2YVUA

Crystal structure of ape1195
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
KCIEKGIVVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEPPENPQLVLDTESNTIEHNVSYLYSLVKAVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
publication title Crystal structure of APE1195
rcsb
source organism Aeropyrum pernix
total genus 71
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yvuA00
1XTKA 3U6BA 2QROA 3FMFA 1XTRA 5KNCA 4Q7LA 2LKCA 1E6CA 2DWQA 4G5RA 2A5JA 2FSHA 4Q47A 1M1YE 4F92B 4BFXA 2RGEA 3B8HA 3FFBA 3B9PA 1Z07A 4PZLA 4KV9A 2QSYA 3RS5A 2L0XA 3B1VA 3DKPA 5GVSA 3I5XA 2RGNC 1W0JA 1G7TA 4MH0R 5FR1A 2Z6VA 1X86B 3K0AB 2J7PA 2ZR9A 3SYLA 1XB2A 3OHMA 3HPQA 1Z6YA 4FN5A 1UPTA 1GNPA 5FFMA 5DN6A 1AIPA 2BM0A 2J46A 2QGZA 4GFDA 4JYBA 3PG5A 2J7PD 3K09A 3NVAA 1XMIA 2BMDA 2OAP1 4MRVA 3HU3A 3IIMA 3KQLA 5HZKA 3I8SA 5DI9A 1NJFA 1GNQA 1KK0A 3BE4A 4NCKA 4LSGA 3TQCA 2F6RA 4XVRA 5HKKA 2GTPA 2BHRA 4KBFA 5E7IA 421PA 3UWOA 1E0AA 1W36D 2ZVPX 5JRJA 1TEVA 2ZR0A 3SR0A 4U7DA 2VBCA 2YC4C 1CXZA 3QOFA 3DOEA 4U00A 5HKKD 2WSMA 3LA6A 3A1UA 2AKYA 5FOXA 5KDLA 1OFUX 3GLGE 1KI9A 1XD2B 1XWIA 2F1HA 1Z29A 1F5NA 2PZEA 3AV0B 2ZSBA 621PA 5BW8A 4GMDA 4ACBA 4LYJA 3D7MA 4OHXA 5DSZA 3TE6A 4Q9HA 2FG5A 3A58B 3CONA 4FI3C 2F1RA 5CJPA 1IN7A 4ZIRA 4HAWA 2V7QA 3EZFA 1TMKA 3IDQA 1Z47A 3P26A 1Z06A 3TLXA 5J4HA 1JALA 4AKIA 1KI1A 3ZDQA 1P72A 5LBIA 4UXJA 2GEDA 3X1YA 4AK9A 3CZPA 4DIEA 1ZIPA 2QAJA 5FOVA 5JRZA 1KIMA 2IUSA 2XTZA 1LNZA 3WXMA 2WWGA 1KI2A 3IEVA 1N6RA 3FGNA 1YRAA 3C8UA 3QJYA 1E96A 1UFQA 3LNCA 3EXAA 5H68A 5KPJA 4LHYA 1NVVQ 2QP4A 3SHWA 4B2LA 3VTKA 2H17A 3R7WA 4JIMA 4LJ8A 4EPRA 4OBEA 2CCKA 1I4TD 5FTLA 4A0GA 3NBYC 3K0FB 4IFEA 3CF6R 4BE7B 2ZUBA 4FIDA 2GXUA 4O25A 2V1UA 4IHQA 3V00A 4JT2A 4B3XA 2CK3A 4M1YA 3A1TA 2XNSA 4JJKA 1EG7A 5GJBA 4RY2A 2ZS9A 4EKDA 2GESA 4IDOA 1PUJA 2CK3D 5CK4A 4JKYA 2Z5FA 4LV8B 3RS0A 4B75A 1G8PA 1E4VA 3CRQA 2OLKA 2FV8A 5EXPA 3W6OA 4B44A 2C9YA 1TQ4A 2PJZA 3N2EA 3M6AA 4ZO4A 3CWQA 1YHNA 3MWYW 4BQSA 3L8YA 2HJVA 4URVR 4NCNA 1D8TA 4P4UA 2ODNA 2UVQA 4TMTA 3IQWA 4QJ5A 1EFRA 4RFVA 4Q4HB 3SBDA 1P9WA 2ZUCA 3WMGA 4CDGA 2R6AA 1P3JA 4KJZA 2QSZA 1D9ZA 1Y63A 5GJCA 4YLGA 4OHWA 3WP0A 2P0EA 1EFRD 1GRNA 3O8CA 4Q66C 2CVHA 4XSGA 3TRFA 2EW1A 4B35A 3GLIE 4PHGA 4DWJA 5EZ5A 2RGAA 4QRHA 2AXNA 2JLQA 3W6NA 3TNFA 1KMHA 4PX9A 4U5XA 4EPTA 4PFSA 1KI7A 4TT3A 3GJ8A 3K0CA 3Q5EA 4QGGA 2ZYUX 1G19A 1XTSA 3QNUA 4BFZA 5SZJA 1EX6A 4DDVA 3I61A 3ZZ0A 1GG2A 3SJAA 4RFSB 3EPLA 2NTYC 5FOWA 4DEYA 3IUYA 1G3MA 1G20E 2J0UA 4C3ZA 3C15C 1OFTA 1TEXA 3QBVA 4DJTA 2HCBA 1SXJA 4DLZA 1EFCA 5JI2E 1KKLA 1KNQA 2GF0A 2YOFA 4EFLA 2ZJ8A 2XB2A 2JJ2A 3GLGB 2Q9AA 3AVTA 4K46A 2W2VA 1SXJD 1FNMA 1KK1A 3K9GA 3DOFA 3VU9A 5L3VA 1L2TA 3B5JA 5DI3A 1I2MA 5FR2A 5FTJA 4XWOA 3GLFE 1FW6A 3I32A 3UWKA 2OESA 2WWYA 4DHEA 1G8HA 4DBLC 4EPYA 1VYVA 1VPLA 3OFNA 2PH1A 4JVNA 3RABA 2ZI4A 1Q22A 5IRCD 1UBCA 3ZVRA 3KTAA 5CJ2A 1RC8A 3Q5DA 3WNDA 5CK5A 4V0MA 4IRUB 5G53C 3QKTA 3K53A 3WNCA 4I4LA 4OI0A 2WOJA 3RHFA 3ZH9B 1NVXQ 1N6KA 2ZRIA 1E0JA 1LVGA 4I1UA 4B3FX 1C1YA 1JR3D 1QVAA 2X77A 3PQCA 4JLKA 3W8RA 2ZR7A 2GVDC 3OIUA 4LBVA 4TLDA 3GFPA 3WMEA 3OE7D 1Q44A 3GJ3A 5GJWC 3T5GA 3RRZA 1WE2A 2QAGC 1G6HA 4IFBA 1JEEA 4WXRA 5FPKA 2B7CA 1LS1A 5J4YA 4PC7A 2ANCA 3REGA 4XWAA 1F3OA 2DFTA 2PZFA 2QQEA 3FTQA 1AS0A 3TSOA 4TLCA 1LS6A 4PPFA 5FBRB 4R7ZA 1FMLA 4P33A 4BECA 1RPZA 4Q4LA 5B57C 4HYYA 4IOLA 4G5QA 4B6FA 2REOA 4P3YA 4BFSA 2XZLA 2CL6X 3N2IA 2XAUA 2YYZA 3NG1A 4HAZA 3MGCA 1ZIOA 4D81A 4RCYA 5M04A 1D9XA 4RZXA 4QXAA 3JZMA 4MKIA 2WMOB 4XOIA 5CB8A 2WAXA 4CZ2A 1H8ED 1RRFA 5FOUA 1XTQA 3P1JA 5FUYA 1R2QA 3KKQA 3P4XA 3NDPA 3UATA 3PUYA 3SYKA 1ZM4A 2Z0MA 2C9OA 3DPUA 3L0PA 2NZ8A 3PUZA 1NIJA 3VFDA 1LY1A 3ZIAA 4ASUD 4AYTA 3QSYA 2G83A 2YHSA 3KB1A 4MDFA 2X19A 2DYKA 1SVKA 5EZ6B 4B3DA 4US2R 1OH6A 4RD2A 3AVQA 4RVCA 1UDXA 3K09C 4GT1A 4HZUA 2H16A 1CJUC 2QG6A 3FFAA 3NBZC 1E9DA 1WA5A 2EU8A 3PV0A 4KYIB 2R62A 4AG5A 2ZPTX 1MO3A 1G8GA 2AWOA 4TQAA 1G8YA 4NP6A 4ZCMA 4E22A 2ZJBA 3EZ6A 1GWNA 2IXEA 3AP2A 2VHUA 2VP2A 2WWWA 4IOMA 5JSZA 4OHYA 2BKUA 4CW7A 4ZV4A 1CJKC 2QY9A 2IA5A 2P5SA 4L4UA 4LJ7A 3GLHE 3FE2A 3GJ5A 5F9FA 1QG2A 4ON9A 4R71A 2OFXA 4WVFA 4DRZA 1R0YA 2XXAB 1IXSB 1YZNA 1Z0FA 4KVGA 3ZZUA 4OQNA 4B2PA 2CJWA 2XJ4A 2ZI3A 1R10A 2EYUA 3AGPA 1MO6A 3GEEA 4LBZA 4NZYA 4TTQA 5C4MA 1R5OA 4TZ0A 5KHOC 1T8UA 2BMEA 3PUWA 4S2EA 4C0JA 3EAQA 4Q7JB 2ZRBA 5A0FA 2WWFA 2QTVB 3GLFB 1FP7A 1XRJA 1XMSA 1OXXK 1NLFA 3K0AA 3PEWA 1T6NA 2ZRDA 1BO6A 2F9LA 2FFQA 1N6NA 3GJXC 5JLJA 1T4GA 1TL7C 3CWZA 2R9VA 3LX8A 3MJHA 4C7OB 1E2GA 2FDCA 2ZROA 4I1SA 4ZDWA 4EIWA 1JAIA 1KDRA 4TL8A 2GBLC 3FHCB 3K8YA 1H8HA 3VKWA 3SQWA 1UAAA 3CKLA 4OI4A 1XF9A 1B23P 4MYTA 2FPLA 2XNDA 2IXGA 3G0HA 1E2DA 1Z08A 3RS4A 5J4KA 3K1JA 3BB1A 4OKSA 2YINC 1KY3A 4MYCA 3Q3JB 4TTPA 5KU1A 1D6JA 1CULC 3THXA 5B2ZA 1U90A 1NJGA 1YR7A 5H8WA 4XIGS 3LLMA 1XCPA 1Z0IA 3QUSA 5FI0B 1SQ5A 3TAUA 4WBSA 2OXCA 1YZGA 2WJGA 1G18A 2GXQA 1BIFA 2JLRA 3BH0A 2IS6A 4Q21A 4F38A 3H84A 3KJHA 3OEEA 5FI1B 2FSIA 2PJRA 1DPFA 2GDJA 4N0EA 4GL2A 2ZS7A 4BZPA 1O87A 2B8TA 3ZYCA 4A82A 3VX4A 2Q21A 2AR7A 4RD4A 1KO4A 4XD7D 3GFTA 1E4YA 1XXHE 3AKCA 3P32A 1XPRA 1ZNYA 3U3KA 4HLUA 1QBKC 4A8JA 3QKSB 2FF7A 1VMAA 4BLPA 2IYRA 5IK2A 1AZTA 5L3SA 1XU4A 3A4LA 3GMTA 1UKZA 821PA 3HYRA 5FOTA 3U44A 1IN6A 1W48A 2EYQA 3NIBA 1S2MA 1S9DA 1N5JA 5J40A 4C0KA 1W0KD 1ZC3A 5IHPA 2AK3A 2RMKA 4D4KA 1E2QA 1F2UB 4DDTA 2GRJA 1IONA 3K0CC 3U7GA 1Z63A 3I73A 3IPYA 4RD6A 3VR5A 4CEHA 4XH9B 2X1VA 1T8TA 1ZU5A 1T3SA 1LW7A 1OF1A 2OBLA 2RGDA 2F1JA 3EA5A 3A8TA 3GJ7A 1DBSA 3BORA 5CYPA 5EP3A 5TARA 2W6IA 2KBEA 3RANA 4PHTA 3QXSA 3WYFA 2GAOA 2DCUA 1DE0A 1L7VC 1Q3HA 2VF8A 3U3OA 2PL3A 2ZRKA 3B9QA 4OK6A 1U81A 1TF2A 2OM2A 3I92A 2ASEA 1S1CA 1SXJC 4D25A 4MA4A 5KOYA 3THYB 3CW2A 2IX3A 2J1LA 3GLHB 4DB2A 2IK8A 1UEJA 1MABB 1CJMA 2OCAA 1OSNA 2ZTSA 4V0LA 1ZM9A 3W34A 4QGFA 2WTUA 3NH9A 2WJIA 2ZETA 4Q4HA 1OB5A 1XJCA 4WZBE 1RRGA 2UZ3A 1XBTA 3KX2A 1NL3A 1W5SA 4EDHA 1P9NA 3IBGA 3IGFA 2V54A 3B1YA 2A5FA 4FCTA 1ONBA 4M53A 4TQ9A 3CBQA 2D62A 5FL3A 4DLYA 2KJQA 5AUNB 3OIYA 3CM0A 2J87A 2OXRA 1NMYA 1G7SA 4O0MA 3B13B 2O0HA 2CBZA 3VNVA 2FN4A 2BVNA 2R2AA 1XD9A 5TMPA 1J7KA 2D74A 1XX6A 2J5XA 5LB2A 1R8QA 2E1RA 3RWMB 1JJVA 3H1TA 4NCHA 3BBPA 3T12A 3NDBB 2IUTA 1BYUA 5C4GB 3EPJA 1G21E 4HAXA 3ONWA 4BLQA 1GVNB 2ZJ2A 4Q1FA 1QHSA 5UKDA 3P27A 3EZ2A 3UPUA 1JXMA 1NF3A 2GJSA 4ILEA 4N3NA 5DGXA 2ONJA 1KO1A 2QNRA 1II0A 3EIQA 2XX3A 2PT5A 4MQBA 4EFMA 1W2GA 3ZGXA 1U98A 2H8KA 2CE2X 4LRWA 4M1KA 4F7WA 3KKMA 4AI6A 1U0HC 3H86A 4UJ3A 3QPUA 5BYJA 4BRWA 4E03A 2C96A 2O8FB 1ZCAA 4ZI2A 1W46A 1YZQA 1XP8A 1S3GA 2Q9BA 1OYYA 1XXHB 3G82C 2ZRCA 4Q03A 2PCLA 4TYYA 1US8A 1Q1BA 3AUYA 2F9MA 1Z5ZA 2BM1A 1P2VA 2B21A 2P65A 3B7GA 4PANA 4TMXA 5EE5B 4DLSA 1QG4A 1M7BA 4MKFA 5KYKA 2MSCB 3AP3A 2CCJA 4JLJA 5K8UA 1IHUA 4Z8YA 3L2OB 1OH7A 1F6BA 3CH4B 2AK2A 2MMGA 3EW9A 1IJFA 1P5ZB 3THWB 4POAA 3AVVA 1A7JA 3TIFA 4JZKA 3LV8A 4Q9JA 1COWA 3H0KA 5HR5A 3BJIC 1UKEA 5H1YA 1Z0KA 5CIQA 1SHZA 3CRVA 3UMFA 1DO0A 4C4PA 3BFKA 3AH8A 3E5HA 2NOAA 1Q0UA 1ZM7A 2GXSA 3ZVLA 1COWD 2IBMA 4EQ6A 1NVUQ 2FWRA 2G1JA 4RD3A 5EUQB 4Q4AB 2C77A 4U02A 2ATVA 2AKAB 4MYHA 4QNMA 5G3YA 2HJGA 2CHVA 1PUIA 4LJYA 4QGAA 3QBTA 2OG2A 1NVVR 1W44A 5AJZA 3LBHA 1FX0B 2CXXA 4PPNA 1FPMA 4IVRA 2ZRPA 1CRQA 2X2EA 2V9PA 1Q1QA 5KSPA 3EPHA 1MOZA 2EFHB 2I1QA 4R2HA 2ZJ5A 4RJLA 3AKYA 1CU1A 2QM7A 2J0VA 1ZBDA 2WIAA 1A2BA 2IYWA 3RRNA 1Y3AA 1BOFA 2VL7A 5A4JA 5L3RA 2Y8EA 1X8LA 3PUXA 2OCPA 2P67A 1NLYA 1ZNZA 5K8IA 5E95A 1G16A 2JGNA 4MUBA 3QF7A 4QJ3A 2IHYA 4LX0A 2GVZC 1TPZA 4XWKA 3EPKA 3VR1A 3LAWA 2V8OA 3GLIA 2AN9A 4H1UA 5FPTA 1W1WA 5FL7D 1JEDA 4GMXA 1WBBA 1NMXA 1X8KA 3OAAA 5L3QB 3NHBA 2QGNA 1FQJA 4M1SA 5C2JB 2HCJB 3MJRA 2F3TA 2WJYA 3LXXA 2YNMA 1DOAA 3LD9A 2DR3A 5FPSA 1PLKA 4M22A 1G6OA 4YXWD 5LD2B 3IO5A 5DO9A 4Z1MD 4M0LA 3UMRA 2ANBA 1NKTA 3IEUA 2WSSA 1E32A 3SFZA 2J0QA 1MO5A 1R7RA 3THOA 5F3WB 3AB3A 4A2WA 2V55B 4C30A 3ND9A 3U5ZB 2UZIR 2LWIA 4GNKA 4RD1A 1WP9A 2W0SA 2WAYA 2ZYTX 5FPYA 3GCGA 4WW0A 4EPWA 2FPKA 1OXUA 4L5BA 2O8BB 3C5HA 1QZXA 4MRPA 1W0JD 1ZD1A 5JJIA 2FEOA 1YRBA 1GL7A 4E09A 1W5TA 3T5DA 4P4SB 3GP8A 3LWNA 4HLUC 4A8JC 1R0WA 2BBSA 3QVUA 5DN6D 3CF0A 2QEQA 1R8SA 4GOJA 4BLTA 3ICEA 3FKQA 2DB3A 2GCOA 3RS7A 4DLVA 1GITA 1WXQA 4KHZA 1QHIA 2H7VA 2FSFA 5CYOA 3Q9LA 3CH5A 5FTKA 8OHMA 2R44A 3PUVA 1DS6A 1Q57A 1VCMA 1RZ3A 2XOKA 3B6EA 1ZUHA 1S96A 4TWZA 4PZYA 3LRPA 3IHLA 4AYXA 3AVPA 4TMWA 4LJ6A 4EJSB 1RYHA 1NVWQ 4C0LA 2J3EA 5JCZA 1ANKA 2FMXA 1R4AA 1KK3A 1MT0A 2IW3A 2GJ9A 2FFHA 1RKBA 1P2TA 2ZYVX 1UJ2A 4D0NA 2ORVA 3QXHA 5EE9A 3Q8XB 3AVYA 4R9UC 2D2FA 2FE4A 2IC5A 3BB4A 4Q4JB 1OHHA 4GDFA 4QKQA 2XGJA 1UDWA 1W2HA 2V7QD 2NIPA 3LH5A 1G7CA 1T3LA 1Q20A 3ETLA 1LF5A 3TW8B 1XEWY 4YMTA 3NC1C 1VIAA 2ZUDA 1GRQA 3VMFA 1U8AA 3TBKA 2LKDA 3A6PC 2BBWA 1RJ9B 4MRSA 4KO8A 4Q02A 2GBLA 2NQ2C 3LO5A 3WMFA 1KSJA 2GA8A 4DCUA 1VIYA 4XVQA 2Q6TA 2REXB 3ZZTA 3SYNA 3I72A 1J70A 1KSFX 2VRWA 1D2EA 3QF4A 2CLSA 5IT5A 1CR4A 2DBYA 5BYKA 4QBIA 4ESVA 4TYPA 1ZJ6A 3OESA 4RZUA 2CCGA 1L4UA 1DADA 2UKDA 5DYGA 2HT1A 1EESA 2Z4SA 1XEXB 2GK6A 4PXAA 3LDAA 1ZM3A 2R65A 1G9XA 1EFTA 1SHKA 2WIBA 3LVRE 1Z6AA 2ZYWX 1GIAA 4ZI3A 1F2UA 3SEAA 2O52A 4K81B 1VG0B 4AKEA 1T3HA 2GCNA 3Q85A 4M2LA 2B8WA 3EWAA 2EQBA 5SZHB 1OIWA 2VIIA 3MCAA 5CB6A 4FCVA 1S1MA 4F4IA 5FTMA 2CNWA 2ORIA 1QHHB 5BN3A 2VHCA 1E9CA 1EWRA 2WKPA 2J9RA 1RIFA 4F91B 5F9HA 2OT3B 4NDZA 1Z8FA 2RH5A 4V02A 2IYYA 2A3RA 3U60B 2F43B 5CLLA 2N46A 2WV9A 1FQKA 3GLHA 2P5TB 2ERYA 1KDTA 1SKQA 1AKYA 3REFA 4CEJB 3CUEF 3TVDA 3TR0A 3AF3A 1KK2A 1SVMA 3O47A 3K70D 4P4TA 5CITA 4I1OA 2WJJA 5A5GA 2C04A 2JDIA 4EPXA 1PLJA 4HDCA 4QC2A 1AM4D 2P3SA 1HH4A 2VYFA 1N0WA 4GP7A 2AHOA 2QUZA 3N5CA 4PSVA 3IQXA 5L8VA 4DLXA 1NN3A 3VNUA 1RVDA 3PEYA 4TT3D 1U9IA 1OW3B 3B1WA 4D4LA 1ZD8A 3FMOB 3W5IA 3TUZC 1ZINA 4F93B 3UG7A 2VP5A 1D5CA 4IDQA 4HUTA 1XMVA 2BCJQ 4DCSA 2GZDA 4QJ4A 1NN5A 4Q1AA 4BEJA 1XCMA 4WIAA 4QM6A 4LJ5A 4NH0A 2J45A 2Q3MA 3FMPB 2ZRHA 1QHGA 4KITB 2CDNA 4TYNA 3ZD6A 1GDDA 1XD8A 2F7SA 2X2FA 1A5TA 1E0SA 2QT1A 1F2TB 2JLSA 2WWIA 4D2IA 1IXRC 3VR3A 2BV3A 3WBJA 2Z83A 1E2LA 4M9QA 3KJIA 3KKPA 2VSXA 2RGGA 2JJ2D 2PMDA 2YOGA 3C14C 1MRNA 1QHXA 1Z6XA 2LCFA 4FW9A 5HE8A 3KKOA 5JFGA 4QM7A 1KKMA 4QHSA 1TU3A 4FINA 4X8HA 4C0QC 5KSOA 1NKSA 1KNXA 5BWMA 2ZI6A 3OFND 3MFYA 2QTFA 3KFVA 3QKRA 1P61B 5E3HA 3KQHA 1NG9A 3F0TA 3NH6A 1TUEA 1L4YA 3I4LA 4AURA 4N0DA 3QXCA 3CF2A 1KI8A 4M1OA 1HT2E 4UNNA 4W5HA 4TLAA 1ESMA 1GUAA 3GJ4A 1R0XA 2F1IA 4DIDA 1BMFA 1Q3TA 4MKHA 4D26A 4NONA 2O8DB 1N25A 1XJQA 2P2LA 3AEZA 3DHWC 3SE0A 4BFUA 3P4YA 4F4JA 2WOOA 4AIIA 2ZXUA 1DELA 5KO2A 4PC1A 4DEXA 1XPOA 2H57A 1NNEA 2PMKA 4QGHA 5D3MA 4WZ6A 2EFCB 4Q1DA 2JJ1A 3GD7A 1KJWA 3K9NA 5JWHA 2ZJOA 2OV2A 3QPWA 4ZDKA 4X8OA 2HUPA 1LB1B 1GKUB 3EC2A 1FUUA 3G5UA 5HCIA 4L8GA 4BASA 1II8A 2JJ1D 1KAOA 2ZEJA 2D06A 5JJKA 1WF3A 3V4FA 2RKOA 2QE7A 4Q1CA 1JECA 3WRYC 1ESNA 3U3MA 3KQNA 1U8YA 1E2PA 2CVFA 2GJ8A 2YVUA 2B7BA 1UBEA 2IYXA 2VA8A 2JLZA 4FMCF 2GK7A 4LJAA 4B47A 5CIWA 1M34E 1ELOA 4M21A 1KDOA 2NG1A 3DKVA 3UKDA 3KQKA 2OCYC 5TXGA 2FU5C 1TQ6A 3GPLA 2IF2A 1F60A 2C98A 4O2LA 2P6UA 4DT1A 2HLDA 3D6TB 4AYWA 2GETA 2WPDA 2VHQA 4JLAA 1IY1A 3GEHA 1D2MA 1M74A 4BFTA 3H2YA 3A1VA 1M8PA 4HUQB 5KSZA 3ZIAD 4ARZA 1KI4A 2HLDD 1G4UR 1AJEA 3TGPA 2FGJA 2IEYA 3GEIA 2C5LA 3T06B 2W58A 2PEYA 2FPMA 2VQSA 4IDPA 4LV5B 5JCPA 3KL4A 3S1AB 4LBWA 4QBHA 2ZRGA 2HT6A 1Z28A 2ZITA 4M9SA 1OE0A 5FBQB 3LX5A 3NBXX 1J8YF 2ZIAA 1NBMA 1E2HA 1ZC4A 5L3QA 4G3XA 1GOTA 1JQJC 1WDTA 2EWVA 2FGKA 4JYCA 1KI6A 4TMZA 3L82B 4MITA 2V1XA 5SZKB 1N6LA 4D4JA 3O8RA 4DSUA 2XSZA 2V6IA 2YZ2A 4YDSA 1AKEA 3LBNA 4MDEA 2NO0A 1DG1G 1G17A 1ZVQA 4I81A 4BUJA 3MRSA 1AGRA 4KVAA 1UM8A 4HB4A 3UXMA 3NXSA 4HLCA 1HEIA 3L0SA 3MWKA 1FTNA 1G5TA 5EP2A 3CR8A 2FEMA 3CNNA 2CLCX 1YZUA 1G3IA 1JBKA 2HXSA 4KI0A 2XJ9A 4A0RA 3HP1A 2J41A 1WB9A 1YJ5A 3BK7A 1VDZA 3A1SA 4P4SA 4LPSA 4DLUA 3W3ZB 1P7CA 5FOSA 4PAOA 2ODWA 4GOKA 4C2UA 4ZKDA 1M7GA 2I3BA 2N42A 5HCNA 1N5LA 2ERXA 5KDOA 1KZGB 1W36B 4QFMA 1H8HD 1HURA 1AS3A 4KLZA 4GI7A 1F48A 4TSFA 2XNDD 4JLBA 2H92A 1NIPA 4PQFA 2BBTA 2IYLD 1DAKA 4KU4A 1BKDR 1SXJE 1XD2A 2ZE6A 4IEIA 1QHYA 4DC9A 2BOVA 4CEIB 2YWGA 3CRW1 3BIFA 4PSAA 4AD8A 1IY0A 1AA9A 1T5LA 4RD0A 4LHWA 3AKEA 3FHOA 1D2NA 1E99A 1JPJA 4XTRA 2ECKA 1NLZA 2GNOA 4LHVA 3A37A 1HY3A 3OEED 3TW4A 4GSYA 1CJTC 1E1RA 1YU9A 3T35A 3UMSA 4ZPXA 1I4DD 3QENA 2XEXA 3M4YA 4KFRA 2IYSA 4ZIRB 5JEEA 5JS8A 5FBWB 1E69A 1SGWA 5JECA 721PA 3K0SA 2YV5A 3K70C 3W90A 3U61B 2A7QA 2PEZA 1OT3A 4JLOA 3OEHA 2DFNA 5DLQC 3HU1A 1JR3E 5IK2D 1FUKA 3PEUA 2AWNA 2QP9X 3NC0C 3NEYA 3X2SA 4Y0AA 3E1SA 3K0FA 4YC7A 3OEHD 5AR1A 1N6HA 2HF8A 4HAVA 3R7WB 3U7HB 4AKGA 3RNLA 3HWSA 1KO8A 2QPTA 2OFOA 5P21A 2QP3A 3KUCA 2ZU6A 3BRWD 2D3WA 3ADKA 3WYAA 4RSGA 1U9IC 4LC1A 4TN1A 3DMDA 3KXIA 4JS0A 4W5JA 3L8ZA 3UG6A 5EJEA 2BWJA 5GADl 4DZZA 3ZLJA 2W6ID 1P62B 4CT4B 2GJKA 4UJ5A 3EZ9A 2KWIA 3FOZA 4G5OA 1GKYA 2WMNB 3B2EA 3R20A 5CM9C 3ZS8A 4A0FA 4PSKA 2RGXA 1VYTA 1ZCBA 3DEFA 1VCIA 4KSBA 3ZQ6A 1JPNA 4KFUA 2A5DA 3EIHA 3JZAA 4KLNA 3WYGA 1IY2A 4BWYA 3CB4A 2O5VA 2ZE7A 3BXZA 5KNDA 5FPHA 2F43A 3CR7A 3N70A 4N1AA 4TL6A 4AKHA 1J2JA 3KB2A 3D3QA 3SOPA 4C2TA 5DE3A 4URWR 3SC3A 1UEIA 1IAQA 4CEJA 4JL5A 4C0HA 3IPXA 5CLQA 4A92A 2AFHE 4L15A 2GHIA 3C16C 3SFVA 4V0OA 5F2EA 4E07A 3SQXA 4W5WA 1J90A 1R5BA 2ZS8A 1N6OA 3WHKA 3AF4A 3DM9B 2O0JA 3B85A 1Q1EA 4II7A 4IDNA 1E9EA 1UKVY 2R6GA 3CX7A 2IYTA 1MR3F 1KMHB 2JIZA 2YWEA 3RS2A 3LQQA 2O8EB 3VX3A 3LY5A 5EXSA 4RFSA 3U3JA 5TDHA 1T5IA 2Q0HA 1FTSA 1Z6GA 1XEFA 2JLUA 3W3AA 3WHLA 1VYUA 3ASZA 4CGZA 4Q9KA 4AC9A 3ZVNA 3M0EA 2PLFA 1IXZA 3PIRA 4JL6A 1KJYA 1E1QA 4XTCS 2J0UB 4PPQA 3EC1A 3Q7PA 2VP4A 1GTVA 4JLNA 3AGQA 4EFNA 1JJ7A 1SVWA 4HB3A 2PBRA 2XITA 1OH5A 3GLGA 3QG5A 1SXJB 2DFKB 4URYR 5EXXA 3AF0A 2WKQA 4UNQA 1K8RA 3IILA 1PJRA 3WBKA 3CRRA 2OAQ1 1E98A 1HQYE 3LBIA 2A9KA 1GL9B 4DUGA 3MG9A 1O3YA 3U7EB 1JAHA 1G3QA 5DI3B 4FWIB 4RKFA 1PVOA 3DZDA 3QIAA 2EVWX 1TU4A 2IF0A 121PA 1T0HB 4M1MA 2ZRMA 3JVUA 3HJNA 1SZPA 4GOXA 4URUR 1Z22A 4LPKA 2G0TA 4M1WA 4UXIA 5JBQA 5B30A 3T34A 1ZNWA 2VTKA 3ZJYA 3KTAB 3CRMA 4TQUS 1FL9A 1VHTA 4HB0A 3T15A 1G291 1U99A 3AP1A 1AN0A 4IXMA 4PHFA 2C95A 1J8MF 4PO8A 1E9BA 5AJYA 1AGPA 4OI2A 2EFEB 3PVSA 3LW7A 1GKIA 5CDFE 4NYMR 3VHLB 2W6JA 1RFLA 3W6PA 3RRMA 2XZOA 3VKHA 2Q9CA 5KUTA 1W47A 5FUWA 3EASA 4B32A 5TVKA 5J4VA 2W6JD 3BERA 4NL4H 3TUIC 2Z4RA 4MGIR 1VG8A 2VLIA 1OJLA 1NY6A 2NZJA 4FMCB 1RRCA 4HLDA 3F8TA 1RW4A 4PC3A 3J81k 1FNNA 1XEWX 3MWJA 5EE1A 2IWRA 2O8CB 4NPHA 3D8BA 2IEZA 2RB4A 2QZ4A 5LD2C 4HB2A 2FZ4A 4WXPA 1DVRA 2ZE5A 4IVQA 3CX6A 4KFSA 3SU8A 1QVRA 1OLOA 1N6IA 4A1FA 3IIJA 2DWPA 5BXQC 1K5GA 1UADA 1BS1A 4OQXA 1V43A 4LYAA 4US1R 4Q19A 5JHHB 2R6DA 3SJBA 3RSOA 3W8NA 1A2KC 1VHLA 2MSDB 2W83A 4QOSA 3ADCA 4GRAA 4OQMA 5EQTA 1U94A 5KSYA 4HDQB 4Q7MB 2ZRNA 1ZP6A 3D31A 3PXGA 1OFIA 1X8JA 2IWHA 1G3RA 1MO4A 4Q5IA 4KCGA 1CR0A 4DLTA 4LUCA 3KXLA 5E7JA 2ONKA 4DCVA 4YMSA 1PV4A 2GZAA 1P2SA 3CLVA 3HR7A 3ND8A 1DAIA 4LV6A 4Z54A 2OILA 1MH1A 2QENA 4S35A 2ZREA 3NKVA 1II9A 3Q72A 1P73A 4HZUB 1NN0A 1VG9B 3OAAD 3AQ4A 1UBFA 1YZTA 4IDHA 5BN5A 2IS4A 3LVQE 1X6VA 2AX4A 3RC8A 1E2MA 3FPAA 5JJLA 1IJEA 4JVLA 2X8AA 1VECA 1EFUA 3U4QB 1SVLA 1AQUA 2DHRA 1HE1C 3U6KA 4B43A 5JSZB 1YR6A 3ZQJA 3DL0A 3E2IA 2XXAA 2G88A 2OZEA 4D80A 4DDUA 3RRYA 3EZ7A 4UKDA 2WSSD 3QEOA 4A0HA 2QPOA 3ASYA 3C5CA 4TMVA 3SBEA 4Q9IA 3TKLA 1E9AA 4PTLA 4B3CA 4CIDA 1CR1A 2R6CA 2QA5A 1NP6A 4JLPA 4B48A 4NYIR 2CJWB 3AF2A 1AK2A 1VCNA 2ZRJA 1G1MA 1NI3A 3IIKA 3GLFA 4JSYA 1JI0A 1P9RA 2IHBA 6Q21A 1GILA 4PO9A 2BJWA 4L16A 5DISB 1DO2A 2RHDA 4C7OA 2E87A 3IBYA 3MAAC 4XSHA 3CO5A 3U3RA 2QPAA 4NCJA 2QMHA 3HDTA 2ZJYA 3GJ6A 2W2XA 3CNOA 2JJ8A 4K8OA 3IHWA 2C2HA 5JS7A 3NHAA 2BJVA 4A9AA 4MGZR 1E2NA 4NU0A 1DAEA 4NYMQ 5FH9A 5C1BA 3KJEA 2XOKD 4DXAA 4H9GA 4EUNA 4TL9A 4W7SA 2ORWA 4HI0E 4DKXA 1U0LA 4LYHA 2VO1A 2BEJA 2HXYA 3SNHA 1X1RA 2NMVA 4V03A 5BQ5A 3ADBA 3THXB 5JHGB 3F3YA 4X8LA 2NO1A 2CE7A 3BGWA 1N5IA 1AZSC 4WZAE 1ZD9A 1G5RA 2PT7A 1OIVA 4PPGA 3SJCA 2XZPA 3B60A 4QL3A 1KHTA 2NPIA 5D3QA 3L0OA 4GZLA 5EE3A 1HUQA 1OHHD 3KFXA 1XJ0A 4BLSA 1JXOA 1YR9A 2QRZA 1T9HA 2G0NA 5E4FA 3DDCA 4XJXA 1OXSC 1EWQA 2J59A 4P32A 3QKSA 4FXPA 2OBNA 1TNDA 4BFWA 5GJVC 4V0NA 4LC0A 1N6PA 3BB3A 4A8JB 3C41J 1XFAA 2BMJA 1S4QA 2HF9A 4YDHB 2R8RA 2KI5A 5EUMA 4DSTA 2O0KA 4ABYA 4B71A 3BWDD 3PITA 5AUQA 5TV2A 1W4CA 2AXPA 5L3SB 4I1VA 3KZ1E 2A30A 2RAPA 3T1VA 2GXAA 3QE0A 4IXNA 1G3UA 1FP6A 4HSEA 5KPDA 1OKKA 2B6HA 2OUKA 4OJQA 4OHZA 3BS4A 1DAFA 3VR2A 4D82A 3U44B 5FBVB 4D0LB 1KGDA 2VSOA 4WA7A 2ZRAA 4NKRA 2C78A 1FZQA 1NMZA 1IN5A 1CJVC 1ETUA 1NSTA 2FX3A 2G1KA 5B64A 4UNRA 3LFUA 1OKKD 5JEDA 4MGKR 3VQTA 3PEVA 1IQPA 3FYHA 2F55A 4QG7A 2JLXA 4LGMA 2KB0A 1HV8A 2OLJA 4GZMA 4CEHB 5JWRA 5AJWA 2ZAOA 1OIXA 3Q7QA 2DFLA 2GWHA 2V4ZA 5EP4A 4US0R 1DG3A 4A15A 3TAHA 4IKEA 1YKSA 1IN4A 2CNWD 1ZUNB 1HT1E 3A36A 5J4LA 5DH9A 1CEEA 2RHMA 2YKGA 4WOPA 3THYA 4A6PA 3DVLA 4M1TA 1ZYUA 2CL0X 4PR0A 5LB4A 3GJ0A 1XCGB 1MABA 2QTHA 3QKUA 1HE8B 5DNYB 3AVXA 1GZSA 3C4JA 1QF9A 4FD2A 4NMMA 5JWOA 3EARA 2IL1A 4JLDA 2IYVA 3SI7A 3K9HA 4DLRA 4IEEA 1Z0AA 1E94E 5ANRB 4JBXA 4NE2A 3V9PA 2IS2A 3QI2A 2C03A 3RYTC 1OFHA 4NYIQ 4OQFA 4DDWA 5LDDC 4Y0VA 3R9IA 2IYZA 4KODA 2HDNB 2E9SA 2H18A 2ZRLA 4ZKEA 2JDID 4NCIA 2QRNA 4YMWA 1K6MA 4IVPA 4OHVA 2NO6A 2QMEA 3WNBA 1GP2A 2C9CA 3ZVMA 5LPNA 3T1TA 4NBSA 1PLLA 1R5NA 2VPPA 1MKYA 2IYQA 2RCNA 4EPVA 2EFGA 3W9YA 3BH6A 2QI9C 4KBGA 2O8EA 2P6NA 2Q3FA 2OBMA 3L43A 4C0BA 2GKSA 1YZKA 3AUXA 2ODBA 4NYJR 5EP1A 1E2FA 4PQRA 1DAMA 1SKYE 1J99A 3BFVA 1E2EA 2IXFA 1U2RA 4ITRC 2P6RA 1E9RA 4PO1A 4QBFA 4OL0A 3X1DA 1EK0A 4A2QA 2GEUA 5IF9A 3KXKA 1KSHA 5GVRA 4B76A 3HYTA 3T1OA 1WBDA 2OSBA 2VH5R 5DYIA 2F3RA 1HQCA 3AKDA 4GBMA 3KKNA 1OB2A 2TMKA 1TUIA 2NPFA 1KOFA 1U8ZA 2CEAA 2GILA 5HTKA 4KSCA 2AL7A 2WWXA 3A4NA 3LLUA 3R8CA 4WAUA 4D6PA 5K8LA 1XPUA 3EA0A 3CPHA 2O8FA 1G4AE 1IBRA 1OH8A 4BZQA 5JI3E 4BFYA 4HEJA 3PCRB 4OJKA 1XXHA 4JKIA 4OQLA 4CF7A 2V3CC 3B82A 1XZPA 2W00A 4LI0A 2IT1A 3HR8A 2C99A 2GJAA 4DLWA 2ZU0C 4HLQB 2D7CA 1P75A 2JATA 4IOKA 5TY0A 1V5WA 4B3GA 1ZNXA 3RS3A 1BMFD 1CIPA 3T61A 1JR3A 3B78A 1Z2AA 3HU2A 1US8B 4Z8XA 2BEKA 2D2EA 3SHFA 5F98A 5J47A 2QT0A 3MMPA 1YE8A 2ZI7A 1UKYA 3OE7A 4FMDF 4L9WA 3SDZA 4KAXA 2ZI9A 3THWA 2A5GA 5CM8B 4DCTA 2G9NA 4LHZA 1Z3IX 4HAYA 1M2OB 1AQYA 1WMSA 3QY0A 2QU8A 3O8BA 4G5GA 5DHFA 1AS2A 1T91A 4XVUA 1VG1A 1Z0JA 3TJZA 3X1WA 1MRSA 4TTRA 1KO5A 3EIEA 4BLRA 1W4AA 2QE7D 3TK1A 3VR6A 3L0IB 1JQLB 4Q4AA 1KDPA 2ZM5A 2ZVQX 2O8CA 3CNLA 4P31A 5HE9A 5G3ZA 4G0NA 1RYFA 2GEVA 3R8FA 4EQ6B 1ZW6A 4F4CA 1H65A 2OFWA 1G8FA 3QVVA 2VHTA 1VCOA 1FX0A 2WICA 4CYMA 4Q01A 1YZLA 2VP9A 3OIWA 4B3BA 2GZHA 4B74A 1ZM2A 4JT4A 5J5CA 4D4MA 3I8XA 1E2JA 5KDDA 2FH5B 4DCNA 3EWSA 1KY2A 2WHXA 1H8EA 2YOHA 1MV5A 4PAQA 2HYIC 1JB1A 1X3SA 1CP2A 4ZDIA 4D0GA 2WPDD 3GFOA 3PJRA 3ZD7A 1HTWA 2QBYB 2EWWA 1GSIA 4Q9LA 1XZQA 2C8VA 4HATA 2MSEB 4A4DA 4ASUA 3AM1A 1JNYA 1ZRHA 1IN8A 2OCBA 4JSTA 4JJZA 4LOAA 4R2IA 3RWOA 2QAGB 1N3BA 3QXJA 4BLOA 2ODEA 2ZQ5A 2GCPA 4HAUA 1LV7A 2XTNA 3NEJA 4OK5A 3K9LA 4O3MA 3CZQA 1ZAKA 1P2UA 5IDVA 3GLIB 1LF0A 3AVUA 5KNBA 3K0EA 4Q1BA 4M8NE 2SHKA 4JMPA 1KSGA 1UF9A 5FUVA 1KYIA 1GM5A 2REBA 3LXRA 1NBMD 1W36C 1E3MA 4B33A 1E2KA 2VP0A 4NYJQ 2VHJA 2ZE8A 3AVWA 3VHXA 2OO7A 3IKJA 4KFTA 3U4QA 5TB5A 4KXFB 1KI3A 2MMCA 3QXXA 2QMOA 1SKYB 2D4HA 4UXHA 1YQTA 1R0ZA 4G5SA 2XSZD 4PZZA 3WP1B 1WCV1 1XMJA 1T0JB 1Q12A 4AY2A 1G64A 2ZJZA 2QMUA 3FKSA 4JLVA 3BFXA 3FDIA 2DWOA 4ZDJA 4B2IA 1OXTA 2AFIE 3IO3A 1HA3A 1E2IA 3FKSD 4CT5A 2O8BA 1QDEA 3SN6A 3OZXA 1SULA 4B34A 3DZ8A 1I4LD 2ZSFA 3E70C 4LBYA 2FFAA 3A1WA 1S8FA 4LCBA 4RCZA 4CVNA 4IJMA 221PA 5AUOB 1EFHA 2KE5A 3C7KA 1TX4B 1N5KA 1Q1ZA 1N0VC 4YONB 2NGRA 4O2RA 4BFVA 2GCOB 2CL7X 4URXR 2HEIA 2VF7A 3TQFA 4CRWB 4AG6A 5B58C 4TSFD 4M9XA 4C9BA 2ZSAA 2JLYA 2I1VB 4PC2A 4PC6A 4Q00A 4EJSA 5CDFA 2QN6A 1KTVA 2FA9A 5JMTA 1CRPA 4R98A 3WRXC 1G41A 2BCGY 4BPBA 4MGYR 1GNRA 2GAAA 3KQUA 1KMQA 3VAAA 2ZI5A 2H1LA 4FWTA 3BD9A 2Q3HA 4Q4JA 3MWLA 5JZVA 1VKJA 2CHQA 2D7DA 1BYIA 4RZ2A 5FUXA 1E1RD 4ZCLA 3HPRA 3MLEA 2PLRA 3NTUA 4M4SA 5KTYA 4V0ME 2RGNA 1K5DA 4H1VA 3VR4A 4Z51A 4XD7A 3LQRA 2QORA 4UQOA 4DSOA 3RDPA 1RJ9A 2JAQA 4OI1A 4BEBA 1A4RA 2BC9A 3I3SR 3B1XA 1ZMXA 3FMIA 1M6NA 2XTMA 2YWHA 2Z43A 2QL6A 1S3SA 2DY1A 2EFDB 5AJVB 1GL6A 3X1ZA 3I1FA 1U0JA 1YVDA 2V6JA 4TYQA 3BH7A 1W4BA 2IS1A 2ZAMA 5DHAA 5AK0A 1I2DA 2OE2A 1TQ2A 3BOSA 5EE0A 3QF4B 1NN1A 1W0KA 1WQ1R 3CPEA 1DEKA 1XEXA 4TLEA 1JR6A 2YJTD 3DM5A 2BIFA 4L9SA 1GAJA 3LW8A 4C0AC 3PFIA 1N2CE 2VEDA 2YC2C 4ACAA 1SVIA 3U2QA 3RC3A 4W9MC 1DARA 3TR5A 4TYWA 3R9XA 4TLBA 4QBGB 2A78A 4Q7KA 1A82A 1IOZA 2RGCA 3EG5A 2J7KA 3ICQB 1GRRA 3QG1A 1ODFA 2NO9A 1G5PA 4Q1EA 5EXTA 2WJHA 5G40A 3CX8A 2CLDX 521PA 4LY6A 1W7AA 4YMUA 1QHHA 3TUJC 3ZS9A 3KDSE 1TADA 2VP6A 2FNAA 1B0UA 2ZANA 2KSQA 4G01B 1P6XA 1S9HA 4TZ6A 4AWXA 5C46F 1BH2A 3DMNA 4BRUA 3VKGA 2FJUA 1EX7A 1OV4A 2DPXA 2FZLA 1A1VA 4C0SA 3BAFA 3K70B 4MRNA 1DAGA 3SZRA 1W4RA 3ECCA 4RKEA 3PENA 4DSNA 2CMKA 4IW3B 5G41A 2J0SA 1XTIA 1XNJA 2QQ0A 3KJGA 1LFDB 3KUDA 1CTQA 3T1QA 4B73A 4GP6A 1CS4C 4OK3A 3R9WA 2N1BA 5SZIA 2ZJAA 3FVQA 2HYDA 1OYWA 3OIVA 1LTQA 2PZGA 4JL8A 4QHTA 5AWFC 1W49A 3MSXA 4M9ZA 2CHGA 3GQBA 4P0TA 1UBGA 4LDJA 4QHYA 4EAQA 2JIZD 4HDOB 1KAGA 2KBFA 4FCWA 2JLVA 1Z0DA 1XDBA 4BGDA 1GFIA 1EXMA 1NBME 2JEOA 3O8DA 3NWJA 2G6BA 2ZRFA 4LZZA 3FHTA 4MKGA 2WBLC 2A5YB 2WZQA 1E1QD 1F2TA 3QPVA 5E7MA 1KZ7B 1CLUA 2K5UA 4TMKA 5C18A 1RE0A 2ATXA 4J0QA 5HZHA 3V4RA 3CIOA 4LHXA 4G1UC 3QQ5A 4BZXA 1ZU4A 1TQDA 3EX7C 3VU9B 3JVVA 1YR8A 1QHNA 2PX3A 1L8QA 1RRPA 2QM8A 1Z6TA 3DO6A 3RVBA 4Q48A 3TMKA 2OHFA 1C4OA 1QRAA 4DUGD 1TTTA 2IYUA 2IUUA 3B1ZA 1NG1A 4JBWA 1TAGA 2OEPA 3M1IA 1HYQA 2W0MA 4KYUA 2WJVA 2G3YA 2BMFA 1N0UA 4JVMA 5DIFA 3RLFA 2HV8A 3CPJB 4PAMA 1XTJA 4ZCIA 3U7FB 1CKEA 4V0KA 3QKRB 4UNPA 4FMDB 5H70A 3UANA 2JCSA 2O8DA 4LYFA 1E0KA 4A2PA 4MYUA 2R6FA 1CF4A 1IM2A 1FFHA 4NTZA 3RAPR 4JVSB 2PX0A 2FFBA 4PHHA 2JASA 4LWZA 5FTNA 5AJXA 3ADDA 1SVSA 5D3MB 4LJ4A 3X1XA 1WRBA 1FOEB 4DB4A 3P20A 2FOLA 2ZSDA 1FMJA 1EGAA 3BC1A 4PQYA 3OF5A 1NRJB 1II8B 1KO7A 1PZNA 4HZIA 3TH5A 4JBYA 4ERNA 1VTKA 5K8TA 3TVTA 1DTSA 3TSZA 1E9FA 2XB4A 5HPYB 2JLWA 2I4IA 4DVGA 1CR2A 1E79A 1NY5A 2AD5A 4URZR 2FSGA 2YWFA 2NO7A 4IOJA 2ZSEA 3FB4A 3UIEA 5ELXA 5AUPB 1NSFA 1Q21A 3F5FA 1E79D 3SS8A 1Z83A 1DAHA 4MUAA 1C9KA 5BN4A 1ZUIA 2BDTA 2GF9A 2VSFA 4OYHA 4JLMA 4YMVA 3W5JA 2G77B 3MD0A 1Z2CA 4DT1B 3H4MA 3NBFA 1TF5A 4HUQA 4MRRA 4RZ3A 2JA1A 1S0UA 2WKRA 3RSLA 2WWHA 4LK2A 2W2TA 2QBYA 3A4MA 4YQFA 3FWYA 3WY9A 4ARZB 2AD1A 1OPXA 3S1AA 3I62A 1X1SA 1R6BX 1E9SA 4TL7A 1G7RA 4LJ9A 2BBOA 4CEIA 5FL7A 4NHOA 2QAGA 3TSWA 4A6XA 4B6EA 2H5EA 3AVOA 3SJZA 4QNRA 1TF7A 1OXVA 2B92A 3PR1A 4I99A 1P60A 4A36A 3MUFA 4FMBB 4UNSA 4Q18A 1P4SA 1SVOA 2BKEA 3QEJA 1M7HA 4ESHA 4GPTA 2WVJA 1KJZA 3AF1A 4EJSC 4YXWA 3I5YA 3UK6A 5FBLB 2PCJA 1CBUA 2A2ZA 4E5UA 4Z1MA 4X8MA 2RGBA 1KI6B 2WM9B
chains in the Genus database with same CATH superfamily
3U6BA 2QROA 5ILOA 4N3BA 1XRRA 4HQRA 2DWQA 1EINA 3ON5A 4ZVLA 2B2CA 1SCIA 3K1TA 8LDHA 3RC9A 5FWYB 2CFCA 2FSHA 1M1YE 3E9YA 3OFSA 4Q47A 2DQ4A 4F92B 4HTFB 2WWRA 4R69A 3GRKA 5AOCA 2CLIB 5KB3A 3FYSA 2EAUA 4RS3A 3LC2O 5BQOA 4PWYA 4KV9A 3QPAA 3IJRA 3K1YA 2NN3C 3KE9A 1F06A 3RK0A 3MUNA 2L0XA 3DTVA 2G5TA 1GTSA 2DBQA 1W0JA 3ZGYA 3O1HB 4MH0R 4BAGA 4BV8A 3X2FA 3K0AB 2QN8A 3IP5A 5F77A 4AJHA 1XB2A 2XRFA 4DCOA 4Q39A 1WZ2A 2WYUA 4MQ6A 2O54A 1GNPA 1UQUA 3IP6A 1MC1A 2R96A 1QGAA 3BD8A 4R6XA 2H48A 2J46A 3RHSA 3EF1A 4A8TA 2J7PD 3IS3A 1XMIA 3IIMA 1GPKA 3FZEA 3OO0A 1NJFA 1GNQA 1J56A 3CVOA 4NE7A 1DL5A 2R97A 4QUIA 5CVJA 4DG5A 5HKKA 2BHRA 1AVTA 1A71A 5E7IA 5LFAA 2V45A 4GPAA 2R7MA 421PA 2A1IA 2FQXA 3ETHA 4WFKA 1WU7A 4QD3A 4G5XA 5GPBA 3F4LA 4IQ4A 3H0EA 1ZEJA 3LA6A 2ALJA 2X5NA 1QCCA 3GEPA 4MIOA 3A1UA 4XA8A 5PGMA 2IHVA 3UK1A 5FOXA 2ZIVB 1M1NB 5KDLA 3ZHCA 3MM4A 1EUQA 5T4EA 4BWVA 1KI9A 2F1HA 4OV6B 4IIJA 1F5NA 1JT9A 3EB9A 4YUYA 2PZEA 3AV0B 3BCUA 3CEMA 1UAYA 3ORRA 2KM1A 1KEEA 1RWNA 3P9ZA 4QGSA 1VBFA 5BW8A 621PA 3ICOA 3D7MA 5JBIA 1ZGZA 3CURA 2F1RA 3GK3A 2RHOA 3OQ1A 2JGDB 4PZUA 1IN7A 4TLMB 5CJPA 3VC3A 1Z47A 4B4UA 3VSDA 2ZZKA 4C7BA 5LMCA 3ZDQA 4BP1A 1WZEA 4Q3NA 4XCQA 1JH8A 5LBIA 5CDTA 4LIPD 4OB8A 1U2GA 4QQRA 3R7AA 4ALNA 3Q3EA 4AK9A 4B79A 5JRZA 2QAJA 3HNOA 3UF0A 2IUSA 2XTZA 2R8OA 3LYHA 3K4HA 3WXMA 4ITVA 1W85A 2HQBA 4MW9A 4CIXA 4ZOQI 4E46A 3NTOA 3A04A 4Z5XA 3PNBA 1M2WA 3EXAA 1YONA 3VYSB 3JWPA 2OQ2A 3OECA 1NMSA 3SHWA 1Z0SA 1RC1A 2I6QA 5H3LA 1PSZA 2EZ8A 2CCKA 3KWLA 1OI4A 1C9YA 1X9IA 1X7XB 1I4TD 4C78A 1VPTA 3V6MA 3UVEA 4ER3A 4HYTA 5F23A 4AZ3B 4C5CA 4IFEA 4MA0A 1SXIA 3F4BA 2X4GA 1HLGA 4O25A 1RM5A 4REMA 5KVVA 4IHQA 5IM4A 3W04A 3CKKA 2WI8A 1PG5A 2CK3A 5G1PA 4ENUA 3RIEA 5CW2A 1ZGHA 4MPJA 4DDMA 2XNSA 5FNVB 2NU9A 5GJBA 2ZS9A 4E33A 5AM3A 4MHOA 4MVCA 1BD4A 2GESA 3GEGA 3QP9A 1UBOS 3VPFA 3T3OA 2PN1A 2Z5FA 2C2WA 1DMSA 1GTZA 1KQPA 3RS0A 4KPEC 3RG8A 5AM5A 1U2SA 1E4VA 4PCVA 4BNIA 1MEEA 1KORA 1P1HA 1YQEA 2PJZA 3N2EA 1VPVA 2NUPB 4I7EA 3CWQA 1YHNA 2QJFA 5KNCA 5B1SA 4AJEA 1PKXA 2CXUA 2NSYA 3CZRA 4TV8B 3UEOA 3IAUA 2PK3A 4BMYA 4CNQA 4WBNF 5BNIA 1M2VB 5IVKA 2ODNA 2UVQA 4TMTA 1GAXA 3IQWA 1WTCA 1DO8A 4K9OA 3URMA 4QJ5A 4YCAA 3SEQA 1EFRA 4RFVA 4Q4HB 4FVTA 1P9WA 1WXWA 3SBDA 3SK0A 3WMGA 3TZBA 3GZ4A 2R6AA 1C30A 3B3AA 2PFKA 3O73A 5KWIA 1QUFA 1HWYA 4XUGB 3WDMA 1Y63A 1M1YB 1JZTA 3WP0A 1SCUA 3O8CA 4D0SA 4J0GA 2VSNA 4M1QA 1R3UA 4FJ1A 1DMRA 3GLIE 1PK7A 2VJMB 3W5DA 2Q5QA 4BQNA 5EZ5A 1PS9A 2DLNA 3LHSA 2MDTA 1T8RA 4NZNA 1U3WA 2JLQA 3OQHA 1S8AA 4MPDA 1KMHA 3EDOA 3KEGA 3TRKA 4EPTA 4PFSA 2CUZA 4LHSA 3KHKA 4TT3A 3GJ8A 3K0CA 3JQFA 2EKBA 5HIAA 1XTSA 3QNUA 4WESA 2V6MA 3RADC 3FWHA 3DAPA 3NM4A 3CLKA 2WVHA 4MVJF 3ZZ0A 3EPLA 2CJYA 4RFSB 1WZIA 1G8MA 4M0FA 4EX7A 5FBHA 2NTYC 4OAQA 2HF7A 1HNWB 3BIJA 2YJ4A 3DJFA 3IUYA 4P58A 1G6Q1 4GKJB 2J0UA 5IYZA 1NVDA 2P7HA 1I94B 1PHRA 3D3KA 3LUGA 4C3ZA 4C2BA 3QHPA 5A6SA 3T99A 5YASA 1G4HA 1SXJA 1JEYB 2C2KA 3L49A 3GGSA 3Q5GA 1P91A 4XX0B 1U2TA 5IAOA 5E8JA 1X14A 1U6JA 5CJJA 4EGCB 2JFGA 4YCSA 1W8DA 2YOFA 1FBTA 4RM2A 4EFLA 4CTKA 3FGOA 1P80A 3AVTA 3OKPA 3HP7A 3JYQA 2I78A 1E66A 1L2TA 4L7QA 3VJMA 3COPA 3UB2A 3K0SA 1L5WA 1I2MA 2NUBA 5FR2A 4XWOA 3A6HA 2OESA 5L7TA 4KC0A 4WJKB 4DHEA 1G8HA 1LPMA 1WUYA 3BAZA 4ES6A 4ZOCA 5ICGA 3VZBA 1VA4A 3LKDA 3A6LA 5AVUA 1EHIA 3O5AA 4CODB 3IP9A 3OQIB 5A4AA 3KTAA 4R2LA 5CJ2A 2WNIA 3IDAA 5SYMA 1Z5OA 2YQZA 2AKEA 2XQIA 2A35A 2ZSHA 3QKTA 2C42A 1YFKA 3DMGA 2TYSB 3NDRA 1DQPA 2FR0A 4EHBA 2GX6A 4KXXA 3GH3A 3USCS 1SFRA 2HQ1A 2J32A 2WIFA 3SC6A 1NVXQ 4DM7A 5B4VA 3QUAA 1R9MA 4XGIA 2XH8A 4Q9NA 2X77A 4QUEA 1A27A 4PG8A 4PRYA 1E6UA 3OIUA 5B6IA 1NT2A 2P9QA 3WMEA 2FPOA 1G8KA 3EEBA 2RHTA 2Q2QA 5KYVA 2JAWA 2NYAA 3KG2A 4JR0A 4F06A 3MQ4A 2QAGC 4HS9A 4ZZIA 3ZEAA 4WXRA 2ORYA 2F2TA 4JFRA 1Q74A 1SD1A 4ARVA 4UAVA 4ZV9A 1DTWA 2W43A 1ILEA 1CSEE 2ANCA 1ODSA 3K1AA 1JDBB 2QTZA 1PL0A 2AMLA 2DFTA 3DLIA 4WNCA 2HR1A 2B4RO 4RJKA 4TLCA 1LS6A 3D4OA 2ISCA 2QVZX 3L1IA 4ZAYA 5FBRB 3A26A 3VR6D 2E5LB 4BECA 4Q4LA 4JX8A 1TM2A 1Z4LA 4DIOA 1EHYA 1ZH8A 4CM6A 2ORED 4QIHA 4LXUA 4WLNA 4EW1A 1OJ7A 1H23A 2NO5A 2XAUA 2H4ZA 4FHCA 3BWEA 4LNAA 5DMXA 1NF9A 4D81A 1CZHA 4LECA 2V7UA 2CZQA 1D9XA 3F3SA 3OKCA 4YDRA 1U8UA 2WMOB 4ZVRA 1R15A 2WAXA 5AHRA 1A8HA 4E51A 5A7FA 1XQVA 1XTQA 5FUYA 1GGFA 3JVIA 1BXGA 3Q6IA 3HM2A 1VL1A 2GOYA 3UATA 3X1KA 4U7WA 1HDOA 3COYA 1ZM4A 3PUZA 1DRUA 3SYKA 2AFHA 2NZ8A 3UOWA 4AYTA 1LY1A 3BE5A 1C1DB 2G83A 2YHSA 4O5OA 4ISCA 1QCDA 1MIOA 2GPTA 1EDEA 4K6OA 1JKJB 4KQ6A 4RD2A 2XTJA 3AVQA 3VDXA 2AQ8A 1UDXA 4W5QA 5HZMA 1YI0A 2XGOA 1CJUC 2QG6A 4KYIB 1WA5A 3PV0A 4Q6BA 2UZAA 3I3OA 4XASA 1CUXA 1MO3A 2XUIA 3B38A 3HFRA 3FOWA 4JUFA 4KLRA 4OOEA 4PCLA 5DLDA 5AMXA 4YAIA 4QOFA 3T94A 4L4SA 1JHRA 2ZJBA 1GD1O 3EZ6A 1EP1B 2XMSA 4MHTA 2VZ9A 3R2JA 2BKUA 4CW7A 3RLIA 1CJKC 3AHFA 5DXJA 4X6UA 4L4UA 3WFIA 4TX1A 1YRLA 1RJDA 4WCFB 3FE2A 3WQHA 3GJ5A 4OVKA 3ZU6A 4LCEA 5CNIA 5K0BA 3A2KA 5TEVA 4DRZA 3LUBA 3CH6A 3K5IA 5KQRA 2W2MA 5AI9A 4X20A 4AJKA 1IG3A 3D3WB 3FLMA 3ICWA 1Z45A 2E5WA 3OBBA 1MO6A 1MB0A 3RKRA 1N57A 2IU6A 5EESA 1JWBB 2F9FA 3R4CA 3F74A 4YV7A 1R5OA 3S29A 4MVJE 3ZOKA 4TZ0A 4MKRA 2XVAA 5E6SB 3PUWA 4S2EA 1JWAB 4Q7JB 2Y71A 5GZ6A 3W7BA 3F8WA 4PW0A 4RSMA 2QTVB 1U2GC 3RUAA 2XUHA 1GTMA 2AFVA 2C0CA 4F04A 3PEWA 2CSXA 1COZA 4L51A 2FB9A 2SICE 2ADFA 2F9LA 2FFQA 3KR9A 4K9DA 4IGEA 3GJXC 3L1UA 3SAJA 1T4GA 1TL7C 2A94A 1GLVA 3WVNA 5F5NA 3LX8A 4DIUA 4PNEA 4BV3A 4R1MA 4I1SA 4RDXA 1XDDA 2G7ZA 1RWKA 1JFSA 4DA4A 1JAIA 4TL8A 5I3ZA 4CLOB 3S8MA 5A9SB 2C83A 1H8HA 2Z1NA 1GO2A 2Q6IA 2Z1MA 3CKLA 1RMQA 1B23P 2YXEA 2PXHA 1DPGA 3G0HA 2G4LA 4J9UE 3URKA 4NV0A 5J4KA 2L19A 1U3DA 5BSKA 1Z4QA 4D42A 3BB1A 4OKSA 1NOIA 3DOHA 4KWTA 4DMUB 5BVGB 2PBZA 3RFUA 3RREA 4CKWA 3PBKA 3ZWBA 1E61A 3ER8A 3O4HA 4GO1A 5B2ZA 1BHSA 1U90A 1YR7A 5DT9A 3PX2A 4LVNA 4BDSA 5HX7A 2LUOA 2BFBA 4X65B 5EQDA 5FI0B 2IIBA 5EMHA 4WBSA 3PF8A 3ROXA 1AXRA 4EZBA 3QEAZ 2WJGA 2GXQA 2JLRA 4OBWA 2FDXA 5JVDF 5A0TA 3CF4G 3CVJA 3KJHA 2CFOA 1ISJA 3A6DA 3LECA 4RH1A 5DTIA 4DPMA 1I7QB 3E22B 1TXGA 3UAGA 4Y8VA 1HI9A 3OPXA 4BZPA 5ISMA 3R44A 2Q21A 4B2PA 2AR7A 4MQEB 4IYRA 1J0BA 5D6OA 3VR4D 4QO7A 1VL8A 5TGTA 1XXHE 1ZNYA 2DP4E 1B8NA 1QBKC 2M6SA 3QKSB 1WDMA 2FPPA 4GQBA 3ZE8A 1QE3A 5I7UA 3LK6A 4Y2SA 4P0PB 5AVJA 3AEQA 4AJ4A 2XWPA 5JG7A 4WQMA 3H8JA 3LDUA 1WSAA 2QR5A 2Y0CA 5D8DA 3A4LA 1UFVA 4MW2A 2YIVX 4WXYB 3F96A 4FUTA 2FUG6 3NOQA 1UKZA 3ZNQA 4Z2AA 3KNZA 4P7JA 5FO1A 3EBLA 4LCJA 3Q0EA 1W48A 3BSWA 4QA9A 1GDHA 5C4IA 2O3QA 3KQMA 2AK3A 5DBFA 3FVRA 4Z9XA 3RM3A 4D4KA 4DIMA 2VTBA 1NVKA 4DDTA 3U7GA 3K0CC 3EDMA 1Z63A 3JQFC 3L7YA 4BB6A 3BL5A 3I73A 5AJHA 2HSZA 3VGJA 3IPYA 2XY4A 4LC9A 1KE2A 3VU8A 5ADHA 1P1BA 3RJ9A 3EA5A 2OBLA 5CYPA 5TARA 4ZICA 3PE3A 2UU9B 1JV2B 3N8KA 4BMPB 4WBNB 4JQYA 2W6IA 2KBEA 3UCEA 3STWA 1XF1A 2ZYDA 3RANA 4X7RA 4RTOA 1E5TA 2DCUA 2OO5A 1Q3HA 4LF7B 2JGRA 2VF8A 5ITWA 3B9QA 7REQB 3P2JA 3NTVA 4JBHA 4X1OA 4YFYA 2ASEA 1SXJC 1WDKA 1TIBA 1UMDB 2V7XA 4RKWA 4RPCA 2PHZA 3Q8MA 4G8JA 4KMSA 2PO5A 4XM1A 2MU1A 4MAMA 5IJXA 4P83A 4S1WA 2UZ4A 1UEJA 3KYDB 3GAFA 4V0LA 3IURA 1J21A 5KVAA 3BZWA 2BH2A 3JW8A 2X6TA 2QZ9A 1YTLA 1OB5A 1Q7GA 1QV9A 3TF5A 3C3CA 3I05A 4M99A 3GVPA 3KX2A 4ZZ3A 5FHQA 3ZWKA 1W5SA 2P2ZA 5A1JA 3FUUA 3K73O 4QSMA 2WWTA 3A1DA 3DEHA 4TQ9A 1R4MB 2A5FA 3B1YA 1JHXA 3P9IA 4FCTA 3CBQA 4FJ0A 4M53A 4RMJA 4JI1B 3WHPA 4OFWA 3H0CA 1U7WA 2KJQA 4HSGA 3DC7A 3VDNB 1AZLA 1NMYA 2P3LA 1JVBA 2X41A 3ELBA 4RVSA 4ZMRA 2RG1A 4MI3A 5A5EA 3GGPA 3EODA 5JO9A 1H3NA 1M5UA 2W6ZA 3KQWA 4L74A 3VNVA 4HNAA 1KEZA 2XUPA 1T5DX 3IOMA 5TMPA 2HA5A 3RU3A 4BKUA 5LB2A 3C98A 1Z8HA 1R8QA 5G1NA 3T4EA 4EGSA 2XKJE 2XQVA 1JJVA 4G36A 3ZWPA 5JS6A 3H1TA 3KAQA 4M7PA 4QAQA 1APBA 2IP4A 3C6QA 3EPJA 1JWLA 1G21E 3O9MA 1GVNB 1EB9A 1FDTA 1NYLA 1QHSA 1VE6A 5H16A 3ZLTA 1T6YA 5UKDA 3TPFA 1JXMA 1NF3A 4DV6B 1LKZA 5DGXA 3EIQA 4FBGA 3O90A 3C7TA 5KAMA 4E6PA 1Q91A 2VHXA 1W2GA 2CYCA 2VDKB 3HB1A 5C8DA 1FK8A 1SOWA 3OZGA 1PWZA 3NPAA 3OUZA 1O77A 5EHQA 4HN2A 3KRTA 1O94D 3T7JA 1UZLA 4F7WA 3K0HA 1YQDA 3KKMA 5B6PA 5INTA 3CX4A 2XD9A 4PG4A 2P62A 5KMGB 2ZB4A 4Z7JA 2NW6A 2VKTA 4NBWA 1FNCA 3M4JA 1L5LA 3NAZA 3NHWA 4G63A 1YA8A 1T1EA 3IDZA 1D3AA 2A59A 1V3UA 3EXFA 3BWMA 4M87A 5M3BA 1XXHB 1H1LA 4IQFA 5ALVA 5BSEA 2TMGA 1S8OA 1ZI9A 2WKWA 3H11A 1IEVA 2WWVD 4ATNA 4DMGA 5C53B 2OWEA 3H9CA 3H2SA 3ZU3A 1LCIA 4MUHA 4EKIA 5AVSA 4IJQA 2I9KA 4BRZA 1YJCA 4LXTA 4E0BA 4RPKA 3GP3A 1US8A 1Q1BA 2YRXA 2F9MA 5A2GA 5FAXA 1NVTA 1GPNA 1QYIA 2IXBA 1NVFA 1V9SA 2OG1A 3QWAA 4IR7A 4HRVA 1Y8AA 3DE3X 3ULKA 4H7KA 3B7GA 2OFPA 3BD6A 4PANA 3GUZA 2VQFB 1M7BA 4H6PA 3MOIA 4L0MA 5DSXA 1CRLA 5EIFA 4XQCA 1PVDA 2VDMB 1Y6RA 1K06A 2MMGA 4F6RB 1U63A 1ABFA 2GD2A 3AJ8A 3E5NA 3O6VA 2ATIA 1RRKA 2I76A 4TS3A 3TIFA 3AVVA 5A9RA 5AW7A 3LV8A 1YAJA 2YFHA 3EG9B 2CXPA 4Q9JA 3RJZA 1ZD5A 4ZOLA 1YQGA 3WGYA 5IAKA 4DV7B 1W8IA 3H87A 1F1BA 3MJDA 3QVMA 1Z0KA 4CTJA 3MTGA 1SHZA 3CRVA 3UMFA 4ENPA 1DO0A 1N2HA 4DGSA 4WNAB 1DJQA 3B2QA 3E5HA 1UMBA 2A7XA 1NYQA 4I5FA 4KSYA 2N3ZA 3HXPA 3AU8A 2QVCA 5DWQA 1VQ1A 5LJIA 1M1ZA 2BFOA 1JMYA 2C77A 3B9RA 4ILKA 2ATVA 4NEHB 1NRIA 2AKAB 4TN5A 4CXMA 1CY2A 2I80A 4LJYA 3MWDB 1WPGA 1KFEB 4QGAA 2OG2A 1NVVR 3ZXIA 5AJZA 4BN0A 4E5YA 4O4JA 1BQ4A 1FX0B 2CXXA 3CS3A 3LBHA 3GGCA 4NDNE 4CUZA 1E18A 1FPMA 4IVRA 5I4KA 3P2MA 1ISMA 1E3WB 3QRWA 2I1QA 3GLVA 4RJLA 1LBHA 1O1YA 1O57A 4TKLA 1NQ5A 4P35A 4W9NA 1HSOA 4R1UA 3RRNA 3IAAA 3TD6A 1BOFA 2VL7A 2GHQA 2XGGA 4GPEA 3A4TA 1X8LA 1YAHA 2OCPA 1SG9A 1DHRA 2P67A 3EXG2 4N6OA 3NOXA 4DLKA 4FE7A 1KJJA 2JGNA 4R2WA 3EY4A 2OXEA 2WW8A 4LX0A 2YIJA 4UTXA 3W05A 1TPZA 2OB2A 3ZHVA 1TW3A 3LAWA 3CGWA 4EVQA 2WUFA 2DSTA 3BFPA 3IR7A 4MV9A 3DYIA 4H0FA 5FPTA 4CCYA 5K0GA 3RASA 4B8YA 1JEDA 4GMXA 1QFJA 1EVKA 1PUXA 4BMXA 3ZBUA 1CEXA 3HKEA 1WZUA 1WXDA 1ZOSA 3GRAA 3NHBA 3OPYA 1FQJA 4M1SA 5H82A 4GICA 1WQ3A 1JPVA 2F3TA 3MJRA 2FMTA 3LD9A 1J0XO 2F4NA 3D59A 4GGMX 3UT6A 4OX9B 4GH5A 1G6OA 2C59A 5GMOA 2OGZA 1YS4A 4OKIA 4X94A 2D5IA 3IO5A 1IEQA 1OAAA 5DO9A 4M0LA 1EXDA 3WG9A 5LZ2A 1G21B 4RPLA 1GCGA 1I7DA 3O4IA 4WDQA 4M60A 5IH3A 2WSSA 3SFZA 2GARA 1C1XA 1RCTE 4P38A 2VWHA 3TZLA 1FX1A 4R2MA 4ED9A 1FMTA 2BGNA 3ND9A 4C30A 1KZ9A 3R5TA 3V1TC 3PR2B 1Y6JA 2R8ZA 4RD1A 5EIBD 2AXEA 2YWDA 2ZYTX 1BJTA 1DUVG 1XALA 1F12A 3EGDB 1SH7A 3PNPA 2FPKA 4V2UA 3U48A 4EEXA 1M6WA 3OPVA 3VTZA 4QYMA 4RY8A 3GA7A 5L3ZA 1RYEA 4OIFA 2FLWA 5FJJA 1XO1A 3FF4A 1HBJA 1I2CA 1T6XA 4C4AA 1YRBA 3IUSA 3FM9A 3BMCA 3T3PB 3T5DA 1CEQA 1F7UA 1OGYA 1AB6A 3QFHA 1A5SB 1FJHA 2HA4A 4QAJA 3RUIA 3QVUA 3IX7A 3G8BA 5DN6D 1R8SA 2WU0A 5H5JA 1T8PA 5CP8A 3ICEA 1PZXA 1DDIA 3PWKA 4AZVA 4FZRA 4TVKA 3RS7A 2CDBA 4FILA 1WXQA 3MIZA 4G65A 4M0MA 1C0EA 1UOQA 2P69A 3PRHA 2W6QA 2VDNB 2EZ4A 2JGMA 3KQPA 3AR4A 3A6KA 2BUAA 3R6TA 5L40A 3PUVA 1Z2NX 1RABA 1ZRNA 4II2A 1VCMA 1RZ3A 3IXMA 4IGIA 4U7PB 3TE7A 1MPXA 3AEUB 2WA1A 2FXVA 4A8HA 4TWZA 5JVDB 1YB4A 3IHLA 4AJIA 1PT9A 2V7VA 3I0ZA 3LWZA 4MS3B 3AR9A 5H81A 3G2LA 2A14A 4Y2TA 3SKVA 1RYHA 4JJ7A 1XZCA 1VL6A 4AMBA 5JCZA 1MC8A 4WOJA 3QA3E 1QCZA 1MT0A 2EP5A 2ZJFA 3HKDA 4K05A 4PGHA 4ZPJA 5CT4A 2FFHA 2GMWA 4I36A 3C85A 4MR7B 2WTXA 4YRLA 4D0NA 5EE9A 3ZD8A 1EI9A 1Q19A 3Q8XB 1B6GA 3WLJA 2C57A 2OO5C 2D2FA 1DIGA 4L8YA 4L9AA 4D3YA 2IC5A 3BB4A 3OF2A 3S28A 1X7DA 4QKQA 1W2HA 4MAAA 2XGJA 4PG5A 1NUHA 4BQIA 2V7QD 4K3UA 1WD7A 1VE5A 1EP9A 1V41E 3LHIA 1NW9B 3LH5A 3WK5A 4CKCB 1JHOA 2IXTA 1QKKA 4E5DA 4IIJF 2VTEA 1D4AA 3FZNA 1DQRA 3IP1A 3Q7TA 3UH0A 5FPQA 1XN1A 2BBWA 3L0CA 1RJ9B 3LSYA 1PR5A 2W48A 4Q02A 5E1DA 3WMFA 2RHGB 1GGNA 1I36A 3V33A 5AFSA 4NJMB 2CMHA 1M75A 1KSJA 1YJ8A 3HCBA 3O8OB 4YUWA 4CLRB 2XD4A 1SBHA 5GZ1A 2FKNA 4R0VA 4KE8A 1MQ8B 2KW5A 3AIOA 1D2EA 1NASA 3HZHA 4AN0A 5B1EA 4KR3A 4AX4A 2DBYA 4FOLA 4GUDA 5BYKA 1PQPA 1N4AA 4OB6A 1XGKA 5AQ1A 4ZVVA 5DN9A 2UKDA 1L4UA 1RBYA 3VPXA 4XPZA 2JLBA 2XB9A 4DXHA 2RARA 1ZM3A 2R65A 2ILVA 3GYBA 4FHEA 1G9XA 4MPPA 3ZHSA 2ZYWX 4ZI3A 5BSFA 3K9WA 4A7PA 2EJWA 5GONF 3KSDO 1RTTA 4LGCA 4CTNA 1B0AA 1GZ7A 1THTA 2YXNA 2O52A 4K81B 1KQFA 2I3ZA 2C2YA 2GCNA 3AJRA 3Q85A 4QDTA 3EWAA 4DYDA 1T4CA 4W4TA 1Y9JA 3QE9Y 3T0IA 1CUSA 1HFEL 3ZE9A 1DXHA 3FI0A 4F4IA 4RLFA 2VQDA 2CNWA 2ORIA 1QHHB 3GRCA 4C76A 2EEZA 2PUVA 2WKPA 2JS7A 1NMQA 3I76A 4QLOA 3DDOA 5GOZA 4JMLA 3VNQA 2ARKA 5IM4F 1DCTA 5GGYA 1B43A 3JASB 4Y98A 1A4UA 2G8LA 1RWMA 4MOWA 4V02A 2IYYA 4YUVA 3Q7EA 1DEXA 4CMKA 3CINA 4M49A 1Z36A 3U1TA 5CLLA 2WV9A 1QRTA 2ZSKA 1GAWA 2XQGA 3D5EA 1J42A 4UFPA 3RG2A 2XOXA 2XCUA 3U0BA 4KKXB 2AFIA 4K9NA 3HXMA 4GZ3A 3CUEF 2F3PA 1HRDA 1ZN8A 2UVPB 4MZXA 5FWXA 3TVDA 3WLLA 3TR0A 1RM0A 2Y1WA 1A5AB 1KK2A 1R8YA 4P4TA 4UDXX 3PQEA 3SEFA 5CITA 2BEUA 2C5SA 4KXLA 3O91A 4HXGA 4LRSB 4ND4A 1LJ8A 1FS6A 2WM2A 3HBNA 4LAFA 4BASA 1QU3A 1WB6A 5KU7A 2VYFA 3LF2A 1BN6A 1A8PA 1FRQA 3N5CA 1L7DA 4BRSA 2V4UA 2GEKA 4J4BA 3WK6A 3ZE1B 3QEMA 3BFJA 1MG5A 4EGAA 3DXXA 1UXJA 4ZYLA 4GI2A 1U9IA 3TLCA 1TA4A 3GQBB 5BURA 3W5IA 1D2GA 2P2GA 1S6YA 5DK4A 1FSPA 3O9ZA 4J7CA 1Z9BA 4JB8A 4BJ1A 1H4VB 4HQKA 5D7BA 1YDHA 2WIJA 3A6FA 4HDAA 1NN5A 4Q1AA 4U2FA 4BEJA 1BA2A 4WY8A 1BDBA 1RR6A 3K16A 2ZOSA 2OKCA 4LMAA 1CNMA 2ZRHA 1QHGA 3DXFA 4TYNA 3AU9A 2XE6A 5J2TA 4P92A 1A5TA 5ER9A 1F2TB 2JLSA 4D2IA 4KO3S 2PH3A 3JAWA 1LPBB 1ISHA 3VR3A 4Z2YA 1CJBA 5IVDA 3WBJA 2IPOA 4BU0A 4IBOA 3EIWA 1GG9A 3KKPA 2QIPA 4QDZA 5BVHA 3R3XA 1AKMA 1YQXA 2PMDA 4IFTA 5MGBA 3IQGX 2GI4A 4KQJA 4DJDC 1L5QA 4TWBA 2YOGA 4BV2A 1QHXA 2CXTA 1VXRA 2ZXFA 3GNLA 1QM5A 5IYZF 1TYCA 1IQUA 1YL6A 2VQ3A 3KKOA 2DOKA 4QM7A 2QMZA 4PINA 5HF9A 5EKDA 3RRFA 3QWBA 1KNXA 2J33A 2HI0A 2ZI6A 4NRDA 2IYPA 1Q15A 4G25A 1PJTA 4LE2A 3KFVA 5KQPA 3VPGA 5E3HA 1U0RA 3DAOA 3FJYA 4DGQA 4BBJA 3ED5A 3ZZ1A 4TOIA 3I4LA 2QUBA 4GLOA 3QXCA 3V2IA 2R5FA 4N5LA 4W9NC 4PQGA 2ATEA 1ESMA 1T15A 3GJYA 3L8FA 3EPRA 3LY7A 3DLPX 3IUQA 1Q3TA 2O8DB 4NONA 1J97A 1N25A 2P2LA 5BYBA 4F4JA 3SE0A 1FUYB 2WOOA 3E15A 4AIIA 5KO2A 1XPOA 1WB4A 4AZ0B 1T9DA 3PC6A 1YFLA 1LW6E 3DLAA 4KUHA 3JYNA 2HJRA 3QX7A 3RFVA 3K9NA 2QJWA 3QELB 1BFKA 5EEHA 1USUA 3RVMA 2BGGA 3KJZA 3MB5A 3Q7IA 3H3FA 4X8OA 4ECAA 2PZBA 2ZEJA 2FW7A 4RW0A 2OPBA 3FOEC 1WF3A 3V4FA 2JI9A 3G9TA 2HPZA 4IDGA 1JI3A 4Q1CA 4CMJA 3J80A 1ESNA 1PW5A 2WU3A 3KQNA 1NTRA 1VOTA 2BI7A 2EQ5A 2GJ8A 2I2DA 4GS5A 5ITZB 4E7PA 1A8SA 2WP0A 4JBIA 4ARUA 4AZTA 4EKEA 1NC1A 3H6KA 1OX4B 1Q17A 4OHFA 1BE6A 1NOKA 4K40A 1U9ZA 5CIWA 2DKOA 3VOBA 3CYFA 2FVXA 4FFOA 5TXGA 3GFBA 1VPWA 1UWLA 4CR8A 4X5OA 4DFDA 2W2LD 3ZY5A 4BMOB 2DLCX 1VE1A 1YMVA 3M9WA 4LA4A 4H4CA 4TRMA 3HI6A 2Y2UA 3WYBA 1NZDA 1KRHA 1RRVA 1L1RA 2PDAA 2DPGA 1ADJA 2DJ5A 2ZAYA 2BLLA 2VXOA 4DR6B 2P9GA 4JCOA 1OWMA 1M8PA 5TF0A 4LDRA 3ZIAD 1J1UA 2HLDD 3RBXA 5E9WA 3WYDA 3TGPA 4YS6A 2A57A 1UPXA 4URFA 4QFBA 2J30A 1K5PA 5I5GA 2PEYA 1XZNA 3ZXXA 1AHNA 3FMVA 3DT9A 5JCPA 1D03A 4JA2A 3S1AB 5LP6C 2HDHA 2NXJA 1HXHA 2P6PA 1WCWA 4G1MB 4M9SA 4C21A 4CMEA 3VDQA 1OE0A 5KWSA 1JIQA 2CJFA 1MRZA 3FNGA 2VBFA 4KXVA 2PKQO 3H1EA 5HM8A 4F9TA 1GOTA 2R7NA 1C0PA 1JQJC 2PUEA 4D6YA 3WO1A 4CM4A 1JHYA 1NQXA 2IUYA 2OORA 3OU2A 1KI6A 2ENWA 3KPYA 3L82B 3MRXA 3C6BA 4MITA 3M4ZA 3R7SA 1NX6A 2RIRA 4MKZA 4NICA 2RD2A 3MRVA 2OCIA 5SZKB 4N48A 5FADA 4DSUA 3IEXA 2RHBA 4XDGA 1UKAA 4YDQA 2GDZA 4ER5A 2V7BA 2WF6A 3JVDA 4D44A 4MDEA 1X13A 3JTEA 1ZVQA 4BUJA 4EATA 1UBJS 4LOIA 3NXSA 4ZAVA 1ORIA 3EXEA 3BXFA 5C9ZA 3ZGZA 4J49A 3L0SA 4F56A 1AU9A 3CNNA 1KS2A 1G3IA 3PFNA 2FY8A 3K15A 1ZRMA 2HXSA 4FYIA 3DTVB 3STVA 3O1LA 2XJ9A 4ZHQA 3N2GA 3WDSA 3HP1A 3P9YA 1THGA 1X87A 2OAEA 1VDZA 3G5TA 3I9OA 2I2FA 3PXUA 3OZWA 1P7CA 3FD8A 2PL9A 3F4KA 5FOSA 2ENUA 1NP3A 1N3IA 2ODWA 4NY1A 1WMDA 2UYQA 3KYBA 4ZKDA 2I3BA 3W5VA 4DR5B 2ZUFA 1Q92A 2CD9A 2IUFA 2YUIA 4QYXA 3JX9A 4TTJA 4F9EA 5KDOA 1W36B 1HURA 5ED0A 4YAWA 2JHFA 2DXIA 4XCXA 5JAZA 2QV0A 3BMXA 4R1SA 4CI0B 2BM8A 3MPOA 1P8AA 4JGBA 2H92A 3O94A 3ZQ4A 1NIPA 2D6FA 2BBTA 3OQNA 1Z88A 4I1RA 5K6AA 1SXJE 3BGIA 4M36A 4BO5A 3M5PA 3N2ZB 3UMVA 3WB2A 2Z3VA 1QHYA 4DC9A 1A77A 5LA6B 4B8ZA 4PSAA 4WNIA 1NV8A 4NS4A 1IY0A 2I91A 4BCCA 1AA9A 4GKVA 4RD0A 4AG3A 5BP7A 4IIJB 3MS4A 4LHWA 3J7AC 1OUMA 3ZTTA 3AONB 3I9V6 2C8LA 1ULSA 1KEEB 2FHSA 4YRTA 2ECKA 5D5PA 5ALIA 2GNOA 1TM4E 4LHVA 4A2CA 3A37A 4V1CI 1U1IA 3T35A 3WDLA 2P9HA 5DTRA 1NDUA 3DDWA 1SWWA 4NBLA 1UIMA 4ZPXA 1K92A 4FYJA 3M4YA 4NENA 1B6RA 4ZU1X 5DYWA 3E9QA 2H2HA 2VDVE 1NRXA 1QHEA 1Z6PA 3K8QA 721PA 5IPFA 5DCLA 1O96B 3W8FA 2JFPA 3P9KA 3TW8A 1GCUA 2A7QA 2XNHA 3PP8A 2PEZA 4JLOA 2LW7A 5JFOA 5DLQC 4UM7A 1F8FA 4DANA 2QP9X 4GSLA 3MWEA 2OZVA 3IEKA 3SHTA 4YAGA 1TYEB 5GONB 2GN0A 3OEHD 4OAOA 1GPLA 1E77A 2HF8A 3BWCA 4P81A 5IZ4A 1MQAA 4IH1A 4HDMA 1BWQA 4IKOA 5KVCA 3LUPA 1CUZA 1I3NA 1V4NA 4IL5A 4GOMD 3EQ6A 5DRYA 4HF7A 1QAOA 5EQFA 3JQQA 4W99A 2D3WA 4UC0A 4C08A 3DFIA 1XLVA 2AMVA 3JQ7A 1C14A 1CUAA 4RSGA 2ZSJA 1U9IC 1CF2O 4RV9A 2IH2A 4CEJB 4TN1A 5KYWB 3NRJA 2QTWB 4LMBA 2YZMA 4C0WA 3NONA 3UG6A 4DMFA 2WB4A 3NM5A 3OBIA 3KCNA 1SXGA 3LDFA 4P2BA 2NU9B 4X45A 3S44A 4G8BA 2UUCB 3KOUA 3EGXA 1MB9A 5AXCA 5LBTA 1KZHA 4ZAFA 2WMNB 5M7EA 1QH9A 2ACEA 3U40A 2EBFX 2RGXA 2X23A 5K1ZA 1EUCA 2H00A 2UVDA 2MCFA 4F7DA 2ILTA 3EIHA 4KLNA 3WYGA 4DQ0A 3E7WA 1CY0A 3PKJA 5T67A 4BWYA 5KTRA 1BROA 1L5VA 1KP9A 3FTPA 3BXZA 5KNDA 16PKA 1Y6GA 2J6HA 4C07A 1T5SA 3I04M 1J2JA 4N8EA 4A5SA 2QTGA 2BKAA 4BGVA 4EW6A 4URWR 1LLCA 2PGDA 2PWBA 1GGKA 1IAQA 1C30B 3AOEA 3HCCA 1V8DA 4NECA 1L5HB 4WMLA 5DB4A 3ZOZA 1XNRB 3ZWWA 1Q95A 2AFHE 2FWBA 1G6KA 2GHIA 3ABIA 3C16C 4L15A 3PQ3A 4RIGA 4V0OA 1XAJA 1RWPA 1U2ZA 2PU5A 1E7YA 2O2CA 1R5BA 2OZLA 2UAGA 3DLTA 4GGPA 3UGKA 2YW9A 3DM9B 4HP8A 3B85A 2CHEA 4II7A 4IDNA 1NT4A 3G0DA 3VXKA 1JN0A 1C8BA 3CG4A 2YWEA 1KMHB 1EB8A 3EZNA 1M83A 3VX3A 3LQYA 1JG1A 3T9AA 1FF9A 1Z6GA 5HIMA 1WSBA 3PNYA 1K8ZB 4WESB 4KG7A 3H4VA 3ASZA 1T9AA 4P3OA 2HWUA 3ESAA 3I2YX 2M2IA 1U31A 4JL6A 1J0CA 3AW8A 3ND6A 4XTCS 3T3GA 2J0UB 3P2EA 3EC1A 3Q7PA 4ZC1A 5IYZB 1IULA 1JHUA 2QG4A 1K7CA 2XNJA 3AGQA 1CVLA 1DT3A 1JJ7A 2F00A 2PBRA 4KQ2A 3WL6A 4B3JA 1OH5A 5JC1A 3GLGA 1SXJB 3JAKA 3AF0A 2FE1A 1K8RA 2NYUA 4J9VA 4ETNA <