2YVUA

Crystal structure of ape1195
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
KCIEKGIVVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEPPENPQLVLDTESNTIEHNVSYLYSLVKAVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Crystal structure of APE1195
rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 71
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yvuA00
3CRW1 1E9DA 3CF2A 3UK6A 1PVOA 3MGCA 2FA9A 4IVPA 4LV5B 4Q7KA 4XSGA 3QUSA 2NPFA 2O8CB 3VR5A 2V1XA 3OHMA 1CJKC 4CW7A 3SYNA 4B73A 1JAHA 4LPKA 1V5WA 1XEFA 1S1CA 4CT4B 3K0SA 4B43A 4DLSA 2WTUA 1W1WA 2CK3D 4B6FA 4HLCA 3W6NA 3QJYA 1W5TA 4W5WA 3HJNA 2XTZA 2GDJA 3L43A 1UADA 1GL7A 3ZIAD 2RCNA 1E3MA 1U0LA 3LVQE 2IUSA 4RY2A 4LHXA 1XMJA 4MA4A 3N5CA 4PAOA 1OB5A 2OFOA 3QKRB 2ZSEA 1G17A 2OCAA 5GJVC 2GBLA 4LJ9A 2JLUA 5C4GB 1P60A 3ZIAA 1XMIA 1LF0A 3K09C 2B21A 1VKJA 3TQFA 1KI8A 2EQBA 1KNXA 2JASA 3SQXA 3TUZC 2XAUA 2HF8A 3P20A 2V55B 3B5JA 5EJEA 4BASA 2YJTD 2OO7A 2BBWA 2DFLA 1TQ4A 3TLXA 1JQJC 1US8B 4IXMA 5DISB 5C4MA 1G8FA 5FTKA 2C9YA 3L0OA 2HXSA 5AUQA 1KIMA 3GLHB 2BMDA 3EZ6A 2ZR9A 4QNRA 4B76A 4DCTA 1W7AA 1PV4A 5DYGA 3VHLB 3HP1A 3IQWA 4ACBA 5JCZA 1MOZA 1YZGA 2GZHA 3BC1A 3TK1A 4MUBA 4LJYA 1SGWA 4KAXA 4C0AC 4NDZA 3WBKA 4C0HA 3C16C 3EPLA 1U0JA 1Q22A 2OSBA 2DPXA 2LWIA 2YOFA 4LJ6A 2BJWA 3VQTA 2QP3A 1XZPA 4TQUS 3BFVA 4TTRA 1JJVA 3X1YA 4JL5A 3VKHA 2V8OA 4TMXA 1YR8A 3WBJA 2QPTA 1SZPA 3NHAA 1P9WA 1C9KA 1U8ZA 4XWKA 4IDPA 2DWOA 3A1TA 3NH9A 4N0DA 5FL7D 2KBFA 3BB1A 4JBXA 2C04A 1DG3A 4URVR 1B0UA 3ASYA 2D2EA 1K5DA 3PJRA 3WMGA 4OHZA 2PL3A 4ARZA 2R6FA 5A4JA 5J5CA 2RGEA 4GOKA 3EASA 1ZU4A 2A3RA 5EXXA 4JKIA 5HZHA 3IKJA 5BWMA 1NG1A 4NMMA 5FFMA 1YU9A 1KTVA 4GFDA 3B78A 1OE0A 4KO8A 1T8TA 1P9RA 1KO8A 1II9A 4JVSB 2CL0X 4BUJA 3T1TA 4OQXA 1XJQA 3SR0A 3NTUA 4AI6A 3BFKA 5EE1A 4EPWA 1HE8B 5JSZA 1M8PA 2P6NA 2ZAMA 2BKEA 3BFXA 3HR7A 3GLGA 3QKSA 5DGXA 1ZJ6A 4RSGA 4BZXA 3V4FA 1P61B 2AHOA 3NKVA 3THXA 1MRSA 2NPIA 4BFYA 1DAKA 1KY2A 2C78A 2FJUA 5FOVA 5LD2B 5JHHB 1JQLB 4L16A 1OXVA 1VCMA 4NCJA 3U4QA 3G5UA 2IS6A 4GNKA 4LJ7A 2IYTA 1F48A 3FE2A 1UAAA 221PA 4TMTA 4QGAA 4BFWA 1KJZA 3QPWA 2XNSA 3AQ4A 3OEHD 3LBHA 1SVSA 2CNWD 1ZC3A 4D25A 2ZSFA 4AG5A 4V0OA 1H8HA 2QI9C 1QZXA 1F6BA 1KZGB 4U00A 4D26A 3B9PA 4RZ2A 3EA5A 4Q66C 4XVRA 5TB5A 1M34E 4MRVA 2B7CA 4LBWA 3OEHA 1S3GA 4G5OA 4U02A 4MKGA 4ZKDA 3EG5A 2CNWA 3NBYC 4DDUA 3VR1A 2P5TB 2YWHA 4KVGA 1ZRHA 4PANA 2OFXA 1NBMD 4XVQA 1DAHA 2AFHE 2CHVA 4AYXA 5HZKA 2K5UA 3A1WA 3GLIE 4NU0A 1Z0JA 1KDOA 3O8DA 2WWWA 4QBHA 1WA5A 2BMEA 3FOZA 1QHHA 1OH7A 1VMAA 2WSMA 1T5IA 3U60B 3ZD7A 3U44B 1TF2A 1QBKC 4ZDKA 3SBDA 4ZI3A 1SVIA 3OIYA 2ZANA 4X8LA 1UFQA 5AJVB 1KKLA 1TPZA 2AXPA 2XSZA 3NBFA 4JLMA 4NTZA 5CIWA 3CLVA 3PVSA 2WV9A 2D7DA 2DCUA 4HAXA 1AGPA 2QP4A 4RZXA 4BQSA 1Z8FA 2P0EA 3LBIA 3OAAD 3TE6A 3WXMA 1ZBDA 3V9PA 5HTKA 4DLZA 4HB0A 4B3CA 1VECA 1IONA 3PUWA 3R9WA 1DVRA 1KMHA 2FG5A 2PX3A 4LWZA 3RC8A 4O25A 2H1LA 2IYSA 2IYUA 3DPUA 1Z6AA 1D8TA 3ZZTA 2ZRJA 1G8YA 1PUJA 4PC3A 3O8CA 1YRAA 2OZEA 2RGGA 2QN6A 2O5VA 4GT1A 4JVNA 1G8HA 2J1LA 3CNNA 4MRSA 3BIFA 5AJWA 2B7BA 4L9WA 4A92A 4C3ZA 5IHPA 3K0EA 3K70D 1OIXA 2GNOA 1OH6A 4P4SB 4M1KA 4GSYA 2OLKA 2H18A 1R5BA 3BAFA 1J8YF 3IHWA 3WYAA 2FSFA 3QG5A 4HEJA 3TJZA 2LKDA 1SXJB 1NY6A 2VRWA 5TV2A 4MGKR 2C9CA 1HUQA 5C18A 3EPKA 3PXGA 1VTKA 2B8TA 1YRBA 4NCNA 3D7MA 2VSFA 4M0LA 3DL0A 1NMZA 2ZI9A 3QVVA 2ZSAA 3KX2A 1ETUA 2J0VA 2WHXA 2XZLA 3I3SR 3LW8A 4QRHA 4TSFA 1TU4A 4C9BA 2VQSA 4F92B 1R0XA 2DWQA 2WOOA 4DLTA 1ESMA 3ND8A 3NBXX 2ECKA 5FUXA 1E2EA 1F2UA 2G3YA 1H8ED 2VHTA 5JS7A 2HYDA 1XEXA 1P75A 3QPUA 5KDDA 3A4LA 2ZAOA 2FE4A 421PA 4Q1AA 1LV7A 5IT5A 1RKBA 4DC9A 5B64A 1KK2A 2JDIA 3RS7A 2G83A 4B48A 4TYNA 3CX6A 1IY0A 4LGMA 4M1WA 1H8EA 4D0NA 1KI9A 2DFTA 3AUYA 3OIUA 1ZW6A 4HZUA 2QPOA 4L5BA 1FFHA 4IOJA 4U7DA 3AVTA 4Q4HA 3R9XA 3QI2A 1U81A 5D3MA 3B6EA 3Q9LA 2WJGA 4IDNA 4MITA 3RABA 2WSSD 2WIAA 4EJSA 2H5EA 4GOJA 4JBWA 3ICEA 5HKKA 1R10A 4FWTA 4IXNA 5EE3A 5A5GA 2QM7A 3ZVMA 3U6KA 2GF0A 3TVDA 4LHZA 3FHOA 3K70C 4M9SA 4QM7A 2JLRA 4NYIQ 1RJ9A 1WCV1 3THWB 4LK2A 2EFCB 3NDBB 2AWOA 2WSSA 1YKSA 4LYFA 1JBKA 3LXXA 1M2OB 1OYYA 1NKTA 3RRMA 1OIWA 1UPTA 5G40A 3U7GA 1Q3HA 4PSVA 1XB2A 3KFXA 1FMJA 3C14C 3GFPA 5F2EA 2JJ2D 4RKEA 2RHMA 2O8FB 1TX4B 5BN3A 1CS4C 2FN4A 4JLBA 3WYGA 4YC7A 3UG6A 3K0AB 4RD1A 2DFNA 5CK4A 1P3JA 2UZ3A 2G88A 4Q4JA 2RGXA 2W2XA 3K0FA 3KB2A 4ZIRA 3HU3A 5J4VA 2ZITA 4D4JA 1GRQA 3ZS8A 1G7RA 4HUQB 2XEXA 2ZRDA 3B7GA 4IVRA 4LHVA 3W90A 1E2PA 2JJ2A 1G5TA 2AN9A 2PEYA 3A37A 4F4IA 5EUMA 4ESVA 5KDOA 5H1YA 1G21E 1XMVA 2EFDB 5CLLA 2XOKD 1XFAA 3THYA 4TL6A 3IO5A 3UWKA 5KOYA 1BH2A 2H16A 4FXPA 3C15C 1G3MA 2QSZA 5BQ5A 1TAGA 3SFZA 1AA9A 4PFSA 1Q44A 1I4DD 1E2FA 2BMJA 2WZQA 4OQLA 4QL3A 3QG1A 2IHYA 2F3TA 2ZVQX 4JYBA 4NP6A 5DLQC 4BE7B 2J7PA 2VYFA 2VF8A 4XD7A 1A4RA 3AF2A 4DDVA 2XOKA 3U5ZB 1R0ZA 1G7CA 1GNPA 1X86B 1GOTA 2FEOA 2RH5A 1SQ5A 4IOLA 3R9IA 3ZLJA 3IPYA 1T91A 4G5QA 2IWRA 4NYMR 1W36D 1S96A 1Z6XA 2CLCX 5L3QA 1IM2A 2VLIA 1N5IA 1HTWA 2RHDA 3LAWA 4HAWA 4NL4H 5D3QA 4JLVA 2Y8EA 2GXUA 3IIKA 3KKOA 1K6MA 3W5IA 2IYYA 1GL6A 1IXZA 1MO4A 2CVFA 4Z54A 1FX0A 3DKVA 3GEHA 3QXXA 2W2TA 4A9AA 4AWXA 2RAPA 3EX7C 4P4UA 1ELOA 1E98A 4JL6A 1ZU5A 4GOXA 2C9OA 3GMTA 3RRNA 4LHYA 1QHIA 4JJKA 1N0UA 3SDZA 2GJ9A 3VR4A 5AUNB 4YMVA 3X1ZA 5LDDC 3NWJA 5H8WA 1OHHD 2JLQA 1EGAA 4UXJA 4AURA 3A36A 4E09A 1E2HA 1KMQA 2ZSDA 1KY3A 4KBFA 4QXAA 5DYIA 1EK0A 3GJ8A 3RHFA 2XTMA 3X1WA 3DZDA 4C2TA 5JWRA 2CCKA 3OFND 1UJ2A 4MRPA 4PSKA 3UMRA 3E1SA 2D06A 1E9BA 2PCJA 3I72A 2ZU0C 1E1QA 1OHHA 3PQCA 5JJIA 3A1UA 2XJ9A 4MQBA 4UKDA 1V43A 4CF7A 5FH9A 3AP1A 1U8AA 1W0KD 4OI0A 2ERXA 3OFNA 4BFVA 1EWRA 3G0HA 1QHYA 2MMGA 4NE2A 1AIPA 1XZQA 2VSOA 4F93B 4HDCA 2ZYTX 1YR6A 3RWOA 1T9HA 3PR1A 5KNDA 2PZGA 3QF4B 1N6OA 2ZUDA 2A5JA 4Q9IA 4A8JA 1OT3A 4LI0A 1HY3A 1TADA 2BBSA 1W0KA 2BV3A 4MKHA 5EP3A 1DBSA 2GWHA 1ZCBA 2PJZA 4CEIA 2D3WA 4XTCS 1RYHA 4V03A 3QXHA 4FD2A 4Q47A 3EPHA 2WMNB 1AQUA 4NCIA 3U3JA 2VP4A 5CJ2A 5HE8A 4WW0A 1KO1A 2QNRA 3QSYA 3LWNA 2H57A 2ZXUA 1GM5A 1MV5A 1WDTA 1II8B 3ZH9B 2CDNA 2QT1A 2WWGA 3BWDD 3M0EA 3HU1A 4Q48A 4FWIB 5C46F 1SKYE 1TMKA 2FPLA 5FOTA 4LHWA 1KJWA 2F1RA 1IN8A 1FL9A 4HYYA 1KNQA 1W4CA 4M9XA 3U2QA 1XDBA 3KQLA 1P2UA 4LDJA 2ZTSA 4IOKA 4NPHA 2YHSA 5JLJA 1P62B 3JZMA 3AEZA 4TMKA 1A7JA 2R6AA 1P73A 2OHFA 4OI2A 3SN6A 3KJGA 3O8BA 4AIIA 721PA 3TR5A 621PA 4C7OB 4A0GA 1QG2A 3GLFA 2ATVA 1KK0A 2GJKA 1U0HC 4G3XA 3KZ1E 3CRQA 2CE7A 1ZVQA 1COWD 1NF3A 4JJZA 1HQCA 3K8YA 1XTKA 4HDQB 4BECA 2F1IA 3AM1A 2BBTA 4NYJR 1P72A 3SFVA 3GD7A 1X8LA 1U9IC 2NZ8A 4UXIA 2QP9X 2ZRBA 3NC1C 3OF5A 4FMBB 1KDTA 3UXMA 2W58A 1XP8A 1QHNA 1CR2A 1W44A 3Q5DA 2XXAB 1D9ZA 3P26A 3ZQJA 2YC2C 1K5GA 3FGNA 4QNMA 121PA 4A6PA 1LY1A 1SVWA 1XEWY 4EDHA 4I1SA 4BPBA 2HLDD 2KB0A 1YVDA 4FI3C 4IHQA 3REGA 2BCJQ 1TQ6A 2IL1A 1R4AA 4QJ5A 1Z22A 5K8TA 1GP2A 1ZINA 3CPHA 1IY1A 2YC4C 4HB4A 2FGKA 2GJSA 5L3SB 5F98A 4FCWA 3CRVA 4PR0A 1XD9A 2ZRPA 4EFLA 1OXSC 4II7A 2NIPA 2D4HA 2Z43A 2NO9A 1W4AA 4CEHA 1R0YA 2IT1A 3H1TA 5A0FA 3EXAA 3DO6A 4XVUA 1W0JD 3AUXA 3SYKA 1BO6A 3Q5EA 3T1VA 2C2HA 2FEMA 1E2LA 1W2GA 3NIBA 1E69A 2F3RA 3KJIA 3VR2A 1DTSA 1SXJD 1VYTA 1Q20A 2WJIA 3KTAB 5KO2A 4Q19A 1N6HA 1T3LA 1CBUA 3L82B 3C4JA 1E0JA 4Q4AA 2ZRCA 1M7HA 1U99A 3CZQA 2V6IA 3B60A 4B2LA 1WRBA 2ERYA 1ZD8A 1NP6A 4BLRA 2HV8A 4P0TA 4JSTA 1E0KA 1IOZA 3QEJA 1DAGA 1S2MA 2YWGA 1MT0A 2ODBA 3WP1B 4JVLA 2BKUA 3GEEA 1CEEA 1NY5A 1ONBA 4DDWA 4DCVA 3BRWD 4M1SA 4Q1EA 3W5JA 1SVMA 3N70A 1DAIA 3K09A 1OJLA 3HR8A 4QBGB 1G1MA 2ZVPX 4JBYA 2BJVA 1OKKA 1YQTA 3AGQA 1GZSA 2J0UA 1E0SA 3P27A 2L0XA 3I1FA 3GJ3A 3LW7A 1T6NA 3QNUA 3R8CA 4M9QA 1CR4A 4DSNA 2O8DB 2WJHA 1XTJA 4JYCA 4EJSB 3CNOA 4PZZA 1RIFA 3ASZA 3VU9B 5KYKA 4HSEA 2JLWA 4CRWB 1NL3A 1KDPA 1HE1C 1ZD9A 3WNDA 3GLIB 5FPTA 4KODA 2W6JD 1A2BA 2NOAA 3K9GA 4PHFA 5EQTA 2W6IA 5G41A 4AKHA 4KVAA 1LS1A 1XU4A 1T5LA 4HZIA 2N1BA 3FMIA 4D0LB 2V6JA 3CONA 4OK3A 4C0SA 4DCUA 3GLGE 3WMFA 3AVPA 4Y0AA 2YV5A 3TGPA 1EFUA 2FFQA 1J70A 4PZYA 5JI3E 2GVDC 5GVRA 3H84A 4IFEA 3LV8A 4US0R 1MH1A 2W6JA 3D6TB 3BK7A 4Q03A 1G6OA 5FBRB 3QXJA 2IHBA 4BFTA 4KFUA 4DCSA 1CXZA 4HUTA 2QQ0A 4B3DA 3K9HA 4F4JA 2F43A 3WRYC 4N0EA 1DE0A 2I1VB 1IXRC 2O0HA 1SXJC 2CK3A 2QBYA 2F1HA 1XMSA 1I4TD 2GK6A 2ZJ8A 4BLPA 5FOSA 2HF9A 2QAJA 5GJBA 3CF0A 2UZIR 3EWAA 2OG2A 5AJYA 3H0KA 3E70C 2IUUA 1U90A 2FFBA 1P6XA 2ONJA 2ZSBA 4JL8A 1D6JA 4NCKA 5FTLA 1XD2B 2B92A 2ZI4A 3KKPA 1S0UA 5KUTA 1Z83A 3VKGA 4PPGA 2GEUA 5DO9A 4Q18A 1Z63A 1IBRA 3RANA 1N5JA 3H86A 3IHLA 5TVKA 5ANRB 2OEPA 2PLFA 4IVQA 2FZ4A 1M7GA 3FMPB 5IK2D 1QHSA 1PJRA 2Q9AA 3KXLA 2HEIA 5KU1A 4ERNA 4O0MA 2ATXA 2VP9A 4PX9A 1HA3A 2GJ8A 4EPRA 1TEXA 4LJ8A 3BORA 5KDLA 3MWYW 3Q3JB 4MGZR 4B74A 2DY1A 4ZPXA 1HQYE 2ZI5A 5E95A 3AKDA 1II0A 2ZRNA 2IUTA 2W83A 1GKYA 1VG8A 5C2JB 4OL0A 4PHGA 3TW8B 5L3QB 4MH0R 1Z2CA 5IK2A 2ZE5A 1MABB 2QM8A 4P3YA 4B75A 3I92A 4G5SA 3QQ5A 5CYOA 1S8FA 1XNJA 2BEKA 2J46A 4RFSA 4EPVA 4Z1MD 1JJ7A 1A5TA 1JB1A 1X3SA 1GKUB 1IN4A 1XEWX 2XNDD 3OZXA 4L8GA 1OXTA 1F60A 1R2QA 4XWAA 1ZM7A 1FX0B 4QFMA 3C41J 2GXSA 1P5ZB 1OLOA 2Z83A 3UG7A 3WRXC 1AJEA 3LRPA 3MFYA 4ILEA 1KYIA 2J59A 3B1ZA 5BYKA 4C0BA 1DG1G 1DO0A 3U3OA 3PUZA 2JAQA 1CKEA 2A2ZA 5FI1B 4Z1MA 2FOLA 1TEVA 2PCLA 1TF5A 2GAAA 3TUIC 3QBTA 4DBLC 2XNDA 1AKEA 1FTNA 4QGGA 2WAXA 3NC0C 4P32A 3NDPA 1E2MA 1KSJA 3BGWA 4CGZA 3MAAC 1KAOA 5FL7A 1TQDA 2SHKA 2ZRIA 3SHFA 3VR6A 4OI4A 2XJ4A 1JR3D 3UPUA 1Z28A 4TL7A 1EFCA 3I62A 3TUJC 4TT3D 1TNDA 1ZC4A 3RRZA 2IXGA 2BC9A 2IK8A 1JI0A 1U2RA 3DMDA 3S1AB 1Q1QA 1MO6A 1P4SA 4ESHA 5BYJA 4DDTA 2IYZA 4AY2A 1S9HA 4LC1A 1JR3A 4R2HA 2NO0A 1ZCAA 3NH6A 4DZZA 2IYRA 4QGFA 4TT3A 4BRWA 3LY5A 2CJWB 4YDSA 1GG2A 5AWFC 2YVUA 3N2EA 2Q9BA 2FFHA 1XCGB 1NMXA 3T12A 1Q57A 1JEEA 3FMOB 2KI5A 3M4YA 4EPXA 2ZJBA 4BRUA 1E9EA 1OFUX 5J4LA 4PQYA 4A8JB 1GAJA 5EXSA 4DLWA 1UDWA 1T0HB 4F38A 4M9ZA 2KWIA 4OHVA 1JEDA 2R6DA 3CO5A 2JCSA 2P3SA 5ELXA 1Z06A 4KI0A 3VTKA 1KI2A 2A5GA 2FF7A 1G5RA 2IS1A 3CX8A 2OCPA 5AJZA 3TAHA 5IDVA 1UBCA 3QBVA 1F2TB 2BOVA 3IIMA 4LZZA 1YJ5A 5DN6D 4TYQA 4JLNA 2C8VA 3SJAA 2A9KA 1KI7A 5CB8A 4IFBA 4TLBA 1Q3TA 2EVWX 1YZNA 3WNBA 5DI3A 4CEJB 5J4HA 1XWIA 2WVJA 3PEVA 5UKDA 1JXMA 3ADDA 3NBZC 1X6VA 2D7CA 4H1UA 2UVQA 1HURA 1N6KA 4A2QA 1OH8A 4PO9A 3BB4A 4WZ6A 2EWWA 3VKWA 4BZQA 2AD1A 3NEJA 521PA 1G8GA 2IXFA 3LA6A 1NBMA 4JLKA 4RCYA 4ABYA 5F3WB 2BBOA 1VIAA 2CLDX 2J5XA 1FQJA 1RZ3A 5CLQA 1KI6B 2C5LA 2VTKA 3K0CA 3L0SA 4IJMA 4X8HA 2WMOB 4YLGA 3T06B 2R9VA 1AS3A 2JA1A 2QAGA 2ZREA 3GQBA 2CCJA 3LBNA 3TVTA 3ZQ6A 2QQEA 3EIEA 1KK3A 2CL7X 2GCOA 2PBRA 4EPYA 2YOHA 4I99A 4YONB 2GA8A 1E6CA 4EAQA 2JLYA 1AZTA 2AK2A 3EW9A 3B9QA 1G64A 5G3YA 1G3UA 3OAAA 1X8KA 5KHOC 4GRAA 3ZVRA 4JT4A 4I1VA 2FSHA 1Z2AA 1YZKA 2QPAA 4PC7A 2XZPA 4C4PA 5KPJA 5J4YA 1M74A 4TL9A 1A82A 1T3SA 3QENA 5EP1A 5IF9A 2RGBA 2WKRA 4ON9A 2W2VA 2ODWA 3R7WA 1Q12A 4DLYA 4QGHA 3OE7D 2JLXA 4NHOA 2OBMA 1DAEA 5FOWA 1VYVA 1JNYA 1G4AE 1XXHA 2V3CC 2ZRMA 1UDXA 2NO7A 3UATA 1ZM9A 5TARA 3LLMA 3U6BA 4TZ0A 1I2MA 2G1JA 2I4IA 3AVWA 1G20E 1SHZA 3OEED 1KSFX 5FTNA 4Q4AB 4B3XA 1J7KA 1ZM3A 4FN5A 2YOGA 1E2NA 4UNPA 1R5OA 1ZIOA 2R62A 2BM0A 2W0MA 4JLDA 3F3YA 4OHYA 3LFUA 4B44A 3K0CC 5FPHA 3IILA 1DEKA 2GVZC 1VCNA 2C98A 2GCNA 1FPMA 2QAGC 3P32A 3OEEA 1TU3A 3ZZ0A 2AL7A 3BERA 4KFRA 4WXRA 5TMPA 2O0KA 3THOA 1E9RA 1BYUA 3I61A 3T1QA 5KPDA 3CZPA 3UKDA 3GJXC 3KDSE 1DARA 2N46A 4UJ5A 3WP0A 4XJXA 4DHEA 2ZR0A 4EIWA 3U7FB 2O8EB 3LD9A 1OFTA 3UWOA 2JJ1D 3AVXA 1KAGA 2LKCA 3QF7A 3QXCA 2ZJ5A 4AD8A 3MWLA 4DT1A 1NVVR 2ZETA 4OHXA 1E96A 2G9NA 3IUYA 1RE0A 1EG7A 4O3MA 3Q72A 1SKYB 1BKDR 3LLUA 1GKIA 4B3FX 2ZS9A 4LV6A 4KSCA 1CULC 1E9CA 1NVXQ 4LPSA 4NH0A 1ODFA 1T3HA 1E2IA 3MLEA 3SHWA 4DCNA 4DVGA 2GJAA 1NN5A 2I1QA 3KFVA 1ZMXA 2JJ1A 4UJ3A 1IN6A 4B47A 4DUGD 2P67A 4BLSA 2ZYUX 3AVVA 1B23P 1E79D 3BBPA 1S9DA 4AYTA 1VHTA 1CJMA 1N25A 4HAUA 5CK5A 4QHSA 2F1JA 2OLJA 1WF3A 4W7SA 3MUFA 5CDFE 4ZO4A 4PPNA 3BH0A 4Q9JA 5LBIA 1QF9A 2YZ2A 2IWHA 4BFSA 4W5HA 1MKYA 3CH4B 3PUXA 4NONA 1XPUA 4M1TA 3SEAA 5CIQA 1E79A 2F43B 2VEDA 5JJKA 2OM2A 2IF2A 4C30A 2Z4RA 1E1RD 2C95A 4BLTA 4PPQA 2O8CA 4HAYA 1FNNA 3FWYA 1OB2A 3RWMB 2ZRLA 3EC2A 4MRNA 4GMDA 1E2JA 2OBLA 4MYUA 4Y0VA 2XGJA 2CEAA 5FTJA 1OXXK 3TNFA 3BD9A 3KQUA 4B6EA 1UKZA 4NCHA 1Z6GA 1E1RA 3B8HA 1DAFA 4TTPA 2QRZA 3EIHA 2NTYC 5DE3A 1EX7A 3GP8A 3RVBA 1ZNXA 1BYIA 1BOFA 1AS0A 4LYAA 3I73A 4HB3A 4P4TA 5FOXA 3ICQB 3BXZA 5HPYB 5JFGA 2A5FA 1K8RA 2HJGA 2PMKA 2GZAA 3MCAA 3MJRA 3SOPA 2VPPA 4LCBA 2Z6VA 2ZJZA 3RNLA 3DM5A 3KQHA 3IQXA 4FW9A 4ZCMA 5EE9A 2J45A 3RRYA 1TUEA 1EXMA 1WBBA 1NI3A 1UBEA 3KJEA 4UNSA 2FX3A 4CIDA 5FBVB 4Q1CA 2F9MA 3AVQA 1NG9A 4LRWA 1R8QA 5J4KA 3ZZUA 3GLFE 4RKFA 2G0NA 2V9PA 4V0KA 2ZJOA 4OBEA 1US8A 1T0JB 2AX4A 4YXWD 1XPOA 1KHTA 2OUKA 1GITA 1DAMA 2PT5A 3EA0A 4A1FA 2FMXA 5JJLA 3LDAA 1NN0A 2VP0A 1VCIA 1Z5ZA 2H7VA 3GLHA 4TQ9A 1EFRD 1G291 1GIAA 1KZ7B 5FR1A 3RSOA 2CHGA 5TXGA 1UKYA 5JWOA 1Q1BA 2VSXA 2P6RA 4M1YA 5BN5A 2WWFA 2RKOA 2ZE8A 2YWFA 4XTRA 1TQ2A 5FPKA 4F91B 5JBQA 4ARZB 1UEJA 2XTNA 2J87A 4QJ4A 2O8DA 3C7KA 4HI0E 4V0MA 1J99A 4DSUA 5FL3A 2C96A 2HXYA 4ZDJA 3SBEA 1HT2E 3NEYA 3ADKA 3CKLA 3F8TA 4BEBA 4MYTA 2IF0A 4H1VA 1NNEA 4RZ3A 1X1RA 2F6RA 2QGNA 5BXQC 2OAQ1 4LV8B 3R8FA 3X2SA 2CVHA 3P1JA 2QA5A 821PA 2IS4A 3GJ4A 4ZDIA 3ZVNA 3O47A 2QGZA 2FSGA 3HYTA 4TLEA 4IKEA 1JR6A 2Q6TA 2FV8A 4TZ6A 1HEIA 5JSZB 2DBYA 3EPJA 4MUAA 3GLGB 3QKSB 4CT5A 1OV4A 5EZ6B 4I4LA 1G8PA 3FYHA 4H9GA 4YMWA 2OCYC 2QU8A 3CUEF 2G0TA 5CDFA 3SU8A 3T5GA 3THXB 1OH5A 5B30A 4URWR 1XRJA 3ZDQA 4D82A 4LC0A 3GJ0A 3TSOA 2C99A 3HPQA 2GILA 3U4QB 3T5DA 1QRAA 4B3GA 3DHWC 1E4VA 1GDDA 5CM8B 3TSWA 1U9IA 2WKQA 5KSOA 3VHXA 2GEDA 2OXRA 4FCVA 3EZFA 3QEOA 1PLLA 4HLDA 2ZJYA 2ZE6A 5B57C 4PO1A 4D0GA 1N2CE 1JALA 4B3BA 2QENA 1WE2A 2CL6X 1DPFA 3EC1A 1NSFA 5EE5B 1D2MA 3TIFA 1U94A 1R5NA 1XCMA 2E9SA 1Z29A 1AKYA 5DNYB 1UKVY 2CBZA 2VBCA 1IY2A 1NIPA 2XITA 4GDFA 1LFDB 4I1UA 2JIZD 4BFZA 1GVNB 1Z6TA 3U7EB 1AN0A 1GSIA 1T4GA 1XBTA 5E7JA 4F4CA 3A1SA 1E2KA 5EE0A 1GRNA 5H70A 4PC2A 4HAZA 1J2JA 4ZCLA 2QROA 3GPLA 5L3RA 2BMFA 1KOFA 5HCIA 4AG6A 1QHHB 3C5CA 1TF7A 4WOPA 1ZM2A 3IBYA 1G9XA 2QORA 4D81A 1YZUA 2VHJA 5L8VA 2Q0HA 2ZPTX 2EWVA 1NMYA 1Z47A 4AYWA 1CTQA 3L2OB 3I32A 1HH4A 1KGDA 5F9FA 1N6RA 3KJHA 3KKQA 3P4XA 3GJ6A 5FTMA 1Z07A 2EYUA 2CMKA 2MSEB 4NBSA 4QG7A 5IRCD 1N5LA 2PEZA 2GCOB 2MSDB 1KMHB 2ANBA 4AKIA 2QMHA 4BWYA 4EKDA 5GVSA 4EFMA 1KJYA 3W3ZB 1KO7A 3RS4A 1KSGA 4BFXA 1RPZA 4RD3A 2GCPA 1ZNZA 1RRGA 1YZQA 2VIIA 1E4YA 4LJ5A 4RVCA 3Q8XB 4ZI2A 1COWA 1Z6YA 2AWNA 3DM9B 3U44A 5DHAA 3V00A 5GADl 1HYQA 1P2TA 2G6BA 2VHCA 4RD4A 3REFA 3SNHA 5J47A 2FZLA 5E4FA 1PUIA 1VG9B 2ZUBA 5HCNA 4WA7A 5LD2C 2JLZA 4Z8YA 2ZR7A 1Q1EA 2A5DA 3N2IA 1AQYA 2JGNA 5BN4A 1VIYA 2HLDA 3EZ9A 3PENA 2RGNC 5SZJA 1P7CA 4MRRA 3DEFA 4JT2A 3SQWA 1LS6A 1F5NA 2ZU6A 4NYMQ 4DEXA 1WXQA 5EZ5A 2OFWA 4IRUB 1UM8A 3QIAA 2NGRA 2JATA 3MWJA 3NVAA 2GESA 1XD8A 1OXUA 1QVRA 4C0JA 2WWHA 3A6PC 2HCJB 2B8WA 2QRNA 4P4SA 4NZYA 4XIGS 1W4RA 3M6AA 4PC1A 4RZUA 4L9SA 1RFLA 1W0JA 1F2UB 4C0QC 1N6LA 4TYYA 2IBMA 4OHWA 5FI0B 1XEXB 1SXJA 2F7SA 3EZ7A 3RC3A 1FMLA 2CE2X 4RD6A 2GRJA 2VL7A 4JLOA 2GXAA 4TYWA 4OQNA 2AKAB 2ZQ5A 3QVUA 4DRZA 2FPKA 4Q7MB 5LB4A 2ZS8A 1N6PA 1J90A 1NJFA 1NVUQ 1EWQA 3VX4A 3RDPA 2E1RA 1E2GA 2DYKA 1G3QA 4E07A 3I5XA 1C4OA 5FPSA 4HLUC 1M1YE 2UKDA 3CNLA 4HZUB 4A6XA 4HATA 2A5YB 1S4QA 2GEVA 4B33A 3SZRA 4PHTA 1Q0UA 4Q4HB 1Z0AA 5D3MB 1OIVA 4LJAA 4US2R 2X19A 3JVVA 3L8YA 3PUYA 2J0QA 3SYLA 1W47A 2ZJAA 3SJZA 2G1KA 2IXEA 3W3AA 3I5YA 3KUCA 1RJ9B 3U3RA 2WM9B 1R8SA 2A7QA 1JR3E 2OESA 1D9XA 2ZUCA 1XTRA 1Y63A 4IDQA 4V0NA 3Q7PA 4PC6A 3CR8A 4JLAA 2ZYVX 3ZVLA 3RS2A 1N0VC 5EP4A 2H17A 4KXFB 2PT7A 3EARA 2RGAA 4B35A 2E87A 3IPXA 5L3VA 5SZHB 3BOSA 2NZJA 1IQPA 3AGPA 3KUDA 1GNQA 3CF6R 2GZDA 5LPNA 4HDOB 1EFTA 5DSZA 3GEIA 4Q4JB 3K0FB 4ZIRB 3LXRA 2WWXA 3FVQA 4B2PA 3THWA 1A1VA 1EFHA 3IIJA 3DDCA 4TTQA 3A4NA 2R2AA 2ZS7A 4FMCB 3LNCA 2C03A 2EW1A 3AH8A 3QE0A 4AC9A 2P2LA 2IX3A 4LSGA 4KITB 3SC3A 3WNCA 4WVFA 4ACAA 3HDTA 3A58B 1TUIA 1NVWQ 2RB4A 3THYB 3E2IA 4O2RA 3QXSA 5JCPA 2O8FA 2KBEA 4DLUA 2FDCA 1KI1A 3AF0A 5CYPA 2OE2A 4A36A 3K0AA 1AM4D 3VAAA 4W9MC 1WBDA 1YE8A 1ZM4A 1G4UR 1P2SA 3GFTA 5AK0A 3PEWA 4LYJA 4PSAA 4LJ4A 4KSBA 4PHHA 2KJQA 4HUQA 4MKIA 2GKSA 4R98A 4NYJQ 1VCOA 5J40A 3IGFA 1KDRA 2BWJA 4EQ6A 2A78A 4KCGA 1ESNA 4JVMA 1NBME 1FOEB 2ODEA 4IDHA 2BDTA 3MWKA 3BJIC 3D31A 3CPJB 4N1AA 3UMFA 4G01B 2DR3A 1ZYUA 5FBWB 5FPYA 2XB2A 1ZAKA 2QT0A 1SHKA 4ITRC 3LO5A 4FMDB 4TLDA 1VYUA 1ZD1A 3IDQA 4Q1BA 5KTYA 1VHLA 4DLXA 4M1MA 4R71A 1W36B 2ZI7A 2H92A 1LTQA 3GJ5A 2P5SA 2IYQA 3K9LA 4KU4A 2ZI3A 1W4BA 4A0FA 2ZIAA 3VMFA 1N5KA 2R6GA 2NMVA 1CJTC 3AF4A 4GI7A 4UNQA 1QDEA 2OCBA 2QG6A 2JEOA 3U7HB 3BH7A 4EPTA 4URYR 4DWJA 2Z4SA 2GXQA 2HCBA 3MJHA 1GFIA 4TLAA 3SE0A 3TMKA 3I8SA 4A2PA 3AKCA 1M6NA 3CIOA 4YMUA 2HYIC 2GBLC 1XXHE 3LH5A 4BFUA 5FUWA 1WQ1R 4IEEA 1FUKA 3B13B 1WMSA 1W2HA 4OQMA 4PQFA 4RD0A 4TYPA 1N6NA 2CXXA 4Q01A 1LW7A 4B32A 1IJFA 3FKSD 3KKNA 5GJCA 3FFAA 4C0LA 4M4SA 5KSYA 1KK1A 5G53C 4YQFA 2X2EA 3FPAA 3B1YA 2PZEA 2ZM5A 2ZROA 3FB4A 4URZR 2AXNA 1YHNA 2QL6A 2X77A 3AP3A 4M1OA 4ZV4A 2YINC 1RRPA 2ANCA 5M04A 4LBYA 2JLSA 3CB4A 2O8BA 2BEJA 3FKSA 4AK9A 4K8OA 2X8AA 3L8ZA 2GTPA 2AK3A 2VH5R 4CEIB 3AKEA 2J0SA 2V1UA 1VG0B 1L4UA 2Q3FA 3CBQA 4W5JA 2ZRHA 3B85A 2RGCA 2HUPA 3CW2A 2IYXA 4TMVA 4DSTA 2QMOA 1HT1E 3U3KA 1X1SA 4PTLA 4S2EA 4IDOA 1OFIA 2WPDD 4NYIR 2REBA 1H8HD 2OAP1 3CRMA 3KKMA 1M7BA 4TLCA 2EYQA 1L2TA 2V54A 4GPTA 3FTQA 4CYMA 2WWYA 2FNAA 2DFKB 5E3HA 5CM9C 2R44A 3QF4A 4A15A 2Q21A 4AKEA 3DOEA 3CRRA 2ASEA 4TQAA 2WPDA 1IAQA 2IEYA 4J0QA 3LVRE 3B1XA 5DN6A 4QJ3A 2ONKA 3MSXA 1L4YA 2X2FA 3H2YA 4KLZA 4PZLA 4OI1A 3T15A 3SS8A 1FW6A 3GLFB 1PZNA 3AVOA 1II8A 1CIPA 2PH1A 1SVKA 3GFOA 2ZI6A 1G41A 2REOA 1XTIA 3E5HA 3WYFA 2VHUA 3TKLA 4A82A 5AUPB 1AGRA 2ORWA 3DZ8A 4JIMA 4JKYA 2XSZD 3HYRA 2F9LA 3ETLA 1IN7A 3ADCA 2C77A 8OHMA 2ZJ2A 2CCGA 1GUAA 2CHQA 1YZLA 2HT6A 4K81B 3WHLA 4FMCF 1OYWA 3F5FA 4HLQB 4LYHA 1Z0FA 2J41A 3T1OA 4V0LA 1BIFA 3L0IB 2WJYA 4C7OA 2PMDA 3RSLA 2NO1A 4KYUA 3BE4A 4Q9KA 1RRFA 3B2EA 1UBFA 1G3RA 2WKPA 5JZVA 3W6OA 2YYZA 4C2UA 1ZNWA 2VP6A 4RCZA 3BH6A 1DS6A 2ZRGA 4GL2A 3ECCA 3UANA 3PITA 1Q1ZA 1P2VA 3UMSA 1QG4A 4K46A 3SI7A 4CEHB 1CF4A 1LF5A 2KSQA 2Z5FA 2XXAA 3BB3A 1H65A 1NLZA 1Z0KA 2XB4A 3QKTA 1E2DA 1ZNYA 1JPJA 2OV2A 4WXPA 2REXB 1U98A 3VFDA 3PUVA 5SZIA 4OQFA 2GK7A 4I1OA 1GNRA 1CRPA 1FNMA 2VHQA 2BIFA 3H4MA 3OE7A 4OK6A 1W49A 2NQ2C 4FMDF 4B71A 1UF9A 4Q7LA 5JHGB 5P21A 5L3SA 3PV0A 1CJVC 2QEQA 3VX3A 3AVYA 3GLHE 2VF7A 3TAUA 4PAMA 2QTVB 1T8UA 4GMXA 2F55A 1CR0A 4TSFD 3RYTC 3FHCB 3CM0A 4OJQA 4MDFA 1MO3A 1GRRA 1NN3A 2OBNA 5AR1A 3V4RA 4KYIB 2AD5A 4G0NA 4DKXA 1CLUA 1W46A 5KNCA 2NO6A 4BGDA 3PFIA 2AR7A 2YKGA 4V0ME 2J0UB 3KTAA 3ONWA 1NN1A 5FR2A 4B2IA 2JDID 1IXSB 2R65A 1GWNA 2H8KA 4OKSA 2MSCB 3W8RA 5FBLB 1DOAA 4E22A 2ZRKA 3L0PA 4LOAA 4V02A 4AKGA 1MRNA 4D4KA 1NJGA 2R8RA 4N3NA 2FGJA 2QMUA 1P9NA 2IA5A 3TR0A 2B6HA 2OILA 3TBKA 1O3YA 4WZAE 5JEEA 2ORIA 5B2ZA 5KSPA 3KB1A 4DLVA 1CRQA 3WY9A 3P4YA 2WICA 1BMFD 3ZYCA 5B58C 3JVUA 5HKKD 2G77B 3J81k 3KXKA 2A30A 2DWPA 4M8NE 1U8YA 3Q7QA 1NKSA 4DIDA 4QBIA 5CITA 1QVAA 3QPVA 5EP2A 4FINA 1F3OA 5FUVA 5JRZA 3DMNA 1E9AA 1G7SA 3G82C 4XOIA 4UQOA 4DUGA 2D2FA 2VA8A 5FOUA 1L8QA 1R6BX 1AS2A 2PZFA 4PXAA 3TH5A 1IJEA 2JLVA 1LB1B 1BMFA 4D6PA 4MDEA 1DADA 4URUR 3VU9A 3W8NA 2QBYB 1S3SA 3DKPA 3GLIA 2J3EA 3RLFA 1G7TA 2QMEA 4FIDA 1ZUIA 3RS3A 2LCFA 1RC8A 2J7KA 2W0SA 4WAUA 4QHYA 4A0RA 5AUOB 1XPRA 1XJCA 4E5UA 3OIWA 1OW3B 3OESA 4IOMA 4Q02A 3W9YA 5KNBA 5DIFA 4A4DA 2KE5A 1FTSA 1E9FA 4DXAA 1XTQA 1FP7A 2D62A 3K9NA 2MMCA 4MYHA 2WJJA 1GTVA 3GCGA 3W34A 2ZRFA 2VO1A 1N3BA 4OYHA 1OFHA 3QKRA 4KLNA 4IEIA 1SVLA 2YWEA 4GP7A 3R20A 5G3ZA 4D80A 4PPFA 2J9RA 4PQRA 3LQQA 2EFHB 4EQ6B 1KO5A 1X8JA 4XH9B 2HDNB 1G19A 3FFBA 2NG1A 4UXHA 4Q9HA 2D74A 2TMKA 4ASUD 1N6IA 5FUYA 4Z51A 2J7PD 1SVOA 1XD2A 3M1IA 4Q1FA 4FCTA 2QY9A 4XD7D 4QOSA 2IYLD 4RFSB 1E99A 1TL7C 1G3IA 4A0HA 4YMSA 4EJSC 3IBGA 2FWRA 4LBZA 1O87A 4M2LA 5JS8A 1WB9A 4DEYA 2FPMA 1IN5A 4ASUA 4IW3B 4L4UA 5AJXA 3VNVA 3DOFA 4OJKA 3SJBA 1E94E 1UEIA 4YXWA 5F9HA 1EX6A 2IYWA 3PIRA 4GZMA 4BZPA 4CVNA 4KV9A 3TRFA 1W5SA 3U3MA 3KL4A 2EFGA 4ZDWA 1Z3IX 3C5HA 1I2DA 2O52A 1KKMA 4M22A 1EFRA 3U61B 5CB6A 4UNRA 5K8IA 4P33A 4LY6A 3AV0B 5SZKB 1MABA 3KXIA 4LUCA 4NKRA 4TL8A 1A2KC 2Q3MA 3D8BA 2RGDA 4QC2A 4MGYR 2V7QD 4US1R 2QTFA 3FKQA 3K53A 4RD2A 3KQNA 4MYCA 5DH9A 3ZD6A 3ADBA 3IO3A 3MG9A 1ANKA 2GETA 1I4LD 2N42A 3RS5A 3MD0A 3WHKA 4GZLA 5HR5A 3SJCA 1RRCA 2AKYA 4QBFA 1L7VC 1RYFA 3T35A 4F7WA 5JMTA 1RVDA 4UNNA 2V7QA 4P31A 3F0TA 4DB4A 1JECA 2JJ8A 3I4LA 4X8MA 1E1QD 2IS2A 4Q21A 3D3QA 2P6UA 4M21A 2PJRA 4OK5A 3CH5A 4BLQA 4BLOA 1J8MF 4D2IA 3VR3A 1G6HA 1D2EA 2IC5A 3B1WA 3K1JA 3CPEA 3IEVA 4S35A 1RW4A 4TMZA 1IHUA 2O8BB 1AZSC 4LX0A 1YR9A 4D4MA 4JZKA 4YDHB 3JZAA 1SXJE 4JSYA 5DI9A 3S1AA 1NVVQ 1OF1A 2X1VA 1CP2A 3EZ2A 4B34A 5K8UA 2FSIA 1AK2A 3DVLA 1R0WA 1UBGA 4PO8A 4KFSA 1HV8A 4M53A 4XSHA 4RFVA 3KQKA 2VP5A 3QKUA 1OPXA 1DELA 3BS4A 2CJWA 2P65A 2QSYA 1D5CA 1NRJB 3GJ7A 3B1VA 3FMFA 4QHTA 3WMEA 5BW8A 3AF1A 3A4MA 4CZ2A 5JI2E 2OXCA 1CU1A 5DI3B 3LQRA 4YMTA 4POAA 4PAQA 2ZRAA 5TDHA 3NG1A 2VP2A 2RGNA 4CDGA 2BM1A 2QTHA 1TTTA 2ZYWX 2ZEJA 1VPLA 2XZOA 1W36C 2GAOA 3PEUA 1Y3AA 2AFIE 2WBLC 1N0WA 4G5GA 2W00A 2JIZA 1Z0IA 1ZUNB 1PLJA 3FDIA 4Z8XA 1EESA 3PG5A 4HB2A 3TQCA 3A8TA 5GJWC 1XTSA 1FZQA 3B82A 3HU2A 4Q4LA 4E03A 1XF9A 2Q9CA 1F2TA 3I8XA 3HPRA 3AVUA 1GILA 1G5PA 3Q85A 3T34A 1XCPA 3EAQA 3NHBA 3PEYA 1VG1A 2FU5C 4D4LA 4X8OA 4XWOA 2QAGB 1G16A 1JPNA 2WWIA 4CEJA 1FUUA 2FFAA 3X1XA 4JLJA 1SULA 3MRSA 5E7IA 3PCRB 5EXPA 4TWZA 2HT1A 4DB2A 3LX5A 4DIEA 3AKYA 4I81A 5C1BA 3MMPA 6Q21A 3LX8A 4JLPA 1E32A 1E9SA 2ZE7A 4LBVA 1KSHA 3CR7A 4Q1DA 3X1DA 3VNUA 1NLYA 1WP9A 4O2LA 4HLUA 3W6PA 4DLRA 2IW3A 2DHRA 1KI3A 1S1MA 3EIQA 4MGIR 5EXTA 3T61A 1E0AA 2GHIA 3AB3A 4GBMA 5EUQB 1GL9B 3R7WB 1KI6A 3A1VA 4Q9LA 2FH5B 3IEUA 3ZS9A 4A8JC 2RMKA 4C0KA 3O8RA 3CX7A 1XXHB 1NIJA 2IEZA 2EU8A 1JXOA 1G18A 4TMWA 2WAYA 4BEJA 2YNMA 4L15A 3K70B 4U5XA 1OSNA 3EWSA 4R2IA 4WBSA 2BVNA 2V4ZA 1Z0DA 2PLRA 2WIBA 1ZIPA 4KFTA 2I3BA 5DHFA 4G1UC 4KHZA 5LB2A 1MO5A 1ZUHA 3C8UA 5H68A 1R7RA 4URXR 1DO2A 3FHTA 2R6CA 3TSZA 4G5RA 2QE7D 5K8LA 2DB3A 2QZ4A 3RS0A 3ZJYA 2EFEB 4Q00A 5HE9A 4RJLA 1XX6A 1PLKA 2OT3B 1BS1A 2Q3HA 4EFNA 4Q5IA 2Z0MA 1QHXA 3ND9A 2QE7A 1UKEA 2HJVA 4QM6A 1W48A 4R7ZA 1XJ0A 2IYVA 5FBQB 3RAPR 4WZBE 2BCGY 1QHGA 4JS0A 1MR3F 1C1YA 5TY0A 2CLSA 1LNZA 5JECA 4DT1B 3AF3A 4R9UC 5JRJA 1LVGA 1ZP6A 4HAVA 4GP6A 1KO4A 3ZGXA 1CJUC 4ZKEA 3UIEA 5KSZA 1OKKD 3CWZA 3NXSA 2BHRA 2QUZA 2WOJA 2XX3A 1FP6A 3QOFA 4Q7JB 4QKQA 4A2WA 5CJPA 4KJZA 1NSTA 4DSOA 1VDZA 4KBGA 1YR7A 3AP2A 3OIVA 3CWQA 3HWSA 2O0JA 3TW4A 2ODNA 1E2QA 2ORVA 1CR1A 1JAIA 1FQKA 1KI4A 4EUNA 1Q21A 2WJVA 4MKFA 4JMPA 3QY0A 2O8EA 1SKQA 2GF9A 2PX0A 1Z08A 2W6ID 4WIAA 4DJTA 5JEDA 4TN1A 1D2NA 4ZCIA 5JWHA 1NLFA 5E7MA 1YZTA
chains in the Genus database with same CATH superfamily
1W5EA 4EUKA 3CE9A 1EVJA 9ABPA 4HEQA 1PVOA 4JC0A 3R7LA 1IEQA 3CO0S 1RYBA 4IVPA 1GSOA 4LV5B 4UE2A 4XSGA 2F2TA 2GN1A 2PGDA 3DT6A 3FOWA 3RVNA 2HSJA 2VRNA 1KRXA 3V4LA 1CJKC 2P2YA 3GDFA 4CW7A 2PSHA 3CZCA 2VZEA 2OO3A 2C4WA 4B73A 1U3WA 2XMBA 3KUKA 4LPKA 2PA3A 1FPQA 4CNBA 4CT4B 1UM9B 2RC6A 4DA0A 4HAOA 2XGJA 1E61A 1BGXT 1YI1A 3K15A 3V4OA 4NMHA 4FDVA 2NZYA 4M46A 3IMCA 3W6NA 4I19A 3GP3A 2AQHA 3I3OA 1BDMA 5CVCA 3T7SA 2P27A 4A5OA 4WFIA 1YTLA 1EFDN 1GL7A 3IURA 1CT9A 1VSBA 2D1TA 3QMVA 4DCGA 3REQA 3EBOA 4DR7B 1E3MA 1WHSB 1Z56C 2IUSA 3WC4A 1XJ5A 3QYPA 1RBYA 3OQJA 3H13A 2OFOA 2VA9A 4WN3A 3FPFA 4B6JA 1RPTA 3VUFA 4KRFA 2HADA 5G02A 4DBZA 5P8WA 2OCAA 3FOFC 3NJ4A 2Q41A 4F71A 2FP3A 1RAIA 3KWJA 4LJ9A 3OFJA 4PSCA 3HVJA 1NDQA 1P60A 1LF0A 2B21A 3TQFA 1QO0D 4E12A 1KI8A 2VZ9A 2JASA 3L18A 5HA5A 4DS3A 1IEXA 4YRKA 2XAUA 2BSXA 3D0OA 2Y67A 3ZNQA 2X2OA 1IOWA 2IZOA 1HORA 1GU7A 2WQZA 3P20A 5EJEA 5ES4B 2YJTD 5AHWA 5GIOE 3KZCA 1US8B 3N76A 2ZSUA 4FSXA 4BKQA 4CM4A 5C4MA 4FDUA 3ZKWB 5LUAA 2PV0A 3KEMA 3RIGA 1KQGA 1JIIA 1P3Y1 1SCNE 1TECE 4BV2A 4UHFA 3LO8A 3EG9B 1QFXA 1DSSG 5MN4A 1M2FA 3ONNA 5A3SA 1M8FA 2I5PO 3VHLB 1V26A 4RMJA 4EWLA 1Y1LA 2OKGA 5LLSA 5HK8A 2SCUB 2WYOA 4NEQA 1NXPA 3P2YA 5JCZA 1R9MA 2XDYA 2BI8A 3JZIA 1JHYA 2PRSA 4KK4A 4UHHA 1YZGA 3BC1A 3K16A 5ALVA 3KOWA 1PGNA 1Z8NA 2ZYHA 4KKXB 4LJYA 4C0AC 2DBRA 2X5NA 1XF1A 4NDZA 3OT1A 4C0HA 1U0JA 2Z9CA 1Q22A 2CLFB 3PR2B 3R5TA 2DPXA 3EVTA 3A2NA 2F48A 3E2PA 3IS3A 3VA7A 2QP3A 4C3VA 3B12A 5GOZA 1RHJA 3DEZA 2BTQB 2IU4A 1AZWA 3FLEA 3PNVA 4EW2A 4AJNA 4TMXA 3VKHA 5I9BA 3TPCA 3QFCA 4NAVA 2EG5A 1SZPA 5JDCA 2PUTA 4YLEA 4LDNA 2CXTA 4WZAB 3C1AA 3T5AA 1NJ1A 1OYVA 3TFQA 4JBXA 2ZVJA 3VPGA 3VPFA 2C04A 1DG3A 5CDHA 3ASYA 4GLOA 2D2EA 5FA8A 1AOXA 4MS3A 3PJRA 2H2DA 1UMCA 1QRUA 4OHZA 1W4ZA 3TLAA 2OV6A 1EAMA 3WI7A 2YRFA 2H3EA 2HRZA 1YL6A 2X1HA 3GFQA 5D5QA 5ITZB 1ZU4A 4HF7A 4WECA 5ABPA 5AIAA 1QIHA 1M6HA 5ELMA 4HRYA 4M98A 3ZY3A 1SIWA 1GU1A 2BZGA 3DW3X 2ZJ1A 3B78A 5C5CA 3GF4A 3FNHA 1U3FA 5CB4A 3ZCPA 4AZWA 5KMGB 1FVHA 2HCFA 1YB4A 1GAEO 4S1OA 2PR7A 2PD4A 1LTKA 2CL0X 2NUBA 3H8JA 4W1RA 1CZUA 1XJQA 3IAM1 4OSPA 2PVCA 4FE4A 3BFKA 2Y1GA 3KO8A 2BFWA 4DGSA 2OGWA 3UPTA 1HE8B 1LVHA 5EEGA 3PF9A 1M8PA 5LQJA 1LI5A 1EFPA 1RBMA 2BKEA 1U2QA 4RX1A 5K0LA 1OI2A 1PS9A 2A0FA 3IT3A 4OA5A 4XKJA 4YYEA 4BZXA 2Z6UA 3B8EA 1P61B 1XAGA 2AHOA 5CLIA 2BHNA 4BNIA 1HT0A 1T9GS 2JIPA 2NPIA 4EYOA 1DAKA 1NGSA 3D5EA 4L08A 3A6PC 3SYRA 5EJIA 3ACCA 1VCMA 2X22A 2IS6A 1GYRA 2HMTA 3D7KA 3RBXA 1QTNA 1QF6A 1DXYA 3HJBA 5B1HA 3LCRA 4KNVA 5B2EA 1XG5A 1U3DA 3LXUX 3OEHD 3ITDA 1B8OA 4PYMA 4S24A 5I5GA 1PK7A 3WWCA 4N5IX 4Q15A 2GCGA 3UEOA 5KOJB 4FC6A 3EW7A 3H5OA 1WB4A 3CBGA 4IH9A 1XK7A 5DCLA 5ALPA 5K0EA 4AG5A 1V8DA 2HMUA 3KEOA 1EVYA 2M6SA 1PR2A 3HCNA 4YJ2B 3VVLA 2I66A 1F6BA 3LL7A 1KZGB 1RHMA 1LSUA 1X92A 3ZNPA 2EBHX 3OTOB 4Q66C 1M34E 4CM8B 4Q3NA 4C04A 4U02A 3UXYA 3NS7A 1UMBA 3BN3A 4JLWA 3OOHA 4RIIA 2AYYA 3VYVA 1ZRHA 3R75A 1IRIA 4PANA 1I33A 1LJUA 2BM8A 3NFRA 2FEWB 2AFHE 2CHVA 5GY7A 4B6PA 1C9JA 3R7SA 5HZKA 4L95C 1BXZA 2K5UA 3CW9A 2VWPA 4K6MA 3MFQA 4NU0A 5AOAA 3ZHQA 3LP8A 1KDOA 2WWWA 1H4QA 1QO7A 1QHHA 4CV2A 5TSDA 1CDOA 3NTQA 3T3PB 3OZUA 2CMHA 3ZD7A 3FCCA 2PZBA 2J5RA 4I36A 4L74A 4RANA 2D4AA 4ZI3A 2CV1A 2ZANA 5AJVB 2HK9A 1TPZA 3S27A 3NBFA 4NNOA 2WWVD 3PLAE 3DQZA 2X13A 3PVSA 3R41A 1UMDA 4HGYA 4IIJB 2H08A 2WG1A 3Q98A 3HGTA 3WXMA 1UJ5A 1ZBDA 4B3CA 2AQIA 4UVGA 3T9EA 2JFOA 4LDPA 3LIPA 1A8SA 1A3CA 3FCOA 3N8KA 2E3JA 1KMHA 1W5BA 2PX3A 4LWZA 1E1CB 1USKA 3UW3A 4F6LA 4HDNA 4JZYA 3RC8A 4KV7A 3KSDO 1APBA 4EMBA 2IYSA 2IYUA 2NM0A 1X9GA 1Z6AA 3DPUA 3QM1A 5JJBA 2FPPB 3ZE1B 3RVKA 4CU5A 1YIAA 3D3WA 3A06A 4F7DA 3IDAA 1WDKA 4ZAWA 4PPYA 4GR4A 4DEVA 1YRAA 3O8CA 4QDXA 3EDRA 4GT1A 5DM60 2HU8A 1G8HA 2J1LA 2DVMA 4ER0A 5AJWA 2B7BA 4L9WA 4C3ZA 1M2HA 1ZGJA 2Y0BA 1OIXA 3IOMA 2GNOA 4UMEA 5IHPA 4NDNE 1CSEE 4M1KA 4IEFB 3BAFA 3GRYA 1JG6A 3G1UA 1T4CB 2NYRA 4LC9A 4AG3A 1SUFA 1XDDA 3IHWA 2YQ5A 3QG5A 3V1YA 4BO7A 2B94A 1MPTA 3ETDA 5L95A 5K3DA 4EK9A 5INTA 3QPDA 1C3EA 5COBA 2NZUG 1GV1A 5IANA 4UUPA 1DKLA 1U1IA 1UBJS 2MYNA 2AC2A 2VRWA 2H6EA 3BE6A 5TV2A 3U17A 5HUQA 5LL6P 1H4TA 3RUEA 5TMEA 4D3DA 4E2WA 3OU6A 1FJGB 3DWGA 5JAZA 1CZNA 5AXCA 1L4NA 4ZOLB 1BDJA 4BO9A 1DBPA 5T67A 3TOCA 3QVVA 2Z98A 1ETUA 2J0VA 3TB4A 4AMVA 1LQ2A 1EINA 1VJ1A 2NX2A 3DYBA 1OD6A 3LW8A 4IRXA 4QRHA 4TSFA 1A2OA 1L4BA 4PRKA 3RG2A 1TU4A 3MW8A 4F56A 4HQ6A 3VR0A 1GT6A 3DDSA 3BWCA 1R0XA 2G17A 3EMVA 2DWQA 4LSWA 4WOJA 4QUBA 5CW2A 3LBFA 7GPBA 1F2UA 4Q6WA 1AZLA 1F6DA 5FBKA 3BKXA 1SC9A 1LDNA 1QH1A 3KETA 3QPUA 4HGRA 1LV7A 2VF2A 3VOSA 4DC9A 3PDIB 3W2EA 2YBDA 3G8DA 1GUFA 5EN4A 2DUWA 3BK1A 1W85A 1CVLA 1N9KA 4N49A 1RXCA 4IZ6A 4BP8A 1BQ3A 3EEOA 2QF7A 4M1WA 5DGIA 1WXEA 4R1OA 4EP1A 2X7HA 2O7RA 8AT1A 4X41A 2LRHA 3OIUA 1IDN1 5JVDB 1ZW6A 1UKAA 2WR8A 2DTEA 4UUOA 1XDUA 2AJTA 2NSJA 4LOJA 2QPOA 4WLNA 4EI8A 5K4HA 3G6KA 1ZX1A 4PR3A 2P69A 4CMIA 2R8XA 4G97A 4IOJA 5TGTA 2WHYA 2M6RA 4Q4HA 2QMQA 1M2NA 1UK6A 2J4CA 4IDNA 4MITA 1IMJA 2OHIA 5AVKA 4JBWA 5COQA 4BVAA 2G70A 3CUTA 1R10A 1PGPA 1Z7BA 4BGIA 2Q3CA 2BFEB 2GTHA 4HK4A 4FI3F 1U8TA 2GF0A 1SCKA 4LHZA 4XUGB 2XNJA 4A03A 1TKBA 3N74A 4C7MA 1RJ9A 4QDOA 1WW8A 2QK4A 5IN5A 1H2FA 1ULZA 4LK2A 3OOYA 5SV2A 4IDDA 1VL0A 1Q0PA 3SC4A 3ICCA 4L0QA 5ER9A 4JI1B 2GZ2A 3QWFA 3TI7A 5LZ8A 1JBKA 2JIDA 3U80A 1NKTA 1WNTA 2J6CA 1OIWA 1SUIA 2GZMA 3HCFA 3LQ2A 3OKCA 5T8KA 3REQB 3ZU4A 5G40A 4XLLA 3L41A 4PSVA 1XB2A 4KX3A 5GPBA 2OOSA 3A9UA 1NFQA 3EQ8A 3LYAA 5H9WA 1CZKA 3F6PA 4PINA 5F2EA 2O2DA 1AXGA 1X0VA 2VK1A 4F2HA 5BUQA 5AVQA 3L6UA 3WYGA 4YC7A 3EF1A 3CTPA 3ZXUB 1F8UA 1MJFA 3DMYA 4FGKA 4BATA 5JARA 2DFNA 2E5LB 3UK0A 4B7AA 3BF7A 2G88A 3KV3O 5ERYA 1Q0HA 2BHTA 3UJ3X 5FJJA 2CZGA 3ZHOA 4MQLA 3HU3A 5J4VA 1JEAA 2VQ6A 2ZITA 4IDBA 4BJ6A 1GRQA 1I7LA 3BMQA 1G7RA 4Q3DA 4HUQB 3B7GA 3NIGB 4IS3A 1ZA1A 1EXVA 4BXOB 1FP4B 5T64A 5C7IO 3ZWBA 4WKGA 1CUZA 2JJ2A 2AN9A 2PEYA 3AOEA 3OETA 1OWPA 2C3PA 3A37A 3NLLA 1E5LA 4GC5A 4NF2A 3T9DA 2VPTA 4DVJA 4C06A 1N9GB 4BVKA 5H1YA 1XZAA 1RLOA 2WF5A 2PL1A 1Z2NX 2FRXA 3THYA 1XFAA 3KVYA 1VJRA 2DM6A 1YL7A 2NQ8A 2QVLA 4HGOA 4F1WA 4MQFB 2XVAA 5KOYA 1N2GA 2B0CA 2YY6A 3H8SA 5BQ5A 3WK6A 1NOIA 1KYYA 1YQUA 1DTEA 3RK0A 2Y76A 5A03A 2VYND 4C01A 4OQLA 2UZ0A 3F90A 3QG1A 1MQAA 2IHYA 1UAYA 1M67A 2BI7A 2QZPA 2ZVQX 3OQVA 4FYWA 4I1RA 2FPOA 4NP6A 2J7PA 3AR8A 4Z3OA 2XHEA 1VP3A 3AF2A 5DYWA 1OGJA 2XOKA 3VVCA 4D4IA 2WJ4A 4QVIA 2JK0A 2R8BA 3FGPA 1G7CA 2XQIA 2C5HA 2XNHA 4J3JA 1G20A 2BR3A 1T1GA 1J25A 4TV9F 4XWWA 2ZOSA 1YGPA 1N5IA 3B3QA 1GYQA 2HFKA 2RHDA 3LAWA 4MQMA 4E0BA 4JLVA 4H7DA 2G6TA 2QZ9A 2P30A 3V48A 4FGSA 2JI4A 3QVLA 4RA6B 2IYYA 3UOGA 1MO4A 5DM1A 4HC4A 3GEHA 3DKVA 2GEFA 4CLEA 1V48A 2W2TA 1C0KA 1G98A 2OD7A 3QGMA 4HWGA 4AWXA 2MSNA 4KMSA 3VUEA 1ELOA 2YQZA 4ETWA 2IOFA 4DA8A 4LXYA 1JMYA 1XLWA 3RRNA 1L7DA 4MI3A 4P6VF 3HGQA 1N0UA 3S28A 2GJ9A 3VR4A 1P5FA 3LUHA 4ZQIA 1BHJA 2CUNA 5E6RA 5M29A 2ATIA 3LZCA 4BRSA 1W76A 1E3DA 1EGAA 1O96A 2JLQA 4F2DA 2O3TA 1VJDA 4H3SA 5DM0A 4E09A 5CFZA 1E2HA 1HGXA 2ZSDA 5K4GA 3NP9A 1IBLB 3E5MA 1TZKA 3ISTA 3T38A 2VEOA 3SE7A 1PRYA 2CZQA 2NTNA 2OHXA 3C5WP 3WYBA 3X1WA 4RL4A 1I2CA 2CCKA 1JHRA 1L7MA 1UJ2A 3F98A 3UMRA 3U40A 4D79A 3OIFA 3FSRA 3I72A 3ZK9A 1E1QA 1OHHA 2A1UA 4C89A 5JJIA 1VLHA 3UAOA 4ECEA 3I2IA 4YV7A 1JE0A 1RXYA 2V7TA 4GZ6A 2VOEA 4NULA 4KGXA 1ZWLA 2WV7A 1KBZA 3HXQA 4NBTA 2GKGA 1Y80A 1LX6A 1L7EA 4ID3A 4TTSA 4OXQA 3A1DA 2VJBA 3L7AA 4BFVA 1EWRA 3G0HA 2MMGA 4XM0A 4BFLA 5CDSA 1AIPA 3LPAA 2VYVA 2NP6A 1T1JA 3JQQA 4HDCA 3RIEA 1UQRA 2YFYA 3OJEA 2B9EA 1THZA 1K5PA 1T9HA 4JUDX 3RO7A 2PGIA 3VHQA 1N6OA 1LBQA 2VDPB 4IS2A 5KIAA 1HY3A 3HBAA 2BV3A 2PMWB 4ZI5A 2ZDGA 1N3YA 4E2YA 3V2UA 2I8LA 1EUYA 3TZBA 2P0AA 3MGKA 4ISCA 1FQWA 3AB7A 4XTCS 2DSTA 5CA1B 1DZIA 3BL5A 1UDRA 2WMNB 2NUTA 4DA9A 4WY5A 4KDEA 5CJ2A 3UHJA 5DFAA 4JB2A 1NP7A 3KLMX 2QNRA 3QSYA 1G5QA 4AUNA 2WMDA 3UVEA 1WDTA 2QXUA 2YN4A 4P4GA 2CDNA 4U5QA 3M0EA 3WA6A 1XC7A 2GERA 4YDRA 1AQJA 1REQB 3HU1A 3OT5A 4J07A 4Q48A 3AWIA 2BH9A 1QIGA 1YXMA 2A1IA 2ON6A 9GPBA 1P19A 4X61A 1KJWA 4TLLB 3GRCA 1IN8A 2MT9A 4MQ5A 1KNQA 4ZCPA 3WLJA 2CFTA 3IT2A 3KQLA 4D4GA 3HA3A 3AEUA 4ZT3A 4MUXA 1KFCB 1YGYA 3R3WA 4BNDA 1EA7A 1P62B 3JZMA 4R3WA 5KB3A 2DJ5A 4K9DA 1EVIA 4TMKA 4EG7A 1NULA 2FFJA 2R6AA 2OHFA 2GLUA 3JYOA 4AIIA 4ZMRA 721PA 4HGQA 4B31A 2W8BA 1FFXB 621PA 2BMWA 4EL0A 4IUBS 3S29A 3Q6NA 4ZVRA 1KK0A 2PY6A 4PGGA 4LF5B 4G3XA 4QYSA 3BCHA 3PT9A 4HZGA 4L4ZA 1U5BA 3UICA 4HN2A 2HBYA 3EK2A 2VAXA 1CF2O 1NF3A 3JWIA 2WM3A 3UWSA 3W7AA 2BFCB 4PQGA 4JJZA 5ITVA 1R50A 3FR8A 4BECA 1RS0A 2BBTA 4J0IA 2ZJ6A 1P72A 4RVSA 3TFOA 2FSVA 3OQBA 4WBXC 4FMBB 1KDTA 2W58A 1MN6A 3WHPA 1QHNA 4IIGA 3U4GA 1W44A 1PJBA 4AY4A 5EIXA 2VZ8A 2XXAB 3HSSA 1PWEA 2H1OA 1AKVA 4A6PA 3JQ9C 1XEWY 3BTUA 2Z9BA 2HLDD 4PYNA 4NJOA 1XLTC 2X9GA 1SURA 3E9RA 5FAXA 4KQCA 1R4AA 4OA8A 2JARA 3ADOA 4YRAA 3PPYA 1GP2A 2OV1A 4L8LA 4X5OA 2B36A 3OMXA 5ESXA 1P4AA 2DT8A 2OCDA 2YC4C 4GDMA 3QVXA 4XPIA 5HYVA 5F98A 3LPLA 4UD6A 1E5TA 4C87A 4ANFA 2OFPA 4CCAA 1QJCA 3P9IA 1VRCA 2XLBA 3ETEA 3QUQA 5B4UA 2D4HA 4XA8A 2ZCJA 4OAPA 2VHEA 2Z8ZA 4GSLA 4F4DA 4Q39A 1HFEL 1R0YA 1P9OA 1FMCA 4J91A 4BN0A 1Z13A 1X94A 4ZT2A 3DO6A 1OAOC 1W0JD 1BO6A 3OI7A 2Q49A 1ZLYA 5D51S 3T1VA 3OZ7A 1E69A 3PGLA 1Z4NA 4MI6A 1ZSYA 1E63A 1R0KA 2O7SA 4Q19A 3U26A 5MFZA 4N3BA 3WGNA 3H2BA 1CBUA 1EFKA 1I2AA 3AF5A 1E0JA 1TIPA 3NHJA 4J1TC 2G28A 3B5EA 3CZQA 1SAYA 1KMNA 1DCKA 3E03A 4H4DA 1WVMA 5U4XA 4XPZA 1DX9A 3PGVA 1QDLB 3WRYA 5BV7A 5D6OA 2N47A 4F06A 1IOZA 2JA2A 2PBLA 2HSZA 1CUAA 1P7YA 2QTVA 2SBTA 1L7AA 2EKQA 2HOQA 2IDZA 2I3GA 2L18A 2ODBA 3QEJA 4J1QA 1YRWA 4ZJUA 3RK4A 1MGOA 4RK1A 2P9HA 3U81A 1EM8B 3KWMA 3CLUD 1W85B 2BZ1A 2YS7A 3ETNA 3FI0A 1N2CA 3N70A 1NNSA 4C4TA 4M8KA 5KNDH 2COKA 1BWSA 1GPLA 1OKKA 2BW0A 2PLAA 2ID8A 2Y92A 1T5SA 4FYHA 4Y2HA 3GGGA 4EENA 3BM5A 1E7WA 2AEJA 4JOQA 3I9OA 2GHRA 1BA3A 1RQPA 3QNUA 2OB2A 2IY8A 4RSRA 2P2ZA 4DSNA 1VOTA 3ZWMA 5HXAA 1QTQA 2PKEA 1IXKA 1KH2A 3CUKA 1IAVA 1ODTC 1E3SA 3F6CA 3TQRA 4MARA 1RIFA 1RVV1 5JW6A 4FJ1A 2RDMA 1VL5A 1GTG1 1NL3A 3OWOA 1MO2A 3VNBA 3RAJA 1ZAYA 2PBFA 4KODA 3VMMA 3EXHB 2W6JD 2C3UA 2AVDA 1AHHA 3ZWOA 1ZVMA 3MT7A 4KVAA 2W6PA 5EINA 5IX8A 4F0JA 4L9RA 2ZYGA 4ZALA 2C7BA 3A3PA 2V6JA 3DAOA 1B42A 3CONA 1DINA 4IJVA 4OK3A 4D0LB 5FT9A 1YU6A 5EMJA 3WMFA 1R4MB 4Z4EA 1YDFA 3AVPA 4MICA 4RU1A 1BE1A 2N0SA 1DIOB 5JI3E 4WFQA 5GVRA 4US0R 3LV8A 4QXOA 2B6NA 5DHQA 1MH1A 3D6TB 3BK7A 4L5IA 5DWDA 5BP7A 5FBRB 3GUHA 3QXJA 4RVGA 3ILVA 3AEQA 4DCSA 1BX3A 4Y6QA 1OFUA 4HUTA 1C7ZA 4HUJA 5IBQA 1PEAA 2F43A 3FF1A 4PF1A 3R7FA 4AY6A 5AW1A 2VDOB 2XCRB 1CV2A 1PR9A 4RLQA 5IXSA 1KVSA 1TA4A 4LYEA 5H82A 1XMSA 4F96A 5EXEA 3TB6A 4QOEA 2ZJ8A 2I99A 3F7TA 3I9MA 5F52A 3BMQB 1LBEA 5FOSA 1VKRA 4WY2A 3AUFA 1KEKA 1U90A 2FFBA 4EHFA 1Y7TA 3N5KA 1UDCA 2WKWA 3FDZB 4Y2XA 3JV7A 1PNVA 3JWJA 5A5DA 3TIXB 4LQLA 5EI5A 3B7PA 2XT9A 4LWOA 5LFAA 2J3IA 2GEUA 3DLAA 1GZ6A 3CLUC 4MQ4A 2EZ4A 1N78A 1PL8A 3Q0IA 3QU2A 3RANA 4IQ0A 3L8EA 3MB5A 4O4IA 4KR0A 4UBIA 1WZEA 1T29A 2QLMA 3DZJA 3DUFB 4BQEA 3FVTA 5A5VA 1K88A 4LZNA 5HBRA 2J5QA 1H2WA 1N3IA 2FZ4A 1M7GA 1JHDA 1NV9A 1QC5A 1S01A 1A9RA 3FMPB 4RHYA 2Q9AA 4B4UA 5CD1A 4RM2A 1RI1A 5KU1A 3EAFA 4O0MA 1C29B 2J6BA 2VP9A 1HA3A 4DCOA 1B73A 2VHXA 4ALKA 1U0TA 5E4YA 1XMOB 4PICA 3Q3JB 4MGZR 3K72B 4RPKA 1BQEA 1SEVA 3C1UA 4P7GA 5E95A 3ZWDA 3ZWKA 4E5DA 5HKAA 2ZRNA 2O2EA 4CUJA 1L4HA 4MMXB 2GPJA 4MV0A 5BR7A 5C2JB 1B2LA 4PHGA 5HEKA 2IPAB 3OZIA 2BT4A 4WD3A 5EHZA 1JDNA 1LA2A 1Z2CA 2PRKA 2QM8A 4JWKA 3ZE6A 3B6KA 1DQSA 2GBFA 3GAZA 4B75A 4Z1MD 3UTDA 3L07A 4H08A 5ITZA 2F3PA 1UAGA 4GWGA 1J2YA 3HJHA 1O95D 1XEWX 2OZLA 4L8GA 1F60A 4XWAA 2GSWA 4QFMA 4EJ2A 3C41J 2GXSA 1P5ZB 4PZCA 2Q99A 3UG7A 1PZEA 3GGCA 3I1YA 4Z7NB 4JXZA 3UTCA 2HA5A 2FN7A 1JEJA 3GFFA 1QORA 2RCYA 1Z38A 2XIJA 2I7XA 3PCXA 2A2ZA 2Y1EA 4EA7A 1X77A 3OQPA 2FOLA 3TUIC 2PCLA 2QL9A 2AT1A 4FOPA 1T1SA 1PEYA 3QBTA 4W99A 2XNDA 5H4HA 1E64A 4LXTA 1M1YA 1AKEA 3F5QA 5JNUA 1ORVA 4FLMA 1PSWA 5CTAA 3MTQA 3DPSA 3EFOA 4P08A 1N1GA 1KSJA 3BGWA 2JHCA 1GCOA 2C1EA 2PMFA 1ESCA 4N01A 1KAOA 4PXSA 4BLWA 1QK4A 3NAMA 4REOA 3CPSA 4FZ3A 3SHFA 4OI4A 4NPAA 3UPUA 3BSSA 4NFHA 4YCAA 4C4RA 5DT2A 3ED5A 4I46A 1TNDA 5I7EA 2GMWA 3WBBA 4X65B 3ZWPA 1PR1A 2BC9A 3ORFA 1JI0A 3DVAB 2A1UB 1TCAA 4HVTA 3C2QA 2R8OA 1Z18A 2QN9A 3FPEA 4ESHA 1Z7WA 3UGQA 3NR2A 4MW2A 2IYZA 4KWCA 4YCSA 1B3RA 3PKJA 3KOOA 4EA6A 3D2AA 2YXPX 3GA5A 5IF3A 1JR3A 2YJ6A 3NWEA 3QV2A 4BX3A 2BMVA 4DZZA 2IYRA 4TT3A 3N7TA 1H1TA 3HEMA 3LMKA 4CCYB 3LY5A 4DC1A 2CJWB 1N2ZA 4YDSA 3SLRA 3W04A 3PPXA 1GN8A 4AJ1A 3CZAA 1X3LA 3MK31 1PNOA 4OGKA 2IXTA 1JEEA 1V39A 2GUWA 2KI5A 3EUEA 2ZJBA 4TKLA 2QRGA 4BRUA 3GXBA 5I7RA 4PQYA 5J4LA 1GAJA 4NQZA 4RPHA 5CAEB 1XI2A 1HX7A 2P9JA 3KUXA 1MEEA 1M8GA 3SBOA 4DLWA 1T0HB 1W30A 2AE2A 3ER8A 2IZ7A 4JK3A 1DRJA 3JQ6A 4M9ZA 5THQA 2HDHA 2W98A 2NUTB 1JEDA 5TQ2A 4EYEA 1QIJA 2JCSA 2ZIZA 2WQ7A 5ELXA 1EIWA 3UCEA 4ETNA 4N9WA 2FF7A 4B4OA 1G5RA 1ZUD1 2RH8A 3IQIX 1U3TA 2EZTA 1OBVA 3SHTA 2CVQA 1O95C 4IDFA 4ZAVA 3LY7A 1I6KA 1UBCA 1RPNA 2AG5A 4XUCA 2ZB7A 1F2TB 3OPXA 5EKSA 1Y3HA 4LZZA 1YJ5A 5BUZA 2JIMA 3OZWA 1QV6A 4ZU1X 3IEIA 2A9KA 4KR7A 3OFKA 3LPMA 1Q0SA 1VSQA 4H4EA 1JE1A 3WNBA 1L4LA 1M5TA 4CIAA 1Y42X 3GRKA 4UM9D 4FC7A 2GASA 3LM8A 1N5DA 3WK4A 2PK3A 3PFWO 5UKDA 3KZMA 3NBZC 4BNDB 3OJXA 3BXOA 1DDOA 3UXEA 4XYBA 4MAFA 4EY3A 4DWWA 5JSUA 4B8ZA 4JC4A 2FPIA 4JP8A 3RFTA 3U39A 2JAPA 2PZMA 4JC8A 3G2LA 4PO9A 4A2QA 4FQ7A 4QTZA 3MCVA 4IZOA 4PN3A 4BZQA 5JT1A 4HDKA 2AD1A 1RHQA 3OCCA 2MYUA 521PA 1XN4A 4GI1A 1ODJA 1BMTA 1U5BB 3SKYA 2JZNA 2GYWA 5KVAA 1U0SY 4S0XA 2BBOA 1SOWA 2VH1A 3PNYA 4K6OA 1G2PA 3DZIA 1GPNA 3BJMA 3I0NA 3W9SA 3WICA 4MJXA 5JLAA 3KSBC 4DJEC 1KI6B 1MOSA 1AE1A 3FYTA 5C1PA 4YLGA 3HRIA 5J2TA 4Z86A 2PANA 1USUA 4ISBA 1R18A 3VDRA 2Y4NA 2C0PA 4M37A 2PBRA 2WHPA 4F5WA 4EAQA 3U09A 1ZISA 1AZTA 1RXSA 2EKBA 3HI4A 3BREA 4WDRA 2JLYA 4HPJB 2E55A 3PCTA 5LN1A 2J3JA 1U4NA 3B9QA 3DE4X 3OWXA 1G3UA 3O4GA 1B74A 4GRAA 4BVEA 2CSUA 3QX7A 1WSBA 1NQTA 4I1VA 4DADA 3FPHA 1XT6A 3G8CA 3GEMA 2DPMA 3EODA 4C3UA 5J4YA 5ENVA 1M74A 4L4SA 3DTVB 4RJ2A 1M0EA 2P2DA 1H0KA 1OBFO 1X0XA 3FNBA 1X19A 1XRSB 2YY5A 3OM9A 4QXQA 4ER7A 4DLYA 4IX9A 4QGHA 2VZ0A 3OEWA 1NJSA 3BXXA 1V1RB 1YRQA 4JCOA 4KQEA 2CDCA 4MPDA 2OBMA 1DAEA 5LZ2A 1TIKA 3P2IA 4TLMB 1RM4A 4CKWA 1GA6A 4KPYA 1XXHA 2V3CC 3IV6A 4G84A 2ZBGA 4O8CA 4OQQA 4WINA 3QBDA 3ZGYA 2JGIA 5MDHA 1JTFA 1Y4DE 3IT1A 3VH3A 3A1EA 5CCDA 1UCFA 3G2IA 1RWBA 1W1IA 4EARA 2DLNA 3KLPX 2O50A 3L1UA 1ODCA 1GLVA 3FUUA 2OVBA 3TGWA 1WJGA 4MIYA 2HREA 4B3XA 4RHEA 1Y6QA 4UHJA 3ZX5A 3KQPA 3V7YA 2YOGA 4M88A 1E2NA 1LQUA 1QRDA 5KNCD 3JASB 2BKXA 4MVJP 4JLDA 3F3YA 1FB5A 2Z3WA 3LFUA 3K0CC 5FPHA 5K0FA 3IILA 1DEKA 5KTTA 2GCNA 3NCTA 1BJKA 2ZULA 2VWHA 4WWHA 3G89A 3NHPA 2WU4A 4WDQA 4L85A 3ZZ0A 2H4HA 3BERA 4WXRA 5EJ7A 4IHJA 1NTRA 4RTKA 3OQOA 3T1QA 3CZPA 1FJXA 4FYMA 4E30A 3P9YA 5I7AA 4MIOA 1QLJA 3KDSE 4NMWA 3SZ3A 1S2DA 5I48A 2JRCA 4UJ5A 1AA6A 2XEDA 1I3NA 3D8SA 1MC1A 4FFOA 3UWOA 2JJ1D 3C8MA 1KAGA 4LE0A 2MU1A 4QOJA 3L0YA 4AD8A 3EQ9A 4X63A 1NVVR 2ZETA 2AHRA 1Y8RA 1GZHB 2GM3A 2ZYAA 2DG2A 3I2GA 1BKDR 1UP7A 1E92A 2PT9A 1Y1KE 4Q3KA 4YRGA 5ADVA 2QY6A 1CULC 1E8DA 1E9CA 4C08A 4CKXA 4AFNA 1T3HA 1E2IA 3BICA 2XKAA 4H1HA 5DXAA 3R23A 3SHWA 4B81A 3C7TA 2GJAA 2W2KB 1NN5A 5EJ2A 5I45A 3IIIA 1Y9ZA 3OCYA 4UCQA 2RJNA 2JHPA 5FPQA 3RTDA 3ID6C 3NYIA 2PU7A 2TECE 1H9BA 4K6CA 5HGJA 2JIRA 4TTIA 1JNXX 1AUVA 4CV1A 2AG0A 3I6MA 3EGXA 3KZOA 5MN5A 2AF3C 3CURA 2QIOA 3E4CA 1RWNA 4JYMA 3WGIA 3MUFA 4DR2B 2YIMA 1U6KA 5D6NA 1MJGM 2VS1A 1MQ9A 4Q9JA 2QV0A 3GZTB 1QF9A 2YZ2A 5ALYA 2BFNA 2IWHA 3T1NA 3TLBA 4KR6A 3WK9A 4W5HA 4X20B 1U8EA 1MKYA 3EWIA 3AEQB 2YN2A 1S2IA 3H5IA 3RRBA 4M1TA 1CFZA 3AI7A 2F43B 4S1WA 5CIQA 1B3BA 5EIEA 3SIXA 4U8HA 1PS0A 4TXJA 2Z4RA 1QB8A 2O8CA 4PPQA 3G0OA 1LPBB 1VKOA 4HAYA 2EL7A 3FWYA 2JF0A 1LDYA 3EEIA 4IIBA 5IYZA 3MUNA 3WSTA 1C0PA 1JSZA 3VKUA 1FP1D 1M0SA 3LDHA 4GMDA 2DX7A 2QE6A 4RW0A 5GONA 1GA4A 2X3UA 2NU9A 5IM4F 1L7QA 3B6IA 3DJYA 4MYUA 4Y0VA 1OWOA 1HDGO 2FOXA 3U7JA 3BD9A 5FEUA 4WCVA 4B6EA 1UKZA 2C4TA 4O0LA 3K8ZA 3V2GA 5BOSB 2HPAA 2PYDA 8ADHA 2NTYC 3DO8A 1BDBA 1EX7A 1JA9A 2Q5LA 3DFMA 1W0CA 4RUKA 1TMGE 5JY1A 1ZNXA 2CXQA 4JBNA 1BOFA 1R6DA 4JYBA 2R00A 4GOOD 3I73A 5FOXA 1X7XA 5HPYB 3F46A 3K6RA 4M55A 1K8RA 4KIGA 1WMAA 3MJRA 4YCBA 1QZ3A 2B34A 2QGFA 3DM5A 3M6LA 5EVCA 5ADWA 3MGBA 3KQHA 4FW9A 3GV0A 3E22A 1MB0A 1VPVA 2HQBA 3DLCA 3E8SA 3PGKA 4JEIA 4YCDA 3V42A 1IK4A 2J45A 3RRYA 1WABA 1NPDA 4G0ZA 3A28A 4IJWA 1EXMA 5D01A 1OFGA 2NTVA 1UBEA 2IHTA 3IX7A 1I7PA 4K2AA 4LVUA 4PW0A 4E3WA 4QLBA 1SKAA 4Q1CA 1Z33A 2B25A 3P0EA 5G0VA 5J4KA 3HFRA 3EF0A 1TO1E 3WMXA 3ZZUA 3GLFE 1Z37A 2G0NA 2V96A 4YJHA 4OBEA 1GUDA 1T0JB 2FEPA 1Y6GA 4W6QA 4CTOA 3BAZA 1Z68A 1DAMA 3H11A 4WOKA 3DAPA 4A1FA 2P40A 4Y18A 1T34A 3D4LA 3HM2A 5JJLA 2WT4A 2A0XA 2H7VA 2NVWA 2EJUA 3GLHA 1GIAA 5ICSA 3R7BA 2IOQA 2CHGA 4QNNA 3SG0A 1NLUA 3LWZA 4D8XA 1P7WA 1Q1BA 2P6RA 3LCUA 4G0UA 3NUQA 1C81A 4RVUA 3GPCA 3BDIA 3RYFB 2WWFA 4Y1EA 2KQUA 3ZDRA 2RKOA 1FSSA 5SY4A 4EHJA 2PJDA 3C87A 3MS4A 5BNFA 3G49A 4F91B 1CQPA 5FPKA 1UEJA 4QJ4A 4J0DA 1XE3A 2E0IA 1M1YB 2O5EA 3ACDA 4HVAA 4N7JA 2C96A 4I1IA 2ZBQA 4HPWA 4MB2A 4JU8A 1K7YA 3CH7A 4D97A 5I7OA 2J0EA 4WGFA 3F8TA 5DCWA 3GDWA 3BTSA 1I5OA 3DZFA 1EBUA 3G9TA 2QGNA 4FP9A 4L51A 4O63O 5BXQC 1NNEA 2OAQ1 3TX2A 5AJTA 3ACBA 2CLLB 4E21A 1VI6A 2GOYA 4LQCA 4OUDA 4UUNA 2CVHA 1P31A 1ISHA 4DZTA 2DSNA 3VR3D 1UBHS 1UPFA 1Y1SA 3CISA 4G4IA 5AYVA 1IQ0A 2IS4A 1TYDE 3IP6A 3MYRA 3OHPA 3E48A 3KJQA 3DEJA 3HYTA 2QTTA 2FV8A 3OPYB 2QX8A 2RI6A 3IUJA 3EEFA 4YT2A 5A06A 4EELA 5A02A 2XUAA 4CT5A 1OV4A 1JDPA 1ZIXA 3FYHA 2A9RA 2I67A 2QU8A 4ND2A 2G0TA 1DT5A 1DKUA 4GM4A 4NHEA 3T5GA 5B30A 1XU7A 1XRJA 4DQKA 2AG8A 4D82A 3GMSA 5MFPA 4M87A 3GJ0A 4ND8B 2G07A 2GILA 4I9FA 1D2GA 3AZOA 4MV3A 4Y9RA 4GICA 3FWHA 3DHWC 1E4VA 3HP4A 4KC0A 5CM8B 1V4NA 4YXFA 1TCBA 2WKQA 4O5OA 3VHXA 2GEDA 3R6WA 4BQRA 2J9ZB