A 5K99A 4OQ4A 3ICEA 4O1IA 2F62A 5LP6B 3LKDA 3ZV4A 4AWAA 3CF2A 3U7IA 1Q77A 4M9RA 2Z83A 3MAAC 4Q12A 1PJTA 5KNCD 2FUNB 2OCBA 1KVQA 4BP3A 3PXUA 2HDNB 1Z7WA 2HA6A 2XYPA 3HV0A 1PR6A 2WSYB 5JUWA 2QK4A 3E05A 4OBWA 1W1IA 4MDFA 2REQA 4BYMA 1VYTA 4JT4A 1Y42X 2Q5LA 1CW2B 2P6OA 5AVSA 1EG2A 1WQ3A 3ACCA 3CUKA 1TPZA 2VYVD 3AR2A 3HUDA 3VYTB 1VQ1A 2YN2A 1RHRA 1ONBA 4FQ7A 3ZD7A 3OKAA 5KS2A 3A1FA 1X8XA 1DDGA 3TQTA 1Z08A 1NQ5A 3DW3X 3J81A 4QU9A 5EXDA 1BGXT 4JI3B 3LTNC 4UPDA 3V8QA 4B3GA 3TDNA 3X0DA 1QP0A 1Z45A 3CRMA 3WTBA 1DXYA 3NO4A 3BK7A 5FWAA 3MPUA 1N0HA 5AI9A 3UWPA 3AT1A 4BX9A 3WDSA 4KN5A 1G1MA 4MWSA 4CNQA 1KH3A 4MQBA 3L0PA 2C07A 3PQ5A 3JR7A 2XKBA 3ID6C 2JGDA 1Q83A 4Q18A 3TSZA 1WPXA 1B8OA 2D1SA 3TBFA 5LXTA 4CM3A 2WI8A 1YIOA 1ZHFA 1RPJA 3N3BC 1L3CA 5FOUA 3RT1A 4NFHA 1P17A 4FFMA 2R79A 4HWTA 4C0JA 1Z28A 1UPUA 3U7HB 3VDXA 1AO0A 4RCYA 3EX7C 1JSXA 2AJDA 3F6CA 3ICWA 3PGKA 4RH0A 1YUBA 3D31A 2IBTA 1Q21A 1WY5A 5AW0A 5DTJA 4BGUA 4BUCA 3SVTA 1S8OA 3KYDB 3O2JA 1B43A 1HYQA 1UPBA 5GJVC 1ZVVA 3QFTA 2JFQA 3GOHA 5KYNA 3TLAA 1MC8A 2XLCA 3VKVA 1X87A 2HHHB 3HY4A 3WLRA 4FEEA 3DZHA 3QVWA 5KSOA 3GP8A 3DH0A 3BQMB 1RIFA 3W3AA 5D3MB 3ZE7A 3GNQA 3IP1A 3BICA 3VVBA 1E2QA 1HLGA 4OKIA 1MZPA 3GROA 4J3FA 3TNFA 4RIFA 1ZW6A 4NXNB 1KYWA 2ZB7A 2XITA 5DH9A 1P1JA 1WCIA 2EC5A 1CQXA 4CMEC 4E94A 5I7WA 1NPYA 3DHWC 4UXJA 3FX2A 2I7XA 4HSGA 1TU4A 4GR9A 5ALDA 3D43A 4LHSA 5LA6B 4DHWA 4G86A 4HT3B 4LCJA 3D5EA 3IYLW 4TTPA 3DB1A 2YS6A 3LPDA 1PNRA 4OX9Y 1CEEA 1TYZA 1BWQA 4OA8A 4XX0B 1N2SA 1E1RA 3FB4A 4N3BA 1XD2B 2W6QA 1YFZA 4K6HA 5CA1F 3U62A 4OMFG 3MILA 1ATIA 1RIIA 2ZJ3A 1ID1A 4RTQA 3HHPA 3GR6A 3W0LB 1VXRA 1VB3A 2QX6A 2O52A 2I22A 2QS9A 3PWKA 4EHJA 4AIRA 5E4FA 1XK6A 1GV1A 3Q8XB 1Y5MA 3OO0A 4H7DA 3W9YA 4E0BA 4UEOA 4TKVA 5E8RA 2HQOA 2IF2A 2Q46A 2BE7A 1N2ZA 5HKLA 4NICA 2WU3A 1G1AA 2YXPX 3I4FA 4PG5A 4ARIA 5A3QA 2VHCA 3LYHA 3TLCA 1QRUA 4NV0A 3SK0A 2HRBA 2P3QA 1JTVA 1S8AA 2WOJA 1MDFA 3OH8A 1E3SA 4GM4A 1E7RA 4YBRA 3TE6A 3D6JA 4O2AA 3LP8A 3JQDA 1WB4A 1A9ZA 4X1OA 3ED5A 1U3WA 4D96A 5F7OA 3PGJA 3MGKA 1JYSA 3OZEA 2AG1A 4O5AA 1N25A 3AKCA 4XDGA 1SOVA 4E1AA 1RLTA 2DMRA 1O95D 1ZUNB 5ALSA 4X6LA 4G0ZA 5FEUA 1BH6A 1UZMA 2YWGA 1CP3A 1IVSA 4M0PA 1ZUWA 1ZEJA 1GSAA 2QW1A 3RTGA 2W83A 2WTNA 2IZ1A 3KOZA 4D9JA 9MHTA 4ARVA 1LZKA 2CHUA 1LNSA 3ZU2A 1RI4A 4LZAA 3W79A 1E9EA 4AIIA 1PUJA 3P96A 1OCEA 3SDZA 3KV1A 3QEKA 2Y1CA 2XMBA 1NW9B 1PW5A 2VVTA 1VIMA 2HQBA 2AFHB 4R98A 5EIHA 1M6EX 3A1EA 3C8HA 3IRUA 3NTXA 3TOVA 4LYHA 3TRFA 3HP4A 4NZ9A 1IXYA 2FPKA 3NRCA 3PX2A 1RI2A 4QJ4A 2IE8A 3BK1A 2IP2A 1C7QA 3JS5A 2VQ6A 5LMUB 2FA9A 1QGDA 4EG0A 4OLJA 5KKCA 2NT3A 4V1CA 4RJLA 2A0FA 3AIKA 3MBKA 1M33A 1NRIA 1Y3CE 5G3ZA 2C5HA 3R3XA 4JP8A 4YP7A 3NW9A 1G3MA 1HETA 4PRYA 3R76A 5CDYA 5LYYA 4BX2A 221PA 3FMFA 2YXNA 3K05A 2IW3A 3X1KA 4PNHA 2Z4SA 3NYWA 1U2EA 3V00A 3KM0A 4YCCA 1GPBA 4YRAA 3L79A 3QYPA 4RYLA 3RC9A 4CXMA 1A9PA 1CUHA 3BC1A 4RAQA 3Q87B 3LMKA 4EPYA 4JJGA 5BNZA 3R44A 4OJNA 3PFHA 4LSWA 1JT9A 3UJCA 3NOOA 2IHYA 1CNEA 4B6FA 2ZRGA 3K6JA 1US8A 3TMAA 2CV1A 1TEHA 4FMCF 2NSYA 5FOVA 3KHKA 5JH7F 5GADl 3KB2A 5DI9A 2VJPA 1T8PA 2XTJA 4NONA 1ICEA 4YRDA 3ZHCA 4DDTA 3O8RA 4B40A 2R1TA 1BE1A 2A9VA 2ZSIA 5AKYA 4MS4A 3OPYB 4OD0A 3LIPA 5FNVB 2H7YA 1ISRA 1SKAA 2ZU0C 3K09A 5KSYA 1RAIA 5BSUA 1K88A 4IH4A 2P69A 2IDZA 4F9EA 1T35A 1IEXA 1EIZA 2C2OA 3PFKA 3A9SA 3AFIA 3ML1A 1VJDA 2X1LA 4IIEA 5A7HA 2NU6B 4I4TA 4TWIA 2IYOA 2UZIR 3I0NA 4U8GA 3W8RA 3K71B 1G3QA 1I33A 1DKRA 3C45A 3ZG6A 5K3BA 4B84A 3RBXA 4DIUA 3FMVA 1JVSA 3HLKA 1H8EA 4W5OA 1C3VA 2AMJA 3JASB 5HHTA 5J2UF 3W7VA 2W6IA 4O1MA 2ODTX 3PHJA 3SXUA 4DABA 2JVJA 2CFRA 3KDSE 3INYA 5EXPA 3GHYA 1KKMA 1RMQA 5FI1B 1ZJ6A 4NFSA 4DJDC 2I1VB 1HE4A 2J6HA 5CDHA 2AZ4A 3OIWA 5A6SB 1YHNA 1R15A 2DR3A 3QRWA 2XZLA 3LPNA 1YZQA 5KMGB 1SH7A 3ER8A 5EPEA 1B0UA 3QPWA 2XXAA 4OAQA 1C3LA 2DVMA 5CJPA 1RLJA 3FAKA 3RABA 4EGQA 3TPZA 3AESB 2QQEA 3GMSA 2RKBA 3JW8A 1DHTA 2V6IA 4HNVA 5BV0A 2AK3A 1DZ3A 1JTEA 3VMFA 4B47A 5GVRA 3SBEA 5EE9A 4EEXA 5JXGA 4QDUA 5TMPA 2CLSA 2ICAA 2CVHA 1OXMA 721PA 5IUNC 1SXGA 1X80B 1Y7IA 4E5UA 3BDAA 3M6VA 5IYZF 4DDUA 3U9LA 4HAZA 4GXRA 1TJNA 2QD2A 2QTRA 1CF2O 1RI5A 3L6RA 5EYPA 2WIGA 3W9SA 2HR1A 4CEIB 3GL9A 2AR0A 3OZIA 4KSBA 3OOSA 3MBOA 2BUAA 1FP2A 1QCDA 1AMOA 1JILA 2YJGA 4JBLA 1O08A 3UJ7A 4B17A 3CY6A 2EF0A 2BGNA 4W4TA 2UYGA 1N1GA 2XMQA 4LC0A 4NAUA 2RHHA 1X7ZB 5I5EA 3RNLA 1V35A 4MR7B 2QQ5A 1V37A 3V2IA 1IVNA 3OU2A 1E0AA 4KQGA 3RFXA 4I5GA 5P8WA 2R00A 1OLUB 4MYUA 3C97A 3A9CA 3ZJYA 1PS9A 3OICA 3SC3A 4MJ7A 5DCYA 2BJWA 5JFGA 3H3FA 2GPYA 3WA6A 5JG7A 1O54A 2V96A 3CX8A 1ZIDA 2GFQA 4ZAFA 3VOSA 2FFJA 1ZOOA 1YB1A 5C46F 3NNSA 4J03A 4NBTA 4JL8A 1ONNA 4Z8YA 4HYTA 5K0ZA 3GLRA 3DF9A 3NONA 1NATA 1GKIA 1IN7A 2QZ9A 2VXOA 4MUBA 1L4BA 2FH5B 2R8RA 2BFWA 3P2KA 1IY2A 3L93A 4MYHA 4X6YA 5CYOA 4Q37A 5D3MA 1YAJA 2TSYB 1SCUB 1OWOA 2CUNA 4S2EA 1CUVA 4H27A 4AYXA 3H5LA 3K0CA 3N1UA 2ASEA 2VHWA 2AL7A 4IXWA 1O5IA 4CLRB 1D2HA 1HQDA 1PUIA 4ZI7B 5BV1A 2IY7A 3GY0A 1EVLA 2P4HX 3ZKAA 1SCJA 3RDPA 4EO4A 3QEMB 3UJBA 1FFCA 1T5HX 1T9GS 1TQ2A 3F5SA 1NBMA 5ALIA 4B87A 2OGSA 2WM3A 1O0BA 2NTEA 4ITVA 4ENSA 1J7KA 3JAMA 1A69A 5A04A 4ZI5A 2JHPA 3DCNA 5IVKA 1U02A 4XM2A 4FLMA 4A10A 1N36B 3IA7A 4LNUA 1XD2A 3E2PA 2JI7A 4WCDA 3I8XA 5EI5A 5AJUA 5C7IO 2OP0A 2RGAA 1AOXA 1CX9B 1GRVA 4NATA 4R81A 1P74A 2GYYA 3I9OA 3NYIA 4DWOA 4MQEB 4YXFA 4MKZA 5CD1A 5LSAA 1BJKA 1GAXA 4V0RA 1XC7A 5IBQA 4P4LA 1Z6ZA 5D86A 5EVJA 2PUFA 4Q9HA 4ENTA 9ATCA 3MTAA 2FMTA 2VBFA 3LY8A 1ZKMA 4BBZA 1IWOA 1K3UB 3FYSA 5IK2D 2AHOA 3KQPA 2Q1UA 2VKQA 4ZJUA 3L6CA 2J9ZB 5MN6A 1OZ0A 1YK0A 1F1JA 4K9PA 1N78A 1XJCA 1A77A 1OAKA 1EK5A 2FEWB 3BA1A 3GUZA 4Z9AA 3ZR4B 1AQNA 4TSRA 3LVFO 1PHPA 1GY8A 4BATA 1GGJA 2GZHA 2F3QA 3WBKA 4UEJA 1LRKA 2HWWA 1ZUNA 3EK2A 4MV7A 4XOIA 5T4BA 4BJ6A 3C3YA 5F1OA 2XEDA 3V7NA 3NJ8A 4FT4A 1ZNQO 5KNBH 4PIMA 5F1KA 1GU7A 2K7ZA 2R25B 3IDZA 4Y6OA 2ZRLA 4WGGA 1YI1A 1WZNA 5TPZD 2XDWA 3ZX4A 2C7BA 3ODGA 4IUDS 4ZJPA 1VPLA 5JJBA 1S8FA 4O33A 3MK31 5IX8A 3ZQKA 1YOBA 2PMFA 3BCHA 2A7XA 5BQOA 3B3AA 3K9CA 2TMDA 3PDWA 5TSDA 1FYXA 2G06A 4UDYX 4D9IA 1V71A 2K5UA 3E3AA 1NNEA 4BQRA 3CKKA 4MYCA 3M6IA 3EDQA 4QNNA 4PF1A 5E1DA 4PAWA 4TSFD 4B6OA 4PZDA 3C6YA 3M7IA 2D74A 3PIDA 3NBMA 4JYMA 4DC0A 3PYMA 3J81k 3GJ5A 3LL4A 3LQ4A 2YINC 3UB4A 4EITA 1W4AA 4KMSA 3UGKA 3RHTA 3UWMA 1XO1A 4BLOA 2FDRA 1RABA 1QV7A 4IMRA 3WBJA 3D3QA 4FGWA 3P20A 1U9ZA 1N7JA 2KMLA 4D4HA 2VP5A 3D2LA 3P9RA 4LRWA 3Q0IA 4Y2SA 1QRAA 1FU7A 2A88A 1VE1A 2WOOA 5LQKA 1TTPB 3W5IA 1FL9A 3E7PA 4RK0A 2M1XA 2ZI5A 1R10A 3BMQB 2NYRA 4GPIB 1PZGA 3EOBI 2A2ZA 4KR0A 2XMGA 5ECDA 1U8EA 3H2YA 5H0IA 3PJFA 2AFRA 2H1IA 1E66A 3LPLA 4MHTA 4LMRA 5GJWC 5B2FA 5KZMB 4YP9A 4TYNA 3N8IA 3OQ6A 4HBGA 4UATA 4J4TA 3AUUA 1GWNA 3DMTC 1E6LA 3FDFA 4IVPA 3I5UA 4KWCA 4M6WA 3DLHA 4Q16A 1U2RA 4PX5A 4X44A 1DO0A 4EA9A 2EIXA 3OPYA 3I45A 1RJGA 2VTVA 5FNVA 3JQCA 4X7BA 3R7LA 1KOFA 1SXJD 5GZ6A 3WRWA 1MB0A 3K15A 1E2FA 1DU4A 4QFDA 4RV5A 1M2EA 3AR5A 5LD2C 1UZUA 4PFJA 1J90A 3MLAA 1T0HB 2BGMA 2FPOA 2YBEA 4FQ5A 1L5HA 3HM2A 4N7RA 1V3QE 4H59A 1HT3A 4V2IA 1N1DA 5K6AA 2F3TA 4D81A 1H4TA 4KQXA 4XJSA 3HH8A 1ZRMA 3AB7A 3JASA 3OZTA 5JC8A 5EP3A 1ADYA 4N47A 4P34A 2IYPA 6GPBA 5DCUA 2AXEA 3PXBA 1K7SN 1NT2A 5JFOA 5KYTA 4ECAA 4EVRA 5EJ4A 1LD3A 4MW4A 5K3FA 2QZ4A 3D0OA 3QI7A 1EJ2A 1MRZA 2I4IA 2IYAA 4K9NA 4U6SA 2EKPA 4FDMA 3BWCA 1V1MB 5TVKA 5A6SA 3GMTA 4D0NA 1SBTA 5IH7A 4NK5A 3TEFA 2EFGA 2C29D 1L7EA 1GNSA 1A8QA 1KDRA 1XDWA 3HU5A 3KOXA 4E14A 4I4CA 3U19A 1HM5A 4JU9A 3MHTA 1AHHA 1JEDA 1R5NA 3ORYA 3QW4B 3UV7A 4D45A 1TF7A 4AP5A 4CM5A 1WD5A 5T67A 3SXJA 4R8SA 1G8YA 3R9WA 1P33A 2H5IA 3STUA 3R75A 1PV4A 1H4SA 5FWXB 1M9NA 2GFIA 1X80A 4BS9A 2DXIA 2KHZA 4ZU6X 3GFGA 3WO0A 5LKRA 3NIFB 3U49A 1FXSA 2FEAA 4LV5B 4QGFA 5H80A 4C20A 4Y7CA 4CM8B 4DIKA 1TIPA 3EFBA 1JG4A 2B6HA 2EJCA 2NO4A 3FCAA 4N5IX 1Q57A 3M70A 1N5MA 1RMYA 2HFKA 3H1FA 3H2JA 3OBBA 4PLTA 4ISCA 4CMIA 2AE2A 2BKLA 4Z4GA 2A3RA 3PK0A 4EB0A 3PQCA 4EM6A 1SG9A 4IDAA 4HZUB 4CTJA 5HJ2A 1O87A 2BISA 2YHUA 2ZTVA 2JNWA 4G67A 4RGQA 4YR7A 1KNQA 2QP3A 5CBPB 1II9A 3LV8A 1OLUA 4CJXA 1SVNA 4QVGA 4DVGA 1OOEA 3LU1A 3NH6A 3DMGA 4P32A 3RKRA 4CYMA 3OIUA 3THSA 1SVUA 3GVXA 4J0JA 2ANBA 3DV0B 3NKFA 1D0VA 2DUNA 4EI9A 1GKLA 2IXDA 3PGXA 2CLMB 7ADHA 4N41A 2O1EA 3NTVA 3JD2A 5CLGA 1U2DC 3Q9SA 5I4BA 2FP4B 4OP1A 4X8HA 1TF2A 2XB6A 3CLVA 2FDXA 4B85A 2VZ8A 4FFOA 3FGPA 2WKWA 2WHYA 3OPQA 3OQOA 2TMGA 4J9UE 5DHRA 1MVNA 1AS3A 2VTBA 1RRFA 3O4FA 3UOAB 4DG8A 3WNCA 1LJ8A 4KV9A 1NHGA 1R0ZA 3GG2A 2P9QA 2C4MA 5H70A 3WLTA 1OKKD 1WEKA 1V6CA 1U7TA 2X58A 2Y9PB 1HDCA 3EULA 4MS3A 1H5QA 4J0HA 4MI9A 5CCDA 5J47A 1B6TA 3PC8A 1QU2A 1U6JA 2YHAA 5CJJA 2NPIA 2OFOA 3BEDA 3NOQA 4C5CA 2QU7A 3MUFA 4QJBA 1FP7A 4NWIA 4QXOA 2IDKA 4AJ4A 2BH2A 1JJVA 2GN8A 4FX5A 3AI7A 4PHCA 1OHHD 2J6IA 3DO8A 2BV3A 2B2CA 3DHVA 4Q4HB 4X84A 3L05A 4CIDA 4WK0B 5K45A 1ZITA 5IAGA 3T1QA 4E03A 1DKQA 3ESBA 4Y2QA 4YRQA 4BKUA 5JMWA 1RAFA 1AKQA 2OV8A 4XPIB 1U0SY 3M33A 2P9FA 4MARA 4PGFA 3EGWA 1JQDA 3VKFA 4FD2A 4IZ6A 1H3NA 3CCBA 1VA5A 3NBYC 1IZ7A 2RAPA 1AC5A 3JD0A 2OA0A 1PK8A 2I4NA 3P2JA 1X7YB 3B1FA 1E0KA 1NJ8A 2X5NA 1OI3A 3EVDA 4IL5A 4D9GA 4F4IA 4DBZA 4V0SA 4F0JA 4FINA 1SXJB 2JFGA 3BGIA 3EZ7A 5NULA 1X8JA 5IT4A 4WNIA 1OTYA 2EDAA 1VCHA 3AQIA 3EC1A 5JSZB 3PD7A 4BB9A 3TYXA 2PLWA 3DEHA 5CLJA 1HSOA 1N6KA 2VLIA 4S12A 3EFOA 4HGNA 2H5JA 5J43A 2RKWA 1Q1EA 3VQTA 1L5KA 2XQFA 1ZXLA 2XGSA 3PL1A 4QBIA 4YX9A 5K7SA 4ZI2A 1NRXA 3DYVA 4XUCA 4HAVA 5ECYA 3AJAA 3ZHRA 1W30A 2IUSA 1WXIA 1XMSA 4L8VA 4YJ2F 3S68A 1M2GA 5E6SB 3S8EA 4C08A 3ROFA 1V8PA 1J21A 3Q11A 1XTIA 4XVRA 1MABB 2Q07A 3D6TB 1QHHB 2VK2A 1DX4A 3IT2A 3PX3A 4TV9A 2HU8A 5H1YA 2PLNA 4FIDA 3KS9A 1GA6A 4IHKA 2A30A 2LTAA 3ENWA 3ZGOA 4AQ7A 4ZQHA 4YUYA 3FNRA 1T8UA 1UT5A 2PCLA 4GSKA 4IGFA 4L4UA 4R41A 1OF1A 2P62A 3DBLB 4Z86A 4PZCA 5IVPA 5JDIA 4C0SA 4D92A 3WGZA 1E99A 3FCEA 5IJZA 2EFYA 1H05A 3M4JA 1UT6A 1BFUA 4INAA 4QGGA 2HU2A 1N7IA 1OA0A 2XD4A 1BQ3A 1Y4UA 2J08A 2WB4A 1FSFA 4LY9A 3DE6X 2JEYA 1BKYA 1HG1A 3G2PA 2W4MA 2LE0A 1YT5A 1DKUA 2VC2B 3MRVA 5TEWA 2KB0A 2G1KA 2HJVA 5K0LA 4QTUB 3L1KA 3MCTA 4BQIA 3K9BA 4RNDB 3GLUA 4JZYA 1KC1A 4PC2A 3HU1A 1S1CA 4M46A 3TIFA 1KEEB 3GRCA 8ATCA 3N2YA 3H83A 3I42A 5CG2A 1ECFA 3W5JA 2GEKA 5DGCA 1KOLA 4H4EA 4DLSA 2V8OA 4S2UA 4UFNA 1E4YA 4OB8A 5H3LA 1HK7A 4DTCA 4MSUA 2XVXA 4K2AA 5KYKA 1F3LA 2HRDA 3HBMA 1R9JA 3L4BC 2CF6A 3IXMA 3U4AA 4GH5A 1IN8A 3IQXA 1HL7A 5JAMA 1EPUA 3Q72A 4Y98A 1HKUA 1IXZA 3W34A 2J45A 1OFVA 2R8ZA 2IT1A 4I99A 4R5MA 1LJLA 1M1XB 4ZD6A 5IW8A 4P38A 4ZO7A 3X2FA 1DKNA 2XB9A 1CUWA 2EJUA 1BJTA 3DWGA 2BZGA 3HDVA 1VLJA 4LJ6A 5FB3A 3RIEA 1JG2A 2E2WA 4HDCA 4IDHA 3LX4A 1UBNA 4OFBA 3K1YA 5G4KB 4N12A 3FHOA 4JUDX 1S2MA 1L9KA 1GQSA 1T2CA 3MRSA 1ZI6A 5JIBA 3PQEA 3PU6A 4FZVA 3F71A 4B31A 3P0EA 3PRHA 4KZPA 5KNBA 1IUPA 3LBIA 2ZDGA 1WA5A 4ZVKA 4EY5A 4AC9A 3CMMA 5HPYB 5EGSA 2UU9B 5CLLA 4RSHA 1QAQA 1QTIA 4P92A 4V0NA 4W1QA 1H42A 4CKZA 1E3TA 4M54A 1Z6AA 1SIWA 3LG2A 4Q9AA 3LRPA 1EFKA 3GJ6A 4XYMA 2B1RA 3LUAA 1LQ2A 4ND2A 4NU6A 4PSAA 3WKBA 2V45A 3ELDA 2JCVA 2C2YA 4X62B 1GPAA 1VLHA 2AUMA 1HYEA 2VJNA 2SKEA 2G0TA 2LKDA 2O1WA 1VP9A 4LPKA 2FPRA 3NNDA 4MJXA 4RW0A 4C3OB 1DXOA 2LW7A 2PWPA 3GLVA 4HX5A 4NMHA 4ZEVA 4KITB 2EJBA 1TX4B 2W6MA 2P6NA 4PGAA 5MN4A 2JPDA 4YXWA 1IPHA 3TAHA 1G5TA 5FPHA 4K0KB 4R01A 3CNNA 3OLVA 1P2GA 3WLJA 2N3ZA 3BN3A 1XZCA 4H08A 1I7SB 2VRNA 1ONSA 4REMA 1K5PA 4E08A 1VIDA 4IUBS 2UZ4A 2QG6A 4ARBA 1JLSA 1Q50A 2QLTA 4K0RA 2OWEA 3K5WA 1E2LA 4DGQA 3MA0A 1V8ZA 3L5OA 3HVKA 3ND6A 3OZRA 4NJMB 4QOGA 1VMKA 1AF7A 1ODCA 2VUHB 5IJ0B 4CEJB 5I8ZA 1V1MA 4URUR 4HD8A 1GGHA 1XCBA 1H5NA 3I58A 3HR4A 1G98A 2Q9CA 3HN7A 4LK2A 1EFPA 3IVMA 3AWDA 4IVRA 4OIMA 3GT4A 3PCTA 4AWXA 5SYMA 3DEFA 4L95C 4WHMA 1WZUA 3O95A 1JYEA 3I39X 4ZDIA 2C7OA 2WJYA 4FW8A 3OEYA 3JVEA 1UPXA 3EEQA 2CFOA 1PFKA 1T1SA 1K7XB 3GELA 1E1DA 3TL3A 2X8AA 3EZGA 4AZ3B 3CS3A 3HVHA 4M37A 3ROMA 3NTLA 2ZBEA 4PVCA 5K3DA 4FGJA 2PBFA 5F7XA 3OECA 3R3SA 4NOJA 3D8HA 4CM8A 1H6DA 2I3GA 2XE7A 1FMLA 1NE7A 2ZIZA 2ENWA 1B1AA 5CPBA 2IPXA 4R9UC 4H1WA 2XJ9A 2V9PA 5ED4A 5EE3A 2GH1A 1V2GA 4LBZA 3OWHA 4GOND 3R0QA 3ICPA 4WK4B 5JCOC 1E6CA 3V2HA 1AJEA 1E2BA 3O38A 1W0CA 2FR1A 4JR1A 2YVAA 1VZ2A 3I83A 4RF4A 1UBOS 5EWJA 3CR7A 3GA0A 3DKKA 1QWSA 1DRUA 1E5XA 2CMHA 2QM8A 4EKIA 2VYQA 4OHYA 4JC5A 2BDEA 2W93A 2IS4A 2IUFA 4DV2B 3JWIA 1JH8A 1C50A 3ESXA 1EK6A 1A8HA 4AS3A 3LDFA 3AK4A 1W36D 4HQKA 2Q5CA 1AHIA 2ZB4A 3K73O 4HX2A 2JCYA 1CY1A 4BAZA 3WSWA 2C61A 1LY1A 1SCIA 1J42A 2HIGA 1KO4A 2JLRA 1KK3A 2QX4A 3CW9A 3DV0A 3L7CA 4G0MA 1DIRA 4Q3BA 4X93A 5IYZB 2Q4OA 2ZTHA 4HCJA 1Z2NX 2R0QC 2H85A 1AKVA 1EP2B 2FP4A 3LHDA 3QXXA 2QRVB 4GE3A 2GBLC 3SYMA 2GPNA 3ZVKA 4RK6A 1LLCA 1R0SA 1H9AA 2XNJA 1DUIA 2XT9A 1WVGA 1AQYA 3K9NA 4G65A 3ZBUA 2WKRA 4Y8VA 3AKZA 2PUJA 3UMMA 2VPZA 4L5AA 4C6HA 4E5SA 4OXQA 1ZQ9A 4JCCA 4CIAA 1WTAA 2IU4A 2ZYGA 1PKXA 1NBOA 1ZUD1 2O8VA 3E7FA 3ET4A 3TW8A 1PT5A 3DQZA 4EEZA 4H7JA 2ZWAA 3MNFA 1C29B 5AD1A 1KQFA 1DOHA 3FPGA 3V1MA 5KJEA 5BRAA 3TECE 1SHTX 4WDQA 4U7HA 3ORRA 2BTQB 4Q4HA 1YR3A 2I54A 4LJAA 3RJ5A 3BRQA 3Q8WA 3DQQA 4PFSA 3QKUA 4YV7A 1FDOA 2WYUA 3A6KA 1K8RA 1BWSA 3CXRA 3ZGNA 4F8EA 4DV0B 2ZZKA 4EB8A 1W35A 3M8KA 3OC6A 4ZTZB 4YP6A 1C2TA 1CDEA 4DA6A 1G8HA 4K1LA 2GFHA 5JY6A 3RS7A 1SN7A 3E22A 2N1MA 1NQAO 3CLUD 3SLGA 4RABA 4F04A 1KQOA 4MUYA 1R0RE 4ZMRA 5A6VA 5TQVA 2KSQA 1P3Y1 1PLLA 1D2EA 1QG6A 2AR7A 3A4YA 4MW7A 2G9QA 1DPFA 1FMJA 1KRHA 4FJ0A 4IBOA 5CEEA 3IBCA 1RW4A 3ONFA 2UUPA 5BNIA 3SNHA 1G9TA 1EP1B 2GR9A 3KQMA 2LBPA 2VNJA 4Q00A 3ROTA 3ZZMA 4CM7A 4PYIA 4POAA 3E7WA 5JSZA 2DHQA 3S2EA 3PQ8A 3L7BA 4AO6A 1NQVA 1Q7CA 1AXEA 1HRDA 1QQTA 5AJWA 1E3LA 4HH1A 5BV8A 2Y77A 4G0PA 1YU6A 2I6TA 1JU4A 1JI0A 3T3IA 3DNFA 2H2IA 1WMBA 2REXB 4IOJA 4MP8A 4Y2TA 1B2LA 1GAWA 4DNXA 3BSWA 4HFMA 4YN3A 1KE2A 2HAEA