2GHRA

Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
269
Chain Sequence
EENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGNTPLQLDVHLLHMESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFEHEVREQHVKLLQGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFKHDNPNEKPLVRWRSHGNLLFSNWLNYYVYQET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Homoserine O-succinyltransferase
publication title Crystal structure of homoserine O-succinyltransferase from Bacillus cereus at 2.4 A resolution
pubmed doi rcsb
source organism Bacillus cereus
total genus 83
structure length 269
sequence length 281
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04204 HTS Homoserine O-succinyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ghrA01
1WL8A 3R76A 2ZUSA 3N7TA 3UK7A 1CF9A 1JDBC 4ZGGA 4UZSA 4XLLA 1QVWA 4Y1FA 4UOZA 1GPMA 4PXYA 3P9PA 3PQ8A 2OR3A 4B2YA 1GGKA 4UCFA 2VKTA 4WXYB 4GE3A 2GHRA 1SOAA 1IZYA 4P5PA 2VXOA 3PQ3A 3ZR4B 1GPWB 3F71A 4AUEA 2YWJA 1I7SB 2ZUTA 1CE8B 4D1YA 4GE0A 3SF8B 4ENUA 5IP5A 4AUNA 4QYTA 3UOWA 4B40A 3NOVA 3F5DA 1QVZA 1KA9H 1IPHA 2ZUUA 2ABWA 3ER6A 3CYFA 1KWGA 2D7JA 4AJ9A 3EZGA 1U9CA 4BTEA 1K9VF 1BXRB 3TTWA 4I46A 4Y1RA 4R7GA 1QF7A 1T0BA 5SY4A 2NV0A 4JQSA 3FIJA 4N0MA 1GGEA 2VPIA 3OT1A 3R75A 3P9RA 4ADSG 2A9VA 4OGFA 3NOQA 4ZDKA 4P34A 1G2IA 2R1TB 3UGJA 1P81A 3EN0A 1VHQA 5SY9A 1J42A 3EFEA 4L8WB 3B38A 1VCNA 3KKLA 3FSEA 4RKYA 4UNIA 1OX4A 1Q2UA 1JVNA 3PQ5A 3ZJ4A 1GGFA 4ENTA 3PQ2A 3CNEA 4P2GA 4UOQA 4Y0NA 4OQ4A 3SF8A 4ZDIA 2R1VB 5JZOA 1UCFA 1PDVA 3UJNA 3NOOA 2RK6A 5SY6A 4K2HA 3M3PA 3EJ6A 4GUDA 1I7QB 1P5FA 3TTUA 1A9XB 1KWKA 4L78A 5SYAA 3TTSA 2AB0A 5JZMA 4Y1GA 4E5VA 4AULA 4RKWA 2W7TA 2ZUVA 3UMMA 4L7QA 1PE0A 1T3TA 2RK3A 2H2WA 1L9XA 3B36A 4OIFA 4OGGA 3B3AA 4I2NA 3GRAA 3PQ4A 3VU3A 5E9AA 1I1QB 2ISSD 4B5KA 4N12A 3BHNA 2LXNA 1FYEA 2R1TA 5BV2P 1IZZA 4P35A 2YWCA 4MGHA 2YWDA 1PV2A 3NORA 2GK3A 3NONA 4ENRA 5LIRA 1C30B 1FY2A 4S0ZA 1KEEB 1O1YA 4OJYA 4ZDJA 1KXJA 3CZ9A 2RK4A 2YWBA 3D54D 1OI4A 3L7NA 1P7ZA 1VCMA 4AUMA 4MTCA 1Q7RA 3BWEA 2IUFA 3PQ7A 4LGYA 2ZUWA 4BIMA 3CZAA 3MGKA 5K4AA 3TQIA 1SY7A 4OFWA 3TTXA 3NVAA 1PDWA 3TTVA 1M6VB 3OT1B 4ENQA 4ENWA 2V4UA 2VDJA 3MIIA 5DFAA 1QVVA 4L95C 3CY6A 4L8YA 3TTYA 4Y1EA 1GGHA 3PQ6A 1N57A 3TTTA 1QWSA 1CS0B 3P9SA 1OX6A 4ENVA 4HCJA 1OY1A 3R74A 4WINA 4ENPA 1QDLB 1OX4B 4P36A 2R1UA 4L8FA 4QYXA 1R9GA 3L4EA 3RHTA 4B31A 1S1MA 3SOZA 2NV2B 1T36B 1P7YA 2FEXA 4I4NA 4B7AA 4BFLA 2VRNA 2WJZB 2XF2A 4E08A 3ZJ5A 3EWNA 1P80A 3WFZA 2R1VA 3L18A 1VCOA 2AD5A 1C3OB 1GGJA 1OX5A 3L3BA 4LRUA 4ENSA 4MNTA 1GG9A 3P9QA 1ONSA 4Y1RB
chains in the Genus database with same CATH superfamily
2BLLA 4CT5A 3R76A 4YVFA 2A5DA 5F7OA 2HLDA 3D8BA 1GAEO 1VJ0A 3DXFA 3OZDA 2XD9A 2FPPA 1DIBA 2PAAA 1X9IA 1UEXC 1UJBA 3NTUA 4P7JA 4EA6A 1T9HA 3PHHA 1CR1A 2Z4TA 1GVHA 3IHTA 5AHXA 2ZYUX 3MS2A 1MR3F 3DTYA 1C8BA 4Y2TA 4C3ZA 4ZHQB 1EJ6A 3VAZA 4C0BA 4BRUA 2WT4A 3O2JA 4HEJA 2P4SA 2GT1A 3V8PA 1ZGAA 3AP3A 3SVLA 5IP5A 5CW1A 4CM4B 2MJLA 5ER6A 1PUJA 5KDLA 1CG6A 2RARA 2XHEA 1FYDA 1Z88A 2D7JA 3SAJA 2PKRA 1NFQA 1K9VF 3AM5A 1AGXA 4PIPA 3TI9A 2GK7A 3F47A 1QH1A 2B99A 2ZSKA 2Q3DA 2ZIWB 4GI5A 5D5PA 5I4CA 1P39A 3WLOA 1AK1A 1BRMA 2NV0A 3OZEA 3VU1A 2ACVA 4FX5A 3GNLA 4QL3A 1XNJA 2RI0A 2N75A 3QYAA 1O08A 4W1QA 4ARVA 3B1WA 3KT3A 4BP8A 1YQXA 4ZVPA 3VYRB 2Z9BA 3B9QA 4MQBA 3D8HA 3X1MA 4EO7A 4NBSA 1KMMA 2VT2A 2FZLA 3GXOA 3MD9A 4FDUA 4HUQA 4JDPA 4L8WB 4UNIA 4PC6A 3SQWA 4A27A 4AY4A 5DNEA 5BVGA 2AFIE 4E1BA 3TD6A 2O7SA 1DT3A 5CX1B 4M1ZA 3IE1A 3CVYA 5J4KA 3L6CA 2ZIXA 4QU0A 4OJNA 4R6WA 4NE9A 4I55F 1V26A 1ZRMA 3ABOB 2LP4Y 4HB3A 3O4HA 3KAKA 4XVQA 3K7EA 2AHOA 3GQVA 3IAHA 2VNSA 2ERXA 3NV9A 4N6OA 4YJFB 4DLLA 3LP6A 1TXGA 5SICE 4YDRA 1J21A 4JI7B 1OLOA 4C43A 3DJYA 3TOCA 1L5MA 2C5GA 2XNSA 1A82A 1EH5A 2DTEA 4K86A 4QXMA 1KH3A 2Q3LA 4FOLA 4R9UC 1FDWA 3BIXA 3VKWA 5TQ2A 3QXXA 1NQVA 3V8RA 1X0XA 3EVNA 4RPKA 3BXOA 1Q6YA 1C30B 4YALA 2XQFA 1Y7PA 4N3BA 3VZDA 2PWPA 3K35A 1AKEA 2HIAA 5JOQA 2YDXA 4EGJA 1C1HA 3PHGA 3DZJA 1G4UR 3IJPA 2XMDA 1EUZA 3V8QA 1PGNA 1E3SA 2P35A 3LWZA 4XRGA 4X6UA 4FBGA 4HNQA 1OXKB 1N25A 1E18A 5AMXA 4L3WA 3ZE7A 3SHVA 1E20A 4DMFA 1WMBA 1HURA 3C0KA 3HVJA 3QPVA 4DCVA 4B7CA 1F0NA 2ZSJA 2QJFA 3AR9A 3HRHA 2AG5A 3MTBA 4HDAA 1HPLA 2FWMX 3DDNA 3O8DA 2DZDA 4R8KA 4ZAGA 4FYPA 5KCMA 1BH2A 3TEFA 5KNDH 1P2UA 1QAQA 4MPTA 6LDHA 2IW1A 3SSAA 2CWWA 5C32A 2JH3A 4ESEA 3G7UA 4KUHA 4N18A 3PKJA 4YWJA 5DO9A 1JHUA 5AVVA 3FPGA 3L1KA 3WFZA 1T24A 3FXAA 3C48A 3UOAB 2X40A 4JC8A 4EI7A 3P45A 1MHPA 2C82A 4RMIA 4TOIA 4Q9NA 5D6OA 4Z0NA 2YW2A 2ZULA 4F7WA 2ECKA 4D8XA 2XDQA 3KSBC 1X39A 4X1KB 2GZ1A 2IYXA 4HAVA 2V6JA 1KAOA 7ADHA 3TQHA 2ACEA 1XOIA 2OR3A 3EBOA 4IHKA 1IPEA 5FEMA 4EECA 3WAJA 3S5JA 1AGRA 3JWEA 3K73O 2FPIB 2XCTB 2RGGA 3SC2B 2GVDC 3AJAA 4JLKA 1T5TA 2WF6A 5DMHA 4ZZ1A 3DOJA 5BR4A 4WBNA 3EISA 3ABIA 4V3CA 3JQPA 3DO8A 3D4OA 3H5NA 4ESOA 2EKZA 3ZYZA 3KLPX 5EJEA 2FG5A 2JHPA 3OKFA 4K87A 2HRBA 5LVAA 5THQA 2WJYA 5LA6A 1Q7GA 5F78A 3K9GA 4X7PA 5A5FA 2D59A 2H5EA 3JTEA 2FJPA 3OCWA 1YR7A 3VPFA 1E8NA 1Z39A 1WDMA 5FJIA 5ADUS 3IUEA 4OOFA 4ZVVA 4HH3C 4HNTA 4JL6A 4OCZA 4QGBA 1U9IA 4TYWA 5KOYA 4X1YB 1XK7A 2V0CA 4HQFA 4QIHA 4ITUA 4IXWA 4JBYA 2P3QA 4M46A 5IKOA 3GVCA 2ZJ7A 2X8LA 1MQSA 1QX4A 4I4TA 4I6EA 4MX8A 1VE1A 3LHKA 5FLYA 2UVPB 3OEHA 3WKAA 4ENTA 1UPFA 1DJOA 3GXBA 2RMKA 4EJFA 1HLGA 2C0PA 1YOVA 4BNZA 3WBFA 2FWAA 1P1HA 3RB8A 2ZXEA 4RQAA 4Y18A 1Z29A 1FRVA 3KEOA 3BUSA 5BN3A 3B8EA 3SDSA 3VDXA 3HYCA 1A9PA 1C4KA 1G291 4JL8A 5IVKA 2B4YA 3JSAA 1R4NB 5E6UA 4QHTA 5K0NA 5HM8A 2CBGA 2FPWA 4Q9KA 4HN2A 1TA0A 3ZWPA 1P4JA 1C81A 4KXVA 4Y2RA 4DEXA 4YGYA 4GPIB 4NCBA 4MUJA 3N5CA 4PC2A 2QB5A 5D8DA 3ES9A 4YRJA 2JGAA 2P9EA 1XEXB 4NBNA 4QKQA 4OH1A 4O3MA 3BPSA 4FNGA 3T0GA 2QUKA 1QYDA 4DT1B 3BGOS 2PRYA 4LCJA 1XMXA 1C29B 1XVAA 2CXNA 3DZIA 1YRWA 3H19A 1R4AA 1E2MA 5AVXA 3P52A 3IESA 2XKKA 3ZV4A 3IKLA 1B14A 3QA9A 1DZ3A 1G6OA 3E9CA 3GLRA 4IV0A 3V5NA 4D4JA 4R8VA 1MO3A 3T12A 4OHFA 2WTXA 3S8EA 3BWEA 2BP7B 4X7BA 3RBXA 2L69A 1R9JA 3K16A 4E5NA 1BMFD 3FOFC 2IS1A 3E1GA 3L0CA 5DYIA 3W4IA 1SM4A 2RKBA 1N5DA 3NH6A 1X6VA 3KQQA 4TT3D 1OWLA 5EGSA 3BF7A 3GX1A 4D82A 1VL2A 2G5CA 1ABFA 2W6IA 4EJSA 3IEVA 4HB0A 2EX1A 3BFJA 1QDUA 3HCFA 4NU6A 5KTOA 3OLZA 3PBKA 5IWCA 1W46A 5JD4A 1SC4A 2WFLB 4JJIA 2HLPA 1MG5A 1QOPB 1U02A 1IXRC 2X5OA 2DRIA 1JHMA 5D00A 13PKA 2O0HA 4EENA 4X6YA 1M6NA 2JKYA 1FSGA 1YHYA 4RVUA 5JHHB 1SXGA 3ZK7A 4IQ8A 2F8LA 3AHGA 2HLDD 2WAOA 2H2FA 3AIIA 2VRWA 5BNIA 3EE6A 3GROA 3IR7A 2YFKA 5DHSA 1S8AA 5EWMA 4BNLA 2PBRA 3H05A 2DUWA 1WVGA 1Y6QA 2X4GA 4DXAA 3E05A 2QRLA 5AW6A 3UMBA 1G6HA 4I0WB 4WXYB 1M54A 1JAZA 3TW4A 5LQAA 1CQJB 3M5PA 3JWHA 4GM4A 5ER9A 3TR5A 4GNKA 2AX4A 4G0QA 1ZSNA 4AYXA 4FBLA 2BGWA 1QFXA 5FR1A 3R40A 3PFFA 4GVPA 5EJIA 5HA5A 3GA5A 3ZWYA 2GHIA 1HZZA 3QMWA 3QQPA 2FW0A 5GJWC 4RTSA 4JI6B 2ZRHA 1AX9A 3O95A 4MQEA 4LZAA 3UAVA 2XCSB 1NLFA 1H85A 5B1EA 4L4RA 1QMGA 2DTDA 2A5FA 2QTRA 4XJXA 1F5SA 3ROXA 5KNBH 1XUOA 1CEXA 4ER0A 4FGKA 1KQOA 2WMNB 1XCJA 3DCIA 4OQPA 1NJFA 2BDTA 1YFJA 5ALLA 3UUWA 4CIWA 1K98A 5K09A 1BX1A 3ZU4A 1N3LA 1PTJA 2G9RA 4LW8A 1IBSA 1Z0KA 5U4QA 5JO0A 3WK9A 1TO1E 3E58A 3EAFA 1X14A 2WJVA 3COYA 3G49A 3NDJA 4MJ3A 1YDEA 1KDPA 1Y63A 4IKOA 1XQ1A 4RPIA 4LAFA 1RAAA 2Z9CA 1X1DA 3WJAA 5KNLA 2V7WA 2WG0A 3EVAA 3SHOA 2PU7A 3P71T 4D0SA 1NHWA 5COBA 3INYA 4RLQA 1TF7A 3LHSA 2B78A 3SJCA 3NEYA 2G1KA 4R1OA 2WSSA 1NF9A 1V71A 3MTIA 1JSLA 2YMLA 4LPKA 5EIAA 3VR5D 3U7IA 1Y7IA 1M0TA 1MH9A 1GZSA 1HFKA 1YQWA 5DIFA 2AKAB 1ZK3A 2PS0A 3D8NA 3GJ4A 4FN5A 4LRXA 3LDUA 1X1BA 3E8MA 2ONCA 3DEZA 1SUDA 2ZCUA 4A1FA 5KTYA 4AZWA 3NQ41 2VDPB 4QYIB 1RT9A 4QELA 4YRCA 4P0PB 1HC7A 1Y82A 5HRAA 4WN9A 3GEMA 4DA7A 3N6VA 2JHAA 2DYKA 3G6WA 3RSGA 2CJPA 2ZJZA 1V5IA 5L7TA 3T06B 1ZMOA 3DCJA 2E9SA 3OTWA 1T1EA 3HFJA 3I9V1 3SR3A 5L3SB 3QE2A 2NSHA 1FK8A 1SXPA 1SZDA 3IMKA 1K6EA 4EI2A 1ULSA 3K8YA 4UVHA 5CG1A 3HDJA 2O0MA 3PDHA 4ZVLA 1YUMA 2GWRA 4M9RA 4JQYA 1B7GO 4NWIA 1H8HA 3L0ZA 2K6GA 2ONZA 1YR9A 5B3LA 3AY6A 5D3MB 1JU4A 3TLKA 1DHRA 3AKYA 4IXTA 4NYMQ 1J09A 4JHXA 1D4AA 3MBKA 1Q15A 4BLSA 1IJKA 1O57A 3M4NA 3SU8A 3AV0B 4IMIB 3TB4A 3DM5A 4ZT6A 2CDNA 4DNQA 2AN9A 2VF7A 4YJ2A 1M67A 3LBYA 5B1SA 3SHQA 3P94A 4AB1A 1MW8X 4MAAA 2CNOA 3GU3A 5I4KA 3QKRA 4XVHA 4WX2B 2UUCB 1TQ4A 1F2VA 1A5AB 1JFLA 2WIAA 2G8NA 3F9IA 1Y1LA 2Q07A 4KQHA 2DPXA 5EQJB 4M1QA 3RK1A 3X1WA 2W43A 4DC1A 3V9PA 1FDOA 1WMAA 2X6RA 1UEIA 2XQGA 2I87A 4KLAA 4MHSA 3KJHA 2C94A 2D2FA 2X9VA 4QEZA 4URZR 5ALRA 1GGKA 2CVFA 4EZEA 4DBVO 3EPRA 4WSOA 3UV7A 2PTHA 4ZI7A 5JI3E 1OBFO 3CNLA 4J9VA 3W7VA 1OV4A 4WNAA 4KN8A 4M9ZA 5DYGA 2QZ4A 1I14A 1AVTA 2YWRA 3GJQA 3LUAA 3H42B 3KAJA 3NNNA 4FNMA 4LDQA 3UOWA 2QUJA 3CSDA 3NBMA 3W4KA 4YDHB 1ESNA 4LMPA 4U63A 2E4UA 4A7PA 4JLVA 1DO0A 3EZGA 2L82A 4RENA 4HAZA 4A8HA 2VXBA 2HMAA 3FNFA 4N3CA 4UTNA 1RXCA 4ATNA 2AOUB 1MW9X 5DOVA 1D2EA 1GIAA 2H4HA 3GEIA 4XW2A 5GZ6A 1SVNA 2QZJA 4K8RB 4PC3A 4BVAA 4DQXA 4LYAA 3AEUA 3FR8A 2L18A 3S2IA 3SF0A 3C5WP 3TPZA 5KMGB 5BUZA 5EQDA 3AJRA 3LQRA 1TQ8A 3AONB 4NJEB 5HZKA 3Q41A 5H0IA 2I22A 4O4JA 3E9YA 2RB5A 4OAQA 1II8B 1EDEA 3FCEA 4IDDA 3OEHD 2I2WA 2Z4RA 3DE5X 3EZ9A 4NR0A 1CUDA 1CUVA 3SF8A 4W9NC 5ICMA 2X9GA 1HLFA 4FE7A 1GKIA 4GQBA 1YZTA 2ZBDA 2AMFA 2BFBB 3CEJA 4K2HA 3UC5A 4H77A 1W5BA 4ZYWA 2FXIA 2W83A 4ZYUA 5EJAA 1CIJA 1SCQA 3ILVA 3PR3A 5SZIA 5M04A 2DECA 4DNFA 2POQX 2PZFA 3K5WA 4WK6A 5FUXA 3W90A 1PEDA 2VOJA 1IATA 2R6HA 2XTMA 3UO8B 3IEMA 2GCOB 1LTQA 3IUNA 4NAUA 3G9UA 2FFRA 2R7AA 4YYZA 2BFOA 4EMSA 1GUFA 4FZJA 4D98A 1DJLA 8LDHA 3U3XA 4ROTA 3BFVA 1PP4A 3H2YA 4IX1A 4A5OA 1YNOA 4EG0A 5TV2A 4LOHA 3V2HA 1WP4A 5E7QA 2QPOA 2QBYB 4ZAXA 2X13A 1W9MA 4MP3A 3OCCA 4MZXA 5IUKC 2OBFA 2VRCA 3H8JA 3T3NA 3L8ZA 4A0QA 5JJKA 3R7LA 5TQ0A 5EEHA 3SS7X 5A7GA 3VVBA 5CB8A 1WMDA 5A4AA 3RVPA 2DBYA 3K9LA 2QAGB 3GDFA 3B6IA 2O7VA 3RAGA 1YFLA 2P75A 5NLLA 1NZFA 1NPYA 2ZB8A 3HUDA 3PDUA 2FR8A 2WAYA 1PQPA 1N2IA 1RMQA 3E6AA 2W6ID 3BXFA 1RRKA 3N7AA 4TWJA 2I54A 3UENA 3FDZB 4I9HA 4FFLA 1ECGA 4YTEA 3HK2A 5JXWA 1T8TA 4MMXB 5K0EA 3AL3A 4MVJI 2ADMA 3VR6A 2Q0QA 5LDGA 1KFCB 2AJTA 1BH6A 3K4QA 4MUFA 2HJRA 5IF3A 3L77A 4AJOA 1IQUA 2XXAB 1JGTA 1IB6A 1L7BA 5HBGA 3GJZA 4Q1VA 3U7GA 5DASA 1EG2A 2HH9A 2I6SA 3CZMA 1WBJB 2XUIA 2ZIUB 4XDGA 5K6AA 1N3BA 1G17A 3BWCA 4DL9A 9ABPA 1CZNA 2FB9A 2RDMA 1WPQA 3R6GA 1QVWA 3B6KA 4OVKA 2WHYA 4B2YA 1UPTA 2SKCA 2WYVA 3KOWA 2YRFA 4MIEA 4FT4A 2ZWAA 3MQFA 4BWYA 5CA1B 2JBAB 2QMOA 4GLOA 3CLSC 2EEPA 3LLMA 6CHYA 3U31A 2WPDA 1KJYA 5EGNA 2B8WA 2Z0MA 1D2NA 1LDEA 3GO4A 3O7WA 2Q3EA 2PKEA 1WW3A 3HJTA 1YDWA 2AFIA 1QHGA 1V2GA 3QU4A 1ABEA 4O2RA 3EIFA 3QMPA 5CP8A 4GZ6A 1UBRS 1JP7A 1FUUA 1J6UA 1CK4A 1RPJA 1ZD3A 1QV7A 2HDNB 2IEAA 3Q7PA 5FP0A 1HOXA 4OBEA 4M1MA 1CEEA 5FAKA 2QRGA 3QXGA 3KXIA 3PSAA 4A8PA 5BUQA 2Q50A 1ZH0A 4MGYR 1BGWA 3L7IA 4G2TA 2J07A 3WLNA 1U9JA 2YCLA 4G0XA 5CR9A 1BCRA 3AUKA 1UPBA 2JI9A 3L4JA 3WX0A 4RJKA 1H9BA 4YAOA 4YAKA 2BE9A 4O2AA 1YI8A 1SH7A 3EGXA 3I9V6 5JZBA 1WA5A 4YRAA 3NW9A 3R1IA 4PSCA 3L7MA 5FPSA 3KT6A 4UBJA 4NBLA 1EI9A 2R2GA 4LJSA 4N40A 3EVFA 2C5HA 5C7LO 5CU7A 4DUYB 5JXHA 4KNWA 4PLCA 1HEYA 4HNRA 4LRWA 2WSSD 2C88A 3WTBA 3VO1A 4L78A 2JFUA 1XEWY 4QU5A 2H29A 4GRIA 5FTJA 3RC1A 1H6CA 3ZUPA 4AKHA 2IOQA 4RJ2A 3AR4A 1DAMA 1UPXA 2QN3A 4J16A 3AR6A 3FYCA 1CR0A 2ANCA 3ZKWB 3EEQA 3G8YA 1TU4A 2ZI7A 3UBMA 1BCSA 1XX6A 2FMFA 5KX5B 2OA0A 4CIYA 2V7BA 1V8FA 1VLQA 2R1TA 4N5MA 4XFJA 1KBZA 1OGJA 1LLQA 2PV7A 4CMBA 5IJ0B 2UYHA 1U4SA 1VP9A 3HR8A 4H18A 1NDQA 2P6UA 3FNEA 4ISBA 5HF5A 4DLYA 2RHBA 1P4RA 2GYYA 4UMEA 3DOIA 1QIEA 3R3SA 1XN4A 3AYXB 3LW7A 4XWTA 2PZLA 3HJNA 2CDRA 3IX7A 1C14A 3LVQE 1HM5A 2P9ZA 3PD0A 1PJ2A 3RLIA 3RIYA 2IYYA 3GFFA 2YR0A 4DMKA 1DZIA 2NVUB 2DR3A 4BBPA 1O5TA 4DRYA 3QX3A 2X22A 4RNDB 2Q1UA 4ZA2A 5TGTA 3RUAA 3S99A 3VVCA 3C97A 3H9GA 3PZBA 2QYHA 3HB0A 4TS9A 1DAHA 1H8HD 4UEKA 2YHBA 3CXUA 3D02A 4XIYA 4X1IB 1KDZA 4DN6A 1MC1A 4Y2YA 5CVDA 5HIAA 5K0JA 3H1GA 1VMDA 3IP3A 1N3IA 4QUIA 1K6MA 5KSWB 1EK5A 2ZGVA 4MHTA 3CRRA 5IXYA 4QBHA 4CLRA 3UT6A 1Y9DA 4B83A 2CMGA 2IPNA 1UC5B 3E1SA 4OMCA 4JQZA 3LIIA 2RHJA 3BS4A 1NRWA 4MKRA 3HO8A 4BBZA 4EKGA 2HN9A 1JQEA 1GDTA 5LQCA 4NU0A 3NWJA 3B52X 1SUWA 4QJ5A 1IU9A 4M8LA 2HMWA 4KPYA 1EJBA 2ZJOA 1D1QA 3G88A 2HDHA 1YMVA 5ALGA 2JLWA 1BSVA 4PTLA 4BEJA 4RQTA 1V25A 2BFDB 4FI3C 4OLHA 1HFEL 1I3NA 2A5GA 4KXWA 2KBEA 4UASA 5H9WA 5CM9C 5KDOA 1K27A 4LOAA 2H5JA 1EDDA 2PDAA 1NP7A 1ADFA 5EIEA 3OFNA 2H18A 1AQUA 4LK2A 3WP1B 1ADGA 3A3KA 4XUDA 4OX9B 3VKGA 2IWRA 3G0OA 1LU9A 3PA8A 4J4TA 2OCIA 1E4VA 2XUPA 5IKXA 4JXZA 4P7GA 1C9EA 1K4KA 5DX1A 2IP2A 5KTKA 1NW5A 2NZ8A 4OBWA 3VVMA 2ZLBA 2KX7A 2W8BA 1LFAA 1F6DA 1T0BA 1X42A 3A27A 1VE5A 1XQXA 4OO3A 4P4SB 2DFDA 5KHLB 3JAWA 5FPKA 2AJLI 1M1YB 1N7JA 4LHVA 5BWCA 4KMRA 1JYEA 1FFXA 3GFSA 1E1CB 3FFTA 4PLTA 5CNKA 3RJ5A 3BTVA 1XB2A 1R6UA 2ERYA 2ZT8A 3EA4A 1PJ3A 3L7OA 4FPXA 1Q1AA 1MJFA 1RAFA 2J41A 3QKWA 1BS1A 3UG6A 1J0BA 2BIFA 2VDWB 4IG9A 3NHPA 1E1NA 1Z12A 2FJUA 3GRYA 3I9LA 5DK6A 4JA0A 2AN3A 4B46A 2HPHA 3R77A 1EIWA 1R4MA 1GGFA 3PQ2A 2PUJA 1GQOA 3U6BA 3CN9A 3VZQA 2ASEA 3ZBQA 2YNMC 4DJ5X 3FMFA 1Z6AA 4ZVTA 4EDFA 3PUWA 2VNIA 2XTAA 2RJ3A 1W5TA 4NOKA 1XMQB 2OZLB 1ECJA 1ONPA 2I2DA 3AF1A 1GG5A 3CH4B 3HA3A 3SQDA 3KYDA 5I7AA 3VNRA 1W75A 1CEYA 2NPIA 4G0MA 1JA0A 2CUTA 4PGAA 3TOZA 4CDMA 3O8CA 1K7CA 3ANYB 3ETNA 3TL2A 2EZ9A 2YHIB 2FQYA 2M9MA 2C29D 3NDIA 1GA4A 1FRFS 1T2UA 5ICSA 2YMMA 3N8GA 3G85A 4Q4DA 3KSZO 5LP6C 3CQ9A 4DPLA 4EFNA 4KGVA 2WVAA 5KO2A 1QU3A 3N2KA 1XDUA 2EDAA 2HA4A 3AWDA 4H7EA 3FROA 2ZI3A 3ROQA 4C5CA 5LUAA 3ZBPA 5C31A 4O8CA 1UK9A 1LV7A 5CURA 1DLJA 2VRCD 3LCJA 4ECAA 3IDFA 1UJ6A 2C8LA 4M0PA 4EAQA 3BB4A 3GPLA 3DUFA 1GU0A 3LPDA 3KKMA 1N2OA 4QSHA 3RODA 3DE3X 4M0LA 4LJKA 1PZNA 3ROTA 3ND9A 4AJ1A 2REQB 4G26A 1T0PA 5JVDB 2BW0A 2ZJ5A 3EEYA 3F6PA 1F4VA 1PLLA 2X42A 3H99A 2FOIA 4B2IA 2ZPTX 3QUBA 2VJKA 1E9RA 1B0ZA 2HJSA 2JLSA 1QCZA 5IK2A 5TF4A 2JGMA 3L7AA 4V2IA 3WZMA 4DJEC 1F7VA 4Q5IA 3GJXC 4TT8A 2QZPA 3TRJA 3R74A 1QP4A 1YRAA 1SD5A 3RHTA 2ZJYA 3KEFA 3D3WA 4IYJA 2ECPA 3BA1A 4FKBA 3SJUA 1AXGA 3UHAA 4BZXA 2D1TA 2XYPA 2ZJBA 3DR5A 2HA5A 2WIFA 3BWVA 2F6RA 4Y2GA 2ZXFA 5FI3A 2Y2UA 2ZVQX 4X94A 1O0CA 2BGNA 2QT1A 5DW3A 5AW8A 3MW8A 4HHEA 3HWX1 4B48A 4C2TA 3P9QA 3BJRA 3C6ZA 1MDBA 1IHDA 5C1PA 3ICWA 1XLTA 4MS3B 2O14A 4CLOA 3R5XA 1RJ9B 3Q40A 4LCBA 4YLEA 3T9CA 2WR8A 3UK7A 4DV1B 3THXA 3F78A 3MCAA 1SQ5A 2J0VA 2P7HA 2QPLA 1OPXA 2TMDA 1T15A 1BE1A 3IUQA 2HA3A 3T7TA 3WOHA 3GYBA 2N42A 4QOJA 1LDGA 1QYIA 1UDAA 1TQDA 1VG0B 2IELA 2WPDD 2FYTA 2ZBUA 3ONVA 2ASVA 1W5AA 1P5HA 4M7RA 5E6RB 2IX3A 1HF3A 4UVGA 2NSDA 1SIUA 5HFNA 2HMTA 1PR2A 5AVKA 2FN8A 2SKEA 2Q4EA 2ZRCA 3LBAA 2I29A 5CCDA 3JASB 3N0XA 5EYPB 4D4MA 1VJCA 1FXSA 1LF5A 4HGNA 3LY5A 2Y1GA 5DSXA 2JI6A 2VYNA 5C1IA 2ZCJA 1YC5A 4R1SA 2A1UA 1T3HA 1Y1TA 3AW9A 3UJ9A 3WLKX 2NVWA 3JXEA 2ZR8A 4DA4A 5CYGA 4RHXA 4NHEA 1T9DA 1BVYF 4JVLA 4O6VA 5AIAA 3HJUA 4XR4A 6Q21A 5IH7A 3SQMA 2XUQA 4K46A 5C51B 4BE7B 1I3MA 4A0HA 1Z33A 3GFQA 4C0WA 3UK2A 1B00A 3N87A 1MXFA 1K63A 3GGCA 4PZAA 4J1TC 5FEUA 5HXAA 1ZIPA 2XB8A 4JJZA 2DE0X 5I9BA 3FI9A 3SZLA 3UMCA 3COWA 2Y1DA 1NSYA 1SBQA 1VKOA 4KKVA 3N6RA 3AUAA 2PRZA 5CM2Z 5J1SB 3NUQA 4PSAA 5KINB 5E8RA 3TIFA 3UG7A 1QIDA 5F77A 3N59A 3D8RA 2CL0X 4P0TA 4Q1EA 4YRNA 5GVRA 3BTUA 5HPYB 2ZI6A 1JS1X 4GPAA 4GDMA 1FTQA 3A6JA 2ZRIA 4H4DA 4WESA 1UL1X 4GZMA 3OQHA 2C7PA 2J0UA 1JYSA 2L2QA 3C74A 1R0KA 3KEMA 4RHFA 3LY7A 5FUBA 5BW8A 5A9SA 4XLTA 4FR5A 4Z4IA 2RJOA 1TEHA 4EFDA 4GP7A 1KK1A 1V37A 3BOSA 3KPWA 1GRNA 2JJ1A 4B84A 1I32A 3HVIA 4KK3A 1OT5A 1HTWA 2B7BA 1FNBA 1VL1A 2X2EA 5HQ3A 4KREA 3N75A 4UU8A 2X0DA 1TIKA 3J80A 2ET6A 2UKDA 4NOMA 1EE1A 3OF3A 2O05A 1KE1A 4FGLA 2VJPA 1Q7RA 3EF1A 3FZNA 2ZP1A 4FR2A 4TLBA 1EQAA 2P0AA 3EW7A 1EDOA 1FSZA 2V4ZA 4XWKA 5FI0B 1NWCA 3W5IA 5K4AA 1Q16A 3YASA 4LHEA 2GD6A 2O23A 2H1CA 3FNIA 5C46F 2OB2A 4IUDS 1X8LA 2WV7A 3KZMA 1H9AA 4NV3A 1DP4A 2C2XA 1EXNA 4O4LF 4ZT5A 5AHKA 2JEYA 5FORA 3UAGA 3WQHA 3DBLB 4Z2AA 2Q2NA 1QIFA 4PG7A 3PYLA 1U11A 3RS5A 3SR4A 1MRNA 2FAXA 4KUEA 3REOA 1L7QA 4P36A 1FA9A 1E1KA 1R50A 1EE9A 3DNPA 1P7YA 4L74A 3ESAA 4KRGA 3AHEA 4DLVA 5LWHA 1DQSA 3KB6A 3R3ZA 2O8EA 3M4YA 1ZM3A 1DAIA 1DADA 3NDBB 4W82A 1CFZA 1E9FA 1K7XB 1KU6A 1TK3A 1VIMA 3NAGA 2WHPB 2OE2A 1J22A 3QBTA 1AKYA 3E3AA 4OQFA 4WADA 4LI3X 3IBGA 3Q3GE 1E3QA 1LS1A 5A71A 1DRUA 1E2FA 1O96B 1E6WA 1GXSB 2Y27A 3AY3A 3QIAA 4G1MB 5FAXA 2CJWB 1MEEA 3OZVA 4MWSA 4D9NA 5AHRA 3RFFA 5KQLA 4FSHA 4KDCA 5ENDA 1GPMA 4CTMA 1KQNA 3GJ6A 3KR2A 4EBFA 1LJLA 2XW6A 4YX9A 4A0SA 4C07A 3PNYA 4UW9A 2RGRA 3EUFA 1ZI9A 4REOA 1ULBA 3JQEA 1XCPA 3KYBA 3ED5A 2B9VA 4IZIA 3QFTA 3F71A 4AIRA 4ALKA 2ONYA 3T1TA 1D2MA 3ZYCA 1JHVA 4RU1A 2IFTA 2J85A 4MULA 1RWQA 2IQ5A 2FPOA 4DC0A 1XTRA 3M81A 4AUNA 1TPZA 2O3QA 4JUIA 4PX5A 4RK6A 1G7RA 4UAGA 3RUCA 2JH8A 3GGDA 4FWIB 1PSDA 4JLNA 5JC1A 3DEHA 3K70C 1NUTA 3KL4A 1RZRD 2BUBA 3UUFA 3C1TA 1BXRB 1ECLA 4KH0A 4ZOEA 3TW6A 3M4ZA 1EVJA 4BFXA 2O7RA 4NESA 2A5LA 4WIAA 1ISIA 1KGDA 3E3LA 4U7HA 2UZAA 5AVYA 3H1AA 2UYGA 4J7AA 2BGJA 1Q74A 3HB7A 1QHIA 2PYDA 1XHEA 3NOQA 4ZDKA 4U5QA 4BQOA 3BMQB 3ISVA 1F6WA 1U81A 1Z0FA 2AFHB 2O48X 3G0BA 1GL9B 2D8AA 2ZAIA 5B3JA 1Q14A 3AFHA 4M8SA 5ELXA 4ZK2A 2GR9A 1KO5A 1X2BA 3EF0A 2VSQA 1CQIB 4AQDA 3LKDA 4QUBA 5ESRA 4FWTA 4QULA 4C21A 4P86A 4UD6A 4Z8YA 3TTUA 3PXCX 1OZ0A 2G88A 2JAWA 2QUAA 5K8UA 1ZOIA 4DKJA 1NQWA 3R8FA 1ZN2A 2W7TA 4HBZA 4X20B 1JA9A 1RZVA 3PJGA 5TPWB 2G6TA 1NVWQ 3FOBA 2V7QD 2O57A 3LNTA 1Z5GA 4JLUA 4MCAA 1DAOA 1DXHA 3H1BA 5D3ZA 5AKKA 4H6PA 2V59A 4TSRA 4P3NA 4GOND 3NDPA 2VSNA 4GGMX 4N12A 1V4NA 3HBAA 4MUHA 4G5FA 3AVPA 3P9YA 1M5TA 5BN5A 5EWJA 5I8ZA 3M9LA 4EF5A 4DJTA 5BWMA 5LP6B 5JEDA 1NYQA 2V0NA 2Y66A 5IAEA 4WKOA 3TR6A 4N1AA 1C7JA 3IMEA 3V9AA 4BZWA 5AVWA 2UYCA 3HKDB 1UDBA 4MPPA 3RT9A 3CKLA 1VBNA 3CPHA 2B2CA 2GK4A 2JH9A 5DBGA 1NA5A 3HRKA 4N7RA 4COOA 5LNK1 2OHHA 2ZQZA 2OQRA 2P4EA 1V1JA 2OVFA 2HXGA 4LGYA 4BVGA 3LPCA 4TZ6A 1KJNA 1RABA 3TCNA 3ZHRA 2GBFA 4BNWA 3F7OA 4ZT3A 2IHZA 2X8AA 5IK2D 3D3QA 3I28A 4KGXA 2J6BA 1LUAA 1JMKC 1QH8A 1KQGA 1DLIA 1U3WA 2DM6A 1BOFA 3I9FA 4RANA 1IFXA 2VJMB 5IYZB 2GN8A 2MTBA 3FR7A 5JCOC 2R2AA 1FSPA 4LXGA 3FYTA 3DP9A 3NIGB 2Q27A 3LO8A 3W5UA 1M2EA 4DC9A 1ECFA 3IYLW 1SXIA 3D2LA 1TW3A 4M38A 3NVMB 1A1VA 2UXDB 2FX2A 2J3LA 4OIMA 2ZREA 4QJIA 3EFBA 3WFIA 3ZX5A 1M1UA 2XB6A 4RO0A 1HUQA 3JX9A 4UHKA 3GUHA 3D7NA 2QGNA 1V5FA 3QXJA 1CETA 3KJEA 4QGAA 2FRDC 5SV2A 1NE2A 2BUAA 3N7TA 5KIAA 5J2UA 4QTTB 4IAOA 3BJIC 3NB0A 1JF8A 1NQUA 4II3A 2ZPUA 3RWMB 1GCOA 3TDNA 3AF5A 2PVSA 1Z63A 3JQBA 2ZITA 3VNSA 5ALTA 2DLCX 1QS0A 5HNKA 1EFUA 3CINA 5LZ7A 2HU8A 2LGJA 1OFGA 1VKZA 3VTAA 3ZU6A 1AMOA 2P41A 1RWOA 1Y6JA 1WUYA 2VAWA 1IUKA 3BMOB 2RHRA 1URPA 3FDIA 4RDIA 4P4NA 4CE6A 4Q4AB 3L0PA 5BNTA 1UJ5A 1X7WB 3VBEA 1QHHA 2QAJA 1KEEA 5CLLA 3VNVA 1XJQA 1FYVA 1PV1A 2WZBA 1ILWA 3PVCA 4QDTA 3PCXA 2HAEA 3S27A 4B4VA 1RKUA 1Y33E 1VFNA 1XAGA 2BI7A 2EW2A 2VYND 3NBFA 4RPGA 1UT5A 4UDNA 3OCJA 2JGNA 5DP2A 1T8WA 1FRNA 4XCVA 3OT1A 2I65A 4OHZA 2PSFA 3CKMA 1H2FA 4WWHA 4UBKA 5KTPA 5GJCA 1MOPA 3EDQA 4QATA 4QG7A 1Z73A 1AD2A 2CVOA 3STUA 3WYAA 1FFCA 4KWEA 5I9SA 1ZCJA 5IKEA 3Q6MA 4OHMA 1B74A 2VHYA 2WSLA 3EGWA 5FTWA 3KDPA 2WZQA 1FF9A 5AM1A 3K1ZA 5LDHA 2CXXA 4XVRA 1U7OA 3BILA 2X9NA 3IP8A 4CKEA 4G5GA 4O4HB 1NU8A 3SE7A 2GKSA 2VK8A 4EGAA 3G1WA 4QDUA 2DUUA 4NCNA 2BMVA 1C8LA 5KOJB 5HE9A 3ROGA 4DMCA 3SZMA 3CR8A 3MN1A 3DEJA 1P5JA 3RGGA 2NZXA 2WWYA 4NMHA 3TZCA 1YULA 3W05A 4MWZA 1RYDA 4AJ2A 1Z7EA 3C8DA 3NGMA 2V5AA 1CDDA 2R4QA 3FMPB 5ARCA 3MLEA 1XTTA 4QGFA 4L9SA 4WV3A 1AZTA 2O2GA 2OZKA 3ZN2A 4BKUA 3WNQA 2OO5C 1TAGA 3NYWA 1ZOLA 4HS9A 4R8LA 5AJUA 3BZWA 4EMUA 3K71B 1GPNA 2A0KA 1QV6A 5KWVA 1S01A 4E15A 4C22A 5K9ZA 9GPBA 1PKXA 2DXIA 4ZCQA 4C7JA 1XU4A 2CK3A 5FUVA 1NP6A 4BJ3A 4DDUA 3GBSA 3REFA 1ZD9A 1JILA 2F3SA 2WWIA 3BWBA 1I2DA 5JY6A 3FOWA 3LHDA 3SX4A 4E2YA 1GPUA 5DBOA 1KY4A 1XKQA 3B8HA 2GPSA 1KQ3A 1E8DA 4TWRA 1N57A 4DQKA 4DA9A 5KX5F 1LQTA 3JQAA 3K9CA 1X9GA 1Z74A 4JEIA 3V4ZA 1RRGA 2JKZA 4LZJA 1QP7A 4B3MB 3VZRA 4D3XA 1WB6A 1NAHA 4UHDA 4ZXPA 5JFTA 2ECQA 2WSBA 3DAGA 4TMKA 2P2CA 3HC7A 1XQVA 4MV9A 1MV5A 2ZZNA 2XLBA 5EZYF 1Q3TA 3MUEA 3WJ1A 1ACMA 1C3OB 4KQKA 4RTQA 1DTSA 2NTNA 4F6CA 1L7RA 4FCWA 4I5IA 3VPDA 1U0HC 3GI1A 3GT7A 3L5OA 1DEAA 1S3IA 3PNOA 4UU7A 4MKIA 2WF9A 2YYAA 3X3HA 3A3NA 1QO7A 4R31A 1UZMA 1P2BA 2OXRA 3P9PA 3VI3B 2CXSA 1GR0A 3HL4A 4AXBA 2A3NA 1YZFA 2XDYA 2FPUA 3OTQA 3ZC3A 3OCYA 1JZSA 4GZLA 2AWOA 1NJSA 2YWJA 4J0DA 4NG5A 3ZHOA 2QD1A 3GOHA 5I9IA 1WCV1 3SJ7A 5J23A 3KWFA 3QUAA 3L05A 5F7ZA 2V7GA 2FMTA 4NOJA 1ZKDA 2CNLA 4CM3A 4DQDA 2BISA 4OMUA 3W2EA 2QSUA 3HYSA 5BSEA 1B8VA 5J2TB 2E1PA 4IILA 1U5BB 2FSHA 4ND8B 5IT9A 5ADWA 1RRCA 3OMLA 1PK9A 4ZICA 1CUZA 1GUYA 2I55A 1JR6A 4DSAA 2ZQ5A 5HIJA 2GD1O 2YXEA 5C53B 1IXSB 4NAVA 3Q8LA 2JDIA 4IPTA 1BDIA 3HY4A 2IOFK 3FPCA 5MFZA 1MU0A 2Y1FA 2BLNA 2WIDA 1I8TA 4MRNA 5JY1A 3S68A 3UBTA 1ISMA 4U7FA 1E7QA 2YIMA 3FYUB 3G2PA 2QK4A 4J0HA 4JJEA 5A02A 5AXDA 1KL7A 1H5UA 1BFDA 1UWVA 1N2XA 1RXVA 1Z25A 3DL4A 4OQ4A 4BO4A 4B44A 3EDMA 3JQ6A 3QEMA 4DSUA 3P5SA 3ZVLA 4GMFA 4HQRA 4K88A 5HP4A 4RETA 3DBHA 2WD7B 4YRTA 3K9HA 2M2IA 4P5DA 4QC2A 1LWNA 1EXMA 4GM1A 3UMMA 3V1TC 1BXGA 2F8MA 4FILA 1VI6A 2V7EA 3HCAA 1G18A 1ZBDA 2G80A 2H0AA 1VI2A 4PQYA 3IBFA 2P6PA 3SQLA 2G25A 4B85A 5JYCA 5LU8A 3GG2A 2ZJAA 2OBMA 4LECA 4OL0A 4EUSA 1TT7A 3LTEA 1TD9A 4JELA 2I7DA 1OXBB 3I04M 3PC6A 4NNOA 3C16C 4LRQA 1MFPA 3GNTA 1EJ2A 5DULA 4M8IA 4FYWA 3RUHA 4JLPA 5JSYA 3SM9A 3J81A 3E53A 3JZIA 2O5CA 1F51E 1M33A 1R15A 1S89A 2I2FA 2CE7A 3QFSA 4BNJA 4N48A 4DS3A 1ATZA 2ZR9A 3EG9B 4EQ6B 3F0TA 1HSOA 2FR1A 4OHVA 1DV2A 3ZE6A 3EGDB 4OHUA 3F5SA 3FSGA 4G86A 2WM2A 1N5LA 3PEWA 3GBVA 2V9PA 3I01A 3O3OB 4YCJA 3RM3A 4F85A 1DU4A 3CB4A 4FXPA 2UZ4A 1NJ1A 2Z8XA 3JQ8B 5CK5A 1DEXA 1T1GA 3IUJA 3LQYA 3NWPA 4Q1CA 4EARA 5IUNC 4GHWA 5DYNA 3F97A 2OFFA 3D6FA 4TKMA 5LN1A 3UC9A 4AW9A 2J59A 3OWHA 1UANA 1PD1A 2ZS9A 2G71A 4AMVA 1MAVA 5F98A 4HAUA 2WYOA 5E95A 1PW7A 3AHDA 4W8OA 4BGUA 2IE0A 1GPLA 2AQIA 4TRMA 3V32A 2EQBA 4RZUA 3FWNA 3T3EA 5JVDF 1HETA 4RVOA 1T1IA 1Z83A 4FIDA 5ENZA 2W5UA 2ZSIA 4MJLA 4V0KA 2GJ9A 2Q3HA 4F72A 1SAYA 2QV7A 2DPGA 1N75A 3BCUA 5J40A 2QDKA 4F5DA 4Z1MA 4CG2A 1VRVA 1NYLA 3IAUA 5C8DA 3MM4A 1GG8A 1T36A 3WGUA 4F5ZA 5A5GA 2N3ZA 2OILA 1PL8A 1NXVA 5CAEB 2C00A 2AC2A 1KEWA 1PK7A 1QVZA 4DXHA 2FSGA 5E7IA 1NURA 2ZJFA 3TNYA 2R5WA 3I3OA 5HSGA 1AGNA 2QS9A 5H5JA 3LXXA 3VHLB 1YCHA 5E3IA 5KYYB 2O8BA 1LRKA 4BKQA 1S7CA 3JV7A 5U4XA 1PR6A 1USKA 2RGWA 2IW3A 4XRRA 1KZ7B 2WYHA 2VP4A 3CJQA 1GNVA 1WZIA 2OV6A 3HYTA 4E33A 1GQ2A 4FYJA 4EFMA 5I4IA 1ZOOA 4F04A 1LWOA 4MJXA 2XUJA 5EE0A 3FCUB 1T5DX 2C78A 3S8MA 6GPBA 2VQ3A 1M2VA 4PYIA 1DFIA 2C9ZA 3CIOA 5AI4A 2BBTA 1OX4A 2GAOA 2XGGA 3C1OA 2W0MA 3EXIA 3HVKA 3KHSA 1K5PA 2ZT5A 4HDSB 1QGYA 1JG2A 2ETVA 4ZYLA 3I2YX 1QWOA 4IWNA 5FIUA 1YR2A 5CB4B 1VPWA 1GUZA 4TVSA 1VPLA 3NOOA 3A4VA 1ZH8A 1X9HA 4IGIA 1TAHA 4BX0A 1Z08A 3U4IA 2WYUA 1Q84A 3PPIA 4MWGA 3EWAA 2D5LA 2N47A 1C7FA 1QFSA 3NANA 1YDGA 1Q50A 4ZOCA 3VGJA 2Q8NA 4BLUA 1T3GA 1I2ZA 2B8NA 3O9ZA 4UE6A 3U4QA 3KOMA 3GLHE 3MMZA 1AQIA 2HWXA 3RYIB 1D0IA 4LOJA 3DULA 1ONBA 3FJ1A 5HQTA 1T3LA 4FOOA 2X0EA 1VRWA 1EZ4A 2EBWA 4XWGA 1JAHA 3LYLA 3NHSA 4GXQA 1G59A 4B6OA 1Z34A 4P3XA 1YS4A 1QK4A 4DG9A 2H2GA 3ZWQA 2VEDA 4FE3A 5JSZA 4QOIA 1PG0A 4EYEA 4HFRA 4GL2A 4UBLA 3IB6A 1EUDA 4UEQA 1EVKA 2HLNA 2CK3D 1XZJA 2IUFA 3HGTA 4F93B 2BGGA 1SU4A 2BFMA 4ENWA 2XWPA 1RHMA 4CEJB 4QT0A 1SCIA 4BV9A 5C35A 2GN6A 3BAFA 4PGHA 3PC7A 2ZWMA 2YFYA 2O2HA 4M8KA 5DGXA 5CDYA 3TE7A 3JQAD 1RAGA 4N3AA 3K1JA 2J3JA 2AF3C 1F60A 3DZ8A 2GO1A 1EX6A 5HQJA 3GLTA 4RWEA 5G02A 4D6PA 3WLPA 2GHTA 2H85A 2QP3A 4O1IA 4ZCRA 1VL6A 3EVTA 4EO9A 3AR7A 3U3KA 5LKAA 1KTIA 5F2EA 1XWWA 5JNTA 3CX4A 2F90A 4QA9A 3WFJA 2PS3A 1HDZA 3PYXA 4NCAA 4YJHB 1PR5A 3KD3A 3HU3A 2FLKA 1FTYA 2BKEA 4HUJA 4OQMA 4WZAB 2G76A 4G89A 3WRXC 3ZD6A 1IONA 2VL7A 5CUQA 3P4UA 5CXXA 1XG5A 5TVKA 1KU0A 2ATXA 1M2HA 3T6KA 5CEJA 1B1CA 1AMUA 3CM0A 1ZUNB 5ITWA 1H2RS 3VOBA 3LT5A 1WCXA 1ZK4A 2IXBA 1Y89A 3MGAA 3K0CC 5JASA 2AGVA 2P30A 4DGSA 2OLEA 3IKVA 4QNRA 2WD8A 3H0KA 2ID8A 3K1YA 5H9VA 1YJCA 4WNIA 4J6EA 2DFPA 4N49A 2F9MA 3I2JA 2O2IA 3IBSA 5I7SA 2TRSB 2IU4A 1R0SA 1KF0A 1QLJA 3IR5A 3W2FA 3E22B 1G55A 3GJ5A 421PA 4P58A 1B73A 4JENA 1D2AA 2I6TA 3Q9SA 1TT5B 1C7ZA 2PY6A 3E03A 4WBXC 2J3EA 5BO5A 3U17A 4BLWA 1SXQA 1EFLA 5TNXA 2QUZA 2ZUDA 3NTRA 3PE3A 2JDID 3Q15C 2PZJA 4Q48A 2HHJA 3TXYA 1E6EA 1X80A 4XCQA 1KVQA 1L7MA 3EUWA 2DFKB 3BK2A 4RHCA 3U4CA 3KJIA 5KU7A 2YW9A 1CUJA 3AB7A 2VWQA 4FWBA 2WU0A 3QELB 3LPMA 3BB3A 3NBKA 2XDAA 4BU0A 2H8GA 3LTNC 4YK7A 1V4VA 3TZ6A 2N1MA 5K5EA 1B3BA 2DB3A 4IIBA 1CT9A 1T29A 1H4TA 2F4NA 4UTRA 5J63A 4UM5A 4I3HA 1OOEA 3EQ2A 2VCEA 3M1LA 4KR7A 1N78A 2VHQA 1R8QA 2PZKA 5DI3B 4MRMB 3OZSA 3SVZA 1Y8ZA 3MA0A 1YZLA 2VZ9A 1ZEJA 2JGFA 2AW3A 4Y1RA 4YASA 4D5GA 4OSEA 3SZUA 3W4JA 5L7YA 4D0NA 4LV5B 5A4DA 2QKYA 4BLRA 2QTLA 1DJNA 1AKMA 2BSAA 1P1JA 3CSSA 3VYTB 1DOHA 4KXNA 4NBUA 1U7WA 4PSKA 4OBXA 5K3EA 2CC2A 2JEOA 3RTGA 2RGYA 2Q46A 5D5QA 2CHVA 3NTLA 3HDYA 3LS2A 5T64A 3RU3A 1HYHA 4U2CA 1TLFA 1RVV1 1JAIA 1K9SA 1LVGA 3PRYA 3T1VA 1XZBA 3ONNA 5ERYA 3AL0C 4YP1A 1Q7BA 1JVBA 4NNJA 5DTJA 3I5XA 2LW7A 4QOFA 1MO2A 3FLBA 2OPBA 4HXYA 4PCUA 3LQQA 1WF3A 4IZ6A 4NE2A 2F1JA 3OBIA 1CQWA 4G4SO 1JEJA 5EJ5A 1M34E 4MZDA 1SPBS 3NS7A 3OD5A 4UTXA 3FSGD 1SHKA 4WOKA 4HB2A 5AO9A 4DOMA 2O2XA 2ZBRA 2E0IA 4XWOA 1VLZA 3L8DA 1GRCA 2OXEA 1KS9A 3NVDA 2R00A 1T4MA 2FE1A 2WK1A 3A4NA 4KQFA 2QAIA 3MTGA 4ZOQI 4DE5A 1R9GA 4ZOAA 2Q6KA 1PS8A 5C1BA 2G82A 1IM5A 1Q11A 1YDMA 4JSYA 2QNRA 6REQA 1F2UA 2VBFA 3NCHA 2HSGA 1U2TA 5M7EA 2OD7A 2H1HA 4GEGA 4B0OA 3RH0A 4P32A 1C2TA 2A33A 3KRTA 3X2SA 1ZO8A 3BE5A 4TTPA 5BN1A 1W34A 4CVNA 1LSUA 1NG1A 3MOGA 3HO6A 3H9CA 4IDHA 4RVHA 2HNAA 4BJ1A 3Q2IA 4KFTA 3E9RA 1AHIA 1IN7A 1X87A 4IL5A 4F1JA 4Z7JA 1SCKA 2A8YA 5KYXB 1B0AA 1G41A 3VPCA 4XIJA 2HV8A 3JQ9A 4Z1MD 4UU0A 1YBHA 5BVGB 1UZUA 2E2WA 3Q0EA 5CDTA 5CPBA 1RWPA 3IEUA 3W5AA 1K0FA 2GZSA 5GIPE 1JI0A 2Q9CA 2XT0A 3DPUA 5MF6A 1M5UA 3ZGOA 1VBMA 1XMIA 5CJPA 1AM4D 2I99A 2NO5A 2ZRNA 1U9CA 4PTZA 4WCFC 1FJHA 4OYYA 2ZRPA 1YFZA 5DGDA 5CFNA 5L3QB 2QVCA 3HXTA 4HG2A 3QHAA 2IS4A 4NPAA 1DPGA 1FQKA 1EMDA 2ZTLA 2C2HA 3HDTA 1CP3A 4C7VA 1DRKA 1E9AA 2AF4C 1J06A 1AKRA 2CXPA 2X2FA 5FTKA 1N7GA 3K0AB 1LNQA 2PGOA 5GWXA 1ST3A 5EESA 4AD8A 1IG3A 1RLJA 5CA0A 4RE6A 1SKQA 1GNTA 1ECPA 1NXXA 4PO1A 3MJVA 1RI5A 1RC0A 3H75A 4FONA 2LNDA 5AOCA 2NQ8A 4IH1A 3FGOA 4S35A 3C7KA 3TRHA 1GZ3A 1S9DA 1TYEB 1ULUA 1XU9A 2O0KA 3HZOA 4TV8B 4TPKA 1GUAA 4Y1GA 1U04A 2ECOA 5I7FA 3ROEA 4WW0A 3BHIA 3U7FB 3OOHA 4KBGA 4GI3A 2WKRA 4LDNA 3QEAZ 3TLCA 4LEIA 1AS2A 4TKVB 3VJMA 3DLTA 1I3LA 1H1LA 2Z04A 1T3SA 2NADA 3GAMA 4XLZA 2XCLA 3VO2A 4Z4EA 2WIJA 4BE4A 3Q3EA 4NDAA 2DWOA 4YN3A 2OD2A 1SVOA 2DBQA 2VQSA 3UTCA 1E7YA 1EP1B 2PGAA 4LV6A 1Z9BA 4QZVA 2PKYX 1C7RA 3LLSA 4BO3A 1W9HA 3EXHA 5AR1A 1Y0BA 1ENYA 3G13A 3N05A 2WVJA 1JEQB 5A4JA 1GTRA 2ZRQA 1ZCFA 1A7AA 2XUOA 2FEKA 1IB0A 4NBTA 2GRUA 5LOVB 4M1OA 4HMQA 3WGOA 5FNVA 2YV1A 2OUKA 3O74A 1N5IA 4O4HF 4RK1A 3BDIA 1NV8A 2FR0A 1T9BA 5LR6A 1GSHA 5C34B 2A0YA 3IA2A 5AJXA 2OFWA 1SCUA 2VXYA 1D2CA 1PT5A 2Z95A 4TKUA 4C4AA 1J5XA 3ZXSA 5BY2A 1PWEA 1P2TA 3N8IA 3AU8A 1XJ5A 1E1QA 4H4EA 3K6SA 2R1ZA 1GYPA 2W6NA 3KB2A 4L1KA 3ROFA 1IJEA 2NO7A 2BCEA 2HJHA 2Q5CA 3ORQA 1TMGE 3K2IA 3E18A 3ZE9A 1RLOA 4WBNB 2VRNA 5FADA 3BD8A 1RAHA 5DBFA 1V6CA 2Y68A 1GKLA 1MKYA 2QG4A 2XH8A 4JITA 2XB9A 3MILA 4YYEA 1TTPB 5JEEA 1SU6A 4DWVA 4EQZA 3GFVA 4LZWA 4O4IB 5LA6B 4H35A 4BC1A 4MR8A 3LGAA 4IUYA 4GAEA 1RYNA 1FPMA 2GPTA 4D79A 3IQIX 3CZPA 2YZGA 3KL2A 3RCBA 1D07A 1DMSA 1NI4B 3OO1A 3WWYA 2X7HA 1MX5A 1H2ZA 3GJ3A 5E2AA 3OUTA 2CMDA 2GAJA 3MGGA 2V6MA 5HKLA 3N0TA 2ZRBA 3KUUA 4ZCLA 4M0FA 1V39A 2A0XA 3GIWA 2AEJA 4XEHA 1YOVB 3EBPA 4YY3B 4UCWA 3TAUA 2WM3A 1V1MB 4KLZA 5F5NA 4YCCA 4D99A 1JQ5A 3W8RA 4C6TA 1WUKS 1MC4A 2I76A 4LBWA 4Q00A 4WDQA 4BTEA 2FMHA 4C0HA 5BN3B 3VV3A 4EUKA 4ECEA 1X1TA 2RI1A 1YXMA 3DEIA 4TYNA 1WABA 1FB5A 4TMFA 3L9XA 3UJBA 3DMFA 3Q3CA 2DETA 4UHBA 2A9VA 1Z2EA 1TE2A 3CA8A 2IKSA 5F2KA 1QRRA 1DUSA 1QK5A 3OPYA 4C1BA 1RRPA 1UP4A 1WLYA 2FWBA 2VZLA 2ZAYA 4NV1A 4MQLA 3VOTA 4BJ6A 5B2EA 3KTAB 3P97A 1Z4OA 3RKUA 5E1DA 4UEJA 5FDFA 2XMCA 1C1DB 2WFZA 2XE6A 4HTAA 3OU6A 4AN4A 3ICOA 3QNMA 4FDTA 5SY6A 2H9IA 1E89A 3F2IA 3CLKA 1VE6A 3UJ3X 4EHIA 2CFRA 3M9WA 4HAIA 1YA8A 2HHLA 3DNMA 3I83A 4OYRA 4GEKA 4WOJA 2CL5A 4DTIA 3HM2A 4X61A 4B6JA 5AVUA 4TGLA 5B4TA 4A6DA 1KMCA 5JBIA 3QUCA 3QOWA 1EDBA 2VH2A 3CUTA 4OTZA 5A05A 1L4LA 1VHDA 2OG2A 4LF7B 1IUOA 3SPXA 3SN6A 3NT4A 4TQGA 3ZKAA 3KDSE 4UARA 4M9UA 5EFOA 3BXZA 4WK0B 2I67A 1BD4A 3OUUA 4MWCA 3UW3A 4TN5A 3CX8A 4I81A 2RG1A 2SKDA 1MOQA 3PT5A 4RXTA 4LNAA 4FLEA 5AI0A 3ZCQA 2PX4A 4KVFA 5DM1A 2WJHA 1F0PA 4YAGA 1ISPA 5DLEA 1WPXA 3L4BC 1P3DA 1DX6A 2I6UA 5C8YA 3U1BA 1HT0A 3NVAA 5I3CA 1YBFA 1HDXA 3ICPA 5F2OA 3MIIA 3KQYA 4DZRA 4G5QA 3FD8A 4RTJA 4DLXA 2J6IA 4Z0PA 2F9LA 1E63A 2H2AA 1NQOA 2MR6A 3TWOA 1IBRA 4C0SA 2DEUA 1CJUC 3FNGA 5GINE 4KXXA 1XDSA 4FEGA 3Q2OA 3V1LA 1IEVA 4RF5A 1KDTA 1HV8A 1NVXQ 1EEHA 4G8DA 3IUBA 4HPWA 1F1JA 4E5YA 2I71A 3C41J 4YI5A 1N2CE 4B4UA 2BDUA 1E4EA 1YF3A 4RS3A 2P9QA 1LNSA 1EAMA 4MI1A 1IZ7A 4XEUA 4BJ5A 3AF4A 5JWHA 4FC6A 2X0FA 1Q6ZA 3NC1C 1L5HB 1DQPA 1A2BA 1V6SA 3UH1A 1E0AA 4M0CA 3KVVA 5DRYA 1RTTA 2GMWA 4F3CA 1SC9A 4PQRA 4ITVA 4DV6B 3EOBI 2OWEA 3JQQA 4S1NA 3ESXA 5D7BA 4U2DA 3BFXA 4RFVA 2RIPA 2W42A 1VM6A 3GLVA 3M5WA 2ES4A 2F64A 5JAMA 1LZKA 3V80A 4BIIA 1P9LA 1EFPB 1F8FA 2JCSA 3PFCA 1QQ5A 1K2WA 2FZGA 2RGCA 1E7RA 2OXFA 2UYYA 1MNAA 2GM9A 2WIGA 2OGUA 1XDGA 1SULA 2Z8YM 3QVXA 4GE0A 1ZVKA 3TMKA 4KAFA 4LE0A 2HGSA 5DCUA 4D0GA 1AKTA 1TJ5A 3PXUA 4XPIA 3RRJA 3TZEA 4P0QB 2VI5A 1YS7A 2P4HX 4HKTA 5T67A 3VM6A 4ID3A 1TU0A 2QLBA 2PMBA 1A7JA 5JS6A 4JJ8A 4JI0B 1NSFA 1RBYA 2HWYA 3DDCA 3I2KA 2ONJA 1ZRHA 3EY9A 4BVJA 2JAUA 1H3FA 2HBZA 3PWSA 5L40A 1BKYA 3UF0A 2R65A 4CU2A 1POWA 4ANFA 1B6GA 4GKVA 3BRSA 3IT2A 3QNWA 4QUHA 4RD2A 5FD8A 1CSEE 1NW7A 1V47A 2ZJ8A 3GLHA 4P34A 4HDOB 5A6SA 3HUFA 4JC5A 1XO1A 3R0JA 4YV7A 1GV0A 1J42A 5H82A 4ZALA 1Q95A 2LTAA 2RGXA 3VTKA 4X3PA 2YXPX 3DA8A 3LOPA 5IAGA 3TS1A 1NTOA 4NU8X 2NPFA 1OH8A 4Y6GB 1OCEA 1P8JA 1DC6A 5BSUA 1V5EA 3CLTC 1XYVA 1AQNA 2QUIA 4CCAA 3CLRD 3E7WA 1C9JA 3HCDA 4W9NA 5CEEA 2AG0A 2XWQA 2IH2A 1KAEA 1A96A 3PDJA 2ZRDA 3ANNA 2D4HA 3GPIA 2XRFA 2H7XA 5JCXA 3JZFA 1VFPA 3QF7A 4BMCA 1KETA 1C9MA 3B1KA 2H57A 1PDOA 3DE1X 1MGOA 3MFYA 1R6BX 1OXVA 3O9VA 4KYUA 3SLKA 1OH5A 3ED1A 2V97A 3M4JA 1NLUA 1CUBA 2I0FA 4FK8A 3SY8A 3Q9LA 5K4HA 4UVDA 1ZHFA 3HU1A 4AURA 4RPJA 5IW8A 5CB4F 1VE3A 1XWIA 2GF2A 3K2QA 2V55B 4PM4A 4X60A 3SKYA 3U62A 1G20B 2B4TO 4HPJB 4UTOA 3H7IA 4RA9B 1NLMA 4HXFB 4QUJA 1FFSA 1NVFA 2FX3A 2IZ1A 1GYRA 1SRRA 3R5FA 4ILKA 4D9FA 4PN7A 4MGKR 2F3RA 3WMFA 4EL5A 1JTEA 2CNDA 1ADCA 4UQOA 4CKZA 4AWAA 1E1QD 4MDHA 1U0NA 1OFUA 4IGAA 4MYDA 4C7MA 1F17A 2CYCA 2GZHA 2H07A 5ERGB 4C3OB 1HDGO 4A23A 2D2IA 1TKRA 2PT5A 2ZSHA 5L3ZA 4DJDC 1GJRA 2QLNA 4RDXA 2R3SA 2V54A 5JTUA 2PZBA 1A98A 5ESXA 5I9MA 3UN1A 5DXJA 3IVAA 3N74A 1K8YB 4HPXB 3ZU5A 4CF6A 1MAWA 2XXBA 5ICEA 2BKUA 1MQ8B 2XIJA 1QKJA 2XVXA 3LYAA 4CI0B 3ZVRA 1GCAA 2B98A 4TL8A 2QTHA 5D85A 4ETIA 1SIOA 1GFIA 1V35A 1VLLA 1UDCA 2LKDA 4UJ5A 4JIGA 4ZAVA 1DJMA 4XM1A 1J99A 2PLFA 2QMEA 1QB7A 4YMGA 2FQ1A 3V4FA 2QNIA 2J9FB 1R0CA 2IRWA 3B7PA 1D2HA 4RORA 2OBLA 2PUVA 4EG5A 2HDOA 1ACLA 1OLXB 3A6HA 5JO9A 1UBKS 3DFMA 3TOSA 4H1TA 3LUKA 2OFPA 2PZ8A 3H3FA 4DCJA 2WA1A 4PC1A 4TXNA 3SF8B 4B6GA 3G2OA 1YQEA 2XNDA 3KHTA 3FPSA 1N1DA 2HT6A 1FBNA 2KB0A 2NQ2C 4PG4A 1DCMA 2BMEA 2C5LA 2C3PA 3RADC 2I3BA 1DCTA 1I33A 3ANMA 3QVJA 2G77B 2PL5A 1EYZA 2IT1A 4HI0E 4U3JA 2G9NA 5BMVF 1F3OA 3DGFC 1OYWA 1T5HX 4CMKA 2O1EA 1G3RA 3OJEA 4X92A 4L76A 1N5JA 3VDQA 3CRNA 2FZWA 4YUYA 1EM8A 2DFLA 3P7MA 1ZDMA 4LRTB 4NNPA 1HE8B 2ESRA 4JUDX 4P08A 3R7AA 4C7KA 5FNZA 5K0LA 3N7UA 1OH6A 4TS4A 4UDOA 3T3MB 3SS9X 5EKXA 2I1WA 3LRTA 5FBQB 3UWPA 4EKIA 2VNHA 5IAAA 2GN9A 2QRKA 1PG2A 2BSQA 4OYLA 4BUCA 2H08A 2COEA 2JNWA 1VDZA 5LBTA 1HLPA 1SVLA 4IIJA 5F1KA 4IFTA 4FZ3A 4ARAA 1ISRA 2PRKA 4B3GA 3TVYA 3NAQA 1XGKA 1VMKA 4NATA 5TQ0B 4F96A 3FCOA 2GERA 1FVFA 5MDHA 1HDCA 4K28A 4LJAA 4RA6B 1M34A 1NJGA 2I78A 2PO5A 1XNHA 2VUTA 3DAHA 3ITKA 4BMZA 3O5AA 1Y9JA 5DNAA 3RIGA 4WLUA 3VV2A 2VK1A 3O03A 1NNSA 4N6GA 3GDOA 5K3FA 4V0ME 2IYWA 1YU9A 2H2HA 2J46A 3H2HA 4KGDA 4HFJA 2OV1A 3L7YA 2ZYHA 3MWEA 4WXEA 3VPGA 1RAIA 4BQEA 2JVKA 4FTWA 2Y0CA 3M89A 5IZCC 2XGJA 3F6EX 1GT91 2XZTA 3GB9A 4WMLA 1DJQA 1Z8DA 1U9ZA 1RSZA 3A9VA 5IKMA 3LDGA 5LZ2A 3KT0A 2OHFA 2QRVB 5JG7A 3M4XA 1N6NA 1C41A 1QC5A 3HFGA 7MDHA 1ML4A 3HXLA 4I1UA 4YP0A 1Z2NX 1VJRA 2JAOA 2O1WA 1WUJS 1H22A 2BKXA 5IVPA 1APBA 5EXPA 2XA2A 4N41A 3P0FA 3DDUA 3WIUA 2BJHA 1KI3A 2DPYA 4MCJA 5DNVA 2V4UA 3ZGYA 1RE0A 3TQOA 3CPSA 4EF6A 5B6IA 3OFJA 2NSYA 1JFSA 1W1UA 2P11A 3OM9A 2Y6VA 4F3KA 1KIMA 2MOKA 3D6JA 3MUFA 4OMFG 1VL0A 1TRKA 4X9XA 3OQMA 4AKGA 4QM7A 1I0ZA 3S2UA 3BL5A 1D1TA 1EHCA 2IEIA 1ZJ6A 1ZWLA 1ZY2A 2FUG1 3H5RA 3OH8A 4CF5A 5CCBA 4PSVA 3KPUA 4GP6A 1IPFA 3QLVC 4QECA 2PA0A 5GAJA 1SD1A 4RK7A 4BP1A 1Z6GA 4BEWA 4ZO6A 3WGTA 2JL1A 3UJ7A 4UTPA 4IVRA 4L6IA 2MT9A 3MHPA 4FT2A 4NECA 4AFNA 5FWYA 1H05A 1IY2A 4Q4CA 1R6AA 4P4LA 5H70A 1EK2A 4X45A 4C6SA 1V2HE 2IIVA 4CU5A 1BWPA 3A9CA 1CZLA 4MLZA 2WE7A 1BCRB 1PGPA 4WHMA 2NTYC 4L4ZA 5DYTA 1TGYA 1AKNA 4H7HA 2W90A 4OKNA 1HDIA 1NY6A 1COZA 1UJ4A 4WAUA 3EGXB 2P77A 2IBTA 4H7JA 2Y2VA 4LJ5A 2VEOA 4WASA 2PLRA 4US0R 3AI3A 5BYJA 2NMVA 2P9YA 2PL3A 1R9NA 2IOFA 4LY0A 4MA5A 4ZO9A 3KBBA 3VJKA 3B2NA 2ZUBA 4C4XA 1M76A 4TRNA 2HJ9A 4NYIR 2JRCA 1BDBA 2B21A 1RPTA 2HD4A 3SC6A 4EIWA 1VKJA 4FHDA 1NNI1 2Q99A 3CX6A 4LYFA 2QU8A 1OTHA 4KLNA 4NYIQ 3GLUA 5JRDS 1C1XB 2B6NA 2VP9A 4CN9A 1NJ6A 2BGLA 4JYMA 5HJ7A 2HIMA 2HHCA 3L1IA 4N65A 3VR0A 5KJ6A 1KJQA 1QQAA 1XJCA 1IJFA 4FFBA 3SMVA 1L8AA 4K03A 1VHLA 4V3BA 5DYYA 5CH3A 1HDOA 2R1TB 1I9GA 1SVMA 5JANA 3QKTA 3A1UA 1KOFA 4EJ2A 4MAMA 4ABTA 2C2BA 2AMYA 4Y9SA 1PJBA 1LXCA 4X41A 1PFGA 3FMIA 3GLFE 3H18A 3UGTA 1E3MA 1NIPA 1OIWA 4WY8A 2ZRLA 1RJDA 4N8SA 3SYKA 5KQRA 2XI4A 4HDRA 3OZUA 3NDRA 3IAAA 4A8JA 5C81A 1NPDA 1QHFA 3FBTA 3NGXA 4TSFD 4M53A 1E77A 1FYXA 1JXOA 2YNMA 4ZVRA 4KXQA 4L0MA 1JJBA 4MDYA 1HYBA 1PUIA 1RWWA 2YASA 2QMHA 5HVNA 2G9UA 2OAEA 5CVJA 5EMJA 1VBKA 3SQOA 1Z3IX 4L8GA 1B16A 4V0OA 1XELA 4TWZA 1M0EA 4TVKA 3KZ1E 1KFBB 3TN7A 2PRJA 1RQPA 1EHIA 2RKWA 4FP9A 3CVWA 2NU8A 2B5WA 2PGLA 2VAPA 4H15A 5EIOA 2R0QC 3N0WA 2L19A 3AIMA 4N6NA 4RIHA 2RK4A 2XZLA 4EB6B 4IZOA 4ZJUA 5LP6A 1IY9A 5LDDC 1ZK0A 3JQ7A 4LFAB 2FJ0A 2H48A 2ONKA 3PGJA 4TV8F 1BE6A 3SIWA 2PGXA 1JKMA 2LBPA 2GTPA 3ETLA 1NP3A 4OFWA 1WXFA 3LAWA 1E62A 2EYQA 3K8OE 3PWTA 4JBLA 3ZD9A 4X44A 4Y2PA 2R87A 3LPNA 3VKHA 3L6BA 4QNMA 1G0OA 1GP2A 4C6RA 4QDZA 2QTBA 1Y9EA 3OZCA 1XLUA 2PAFA 3DBIA 2ZYAA 2D5AA 4JS0A 4N3GA 1JZQA 4RD3A 2XSZA 3C14C 2RKOA 5EP3A 3ET4A 3SFZA 4D9GA 5K3OA 5H68A 2VSXA 2WYIA 4D56A 5GTDA 4Q12A 1H3NA 4JU8A 2I1LA 2REOA 1H23A 4K1LA 4N0DA 1XVLA 2R5NA 1P80A 2E5FA 1ATIA 1H2AS 4AJEA 1VA5A 4U39A 1U3CA 2FWNA 2VCHA 1GG9A 1GPAA 4PSDA 5LOVF 1F2TA 4OHRA 1XVVA 3BWYA 1BVRA 2GKOA 3GZTB 5TPZA 1ENOA 2E4WA 2LR0A 2H51A 3AH8A 1ORVA 5DW0A 3DOCA 3JAWB 3Q2KA 3HN2A 4CR8A 3D8UA 2PIAA 2Z98A 4LKRA 2FW9A 3E2IA 3OD1A 5G1OA 1FFXB 3UT0A 2PLAA 5BV8A 5EHXA 2ISCA 1IBLB 3ONEA 2VHEA 1WW8A 4A92A 4R71A 5JFGA 3NLLA 4IM7A 4DIOA 1BAPA 1Q1BA 1D7OA 2WICA 4NFYA 3FI0A 3MWKA 4G9EA 3QEBZ 3CLSD 4BNIA 3ZXUB 2XNDD 4WBNF 3WLIA 2J0SA 3KYCA 1GZ4A 1FTSA 3AJ8A 4ZQGA 4BNGA 2XQIA 4G41A 3NM4A 2R6DA 2VUSA 4LX8A 1NVVR 4RY9A 1ZJ5A 3W6OA 4RV9A 5JWRA 1G42A 4O4IF 3SCZA 5BQFA 1WXQA 4URXR 2AOTA 3OZAA 4IJ5A 4BQNA 4B2PA 1H5NA 1O97C 1NVVQ 4K0KB 2LZ0A 3A28A 4HGOA 3NPAA 2O3RA 1PAUA 4I1OA 3AI1A 4OGWA 1UUFA 3D4PA 1HQDA 2DPMA 4EVRA 4ZZ0A 3MHTA 2GLUA 3QWFA 3FMVA 1SQ0A 1ZONA 1GG2A 2AYYA 3G8CA 3HCWA 3WLFA 3F8SA 4HEQA 3U09A 3FSEA 1PW5A 5DX8A 3T4PA 2MWMA 1QFYA 4LRYA 1EK6A 2VVTA 1QP0A 3T1HB 2ZM5A 2HU2A 1GQFA 2R1VB 3AOGA 3H11B 2P67A 2VJCA 1WJGA 3JYHA 1CY0A 3ILHA 3DB1A 1W5SA 3UAOA 4B6SA 4DSOA 4B4KA 3DUFB 1RKXA 3D4NA 4M6WA 2VP6A 5IVDA 3WGNA 1K8XB 2Y1XA 2ZI4A 4LYDA 3EYAA 4M0UA 4BC0A 1SQFA 3C1AA 3DLBA 4YCSA 6YASA 4NMWA 1L5YA 5ISMA 2HSZA 1RAEA 2QSZA 2FUG6 4XSHA 3DZBA 3I2HA 1GDHA 1USGA 4DV5B 4MS4A 2DAPA 4QPDA 1CBUA 3T5BA 2A9PA 3F6YA 3I9MA 1WQ4A 1J8QA 2HX1A 4OB8A 1N2CA 3BEOA 3GJYA 1R0BA 3N9IA 3IR6A 1XYGA 4M54A 1UAAA 5BOSA 5A04A 4JC4A 4FW9A 4EYGA 2JHCA 2XITA 4EJ6A 3IQGX 1X92A 1G6KA 1BN7A 1Q1ZA 1WB4A 2ZWIA 1IG0A 3BD7A 1TJPB 4IQ0A 2C54A 2R9VA 4QFCA 1A8IA 1MP0A 1AY0A 1GGVA 1YDFA 3EDYA 3JU3A 4GBMA 2OENG 2VT7A 4NH0A 4R54A 3KFLA 4N5NA 2VSOA 4I1RA 2WILA 1HR0B 2BZ1A 4CEHA 1SKYE 1IOVA 1AZSC 5CD9A 4JFAA 4MKGA 3M2TA 3WIVA 1QDLB 4LZLA 1TPYA 4GWLA 4JT4A 2ZUEA 2H1VA 2PNFA 5L3VA 4K81B 4E21A 1NOKA 2QX6A 3IQEA 5C3UA 2FKNA 3ETGA 4NS1A 3ZGXA 5CGZA 5B37A 1BYUA 2ZYIA 4W8GA 2FU5C 3BDVA 3KVYA 4WNYA 1NASA 4YJGA 2QLFA 5DNCA 4ZTZB 1HG1A 2QSJA 1CFJA 5GGXA 5IC4A 3NUGA 1U2RA 5JS7A 3K4PA 4MO9A 1LBTA 3QUQA 2QJOA 2ALJA 1YL6A 3FY4A 1R8XA 3DE2X 3EQ9A 4IDCA 3V46A 1RKVA 2N9UA 5JPIA 2XBMA 3U4HA 1R0ZA 4RFSA 1H65A 5DEOA 5JECA 3K31A 3WA7A 4OH7A 4GOXA 4CN8A 2HHHB 1EM6A 4REMA 4HDNA 4GSLA 4U8GA 2EL9A 5JH7B 1E0JA 121PA 3DMNA 1NVAA 4TXHA 3ZXIA 4OD0A 3QWBA 1W59A 3BX1A 3CNOA 3U3ZA 1G5RA 2IYUA 3DB2A 1SUCA 4NBRA 4WFKA 3M1AA 3RRXA 2XX3A 3PJFA 4ER5A 5K3CA 2QAGC 1NF3A 4C4ZA 4WXHA 2C96A 4TWBA 3LT4A 2D5IA 3FH0A 1QBGA 4H3HB 4LDRA 2QN2A 4IGEA 4MVJM 4KDRA 4AMUA 3IAFA 4WERA 1Z5PA 4OGFA 1KI6B 4IO0A 4WT7A 3H8WA 4RF3A 2Z5FA 3H2IA 4C06A 5FH9A 3KQPA 2HNBA 4HNAA 4DY6A 1P2SA 1RI1A 1TYBE 2Y4NA 2CBZA 3MWDB 3ONWA 1EVEA 1F9AA 3G89A 4RY2A 4CKBA 1KJ9A 4PYQA 4C7OB 1HKHA 3JD4A 1PS0A 2DQYA 4RMJA 3ADCA 3E5NA 4A9AA 3X43A 3ZWVA 1QRAA 2B2XA 3W34A 4A03A 4HLDA 3RYCA 2PGDA 3L6RA 1W73A 2GEUA 4XFDA 2QD5A 1B8OA 1GZDA 2YNMD 2H4WA 4PPYA 4QVKA 1ZL2A 2JJ2A 4XFKA 2Z6QA 3FETA 4MRAA 1JVSA 1L9XA 3P8ZA 4KJZA 1YZHA 3AFNA 2UZ1A 4DHWA 4I7EA 1FYWA 2Q0HA 4HYTA 1MABA 4Q47A 4JJKA 1CVRA 2QIOA 1E5XA 4HWKA 2BMJA 3B9BA 1S8OA 4OYHA 5FCDA 5FUWA 1E1RA 4F1WA 1ZD4A 3HCOA 3FHLA 1L3CA 4RKEA 3FYSA 4OXNA 3VO9A 4DLRA 3LKZA 2DY0A 3P32A 3PL1A 3Q11A 4OAOA 2RJNA 4UAUA 3V8BA 1K0UA 2APJA 2YOGA 4RIIA 5BSRA 1N5RA 4D8UA 3IVGA 3T3GA 4DIUA 1KHTA 3D5EA 4DV2B 4GXTA 4CZ2A 3WRYC 3TXAA 4OP3A 1ZIXA 5LZ8A 1MMFB 3BGVA 3CW2A 4EELA 3TDKA 3OEED 4V0NA 3THRA 2XRMA 3TZHA 3HZRA 1BMDA 4ZU1X 1EGVB 2NU9A 2GXUA 3OJWA 1JQDA 3L92A 4BUZA 4F5YA 5JDIC 4M60A 3O8LA 4B3FX 2ODAA 4E46A 1GGMA 1RVDA 1UKAA 3R4CA 4L8YA 1ZD5A 4MW0A 2MSDB 3LBHA 4R2XA 1T2EA 1YB1A 4RNCA 1YB4A 3ZX4A 4BQRA 4ROSA 2JGEA 4DCMA 1CDEA 1V6AA 2JEZA 2XSZD 3NYRA 4ENSA 2RCYA 4EX7A 3H9QA 3THYB 5AFSA 2D4AA 1UFKA 3Q3VA 3KQSA 3GEEA 2Q9AA 3COVA 3IOMA 4LXQA 2HO5A 4OU4A 4IIVA 1JAYA 2C4KA 2JLCA 1BD3A 3HDHA 3QWIA 4IFEA 4LRUA 3INGA 2XAAA 2VDRB 3WDLA 4XE5A 5TPZD 2DWQA 2NN3C 4M4SA 4Q34A 1BZYA 1NY5A 1U8EA 3KE9A 3P2YA 2WY2D 4JVSB 2IBMA 4E6EA 1XCLA 4HDMB 2D0PB 1E5LA 1G8GA 2ILVA 2R6ZA 2XEXA 4M89A 5J58A 3HB9A 3EXAA 2DUMA 2XWBF 4TV9A 5J4VA 4NP6A 1S8FA 4A6XA 3JATB 2AXPA 4WN3A 5JROA 4KSYA 2QRPA 4BDSA 1JIVA 2IOYA 3C5HA 5CRIA 2DBZA 3M6IA 4AUEA 4UHEA 1TMYA 2FDRA 2HMUA 3RWOA 1AV7A 1SK9A 2Z30A 2PQMA 3T52A 5JD3A 1KBQA 2ZSAA 3VBCA 3N70A 2X8JB 4AJIA 3V48A 1HTBA 1IPHA 4PZLA 1UBCA 5ECGC 4W5TA 3C3EA 5JATA 1NXPA 1ZUWA 4UM9D 4F92B 2BBSA 5K8VA 3OZ7A 3ZHTA 2KS6A 1L4FA 3GHHA 3RFXA 2A9QA 1T0UA 5JDCC 4P98A 3MGBA 1GNRA 1R8YA 1VIAA 3KPVA 3PHBE 5I9LA 5B2FA 4D43A 1AXRA 2F1IA 3SOPA 1KKMA 4V0MA 5EWJB 3RIHA 4BHTA 3K6JA 2OGTA 3PE6A 5FHQA 1VKHA 1ECBA 2O4CA 3IXLA 3K09C 3H2SA 4YP9A 4KR6A 4B6EA 1Y6RA 1WMEA 2D0IA 4MV6A 5JE8A 2BFEB 2AJCA 3GK3A 4IRXA 4LIPD 1KVSA 1E79A 2VTKA 5KNCH 5E3JA 2C8VA 4OK3A 2B1IA 5K51A 4ALNA 1A9XB 5ELMA 4K9MA 3F3KA 3F8WA 3WGZA 5HYVA 4EUHA 2GEDA 4X62B 1A9QA 3G2LA 4BO2A 4YQZA 3O4RA 5DTQA 4MKZA 1YI0A 1YA6A 1CY1A 2ISQA 2GCIA 1FVXA 2AUTA 1UXHA 2AS0A 1VJDA 3ISJA 1QH8B 4FR0A 3FRHA 3RRNA 4E6PA 3CGWA 1OAAA 1UMCB 1LDNA 4EB0A 3CEPB 3W1VA 4D44A 5DDIP 3VX3A 4UQLA 1LDYA 4KR9A 4KEAA 2AYZA 1Y7TA 1UINA 1ZVQA 2QGZA 4X54A 4DQ0A 2AVDA 2VQDA 1FXWA 4FJ2A 4FXOA 4IJWA 4NOLA 4OLJA 5CITA 2JIQA 2EJTA 5DLQC 1S2MA 1KXJA 3CEMA 5T6MA 4EHDA 4OKSA 3OETA 5BSFA 3OHMA 1Q0LA 3DOOA 2QN6A 3C6KA 2QU7A 3EIQA 3RSSA 3ZOZA 4JDUA 3T0IA 2ANBA 1CUGA 3IBYA 3V2GA 3IKMB 3DGEC 4XQCA 4DM7A 1ODTC 1OJLA 1B6SA 5A4KA 3ESZA 2HL6A 2DTXA 1UWCA 5FKJA 3CPJB 3HEMA 5F1PA 1ISHA 1AKQA 5GQSA 2DC1A 5REQA 3HJFA 4JLOA 4G36A 2WAMA 3VC2A 5LMCA 3BWMA 3CXRA 4O2BF 4R0VA 1YHZA 1WHTA 1RD4A 3NI2A 2EIHA 2G04A 2LVBA 2X3FA 4P5EA 1J2TA 3F8TA 2WC1A 2AX3A 3KLBA 3PUYA 1H2HA 1XQWA 1QHHB 2YFQA 3DW3X 4GDFA 1Q7TA 4ZO4A 4M0EA 1KO1A 4XX0A 2OORC 3ODGA 4U1RA 1GL3A 3KZXA 2EF0A 3DPSA 1UZLA 3ECAA 4HGRA 2IXEA 2BGKA 3HKBB 2C31A 4Y1RB 5E1MA 5EZ6B 4HVLA 1OBOA 4EHKA 3D6UA 1X74A 5EN4A 4R41A 4HADA 4DW8A 3HJBA 4PPGA 4UUQA 3RUPA 4CXMA 1V8PA 1XMVA 4RH1A 1SVWA 3LECA 1L7EA 2G5GX 2GHRA 3TIIA 1WDKA 3SQNA 2F43A 4EY4A 2PX3A 4O1MA 3ZLBA 1VPDA 2HF7A 3BB1A 2RIRA 1BX3A 1TM7E 1M2KA 2JFPA 3AMVA 3GJ8A 1OZHA 1TIBA 4JBWA 4TUYB 4UVIA 3DYBA 2PEZA 3GLFA 1XD8A 2GJ4A 2ZIAA 4Q7EA 2VAMA 1SHLA 1THMA 3STHA 1CYEA 2CXOA 2FSFA 4CKEB 4UREA 4ERNA 2PO7A 3HWRA 1G21E 1CJTC 2PR7A 3HJAA 3REQA 5AW9A 4A3SA 3K70D 2BC9A 4KU4A 2OHVA 3IAM1 3MSXA 3ORYA 2C4NA 4DCUA 3BMCB 2R6JA 3TNLA 4PAQA 1XHLA 4J29A 2QVYX 4MYUA 5CYPA 5IDVA 3WKDA 4EK9A 3LRPA 3S3TA