2YVUA

Crystal structure of ape1195
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
b'KCIEKGIVVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEPPENPQLVLDTESNTIEHNVSYLYSLVKAVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable adenylyl-sulfate kinase
publication title Crystal structure of APE1195
rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 71
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yvuA00
1F60A 4QGGA 1KDOA 4ZCMA 4URZR 2J46A 5KPDA 2IUSA 1NY6A 2QP9X 3GD7A 2NZJA 1G41A 4FMCB 2AFHE 1M8PA 1QHYA 5E7MA 3SS8A 1QBKC 2NO0A 1AS3A 4QRHA 3IUYA 4WIAA 3W8RA 1UJ2A 4TN1A 4BE7B 1XD2A 4WXRA 3RSLA 3NTUA 4B71A 1BOFA 2IYTA 1R7RA 3NBXX 1G21E 2HDNB 4LYFA 2YWFA 4NPHA 4XWOA 4UNQA 2YYZA 4Q1AA 4D81A 4K8OA 2GEVA 2QQ0A 1UKVY 3IEUA 1X8LA 1M7GA 1YR9A 1U8YA 2XOKD 3FYHA 3ND8A 1VYUA 2B92A 4DLTA 5GJBA 2AR7A 1VHLA 621PA 2FSGA 1CKEA 2P5SA 3LNCA 4LRWA 4LZZA 4DDTA 2H16A 2DB3A 2PEZA 4G5SA 3EXAA 421PA 4JL5A 1P60A 4KLNA 3A37A 2EYUA 1KMHA 2KSQA 4JVNA 1ETUA 2JEOA 4EAQA 4BLPA 3TKLA 4QBFA 2B8TA 2CE7A 3BOSA 2ZU6A 2DR3A 2O0JA 1NMXA 3L2OB 4EJSA 3W3ZB 1OXUA 1M74A 1NP6A 1E69A 1Z3IX 4EJSC 4GL2A 1ZM7A 2IYVA 3HP1A 5CJPA 2QROA 2AXNA 3AF3A 3OF5A 4IOKA 2X1VA 2VHTA 3P27A 2BKEA 4V0NA 2D74A 5FPSA 2LWIA 1GP2A 3IQWA 4B34A 2HJGA 1LVGA 3CO5A 4QM7A 4KO8A 2A2ZA 2KBEA 3R20A 4LHXA 1XZPA 5AJYA 4A0RA 5AUQA 3IKJA 4AURA 4L9WA 1EWQA 1OE0A 2F55A 1X3SA 4A2WA 3UMFA 1NLZA 3B8HA 4DT1A 3P4YA 2ZPTX 3GJ8A 3KB2A 1XEFA 4QGFA 1PVOA 4BLSA 1UEIA 2V55B 4PO1A 4BRUA 1Z6YA 3B7GA 2QTFA 3NBFA 2WIBA 4FN5A 4FCWA 2NOAA 1G291 3W3AA 2WJGA 1RE0A 4A36A 1ZAKA 4LV8B 3GFOA 3RC8A 3VX4A 1KNXA 3R9WA 4BECA 2QPTA 2FFBA 5DI9A 3MLEA 1IXZA 1G16A 1PZNA 4Q7KA 3X1XA 3U3MA 4H9GA 4RD3A 1AKEA 1Z6GA 4LPSA 1NF3A 1EFTA 3Q7QA 5EUMA 1YZTA 3MG9A 2D2EA 2IWHA 1W7AA 4AK9A 4BFXA 3Q85A 3EW9A 1E2JA 1IN4A 1P73A 4TMXA 2BM0A 2XITA 3WYAA 3KFXA 4KHZA 3MRSA 1SVLA 4HLUC 4N3NA 2ZUDA 3U7FB 2OILA 4YDHB 3GP8A 2CHQA 4TLBA 1OFIA 2E87A 2J0SA 2GAOA 1IOZA 1A4RA 1EFRA 3D31A 1BYIA 4B3BA 2B7BA 1NN1A 3GEEA 1WE2A 4IOLA 4EFMA 4M22A 2YNMA 5BYJA 2QNRA 1JBKA 1WCV1 4YMWA 2WJVA 2QPOA 3KZ1E 4TYPA 2Q0HA 1G3IA 1N6NA 4KYIB 4W9MC 2ZAMA 4JVLA 1TMKA 2R6FA 2XZLA 1EFCA 1US8B 2W0MA 3R7WA 4DIDA 4LDJA 3U44B 4O3MA 1E0AA 2H8KA 1TPZA 3EIEA 3QF4B 4PO8A 3Q72A 2YJTD 4BLOA 1YZQA 4YQFA 2CCKA 2O8BB 2QEQA 1NKSA 4UXJA 3TR5A 2O52A 1COWA 2CJWB 1KZGB 5A4JA 4JLDA 5FI1B 3TE6A 1I4TD 5AJWA 3RWMB 4OI1A 1R5BA 2ZJZA 3S1AB 4D0GA 3ZVNA 3EAQA 1KY2A 2PCLA 2VYFA 3RRZA 3U3JA 5DNYB 5TARA 1WP9A 2ZE8A 3MJRA 3VQTA 4R2HA 3SOPA 2NO9A 1OB2A 2ZM5A 1EX6A 1EXMA 4EPRA 4UNNA 2ZYTX 3BFVA 2YWHA 3DM9B 5KNBA 5CYOA 521PA 4OI2A 4EPYA 1PUJA 3GEIA 3TUIC 3UANA 2OFOA 2O8DB 1U8AA 2JJ1A 5J4KA 1GNQA 4PPGA 2WJYA 2CBZA 2W6JA 3AVOA 2D4HA 3IGFA 5DSZA 5KU1A 2AFIE 5HTKA 1KI2A 3AV0B 4Q9IA 5LBIA 5JECA 2W2VA 3EWAA 4CEHA 1GNRA 3BK7A 5EP3A 3KQUA 1N6PA 5L3SB 2Q21A 3MWYW 4FMDB 1EFUA 4TLDA 4X8HA 1U0LA 4R71A 4NTZA 2QPAA 5G41A 4TZ6A 2DWQA 3HU3A 3BXZA 1UBEA 2PBRA 3CONA 3U7EB 2ZXUA 1E6CA 2ANCA 4HAZA 4OI0A 1IN6A 1G5PA 2C8VA 3RS0A 1Z5ZA 1AGRA 1F2TA 3SI7A 4GMXA 2QP4A 1WBDA 3JVUA 4YMSA 5IHPA 1HE1C 1LB1B 2RGEA 4DCNA 5IRCD 5J4HA 5BN5A 1VKJA 3TQFA 4TL9A 4ILEA 5BYKA 3KQLA 3QKTA 5FBLB 1TADA 1NN5A 2PX0A 3WBJA 3QY0A 2IUUA 5CIWA 4LHZA 1T0HB 3O8BA 1OB5A 3FHCB 3V4FA 4C0AC 5AR1A 4ZKEA 1XF9A 2Q3MA 2PT5A 3B85A 1W4RA 4HSEA 1KMHB 3CR7A 2WKQA 1FUUA 4RZUA 1X6VA 5JS8A 1FOEB 2W00A 3GJ6A 1XTKA 3CZPA 3K9NA 1N5KA 3TSZA 2ZJ5A 2BV3A 2DFTA 4EJSB 5SZJA 4S35A 4EQ6A 2Z4SA 2J59A 3DO6A 2WJIA 1G5RA 4A8JA 1PLJA 1YQTA 3T5DA 3BH7A 2GJ8A 3BBPA 2PLRA 4A8JC 1ZD8A 2GCPA 2QMUA 3SZRA 2GXUA 2CE2X 2ZJOA 5A5GA 1Z0FA 2P6UA 2V6JA 2GCOA 2GZDA 1LTQA 2WOOA 4GP6A 5J40A 5SZIA 1GIAA 1JR6A 3PXGA 2YOGA 2PH1A 4N1AA 2ZI6A 3IBYA 4I99A 4DT1B 1AZTA 1OF1A 2JCSA 2IYUA 1CTQA 5JRZA 2WWHA 4W5JA 1UBCA 1CJVC 4Q19A 1OFUX 3U6BA 2N42A 5KUTA 1DELA 4EDHA 3AVPA 3T1QA 2WAYA 4FCTA 3T1OA 2W2XA 1QDEA 1GDDA 4LBYA 4IDHA 4PAMA 1MRSA 2ZJ8A 1QVRA 2ZRCA 3TMKA 4PAOA 1N0VC 4NDZA 1LS1A 4UJ3A 4QOSA 1XTIA 2J45A 2FSIA 1MABA 1R0ZA 2RGNC 3PIRA 4UNSA 3QF7A 2EFGA 2FEOA 2OXCA 4HZIA 1L4UA 1QHXA 3EPJA 1T3LA 2OSBA 3JZAA 5HKKD 2V1UA 1TF2A 2OCYC 3FFBA 2F9LA 2YVUA 5TVKA 3AVUA 4WBSA 5JWHA 4TQ9A 1AS0A 4Z51A 1F2UA 4OK6A 1KDTA 3QQ5A 3N2EA 2VSXA 3ONWA 1OXVA 3UG7A 2BHRA 2QAJA 5EZ5A 3Q5DA 3HYTA 4KVGA 4LCBA 2VF7A 3A4LA 4ZV4A 2YOFA 3HDTA 1NSFA 4OL0A 4YMVA 1CR2A 4MITA 1EK0A 2H7VA 2JDID 3LLMA 1VPLA 3A1UA 4AY2A 1N25A 2QY9A 1W1WA 1AA9A 2JATA 2CMKA 3PFIA 3L8YA 1YVDA 4E5UA 1CEEA 2FX3A 4PSKA 2GCNA 4PHGA 3R7WB 2OHFA 1H8EA 4A0HA 5K8UA 5KDOA 2C9CA 1PLLA 4KODA 1OIXA 2WBLC 4NU0A 1BS1A 1E9CA 3I5YA 2CK3D 3E70C 3OIVA 1IN7A 3WHKA 1KK0A 2E9SA 3T1TA 2QSYA 4ERNA 4OQMA 4ZKDA 5FTKA 4UKDA 4B75A 1ZRHA 4OJQA 4X8OA 1G1MA 1SKYB 2OCAA 2WTUA 3PR1A 4V0KA 4ACAA 2OESA 1J90A 1G3MA 4CT5A 4CGZA 3U3RA 1VCMA 5FBRB 4DLRA 3TLXA 4TLEA 3WNDA 4NE2A 5JI3E 4MKFA 1W49A 5EUQB 5UKDA 2J0QA 3CWZA 3NIBA 3CPHA 4BPBA 2AKAB 4LJ9A 5E4FA 2ZRLA 2CLDX 4PC7A 2J0UB 2CVHA 3OIUA 1Z0IA 4DB2A 3I92A 3EZ2A 1JALA 4B2PA 2NZ8A 1ZM3A 2A78A 4CEHB 2XNDA 3DMNA 5CK4A 1OXXK 4HB2A 3W6OA 3KB1A 4D80A 4AKGA 2GVZC 2ZI4A 3CR8A 4M1SA 4BLRA 2F1RA 2AK2A 1HTWA 2JLSA 4QL3A 4PC1A 3K8YA 5KPJA 3LV8A 1JECA 2XX3A 3FKSD 3QPVA 1RIFA 4ZI2A 1E2IA 5DO9A 1NVVQ 2PJZA 1EGAA 2BBWA 2V8OA 1OIWA 3F8TA 3LVRE 4AYXA 1X1SA 2QT1A 1ZINA 1FZQA 2JIZA 2C78A 4TTRA 3I32A 2GBLC 2Z5FA 2ZI5A 3W8NA 1U99A 2A9KA 1FFHA 5FUVA 4CDGA 3RS7A 1E1RD 2CL7X 5FOXA 2WKRA 1ZM2A 1JEDA 1W48A 3NKVA 3KL4A 5J5CA 2BEJA 3EIHA 3AVTA 1I2MA 1ZBDA 1O87A 4EFLA 4LWZA 4D82A 2WHXA 5BW8A 1KK1A 1SVOA 4Q9KA 3AGQA 1H8HD 2WJHA 5FPKA 2PZFA 2FZ4A 3CF0A 3LX8A 3KXKA 2IA5A 2HUPA 2EVWX 3BB4A 1E98A 1J99A 1OH5A 4L5BA 3ND9A 1UAAA 3CRW1 1IN8A 4UQOA 5JZVA 4H1VA 2VP4A 4Q7JB 4C0HA 3ZVMA 1ZMXA 4EQ6B 5L3RA 3EPHA 4F93B 2QBYA 3BE4A 4C0SA 1KOFA 5GJWC 1ZC4A 4A8JB 1GG2A 3QVVA 3PJRA 2XGJA 5JJKA 1N0UA 3CUEF 1ZNWA 1JXMA 3ICQB 4MRSA 2O8FA 2XNSA 4RCZA 4ARZB 3PEUA 4XVRA 3DVLA 4TYWA 4DUGA 4L15A 5IK2D 5C1BA 5BN3A 1NVVR 3TK1A 3OIWA 2J0VA 1N6RA 4RZXA 2A5YB 1OLOA 2ZSAA 3VNVA 1E0KA 1PLKA 4DBLC 4US2R 4RD2A 5JHHB 3GLIA 1OH8A 2OAQ1 3A4NA 1R10A 5CM8B 4II7A 3T06B 3GFTA 3K9LA 3MD0A 3OAAD 4DCVA 1Q12A 3N70A 2ZU0C 4F91B 3I5XA 4MDFA 4QHSA 1CS4C 3RDPA 3KJEA 4NBSA 4RVCA 3L0SA 1NKTA 3AVWA 2VP6A 3CPJB 2QI9C 4TYNA 2ONKA 4A82A 2V6IA 4C0JA 1T9HA 2FG5A 1JB1A 4C0QC 4J0QA 3U7HB 1DAFA 1AIPA 4EPXA 2F43B 5JI2E 4E03A 3W5IA 1I4DD 5FBWB 1VECA 4PR0A 4B3CA 2G1KA 2W6IA 4OYHA 3X1YA 5FPHA 1F2UB 4URUR 2WWWA 2ZRNA 3B1VA 1SVWA 4XD7D 2BMEA 1TEVA 2ZJ2A 4HI0E 5GADl 3ADCA 4B47A 2XSZD 5JEDA 4KLZA 1RPZA 1T6NA 4PSVA 4PX9A 2EFHB 1FX0B 1NI3A 4B3GA 1XBTA 4JSYA 3L43A 4IHQA 3A1TA 3RHFA 4F7WA 3SQWA 1P9WA 2HT1A 3FMIA 1DADA 4I1OA 4M9SA 2IWRA 1OHHD 1W0KD 3C5HA 4RZ2A 1E79D 3NDPA 1YHNA 2R6CA 2A5GA 2O0HA 4WZBE 2FDCA 3U2QA 2CNWA 2G3YA 3BB3A 4TSFA 2W0SA 1DOAA 3M1IA 1VG0B 5FBQB 2E1RA 5HCNA 2CLCX 4HLQB 2G0NA 2GXQA 2RH5A 3X1DA 5KO2A 1FP6A 5ELXA 2V7QD 4CT4B 3GLGB 4X8MA 3LVQE 3IEVA 2QL6A 2GNOA 2ZRPA 4ESHA 1XDBA 2A7QA 2DWOA 2ZI9A 3RS5A 4TL8A 1NNEA 2VHCA 3ZVLA 4JJZA 4DIEA 2JLRA 4ZDJA 4FMBB 1UF9A 1C1YA 2ZYVX 3NEJA 2Z0MA 1DAIA 3SE0A 3AUYA 2EWWA 1KSGA 2TMKA 3L0IB 4LK2A 5JEEA 1XMIA 1DBSA 3QF4A 4MA4A 2UZIR 5J4VA 5KSOA 4HDCA 2O8BA 1A7JA 1Z6TA 5FOSA 3GJ5A 4WW0A 2IEZA 2MSCB 1YU9A 1CU1A 4JIMA 4RKFA 3FHTA 3S1AA 1BMFA 1DG3A 1XD8A 4LJ4A 1VYTA 1KO5A 2Q3HA 2ZI7A 2IHYA 2YWGA 3D6TB 4BGDA 2EYQA 1P6XA 1X8JA 4LI0A 4DSNA 4GOKA 2FA9A 1NVWQ 1KI4A 4M1YA 3M0EA 4NHOA 4NH0A 2ZR9A 4Q00A 4MRNA 1YZLA 1AS2A 1G4AE 3DKVA 2XXAA 2O8DA 1TL7C 4M1WA 4G5QA 1G18A 2IYLD 4HB4A 3W5JA 5JS7A 4PTLA 1GZSA 1Q0UA 1SXJC 1VHTA 4GMDA 2WM9B 4RFSB 4EPVA 4PQRA 3U6KA 1BO6A 3ZGXA 3MGCA 5L3SA 4DLUA 5TV2A 1KKLA 1KK3A 3UWKA 2VP5A 3OEHA 4EPTA 1E2HA 1QZXA 1E96A 1Z83A 2NTYC 5G3ZA 3QJYA 2WSSA 4BFWA 2KB0A 3B1XA 1XU4A 2LKCA 2ZRIA 3QUSA 1MO3A 1VCOA 3AF4A 4LX0A 2ATVA 4TWZA 2QBYB 1RC8A 2RHMA 5AJZA 3IIKA 4AYWA 3TGPA 3GFPA 2QZ4A 4TMVA 2GAAA 3B13B 3BJIC 1G7RA 4X8LA 5C18A 5JMTA 4PQFA 2O8FB 1KY3A 3ZD6A 2AK3A 2WKPA 4P4SB 3EZ9A 3WNBA 4M9ZA 3DOFA 4PQYA 3TUZC 5JBQA 1II8B 1IJFA 4MGYR 1T8UA 5DISB 3V00A 4IDNA 1IBRA 2AX4A 4I1UA 4BQSA 4NP6A 3ZVRA 3O8RA 5E95A 2RCNA 4WOPA 3DDCA 4G01B 4DWJA 2FSHA 1U2RA 2FV8A 4D4KA 4CEIA 1UBFA 3GLIB 1TUIA 4YC7A 2VO1A 3KUCA 4NCKA 2WPDA 1JJVA 4BASA 4WZAE 4F92B 4D0NA 4B76A 1SVMA 2A30A 4FXPA 2G9NA 3WP0A 3MUFA 1YR6A 2ZSEA 3EX7C 3QNUA 3ZZTA 2OCBA 5JWOA 3K9GA 4LHVA 2IYXA 4JVMA 3ASYA 4B6EA 3BH6A 4RD6A 1WB9A 1XJQA 2O0KA 5FTNA 3ZZ0A 5JCPA 1IY2A 2FFHA 1E2MA 5D3QA 1BIFA 3VMFA 5CYPA 4KI0A 4PHHA 5DYIA 5EXSA 1NRJB 5BXQC 4A1FA 3Q7PA 3L82B 3FTQA 3CW2A 3BB1A 3EIQA 2QT0A 1C9KA 3E2IA 2P67A 4B32A 4B3FX 2ONJA 2FN4A 2LKDA 3NBYC 4N0EA 1TUEA 1EFHA 3C4JA 4DLSA 4ESVA 4B35A 3BORA 5L3VA 5KOYA 5G40A 4ZDKA 1D6JA 2WV9A 4D2IA 4KSBA 1LF5A 3QI2A 4GZMA 4JBWA 2QORA 1II9A 4LBWA 5JLJA 4IEEA 4IVQA 1RKBA 1SKYE 1E9RA 1G64A 1G8FA 1QG4A 3AVXA 3ZQ6A 1OH7A 3K53A 1PJRA 2WZQA 2FE4A 3VKWA 5GVRA 5K8IA 1RYFA 4EFNA 2J5XA 2GA8A 4HLUA 4DLWA 4US1R 1MV5A 2GJ9A 1VIYA 2NO7A 3G5UA 4JT4A 2NPFA 3SYLA 1S3GA 4DZZA 4KBFA 4XVUA 2QENA 4QJ5A 1W5TA 2Z6VA 1J7KA 2ZRFA 2ZUBA 3RABA 1P2VA 4LBZA 1EFRD 1HUQA 1OFHA 1S1MA 1ZW6A 1IAQA 2YHSA 3KUDA 2JA1A 5EXPA 2RKOA 2DWPA 3F0TA 3SDZA 4LGMA 3RRNA 2L0XA 2QSZA 2F6RA 1E4YA 1RRGA 3I8XA 1FPMA 2CL6X 5D3MB 1Z07A 4M2LA 4Q1FA 1E2FA 1P2SA 5KDLA 3RS3A 1FP7A 4A6XA 1GILA 2N46A 4LJ5A 4AI6A 2VSOA 3VKHA 2BMFA 2J9RA 1NMZA 3SFVA 2HJVA 2MSEB 2OFXA 2JLYA 3NDBB 1COWD 1TF5A 4IFEA 1JQJC 1JR3E 3AGPA 3KX2A 1OXSC 2ODBA 2EFCB 2ERYA 121PA 1G8GA 2CDNA 4TTPA 1TU3A 3AM1A 2FFQA 3QXHA 4O25A 4RCYA 5FPYA 4KV9A 2XZOA 3K0AB 4LHYA 3OFNA 2H17A 1VIAA 3VKGA 3JVVA 3VFDA 1GRRA 1LS6A 2RAPA 5EXTA 4Q66C 3AEZA 1NVUQ 3L8ZA 3MWLA 2XTZA 3EZFA 4G0NA 2RMKA 4FIDA 5AJVB 2A5DA 2WMOB 1H65A 1SVKA 2JJ1D 2B6HA 3CNNA 4KFUA 4U5XA 1L4YA 1YZUA 2W6JD 4OQFA 3I8SA 2BOVA 4O2RA 4O2LA 4IDPA 2ANBA 3TNFA 1AM4D 3RSOA 2XXAB 4MGKR 2J0UA 3VR6A 1SXJB 2QMHA 3RYTC 4A6PA 4V03A 3AF0A 1ESMA 3LRPA 4IVRA 4JBXA 3EASA 3WNCA 4AKIA 4A4DA 2YC4C 5F3WB 2QE7A 5E3HA 1JPNA 3B60A 4PHFA 1P75A 1IY1A 3HU1A 4ZPXA 1GTVA 3LW8A 3H4MA 1RRCA 3C41J 1DG1G 2RGBA 1G4UR 5AUNB 4JSTA 2Z4RA 5CIQA 4CF7A 2IS2A 4R2IA 4Q48A 4I1SA 2H1LA 4LPKA 1MOZA 3AQ4A 1M34E 4JBYA 2ZREA 1GL7A 3QXCA 3B1WA 4FINA 2DBYA 3QXXA 3ZYCA 1JR3A 1FNMA 1NJFA 3NBZC 4PC3A 4DSUA 3VHLB 1ZVQA 2D2FA 4HEJA 2A5JA 3D8BA 4MUAA 2FF7A 4R7ZA 2F1IA 4TMZA 5TB5A 3ICEA 1W2GA 4M4SA 2H18A 4CEIB 2V9PA 1D5CA 3OESA 2PL3A 1KI8A 1ESNA 1FQJA 1E2EA 3QEOA 3QXJA 3PUVA 4IXMA 3OEEA 3K0FB 3QOFA 2QQEA 5F98A 1P7CA 1E9EA 2VL7A 4MQBA 1VMAA 2ODEA 2F9MA 4RD4A 4NL4H 3TSWA 1G7CA 3VR5A 4PANA 4MYCA 4QJ3A 2EWVA 1XD9A 1V43A 4KAXA 1JEEA 2NO1A 1HEIA 3NHBA 4L8GA 5L8VA 2VH5R 1QHHA 4ARZA 5FL7A 3CX8A 2ZTSA 2IX3A 4M8NE 4TT3D 1W36D 4R98A 3A4MA 3RC3A 4DDUA 2VIIA 1XRJA 3TVTA 1T0JB 4TT3A 1HY3A 1ZIOA 1Q22A 3TW4A 1M2OB 1EG7A 2WVJA 2Q3FA 1WDTA 4KJZA 4D26A 2UZ3A 1KO4A 3CLVA 3QENA 1OYWA 3VR1A 3THYB 2EW1A 1U0JA 1XXHB 1G6OA 1SVIA 3H86A 4Q4LA 1NBME 2ZYUX 1FMLA 4MGIR 1CJTC 3QIAA 5DIFA 4P33A 1W4CA 1TNDA 1UKYA 2GK6A 3DEFA 2CXXA 4ZDIA 1QRAA 2H57A 3K1JA 4LYJA 2DYKA 1KO7A 5FTMA 1N2CE 3VHXA 2RGNA 3QXSA 4I81A 3GLGE 5AWFC 5FPTA 1U9IA 1ZYUA 4LV5B 4FWTA 4DCSA 2BC9A 5FTJA 3I62A 2C2HA 1UDWA 1U9IC 1GNPA 3AB3A 4Y0AA 4ABYA 2OAP1 2RGAA 3KQKA 2HV8A 3MJHA 2F43A 2FWRA 4WVFA 5LD2B 4Q1DA 3B5JA 4LV6A 1N6OA 3NWJA 3CZQA 5KSPA 1N3BA 3CH5A 1W0JA 4QC2A 2ZSFA 5IF9A 2QRNA 5EE1A 1Z29A 2BCJQ 5FOUA 4XIGS 1OKKA 4IDQA 3GJ0A 4URVR 1N6KA 4E07A 5TDHA 1MR3F 1CULC 1OT3A 4Q02A 5DH9A 2J7PA 2X8AA 4UNPA 1FX0A 2W83A 3KXIA 2C5LA 3ZIAA 5FUXA 1P9NA 3AKEA 1XMVA 1Z0JA 1FUKA 1AJEA 2VPPA 4QHTA 4QXAA 1GKYA 3V9PA 2WAXA 1H8ED 1XTJA 3KJIA 3SNHA 3SJCA 4TMTA 1G6HA 3FDIA 4DLVA 4HUQB 4GFDA 3B9PA 1KI3A 1JXOA 1ZM9A 4IOMA 1QVAA 1WA5A 1E2NA 1UADA 3IHWA 4MKGA 4PZLA 1QF9A 2IL1A 4GPTA 3SEAA 4C0BA 4AKHA 1ELOA 1NBMA 2D06A 3O47A 4PXAA 4OK5A 5B57C 4HLCA 1XPOA 1BKDR 2X77A 1X8KA 2ZEJA 3DHWC 5C2JB 4JMPA 1CJMA 1IHUA 2OFWA 4AG6A 1D2MA 2GVDC 3C15C 2ZE6A 5FFMA 3GLGA 3LLUA 2ZRKA 4HB0A 4NCNA 5KSZA 3GPLA 4JLAA 4QG7A 4G5OA 2C95A 2J1LA 2YINC 1HYQA 2ZR0A 2FGKA 2XZPA 4JYCA 1A2BA 2ZRBA 4Q9JA 1XJ0A 1NIJA 2FEMA 3K9HA 4WA7A 2XAUA 2Q9CA 4WAUA 3QKUA 3BFKA 1DVRA 3K0CA 3RWOA 4CIDA 4OI4A 2J7KA 1FTSA 2XNDD 3SJAA 3B1ZA 3P1JA 4M1MA 5CLQA 3K0CC 2WJJA 3LFUA 3RS4A 3ZJYA 5AUPB 3AP3A 4B44A 3ZQJA 3EC1A 4C30A 5BQ5A 4IVPA 3H84A 1KIMA 1I4LD 3W90A 1E4VA 4XJXA 5F9FA 2NO6A 3H0KA 4TQAA 3BWDD 1JNYA 4URXR 6Q21A 4QM6A 2WWIA 2JIZD 4XWKA 2GF9A 3IIJA 3FB4A 3GLIE 1KO1A 3DMDA 1E2PA 1SVSA 2GBLA 2OT3B 2FPLA 3CRRA 4OBEA 5FUYA 1Q44A 1ZUNB 1GSIA 4UXIA 1S3SA 1T91A 2OBMA 4QBHA 1KTVA 4QNRA 2D3WA 3PEYA 4URWR 1KSFX 1XP8A 1YR8A 4KSCA 2XTMA 4OHWA 1FL9A 1MRNA 2OLKA 3X2SA 5L3QB 1T3SA 2OE2A 3SHWA 2VLIA 4Q1EA 1ZIPA 2XJ9A 1UM8A 2O5VA 1BYUA 1QHSA 2JJ2A 5KTYA 4RFSA 1J8YF 3NH9A 5KNCA 5JJLA 1NLFA 3MSXA 2HCJB 3U3OA 3TJZA 2PCJA 3CH4B 5K8TA 3HPRA 1SZPA 3ZS9A 3QPWA 1Z06A 2IHBA 3LBIA 3FVQA 4OQNA 3R9IA 4YMUA 1Z47A 1R8QA 2N1BA 3PQCA 1YE8A 1A1VA 1P72A 4PZZA 1WQ1R 1MKYA 2BKUA 4PHTA 2CCJA 4DEXA 4DC9A 3SJZA 3O8DA 5C46F 5BN4A 1DARA 5HR5A 5GJVC 4JLMA 3T35A 2JLQA 2HXSA 2FU5C 4DUGD 3W9YA 3B6EA 1RJ9B 1YZKA 3I73A 1Z0DA 4MRVA 1QHHB 4P4SA 4A0GA 1XPRA 3CWQA 4P4TA 5KSYA 1G9XA 2X19A 1II8A 1ZC3A 4B3XA 2CEAA 2VP9A 3R9XA 3PG5A 1CJKC 1DAKA 2ZS9A 4LJ7A 5AJXA 5DLQC 2XEXA 2VHJA 3KFVA 1HURA 3VX3A 1K6MA 1OV4A 1GL6A 4B3DA 3AVYA 2WSMA 4CRWB 1ZP6A 1FTNA 5FI0B 1E9DA 2ZSDA 2R62A 4OJKA 2W2TA 2PJRA 1N0WA 4M21A 2K5UA 2CLSA 4A0FA 1OW3B 2ASEA 3HWSA 3EC2A 2AHOA 3I3SR 2ZETA 4HZUB 4WZ6A 4AG5A 1U81A 4G5RA 2G6BA 2FPKA 3E5HA 2O8CB 1Q57A 1ONBA 4LJ6A 4QJ4A 3GJ3A 1TEXA 1XCPA 4IRUB 1IN5A 1KNQA 3SHFA 4QNMA 4W5HA 4C9BA 2C04A 1L7VC 2P3SA 2W6ID 3N2IA 3P26A 1E94E 2HXYA 4TYQA 4V02A 4BZPA 3CB4A 3NC0C 1P2TA 2REOA 4TZ0A 1G7TA 4FW9A 4RY2A 4Q4HB 2OXRA 2QUZA 5JWRA 3SR0A 3WP1B 4KXFB 4M0LA 3WRXC 1S2MA 4JLBA 2GJKA 2EU8A 3WYGA 2YC2C 1X86B 1N6IA 4Q4JB 4Q9LA 1NN3A 2H92A 2V54A 2ZJBA 5CDFA 821PA 3T61A 4AC9A 2C98A 1K5GA 4B73A 2HYIC 4MYHA 3W34A 1X1RA 2GWHA 5EP4A 4G1UC 4UNRA 1GITA 2WOJA 4LYAA 3HR7A 2HF8A 3QG5A 1D9XA 3CRMA 4B6FA 2CNWD 1G5TA 2R2AA 4C7OB 2ERXA 2J41A 4TSFD 5JSZA 2IS6A 1LY1A 5JCZA 1DS6A 3REGA 2Z83A 1T3HA 2ORIA 5IDVA 1HE8B 1U98A 3D7MA 2BBOA 2VQSA 4YONB 2FGJA 4W7SA 4ZO4A 2VHQA 1S9HA 1SXJE 2ZUCA 1KYIA 1HQYE 5B58C 2FMXA 4Q5IA 4EKDA 3I4LA 4BRWA 4L4UA 4D25A 1S1CA 2YV5A 4IJMA 1ZJ6A 2B8WA 2KI5A 3FPAA 3TAHA 5B64A 3K09C 5D3MA 2JLWA 3IPXA 2RGDA 5SZKB 5CK5A 1GOTA 2F3RA 3SBDA 3WMGA 3C7KA 3KKNA 5KYKA 3IO5A 1NL3A 1CR1A 1U0HC 2OG2A 4JKIA 5JHGB 2IYSA 4D6PA 2ATXA 1CR0A 2W58A 4QHYA 2JAQA 1QHNA 2G1JA 2IXGA 4D0LB 4PSAA 2BVNA 5DN6A 2OV2A 4AIIA 4ASUA 3Q3JB 2C9OA 4BFZA 2ZRDA 2SHKA 4JL6A 3IO3A 4C2TA 4M1OA 4RZ3A 1SHZA 1VTKA 1BMFD 2DFNA 5KNDA 1M6NA 2GDJA 3B9QA 4ZIRA 1WRBA 2PMKA 3VR4A 1TF7A 1XEXB 3K0AA 3NXSA 1Q1ZA 2ZE5A 4NYIQ 3CPEA 3ADDA 2WMNB 2D62A 4Z1MA 3SN6A 3T15A 3AH8A 2QA5A 2IYQA 4RD0A 5FUWA 1MO4A 4QGAA 3W6NA 1XWIA 1Y3AA 4IKEA 3PUWA 1E3MA 2BJWA 4FD2A 1G7SA 1E1QA 1S4QA 1V5WA 2DFKB 3GMTA 5HE9A 1E9BA 1SXJD 5KDDA 2J3EA 4P31A 4YXWA 1XFAA 4Z8XA 4ZCIA 4UXHA 5H1YA 1G8YA 1SXJA 3F5FA 1Q1QA 3G0HA 2ZI3A 2V4ZA 5JRJA 3AVVA 1KI9A 4HLDA 4XTCS 3CRQA 4KVAA 2R6AA 1HA3A 1EWRA 2F7SA 3OEHD 2IF2A 1P61B 2HLDA 2ORVA 2RGXA 4EPWA 1UKEA 5CLLA 4Q7MB 2WSSD 3V4RA 1ZD9A 3PUZA 3L0PA 4LHWA 3ZH9B 3H1TA 1E9FA 1QG2A 1HT2E 1TQDA 4NYMQ 4V0OA 1P5ZB 4D4LA 2AL7A 1Z6XA 2WWXA 2AKYA 2IW3A 1RW4A 3VAAA 3G82C 1XXHE 1WBBA 4IFBA 2ZRGA 4MRRA 3DZ8A 1I2DA 1XPUA 4KITB 2CHVA 4QFMA 5AK0A 4V0ME 5CM9C 3T34A 3A1SA 1IONA 1GVNB 5ANRB 1NMYA 4KFRA 2G88A 2QG6A 2WWGA 1S9DA 2AN9A 5DI3B 1OIVA 2KBFA 3B78A 4C3ZA 4NYIR 3THWA 5EXXA 5LB4A 2CVFA 4PPQA 4E22A 5H8WA 2WWFA 2WPDD 1P9RA 1M7HA 1Z6AA 3QG1A 4DDVA 3GJ7A 4JT2A 1A5TA 1G8HA 1SKQA 4JVSB 2WIAA 1YR7A 3I61A 2R6DA 3K70D 3DOEA 3DL0A 3UK6A 3GLHB 3Q9LA 4Z8YA 3K0FA 1K8RA 3UMSA 4OQLA 1W46A 1VG1A 1LF0A 1D9ZA 1Z8FA 2R8RA 1A82A 1D2NA 3B1YA 4G3XA 1XNJA 3MAAC 4JLKA 4YMTA 4RKEA 2XOKA 3ZZUA 2JLVA 2X2EA 4PPFA 1G8PA 2VTKA 1ZUHA 2C9YA 3VR3A 2ECKA 4F4IA 3A58B 1DO2A 3QPUA 1TQ2A 3NH6A 2QAGA 3KJGA 4OHXA 1KKMA 1QHGA 5K8LA 4NYMR 1Z2AA 3LX5A 5EP2A 4FCVA 5C4MA 2IYZA 2QAGC 5FOVA 1W5SA 2REBA 2VEDA 1J2JA 3IIMA 1XMSA 1M1YE 4R9UC 3R8FA 3THYA 3I1FA 4LBVA 3CNOA 2HCBA 3F3YA 1XXHA 3TH5A 4OKSA 1HV8A 2B7CA 1Z63A 3VTKA 1OJLA 2Y8EA 2Z43A 3R8CA 3UWOA 1XB2A 3GLFB 4V0MA 4C0LA 5IT5A 2HF9A 4M53A 2DPXA 4MKHA 1QHIA 1E99A 1G3QA 2NQ2C 3O8CA 3TIFA 4HAXA 3LY5A 1WMSA 4K46A 4BEJA 4TTQA 3C14C 3U3KA 1KHTA 3FWYA 4HDOB 4DDWA 4UJ5A 5JSZB 2X2FA 4TL7A 4CEJB 2ZRAA 3EWSA 2FZLA 2O8EB 2QRZA 3BAFA 4Q4AB 5KHOC 1TAGA 5LD2C 4TMWA 3AP1A 4Q7LA 2MSDB 3BC1A 2P2LA 3N5CA 2ODNA 2GRJA 2QM7A 2AXPA 4ZCLA 3KKPA 2XJ4A 4KFTA 5EQTA 1DO0A 1OXTA 4DCTA 1T5IA 2QGNA 4KYUA 4RD1A 3U4QB 2BEKA 4AWXA 1P62B 1NJGA 3THOA 1W2HA 1K5DA 3TQCA 1GFIA 3NEYA 1R5OA 2QU8A 3VU9A 3KXLA 4LJ8A 3KQNA 2IEYA 3NC1C 4BFSA 4Q03A 1ZM4A 2GHIA 2F1HA 3W6PA 2VF8A 2OBLA 3FFAA 4IOJA 4DJTA 3HYRA 4P0TA 1CXZA 4HUQA 4BFVA 3LBHA 2OLJA 1IQPA 4O0MA 1LNZA 4A92A 4MDEA 2G0TA 1EX7A 3QKSB 3LDAA 4XOIA 2FOLA 4GZLA 3OFND 4ZIRB 3DPUA 3K70C 3T12A 1Q20A 3CM0A 1MO6A 4XWAA 1P3JA 3LAWA 2AD5A 3GJXC 4JLVA 5J47A 4KU4A 3PUYA 1LFDB 1R6BX 4ITRC 1T4GA 5TY0A 2OBNA 4YLGA 3OE7D 4AKEA 1ZNXA 4DLYA 5CJ2A 1Q1EA 4NCHA 3I72A 4HB3A 3NVAA 4B2IA 4DVGA 1ANKA 1KDRA 4MUBA 1II0A 3RRMA 3OE7A 2OUKA 4LC1A 3P32A 3C5CA 3CKLA 5M04A 1D2EA 1F48A 3AKYA 1EESA 2QE7D 5FH9A 2VSFA 1NG1A 1HT1E 4JJKA 4OK3A 4Q21A 4QBGB 1DAGA 2ZITA 4CZ2A 1N6LA 2VP2A 2OEPA 2GXSA 4TLCA 221PA 1N5IA 4JLPA 4DLZA 4Z54A 3D3QA 3LXXA 2P6RA 2DCUA 3QE0A 1P4SA 5TMPA 3HJNA 4TMKA 3PEWA 3ZLJA 1S0UA 4IEIA 2PEYA 4EIWA 5G3YA 3KTAB 4U00A 1SULA 3SFZA 2YWEA 5H68A 2ZJAA 3UPUA 1JR3D 5GJCA 3LQQA 3T5GA 1GRNA 4ZDWA 4DRZA 3EG5A 4URYR 5DE3A 3SQXA 4DKXA 4GNKA 2CHGA 4H1UA 3K0EA 4M9XA 1KSJA 4DXAA 1OYYA 5L3QA 3U5ZB 4GI7A 3REFA 1XEWX 1XD2B 2KE5A 3PITA 1FW6A 1N6HA 4DHEA 3THWB 1G3RA 1RRPA 1UBGA 4JL8A 4TL6A 3FMPB 5E7JA 2Q9BA 1B23P 3TRFA 1R8SA 2GEDA 3OEED 5HZHA 2WWYA 2IYRA 4PAQA 2C03A 2NIPA 4MKIA 2BIFA 5LB2A 4BFUA 2DY1A 1DPFA 2BJVA 3LWNA 1XZQA 1GL9B 4F4CA 1CIPA 3FHOA 4Q01A 3M4YA 1R4AA 1N5LA 1YRAA 3HU2A 5HE8A 4BFYA 1FQKA 4GOXA 2VP0A 1KJWA 5FL7D 2F3TA 1Z0KA 1IXRC 2GETA 5CB6A 1CP2A 2BM1A 3M6AA 1RJ9A 1PV4A 3MFYA 5E7IA 2ZR7A 2PT7A 4GBMA 3KQHA 1E0JA 3EPLA 2QAGB 2ZE7A 1RVDA 4QGHA 4TYYA 1Q1BA 4BLQA 3BH0A 1S96A 4A9AA 1OPXA 1JQLB 3FMOB 2V3CC 2FH5B 1Q3TA 4FMCF 1NSTA 3GJ4A 2JJ8A 2FFAA 3U61B 2V1XA 4LYHA 1R5NA 2IBMA 2IT1A 3MCAA 1CBUA 4NKRA 3OZXA 2B21A 2OM2A 4I1VA 3Q5EA 4YDSA 1CF4A 1NIPA 3IHLA 3AF1A 3PENA 2VHUA 4HZUA 3L0OA 1GWNA 4MYUA 4L9SA 5FBVB 3EZ7A 3ZD7A 3BGWA 4OHYA 2O8CA 1NG9A 1O3YA 1UPTA 5B2ZA 4B48A 2FNAA 5H70A 1XTQA 1R0WA 2QTVB 1W47A 1XTRA 4Y0VA 4OHZA 3WY9A 1W36C 4M9QA 3U60B 4B2LA 1W0JD 3KKOA 1DAMA 5F9HA 2ZQ5A 3BD9A 3ADKA 3RLFA 1R0XA 2GILA 3EZ6A 3GEHA 3KKMA 4NZYA 1JAIA 1AZSC 4Q4HA 3AUXA 4HAVA 1OKKD 3RNLA 3VNUA 2KWIA 1JI0A 4PC6A 2GXAA 3MWKA 3RAPR 2J7PD 4M1TA 4BZXA 2RB4A 3WYFA 4Q4JA 3K0SA 2C96A 3A36A 1XJCA 2QGZA 3CBQA 4Q1BA 3VR2A 4NMMA 3ZIAD 3ZDQA 4DCUA 1KK2A 1G3UA 1U90A 2ZROA 1E2DA 1UKZA 3QKRA 5F2EA 2RGGA 3C16C 2G77B 2RHDA 4ACBA 5SZHB 1AQUA 4CVNA 5J4LA 3WRYC 5JJIA 1J70A 1DAHA 3PVSA 4N0DA 3VU9B 2IK8A 1DEKA 2ZYWX 1E0SA 1R0YA 5HKKA 4GDFA 1TX4B 2VRWA 4JZKA 3THXA 4L16A 2P6NA 1MO5A 4C7OA 4P32A 4JYBA 4KCGA 1NBMD 4PC2A 3J81k 4JS0A 3TUJC 3CF2A 4C0KA 2JLXA 2XTNA 5EZ6B 1IXSB 3QEJA 5BWMA 1G19A 3X1WA 4PPNA 3K70B 4A2QA 3UXMA 2FPMA 3B2EA 3LW7A 1Z22A 4DSTA 4GRAA 1E9AA 1ZCAA 1ODFA 5JFGA 3E1SA 5A0FA 1M7BA 1UFQA 2JDIA 4PO9A 2GEUA 2QMEA 3AVQA 2YOHA 1GRQA 1SHKA 5C4GB 3FKQA 4DLXA 3ECCA 3FMFA 3RANA 2ZANA 4POAA 4I4LA 2IC5A 1LW7A 4FI3C 4D4MA 2PZGA 1Q21A 4XVQA 1ZU4A 4M1KA 1XX6A 1KO8A 2PLFA 3TBKA 3GCGA 2H5EA 3WMFA 1KGDA 3BRWD 4C2UA 2CK3A 3KJHA 3CF6R 3LH5A 1WXQA 1AQYA 3AKDA 1NVXQ 1S8FA 4HAUA 1R2QA 4ZI3A 3QVUA 1YZNA 5CITA 2FSFA 1CJUC 2NG1A 1XEWY 2P0EA 1AK2A 3KDSE 2Q6TA 4G5GA 1Z0AA 1ZNZA 3EA0A 3FE2A 4S2EA 3PEVA 1E2QA 2D7DA 1YZGA 1KI6A 1XEXA 2GKSA 2I1VB 2REXB 5EE3A 4A2PA 1Z2CA 1DAEA 4B33A 1AGPA 4B43A 1D8TA 4ON9A 1KJZA 3A8TA 2ORWA 4LJAA 1A2KC 4BLTA 2AWOA 4HAYA 4LSGA 2A5FA 1CLUA 1TQ4A 4RSGA 2DHRA 4IW3B 721PA 1U8ZA 3GLHE 5G53C 3FGNA 1GUAA 1E2KA 2DFLA 4P3YA 2I4IA 3KKQA 2JJ2D 4Q1CA 1E2GA 3SBEA 2IXFA 1VDZA 2RGCA 5DHAA 3SYNA 1VCNA 4TQUS 1CR4A 2EFEB 1RZ3A 3FKSA 1KMQA 1F2TB 5P21A 4HATA 4E09A 2ZVPX 1TTTA 1KDPA 4XSGA 5FTLA 1B0UA 3OIYA 4F4JA 1SQ5A 3CNLA 4GOJA 4NONA 1RRFA 4CYMA 2ODWA 2J87A 1CRQA 2CL0X 1KI1A 4GSYA 2XB4A 3IDQA 2BBTA 4MYTA 4BUJA 1GKUB 1MT0A 2AWNA 3TR0A 3TSOA 1DE0A 3SJBA 1KI7A 3P20A 1E1RA 4P4UA 4XSHA 1L2TA 1NLYA 1YKSA 4DEYA 2MMGA 4NCIA 5CDFE 3ADBA 5CB8A 1OSNA 1E9SA 3SYKA 3GLFE 1VG9B 3UKDA 1N5JA 3IPYA 3QBTA 1W44A 1H8HA 3WBKA 2OO7A 2BBSA 1F5NA 2JLUA 3SC3A 1CRPA 1W4AA 4HDQB 5DI3A 4BZQA 5FR2A 2BMDA 4NCJA 3B82A 4GP7A 1VCIA 2JLZA 4OHVA 2HEIA 4HYYA 1UEJA 3BERA 2EFDB 1F3OA 3LD9A 3CRVA 4FMDF 1XMJA 4HAWA 1JJ7A 3CX6A 5HPYB 4EUNA 4XH9B 3CIOA 2IXEA 5B30A 4JLNA 2I3BA 5EE9A 1IJEA 1RFLA 2UKDA 3GLHA 3P4XA 1YJ5A 3PV0A 4C4PA 4BEBA 1NY5A 2GCOB 1Z08A 4PFSA 2IYYA 3AKCA 3T1VA 5FL3A 5FR1A 2MMCA 4K81B 2UVQA 2R44A 3MWJA 2HYDA 3U7GA 1W36B 5EE0A 2OZEA 3UATA 2XB2A 3EA5A 4MRPA 1Y63A 5IK2A 4F38A 3ASZA 2KJQA 1GM5A 5HZKA 4OQXA 2C77A 4LOAA 1T5LA 5DYGA 1NN0A 1E32A 2GJAA 3IQXA 3BFXA 1XCGB 2IS1A 1GKIA 1HQCA 2ZSBA 3OAAA 1GAJA 4MGZR 2R6GA 2PZEA 4Q18A 3LBNA 4BWYA 1L8QA 4HUTA 2OCPA 5FOTA 4KBGA 4QKQA 4A15A 3AF2A 3H2YA 2IYWA 4Q47A 1MABB 2P5TB 3UMRA 4LC0A 4AD8A 1Z28A 3QKRB 5DGXA 3FOZA 3BIFA 1VYVA 1KSHA 3GLFA 1JPJA 1OH6A 3TW8B 1AN0A 4JLOA 3WHLA 1JAHA 3EARA 3LQRA 2IUTA 3WXMA 2HT6A 2F1JA 2NPIA 4MH0R 3THXB 1KAOA 4D4JA 3RS2A 1U94A 1P2UA 2GZHA 3PUXA 2JGNA 3QSYA 4CEJA 1XCMA 2ZRMA 4AYTA 3NHAA 4NYJQ 2ZJYA 2QTHA 2O8EA 1ZUIA 4XD7A 1HH4A 1SGWA 1G17A 1RYHA 4Q4AA 2GESA 1BH2A 2JASA 2XSZA 4IDOA 5EE5B 4LJYA 1ZU5A 5TXGA 2ZAOA 4Q9HA 1LV7A 1MH1A 4JKYA 3LA6A 4BFTA 3K09A 4CW7A 2ZRHA 5EP1A 2NMVA 2ZIAA 3RRYA 4U02A 3U4QA 4KFSA 2BDTA 1W4BA 2VA8A 2WICA 1OHHA 1W0KA 2VBCA 2ZVQX 3UIEA 1KZ7B 1KJYA 2GZAA 3DM5A 1E79A 3ETLA 4IXNA 2Q9AA 2QMOA 5GVSA 3BS4A 4RFVA 5DN6D 4LUCA 4ASUD 3ZS8A 3A6PC 3DZDA 3HPQA 2R65A 2ZS7A 4FWIB 2R9VA 1FMJA 3X1ZA 3DKPA 2GTPA 4XTRA 3RVBA 1ZCBA 3WMEA 4PZYA 2LCFA 4RJLA 2IF0A 3JZMA 1G20E 2PX3A 3SU8A 5EJEA 2V7QA 3QKSA 2GK7A 2YKGA 1F6BA 1C4OA 1Q3HA 5DHFA 2GF0A 1J8MF 4Z1MD 1UDXA 5FOWA 8OHMA 1KI6B 1DTSA 4US0R 2AD1A 1E2LA 3AP2A 3UG6A 1FNNA 2I1QA 2CCGA 3CX7A 3EPKA 1WF3A 4LY6A 1YRBA 1IY0A 1E1QD 1US8A 4DB4A 5HCIA 3U44A 3QBVA 1TQ6A 4YXWD 1VG8A 4NYJR 3IILA 4TLAA 2IS4A 1PUIA 5J4YA 2ZRJA 3NG1A 4U7DA 4JLJA 2D7CA 4W5WA 3LXRA 1T8TA 1IM2A 4DSOA 3Q8XB 3OHMA 2CJWA 3A1VA 2YZ2A 2BMJA 4QBIA 2HLDD 2QN6A 2ZS8A 4WXPA 2NGRA 2GJSA 2PMDA 2P65A 3HR8A 3PCRB 5LDDC 4GT1A 5LPNA 3C8UA 1KAGA 2G83A 1AKYA 2QM8A 2BWJA 4V0LA 1OFTA 2QP3A 2EQBA 2C99A 3IBGA 1ZNYA 2BCGY 3GQBA 3LO5A 2FJUA 3TVDA 5AUOB 1XTSA 3TAUA 3MMPA 1TU4A 4B74A 1ZD1A 3KTAA 2A3RA 3A1WA
chains in the Genus database with same CATH superfamily
1A95A 4QGGA 2JBAA 1KDOA 1EJ2A 4TZTA 4DKJA 1RJGA 4QATA 3LUKA 5KYTA 3RYFB 2QTAA 4KAFA 1O54A 2JF0A 3E9EA 2NZJA 3GD7A 1KF0A 1G41A 3OQ1A 4FMCB 2HQOA 3U4GA 3PYMA 3S28A 4ZCRA 4YP9A 4PX2A 5AK3A 2AOXA 4BMPB 1QBKC 1Z6PA 4QRHA 3IUYA 4N3GA 2WYHA 2R8EA 3S2IA 4YHHB 1RI4A 5KTPA 4M87A 2IUEA 3NGXA 3HCBA 3Q3CA 2GYUA 2WAMA 3NHFA 5FX2A 3AHCA 4M0DA 2X3UA 1ESZA 2GM4A 4MWDA 2JA2A 1BWPA 2HDNB 2O6HA 4WXMA 4D74A 4RIIA 4LYFA 2J67A 2YZNA 2YWFA 4NPHA 3M3PA 4XWOA 2EFJA 1RYBA 3L6UA 4NNPA 5C1PA 3SKXA 1OZHA 4D81A 4LFBB 2GEVA 4HS4A 2QQ0A 1CDZA 2GPTA 4OQDA 5CG2A 1QC5A 3FYHA 2DUJA 4D4GA 2ZBQA 2PKCA 4DLTA 4ZOLA 1A9XA 1VHLA 3OT4A 5JV5A 5ITVA 1L7AA 4CDMA 4LRSB 4IIXA 3WYBA 3A6GA 1G9TA 3KVNA 1HETA 2XDWA 5DKFA 3RFXA 3REQB 2VDPB 4ZYTA 3ZDDA 2JGRA 3RRFA 1AQJA 1P60A 3TB4A 4JB2A 1UK7A 4UMFA 3ANMA 3NCHA 5KB3A 4G1FA 4HDMA 2GDZA 4FYPA 4R5MA 1GXSA 2FR8C 2GMWA 1V0JA 3OBBA 4JQOA 1QRRA 2JI8A 2ZU6A 2O0JA 2QRKA 2B37A 1J0CA 1B8NA 5EINA 5BSHA 2H7CA 1H94A 1RZUA 3P9RA 5JSFA 1NP6A 3ZQ4A 3FFXA 4EJSC 4IPTA 2VUSA 3TO5A 4DMLA 2ID7A 2N75A 4Q3NA 5CXUA 4Y1EA 4Z86A 3AF3A 3F98A 3IODA 4R9SA 3S8EA 2VHTA 2C5HA 2BKEA 4ZVMA 4DC9A 2HJGA 2I8CA 1NI5A 1IBSA 4I5FA 3VR5H 4L74A 1T9GS 1IEXA 4H7KA 3EZGA 4AURA 4WADA 4OHPA 1HZZC 3KHSA 1I33A 1F0YA 1HRKA 2C31A 3CY6A 2WF5A 4FHFA 4NAVA 4A2WA 3KQOA 3PFHA 1GN9A 1SBCA 1VIVA 3GJ8A 3CCBA 4MUHA 1MORA 5LFAA 1DT5A 1C5KA 5A06A 3FPSA 3K7EA 1UEIA 4X85A 5AVSA 4YRRA 4F71A 2QTFA 3NBFA 4FN5A 4KWTA 1F3LA 3E23A 3EVFA 1G291 4LNUA 2WJGA 4EW3A 4KQCA 4JR1A 5K99A 4A36A 4LV8B 3Q0EA 4OOFA 3RC8A 2XD4A 3R9WA 1UPFA 3QVMA 4PU0A 2QPTA 4K0RA 3I1IA 3MLEA 1VGVA 4HLNA 4DYHA 3U3MA 2XRZA 4H60A 1KQGA 2H2GA 3P9YA 1E60A 1Z6GA 1DJLA 5EGNA 1QKJA 1QS0B 1NF3A 1YBFA 4ZYLA 2EX4A 5JUWA 1YZTA 1I2ZA 1E5QA 3MG9A 1BCSA 1LPNA 2DKNA 3BMQA 3U62A 2Y1GA 3OWXA 3PKJA 1VJRA 4AK9A 4BFXA 4ZGWA 5I7HA 1KU6A 2BFNA 2PQ6A 1P73A 2R6R1 3HBFA 1FF9A 4LXHA 4P80A 1EXNA 2CXNA 2IGBA 3ZHVA 1H42A 2ZBPA 3S2EA 3TD2A 4GLFA 3H5WA 4EM6A 3ZBQA 3U7FB 3RAJA 4CKEA 4DYVA 2DETA 1QFXA 1QO0D 5FOQA 3PQ4A 3GP8A 3GGSA 2Q50A 3CH6A 3H1GA 4O3FA 4Y7CA 3DBHB 2PH3A 3AR9A 5HJ5A 2BTEA 2B4TO 2BFFA 1P2FA 4YRBA 1SKMA 1QAOA 3D31A 1T5OA 3MM4A 4G0QA 3OZSA 4IGEA 4MGEA 4E11A 1OAOA 1YS7A 2I99A 3I2IA 3GEEA 1WE2A 4EFMA 3L4SO 1LTHR 1M33A 2ZDQA 3EDQA 3KC2A 1OZAA 2YNMA 3P9IA 1Y98A 2R84A 3CEHA 1MJGA 3PC6A 3SICE 3SNKA 1JBKA 3MJSA 2WJVA 3EW7A 1UZMA 4TYPA 2OD9A 3IR5A 1CZUA 4DQVA 2Q0HA 1G3IA 3V4OA 3T7SA 2ZQYA 4QARA 2QLFA 2Y68A 3S29A 4AFNA 2ZCJA 1EFCA 4OP2A 2MINA 4HNAA 4LDJA 1TPZA 2H8KA 5BQ3A 3LSYA 3Q72A 3E84A 2YJTD 4BLOA 5F7OA 2J5QA 1T5DX 2BSXA 2CCKA 2O8BB 2QEQA 1SRQA 4BVAA 1L7BA 3IRUA 2VAVA 4FSDA 4G81A 5AKXA 3KWFA 1JWBB 2A9QA 2TECE 4O4LA 1COWA 5KKNB 2CJWB 5HKLA 5A4JA 2P90A 5IEJA 4M0CA 4F7DA 2EBFX 5JCXA 1R5BA 1PCXA 4GOMD 5K2OA 4P92A 1WCIA 1Z39A 4OQ4A 5DNYB 1FYEA 3IV6A 3F5DA 5E4YA 5JCOA 4F5DA 3AHFA 1P7VA 1Z0UA 1WCXA 1Y82A 3VQTA 5F4ZA 1QIJA 1W59A 4WN3A 4DRYA 5JQWA 4PZCA 5ICGA 1HFKA 2YWHA 2VJQA 3DM9B 3IB3A 4QRDA 4D4HA 4OI2A 1RYDA 4QXMA 4YGXB 3V8VA 5KNLA 4P1ZA 3PR3A 3VJKA 2CV0A 5ITWA 1U8AA 4JZYA 1XKLA 4QQRA 2P6MA 2WJYA 2VYND 3DDZX 2D4HA 4F9GA 2HM7A 2OY0A 3HO8A 1KI2A 1L5ZA 2JBAB 4MHSA 4A10A 4F84A 2C2OA 3H16A 5JECA 3PA8A 1EX9A 3JXEA 1LDMA 3FBGA 3LUFA 5JIBA 3HU5A 5L3SB 4EGSA 3EGIA 3MWYW 3ZWQA 4R71A 4JK3A 2QPAA 3ICWA 4LZLA 2DWQA 5E4TA 2C88A 4BNKA 5JADA 2BZSA 2H3HA 2MSNA 1I6LA 4KXWA 2AOUB 3SVTA 3GPIA 2P1RA 1LQUA 3C1TA 3L04A 4ZMSA 3OQIA 1Z5ZA 1AGRA 1IOWA 4CLRB 2J08A 3HJRA 1EWVA 2DU8A 3GOQA 4YQYA 1JKJB 2EHJA 5I9TA 1D4FA 3SIXA 4ZVQA 4ZQEA 4X91A 5D6NA 3BVPA 4RKWA 3MUNA 2PR7A 1HE1C 4EHBA 3B9RA 2EGGA 4IDAA 4TV9F 4UEWA 3T4UA 1VKJA 2E4YA 3PNQA 1EI9A 1M0WA 2IHUA 4X1KA 1Q0SA 1P1FA 4JC0A 5BYKA 3KQLA 4K3UA 1NVAA 4ZOLB 1KWGA 4CCYB 2AX3A 1YIOA 3CG0A 2V98A 1KA9H 2EGHA 5F77A 1U3UA 2HRRA 3V4FA 1T6ZA 2X4LA 2XYVA 4IAOA 2PT5A 2YJGA 1JBQA 1WPXA 2QDXA 3GY0A 3QVKA 3HJBA 1GPBA 1SB8A 3CR7A 3OLYA 2GUGA 4NK5A 3RJTA 3WI7A 4RZUA 1KEKA 2VBIA 5JS8A 5HW0A 2JGMA 2ZIEA 1T1GA 3B5EA 2IHKA 3K73O 4IRMA 4PLPA 3CZPA 3WL3A 5JVDA 2ZJ5A 2BV3A 5KTKA 5SZJA 2FW8A 4KQIA 5F5NA 4EBBA 3DO6A 4B84A 4EQZA 3WGMA 1PG2A 2B4YA 1PFUA 1KP2A 1YQTA 3OZRA 4JROA 3LUPA 1Z73A 1U5BA 3E81A 1H1TA 3LF2A 2HBQA 1USIA 4JUCA 2OGSA 2GCPA 3STHA 3U49A 1RHRA 2CE2X 2HK9A 1CJBA 1D09A 2I78A 2ZJOA 3BXFA 4JJ8A 2XTJA 2I7VA 5TMEA 2REQB 2GZDA 1LTQA 2VAMA 4MICA 4AJOA 1V7QA 2V7WA 4CMIB 1JR6A 3N2LA 3DMPA 5CB4B 5G1PA 4U2DA 3PXGA 5DT9A 2XVYA 5EFOA 2W48A 4H3SA 2CNOA 4YQEA 3QTTA 4CQJA 2JGJA 1F8FA 1GGEA 2QUBA 3GT7A 4ZYZA 1P1BA 2Z9BA 5F51A 4ZTUB 3DO5A 3G0DA 3QUTA 5ECWA 4MR8A 2VXOA 1CJVC 2D1TA 1W1UA 1DIOB 1JSCA 1OFUX 4Q15A 2A1TS 2QX4A 1QYWA 4EDHA 4X3PA 1GFWA 3ZU2A 4FCTA 2IYFA 3HBNA 1J5XA 3DOIA 1PJLA 3HUFA 3EY4A 4HHEA 4M54A 3NDJA 3JQ6A 1AHPA 1NXQA 4I9HA 1TW3A 3VR2D 3GELA 2EZ8A 2QL5A 2ZJ8A 3VVBA 1M0SA 1GVHA 1Q11A 4NDZA 4UJ3A 2AJCA 2FAXA 4QOSA 4D97A 1Z4IA 2C3MA 4UUMA 3LYLA 3KEFA 1EFPB 3IIIA 2OV6A 2FEOA 4HZIA 1IUNA 1KL7A 4X5OA 1QHXA 3DFMA 4YCJA 5E2BA 1BCSB 2O6LA 1T0UA 3BMQB 3PEFA 1QAQA 3TCKA 4ZVVA 5HKKD 3RIHA 1QGYA 2PA0A 4P3XA 1C2YA 3ZK9A 1MHTA 3AVUA 4PYKA 3G5MA 4L4RA 2DM6A 2HLHA 1UFVA 2NTNA 2OHOA 1RHMA 3CNQS 3EC7A 4LRTB 3A3KA 5F21A 4CMKA 1IOVA 4K1XA 4CKEB 3OX1A 3LUBA 3N2EA 2VSXA 4CM9D 4UU0A 5EZ5A 1J09A 2Q8NA 1IFXA 3Q5DA 4KVGA 1ZITA 2Y1LA 2VF7A 1UANA 2CVQA 1LDGA 3A4LA 5DP2A 3H11B 1C30A 4DG9A 4EKGA 2QTBA 4HK4A 3HDTA 3KJNA 2YHAA 4YMVA 2WUFA 3DWIA 3Q3EA 1EK0A 2H7VA 4MITA 3LLMA 5ECGC 1VPLA 5F4BA 4UUQA 4AY2A 2QY9A 5AKZA 1AA9A 2JATA 2CMKA 4UDOA 4UVHA 1NW9B 5NLLA 1RCUA 2J3LA 3ZHRA 4LRYA 4HPJB 2FCRA 3HUEA 3W0LB 4A0HA 2OHFA 4HNAB 3AY0A 1UKBA 1GQOA 1WB5A 2H00A 3A3YA 1NASA 1OIXA 3RUPA 4ZQHA 2BY4A 3OIVA 1IN7A 1AT1A 1KK0A 2O3UA 1UMDA 4O4LB 1YTUA 2AYYA 2AUTA 1I7DA 5T8KC 1ZPDA 2EOAA 3TN7A 4PSCA 1WB6A 4UKDA 3F90A 1ZRHA 5NULA 3CT4A 4OJQA 3FYUC 4X8OA 1ZOPA 1CVIA 1IWOA 3ZGYA 4P82A 3E27A 5B5SA 5IZCA 1SKYB 4Y30A 1TJPB 2OCAA 3L07A 2C5EA 4CGZA 3EMBA 3D81A 3G02A 3HRHA 2TYSB 2NNWB 3ANTA 4AMZA 4GNRA 4L73A 1C7IA 4NE2A 3RC2A 3V8NA 1VIDA 1W49A 1O2DA 5UKDA 1F14A 3H1BA 3GNQA 1NAHA 5K0FA 1PGOA 4KR7A 1GGKA 4QYTA 4LXYA 2CVHA 3KUUA 1E6UA 3L7KA 3OIUA 2DLDA 4BB9A 3I45A 2WM2A 4DB2A 3EZ2A 4PX3A 1GUYA 1XVUA 1LLDA 2XA1A 5FA5A 4B2PA 1VXRA 2NZ8A 2EP5A 3K92A 1ZM3A 6ABPA 3J7AC 3E4CA 2BGGA 5CK4A 3MTGA 1OXXK 4HB2A 1X1BA 3KB1A 2XT0A 4TSRA 4D80A 4AKGA 4L4XA 2EBUA 4N01A 1J24A 3VZBA 1DSSG 4K9KA 1HTWA 2JLSA 4QREA 5KPJA 5DW3A 1Z0SA 1JECA 3F7OA 2R4UA 3FKSD 1OCEA 4II3A 4ZVOA 3GEPA 1NHGA 3DT8A 4BQNA 4ZI2A 5F33A 1TKBA 1E2IA 3TEJA 3ZE9A 3TI9A 4Z4IA 4QJBA 4C6SA 4RUKA 5IP5A 2PGLA 1DJNA 3P0HA 4O29A 5ENZA 1NU6A 3LVRE 1SCAA 3O8OB 4U0KA 1ZINA 2RHWA 1J8FA 1HL7A 1P4JA 3I32A 1Q7RA 3BPSA 4OHOA 3T3HA 4HVCA 1Q7BA 2Z5FA 2A9KA 1GADO 3FSGA 1X7ZB 4CDGA 1G38A 5T41A 4FR0A 4MV1A 2AZDA 2CL7X 3KYDA 5I45A 3QE3A 4C78A 2HREA 1SD2A 1XJWA 4CKBB 3NKVA 3GT0A 4ZICA 2BEJA 1N2EA 4HJXA 4LMAA 4YCSA 3AVTA 2XHEA 5D6OA 4RULA 3CC8A 4LWZA 3TL3A 4D82A 3WWPA 1SVOA 2D0PB 1H8HD 4ETNA 1LQTA 4IKPA 5BMVF 1I6WA 2FZ4A 2G4VA 1KFEB 1U04A 2OAGA 2EVWX 4GX0A 4PIPA 1E98A 1J99A 1VKHA 3LCRA 4YT5A 3BSFA 4Y1RA 4ETIA 2K2WA 3NYRA 4ENUA 5A5VA 4FHGA 3C3EA 2IEDA 4H1VA 1Y3DE 4MW2A 3ZVKA 1KE2A 3PLNA 4Q7JB 4C0HA 5JYEA 2WHPB 3FWNA 1A9PA 4G9EA 3EZYA 1ZR4A 2PL5A 2W2MA 3BTUA 5GJWC 3KR1A 1CERA 3H2JA 3UAGA 2XGJA 2I4NA 2H7XA 2LBPA 1LWOA 2POCA 2Y77A 3NHZA 1DHTA 2PUVA 3BULA 5K8VA 3COWA 2D1SA 1WZUA 1XZDA 1N2SA 1OWOA 1HQKA 4RCZA 1PIWA 2D5CA 3TR6A 3A2KA 4XVRA 2WFZA 5TC4A 1KRWA 2EG5A 4JBLA 1Y81A 4L50A 2QGFA 3TKYA 4D99A 3LCUA 4QLOA 1EINA 2WW8A 5BN3A 1I2CA 3OPVA 1LRJA 4UCXA 3P4UA 1X1QA 2ATIA 1OLOA 3GJQA 2OKCA 3TDNA 3D0OA 1PLKA 2BEVA 3ELBA 4RD2A 2ST1A 2OAQ1 4RQBA 2Z5VA 4II7A 3OAAD 4CLDA 4Q7QA 1FRZA 4PYJA 2CGEA 3N70A 2ZU0C 1GPYA 1AXRA 2Z3ZA 3G9UA 1YI1A 2COUA 3BRCA 4IXDA 4YJ2F 3RDPA 3KJEA 3SLRA 4AS2A 4ZQBA 3WRXA 5KZMB 1UFOA 2UYOA 1FUEA 1QB7A 1FNDA 1PS9A 3GMIA 1NE2A 1NKTA 3H0CA 3R6TA 3SYTA 3TTWA 2I80A 1T4DA 3R6LA 1AMNA 3AVWA 1FK8A 2ONKA 4BV8A 4C0JA 2OTCA 3DEHA 2FG5A 4LY9A 4NBNA 4BMSA 3RVDA 1ZGAA 2ZIFA 3ITEA 4P54A 1AIPA 5HTOA 1W96A 2F43B 4EPXA 1MX5A 2PZBA 4E5PA 5HIAA 3E1KA 5I9SA 4UM7A 5DCYA 1U3WA 5DP1A 4CTKA 1L0BA 1H0KA 2G1KA 2W6IA 3UC5A 2WINI 1BGXT 2FHSA 3PFBA 3TM4A 5ED0A 2WWWA 2V7XA 4UHKA 1KDYA 1SVWA 2JFZA 1TEVA 4OPMA 1TPYA 5CDHA 2V0GA 1BA3A 1GV1A 3H5TA 2QVXX 3P2MA 1SUAA 3I01A 4UHDA 1XSEA 3LC0A 3V8BA 1NATA 3T6KA 3WLKX 1UKAA 2VDLB 5A5FA 1WF6A 4PX9A 2FUG1 4F12A 1W75A 1DQYA 2FPUA 3A1FA 1VGQA 1M2HA 2Y1EA 4HS9A 3L43A 2OFFA 3RHFA 3SQWA 1F17A 2QD4A 2WV7A 1I3LA 1L4EA 4ID9A 2HIHA 5IVPA 2OQRA 5HMMA 2AF4C 4M9SA 2ID9A 1ZLXA 5KHAA 3R44A 5KOJA 2FSVA 4RZ2A 3BG5A 3DVRX 3H9QA 1E79D 5HJ7A 3C85A 3R0QA 3U4CA 2R6CA 3G7SA 1OTYA 2A5GA 5A6SB 3LRTA 5IHXA 2FDCA 4H1TA 2ILTA 4J3FA 3C39A 3VPHA 1Z5VA 4GPZA 3SEZA 2OGWA 4IMJB 2A86A 1BMDA 2AQHA 1XZAA 3M1IA 1W8IA 1UMDB 1W73A 4HLQB 2XE6A 2W6QA 1J49A 1WG8A 5J1SB 5BMVA 3QUAA 2AC2A 3N2KA 1RYMA 6REQB 4PYOA 2FRVA 1D4AA 3G59A 4IM7A 1UC4B 2GNOA 3CS3A 2QX9A 3I37X 3OKPA 1XDBA 3R3HA 4ESHA 2VHCA 1XALA 3A6EA 1GNSA 2A3NA 4O4IA 5F1KA 2Z9CA 5AXBA 3RFFA 4AXXA 1IATA 4DM4A 3O4HA 4L1KA 3E6AA 1YS4A 4FMBB 2W22A 3DQPA 1IQRA 3RK1A 4Y9RA 1VRCA 1YFLA 3Q2IA 4L5JA 3CLKA 4R2LA 3LXUX 3Q6NA 4WCFA 4Z7OB 4LK2A 4Z9BA 5JEEA 1ZJJA 3WA7A 1DBSA 4H4EA 1BAPA 1XFDA 2UZIR 5J4VA 3DB1A 5KSOA 1A7JA 3RT7A 3P97A 3GCWA 2DOKA 2FOIA 4MVJG 4WW0A 2C3PA 2MCFA 5CBKA 4YH1A 2IZ6A 1YU9A 1CU1A 3WGIA 4JIMA 2DR2A 3PDHA 1A77A 4X54A 4ZT4A 2AXEA 3L3BA 3QVTA 3HM2A 1KO5A 1ZX1A 2IHYA 4Y98A 1GCUA 4YV2A 4BGDA 4W5RA 1DTEA 5SYMA 4R9NA 1XQYA 4J8PA 2JIDA 3T3PB 4BE9A 1V5GA 2GCGA 4NU8X 1KI4A 3E5MA 3F3SA 3I6YA 3KYJB 4M1YA 4NH0A 4FFDA 4NMLA 2INGX 1DI0A 4CL2A 1RBYA 1VSVA 3NATA 4MRNA 2N9UA 3AEYA 1K7SN 1P5HA 1EZ1A 1YO6A 1V39A 3JZIA 3WLJA 3PCTA 2O8DA 2P68A 8MHTA 1LBTA 2XCTB 1T35A 2QHXA 3R3UA 4XLLA 5CGQB 1R4ZA 1DWOA 1LSSA 1NVGA 1HSOA 1K97A 4HB4A 2VOJA 4X93A 3W5JA 1UJCA 1GZSA 4B3SB 1VHTA 1AB6A 4GMDA 4FOSA 2FZWA 4JI4B 3WIEA 4FNMA 1PR6A 1BO6A 5IC6A 2RJOA 3A6DA 3UWKA 3VBEA 2JFNA 3D1JA 3OEHA 5A04A 2BGIA 2ONYA 3DVSX 1FW8A 2X3FA 4ND7A 3E48A 1BRMA 2XQFA 3JRXA 3OPXA 3D2CA 3CZRA 3DJYA 4Y1RB 3QJYA 2A1IA 2WSSA 1X70A 5MFZA 2ZRIA 1DJPA 3Q9SA 1MO3A 3VRHA 5GM2A 4I1IA 4BHTA 1VCOA 4H6PA 4TWZA 2QAIA 2WHQA 1Z17A 4E4RA 1VLLA 4M98A 5JXIA 2QZ4A 3PT9A 3CZ5A 1ZONA 4I9UA 2Y3IA 5C18A 4GZ6A 4ARAA 1ULTA 1PZGA 4G67A 1KY3A 2PSEA 3ULKA 3WNBA 3ZDFA 2GPNA 4M9ZA 3FMGA 2FG6C 3F2IA 3DOFA 3FTPA 4WLEA 5I9IA 3TUZC 1II8B 1CUIA 4NAHA 2XKKA 1A8SA 1WVIA 4F04A 1Y9DA 5ETJA 4NP6A 1KIFA 1X13A 2YIMA 4NDAA 1RAAA 3MGBA 4OXYA 1B6SA 1RIIA 1T0IA 3H6GA 1FP4A 4NHEA 1L5VA 5CVCA 4DWJA 5KYYA 1FZTA 1TUIA 1ETHA 4YC7A 4R6XA 3PKIA 2VO1A 2BHLA 2JLCA 5CW2A 4F92B 4MR9A 4ZVKA 4B76A 4DREA 5JDCA 3COSA 1SVMA 3IESA 4G97A 1LVUA 1WEHA 2IU4A 1FMTA 4WLOA 4BX8A 3EX7C 1Q7EA 3ZZTA 3TGLA 2OCBA 1NDHA 1T3ZA 5CA0F 4HJRA 4L02A 1QMPA 1VSQA 2IYXA 3UFXB 4FC6A 3ASYA 2OV8A 2FZ5A 3BH6A 1NVTA 4DR1B 3RE1A 2WT9A 1SD1A 3STWA 4G86A 1IY2A 4B4DA 2QLTA 2YVKA 1UPBA 1KORA 1OLXA 3F1LA 3OX2A 1E7QA 2HHJA 1NRJB 1N0IA 2CMHA 3L7MA 4AUNA 2QV7A 5KAPA 2H5IA 3BB1A 2IHTA 2JK1A 3P9SA 4PG8A 4UMDA 3T5MA 2LKDA 4PCVA 4FZRA 3C4JA 1PJAA 3O03A 1Y5NA 1EJBA 2XECA 1C3JA 4HD8A 4TYMA 2J3KA 3K35A 4B35A 3A4IA 2J32A 1EK5A 2YW2A 3NETA 4AU1A 1GFSA 5KINB 4Z9YA 3HO1A 3TQIA 3KKEA 3GFFA 2EIHA 2WB2A 3U3ZA 5I3ZA 3Q5GA 1YUBA 4DCJA 5DNWA 1SEPA 3QI2A 4GX5A 3WAKA 1MIOA 2EZUA 1II9A 3AFGA 4BU1A 2DSNA 4FBGA 1KETA 1V1RA 1YV9A 1ZBQA 3E3NA 4IVQA 3PHIA 1IUPA 4MIKA 4N3AA 1MD9A 3D3EA 1G64A 3IQEA 1DXQA 2ZWMA 4WBNF 1QG4A 3AVXA 4X66B 3COPA 2EBWA 5E6RA 1OH7A 3GYGA 1IG3A 1PJRA 1ATIA 3FUUA 4W1RA 5IAAA 4YCNA 3OTGA 2FE4A 5JNRA 5D7BA 3B1FA 3F4LA 3UJNA 1I2BA 4B31A 4PZUA 5A5EA 3FDXA 4O02B 1JIQA 5AKIA 2E1PA 3HL0A 1HE5A 2CLLB 2IYEA 2J9XB 4US1R 5GOZA 1MV5A 2GJ9A 1VLZA 2NO7A 3ZH2A 4BDTA 3OHPA 4JC5A 4DZZA 4ZYVA 5I7VA 4D45A 2QENA 4QJ5A 1D07A 4Z9XA 2VWHA 3NIWA 1V37A 2R7MA 1J7KA 4X1IB 4GXRA 2GAFA 4LBZA 4MRAA 1MAWA 1NWHA 2PLAA 4NFLA 4R51A 1JHOA 2YHSA 3AM3A 2OA0A 2JA1A 1U0GA 2RKOA 5HKOA 2F64A 2GYVA 4YMIA 4EYQA 4X3CA 4ITVA 2YNMD 3LVBA 4UBMA 5FFNA 1X7WA 2F6RA 5D86A 4Z4QA 2Z6QA 1VPVA 5A62A 1FPMA 2CL6X 5L4NA 4RZHA 1RHJA 1CB0A 3FKJA 3KYCB 2VJMA 4D56A 2AVDA 1LDNA 4O4IB 1H5UA 3JYQA 3IAAA 4D9FA 4L8WB 3UJCA 4D3SA 3EXIA 5D5HA 5FP0A 4H7FA 2PX5A 1GQFA 2J9RA 3W6ZA 1WKBA 4EYKA 2XHZA 1CQWA 4PS1A 2N1MA 1W25A 3GZ4A 4NARA 1XQWA 1TZJA 4MTLA 1WXIA 1COWD 1PD0A 1SY7A 1TF5A 3UAZA 2DGDA 3L8GA 4TMYA 4H3KB 3KQWA 4LI3X 4F06A 3EIOA 1AUOA 1ZMOA 2LV8A 3AI1A 2CDNA 2QNBA 2OD7A 4P5DA 2FFQA 4EA6A 1F2VA 4BGVA 4NEGA 5K3FA 5FLEX 1Z26A 2FWIA 2R1UA 1A69A 5FYQA 3A1EA 1JVBA 2P6OA 2Y9MB 2QG9A 3K0AB 4LHYA 1YDHA 5KOHA 2FHPA 3LCCA 3MMXA 4N3BA 4RLSA 4BNNA 4YMLA 4REMA 3TIGA 2AN5A 4GYJA 4MLZA 4N9WA 4YRAA 1NVUQ 7REQB 2YIVX 2Z5LA 3FZEA 3MHPA 3CNNA 2WMOB 2B6HA 3LZCA 3PC8C 4C3OB 3ZHZA 1L4YA 1YZUA 4OQFA 3WWCA 1KH2A 3UMJA 2FWPA 4QDUA 1XDDA 2ANBA 3N87A 1I13A 1WW3A 4H7JA 5DB4A 3FM9A 1ABEA 1WSWA 3B1KA 1SXJB 2BZ0A 1KQPA 4HXGA 2QYSA 4KE6A 5AKGA 4V03A 4MKRA 3UMGA 1J21A 3A04A 2VK1A 3FUVA 1XAIA 3LRPA 2WPNA 3HS3A 3QHPA 2VRNA 4IVRA 3I4CA 3ENZA 4JBXA 4KH0A 2OGUA 1LI4A 2ZSJA 3ZHUA 1ZN8A 5BURA 2M6LA 4DQDA 1J4AA 1JPNA 1JU9A 5JTUA 5KJ6A 4QXOA 3VM6A 4C4SA 3KLBA 1IY1A 3ZDRA 3LW8A 3H4MA 3S1SA 4KN8A 2RGBA 3IUJA 3PFFA 1HL3A 1NXXA 4CF7A 2IS2A 3QMPA 4R2IA 4Q48A 5BVGB 4X64B 3KQMA 4IR7A 3SBOA 3SF8A 5ED4A 3LKBA 3GLKA 5IW8A 1TT5A 4ND2A 4B6SA 2ZREA 1GL7A 3WOHA 3WBFA 1AV6A 2WT4A 4H15A 4KKVA 3QXCA 3EDOA 4N8SA 2PPVA 4C3UA 3RF7A 4TKZA 1MAUA 1E1KA 1FNMA 1WQ4A 3NBZC 5CH5A 5GONB 3W4IA 4DSUA 5LUAA 4PGGA 5D8DA 3CWCA 3HKCB 5AD1A 2KX7A 2A5JA 4U7TB 1SCNE 4BO9A 3RU7A 3EA4A 2FF7A 1Q50A 1J2TA 3A2LA 2YJ3A 3H87A 2ZBDA 1U0NA 3NQ41 4TMZA 4IGIA 3DE0X 5GWXA 1CVLA 3OTOB 1HX7A 2DFDA 4OGLA 2VDRB 1G0NA 2XMRA 1V1JA 4LCEA 2B4KA 3D7LA 2HJ9A 3HSSA 4CG2A 4I9NA 1PV2A 4P4NA 4PR3A 5KYYB 2ZVDA 1M8JA 4UDYX 3VZRA 1QPBA 2X4IA 2OHIA 3H6KA 1KI8A 3AUAA 1FQJA 3K96A 2DMRA 3RVLA 4B4VA 2IU0A 1WV0A 3OEEA 1OROA 3QOFA 5FXMA 1P7CA 1E9EA 2EW2A 2V59A 2VL7A 1TOAA 4L28A 4MQBA 5EWJA 5E4JA 1G7CA 4J43A 3WOVA 1PK7A 3RVNA 1JAXA 2ECQA 4G0VA 4KAXA 4LY3A 2C7VA 2YZGA 2WD8A 2MYPA 4O4HA 3RTDA 1PUXA 3DZHA 1AY0A 3I01M 4G9GA 1P4GA 2OZLB 3MTEA 2FWAA 2E4VA 1TM7E 3IVCA 4ZAXA 2GH1A 3RC3A 2FN7A 3LF1A 1JG6A 1T0JB 2JI9A 5A05A 5C34B 4AJNA 4BMNA 4AJEA 2ZIGA 2PVPA 1ZD3A 3ANXA 3TW4A 3VAZA 2IZ5A 3DE4X 1WDTA 4ZAFA 3P2IA 1ENZA 2UZ3A 3LBYA 4O33A 3VR1A 4O4JF 1HDOA 3CHYA 3YASA 3X3HA 3EE6A 2AG1A 3RS8A 1A4IA 1VA4A 3D6JA 4MGIR 4MI9A 4Q4LA 4IMPA 1CJTC 1KC3A 2O0LA 4YJ3B 5FKJA 3UCEA 1W4CA 1UKYA 3DTTA 3TZBA 4UTPA 1KQOA 1RHUA 2ACKA 1KO7A 2DYKA 2VAPA 3RK0A 2C7RA 3CVWA 4I81A 1D1QA 1NQAO 1M5TA 1GUZA 2GCEA 3IBSA 3I05A 2BC9A 1JBEA 3AI7A 3EG9A 4RK5A 3I62A 1UDWA 2WQ6A 3H65A 2I4TA 3AB3A 3QPCA 4Q9AA 3KBBA 2QUHA 3FZNA 5SY9A 3EUEA 1EIZA 2HV8A 3MJHA 4E7PA 2FWRA 4IZ6A 4WVFA 1AOXA 2PJDA 2AZMA 4AN1A 4KIUA 3NWJA 5LD2B 1OBOA 2ZTVA 3JPYA 1NR5A 2NM0A 1T29A 4CM8A 3VGJA 3W05A 1GPLA 5B7GA 5F1YA 1YC5A 1J1ZA 3NUZA 4RJKA 3KEQA 5FOUA 3COYA 4ES6A 3KZMA 1WOYA 4UU8A 1FLVA 3IAEA 3GJ0A 3N3AC 1N6KA 1OU4A 4TWAA 1MR3F 1CULC 1GSOA 1QFZA 3EF1A 5B3LA 2NZWA 4BKOA 2J7PA 1OTXA 3V55A 2YW9A 1GUBA 3T9BA 4RH3A 5HJ2A 4OFWA 4Z7NB 2J3IA 5I4KA 2VJMB 1QCCA 3EXG1 1FBNA 2PX8A 3IE0A 4PFQA 5EPEA 5FUXA 1FUKA 1YOBA 2VPPA 4R31A 2XGMA 3EXIB 5L40A 4KMSA 2ODPA 3ROMA 1XTJA 3SNHA 4TMTA 4DPLA 4OH1A 4PN3A 3T3EA 1JXQA 3GA7A 4DLVA 2YWJA 4HUQB 4XRRA 5JFTA 2WAOA 1N2IA 3AINA 3HGTA 1JXOA 1MJ5A 3SZMA 1WA5A 1BQ4A 3PA6A 1RADA 3ADOA 3C6ZA 1SMKA 2D06A 1WKCA 2C2GA 2GBIA 3DZIA 1XPOA 3SX2A 3AHIA 1Z2PX 2X77A 3N3BC 2XUAA 2HDWA 2E0IA 1LUAA 3GGCA 3R7BA 3GX1A 3P2JA 3W6UA 4ARSA 5FFMA 3BYZA 3CRZA 3MGKA 3OD1A 2NSHA 3LLUA 2EEZA 1GAEO 2XUJA 3L7AA 1UP7A 3OLCX 4NCNA 4B4OA 5KSZA 3GPLA 2ACVA 1S7GA 1T10A 2GX6A 2RBKA 3BZBA 4G5OA 4NWIA 4OP3A 4YPFA 5WRFA 1AV7A 4RACA 5EGSA 2B99A 2PYDA 2ZIUB 2ZAIA 5LZ2A 2VDWB 3PFGA 3RU9A 3SXJA 3ROGA 1LLUA 4PPYA 1NIJA 5ER9A 3O8QA 3HDGA 3BDIA 4JODA 4WAUA 2XAUA 2Q9CA 2BR5A 1U2PA 3U26A 1KJIA 5CXQA 2UZ1B 1QTIA 5JC1A 3PLRA 2ZTLA 1FP2A 3SJAA 3INTA 4MUEA 4M1MA 5CLQA 3GCXA 1IY9A 2V5AA 3LFUA 5F12A 3ZJYA 2AZTA 4ZODA 5AUPB 2PUFA 3MGAA 3AP3A 2C4MA 3BRWA 3N8KA 1BA2A 3MTQA 3T7TA 3WSVA 4B44A 3NBKA 3HBLA 3UMBA 4CTOA 1Z68A 2BLLA 4LTDA 5BQ5A 1I4LD 2MTBA 3JWGA 4RXMA 1V5EA 1DOHA 2XMPA 1VE3A 4GE3A 3DR5A 4LYYA 4JBIA 2WABA 1JA9A 1ISRA 2H06A 3AV3A 3F6PA 3NWOA 4TV9A 2OBXA 6Q21A 5C53B 3ZE1B 3G2MA 4KE9A 4QM6A 2Q1YA 2W4IA 3GUHA 4XVHA 2GF9A 3HDQA 3IIJA 3OO0A 5C1DA 1E2BA 3GLIE 4ESOA 2G76A 3SF8B 4WGFA 2YUTA 5IN5A 5AW7A 1MJNA 5FUYA 1Q44A 3F6RA 3FSGD 2R60A 3DUFA 2OPHA 1MEEA 1S3SA 1KJJA 3LKDA 1KFKB 1PP4A 3ACDA 1J00A 1TLFA 2QRHA 3LP8A 5CVUA 2F90A 3D3KA 3JQGB 1ZRMA 3TE7A 1KSFX 2VUIB 1YR8A 4BJ3A 1PJCA 2VPZA 3WA6A 3A6ZA 2ATEA 2OE2A 3SHWA 1ZIPA 4LRXA 1HNNA 1UM8A 1BYUA 1QHSA 5KIAA 5KTYA 2XE4A 5JXWA 2GHTA 4HAOA 4JBHA 4B6RA 4F96A 2G70A 3C1AA 1HF3A 4LJRA 5FUBA 5JJLA 3W8DA 3ZQUA 4XQCA 3EMVA 2PCJA 3CH4B 3HPRA 4J1NA 4IHKA 3RVRA 1Z33A 1CNFA 1QH0A 4DNOA 4ZAVA 3DW3X 3LBIA 1DX4A 2LCIA 2OENG 3BZUA 3TLZA 4DS3A 4FDUA 2DT5A 3RH0A 2VJDA 1R8QA 2FR1A 3PQCA 4ND8A 5T64A 3DLTA 5COAA 1EYZA 5EWJB 1UK6A 2OGTA 2OP0A 4MB6A 1QQTA 1ODTC 3ZHQA 4AICA 3IBFA 3L6RA 2JHFA 4LQ4A 5BN4A 3O92A 5JS1A 1MPTA 5GJVC 1NLUA 1C0KA 3T35A 2JLQA 4WN9B 4DMUB 4D44A 2WYUA 2Z8XA 3CLTD 4LOLA 1YZKA 4O4HB 3PGXA 2FR0A 4PONA 5JAOA 1DQPA 4WSOA 4YAGA 1BROA 1BXZA 3FWZA 1PSWA 4HNGA 1XPRA 4TGLA 4MW4A 2O20A 1G9XA 2H85A 4KQ2A 4B3XA 1M0EA 1DCKA 4M0KA 1CJKC 1S2DA 5DXAA 5DVZA 2FEWB 1KQ3A 5AJXA 3CNEA 5D5QA 1SKAA 3VX3A 3LUJA 1OV4A 2VDOB 1T9BA 4FJ2A 4EG0A 4B3DA 1OI2A 2PAAA 2V5VA 4CRWB 2VK2A 1Z4QA 3DYIA 3ROQA 2ZSDA 3L6EA 1QM5A 1WJGA 3GCDA 5BSVA 3IYLW 5IX8A 1P74A 4H35A 1ADFA 1IVYA 2AQIA 4J0IA 3V1UA 4GPD1 3JQ7A 2K5UA 3H8SA 3MBKA 3K32A 3QLUA 3LUDA 4GHWA 4MLCA 3U81A 2HJWA 2JHCA 4NBKA 2C9DA 4HZUB 4WZ6A 3M5CA 4AG5A 1JZQA 4UBNA 2J9YB 4JOBA 4F21A 5ADUS 5JZSA 2Y99A 2Z6UA 5CDTA 2Z98A 2ECFA 4QXQA