2GHRA

Crystal structure of homoserine o-succinyltransferase (np_981826.1) from bacillus cereus atcc 10987 at 2.40 a resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
281
structure length
269
Chain Sequence
b'EENIFVMTKERAETQDIRALKIAILNLMPTKQETEAQLLRLIGNTPLQLDVHLLHMESSFYKTFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKRIMEYSKTNVTSTLHICWGAQAGLYHHYGVQKYPLKEKMFGVFEHEVREQHVKLLQGFDELFFAPHSRHTEVRESDIREVKELTLLANSEEAGVHLVIGQEGRQVFALGHSEYSCDTLKQEYERDRDKGLNIDVPKNYFKHDNPNEKPLVRWRSHGNLLFSNWLNYYVYQET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine O-succinyltransferase
publication title Crystal structure of homoserine O-succinyltransferase from Bacillus cereus at 2.4 A resolution
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 83
structure length 269
sequence length 281
ec nomenclature ec 2.3.1.31: Homoserine O-acetyltransferase.
pdb deposition date 2006-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04204 HTS Homoserine O-succinyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ghrA01
1FY2A 1S1MA 4OGGA 2VKTA 4PXYA 3UOWA 3UJNA 4L7QA 1U9CA 4P5PA 4LGYA 3SF8B 3N7TA 1GGEA 3EWNA 3PQ4A 1SY7A 1L9XA 3PQ3A 1I7SB 3TTVA 1GGHA 1J42A 2YWBA 4E5VA 1IZYA 1KWGA 4B40A 3B36A 4GE0A 4UNIA 1OX5A 3MIIA 2NV2B 1M6VB 2IUFA 3L4EA 5DFAA 3ZR4B 3PQ8A 3P9QA 3FIJA 3NOQA 3R74A 3CZ9A 1KA9H 3L7NA 4LRUA 4ZDIA 1C30B 3NONA 3R75A 1P81A 3OT1B 1OX6A 4P35A 4AUMA 3SF8A 3P9SA 4B7AA 5JZMA 4B2YA 3CYFA 3TTWA 3TTTA 4ZDKA 1OX4B 3GRAA 3TTUA 1CE8B 5SY4A 2VXOA 3UGJA 4OJYA 4ENSA 1A9XB 3TTSA 3PQ5A 2ISSD 1GGKA 1QF7A 2VDJA 4MNTA 4P34A 4S0ZA 3UMMA 4ADSG 4ENWA 1VCOA 1I1QB 3BHNA 4UZSA 1GG9A 3TTYA 3UK7A 3NVAA 2R1VB 4ZGGA 1P7YA 4I2NA 3F71A 4HCJA 4OIFA 4R7GA 3PQ7A 4Y1GA 1P7ZA 3EFEA 3B38A 3P9RA 2RK6A 3EN0A 4OGFA 2ZUWA 2OR3A 1Q2UA 1I7QB 1P80A 4MGHA 1FYEA 3FSEA 4OFWA 4ENQA 4ENVA 1IZZA 4Y1RB 4AUNA 2FEXA 1BXRB 4ENTA 3TTXA 2R1TB 4I4NA 1CS0B 1ONSA 1QWSA 4N0MA 4RKYA 4UOQA 3WFZA 2VRNA 4I46A 3CY6A 1N57A 3ZJ5A 1VHQA 4L8FA 4UOZA 3B3AA 2ABWA 2A9VA 3VU3A 2ZUSA 1P5FA 4ENRA 3M3PA 1PDVA 1IPHA 1QVVA 1JVNA 3NORA 5IP5A 1GGFA 1SOAA 2YWDA 4E08A 1QDLB 3PQ2A 2GHRA 2V4UA 1VCMA 3OT1A 2R1UA 1K9VF 4L78A 1GPMA 2R1TA 3CZAA 5SY6A 1OX4A 5LIRA 4QYXA 4BTEA 4D1YA 4GE3A 4WXYB 4L8WB 3MGKA 4Y1EA 1UCFA 1KXJA 1PDWA 3L18A 4ENUA 2GK3A 1PV2A 3PQ6A 3EZGA 1KEEB 3SOZA 3F5DA 1GGJA 2ZUUA 3KKLA 4L95C 4RKWA 1OI4A 4P2GA 3R76A 3TQIA 5BV2P 4BFLA 1Q7RA 4B5KA 2VPIA 1PE0A 1T36B 2R1VA 4Y1FA 2D7JA 3NOVA 4UCFA 1QVWA 3NOOA 4AJ9A 4ZDJA 2RK4A 3P9PA 4WINA 2AD5A 3EJ6A 2NV0A 4P36A 5E9AA 5JZOA 5SY9A 1T0BA 4QYTA 1KWKA 2LXNA 2W7TA 4AUEA 4L8YA 5SYAA 1G2IA 3L3BA 1JDBC 2AB0A 4BIMA 2H2WA 4N12A 2XF2A 4ENPA 4GUDA 3RHTA 4Y0NA 3ER6A 4Y1RA 4XLLA 4K2HA 5K4AA 1GPWB 3D54D 3ZJ4A 1CF9A 2YWJA 2WJZB 2YWCA 1WL8A 1C3OB 2ZUVA 1R9GA 3CNEA 4JQSA 4MTCA 1OY1A 4B31A 3BWEA 1T3TA 4OQ4A 1VCNA 1QVZA 4AULA 1O1YA 2RK3A 2ZUTA
chains in the Genus database with same CATH superfamily
2R44A 1MRZA 2EWWA 4EI7A 2ZYAA 1H42A 3FLMA 2IOQA 4JXKA 5CW2A 4ZAWA 2XRYA 4BLRA 3I9KA 1GNRA 3KUXA 1E58A 1EXNA 3N2GA 4NJEA 4EPYA 1BMFD 2WTUA 1TECE 2F9MA 2BZ1A 3VR5H 2W71A 2RGRA 3VR3D 1L4BA 1G19A 1C4XA 2JZCA 4RENA 1XL0A 2NG1A 3E9NA 5LB4A 3KKEA 4FYJA 4RZXA 4WWHA 1Q19A 2C9BA 4KZKA 1G8FA 5CJJA 1B14A 2H4YA 5CYPA 2PFSA 1B1CA 1KP2A 3H1TA 5D3KA 2X5OA 4EG0A 1Y9ZA 3H0EA 4LBZA 2YZGA 4WEQA 4AJNA 3IEUA 3IP8A 4AP5A 4PS0A 3PFKA 5F3DA 2I3GA 3K6SB 4F60A 3EA4A 4KW7A 4TWJA 4O2AF 3MWGA 1M1YE 2O1EA 4YV2A 2DETA 1ATIA 1DINA 1K06A 2MJLA 1T0HB 5A3SA 3B70A 3DAGA 3HU3A 3OFKA 4N9QA 1PEKE 4D4MA 2BCGY 4GKVA 1A5BB 2P4SA 3QWHA 1KK1A 3UY4A 4D02A 2FMHA 1SXPA 1TA9A 2DTXA 6PFKA 3NC0C 3L0OA 4R4JA 4ZEMA 4DARA 3H84A 4D4IA 2Z6UA 2XD4A 4RSRA 4FFPA 1FFXA 4O2BF 1VMKA 1NT2A 2HU8A 8ADHA 4L6CA 2N75A 2AHRA 4M55A 4XPIA 1Z2PX 5IDVA 5EHNA 2BDTA 2WJIA 3AV3A 2JCXA 1Y1SA 3FSEA 4RGYA 4WOKA 3ZW8A 1N5LA 3EHDA 4PAGA 2OPBA 4OKNA 1IY0A 4NBUA 3QY0A 4AY5A 5KQRA 4EO4A 3PGKA 4TS9A 4MVJD 2NT4A 4IXMA 4XCVA 2EKDA 3JD0A 1XTVA 2WB2A 5HIMA 2QX8A 3LHDA 4IQFA 4B3CA 4LF6B 2CBXA 2ABWA 3WK7A 3C7DB 4YUAA 5ECYA 2C4MA 5K0TA 2KX7A 3I2GA 3LHSA 1QVVA 2VSQA 2B1IA 3NHWA 2FF5A 2HF8A 3BIJA 2I1QA 1IJEA 2AG1A 2IGBA 4D9CA 5HCIA 5L9AA 1YDMA 1NW6A 1Y8RA 4LJYA 4KX5A 2ZG6A 3AUFA 1B41A 4FYYA 3FVVA 4GPBA 3ULKA 3MUNA 1TJNA 4E4YA 1R5BA 2JCVA 2FKAA 3ICPA 2IP1A 2LIPA 4UMDA 3FYDA 2X0RA 1DE0A 1W75A 1AD2A 2XT6A 3EY9A 3MMNA 1O6BA 4Y6LA 4YWHA 5LB2A 1JILA 3UMCA 1QG2A 1M1XB 4XVQA 4Z99A 1I2AA 1F6BA 2NX2A 3N2KB 3KB2A 4UE3S 1VG8A 4Y2VA 4YWJA 2Z5FA 1GA6A 5JXIA 3VKFA 1DDGA 2R2GA 4AN0A 3QE9Y 4X3PA 3HKEA 3ND6A 4ZAGA 4EEXA 2FE1A 4XZ3A 1E2QA 4WXMA 3V4ZA 2AF4C 3RS0A 5AJYA 1BXKA 3QBTA 1LV8A 4S35A 3HSSA 2NO7A 5GM1A 4IQ4A 4G37A 4Z9XA 1C5KA 1K0UA 4NNJA 2WC1A 3TLMA 7ABPA 4QTUB 2VP9A 5JASA 1XLUA 4LVNA 3LPAA 2IYRA 4QJIA 3ELWA 1GL7A 1CS0A 4HVTA 4NQZA 2JCGA 3DJYA 3RV4A 2OG1A 4Z7OB 5EY5B 1NG9A 5ALUA 1UR5A 2VK4A 1UMBB 2VJMA 2D1TA 2DAPA 4GIBA 2GPAA 3UUEA 1VDMA 4H4CA 3L8DA 1B0ZA 2PA3A 2XWPA 2Q7XA 2OAP1 3CO0S 4NMXB 4UNQA 3U81A 4LXQA 4J1NA 2BM8A 3RYCB 4CKYA 2DJIA 1L9XA 1SBTA 4GC5A 1I7SB 3K70B 4RZQA 3DMTC 2ZS7A 3WHIA 3KELA 1P2TA 2AD1A 4R84A 1USGA 4JL8A 2QJFA 3KQNA 3AUYA 5FBQB 1NBMD 2IHVA 2IEBA 5EE0A 3TINA 1G7TA 4I4IA 3RTDA 1IOZA 4BVFA 1E7RA 3V55A 5ITSA 5CB8A 2YL2A 1W5FA 1H4SA 1IXYA 1JQEA 2VPYA 1HQKA 1OPXA 1QKIA 1USWA 4TYWA 1ZH6A 3MAJA 5IH3A 2R8OA 3D59A 3DCIA 4XSVA 2MMCA 3UJ7A 4BGUA 1YR3A 3CW2A 3V42A 1RKUA 2A92A 1KI9A 2VLIA 1BDBA 2CE7A 3UMMA 3U5ZB 3L05A 3EGDA 2FEKA 4MGKR 3T7CA 2J9XB 2I65A 2ZYIA 3CINA 4JKOA 4JT9A 3ORRA 4UPEA 3FYHA 3W7VA 1F0NA 4ZOQI 5EJ4A 1YGPA 4TN1A 5DX8A 2E4AA 4RZHA 3R8XA 4YDHB 3PWTA 1QGAA 2RGGA 4WQMA 1JT2A 4LI3X 1N5IA 1E5VA 1U7TA 4RY8A 3GPCA 4KLAA 1M2WA 4GI5A 2QRMA 1CZLA 4GGPA 2V6FA 3O93A 1E7YA 1U9ZA 3VU1A 4ZI3A 3TLGA 1PJ8A 1XB2A 3FZYA 1WZCA 3I37X 1XP8A 2PSJA 2CNBA 1MOSA 1J07A 3ZV7A 1AJEA 2F3QA 3JASB 4H60A 4RZ2A 5BN4B 4HNUA 3CZMA 1WCXA 4R1SA 1LI5A 5DM1A 3CZRA 2O5RA 4C7MA 5L3VA 2BI8A 3JQAB 3PRKE 1JW9B 4DWWA 2B30A 3QVGA 2RB4A 3TQSA 3UWPA 1BXGA 2RHBA 3K5WA 4I1VA 1WMDA 4LXYA 3T5TA 1F0KA 1CJKC 3UC9A 2WTNA 1GFZA 3U09A 2Z98A 2HOQA 2IY9A 3B89A 4RLFA 3L04A 2FCAA 4X5OA 4PYJA 1X1RA 1OWLA 2F48A 4JX8A 4R8VA 2C2ZA 2NGRA 3Q7SA 4ICIA 4RCVA 1BZYA 1GUYA 1PJCA 1J33A 1WCIB 2BONA 1HFKA 3BMQA 4P92A 2GDZA 2FQ1A 5BURA 1U5AA 1KVRA 2HRBA 2LDXA 5TPZD 5CH3A 1E1CA 2XD9A 3K9NA 1CRWG 5EE1A 3OOHA 2C4HA 3PK0A 1AKQA 1A5AB 2ZIXA 3TBFA 5CVEA 1HE2A 1Y48E 3C5WP 4X7RA 3UF0A 4A23A 1ZA2A 1VKOA 4JI2B 1D8TA 2UVQA 3PD1A 4C0QC 3O2SB 4JB8A 4Y0NA 2CXHA 1J99A 2X76A 4LZZA 4C08A 3BE5A 3C5CA 2QTAA 3IA2A 1M74A 1WSBA 1CQJB 2VDUE 4JOSA 5ALYA 3WGHA 1XDDA 2CGEA 1EUDA 2QTBA 1ID1A 3C6QA 4PIPA 5E9JA 5IJ9A 3A27A 3IB6A 4RV4A 2PKWA 1ORVA 4ER5A 4Q24A 421PA 6NULA 1T5LA 4I5IA 3TRHA 4LSMA 3RU9A 3UB4A 4K46A 1H66A 1ICEA 4OATA 3O8NA 4FM9A 2NUPA 3QYPA 4IM7A 2YY6A 1FUIA 2YYYA 4LCBA 2X19A 3DMRA 4LRXA 3DWGA 1W2GA 4J0CA 4AL4A 4N0QA 4EGAA 1AXGA 1AQIA 4E7PA 1S2LA 3EXG1 5B1HA 2WOJA 1E4VA 1X9HA 1N7GA 1Q7EA 3CR3C 1ULUA 4J75A 3T9CA 5J23A 3FM9A 1SMKA 1ZL0A 2XRFA 2ZWIA 3P7MA 2W6IA 5FBVB 5EIHA 4DC9A 4RF3A 5IDYA 1L6RA 3PRJA 4WCFB 4B45A 3IAAA 5A03A 5DVZA 1ZLYA 2IOFK 2HN9A 1WXGA 2Q4OA 4QPJC 4FOTA 4N7JA 5SY4A 1TCCA 3G5MA 1JIIA 1JIJA 2QRNA 1MH9A 4L07A 3FPEA 2K2QB 2D1QA 4IUCS 1UFVA 4S1PA 1Z8FA 4S1VA 3VPBA 5JHHB 5FNVA 1BVRA 5AW8A 2AI1A 2VRCA 4F4UA 4FGLA 1W0JD 1KU0A 2AG5A 5I4IA 1ADCA 3HEAA 2PL5A 3HABA 4LJ7A 5FBHA 3HMKA 3VSAA 2JVIA 3RSSA 2BEJA 3GH1A 3MMXA 5K8TA 4IHJF 3GUYA 2HMVA 4Q9NA 4JC4A 4L0QA 1G98A 1UPAA 2NOAA 4CDNA 5KNCH 5LU8A 2IUYA 1MV8A 2IEYA 3DTTA 3O5AA 2A9PA 3RVQA 2ZRKA 3VPAA 4EW1A 3GHYA 4F1KA 1J97A 3IURA 2UXBB 1JJBA 5IHPA 1S2DA 5AUPB 4BN5A 3E48A 4W5JA 1ESNA 1NV9A 3PEEA 3RYFB 4ZTBA 4YX9A 2BGMA 3EZLA 2IZ6A 1EM8B 4F2HA 2NUAB 1U7WA 2FNAA 1VGRA 4O29A 2AQ8A 3BSYA 2RGYA 4PRYA 3RTGA 5GIPE 1GPAA 2PBFA 3EMDA 3LF1A 1ZU4A 1IPHA 4FEAA 4OP2A 4QTXA 3V8PA 4ZOLA 2PBZA 1DEOA 2GUGA 3IUEA 5ECDA 5CB4A 2FK8A 2E82A 2I29A 3QKIA 3FZGA 2EJCA 4NU5A 3PDIB 1UDCA 3AM1A 5TB5A 5IFLA 3BWMA 1LC3A 4O2BB 2CUZA 2Q1WA 5EQFA 5AK4A 3MQFA 3REQB 4EZIA 4DEYA 2VDMB 4WXYB 1Q1NA 3DZIA 1YDWA 3IJ5A 5DWDA 1BJKA 4D46A 3Q41A 1AV6A 1X7WB 2XWQA 4JCOA 4RKWA 2C5EA 1ZM9A 1TQ6A 4FNMA 4BEBA 1JP7A 5H9WA 1E1QD 4JI8B 4DR6B 1Y8QA 3DUFB 3JQ8B 3ZD8A 4U1RA 3TJMA 1FRVA 2GA9A 5EHXA 5LOVF 4WINA 1GSIA 1TYEB 3DEKA 4PLCA 4IFBA 2LXNA 2AMJA 2QXUA 1QIDA 1E3JA 4FLMA 1KL7A 1PNOA 2JZNA 3DE0X 5BSVA 1LBEA 3IMFA 4BWFB 2ATVA 1I51A 1KY5A 1S2OA 1TD9A 1Z2CA 3EXFB 3I5MA 5E2IA 1FUKA 5EE3A 4IRXA 5F2NA 2YIMA 4B6GA 2BC9A 5U9CA 2OGSA 2JIOA 4MUBA 3DZ8A 1PJZA 1GPNA 3KV3O 4DV2B 2D62A 2YIVX 5J4YA 5BNTA 3QBDA 2CHEA 2NVWA 4OYYA 2PWPA 4LDRA 3ZQUA 4AKGA 4MRAA 4RF5A 3SXJA 1CY8A 2CF5A 2Z1MA 3ADOA 4O4JB 1ISGA 1QG6A 1SULA 3CBGA 4EL5A 2I66A 1RJDA 1VPEA 1XJWA 2ZRPA 4M0EA 1P2VA 3SBDA 1U6JA 2VZ9A 1VSVA 3HXKA 2QUAA 1VSUA 1G41A 2H1SA 4Y30A 3ZWCA 2XW6A 1R00A 4IIJA 1N8KA 3NDPA 2AG8A 1UJCA 4H6VA 1XMOB 2ZANA 2Y4OA 3FB4A 1MAUA 3LYLA 2DT5A 1PT8A 3GT4A 5FL3A 4ACAA 4TYYA 1VPVA 2Y2UA 4KK4A 1A9TA 3I2YX 2TMDA 4U7PB 3JR3A 4QSHA 3UGTA 2H5LA 3GXBA 5BSKA 5KCZA 3G7NA 4JCCA 2ZOSA 1ES9A 3RJZA 4DPMA 1G21B 4WESA 3P45A 3ZS8A 3MWJA 4DE5A 3VTZA 2WE8A 2ZVJA 3IAS6 2ZB7A 2Q4EA 3SY8A 4PIVA 3STTA 4MP6A 3UKDA 4JV5B 2NQTA 2HCTA 2W4IA 2F90A 3AHHA 3HKBB 4L1KA 2PL9A 4QLAA 2RAFA 4UZSA 1GQOA 4ZQCB 3K70D 3D8BA 3L8CA 1V8BA 4IDDA 2CL0X 1ZM2A 2W6JA 3BQNB 1FNMA 4KN5A 1FJXA 5TJHA 3D2BA 5EUCA 1YK0A 2GXSA 2R8PA 3VDQA 4EABA 4B7CA 2HX1A 2WF7A 4HXFB 2V74B 1VYUA 2ZS9A 3I2JA 4IMPA 3BE4A 4C9BA 1GZ7A 4DWOA 5D1HA 2FFRA 4YHBA 1CC1S 3WAKA 4E03A 1G7RA 2RG1A 2XDQB 2JIMA 4JX9A 3TSYA 5IHXA 4ZGBA 2IH4A 1KDRA 3KVYA 2NACA 3G23A 4HS9A 4R1UA 5IBQA 1QYWA 3VDMA 4DRXA 4CKCB 5K45A 2QBYA 5L4LA 1J0AA 2CYAA 5EXPA 2HT1A 2QJTA 3EOAI 4G8BA 1BA3A 4E4RA 4LSGA 2ISQA 3L0BA 4IVQA 1NL3A 4KQFA 1M66A 3LAWA 3VPHA 1D4FA 3PVZA 3K7EA 1IZ9A 2X5JO 2XUKA 4B4UA 4BLQA 1CUDA 1WA5A 2ZYSA 4XAQA 1T5OA 3ACBA 2H2GA 3KLMX 3ZBUA 4WN9A 5BN3A 1BVYF 1H6CA 4I50F 4GR4A 3TOZA 3HDGA 4NZ9A 2DR3A 1PCXA 1QX3A 4MV1A 3V97A 1SHZA 3C24A 1KETA 5IF9A 2I6SA 3HJTA 3LSTA 4LEIA 3CB2A 1FQJA 2O2YA 4MKHA 4X64B 5C52B 1EFTA 1CY1A 2PXAA 4KDEA 3ZZNA 1RBMA 3E5RA 3ZDEA 4M7RA 3L8ZA 4QU0A 5DPMA 5G40A 4DWVA 2PUDA 5JADA 3ZPXA 2GQ0A 1KMIY 2H1FA 2JRLA 4FHCA 2ZTSA 3VNSA 1UINA 3GAMA 4FOSA 4IF4A 4ND6A 5DN6A 3THXB 1DAEA 1IJBA 2XYQA 4HX9A 3D2LA 4HZIA 4K87A 2YJZA 4MGZR 2WP0A 4V0QA 3VOTA 2OLEA 3BDAA 5A2QA 5MN4A 3QM1A 4L0MA 5KMGA 1ZN8A 4M22A 3CGGA 3M82A 5JHGB 5A3VA 3SSNA 2J0SA 2O2HA 1ODKA 2CUTA 2ZWPA 1JDBC 4Z7QB 3JQAD 2TYSB 2JLYA 3TFQA 2GEKA 1RP7A 1EX9A 3PQEA 1N32B 1G8GA 2V8BA 1B6RA 1TFUA 3CNHA 3LVQE 2HNKA 2HZBA 3R5KA 3LP8A 1PJSA 2QWXA 3G5UA 4G4IA 3DONA 4KU4A 4MVJM 2E4WA 1WXWA 5FBWB 4J91A 4AY6A 4RIEA 2BEKA 3MJSA 1A72A 3Q7TA 2J3KA 5EJGA 2FW6A 2MINA 1BWPA 3DV2A 4Y9DA 1PL6A 3JYQA 4EQ6B 5I7VA 1GAXA 3TRFA 2R60A 1NJGA 3A6DA 1TMYA 1CQWA 2QLJA 2QX7A 5EXSA 5JR3A 2BKLA 4UUQA 3N74A 4EECA 2NIPA 2AR0A 4GSKA 2AG0A 4EYSA 3WGOA 3T3NA 3DYBA 2PX2A 2ATCA 4JSYA 2AMYA 1T8TA 3FOAA 4AZ0A 1IYZA 1P1BA 2YDYA 2RHCA 3HP7A 4S2EA 1X9GA 2QN1A 4R98A 1P72A 3AO0B 3C4VA 2NU8B 4DS3A 3KAPA 2HGZA 4P38A 2BM0A 4MPRA 4BQNA 3AXTA 2COEA 4UATA 1A2KC 2FMUA 3BFVA 3VKHA 4H27A 1MA0A 2YWXA 4H7FA 4YUVA 2IUTA 1M2OB 4JVLA 2CE2X 4GFDA 1Y34E 3UJHA 4NDZA 1YR1A 4BCCA 1NWCA 4F72A 5IN4A 1G3QA 2YWFA 3GROA 5B6PA 2GKSA 3TZBA 3JQ6A 3UAYA 4ETNA 4KIGA 1R9JA 1AO3A 2RKOA 4W5QA 4RMNA 2RGNC 3FNEA 1JDTA 2ZSAA 3CWQA 3DF7A 3VX4A 3IVRA 3NATA 1UKBA 1HT2E 4YS6A 1GCIA 1MENA 3D5EA 4I3HA 1T9ZA 5F1OA 4MRMB 5CA0B 1GG5A 3NANA 3N76A 2G40A 1G16A 1UZAA 2QMQA 2QLBA 2R66A 1UJMA 5DTMA 1S8OA 3HRIA 3JQGA 2QM7A 4CCSA 1FTNA 3V8EA 1HDZA 5CGQB 3RFCA 3U7EB 2CMHA 2Y0CA 3MILA 5BOSB 1IPEA 1FYDA 4LISA 3ZZ0A 1RPNA 3IA7A 4DRZA 5T41A 3D4LA 4N3NA 3NBQA 3EQ9A 2UUPA 2HIGA 2FEAA 4PCVA 4HPWA 1C1XB 1MN6A 1QWSA 3EF1A 1N3YA 3FKSA 5TGZA 2IV2X 4Z3KA 2XMZA 3WAGA 1VLHA 2A9VA 2BFBA 5EWMB 3WLHA 1M2HA 3LD9A 4ZV4A 2V1UA 2HY7A 2JAOA 2JEOA 2VNJA 3M6LA 4N6NA 4DSTA 1J1ZA 4N9WA 4R41A 4LSWA 4JYPA 5TVGA 4BQRA 1GM5A 4DUZB 4QYIB 3VKUA 3EC7A 4P9NA 4U63A 3GB9A 2C0CA 5IUNC 2IYVA 5KTTA 4IHJB 1HFWA 2JFXA 1QNFA 4WFIA 2VSYA 4B4DA 5BYAA 3AINA 3ED1A 4Y1EA 1K2VN 1N0UA 2YFQA 2ZUUA 4PQRA 2W42A 2R4QA 3NBUA 1VECA 1DC6A 1E2FA 4GC9A 4H7JA 4J2TA 2LBPA 2O3RA 4L51A 4ZP1A 4KNYA 4OO3A 3A0RB 1HSZA 4Z9AA 3Q98A 1UXIA 2Q0QA 3MCTA 1YASA 4Q3AA 2BE9A 1E1RD 3EDMA 4G0WA 1NTOA 2RKWA 3MS7A 4JZYA 2FF7A 2X6TA 3BTVA 2ROQA 4NOJA 3LUCA 2CJWB 2VSXA 3L8YA 5KO2A 4W5RA 3HCPA 5B1YA 3R3ZA 2C54A 2CHUA 1IH8A 1NI3A 1A27A 1NMQA 4B71A 1XF1A 3RWOA 5I9BA 5AHWA 3T3HA 4X41A 2JGLA 2IH2A 2XUDA 1TGYA 3I6YA 5ALRA 1SPXA 4PFQA 1XMSA 3CLRC 3KOYA 2R5NA 3OMLA 5DNAA 1RWBA 3VU8A 5DI3B 3WJ1A 3E3OA 5BQFA 5JATA 2GHIA 2GF0A 3AM4A 2P0AA 1NFFA 1O95C 1WCYA 3QW4B 1DUIA 2X1LA 4XRRA 1JLLB 3KZVA 5TVKA 3J7AC 1LSOA 1X9IA 1IQRA 2FG7C 5EWJB 4HV4A 1H9BA 3S8YA 3KR1A 3TL3A 3KJGA 1DG1G 1DQRA 3PKIA 4C03A 1MQ8B 3QEMB 4WASA 4HAYA 1GN9A 1REQA 1G6KA 2VHXA 2JGEA 4HNSA 4UU8A 1J42A 3BA1A 3WVNA 5LWHA 2KLHA 3TMAA 1ONPA 3PENA 2NT3A 3TAHA 7MHTA 4BVEA 5IM5A 4DDVA 2X3FA 4K3UA 4GPAA 4CT5A 5B7QA 5CCEA 2PSDA 3ZZTA 3N7AA 3TE6A 2NNWB 3S7ZA 2OT3B 1KMCA 1XTTA 3VZSA 4JP2A 4H4DA 1RD4A 1T0PA 3R75A 4B84A 2BWJA 2OZLA 3MWEB 3EQ7A 3NP7A 4RAOA 1H6DA 3DW3X 1W25A 2IEDA 1QQTA 2OV1A 3PYMA 3WRXC 5GINE 3O9MA 3Q10A 1VLZA 2RIRA 3GGGA 4NYIR 4OA5A 4ZMSA 5AQEA 2H65A 4ND5A 4JJ6A 3LUKA 1QIGA 1FSPA 3VYWA 3AIIA 3CLSD 1XYVA 4H3HB 3DLPX 1XX6A 1S9DA 1I1QB 4I08A 1IATA 2VP0A 3LUGA 3AQIA 3WLJA 1RFLA 1CNEA 4FB4A 1OV6A 3KQSA 1BCSB 1H2EA 1K4MA 1QHSA 3TR5A 4D3YA 5ENVA 3PTAA 3F4KA 2CMFA 3QFCA 4Q4AB 4XSHA 2H8GA 4ZRNA 3VGPA 3P9RA 2QRLA 4GOMD 5SZJA 2PX5A 4MQ6A 1ZRHA 2J30A 3PFBA 5HIJA 3UXEA 1JR3A 5CBPA 4YFVA 3LKZA 3K1AB 1G3IA 4YLEA 5EINA 3QUAA 5FTJA 1L3IA 1AKTA 1TEXA 1U94A 2OL4A 2V7UA 3QNWA 3IEXA 3KCQA 5TE9A 3STHA 4D8WA 4OREX 4EGSA 5H0IA 3SNHA 1DXYA 3CLVA 4OHCA 4P31A 4D6YA 5LZ2A 1G3RA 2WM9B 3E0QA 2R86A 2B61A 4BX0A 2Y6UA 1NYLA 4GPD1 3WWDA 2RG7A 5DEIA 1E9BA 3E7XA 4PSVA 3ZX5A 3IQHX 4Q4JA 3KT3A 1SQGA 3IIKA 4QBTA 5IKMA 2PH7A 1PW5A 1SCJA 3FGOA 3ELYA 3QVXA 1U81A 3BHMA 1Z13A 1BQ3A 5AUOB 4MP3A 3U1TA 2JAWA 3QLJA 1N2BA 1Z18A 4W1RA 4IOJA 3ROEA 4XWTA 3U9SA 4BNVA 1GR1A 1JR2A 4B1FA 1LDYA 2HK8A 2WAXA 1ZIXA 2JPDA 2CDNA 4TV9A 1I7DA 2NYUA 2P5TB 2QGNA 2P6RA 4D9MA 5FOQA 1K7EB 3CS3A 1FP1D 3CVJA 4TT3D 2ACVA 1L5VA 1R0BA 3R7AA 2DHEA 3NHMA 3E9YA 4BKMA 1GFSA 1QONA 3U2QA 2GXAA 1K89A 1EBBA 2Y9PB 1V6CA 2IIQA 4XD7A 4S04A 3L82B 4HEJA 4AX8A 3Q5DA 1SCQA 3P27A 3FNBA 1BU8A 1QQ5A 1BKSB 1TU3A 2XGOA 4I50B 4L76A 3P9KA 2EBUA 2ZRHA 2O57A 3CF4G 2W4QA 2OV8A 4Y9UA 3W1EA 4LOHA 5EHZA 2W2PA 4CV1A 5F33A 4WY2A 2PT7A 3E84A 4WKPA 3CXUA 2K5UA 3V4RA 4WY8A 2QY9A 4N6GA 3EXG2 2LVBA 3S2IA 2OXIA 3I5XA 1RJ9A 4UZEA 1A8PA 1QHGA 3VHXA 2ODEA 4C4SA 2VYFA 2PIAA 1PGQA 3AKZA 2CXTA 2GZAA 1WQ3A 2AEFA 3EXIA 3QEJA 5AKJA 5DHUA 1BFDA 4XIFA 2H7YA 3JQCA 2Q4RA 4FEGA 4JVSB 3WZLA 4K05A 4OHYA 4V3CA 2DECA 2CVHA 3FWYA 2EP7A 4ALNA 1FE8A 1ESMA 1MPXA 1LBSA 2J3MA 3O8OA 4L8LA 3N70A 3UAGA 1EJ0A 2QRPA 2ZRGA 3NO4A 4BB6A 2OMKA 4DQKA 4LRUA 4R2KA 1BDJA 2AK2A 1H9AA 2N1BA 3UJDA 5KSYA 1Y9JA 2M6RA 4CJXA 2JBAA 1GDTA 2BHLA 2GPNA 2XZOA 1YDEA 4NU6A 1J9ZA 2FSGA 2ECKA 3AKYA 1I2DA 1GOTA 3G2NA 4IKEA 3E8MA 3TQQA 4MZXA 3GQBB 3LBNA 2QA5A 2OBMA 2UUOA 2IGTA 3ITNA 3RIGA 4AXBA 1GVNB 3NHJA 4AJPA 3AETB 2H4FA 2QVYX 4KWEA 4TM8A 2IUUA 4XWKA 2XB2A 2J48A 2J9GA 1XGKA 3S29A 3ZC3A 3T38A 1ZN2A 4ZGGA 3G13A 1C50A 4N48A 3SZUA 1F9EA 1USKA 3H5NA 3I52A 3QVVA 4HCJA 1J0BA 2A1TR 3OBBA 4MINA 2QMOA 4P2BA 4Q66C 3UANA 3VJRA 2DF8A 4NOLA 4K0KB 1BX3A 1KKMA 4Q9HA 4ZWNA 3R3WA 1J9GA 1Y63A 4QELA 2O19A 2OYSA 2EQBA 1TQHA 5DT9A 4E11A 3S7TA 4LYFA 1QFXA 2ORIA 2PZFA 3PC4A 1U4SA 1PZMA 3CR8A 3B6ZA 3D4IA 5BOVA 3WRWA 3DP7A 1U3DA 2XIQA 4K9QA 1VIVA 4HYYA 3PD0A 2D0IA 2G77B 3ESBA 4KO1S 3DDZX 4RTRA 1EK6A 4C2AA 1BD4A 2FMXA 5CVTA 1BX1A 4UOQA 3H8JA 2NW6A 5KU7A 4XUEA 2ZE6A 3TX2A 4IXNA 4LJ8A 4HQ0A 1WMSA 1XZKA 3H8WA 3E9ZA 5DTJA 1CHNA 1CUWA 2MMGA 2WTXA 3OMXA 5GTDA 4LF7B 5IDQA 1NN1A 3UHFA 4AP9A 2E3JA 3B13B 4UE2A 1EX1A 1B00A 4FDLA 3F7MA 4Q5IA 5D86A 4B8ZA 4GM0A 1HNXB 3GK3A 4K0RA 2QRUA 4KQIA 4ZI2A 3KZKA 1Q92A 1XEWX 5T3UA 4JVMA 5B3JA 2VNSA 1C9MA 2CJYA 1SB9A 4M83A 3U4HA 4DN6A 4KBGA 5EE9A 1PR6A 2PD6A 5E2BA 1AE1A 5BRAA 3T1YB 4N65A 3M6WA 4BKQA 2QP3A 1NMEA 4FMCF 4U5XA 5BQ5A 4Y1FA 2YXEA 1L5SA 5AOAA 1KPIA 2HUNA 4F1WA 1CDDA 3FWPA 2H2FA 2DPYA 3W8EA 5A3RA 1IOLA 5ALZA 3CZ5A 1LPBB 4MYRA 4PRKA 1G2OA 4TMFA 4AUEA 1L5HA 5AHXA 1YQXA 3FTEA 4O4LB 4MVJI 1JA0A 1L7VC 3SEAA 2WVGA 4MYUA 4UKDA 4JH0A 1I8TA 1BS2A 1QLHA 1RHJA 1VC2A 1Z4IA 2PJUA 2H1HA 3IQEA 4ARSA 3AFGA 5HBRA 2C1XA 4ARBA 2V7VA 3E2IA 3ZV4A 1VDZA 1VM6A 1CZUA 1JU4A 1QC5A 2XNKA 1XAJA 2OQVA 1I7PA 2HK6A 3CSSA 3DBRB 3TLJA 2EW2A 2O20A 1T1SA 4G5OA 1KKUA 4F2WA 3HPQA 4LHVA 4KQ1A 1UOQA 2C2MA 4A8JA 1XZHA 1ESCA 2QORA 3DV9A 5C5DA 3BF7A 1MF7A 4LVCA 4EMUA 2OQIA 3H2GA 3A4NA 3BMNB 1L3CA 3T7DA 4AW9A 5JI2E 1IM5A 2CNNA 4TUYF 1JJIA 2CLSA 1D8AA 3I05A 5AK5A 1W7AA 1YRHA 4TYQA 4CF7A 1US8A 3K94A 3U3KA 1EINA 3EFBA 3EQZA 3TEFA 3KSMA 4JODA 5AWFC 4IQ8A 5IKXA 2YZKA 3ZHZA 1B74A 5KKCA 1MCZA 4OHKA 3QFHA 4K26A 3B6IA 3E9QA 4O6VA 2OSVA 4RWEA 4EY6A 4N3CA 1ORRA 3GA5A 2WFMA 1VYTA 1JFLA 4C7BA 3IOYA 5CH8A 4MNTA 4S0ZA 1SG9A 2DQSA 1NBHA 1ELOA 3I0NA 3R2JA 4RELA 3G0HA 1O97C 4C0KA 1VCOA 1E9SA 5D85A 4DIKA 2QP4A 5AM3A 3U1BA 5GONF 4ER3A 3NVAA 3KKNA 1ZITA 1TI7A 2PLWA 2VEOA 2AOVA 1K0FA 2E1PA 3VPXA 1CJTC 1Y5IA 1G9XA 1OTYA 2ZSFA 3IV9A 4KQ9A 3ZVRA 4BWYA 3P0HA 4B8YA 3DFUA 3QEBZ 2JFQA 1CJSA 2ZJ7A 4K40A 4REQB 5COQA 1TVKB 3JD1A 3I04M 4KWTA 5F7XA 4GMDA 4UULA 3GUUA 4QU9A 3TNFA 4HWOA 3THYB 3CT6A 2AVNA 2EW1A 1OH7A 4B85A 5I7WA 4CLOB 1EVIA 3HBMA 1RPZA 3EUFA 1JKIA 3ON5A 1HTBA 3LZDA 4ZAVA 3AR6A 3FUTA 4FDMA 1JIVA 5JLJA 2YKGA 1MAVA 1YV9A 2CFIA 1YB2A 5G53C 1SC4A 1NQUA 3OZUA 3CSUA 1U8UA 4KXFB 4DZRA 3NC4A 1S8AA 3FCAA 1E2HA 4G97A 4JHLA 2ZRJA 3NPMA 4JB2A 2DQYA 4U2KA 5K1ZA 2H4XA 2IWRA 4GVLA 1CIPA 3HY4A 4CCYB 3K9HA 3ZQ6A 4L02A 2CD7A 1EH5A 3O26A 3VYSB 5LJIA 1M2GA 4G36A 3OP1A 5ALKA 1W5BA 3WMXA 2GILA 1TJYA 1OX4A 3OJWA 3ZCQA 1ACLA 2EL9A 1KO8A 4DLBA 5BNZA 1W6RA 1XQWA 4TSKA 3F4BA 2UVDA 1ONBA 3DDHA 2GXQA 3DS8A 3HWWA 4IOKA 4S24A 5DYYA 4F5DA 3PG5A 1JJFA 5A4DA 4QU5A 3F9CA 2H2HA 1Q7RA 1P7PA 3DZFA 4X00A 3RVBA 1ZCBA 4CIWA 2HF9A 1IAVA 2GCIA 4KSYA 2I3ZA 2ORVA 3KYCB 3OSZA 3COYA 1GTVA 1R4NB 2FW0A 2WD7A 4FK8A 1GL9B 1I24A 4MJ7A 3WLNA 4C3OB 1NBIA 4PTYA 1BIFA 2OE2A 4TV8F 4M0UA 3OLQA 2WK1A 3L2OB 3DEYX 3II6X 3RSHA 1PO7A 1OUMA 1P2SA 3TLCA 4L4XA 1YFJA 3EZ2A 5ETJA 3KTAA 1EB9A 3CKLA 1JJAA 1QFJA 3K4HA 4OL9A 4OXRA 1VGVA 1BAPA 1P3DA 3FSJX 5DHQA 3T5GA 1U0EA 3H9GA 4BLWA 3TCKA 4Z7JA 3INRA 4WZAB 4ZXFA 3O4FA 4Z0NA 4YJ3F 2E4VA 3R5FA 4L4YA 4M6WB 3DNMA 4AMBA 1T2CA 3MTQA 1PVDA 4MR7B 5K8IA 1EP2B 2Y1GA 4ZGWA 5EJAA 3QG1A 2G70A 4HO1X 3S40A 1SCBA 3TTVA 1WVGA 3E9EA 4DT1B 2GJKA 2QNIA 4OTZA 4DMLA 2E18A 4Y3UA 3RHZA 3GJRA 5IANA 2OOKA 1RRVA 2CBZA 4IS2A 4RHFA 1KS9A 5HILA 3SLKA 2J4FA 5A9SA 1BE8A 2P7HA 2IHBA 2IEAA 4Q93A 1GGMA 2OOSA 3LLMA 2QMHA 3R7SA 4YRAA 1GR0A 1M2KA 4AMGA 4GPZA 3GVIA 3WK8A 2DTDA 1O6FA 1YU6A 2VRBA 1ZOIA 2G9NA 3OE7D 4IGEA 3S68A 2GSDA 1FU4A 3BCUA 1R0KA 1HMYA 1Y4SA 1OBCA 4HWKA 4OCZA 3PNBA 4GXNA 1EDBA 4HLCA 3VR4A 4LF5B 2ZT6A 3HB0A 3PWZA 3R44A 4YAGA 5DI9A 3RYHB 2WUEA 5KYNA 3FBTA 1WQ4A 4ZRMA 3WYCA 1FU7A 4ASUD 4TVSA 4PZAA 2GZ2A 5AFSA 3EEOA 1FYFA 3OA0A 3OZCA 3EARA 4QAJA 1C0PA 1UZNA 4L16A 3PHJA 2XCLA 2YJNA 5LYJF 2EERA 2ZJ0A 1K88A 1S0UA 1GVHA 3IPCA 3KHTA 2W6QA 4KOEC 1Z73A 2W43A 2VL7A 2NNLD 2QMZA 2VSFA 1RIFA 3A9SA 5HVNA 3DSRA 1PK8A 1RRPA 1D2AA 2W83A 5I7SA 3J81k 5CNKA 1OXTA 3ZY6A 2J46A 2DGDA 3MXOA 4ZEWA 2EQ5A 2GBIA 1UT6A 2BH2A 1X70A 2ONKA 4M8IA 1OFUX 5EIBC 5ER6A 4CZ2A 1D4OA 4GOXA 4XI9A 1E3WA 1OWOA 1XCJA 2F00A 1U0FA 2PUWA 4Z1MA 3RS2A 1RZ3A 3DVRX 1S3FA 1CUVA 2G80A 5KNBA 1FFYA 3CF6R 3S28A 3SZLA 2PD4A 4PFKA 3A7DA 5K8UA 2QUBA 2WJJA 3CR7A 4G23A 3RC7A 5D5PA 2BSAA 5HFNA 2OHIA 1J8DA 4QOHA 3RHSA 3TEMA 2JGRA 2HLNA 3NETA 3OCCA 1SD1A 1OZHA 4HB3A 4ZEOA 3GV0A 5DLEA 2PZBA 3MJFA 1EHIA 1ZN9A 5GWXA 4E09A 1U6IA 1GPJA 3T9AA 4F38A 4YCLA 1XHFA 3BB3A 4YBRA 5AVZA 2V7EA 4ZI7B 3LY5A 5G2OA 1E5XA 2XCTB 1H1DA 1JXQA 1YZNA 1Q15A 2Q50A 1WUKS 4REMA 3OU7A 2ATEA 5CDYA 3GHHA 1I4EB 1Z07A 1XZ8A 3TRIA 5F7JA 1YZKA 1OAOA 2X6QA 4QYTA 1ZLXA 3COWA 4MRRA 4E14A 1XD9A 1G2IA 3I2KA 2RHOA 2C61A 1JKFA 1TCAA 1XELA 2Q2OA 2O7VA 3AJ8A 5TARA 3LLUA 4PNHA 3S1AA 2WPDD 1U3VA 2AE2A 2WSBA 2Q9CA 3ETLA 3AG6A 3MB5A 4HVAA 1KFJB 2C3MA 1WPXA 4PX5A 4XVCA 3BH0A 1KMQA 4M1SA 4NMWA 1UPCA 2MU1A 1KVSA 1GTMA 1ISJA 1WSDA 2YN4A 2EC5A 2RGEA 1YA8A 4MW2A 5LYYA 3VYUB 5LQUA 1T2NA 1UWVA 4CG0A 1Q6ZA 2GCGA 3BXGA 1MC1A 2AJ8A 2H1LA 2P9QA 2VVTA 7REQA 2X8JA 1QG4A 3U6BA 1NW3A 3E2MA 1W73A 1FMTA 2EFCB 2QNRA 3P97A 1G42A 3OLYA 2HU7A 5JS8A 7YASA 4LOJA 4TYPA 4UHDA 1Y4UA 1YO6A 4INZA 4OHPA 2WJPA 4XCXA 1K08A 2Z9BA 3FG9A 3OPYB 5G0SA 1RLMA 5TRTA 3EH2A 3KR2A 1I9GA 1DLIA 1PN3A 2OCBA 4R1OA 1Y82A 1GHTA 3H0KA 1G66A 2D2FA 6YASA 3IPAA 1GTZA 2P9HA 4PSAA 3TW8A 1QP0A 1G0OA 3HEMA 4LXXA 4OQYA 1QK4A 3Q12A 3HNRA 3WLIA 3UO8B 4ZYXA 1U7PA 3RC8A 4PBRA 4W4TA 2Q3JA 1P7WA 4C6RA 3WDKA 2ZK7A 3FDJA 5C37A 2H00A 4AJEA 3UGJA 4R0MA 1T29A 1VPWA 4MUXA 1C2YA 4BO5A 1KGSA 1L7QA 2BFWA 2R7MA 1XDZA 1VCIA 2PMBA 3Q9LA 4GXQA 5FORA 3GJ4A 1XNQB 3QVTA 4YMTA 3PRYA 1DBSA 1M1UA 2Y67A 4A82A 5K3CA 1VG1A 3H97A 3I3SR 1THTA 1Q0HA 4Q6WA 3EFOA 4N39A 4E1BA 5HIKA 1KH1A 3EFEA 3DLTA 3FTCA 1R8JA 1KY3A 2H16A 5DYNA 4I6JA 3INNA 1NBOA 1U7UA 3WGZA 4ROSA 3D3WA 1W93A 4JLJA 1NURA 5ALGA 1AS3A 4OFWA 3RUCA 3WDLA 5KKNB 4Y6SA 5DZSA 2CT8A 4KVZA 2WA2A 1C0IA 1WKVA 4IX1A 4KLCA 1KDTA 3L9WA 2VDPB 5EUBA 5LDHA 2P6OA 2ZAIA 3QFFA 5I9MA 1N0IA 2XADA 3IE1A 4TWIA 2A33A 2DPMA 1Y3CE 1U0HC 3W06A 4KHZA 1FMJA 5IDXA 3LK6A 2D2IA 2HWYA 4BJ5A 3BXPA 3KSAC 4H6XA 4LE1A 3RG8A 2AXQA 3OUZA 1ZESA 4LCEA 2JLXA 1D6NA 1VMAA 5CYFA 1QDLB 2YW9A 4BATA 5ESDA 3H11A 4BO3A 1RQ7A 1E8MA 4NZZA 1QGYA 1OYOA 2G4LA 2VUUA 4IIFA 1SC6A 1TVMA 2P2GA 4IDNA 1ECGA 1OMOA 2YH2A 3ADDA 5CT4A 3RODA 4RADA 2BTQB 2W70A 1Z33A 2ZXEA 2OK8A 1TLFA 3CRMA 4X6UA 3H0CA 3FR8A 1JQBA 1AM4D 3OA2A 3M2PA 3WBKA 3CO5A 4ND8B 4L4RA 1GKIA 4QXOA 5AM0A 1JR6A 1UM8A 1LFDB 4BP9A 3ZI4A 1E79A 3T7KA 1WRBA 5DK4A 3RUPA 3BM5A 4Q4LA 2JKZA 1A8QA 5HXAA 3AUJB 4QT0A 3Q85A 3NVMB 4OYLA 1H5QA 3CA8A 4IAOA 2ARKA 3MUEA 1MO5A 4YJ2A 3L0CA 1M1YB 1IXKA 3PP8A 1S02A 4RK4A 3B12A 5IVIA 3UAXA 3F6RA 3M5PA 1Q1QA 1UP4A 3CIOA 4OQMA 5JWRA 2ZI4A 2XLBA 1HZZC 2ZSKA 3VMMA 2AN5A 4F4IA 3QWIA 5JU6A 3I0MA 3FHTA 3W8NA 3SZOA 1DTWA 3H5TA 5E7JA 4JR1A 1IU9A 4R1MA 3BZWA 1MNAA 2DY1A 1EK1A 4HH1A 4XM0A 2IDJA 4WVLA 4MWZA 1CV2A 2AUTA 2OYCA 3G0IA 4BJ1A 1EFPA 2A8YA 3E3AA 4OM7A 1AN0A 1QO9A 3DXYA 5H4HA 5ILQA 3PQ4A 5M34A 2W37A 1YZFA 1B3RA 5TX7A 1M5RA 3KKMA 2G72A 3JVVA 1DMRA 3AM3A 1GD1O 2J7KA 5HF5A 1I2MA 1XUOA 3NALA 4ILEA 3WFJA 3E5HA 4CG2A 1JPJA 3X1ZA 2Q4DA 2AQKA 1K4YA 4TV8B 3JYOA 3W2GA 1I1OA 1WQ1R 1YFZA 4B4WA 2HQSA 5AM4A 4A16A 1NOIA 1A4UA 1PKEA 3E8XA 4F45A 5BW8A 2ETVA 3RSGA 1O8BA 4QBGB 2VA9A 3FX2A 2C2KA 1CKEA 3OJEA 3PNLA 3UPDA 3O03A 1YF3A 4Z4QA 1MABA 4EG3A 3F1LA 3TSWA 4HDAA 3MD9A 1DAFA 2XXAB 2C9CA 3E0XA 1JEYB 1EWVA 1CUEA 3RD5A 4YJ3B 1NY5A 2R6DA 2Q6IA 4V3BA 5HGJA 3V1LA 1YZQA 2P2NA 4RHEA 1VOTA 2QYSA 3M1YA 3CLUD 4ID9A 1G5PA 1WMFA 4YH1A 5E4FA 2DLCX 4XB1A 2IS1A 4WBXC 1ZOLA 2DZDA 4OLHA 2HXYA 2Q27A 3NIGB 2CCJA 1JLSA 3BH6A 4IG9A 1AMNA 4Q01A 4WXPA 1JR3E 3QMPA 1T8SA 1PJTA 3ZZ1A 1GCAA 5GZ3A 4P86A 4L9SA 4RHCA 5KVSA 1MDBA 3N39C 5D7BA 4ANFA 3BFXA 1M8PA 3S0JA 4N18A 4FFVA 1ZICA 5DKFA 4D9GA 2FJPA 3ZWXA 1T26A 4EPWA 2POQX 2QN7A 3GDWA 4ZO6A 5IJAA 3DZGA 4FNAA 4LE0A 1YKFA 2LNDA 5DN9A 2NZ2A 4JBWA 1SRQA 5LBUA 5KINB 5ED0A 2HJHA 4B6SA 4BEVA 7GPBA 5AI8A 5KYVA 3VVLA 1Y3AA 1QAMA 4OK6A 4XDHA 4DJEC 4F4DA 3P2YA 3CHYA 4DMMA 5ADUS 2JA2A 2UYGA 4BO2A 4DLAA 4DFDA 2CXUA 4LIPD 1DCFA 2G04A 1RRMA 2OVFA 2W00A 5LYJB 4U3JB 2Y1WA 1Z16A 3COPA 4EHAA 3JWPA 5TEWA 1I2BA 1BMQA 3IESA 5IC5A 1E98A 3AHJA 3OZSA 3P96A 2PJDA 1XTQA 5AI4A 1TAHA 5SZHB 1C81A 4LZLA 2PRYA 1C8KA 5SV2A 1N92A 3JAWB 1XBTA 4G1BA 5IYZA 2ZAGA 3FGNA 3H1EA 1JHZA 2AC4A 2PGLA 1L1FA 3FAKA 3LUAA 3TQOA 3UAZA 3EUWA 3KOOA 4RNCA 1EZ1A 2NZWA 4RETA 4INAA 3RASA 2RC5A 2FZKA 2PZLA 2VDRB 4FEEA 2XCOA 5K09A 2FN7A 1Y7TA 4LGVA 1ZQ1A 1UWLA 3AJAA 3I6IA 3M6AA 3SSMA 4HVCA 4KRGA 1ZM4A 1QWOA 2HQOA 2JGDA 3U80A 3ABIA 2VR1A 1YJQA 3FSGD 3HB1A 4QOEA 3NHFA 3PPWA 1YB1A 1P4GA 2QGFA 3LIIA 4NKRA 4WGGA 2ZSJA 4KSCA 4QNNA 2B8NA 2FSHA 1UL1X 4IR7A 2CJPA 3QIVA 1UP7A 2QENA 2ZBQA 1HC7A 2B5WA 4PLYA 3QMWA 4GX2A 4AJ1A 2XNHA 4W1SA 5JXHA 4ETWA 4ZKDA 1NAHA 1XRSB 1DAKA 1Q1ZA 1JG2A 2C3PA 1DBQA 1SOMA 3QLVC 1KTVA 4F93B 2P9EA 2JLCA 1MXFA 3R7FA 3K20A 4I4TF 5JMTA 4TT8A 1LZLA 3H1AA 4JSTA 4DG5A 4EF5A 2RHDA 2C9MA 2IXEA 1EXDA 2BEVB 1ZUNB 3MRXA 1FDTA 1T9AA 2VQ3A 3B1KA 4HQ6A 4PO1A 1QP8A 3V1TC 3EISA 1JGTA 2POCA 4AIIA 3UFBA 3VVMA 2XT0A 3T99A 1JMYA 3GFQA 2D1FA 2H4HA 4N4AA 3SN6A 5JSUA 2HH9A 3H2YA 3KIPA 4AU1A 5A3JA 2BGWA 3C8MA 3TW4A 4TMYA 3ZHSA 1T6BY 3ZCXA 3A2KA 3LQ1A 2XQFA 1R0WA 1TYAE 1OZFA 2BEWA 2DKOA 2GPBA 1P7YA 4LJ6A 2BGUA 1Y1QA 4K6MA 2PMCA 4K2AA 3AZOA 1KIFA 3LRPA 2ZJ4A 3RFXA 5K3AA 2B94A 5K8LA 5AKEA 5EEHA 5JAUA 3B38A 1Z35A 3O3MB 4C05A 1I3OA 1NM5A 5BW4A 1H1LA 5FUXA 2XUOA 3PWSA 5JV5A 2FZWA 5K9ZA 2BHRA 2DKFA 3E1GA 4HZUA 1R37A 4TS1A 1XA0A 2QN3A 3V8RA 1JQKA 2EQAA 4ZVQA 2ODWA 4XEUA 1DJOA 2YQZA 1P39A 1DTSA 2G1UA 3BZBA 5ALNA 3ACDA 3V33A 4M8SA 4D5EA 2ZYVX 4K9NA 2FEOA 3JQEA 5E1BA 5KHAA 3EDRA 1GZ5A 5LP6A 1MR3F 2V7XA 1JT9A 2Z1NA 4J1SA 3Q8WA 4OGKA 4X8HA 3ZXIA 5KTMA 1L7AA 2GMWA 2J0EA 4KR2A 3GNQA 2YWEA 2XTJA 1I3KA 2NU9A 3VV2A 3GD5A 4WKCA 3VDNB 3L7DA 5IUKC 4F3KA 2GO1A 1ULSA 2QVZX 3EGWA 3OQIB 2WTAA 3KB8A 1BROA 3ZVLA 4GR5A 4KN8A 1BWSA 1PFYA 2ZBGA 4XFJA 3AHCA 3R5SA 4ALIA 5TPZA 2F9FA 3I58A 2WWVD 3R7WB 4DMFA 1NSTA 3HACA 1ZHFA 3NFYA 3VYVA 4NV1A 5L7WA 5DHRA 3ZWPA 1Y6RA 4CF5A 3OFSA 4GRDA 1U5CA 2XCUA 3HL0A 4EMTA 4PGGA 1B93A 5EN4A 4F7DA 2JLUA 4H7PA 3NBKA 1FX0B 3QEKA 1L5FA 3JTEA 4EAAA 3JALB 4CLHA 3PITA 4RXMA 4ER7A 1KMHA 4YQFA 4WSOA 1FFGA 3PQFA 3FFAA 3LDHA 2IYWA 1RYFA 2DCMA 1F2UA 1CIJA 2FR1A 2RSLA 2GAJA 2Z2ZA 3DWIA 4HWSA 4UHBA 4DSAA 4DEXA 1TC2A 3IQZA 2M1XA 4YLYA 5J59A 1SBHA 4RYDA 3LX5A 5LMUB 2CLCX 2JJMA 4WV3A 2AE1A 3V7NA 1ENYA 2V4MA 4GRIA 3W6PA 4E7OA 1D07A 1WZUA 1HQYE 3GUVA 1T5BA 2OP1A 1E3IA 3F7OA 5CGZA 5TC4A 1WW8A 1RYNA 5JNLA 1QHEA 1FRFS 3VO9A 3DE1X 3DE3X 5E0OA 2PLAA 3UT5A 1JHXA 2OO5C 3KCNA 3SF8B 1NVBA 4HI0E 5K6AA 5A9TA 1ENPA 1KJJA 2QAGA 3QXSA 2ZBVA 4RDIA 3QLTA 3UGQA 1RWPA 4Q6BA 3HVHA 2QL6A 4QYSA 4ZVVA 4CQMA 7ADHA 1TYZA 2N1MA 1L4KA 5EYPA 3X1KA 5C7YA 2O0KA 1WU8A 1WXDA 3N0WA 1V8FA 3V2GA 3T5MA 2WMYA 3A6HA 5E6RB 4MOWA 1UZUA 1SCUB 2EJUA 1AQLA 1NUTA 2GRJA 2K6GA 1GFWA 1GSAA 1AOXA 1I0IA 1IHOA 2MSDB 3T3DA 4D9JA 3TECE 3B2NA 3ANNA 2WSSD 3PFNA 3O38A 2UDPA 1FLNA 2LCIA 3GJYA 4DBLE 2L82A 1LPSA 3HO6A 1SC9A 3WNQA 4ZALA 5J1SB 4X20B 1KERA 2XLCA 1E6MA 3PHCA 1W0JA 4H77A 4JLVA 1QMGA 4JXXA 4H7KA 1NF3A 1NF8A 3MVEA 2X7XA 3L1HA 2C8LA 1VE5A 5H8WA 2Z09A 1I14A 2R65A 3EIWA 4PE5B 1CUSA 1F3OA 1O6ZA 1Z2DA 2CK3D 2PCLA 2DUWA 3D31A 1RRGA 3R3JA 4FMBB 4PANA 2FPPB 1W96A 5JISA 3UWSA 4DV7B 1S6YA 3UMFA 1QH0A 1HXHA 3OCWA 3K15A 4GP7A 2X8AA 3SM3A 4EBFA 5L6MB 5JEDA 1RQNA 2ZWVA 2R6R1 2N46A 4LHEA 4R5HA 2AZTA 3A04A 3SYKA 1JFFB 1RQGA 2VO1A 2JRCA 3CRNA 1J2JA 3ONWA 1FTQA 4M7OA 4RVDA 5GV7A 4EHLA 1EK0A 4XGNA 3IB3A 3Q6MA 3GT0A 4FJ1A 3S55A 4LY0A 2P65A 4ENTA 4CNQA 2WB4A 4I4NA 4EI2A 5C1DA 1DBPA 1PFKA 2J5QA 3OIDA 1QIJA 3AESA 4HNAA 3JRXA 4EY7A 4UBKA 1AMOA 1Y3DE 1DOAA 3BORA 1MC4A 3ZHXA 1I4TD 4DRYA 3TXYA 4DSUA 2GYUA 5EJMA 1HE1C 3Q3HA 4DHWA 1RADA 1TO2E 4ZRDA 2DRIA 4M1YA 4YYEA 1PJLA 1Q83A 1GEEA 3QBVA 1PL8A 4H31A 1L5QA 3UHOA 4YMVA 2PKEA 3UXMA 1K6EA 2OP0A 3EVZA 1RBZA 3NJRA 1A4RA 2FPSA 1ZI6A 2G07A 4I9UA 2FXIA 1ZR2A 5HUHA 3T34A 3ROMA 3IBTA 3QJGA 1KSFX 3QWFA 3GDHA 1PE0A 5HJ7A 1R0ZA 2CCKA 2O2IA 1XEFA 4MCHA 4OEHA 4DABA 2VWQA 2WIAA 3IQWA 1BOFA 4BPRA 2PS0A 1SKUA 4I3GA 2XA2A 4M0CA 2A9KA 2IYUA 4H15A 1QYRA 4RIFA 2HMTA 4IFTA 3ZCVA 4AJHA 1V1MA 1YQEA 1M7GA 1ECBA 1WUJS 1V1JA 4MS1A 4UBIA 3WV4A 4YT2A 4K03A 1JNXX 1N9KA 1ISMA 4U8HA 2P6UA 4F97A 5FH9A 1DWOA 1N8TA 3CB4A 3N2KA 3NWEA 1DEHA 5C9ZA 2VKQA 4EG1A 1XA4A 3PSAA 1OY1A 3LT2A 3JZFA 4JENA 4IDGA 1S8FA 4D82A 3G49A 1I3LA 2VLBA 5BQ3A 3A6KA 1H0RA 1IWOA 3I64A 4XYLA 3D8TA 3ZV6A 1NVWQ 3IO5A 5BMVF 2OBYA 3MBKA 4JLWA 3TJRA 1I13A 3KD2A 4Q3KA 4Y7CA 3H65A 1T9DA 1XRPA 2P1RA 3Q7PA 1SA0B 3G2OA 1IZYA 1RM5A 2X2EA 4YREA 1GPUA 1Z34A 3Q3VA 3B1JA 3R3VA 4QUIA 4L8GA 3RAGA 3URMA 2OA0A 2AFIA 4JLPA 1BYIA 3OIGA 3ZWKA 5ELMA 3ZYZA 4BUZA 3ZR4B 5JQGA 2R97A 3PFFA 4QC2A 1UMBA 1VJCA 1C7RA 2V55B 3UWKA 1PJ3A 4WOPA 3T4UA 4NP6A 1UBCA 1D2HA 5GGXA 1J8MF 5DLQC 4CHTA 2AN1A 3QVUA 1JG3A 4WPGA 2GGSA 5I7AA 5JDCC 3G2PA 1YAJA 3FVQA 4EGFA 3HXQA 1QPZA 3M33A 3PV0A 1BVHA 1WHSA 3FHOA 1XWFA 3DV0A 2FH5B 3QXCA 2ZJYA 3MWFA 3PXDA 4M0KA 3GDFA 2JHFA 2FA9A 2PMDA 2IQIA 3IYLW 5IK2D 1GU1A 4O4IF 2QSYA 1NI4A 2YIDA 2AXPA 1PR1A 4HJXA 3GRZA 3L02A 2OG2A 2HA5A 2IPNA 3PHIA 1KDVA 1BH2A 3X2EA 5LFAA 3DNPA 2JD2A 1O6GA 1CETA 1LNSA 4A73A 1YFKA 1HLGA 2FGKA 1KZ4A 1LDGA 3D3KA 4Y1GA 5ALPA 3Q8XB 3OKCA 4R2JA 2R68A 4DDUA 4WFQA 2P91A 2X42A 3K8QA 1RNLA 4X8OA 2FUNB 3PA6A 4JP5A 3QVJA 1PT5A 5ITWA 1QR2A 3RAEC 2DUMA 2FDCA 3IVCA 1ENZA 4RD2A 4L5AA 3ENVA 3DXFA 1ZVMA 5FTKA 1TVEA 2GCPA 1BFKA 2FUG6 4BVBA 2XYHA 2W4MA 2XKAA 3CZQA 3LQYA 5TPWA 2ZZMA 1XPOA 1QTRA 5KQPA 4PZDA 1N57A 2W6CX 2FW7A 1RLIA 2P30A 4F3NA 1DQYA 3KO8A 1V0JA 4RW0A 3O90A 4BFUA 2A1IA 5BSEA 5GIOE 2Q1SA 4HQOA 3W3ZB 4DL9A 3U4QA 3B85A 4NONA 2QZ4A 1SBCA 2Y1XA 4GT1A 5TF0A 5EXEA 2UYCA 4MWCA 3ZCSA 4CLDA 3E81A 3KXKA 3OQMA 5H81A 5F51A 4HQRA 2W8BA 2WSIA 3TZCA 4DYDA 1XEAA 1ZMBA 2V96A 4JQYA 1PR2A 4OHZA 1P73A 2JEZA 3JASA 3ND7A 2DERA 4P98A 4YJGB 1Y5LA 4LG1A 1YL5A 1JTVA 4F1JA 1XAHA 1SHKA 1KZ6A 1HE3A 2HDNB 5IARA 4JELA 4UJ5A 5F73A 4LK2A 4LVOA 4RLQA 4EHHA 1EDDA 4KWCA 2NAPA 1VPLA 1A9OA 3EW7A 4AMUA 3ILHA 3UXHA 1XFAA 3STUA 2H7VA 3CXRA 1YIOA 1TT5B 2GD0A 2HQBA 4OGLA 1YI8A 2VDOB 4BFSA 3HXLA 1UH5A 3F5MA 3BSSA 2WTEA 4L57A 5KZMB 3I04A 5T6BA 3F6EX 4TTIA 5GPBA 3DR5A 3IAM1 3U49A 4YT8A 3ZD7A 1E0KA 5LR6A 5JE8A 1I36A 1YB4A 1DAHA 2CSUA 1GA4A 2VKTA 3AK4A 5A4AA 1M3SA 3X2FA 3M0EA 3TR6A 5C8ZA 2QSZA 1FBNA 1TJ3A 1X39A 2UUAB 3RVSA 1NX6A 2WU0A 2JJ2D 2QTHA 1U7XA 4N0PA 3QPVA 5HP4A 2IXTA 1QF9A 1NBEA 2NSDA 3GBSA 3JRWA 4RFVA 1WG8A 1OX5A 5BMOA 4KDRA 2QMEA 1QZXA 1KYWA 1ST3A 2FX2A 2Y1DA 3ESXA 5E6SB 4C04A 4EVSA 1OF1A 1RYZA 5EXTA 1DRVA 4E5PA 1Y4ZA 4M53A 3EVFA 2QPOA 1UKYA 2QV0A 3B48A 2YNMA 3PEWA 1XQVA 2C2OA 3AVYA 5DYIA 3SF0A 1PV4A 3ZIDA 3SHVA 3CV3A 1RXYA 3TTTA 1MGOA 1ZBDA 2Q21A 3GRUA 1KTIA 2DTEA 5EHQA 5EQTA 4Q05A 3DMHA 4UM8B 1XI2A 2KSQA 4H3VA 3ZDYB 5JZSA 1WTAA 4DLVA 1LW7A 2YWRA 4AO6A 2PGJA 4NCHA 1SUWA 5BPHA 2FQYA 4FLEA 3THRA 1IE3A 1PF7E 1ZX1A 3EGEA 3F5QA 1UBTS 4UAVA 1ARZA 4UUNA 4CTJA 2XUAA 3KHSA 1OLSA 2WAAA 4QXPA 1FL9A 1UFOA 4U9IS 3OQBA 4O63O 1BGVA 4Y8VA 1G38A 5FWXB 3VMFA 2PYZA 4G1UC 5AVQA 4K9KA 2AKYA 4RLHA 5I01A 5ALSA 3QVKA 3OQPA 4X8LA 4MI6A 4HNTA 4IMJB 5JAZA 5D7NA 3VTAA 4TSFD 4S3MA 2E5LB 5LQRA 3R6WA 2GN8A 3NTLA 1HK7A 1F51E 2HPAA 3I6QA 1UUFA 1LX6A 2XB4A 3L5OA 4JDUA 5FOUA 4UOZA 1X86B 2F4NA 2OXCA 1OXSC 2Q46A 3EG5A 4ZTUB 3FR7A 4ND3A 3K0EA 1LB1B 5ICFA 2OGUA 2ZU6A 2IF0A 4NJEB 3N2GB 3H1BA 4NNOA 1P8JA 5A02A 5CA1F 4RXTA 2FETA 1SWVA 3AFOA 3QUTA 1Y5MA 4HWRA 1DX4A 3R6LA 2WVHA 3SEFA 3RYFA 3IQIX 2B5OA 3NU1A 4YQYA 3RRZA 5F21A 3ROXA 4O2AA 4MEJA 4OOFA 2TS1A 3DBIA 4LTMA 3DUWA 1E1RA 3C3PA 4X95A 3EXHA 4JP8A 1NJ6A 2WWGA 2P5YA 2O4UX 4MIYA 4INPA 3QHQA 2Q3LA 4MV4A 3KXIA 4HD8A 3N8DA 4YCJA 5FAXA 4X1IB 1Z5OA 1E2EA 2J67A 3G2QA 2VUIB 4YPVA 4OLFA 3K16A 4DEVA 1D0IA 3PDIA 4ZJZA 3MTDA 4AN1A 1F6DA 4D0GA 4O2BA 1YE8A 3RS7A 3VC3A 2RDMA 4MRSA 1KARA 2C2YA 4M4SA 2I6UA 4J9UE 3CUVA 5FLEX 5HFJA 5CDUA 4HB0A 3KQVA 4PFSA 3TGWA 3TW6A 3IL2A 5C3MA 1Y8AA 1X7WA 2EKQA 2ILVA 3AEZA 2PH1A 3C45A 3NTUA 3PCTA 1BXRA 2FG5A 4D97A 1M10A 5B36A 5FUMA 4CNBA 1FFXB 1WNTA 2L42A 5FOSA 3NNNA 1ZN7A 3FCSB 2XVYA 4BMYA 3QKRA 1TTPB 3WX0A 1LI7A 4DDWA 1S1MA 3IODA 4B7XA 2XQJA 2IF2A 4XW2A 1JXMA 5HKBA 4LMRA 2C95A 2IV3A 1YZHA 2BGNA 4A03A 5BN5A 1RMTA 1RLJA 2JBWA 1C3VA 1T8RA 3PS9A 1CF2O 1I6LA 1E7QA 2AXEA 4KC0A 5A4JA 1R4AA 2Q6OA 2QEQA 5JDIC 1JYEA 4QXMA 3HB5X 4FMPA 4KWIA 4HAVA 5JWOA 1G4HA 2E6KA 1LBIA 3V2HA 2IQ5A 3ZVNA 3R9IA 1E2LA 3JVIA 3USZA 2W22A 1QPBA 1ZUHA 5KYUA 4MLZA 4FR5A 1RT9A 2Q3CA 4TXJA 3EPKA 1WXIA 1KDYA 4C3UA 1JI0A 4HOYA 3FPBA 3IXLA 1Y8RB 2VHTA 3OLZA 1SG6A 1XQYA 2HMUA 3CH7A 4GO1A 4URUR 4YO7A 5IWCA 3DTVB 3ZKWA 1M2FA 1SQSA 2QP9X 5EMMA 1PFWA 1RZRA 3MLBA 4D98A 4UPVA 2J3QA 3TKAA 1QYVA 4IHQA 4JIMA 3IEVA 1B8OA 3A3KA 1F2TA 3I76A 1WB9A 4TZ6A 3QWBA 4WECA 1AXEA 1LBHA 1FS6A 4KG7A 3UK7A 2G5CA 3EC1A 1J7KA 2Z4SA 4NV0A 4B3MB 5KSPA 2VDQB 3WLEA 3PRHA 4N1AA 3ADCA 1DIHA 2Q62A 4DIEA 4C4AA 3WJ2A 2PX4A 2QUZA 2AXNA 3T3PB 5AVUA 4PTZA 5LQNA 2C4UA 2RK6A 4ZK6A 3RC1A 1EGQA 5A71A 3TVTA 1J22A 4ZHQF 4MEBA 1PL7A 3KFLA 3LJKA 5FXMA 2YQ4A 3UUFA 2BGTA 4Y2UA 1PJBA 3PCXA 2W6OA 3H8VA 4JLBA 4CV2A 1J2RA 3NYQA 1LRJA 5EJ6A 2FPOA 1CS0B 4NJMA 1D6MA 5T3YA 1NGSA 1SVKA 3JYLA 4XQ0A 2HV8A 3FHJA 4I5DA 2HMAA 4ZKEA 3WGLA 3H4IA 4I66A 1C1DA 4DC1A 2B1RA 5AW5A 4LW8A 3DVSX 1QCZA 2O6HA 4JI0B 2AEJA 1QV9A 3UJBA 4CCAA 3SXUA 2O0HA 3JZDA 2Z58A 4E08A 4OHXA 4MAAA 4L7VA 4KXYA 4EJSC 3WXMA 3QW2A 4ARCA 3FCXA 3DC2A 2WJYA 4LKOA 4POAA 4IZHA 2O48X 4DB2A 1VPDA 4TT3A 1GUAA 2AOUB 4P80A 4D74A 1KEKA 8ATCA 1ZCFA 1XRNA 2IEZA 4YACA 5CXQA 2YV1A 3UIEA 4KTTE 3EGCA 4KODA 4NNPA 1WD7A 4TPKA 3WKDA 1LI4A 3E7WA 4ND2A 3B7GA 5CFMA 4BQIA 4MCIA 2EBWA 2YUIA 4ZDWA 5CTJA 4BVAA 4CLRB 3I62A 1E4OA 4BL5A 1KQGA 3OX4A 1WY7A 5K8JB 2O8BA 1CUZA 3QU9A 2AEMA 3GLTA 2WJ3A 3IT0A 1CNMA 4NBKA 1I9CA 3EGDB 4QDKA 1AF4A 1EEHA 2F1OA 2R6GA 2XUJA 1RQRA 3E05A 1X94A 3UQZA 3ROQA 3AUKA 4TM7A 1E94E 1VE1A 3GELA 5DIFA 4UM9B 2VP6A 1UEJA 1CF4A 1W4AA 2IPOA 5H02A 2XE7A 1W4LA 2WQ6A 4IIGA 2PEYA 1F7UA 1T3TA 1M34B 3SE7A 3S2GA 5AJWA 1MC5A 4NG5A 3QOXA 4AKSA 1IBCA 3OCYA 1EDZA 2G8NA 3P5BA 5DU2A 3WDSA 2QL5A 5FUBA 4D9BA 3IUYA 3IR7A 4J49A 5FBKA 1MKYA 3GJ8A 4LRTB 2SICE 2Z9CA 3GEGA 3TLGB 4DCUA 1ZVKA 1XZBA 2YZ7A 4MQLA 2IHNA 2NTJA 4ALKA 4PHHA 4Y2JA 1Z83A 1VG0B 1GPBA 5HHTA 1DKQA 4Z4EA 1E1NA 1IWBB 5L4NA 4NV3A 2ZYGA 4GQAA 1YZYA 1VFNA 3AY0A 1VL8A 1NQWA 2J87A 1D4ZA 3D6NB 4PAWA 4CMEC 1F2VA 1Q17A 3AF5A 2DY0A 4H2DA 3QVGB 1BXGB 1ZAKA 4QXRA 3N6RA 4AY4A 2OKCA 5HE9A 1BN6A 1CULC 2FPMA 1PQYA 5MFPA 2EP8A 5DM70 1XROA 1Z29A 2VG8A 1CZOA 4PG6A 5E7MA 5FOWA 1DKMA 2ORED 1DIOB 1VIDA 1ECCA 3C4QA 3H8SA 4GWLA 3SIWA 4LNAA 1JG4A 5DGHA 4E70A 1D2EA 2CVZA 3F6PA 4EFMA 1Z6XA 1GG9A 2JVJA 3BMQB 4OHVA 1PNTA 1PP4A 4DR3B 4YO8A 4YC7A 1E1CB 2X0JA 3TIVA 4IIDA 2VSOA 3WOHA 3ICQB 1RTTA 1SK9A 3RF7A 4BGEA 4GD3Q 1M2OA 3IMKA 1YVRA 2ZIXB 3E5MA 4DLSA 1U3WA 1RKXA 2QE6A 1OVMA 2IOFA 2ZBUA 2QR3A 2X7HA 1GLVA 4Q7KA 1H0SA 3LA8A 2CZCA 4MUMA 2II6A 1YNOA 3FMVA 1IXZA 5JWHA 1EQUA 5BSWA 3HU2A 1M2EA 3LVBA 1O58A 4AQDA 4MRMA 1M7BA 4RTSA 1DEKA 2PCJA 2XJ9A 3GNSA 5I9TA 3GRYA 3PQCA 3TFWA 4DLPA 1K92A 4UNPA 4V1CI 3I28A 4DMUB 1P77A 2VI5A 3HZHA 4ED9A 1NP6A 3L8GA 5FUVA 1SRRA 1WZIA 2P5SA 5E6UA 5T4HA 4BASA 1DQNA 1EU1A 3BA6A 3BGDA 1H2RS 3ZHBA 4YRNA 4ZYLA 1BNCA 4BGDA 3R40A 3QLUA 5K51A 1ZA1A 3HJUA 4GWKA 1GKLA 3T5BA 1OYVA 3T5CA 3UMBA 4HEA6 1AGPA 2XODA 4CXMA 2NZ8A 1JQJC 2HA0A 3WADA 3OCZA 1XAGA 4F5EA 2OSBA 4ENUA 4QLBA 1ULZA 2I4NA 3SOZA 1PHPA 1Z4NA 4OSEA 4UUBA 1FFCA 1UXHA 2BW0A 2I8LA 5EWMA 1JKJB 3N6VA 1V5FA 2V45A 4IW3B 4ZIRA 2Y05A 4NXNB 2XYRA 4IOMA 2EG5A 1PR0A 3IILA 4C4ZA 1ATZA 1B2LA 1NVMB 3O3CA 2AD5A 3DDCA 1Z7GA 4Q39A 2ACEA 1RAEA 4L15A 1DBRA 1X7GA 2W2KB 2Y0DA 2QUIA 3TGPA 4IHJA 3ESYA 3NDJA 3VNQA 3HYRA 5DEOA 3AG5A 3W6OA 5FNVB 3WWCA 4DZZA 4FIZA 5K99A 1CCWA 5FFNA 3H2BA 1P17A 4E51A 1IBRA 5CA1B 4P83A 4I1RA 3NHLA 1P9OA 2AR9A 3EMKA 2L18A 4TXMA 5KREA 5H5JA 3T9FA 1TM1E 2VJOA 1KNQA 1E66A 1HNNA 1TMOA 3LGAA 4QD3A 1O1YA 4C21A 2MT9A 6ADHA 3AXSA 3N05A 1EKXA 2OILA 4OF4A 1JIXA 3DDUA 3UC5A 3ZI7A 7MDHA 5JTUA 1RHUA 1ZIYA 3OZIA 5HK9A 3AHIA 5KWEA 1ODTC 3O84A 2G0NA 4PSCA 1QUFA 2YUTA 4FD3A 2IHZA 4RAQA 2J0UA 2FVXA 2J6HA 3U3JA 4BQQA 4M89A 4W7IA 4ZCTA 2QD3A 4ZOLB 5B2EA 1PQUA 2OD2A 4P7GA 3QEAZ 1KOGA 2H2DA 1XR3A 3PR1A 5BR1A 3FYCA 5EWJA 4IG4A 3HM9A 5IU6A 1YR7A 3RNLA 1LVGA 3GMTA 1RYHA 3HKDA 4DAOA 4HP8A 4M37A 1ZXXA 3DHWC 1SG0A 1YS7A 2AFVA 4RZIA 3SHQA 4H4EA 1FZQA 3L6DA 4GZ3A 1UBEA 1WCV1 4J2OA 1JUDA 3RVMA 4F86A 6LDHA 5HRAA 4EA7A 1SKYB 1E2MA 4EPVA 4FSHA 2GESA 2BUAA 2HAEA 2WKPA 5THQA 3M4ZA 4HMOA 3P71T 1NMXA 3I6BA 4LZJA 3TXAA 1T8YA 1VLQA 1QIFA 3MWEA 4M8NE 2P3QA 2PN1A 1X3SA 2DPXA 4NYMR 3SHTA 4QVIA 1NVGA 3D6FA 3M9XA 3VX3A 1TEHA 2E87A 5EOVA 2IKQA 2HJSA 1X8JA 3T7SA 4D9IA 4NFYA 3JQ7B 3HKCA 2QJWA 1ZINA 3LOPA 5L40A 3C3CA 4FDUA 2NN3C 1YU9A 3DTVD 1MJGA 3PT9A 1V41E 5JAQA 1RXCA 3IXMA 1Z12A 2JFBA 3KQPA 4JNKA 3RJMA 4E5NA 1OD6A 2HUPA 3O6VA 4J7XA 1H8HA 5I4CA 2X4GA 5KC9A 3J80A 2REQA 1V1RA 2IL1A 1UZMA 1C1HA 5LP6C 4W5OA 3IP3A 2C7GA 1NW9B 1RRKA 1WMBA 2FRDC 3OJXA 3GEEA 3LXRA 1DKPA 4I9GA 2ZFUA 3IP1A 2OXEA 4KFSA 2GAAA 1WKBA 4GGOA 3ZWBA 4WDQA 4RD3A 4BHTA 3KVNA 4YCAA 4E2YA 2FDRA 4TROA 1DHRA 1AKUA 2HSDA 3ANTA 3LOUA 3MG9A 4IIJB 1M83A 4X84A 5THKA 2K7FA 4HGOA 5BQOA 5B58T 4HGQA 1A9XA 1U2SA 3FOCA 2CNKA 3MCWA 3DKVA 5BWLA 4L73A 3RIHA 1N5OX 2L69A 2PMWB 1QCYA 2LRHA 4EA6A 1ZL2A 3AY7A 4JK3A 1A77A 1BD3A 2VDKB 4V2UA 1CUFA 3BYZA 2EBHX 4NE2A 5CCBA 3CNQS 3DMFA 2ZBPA 4WESB 2V97A 4DG9A 5FA6A 3NCTA 3PJEA 4KDCA 1L6IA 1LQ2A 2E21A 4OYRA 4QODA 5JAMA 2MSLA 1Y1KE 4FE7A 2VDLB 1YDFA 3KEMA 2A86A 1GV1A 4XLLA 4J7AA 4R3WA 4JEIA 4B09A 1SVLA 1NW8A 4CM5A 4K6HA 2OHJA 3CTPA 4U7GA 3GIDA 3VJLA 3AIOA 3QXHA 2V6BA 3JD4A 2GM3A 3IAUA 5HX7A 2ODQA 4ZC8A 4B46A 3C3WA 4MW6A 3T6KA 1SVOA 1ESEA 2HU2A 4EUEA 4R0VA 3FOBA 1QUEA 3AU8A 3B6EA 2WF5A 4WDRA 1YUNA 2PANA 4I50A 2X0NA 4EA9A 3ONEA 5K8CA 2QBYB 2ZR8A 1CRPA 1HT1E 2LP4Y 2XUQA 3I45A 4O1HA 4XDYA 3KTDA 3UBMA 1CEEA 1QKJA 2AFIE 4MV3A 4B40A 2BR4A 1MT0A 3UG7A 5AK6A 521PA 1GAWA 3OX3A 2CHQA 1DNPA 2I76A 4P4SB 5DE3A 3RARA 2VWGA 4E2WA 4C2UA 2Q5FA 3E15A 3C8UA 3LY9A 2FR8C 2AIRA 4WN9B 1JQAA 3C48A 5HQJA 4R7TA 2WHPB 4TRRA 3RHFA 1I33A 5BN3B 4UM9D 5IRCD 2Y68A 2IXAA 4CU2A 5LSAA 4HGPA 1P81A 4QU8A 4OXQA 2GEBA 4R6XA 3QKWA 5KHOC 1WVIA 2V0GA 4V38A 3DPSA 1CQIA 3DD5A 4EKYA 4N3AA 5IVPA 3U9LA 3MWDB 3VISA 4TQGA 4UUOA 4JMPA 3U0BA 4EQZA 1DQZA 2YXBA 3R0VA 5EUQB 1FRZA 1UC5B 4FBMA 4QQFA 4ETIA 1WUYA 1UBMS 1YBFA 2A0UA 2HC9A 2P4HX 2I55A 6GPBA 3WL7A 2AMVA 1OR8A 1PUXA 3QVSA 1WVMA 4EJFA 1X19A 2HU5A 1BE6A 4JA2A 5BP7A 1EAMA 1VQ1A 2NXJA 3A11A 1HOTA 4MA0A 1U4OA 4IH1A 4XIGS 1T3GA 2AOTB 3IVXA 5IEJA 4Q1BA 5KMGB 4TTRA 5G3YA 5DBHX 2NZXA 4NATA 4YAFA 3CZPA 2QM0A 1ISIA 1Q2UA 2LCQA 4YP5A 4EL0A 1TIKA 4CYMA 3A36A 2B7CA 3ZGXA 1RACA 2P6NA 3AETA 2E55A 3BKWA 3T8YA 4PGMA 1BFUA 4EKEA 1C1YA 3OOYA 1FYXA 1U8CB 1W9MA 1JA1A 3DYVA 4RPGA 4LC0A 3ZU4A 3CEJA 3D4PA 3F3SA 4L4UA 2JW5A 4EO7A 4LBWA 2MINB 1BGXT 2XV1A 4Q9KA 3RRXA 4BMXA 2Q41A 4DCCA 1NVKA 4P5DA 1PWZA 4QEKA 2F1HA 4QGHA 3BC1A 2IUSA 2VP4A 2W8ZA 4QTTB 3ORFA 1R4MA 1IK4A 4EYOA 4I9FA 3KQLA 4ZCQA 1IM8A 1XWIA 2A9JA 3MMZA 3R0ZA 4ZVRA 1G8JA 4DQDA 3FLAA 4DR1B 2QN9A 4EATA 1NX9A 4D9NA 2FPRA 1CUHA 4YNBA 2P40A 1GYPA 3K9WA 3PGXA 1N2XA 5HKLA 3RSFA 2GBLA 3N5CA 1MJHA 3PXAA 4IKOA 3V3KA 4C88A 1W36B 3K9BA 3PVCA 3KKZA 1X8KA 2HW8A 3COJA 1QHXA 5BV2P 5G1PA 2QF7A 4BB5A 4NARA 4J0HA 4OL0A 5COBA 1CIVA 3TM4A 4G5YA 2ID9A 2ZYTX 5F77A 1MOZA 2RK4A 4WJZA 4JJKA 3ZQKA 5CT8A 2P27A 4U6QA 5A3QA 1LNQA 4C1NA 3OJLA 2F2TA 2NV6A 1R7RA 5C35A 2IX3A 4OX9B 1MDFA 1R9NA 2GASA 2OBNA 2UYQA 3A3OA 3H7AA 3L1UA 3OM9A 4PX2A 4QREA 4BJ6A 4DA4A 2X2OA 4PBTA 2ZJOA 2PV7A 2YVQA 3AEXA 3BQ9A 3RLFA 3HYSA 4K8OA 3EAGA 3WGTA 4U7WA 1N6NA 2W6ZA 3W2HA 3JQGB 4KN9S 4PQEA 4PYKA 3O92A 4WJKB 5JOQA 1DKLA 1ULBA 3GFBA 1AXRA 2ZROA 3L92A 3BQMB 3S2UA 1RM0A 2XTZA 3DA8A 4QOSA 3X1DA 3AF6A 2L2QA 4CWAA 5B3KA 3IMCA 1NHWA 1FW8A 3RBXA 2P2DA 1DKOA 3GGCA 3KVOA 4CR7A 3RI3A 2BKXA 2GX6A 3Q7IA 3KZCA 5GGYA 4HVLA 5KIAA 3QKSA 1EPUA 1F5NA 3ZV3A 2QQ5A 3O95A 2BFBB 4TXNA 2BGGA 4NTZA 2HBYA 2RGNA 3LCRA 2XNCA 3H2IA 3LXXA 5TQ2B 1E6CA 3VU9B 5JBNA 4C01A 2GJ8A 1KFEB 1NXXA 1KA9H 2WUFA 4ZDIA 4ZYVA 4PZ9A 5LMNB 3VQTA 5EQDA 4HXYA 4PXSA 2J6BA 1AS0A 2ZB8A 1RYEA 3ETEA 3G6KA 4G0VA 2C77A 1EYZA 3L1VA 4CMKA 3UYKA 2VXOA 3R3UA 1UT5A 5DCLA 4ENSA 4FJ2A 1NVVR 2HNBA 1EWTA 3PPIA 4OIMA 4XRGA 4NEQA 1T4GA 5C1PA 5A5GA 2HPVA 4BRWA 2GFIA 3GMDA 1UDRA 4BMOB 5K0NA 1SUBA 4FHDA 4D8TA 2Q45A 3OQVA 5JAHA 1YVPA 1Y5RA 4ALMA 3SWWA 1IBLB 4MDYA 2IYFA 4BCDA 4OP1A 1UKVY 4AN4A 1OH6A 1P5HA 2NTEA 3WWZA 4NESA 3WK6A 4PW0A 5K3EA 5LXTB 1NR5A 1TEVA 5TDHA 5ELXA 4JOBA 4QTZA 2CKMA 2P41A 4ECEA 3OZEA 5AESA 2JVKA 4Q9JA 4DCSA 4QQ8A 3DFFA 4LS3A 1X2EA 2NYVA 5IN5A 2C00A 4FGSA 4JUDX 1QIMA 4XPZA 1QE3A 2B2CA 5B6IA 1C7JA 1Z7YA 1PGJA 2R7KA 3O0TA 4WK0B 3V9PA 5BSMA 1O57A 1VHQA 1OBVA 4XLTA 2EIXA 3B9BA 3Q3EA 1TVKA 1EVLA 2D0OB 4WNAA 3WICA 1MVNA 3CPSA 2B0CA 3DEFA 3MFQA 5F52A 3FROA 5BVHB 1NQTA 2HGSA 4JR2A 2DWPA 3PB3A 4A0FA 2VJQA 3QX8A 1REQB 1FEZA 4HLNA 1GTRA 3RR2A 1ZM3A 3KJFA 4X1KB 5JXGA 1WXHA 1CQPA 3LV8A 4OJTA 1FTWA 4OAOA 4MI9A 4X54A 5AOBA 5IBPA 2WWFA 2QD2A 3GJ7A 3JQ9C 3N1UA 4GLOA 5NLLA 4GZ5A 4WHMA 3KL4A 4UEKA 2EGUA 2ZQ5A 2Z6VA 2GYYA 3N0VA 1B0UA 3W9BA 4UOEA 3O8DA 1H2HA 3EIFA 3D7LA 2JEYA 4XR9A 3QF7A 2WIKA 2R47A 3TX6A 3EZ7A 1RRCA 1E7SA 1QHNA 2W7TA 4MGYR 3ST7A 4KX3A 5U4XA 2AMFA 4X7PA 1UKAA 2SNIE 1C14A 1ISPA 1USIA 1CJVC 1R6VA 4KXUA 2RD2A 2E2WA 1C4WA 1KJ9A 1O03A 3M4XA 3PGVA 2RBEA 2C7PA 2YJTD 4XGQA 5F7OA 4FEYA 3HMQA 3V8QA 1BDIA 3CSDA 4ND7A 2JATA 3VGJA 1VA5A 4C22A 1W94A 4KACA 2ZI7A 5GAJA 5KJCA 3IIIA 4GYWA 5KNDA 1Q1AA 3Q3JB 4NXMB 2H18A 5CBPB 1S3SA <