2YVUA

Crystal structure of ape1195
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
KCIEKGIVVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEPPENPQLVLDTESNTIEHNVSYLYSLVKAVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of APE1195
rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
total genus 71
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yvuA00
3LXXA 2Q3MA 1GDDA 2YWEA 2YOGA 2NO6A 4JZKA 4JMPA 4LJ7A 3K70C 1Z5ZA 4L4UA 4GNKA 4Q18A 1DVRA 2BM1A 5CDFA 2FFQA 1ZBDA 2JLUA 1QG2A 1Z07A 3T35A 4TMVA 4MDFA 4KCGA 2QN6A 4Q9IA 2FNAA 5AR1A 4ZDJA 2IT1A 2ZRLA 2ZAMA 3AP1A 1E2DA 1Z3IX 5F2EA 2ZITA 3LBIA 3AVWA 2EW1A 2ZS7A 3X1ZA 1Z0JA 3ZD7A 3WBKA 4DIDA 4Q19A 1UF9A 1DAHA 4ERNA 1JR6A 1X86B 3BB1A 2GEUA 2NQ2C 2QM8A 1M74A 2O52A 1XMIA 1JQLB 2H17A 1LV7A 2AD1A 2TMKA 4MGYR 2PLFA 721PA 5F98A 4DXAA 2WM9B 3S1AB 3IKJA 2G83A 4JS0A 5E4FA 1D2MA 1NJFA 1JAHA 3IUYA 3K53A 4FCTA 3DDCA 3FFAA 1CJKC 1N5IA 2BCJQ 4BUJA 1T0JB 3T1QA 2JDID 2VTKA 2CJWA 3B7GA 2F9LA 5BXQC 4KSCA 1H8EA 1HQYE 1N5KA 2ASEA 2DWPA 2GBLA 4A92A 2WHXA 3BAFA 2QE7D 1M2OB 4G5OA 4UNPA 3AF1A 5CITA 2LKDA 2KBFA 4XJXA 3K0AB 2A7QA 2BMFA 4OQMA 5CM8B 2YOFA 3QF4B 1OYYA 4A0RA 1BOFA 2FSGA 5CB6A 2QPTA 5FI0B 3BB4A 3C14C 1KNQA 1P5ZB 3QKSA 2ATXA 3VX3A 4FMBB 4MH0R 3UKDA 2HT1A 1ZD8A 2QG6A 3FE2A 2FFBA 1UBCA 4LBZA 1L7VC 2DBYA 1UKZA 4UNSA 4Z8XA 3I8SA 3FKSD 6Q21A 2CLDX 2ZJZA 3X1XA 4LGMA 5E7IA 1N6HA 1VG0B 2PZGA 2RH5A 4GOKA 4ITRC 4XD7A 4DSNA 1W4BA 4CW7A 3D31A 1KO8A 1NN5A 3CWQA 3DVLA 1G8YA 3VNVA 1OXVA 2Q9CA 2W6JA 2EFHB 4J0QA 2IS6A 2ODEA 2ZI7A 4FIDA 4Q9LA 1G41A 2QSYA 2RHDA 5BQ5A 4C0KA 4PO1A 5KDOA 1E1QA 1OPXA 1KYIA 2ZU0C 2P6RA 1T91A 1K8RA 2C2HA 4PSKA 3WP0A 1VPLA 2NIPA 1Q20A 4F91B 2W83A 2ONJA 1A82A 4JJKA 5FTKA 1U98A 3TMKA 4POAA 2ZXUA 1ZP6A 4JBXA 1G1MA 2A2ZA 2QTFA 1N2CE 1NN1A 4GZMA 3WNCA 4BASA 1ESNA 1TEVA 4B2IA 1GRQA 4Q4LA 2PH1A 1FNMA 1YZKA 2I3BA 2IYYA 2VHQA 2V6IA 1DOAA 1PV4A 1VCOA 1ZU4A 3KJGA 2H18A 4A2WA 4OHYA 3NDPA 3T1OA 2Q9AA 2WWGA 1S4QA 4CEHB 1CTQA 1JR3A 3T5DA 1WF3A 1AKEA 3K0EA 4WZBE 3EPLA 2QQ0A 2ZUCA 4TQAA 2C8VA 3DM5A 5AJYA 5FOVA 4HZUB 1WA5A 4URYR 4XWOA 1ELOA 1M6NA 5AJVB 2IWHA 2AK2A 4ARZB 1U90A 2BMEA 3RAPR 3X2SA 3TGPA 1RE0A 3B8HA 4L9WA 4X8MA 1ZIOA 5KSPA 2O8DB 5DI9A 3ETLA 4XIGS 3HJNA 1RVDA 1IXSB 2KSQA 3NEJA 2QMOA 4RJLA 2B8TA 3GLFB 5GJCA 4A82A 2VSXA 4PSVA 2NO0A 1NVVR 3DM9B 4DT1B 4YXWA 4ESHA 3NVAA 3U3MA 5EE0A 2J87A 5EP3A 2VYFA 1RJ9B 2ODWA 2XGJA 5EE1A 4F7WA 1ZNWA 4WW0A 3TSOA 2GTPA 3SHWA 3CRRA 3K9NA 2ZPTX 3H0KA 4MKGA 2GCNA 4A8JB 1QHIA 4LJ8A 1R8QA 1GKYA 1W36D 2O8BA 1DO0A 1HEIA 4NCKA 1F2UB 2ZE7A 1E4YA 4XVUA 1Q22A 1YE8A 1SHZA 3GLHB 4NE2A 1II8A 3GLIA 2G0NA 1HUQA 1P9WA 2V3CC 4QHSA 3TW8B 1ETUA 3K0CC 4URXR 3D7MA 3BXZA 4JJZA 3W6OA 4GOJA 2BOVA 3WBJA 5A5GA 4N1AA 2GWHA 3TSWA 3GLIB 3ZVMA 3GCGA 4YC7A 2PT7A 3IIKA 4XTCS 3A6PC 4B76A 1P75A 5B64A 3Q3JB 5CK4A 1U81A 1GIAA 2QM7A 3MUFA 5IHPA 2F3TA 2X8AA 4KV9A 2Z4SA 5J40A 2R6FA 3SEAA 3K09C 3G82C 1QBKC 5JSZA 3R7WA 3AVPA 1H8ED 5G53C 2H8KA 2F3RA 3C41J 4Y0VA 2EFCB 2G88A 2GCOB 3UMSA 1FX0A 3O8RA 4NZYA 4TLDA 4E09A 3EA0A 1ZD1A 3TKLA 3RDPA 3RC3A 4TYWA 4OL0A 5JSZB 3UXMA 2HT6A 2LCFA 2RKOA 2ZRDA 3EARA 2G0TA 2CVFA 3GQBA 1I2DA 4F93B 2J3EA 2GCOA 3I61A 1U8YA 1XTJA 3VTKA 1WE2A 3OHMA 4Q4JB 4RVCA 2QNRA 2MMCA 4M1YA 4R7ZA 1RKBA 1UKVY 1JQJC 1V5WA 3BD9A 1Z63A 1X3SA 2O8FB 2QP4A 4A4DA 2WSSD 1KMHB 3VFDA 1XDBA 2B7CA 3Q7QA 1T3LA 2GJ8A 4MITA 3EAQA 2NG1A 4JLJA 2FMXA 4MGZR 4TQUS 4U02A 5BN4A 3ZLJA 1R5BA 1P2TA 1S96A 1LNZA 3T61A 2O8FA 2F7SA 3CNLA 1T4GA 1TAGA 2XZOA 5G40A 3O47A 4FW9A 2OAQ1 2DFKB 2JJ1A 4TLEA 3PXGA 4Q02A 1N0VC 2DR3A 2V1XA 4PHTA 5CYPA 1FW6A 2KI5A 1S0UA 3RSOA 4MGIR 3O8CA 3SFZA 4S2EA 1U94A 2KJQA 1F48A 1AS3A 2WAYA 5TXGA 4RZ2A 4OI2A 1G8FA 4RD4A 3AVQA 4PZLA 3DKPA 5TY0A 1SHKA 3DHWC 3LX8A 4C7OA 4N0DA 2ZR7A 5L3SA 3QOFA 4BRUA 3QJYA 1LF0A 5K8UA 1CRQA 3GFOA 2ZR0A 1A2KC 3OZXA 1XXHA 1XD9A 3SHFA 4BLSA 4JLNA 1SKYB 3OF5A 4PPNA 1E2QA 1GRRA 5C18A 221PA 1G8HA 4W5HA 1KI2A 1SVKA 1XEWY 2EVWX 3AVVA 1G7RA 1KI6A 2ZRNA 1OHHA 3UMRA 3HU2A 3A1VA 1OFTA 3BS4A 3KDSE 3VR5A 4LYHA 4Q21A 1Z6AA 3LD9A 2IYQA 1CS4C 4QXAA 1ZNYA 5EXXA 4EUNA 4PXAA 5CK5A 3LQRA 1GILA 4ON9A 4TTPA 2WTUA 1ZM3A 1EFRA 1R0ZA 3AUXA 2WMOB 3GLIE 1YR9A 4A1FA 1D9ZA 2G1JA 2IYXA 3P4YA 4GBMA 1A2BA 1FNNA 4KVAA 3U7FB 3W5JA 2CMKA 2ODNA 4KI0A 4DEYA 1X8JA 3M1IA 2PT5A 4HB4A 3AVUA 3CZPA 5JRZA 5HZHA 1W4RA 1KY2A 2CXXA 1FP6A 1QZXA 4QGHA 2OCPA 5JI2E 4RD0A 2ZRGA 2XEXA 2PL3A 3TAUA 2ZM5A 4WZ6A 4WIAA 5AUQA 2WJHA 4Q00A 1QRAA 4Y0AA 1XJQA 2OT3B 1NMXA 1U8ZA 1R8SA 3QBVA 4FN5A 4Q4HB 1OXSC 1XMSA 3R8CA 3AGQA 5L3QA 2EYQA 4HZUA 1IJEA 1TQDA 3RSLA 1W0KA 3JZMA 1E2IA 2JJ2A 1EFUA 2WSMA 4IDQA 4I99A 4TZ6A 4RSGA 3IPYA 3KTAB 4BECA 3PR1A 3V9PA 2OLKA 1FQKA 2QTVB 3KXLA 4HB3A 4DCTA 2ZROA 1ZM2A 821PA 5A0FA 3EA5A 3FKSA 2ZRPA 3IIMA 3RVBA 4YMSA 3B9QA 3SS8A 4EKDA 3P20A 3NDBB 1E2GA 3T34A 4FWIB 5DNYB 1S1CA 5CLQA 3WNDA 1AS2A 1VHTA 2GF9A 3TK1A 5JWRA 3ADCA 3W3AA 1GVNB 4Q5IA 2GCPA 4I81A 3EASA 3SOPA 2QT1A 2D4HA 1N6KA 1UM8A 2WJYA 4Q4AA 1G291 3ZZTA 1NVXQ 1KO7A 4EPXA 4XH9B 1XU4A 5H68A 1E6CA 2A5YB 3CX6A 3EZ2A 2J5XA 1MT0A 2Z0MA 4V0NA 4YMTA 2HYDA 3HDTA 4LY6A 1ZMXA 1MO5A 3H84A 5EJEA 1BMFA 5IRCD 1QF9A 1RRGA 1P73A 3VKWA 2XNDA 3W8RA 3B1XA 1Z22A 3KX2A 3RNLA 4M1SA 5F9HA 3OFND 4P4TA 2IF2A 2XAUA 4MRPA 1W0JA 4AK9A 3LH5A 2W6JD 4URZR 5FTLA 4OYHA 4PHFA 3ONWA 1XTIA 3FTQA 1FL9A 3KB1A 4Q1DA 2BBSA 1F60A 1E1QD 3QKSB 1TF7A 4S35A 4ZI3A 3QEJA 1KKLA 4BFYA 4BZXA 4JT4A 4PC1A 2JLWA 4FINA 4MRRA 4UXHA 3CR7A 3FMFA 1R5NA 3U5ZB 2PJRA 4KFUA 1TMKA 4WOPA 3T15A 1BH2A 1JJVA 3DMNA 2JGNA 2RGNC 4P4UA 1LF5A 2A5DA 2CHQA 1HYQA 3O8DA 4W7SA 2FSFA 3LA6A 1YR7A 3GFPA 2CCJA 4TLBA 3QEOA 1JJ7A 3AB3A 1JBKA 2GEVA 2Z4RA 1XTSA 2DHRA 3ASZA 4P0TA 1MO4A 2HV8A 4BFXA 1OH7A 2J0UA 2MSDB 1KAOA 1P2VA 3B1WA 1NSTA 2XB4A 3SQWA 3BGWA 3SYKA 2DFNA 2F9MA 2FOLA 4LHYA 5DN6D 2WV9A 3FYHA 2JIZD 4M9ZA 4ACAA 2DFLA 3HPQA 4MUAA 3BJIC 1KY3A 2FG5A 2CL7X 1EFTA 1Z06A 2CVHA 3NEYA 3BH7A 3AVYA 5FTMA 2ZJ5A 5GJBA 2G6BA 1VMAA 1KIMA 2D3WA 5DISB 3THXB 3BERA 1AJEA 4XSGA 2DFTA 2K5UA 2YVUA 3BH0A 2QY9A 1CU1A 3GEIA 1KHTA 2V7QA 4KBGA 2GRJA 3EWSA 5KSYA 4KJZA 4L5BA 4JVMA 1OH6A 3AGPA 1ZUNB 2VP5A 2QORA 1M7BA 3QXHA 1LFDB 5FTNA 1Z8FA 4JYBA 4TYQA 1T3SA 2X2FA 3SU8A 2BEJA 1N6IA 5KPJA 5GADl 2ZJYA 4B6FA 4LHVA 1IOZA 4KSBA 3PEVA 1XTRA 3BFVA 2GBLC 3QY0A 2ZTSA 4V0MA 4URVR 3IHWA 1OLOA 2R8RA 3KFXA 3IGFA 4KITB 4U00A 1TPZA 4HDOB 1NMYA 1NRJB 1OIVA 5JHGB 2W2XA 4EPVA 3IBGA 4NYJQ 2GAAA 1U99A 1JPNA 1CJTC 4O2LA 1P9RA 4XD7D 1I4DD 3KXIA 4CT4B 1W44A 5AUNB 4XWKA 3TAHA 2F55A 3U61B 2FN4A 3H86A 3CR8A 1I4LD 4MRVA 4D4MA 4RFVA 1AN0A 3VHXA 2OV2A 2QGZA 4XSHA 1JXMA 2HCBA 4PANA 1U9IC 4DDWA 3TUJC 5KTYA 2QI9C 2Z43A 2N42A 3BRWD 4IDNA 4PHHA 1IY2A 2ORVA 1DEKA 2J9RA 3A4MA 3QBTA 4LOAA 4LV8B 3SBEA 4DCVA 1YZUA 3HP1A 3IILA 1BIFA 1YQTA 1AA9A 4WVFA 5HE9A 3QVUA 2FFAA 4XVRA 3SQXA 1ZJ6A 1L4UA 2MSEB 3LY5A 1WCV1 1Z6YA 1ZNZA 3A4LA 3K0FA 3KZ1E 1N5LA 2CHGA 2WKPA 1XPRA 1NVWQ 2GEDA 1TL7C 3AF3A 3GJ4A 1OB2A 2CEAA 2NO7A 3U4QA 1E0AA 3W5IA 3U2QA 3OIWA 4LI0A 4RFSA 1UEJA 1P2SA 2ZSDA 2A78A 2IEYA 3KB2A 3CX7A 4I4LA 4HAVA 1IN7A 1R10A 2Q6TA 5EE9A 4O0MA 2V6JA 1DAMA 4C0SA 2WPDD 1Z0KA 4JLOA 2IUTA 3C4JA 1MOZA 4I1OA 5EXPA 4CF7A 4NCNA 1E9AA 2MMGA 5DH9A 5J4YA 3THYB 3FMIA 3TLXA 3WNBA 4EFLA 4LX0A 2IS1A 1VYVA 4TN1A 1AKYA 4XVQA 4QM6A 4KFTA 3W6NA 1TTTA 4PSAA 2OFWA 2VP0A 3IDQA 2AWOA 1GSIA 2J7PD 4QOSA 3TW4A 2G9NA 3PJRA 2XTNA 1W4AA 4GI7A 1OKKD 4KBFA 2C98A 2GZHA 3OAAA 121PA 1UBEA 2ZSAA 2W6ID 3OIVA 5IT5A 1AZTA 4MYUA 5GJWC 1XD2A 4XOIA 3RABA 4C0QC 2C9CA 1BYIA 5H1YA 4G5QA 3QG5A 1YZQA 1Z2AA 5SZJA 3VQTA 3V4FA 3CH5A 4Z1MD 4NDZA 4FCWA 4V0OA 1J90A 4US2R 1NG1A 3R7WB 1I2MA 3HU3A 4KODA 4ZO4A 2BMJA 1TQ4A 2DWOA 4M21A 4EPWA 4QJ4A 2ZYVX 5F9FA 1GL7A 1S9HA 4OK3A 1KNXA 2O8CB 4P4SB 1UKEA 4YMWA 1XEXA 4AKHA 4D0GA 3KQKA 4DLZA 2QSZA 4NKRA 1KSHA 2BCGY 1HE1C 2AK3A 3QF4A 3B82A 3WRXC 2WSSA 4UNQA 5C2JB 1XTQA 4M8NE 3ECCA 4TLCA 4BLTA 1E79A 5BW8A 3VNUA 4QGGA 1D2EA 1R5OA 2EWWA 2R6CA 1OB5A 4A2PA 4M1KA 2XJ4A 4LHZA 1EXMA 1KI6B 2VPPA 2YHSA 4P32A 4LDJA 2J0SA 2BIFA 4MKIA 1GITA 1QDEA 2UZ3A 4BFUA 2CDNA 4JLVA 4M1MA 1J99A 2VLIA 5DN6A 3A8TA 2WZQA 3S1AA 3X1YA 5K8LA 4JIMA 3TUIC 1ODFA 1XX6A 4BRWA 5FBRB 4LJAA 3L8ZA 1OJLA 2WJVA 4KAXA 2NOAA 5ANRB 3AP2A 4JVNA 3SFVA 4KFRA 2WKQA 2ZJBA 3B1YA 2IXGA 4JL5A 3QPVA 3ZYCA 1FUUA 1JALA 5JJKA 4Z51A 3PEYA 4Q7KA 1CJMA 1GUAA 3CRW1 4TYPA 1A1VA 4IDHA 2IYVA 2F43A 4UJ3A 2ZR9A 3CF2A 3CNNA 3I92A 3NC1C 4Q48A 1BMFD 1OHHD 1QG4A 3QQ5A 4HLCA 1P6XA 1QVAA 4US1R 2FF7A 2YWGA 5FUWA 4TT3A 1US8A 1S8FA 3VMFA 1PLJA 4Q4HA 5FPKA 1V43A 2VBCA 3KJIA 3C15C 2DWQA 4QNMA 1D5CA 2ORIA 1E9FA 2A5GA 2YINC 3KKMA 3LAWA 3ZH9B 3SBDA 2F1JA 2WWYA 1HTWA 1D6JA 1ESMA 1JNYA 1U2RA 3K9GA 3KFVA 4CRWB 3A1TA 3WMEA 3IO3A 1UAAA 3UPUA 2OCYC 1I4TD 4LBWA 1ZIPA 2D2EA 5E3HA 1NI3A 5E7JA 2NO9A 3LW8A 1CEEA 1KI4A 3I72A 3SI7A 2CE2X 2ZE8A 3B78A 1GG2A 3QNUA 3T1VA 1OE0A 1ZNXA 2CCKA 4G3XA 1A4RA 4HLUA 1XFAA 5FBLB 1Z29A 4ASUD 1XP8A 5TMPA 4ZIRB 2G1KA 1N6PA 2RGNA 4B43A 3GLGA 5HKKA 2NO1A 5JLJA 1IN6A 2IHBA 3KKNA 4IOLA 5AUOB 5JRJA 2D7DA 4OHWA 1Z08A 1GL6A 1DPFA 4AWXA 4B48A 1LY1A 2ZRCA 1P60A 4Q9JA 3OIYA 3IHLA 4LJ4A 1NSFA 1UPTA 4RCYA 1G17A 1VCIA 1MR3F 2FSHA 2AFIE 4GMXA 1Z6TA 4A8JA 1OIXA 4C0HA 1E2NA 4GP6A 2HJVA 4YDHB 1UDWA 4YMUA 3EZ9A 3THWB 2JJ8A 4PPFA 2P6UA 3KTAA 3ZS9A 4A8JC 1CR4A 3MFYA 3PG5A 4A0GA 4AYWA 4DSOA 3K70B 3U7HB 2VA8A 4RFSB 3X1WA 4DSTA 1W36C 1CJUC 1W1WA 2RHMA 1EWQA 4YMVA 4TL9A 3DEFA 2GETA 1F3OA 4QGFA 2D62A 1DAEA 2VHCA 3VR6A 3UATA 2O8DA 3SZRA 2DYKA 4YDSA 2GZAA 3A1SA 4BPBA 2BJVA 2BHRA 2JATA 2ZEJA 1CF4A 1E9SA 3B13B 2QPOA 2FE4A 4NYJR 4DDVA 4B3CA 3CH4B 3JVVA 5F3WB 4PZYA 1MABB 4PQFA 5HCNA 2VHTA 4R2HA 2XITA 4NP6A 2CLSA 3C8UA 1FX0B 2WJGA 4Q1FA 2A30A 1G4UR 4PAMA 4HB2A 1MV5A 4DJTA 2HCJB 3NXSA 1G3MA 5IF9A 1J2JA 1NY5A 1U0HC 2QRNA 4OQFA 4DLRA 3VKGA 5D3MB 3GJ8A 2R6AA 4TYNA 2C9OA 2O8BB 1YKSA 1Z0IA 2Z83A 4FMCB 4US0R 1TF2A 1P3JA 2XSZA 2AWNA 2OCAA 1KSJA 2X1VA 1P62B 1ZU5A 3CF6R 5H8WA 2EWVA 1IN4A 1E94E 3GJ6A 3WXMA 1XNJA 1CXZA 1CLUA 2E9SA 3EX7C 4LYJA 4FXPA 1Z0DA 2ERYA 4ZDIA 5LDDC 1JECA 2W0SA 3GJXC 1R7RA 2DPXA 2W58A 2UVQA 2WJIA 4HI0E 4LJ5A 4AI6A 2FSIA 1IBRA 1TQ6A 4OQLA 5CIWA 2QEQA 2WWWA 2C99A 2HLDD 3CRVA 2ECKA 4XWAA 1NG9A 3RRMA 1W4CA 5DO9A 4LJ9A 3GLHE 3SNHA 4LJ6A 3MAAC 2XOKA 1VG8A 5TARA 1OFIA 2GZDA 1Y3AA 2A5FA 1NVUQ 4OJQA 1KDRA 2E87A 1FP7A 1WB9A 1W5TA 1TNDA 1Z0FA 4L9SA 2RGBA 4LHWA 5E95A 4M2LA 2F1RA 2GNOA 5G41A 1E3MA 1DAIA 2PX0A 4C7OB 3WHKA 3B2EA 1GWNA 1E4VA 4BFZA 1R6BX 5L3SB 3X1DA 5KDDA 2O8EA 1P72A 1VDZA 4Q1AA 4P31A 4CIDA 4EPRA 2IUSA 4M53A 5L3VA 4JVSB 1G5PA 4B3FX 5UKDA 4G5SA 2AR7A 1PLLA 4QC2A 3EG5A 3GLGE 4IJMA 2I4IA 4KO8A 3AQ4A 4F38A 4JL6A 1GKIA 3LVQE 1PUJA 5CYOA 3BFKA 4XTRA 2QROA 2R2AA 3I5XA 4QHTA 5JHHB 3FOZA 2AX4A 4JLPA 4DHEA 1G5TA 2IS2A 3BORA 2IYTA 1KO5A 3TE6A 2JJ1D 3QENA 1TEXA 3KXKA 5DYGA 3CONA 3GEEA 1Z6XA 4HLQB 4DKXA 1Z83A 3CB4A 2C77A 1C9KA 3CPHA 1KSFX 3QPUA 4B33A 5KO2A 4TL7A 4TQ9A 2OLJA 3QKUA 2GF0A 3ZD6A 1SULA 1T3HA 1NLZA 2GVDC 3NBFA 2WOJA 1SVWA 1ZINA 2PZFA 1ZUHA 3MSXA 4LV6A 2R9VA 5B2ZA 2D2FA 1NKSA 3IIJA 1N6OA 1Z2CA 3U3RA 1E9BA 4CEHA 4LYFA 5M04A 1CIPA 3RANA 3GLFE 4HDQB 3GMTA 1RYHA 2IL1A 2PLRA 1KI1A 1XJCA 1YZNA 3W6PA 4DSUA 2AXPA 2VP4A 4L15A 2P0EA 5E7MA 3U60B 1C1YA 3PUVA 3UWOA 3NKVA 4PC7A 3W3ZB 2GA8A 4V03A 1Q0UA 2YKGA 3K1JA 4A0HA 4NCJA 5L3QB 4V0LA 2EFGA 2UKDA 4JBYA 2VF7A 4OK5A 4Q66C 4IVQA 3EC1A 5JWOA 1ONBA 1OT3A 1F2TB 3ADKA 1X1RA 3GFTA 4JBWA 2W00A 4D6PA 1JXOA 3HPRA 1ZC4A 3B85A 5HZKA 2IWRA 4DWJA 3T12A 5LB4A 4TMTA 5HTKA 5KNCA 2G3YA 1KTVA 5FL7A 2ANBA 3KKOA 5JCPA 1IY1A 2QZ4A 5JWHA 3T06B 4N3NA 3I8XA 2NPFA 3U4QB 2Z6VA 4H1VA 4LCBA 2NTYC 3GLHA 2JIZA 1AK2A 1SXJE 3Q72A 1A7JA 2QAJA 3L2OB 3K09A 3SJAA 2OBMA 2HLDA 3LQQA 4X8LA 5AUPB 4NYIR 2FFHA 1UJ2A 2HJGA 4LZZA 4ZCMA 3GD7A 2FU5C 3PITA 2RCNA 3ND8A 2JJ2D 3AH8A 4B44A 4ZPXA 3CW2A 1Q3HA 2ZSBA 2CHVA 2ZRMA 1KO4A 1KDPA 3VU9A 3NWJA 4PO8A 1UADA 2OM2A 1RRFA 5BYJA 4C0BA 3PENA 1E1RD 2ONKA 5C1BA 2IYUA 2J7PA 2V1UA 5AWFC 2B21A 4AKIA 1QHXA 4IOMA 4MRNA 1UFQA 4OHVA 3VHLB 2XJ9A 4LBVA 4K46A 4B2LA 1RIFA 3EW9A 5P21A 2CBZA 4QHYA 4UXIA 2ORWA 4OI0A 3L0PA 2YWHA 3EZ7A 2ZE6A 3ASYA 1AGRA 1LS6A 3PFIA 4QKQA 1M34E 1J8MF 2GJSA 3TR5A 2KB0A 4LV5B 4RZUA 4LC0A 2C5LA 1VYTA 4PC6A 1NLFA 1M7HA 3DPUA 2BMDA 1N0WA 2CK3D 2HUPA 4NMMA 1W7AA 1MRSA 2QT0A 4BLPA 4MDEA 2IYRA 1OYWA 3MJHA 3FPAA 1Y63A 1KDTA 4C4PA 2J0QA 1OW3B 4YQFA 1G19A 3NHBA 1VG9B 4DLVA 3WHLA 4AD8A 2VF8A 1GRNA 4AG5A 3CX8A 2ZYUX 3HWSA 1L4YA 4H1UA 3LW7A 5DGXA 1SVOA 1N6NA 1VIAA 4DDTA 1IQPA 3P1JA 2BDTA 1IXZA 3ZQ6A 4JVLA 2QRZA 1E9RA 5B57C 1RW4A 5FL7D 3ZVLA 4LHXA 4MKFA 4PX9A 1C4OA 1YVDA 2C78A 3DOFA 3ZZ0A 2A5JA 2XNSA 2OHFA 1N0UA 3SC3A 2QP3A 2LKCA 3A36A 2VEDA 4M9QA 4ZKDA 1FZQA 3EIEA 2IYSA 2WWHA 5EP4A 4FWTA 4AKEA 1RFLA 4MA4A 3M0EA 2QMUA 1FFHA 1AIPA 5KSZA 2DB3A 4YONB 2OBLA 5GVRA 4DB2A 5EQTA 2J41A 5KDLA 3PV0A 2IYWA 2BBWA 1DG1G 1N25A 1CR2A 2REXB 2RGEA 3PEWA 1OFUX 4HAZA 2C04A 1GKUB 2ZUBA 4B6EA 3TQFA 4F92B 2RGDA 3N2IA 3E70C 3ZDQA 4R2IA 2QBYB 5EXSA 2QA5A 2JAQA 4ACBA 2H7VA 3LWNA 1NBME 3OEEA 5FFMA 1KI9A 3GJ7A 1OV4A 1PZNA 3AVXA 3ZJYA 2IA5A 1GZSA 2CCGA 4RD6A 5EE5B 2GJAA 5DHFA 2JLXA 1T6NA 2IW3A 3Q8XB 3LX5A 2FH5B 4IRUB 1HY3A 3QKTA 1QHHB 2IHYA 4DLTA 2OCBA 1E32A 4FD2A 4EJSB 3MGCA 1US8B 3ZVNA 2GESA 2ZAOA 4GP7A 1ZD9A 2YZ2A 3WYAA 3BOSA 4B32A 5CDFE 1WBBA 4HAXA 3KUDA 1CR0A 4O2RA 3UWKA 4HLDA 4M9XA 4NCHA 5K8IA 2ATVA 4ARZA 2ZRKA 2X2EA 2ZI9A 2WVJA 5CJPA 5C46F 5FR2A 4QBFA 5FOUA 4E07A 5JI3E 2JEOA 2XOKD 3H4MA 2UZIR 3K0FB 4JLKA 4CZ2A 2XTMA 2ZVQX 1ZCAA 3LO5A 3L0OA 4AY2A 4G5GA 1DAFA 5BN5A 3NBZC 1XMVA 5JBQA 3LLUA 1W0KD 1TU4A 3UK6A 1AM4D 5KUTA 4ASUA 5CB8A 1PVOA 2VP2A 1KJWA 4CDGA 1OIWA 4HZIA 3MWLA 5J4LA 2ZI3A 1G4AE 4GRAA 3N70A 5SZHB 2YC4C 1DBSA 4PC3A 3LBHA 4OI4A 4EQ6B 4UNRA 3MWKA 2PZEA 1G6HA 2J59A 3FHCB 3Q9LA 3FFBA 1GM5A 5CIQA 3QXSA 1P2UA 2BEKA 2B8WA 3O8BA 1G7SA 2VO1A 3FGNA 5LD2B 1DS6A 1TADA 1YRBA 3B1VA 3FB4A 3QI2A 4UNNA 4WXPA 3R9WA 4WXRA 1NL3A 1SVLA 3LRPA 3BC1A 3L0SA 4A36A 3LVRE 5FOTA 3IQWA 2FZ4A 4NBSA 3UIEA 3ZS8A 2BJWA 4PZZA 3DZDA 1DTSA 3UMFA 4DLUA 2FPKA 5BN3A 2IS4A 1RRCA 2VP9A 1W36B 3CRMA 4IW3B 4TSFA 1MO6A 4II7A 4D0NA 1OSNA 3IEVA 4MRSA 3VX4A 1S9DA 2QAGA 1ZC3A 3F0TA 2CNWA 1F2UA 1G16A 5JFGA 1IY0A 4JSTA 4X8OA 1GNQA 1WXQA 1SVSA 2OAP1 1ZM9A 3RHFA 1XCPA 4UJ5A 3AKDA 1PLKA 3LNCA 4B3DA 3VAAA 4DDUA 1Z0AA 1X1SA 3EC2A 4WA7A 3QPWA 5KHOC 2ZETA 3LBNA 2GKSA 2ZRAA 3D6TB 3ZIAD 2OEPA 2JDIA 1NIPA 2FPLA 5EUMA 2VSOA 1VG1A 1KGDA 1NIJA 4FMDB 5FOXA 4QBIA 2ZRBA 4NH0A 2IYLD 4LK2A 2RGCA 4LC1A 1E98A 4M22A 2VHUA 2GDJA 4DUGA 1NBMA 4B3BA 3KJEA 1CBUA 3TIFA 3AKYA 2GJKA 4NCIA 5DIFA 5KYKA 1EESA 5DYIA 1VECA 3RRZA 5JJLA 4M0LA 4IXNA 2FX3A 5KPDA 3VR4A 1XCGB 3WMGA 2XXAB 5K8TA 2BKEA 3LDAA 5EE3A 4QJ5A 4BFWA 2AHOA 4BGDA 1R4AA 1KZ7B 5CJ2A 4HB0A 1J8YF 1SVIA 2PJZA 1KMHA 4DIEA 3L43A 4AIIA 1AS0A 1SXJD 4PHGA 3U7EB 1JR3E 4D26A 1R0XA 1ZVQA 2AKAB 1N3BA 1NKTA 2AD5A 3R9XA 1T8TA 2VRWA 2V7QD 3CUEF 4ZDWA 2ZI4A 1ZM7A 4O25A 4NL4H 1HQCA 3Q7PA 3MWJA 5JCZA 2XZLA 3E5HA 4C0AC 4GSYA 2O8CA 4Q1BA 5JJIA 2G77B 4C0LA 2P6NA 1B0UA 3U44A 2BBTA 4GZLA 1OXTA 5C4GB 2ZYWX 4ILEA 5KU1A 2F1HA 2F43B 3B9PA 2Z5FA 3Q5DA 5B30A 4TMZA 1G3UA 2Q21A 3OE7A 4D0LB 3NBXX 1YR8A 3CNOA 4M4SA 3CKLA 5IDVA 2L0XA 3PUZA 4QBHA 1N5JA 1A5TA 4OBEA 3P26A 1NJGA 1NY6A 1AQYA 2JLYA 4IDPA 1PJRA 3F3YA 3RS5A 1R0WA 4MUBA 1XF9A 3AF0A 1Q1BA 1IHUA 4QFMA 4DEXA 1YU9A 4KYUA 3OFNA 1GNPA 1KAGA 2RAPA 3V00A 1JI0A 4EDHA 4EFMA 4KVGA 2ZS9A 4Q1CA 2OUKA 2JCSA 4JLDA 4LJYA 1L8QA 3RS2A 5CLLA 2Q0HA 4Q7LA 2QU8A 2GJ9A 4RZ3A 5FPSA 2PEYA 3W34A 3TUZC 3NTUA 1NP6A 5FUVA 3AF2A 1TU3A 3BH6A 3CM0A 2HEIA 5FBQB 4WAUA 3GJ0A 2OXRA 2FJUA 2IYZA 4EFNA 2VHJA 1UBGA 4NU0A 4A9AA 4F4CA 2W0MA 2HYIC 3CF0A 1IM2A 1JR3D 4ZCLA 1NNEA 2XTZA 3B60A 1LS1A 3KL4A 5FBVB 3AVOA 4GFDA 5FPTA 1AGPA 2YC2C 1BS1A 2P5SA 5A4JA 1G3IA 3EIHA 3UG7A 2W2TA 1ZRHA 4DC9A 4IFEA 5FPHA 3GJ3A 3VKHA 4TWZA 4M1TA 3C5HA 5H70A 4JSYA 3IPXA 4O3MA 2H1LA 2QMEA 5BYKA 3SYNA 5AJXA 4DB4A 3HR7A 1E0JA 2O5VA 1BKDR 4CEIB 4LYAA 5DLQC 4UXJA 4EQ6A 1FUKA 1GOTA 1XJ0A 1II0A 3ND9A 3RRNA 3KQHA 3EIQA 4QBGB 2GHIA 4M1OA 3K0SA 1UKYA 4X8HA 3F5FA 3K9HA 3KKQA 2QGNA 4DZZA 2V4ZA 2JLSA 1OKKA 2Y8EA 3R8FA 2ZJ8A 2EU8A 1BO6A 3BFXA 2KBEA 5SZIA 4MYHA 2PMKA 2ERXA 4LSGA 2IXEA 3G0HA 1H65A 3QG1A 3RYTC 1F5NA 4MKHA 4EAQA 4AYTA 1XXHE 3E2IA 3H1TA 3VR3A 5IK2A 2I1VB 1SGWA 5EP1A 3LV8A 3PUWA 3TVDA 1TUIA 1T5IA 4C2TA 2IK8A 3AKCA 2CL0X 2J1LA 3UANA 4BEBA 2NGRA 4EIWA 2PEZA 2H92A 2O0HA 1KI8A 4MYTA 1P4SA 1SKYE 1OXXK 2O0JA 1KK2A 4LPKA 4HAYA 4GMDA 3TNFA 4WZAE 3I1FA 3U6KA 1EX7A 4GOXA 4M1WA 1RC8A 1WP9A 1QHGA 1ZM4A 2OZEA 2ZSEA 4BFSA 5SZKB 4CT5A 4QG7A 2REOA 1G3QA 4G01B 1KKMA 1MABA 2AXNA 2ZVPX 2ZJ2A 3TH5A 1DARA 4QL3A 3SYLA 3PUYA 2GXSA 3MJRA 1OH5A 2CJWB 2HXSA 4BLOA 2R65A 2ZI6A 4P33A 4W5WA 1GTVA 3REFA 2VP6A 2ZJOA 5TVKA 2WWIA 2O8EB 2A3RA 2ZUDA 1QHNA 3IQXA 4BWYA 1FMJA 2ZANA 5LBIA 1DAKA 2ZRFA 3FMOB 2KE5A 3ICQB 2VIIA 4TTRA 3DZ8A 1G20E 1YZGA 4OHXA 4BLQA 5J4HA 3SDZA 3Q85A 1E2HA 5JEDA 4G1UC 4URWR 4N0EA 3FDIA 4HUTA 2JASA 1KK0A 1U0JA 1KJYA 1SVMA 2WIBA 4TMWA 3U7GA 4PR0A 3N2EA 2QUZA 3IO5A 3THXA 3LXRA 5JS7A 3WMFA 3FWYA 2GAOA 3OEHD 3K8YA 1VKJA 4U5XA 4FCVA 3SJZA 3T5GA 5FI1B 2OE2A 4HAWA 4QJ3A 1XWIA 4TL6A 5BWMA 1E2LA 2JA1A 2N1BA 5TB5A 3WP1B 3L82B 4RD3A 1NVVQ 1XEWX 1LVGA 3CO5A 4R9UC 1VCNA 1ANKA 1RYFA 1EFCA 2ZS8A 3TQCA 3CRQA 3GP8A 4MQBA 3DOEA 2QAGC 3OESA 4WBSA 2GK6A 1XPUA 4CGZA 1UEIA 2BM0A 3QVVA 4HLUC 1NF3A 4IOKA 3ZIAA 2WMNB 3I73A 1XZPA 4URUR 3TBKA 4BFVA 4C9BA 1EFRD 4NYMR 5JECA 4DUGD 3BB3A 1G6OA 5D3QA 2Q3HA 4ZV4A 2V55B 1D2NA 5EP2A 3C5CA 2OESA 1VTKA 3P27A 4DT1A 1E2KA 4Z1MA 2FPMA 2ZQ5A 4PQYA 4IOJA 1QHHA 1E2JA 2X19A 4A2QA 4JLAA 4D4LA 1SZPA 2PCJA 5J4KA 3G5UA 1WBDA 1KDOA 2LWIA 2RMKA 3FKQA 2N46A 2NZ8A 4IKEA 5DSZA 2J46A 4OK6A 1MRNA 2IEZA 3HYRA 3AVTA 1KK3A 3KUCA 5HR5A 1F2TA 4RD2A 2E1RA 4JT2A 2ZREA 3HR8A 3ZZUA 1DAGA 3AKEA 1OXUA 4B2PA 3I4LA 1NLYA 1H8HA 3B5JA 1K6MA 2O0KA 1JEDA 2FA9A 2QENA 3NC0C 4FMCF 4QNRA 1S1MA 1XEFA 3QXJA 4DCUA 1CJVC 1P7CA 2JLZA 4IHQA 4PFSA 2IBMA 4JKYA 4JL8A 1LTQA 1T9HA 1E0SA 1XMJA 4OKSA 3GPLA 1X6VA 2AN9A 1IONA 4B3GA 4YXWD 3U3JA 4A6XA 2NZJA 3MWYW 2F6RA 3RWOA 1H8HD 1COWA 3OIUA 1W49A 1JPJA 1YZLA 3U6BA 2H57A 3W9YA 5FOSA 5FL3A 5FTJA 4RKFA 1RJ9A 1FQJA 2H5EA 2OG2A 1JAIA 3K70D 4HEJA 1GP2A 1CR1A 3BWDD 3OAAD 4Z8YA 2P65A 3KQLA 3QUSA 1M7GA 4EJSC 3F8TA 1WDTA 3PQCA 4TL8A 2IUUA 2PMDA 3C7KA 1II8B 2J45A 4IEIA 4TLAA 4AC9A 3RRYA 4YLGA 3EPHA 3THOA 1XD8A 4QRHA 1XPOA 1E2PA 4IVPA 5DE3A 5FUYA 4IDOA 1J70A 1T8UA 4Q47A 3AV0B 1FTNA 2XX3A 2OILA 1E99A 2XSZD 1NMZA 1Q1EA 2ZJAA 1O3YA 2QP9X 3TVTA 4BQSA 3OE7D 4HUQA 3KQUA 4F4IA 1MH1A 3JVUA 3Q5EA 4B75A 1IAQA 1GL9B 4LWZA 3WYFA 2VL7A 5CM9C 3QKRB 4RKEA 2XZPA 4IVRA 2PX3A 2ZE5A 2QMHA 4HUQB 4K8OA 3FHTA 1XD2B 1ZAKA 1VCMA 1F6BA 2J7KA 3DMDA 2QTHA 2DCUA 3TRFA 3WRYC 2BC9A 4V0ME 3QKRA 1SXJB 4UKDA 2BBOA 1UBFA 3QIAA 4PC2A 1KI7A 2QPAA 3H2YA 4V02A 1TX4B 3K0AA 3K9LA 5DI3A 3WYGA 1Q57A 3B1ZA 2QL6A 4R71A 2PCLA 3NBYC 1EK0A 1HURA 4Q4JA 1W5SA 4RCZA 3QF7A 1CRPA 2ZRJA 3L8YA 1M1YE 4P4SA 5DI3B 2WAXA 3N5CA 3DO6A 1LW7A 2XXAA 1TF5A 5JEEA 1E9CA 2C96A 1KO1A 3R9IA 5GJVC 2YJTD 4B74A 3D8BA 3PVSA 5FH9A 1G5RA 2GXUA 2JLRA 3A37A 2ZU6A 1K5DA 1B23P 4C2UA 4CYMA 4HDCA 2R44A 4CEJB 3QXXA 4D4KA 1KOFA 1G21E 4EPTA 1Q1QA 2R62A 3P4XA 2BWJA 1DELA 3LFUA 1EGAA 4A0FA 2DY1A 3FVQA 1KSGA 5LPNA 5KNBA 1EG7A 1NN3A 4KU4A 4CEJA 1YJ5A 2WIAA 2WPDA 3HYTA 3GEHA 2JLVA 5C4MA 2OFXA 3FHOA 1U0LA 2C9YA 3MLEA 5AJZA 3CWZA 3QXCA 2CE7A 4ZKEA 3MG9A 3U44B 4OHZA 3CIOA 2QBYA 1G7CA 3DKVA 3QE0A 4ZCIA 4BE7B 1GAJA 4DLWA 4Q03A 5IK2D 2GXAA 2XNDD 4JLBA 3OEED 4AYXA 1RPZA 4M9SA 3RS0A 4ZI2A 2SHKA 5TDHA 2H16A 2WWXA 3NIBA 1COWD 4W5JA 1N6RA 5HE8A 2FGKA 2P2LA 3MMPA 1TQ2A 2ZRIA 4Q7MB 5L8VA 1EWRA 1OH8A 3PEUA 2VSFA 2CL6X 2YWFA 2YOHA 3NG1A 2NPIA 5EZ6B 4B73A 4B47A 4TTQA 5TV2A 4DCSA 1XCMA 2WOOA 1RZ3A 1II9A 3WY9A 2WJJA 4DRZA 4B71A 3A1WA 3MD0A 2F1IA 4HATA 2MSCB 2NMVA 2EFDB 2WWFA 1PUIA 3K0CA 1HH4A 1FMLA 3ICEA 1HE8B 4ZIRA 4TYYA 4JLMA 4AURA 3GLGB 3NH9A 4NYIQ 1DE0A 2YV5A 1XTKA 3AM1A 4B35A 5ELXA 1G8PA 5KNDA 4CVNA 3SR0A 3EPKA 1BYUA 3TR0A 4F4JA 4Q1EA 4L8GA 1JEEA 2RGGA 1R0YA 2EFEB 3RS3A 3A58B 4Z54A 4PAQA 5J5CA 1HT2E 3QSYA 4BLRA 5G3YA 1KJZA 3THWA 1SKQA 4MYCA 4HAUA 4AKGA 2Q9BA 1S3SA 1K5GA 1U9IA 4IXMA 4TT3D 2IX3A 4A15A 1DADA 3OEHA 4KHZA 1IN8A 2ANCA 3W90A 4PO9A 4BEJA 2OSBA 1FPMA 2EYUA 4I1VA 4GL2A 1YRAA 3DL0A 1E69A 3I5YA 2CLCX 3KJHA 2IF0A 5FR1A 3AUYA 521PA 4C3ZA 1R2QA 3VU9B 1LB1B 2AL7A 4D81A 4GPTA 5KOYA 4TSFD 1O87A 4NTZA 3TJZA 5HPYB 4DLSA 4IEEA 4IFBA 1YR6A 3A4NA 1WRBA 1S2MA 4OJKA 4DCNA 1W2HA 1YHNA 4KYIB 3GLFA 4KFSA 4ESVA 1G64A 2GXQA 1ZCBA 1VHLA 4FI3C 2ZSFA 1EFHA 2BV3A 1VYUA 2D7CA 4LUCA 4RD1A 2JLQA 1XRJA 5KSOA 4Q4AB 1XB2A 2B6HA 1E2MA 3LLMA 4C0JA 5D3MA 1Q1ZA 3KKPA 4QGAA 1MKYA 4NONA 4U7DA 3BK7A 2J0VA 3EZ6A 1GFIA 2PBRA 1EX6A 4NYMQ 5L3RA 4Q7JB 2VH5R 2D74A 1T0HB 4KLZA 2D06A 3A1UA 1ZUIA 2GK7A 5FBWB 3D3QA 3NHAA 2W6IA 4D4JA 1Q44A 1MO3A 1ZYUA 1NBMD 2OBNA 1E0KA 3SJBA 4HYYA 5FPYA 3EZFA 1IXRC 3PUXA 621PA 4QM7A 4BFTA 1HT1E 4OQNA 4BZPA 4A6PA 3VR2A 1E96A 3IBYA 1CP2A 4G0NA 5AJWA 2RGAA 1KK1A 5EXTA 3REGA 1JB1A 4LPSA 1CKEA 4DLYA 4E5UA 2WKRA 4PPGA 1WMSA 1G3RA 2QE7A 1P61B 2OFOA 2P67A 3MCAA 2IXFA 3J81k 3PCRB 4E22A 2ZRHA 2XB2A 4I1SA 1G8GA 3CPJB 2FEMA 3RS4A 421PA 4TMKA 1IN5A 1SXJA 5HKKD 1NN0A 4PAOA 1SQ5A 4D2IA 5EUQB 1VIYA 1XEXB 3BIFA 3RWMB 2CK3A 2WICA 3CPEA 2V8OA 3M4YA 4JKIA 4TMXA 3V4RA 2FV8A 2FDCA 5LB2A 1SXJC 4DBLC 1KZGB 1AQUA 1E79D 4R98A 5DHAA 1WQ1R 1FOEB 2J0UB 2ZYTX 4P3YA 5GVSA 2EQBA 1CULC 3GJ5A 3AEZA 5B58C 4UQOA 3U3KA 2IC5A 3L0IB 5EZ5A 3SJCA 2RB4A 4V0KA 3JZAA 5J4VA 2R6DA 1XXHB 1X8LA 3PIRA 4RY2A 5G3ZA 2I1QA 1FTSA 2VQSA 1W48A 4OQXA 4LBYA 2C95A 5HCIA 3EXAA 4H9GA 1KMQA 4KXFB 2HXYA 4DVGA 2FWRA 3BE4A 3ZGXA 1XZQA 2AFHE 3I62A 2P3SA 1L2TA 5FUXA 3IEUA 2HF9A 1W47A 2YNMA 4DLXA 3M6AA 5J47A 1Z47A 4D25A 3AP3A 3C16C 3AF4A 3ADDA 4KLNA 2AKYA 4Q01A 4PPQA 1G18A 4EPYA 5FOWA 2FZLA 2W2VA 4RZXA 1UDXA 4D80A 1QHYA 1E1RA 2C03A 4NHOA 4OI1A 1Z28A 1QVRA 3FMPB 3HU1A 4HSEA 1N6LA 4LRWA 2WBLC 4G5RA 3UG6A 4BZQA 1GNRA 4EJSA 5AK0A 3R20A 1QHSA 4TZ0A 5JS8A 2QQEA 1X8KA 4GT1A 5JMTA 4B3XA 2P5TB 3KQNA 1YZTA 4AG6A 1IJFA 3W8NA 1G7TA 2ODBA 3T1TA 8OHMA 3CBQA 3ADBA 1OF1A 1Q12A 1W2GA 2ZIAA 4JYCA 1Z6GA 3RS7A 3EPJA 3CZQA 2OXCA 1KI3A 2ZI5A 3P32A 1W0JD 4I1UA 4C30A 3SE0A 3BBPA 2REBA 5JZVA 1G9XA 4Q9HA 4K81B 3ZVRA 1DG3A 1Q21A 3ZQJA 1S3GA 1D9XA 2V54A 3MRSA 1J7KA 3THYA 1OFHA 3TSZA 5LD2C 2R6GA 1E9EA 2BKUA 4Q9KA 1W46A 4FMDF 2BVNA 4L16A 2YYZA 2X77A 2A9KA 2FEOA 4GDFA 4MGKR 3CLVA 4D82A 1T5LA 2HDNB 4ABYA 1TUEA 2KWIA 2B92A 4CEIA 4ZDKA 1HA3A 2V9PA 4NPHA 3NH6A 4B34A 2RGXA 1E2FA 2B7BA 1RRPA 3SN6A 1HV8A 4PQRA 1U8AA 4W9MC 1P9NA 3B6EA 4E03A 1AZSC 1ZW6A 3U3OA 2OO7A 1E2EA 3EWAA 3E1SA 3I32A 2QAGB 1M8PA 1DO2A 4PTLA 2GVZC 3VR1A 2CNWD 1D8TA 1E9DA 2HF8A 2GILA 1Q3TA 3RLFA 3RC8A 1XBTA 2Q3FA 2FGJA 3I3SR
chains in the Genus database with same CATH superfamily
1H0KA 4DRXB 2GPSA 2YJZA 3DHNA 1EHIA 5AI6A 4DMMA 3NTOA 4EMUA 2M6LA 4JZKA 3FA2A 2NACA 4ZJUA 4RIHA 3TTWA 3DW3X 5FX2A 4NMXB 4DLPA 4RXMA 1H1TA 3NS7A 2BM1A 3DPSA 3QH4A 1JU9A 2FFQA 2NADA 3DLCA 3V1NA 1QG2A 2JLUA 3T35A 4M0KA 2X3YA 5AR1A 1GGJA 1I2ZA 3AP1A 5BOVA 3UM9A 5I9NA 1Z3IX 1IMJA 2ZITA 5KREA 4JKOA 2EW1A 1H66A 2PQ6A 4J4TA 3WBKA 4AN1A 1KQFA 3ZDAA 4MEJA 4QOIA 3HCAA 3RYHA 1C3EA 1PFWA 2EOAA 3KKZA 1PX0A 3HA2A 1KOGA 1RAIA 2ZIZA 2UVPA 3BB1A 3JQ9C 4P3KA 2O23A 2V9CA 5EWLB 4BLVA 3I09A 1LV7A 4MGYR 2TMKA 2J6IA 3R3HA 3F74A 4WZBB 3ZHOA 4A26A 721PA 4INPA 1HSZA 3I6ZA 1OFUA 5IBQA 4DXAA 1U9JA 4LDZA 5IAJA 1N1EA 3UOAB 1AMNA 3E0XA 4YR9A 1JAHA 3F5SA 5JH7F 1J8DA 2FPWA 3DDCA 5FAXA 1U8UA 4OHRA 4AZ3A 4DFDA 1BHJA 2BCJQ 3WWCA 4JOCA 2OHOA 4AMYA 3WGVA 4Z0PA 2OCKA 1NXVA 5E4YA 5TX7A 4OMUA 1XA4A 3T1QA 4BNJA 2CJWA 4HWTA 4YUAA 4R1TA 5D5QA 1PE0A 4DY6A 1H8EA 1TJPB 3DXFA 2GBLA 3W7AA 3LUGA 3F6SA 4A92A 2IBTA 2ZLBA 1M2OB 4UNPA 3RREA 3AF1A 4AZ0A 2LKDA 2KBFA 2QK4A 4FX2A 4S0ZA 4XJXA 2A7QA 3K1ZA 1QFSA 4OSPA 3ZCRA 5TJHA 2JANA 1Z6PA 3QF4B 2YZ7A 3ZHTA 1Y5LA 3WLMA 4RKQA 1FFBA 2QRJA 3AFMA 4A0RA 5BQFA 4HG2A 4ZFNA 1WABA 1BXRA 2ZQZA 5FI0B 1DJLA 4UU7A 4GX5A 1W96A 2UUOA 3BB4A 3UWMA 3C14C 4HNUA 3GXBA 2DBZA 2DQYA 2RC5A 1YZFA 3NALA 4CXMA 2JZCA 2J4DA 2VPYA 3DEZA 1P6QA 4GGOA 4LDRA 3UJCA 1X7DA 1P3DA 3Q3VA 2QG6A 2HJSA 4DREA 2PVPA 4PS1A 4WKPA 1UBCA 2NQ8A 3KP1A 3H8JA 3I8SA 4QUAA 5JXJA 1ONPA 3JQBA 4I8XA 3GMDA 1VSVA 5D00A 1N2HA 1VG0B 2WTBA 3CLKA 2BFBB 1I1QB 1W4BA 3FRHA 4B09A 1XHLA 4E08A 1NN5A 2PMCA 1EEHA 4UBKA 1NVKA 3AY0A 4EM6A 1N9GA 3I6QA 1UAGA 1XYYA 4XB6B 3EIWA 2A9FA 2EFHB 1NQWA 4JELA 3O0TA 2C9BA 1FDWA 2ODEA 3E4DA 4FIDA 2C8JA 4QAJA 2BPOA 3B89A 3WNQA 2RHDA 5BQ5A 4TV9A 2I66A 2QRGA 3WB1A 5IZCC 5IJWA 3LCVB 1KYIA 3D6VA 1AUPA 3UXEA 1B00A 2P6RA 2HF7A 1T91A 2VWGA 4WOJA 3WP0A 2NIPA 1Q20A 2Q46A 1JR4A 2O48X 1W0CA 1FMTA 1UQRA 1A82A 5FA8A 4X44A 4LQLA 1ESZA 3LPLA 5FTKA 3JCZA 1K2WA 5I8WA 2XVXA 2F00A 4JV5B 1VJ5A 2Z8XA 1F20A 1N2CE 2YDYA 4M0UA 3WNCA 2BRUA 2PD3A 3FDJA 4N3AA 1MC4A 1QH1B 2RB5A 4H2DA 2TRSB 3WE7A 1TEVA 5DK6A 3FCUB 1GRQA 5ALOA 3O75A 4NX2A 4B6GA 2GZ2A 1INLA 3EBLA 4L6CA 2FQQA 3K9BA 2HK7A 2HSJA 1VCOA 4A2WA 4H77A 2V7BA 2R97A 1K0UA 1EE9A 1VXOA 1S4QA 1CTQA 4H17A 1MXHA 5IAOA 5CCDA 3SK0A 1UXKA 1IEXA 2JCXA 3NCHA 1SCDA 2OUIA 1AKEA 1UWLA 2WJZB 4WZBE 1Y4UA 4W8HA 4X61A 3DE4X 1U80A 4N40A 4ZO9A 3A1EA 4Q3NA 4HZUB 1KARA 2OV4A 5DDIP 1HDOA 2C20A 4XB2A 5ALWA 4URYR 2FSVC 4D42A 4EUEA 2WILA 1M6NA 4QQ8A 3NHWA 3LDUA 1QONA 4ARZB 3CBGA 1M75A 1U90A 3RAPR 3TIIA 3X2SA 4PX5A 3TGPA 3AK4A 5KINB 5ALLA 1QIIA 2QTLA 1J97A 1JFRA 3BIWA 5KJFA 1FU8A 3U56A 3V8EA 4XIGS 3STUA 3SVZA 1QO7A 2AJBA 1IXSB 2VTVA 3JWPA 4GC9A 2JHAA 1P1FA 4K7JA 1L7DA 3NEJA 3KOXA 3GLFB 3W3AH 3O38A 5GJCA 3DAHA 4FZVA 4PSVA 4O4JA 3QVGA 4Y1RB 1SBYA 5LUAA 3DM9B 3L41A 4YXWA 3T7TA 4F46A 2E4YA 4MR9B 4PW0A 5K0LA 4ONEA 1P45A 3NVAA 4UEKA 4UMFA 2ONZA 2WDPA 5EE0A 2C29D 5AVYA 5IVHA 4HN9A 3FW1A 2A1UB 4JI6B 1U1CA 4HMPA 5CW1A 1J0BA 5D1HA 2AN1A 2BFAA 1U7ZA 1WZUA 2GTPA 3F49S 4FVTA 3SHWA 3TX2A 3CRRA 4LDQA 1JQDA 1XWFA 4MKGA 4EHBA 3NVDA 4LJ8A 1Z74A 2YH2A 3K9WA 4JK3A 1W36D 1DO0A 4NCKA 1F2UB 2ADMA 1GZ7A 2J08A 2J9FB 2B4TO 1QQ6A 1Q22A 3FDZB 1SHZA 3GLHB 4NE2A 3TSAA 4JP3A 3B3JA 1Y3BE 4FK8A 2G0NA 1P9WA 1YC5A 2ZWAA 1L7BA 4URXR 3BGOS 1KPIA 2CB9A 2AH5A 3FR8A 2H48A 4YJGB 3W6OA 2NUTA 2C7GA 4NR0A 5A5GA 2B1IA 4QZVA 4X65B 3UYKA 3R8XA 1BAPA 4NBVA 2VRCA 4YC7A 5CEFA 3IIKA 4DA6A 5B3JA 4B76A 2Q2QA 2OQRA 5L53A 1GIAA 1RABA 2F3TA 3K30A 4KV9A 3STTA 4ARIA 4UE3S 4DNFA 2YMMA 5HUJA 4X97A 3GYBA 1HM5A 2YBDA 4YWJA 5IMBA 3UMSA 2DHEA 2EFCB 2BFEB 1ULHA 2X8BA 3IX7A 4WJLA 4C2AA 3EA0A 3HVIA 1JHMA 3F8WA 4DWVA 4QATA 1P2GA 3M81A 3RC3A 1XXLA 4TYWA 4MLCA 1IK4A 4XYEA 5JSZB 4D3YA 5I4KA 2W6ZA 7ABPA 1GDHA 2G0TA 1WD7A 5HJEA 4J0CA 3WSWA 1UFOA 1XTJA 4H0FA 3VTKA 1WE2A 3OHMA 2XWJI 1RLTA 2MMCA 3QPDA 3KK0A 1E62A 2P0AA 1UKVY 4R7ZA 1JQJC 1S6YA 1UFKA 2EP8A 2O3SA 2ZJ7A 2C2WA 2QP4A 4A4DA 2WSSD 2FMUA 4DIKA 4OKNA 2GPBA 3Q7QA 5H7XA 5CW2A 2WUEA 3T6KA 1SOMA 5CVTA 4L78A 4XCXA 4KPFC 4ZT7A 3E9EA 4TGLA 3E23A 3ZLJA 1CZKA 1G8MA 1I8TA 2HTEA 3K7EA 3KVOA 1S96A 1LNZA 1PR6A 2R7AA 3SLRA 2O8FA 4O02B 3B1FA 5HIIA 4NV1A 1TAGA 4DC1A 5G40A 3FOWA 3PU6A 4DNQA 1NA5A 2XZOA 4S1WA 4S1PA 1Y8ZA 2DFKB 4HO1X 3ZKWB 1U6IA 1RHQA 1TLFA 4KH0A 3PXGA 2PRZA 2AJ8A 3HB0A 3MUOA 4Q02A 5DBIA 4B6JA 4EYGA 5HJ5A 5KJ1A 1IY9A 3D6AA 1USIA 2KI5A 4OM7A 3KTFA 1Y8QA 3OFKA 1ZICA 4S2EA 1L9KA 2POCA 3FNBA 3TX6A 3ZJVA 2WAYA 5TXGA 4BP9A 4PAGA 3GUYA 2AG0A 3AVQA 3QOXA 1JFFA 3UXYA 2XB6A 2Q3JA 4B82A 1XG5A 4IH4A 1FU7A 2VQDA 7REQB 5FWDA 3WOHA 1OGYA 1Z4MA 4CQMD 4YV7A 3GFOA 3ET4A 3OZXA 4KWIA 4XUGB 2ZZNA 3KT0A 3KWFA 1SKYB 2J5KA 2YN4A 4P54A 3S6JA 4FKBA 5DOVA 1GRRA 1PI3A 1AY0A 2ODAA 4U2KA 1TKRA 4I1RA 4HXFB 2IV3A 3QRWA 3VSCA 2BGIA 4YFVA 3PHGA 1QAMA 4D9GA 1LK5A 3OFVA 5EMHA 1RRMA 2ZRNA 3DDOA 3OQ1A 3A1VA 1XAJA 1OFTA 1N2XA 1XZIA 3BS4A 4C4XA 4C7KA 1VP9A 3CNQS 2XRYA 3LD9A 3UA3A 2RH8A 3DTVA 5HIMA 5REQB 5ITZB 1X0VA 1GA1A 2AFIB 3JWEA 3LQRA 4MICA 3RUCA 4D5EA 5JIBA 3KR0A 3OC6A 4QUGA 4AF8A 1VLHA 3GZNB 3U9LA 1RRVA 2X1MA 3DE0X 4IIJA 1SQGA 1YR9A 1U1GA 4YRTA 4S0XA 3EGDA 2FDRA 1TLLA 4MPJA 1CY2A 1NURA 4YH1A 3P4YA 4TRMA 2C88A 4G9EA 2DBVO 4GPIB 5EVJA 3IVRA 3U7FB 2ID4A 3PHIA 4UZSA 4G0VA 1X8JA 1NT2A 5KBYA 1SRRA 2CMFA 3M1IA 2GTIA 3Q7SA 4N5LA 1UBTS 4YJHA 4ITUA 5JT1A 5AXCA 2CLEB 4IDDA 1NPYA 3C1UA 1ODLA 3RU9A 1Q6YA 1TT5B 2R5WA 1RPAA 2B0JA 3IQZA 5EEGA 1QZXA 1T9GS 2ZDGA 3PRKE 3SC2A 3F78A 4YAFA 3R7AA 3RVLA 3WIBA 1N32B 1F8FA 1L4MA 2ENWA 2ZM5A 3DE5X 5AUQA 3S0JA 1VE6A 2XPCA 3FJ1A 5TQ0B 3P9IA 4AO7A 1Z12A 4DJDC 4UMDA 1XJQA 5E6RA 2ZIVB 1BDJA 4IDEA 1R8SA 1VL8A 2PWYA 2YNMC 3I0NA 1QDLB 3IAS6 4NU5A 4WADA 3S27A 3QITA 5CUQA 4Q3EA 3R8CA 3AGQA 1UMKA 2EYQA 4MW9A 4ATNA 5IF3A 5EC8A 4YQZA 2RIPA 1IJEA 2DECA 4E3ZA 3O26A 3ZN2A 5ED4A 3T9BA 1XDWA 1JG1A 4MQLA 1ECPA 1QOPB 2X5NA 2JJ2A 2WSMA 3E1GA 1A8IA 1SQ6A 3DCNA 4FGZA 4BECA 5LQSA 3V9PA 4HTAA 2QTVB 4OPMA 4DCTA 4ZYTA 3GMIA 3SQDA 5A0FA 3ZY3A 1VRVA 3WLIA 2JFZA 2AG1A 3RAFC 3V8MA 3IIMA 1G8AA 4PXYA 2NXWA 1DFGA 4YMSA 3NDBB 1E2GA 4EO9A 3QVKA 4D92A 2CLOB 4FWIB 5HUHA 3E03A 1EVQA 3FSRA 2X40A 1VB3A 3JD0A 1S1CA 4J0DA 2AZ4A 3WNDA 4AP5A 1LFAA 1AS2A 2GF9A 3TK1A 4BTLA 5LP6A 1GDTA 1CIVA 4Q5IA 4GEKA 1Y9DA 1GN8A 1DKLA 2LR0A 2VQ6A 3EASA 1YVEI 1I3OA 1L5YA 2QT1A 2G82A 5MGNA 3RBXA 1PJ4A 4Q4AA 4ALIA 4KMOA 2NT3A 3K32A 4OL9A 3FNIA 1MTOA 3KUKA 1KAMA 1DKNA 1GR1A 4EPXA 2Y2VA 4XH9B 5K09A 4O6VA 1CG6A 3Q7IA 1S5PA 2R3SA 5M34A 1E6CA 2A5YB 3CX6A 3EZ2A 3HG7A 4WTOA 2Z0MA 4YMTA 4JBHA 1LC3A 1J0CA 2ZFUA 1PVVA 1MO5A 3H84A 2DTEA 1BMFA 1U3GA 2H00A 4OLHA 1F6DA 4PM4A 5IXSA 1KH2A 1NNSA 3DNPA 2A14A 2QAIA 3KX2A 4LN1A 1E1KA 4D8TA 5D5HA 2R1VB 3HSSA 3CVUA 1CY4A 2W6NA 2VZ9A 3OFND 4P4TA 2IF2A 3K4HA 3H16A 3N3AC 5FV7A 2PFKA 3WO0A 3JWGA 4IGAA 5A03A 1W0JA 4P81A 2MT9A 3OECA 2VAPA 5HF8A 3R76A 1DBWA 3ONWA 3CT4A 1Q50A 3DZGA 1FL9A 3FTQA 3I37X 4WHMA 3RUPA 1KXJA 1C0KA 4LDAA 4GOND 1Q19A 1M54A 3QEJA 4GQBA 2FTKE 4PC1A 1C7FA 5DYYA 4FINA 2HFKA 1KAHA 1ZH4A 4MRRA 4UXHA 3VGPA 5DYTA 2ZIWB 2PJRA 4L5CA 1JQAA 3NM5A 4EH1A 3T15A 2AR9A 3LO8A 3EUWA 5ADWA 2A94A 3R7FA 2QJTA 2A5DA 2FKNA 3QP9A 1HYQA 1XZMA 2Q0XA 4RETA 1Q15A 2FSFA 3HY6A 4W7SA 3GFPA 3SLKA 4JIGA 4TLBA 2NUAA 1BWQA 3K35A 4YQYA 1JJ7A 3IP1A 4GOOD 4H18A 3EXHA 2HV8A 1ZGJA 1OH7A 4U6QA 2WB4A 1CZNA 2I03A 2MSDB 1P2VA 1PR4A 2J8ZA 3B1WA 3FFTA 3HVUA 4HK4A 4MA5A 3BGWA 4R2LA 3SQWA 1HOTA 1XDGA 2Z2ZA 2HNBA 4LHYA 4O5AA 1BHSA 1PTJA 3DOUA 1X92A 4I7EA 4JSRA 2PLWA 5EJ4A 2CL7X 1PN3A 5BSTA 3W4JA 3E61A 3IOCA 3JWIA 1EX1A 3WICA 3V34A 4MV4A 3WJ7A 3UPTA 1I94B 1K6JA 1Q0TA 3SYRA 3BA6A 5GJBA 2G6BA 3U4IA 2DKFA 5I9TA 2JHFA 5DISB 1KIMA 3PD1A 3EQ6A 1AJEA 1CS0A 1NLUA 3BERA 3DZFA 4KXNA 4E32A 1AHIA 3WLKX 3U37A 2D0IA 4LW8A 4FI3F 1GYPA 4KLCA 3GEIA 4GF5A 1ZLYA 4GLJA 2Z2IA 4OHMA 4X3CA 5ELMA 3T3GA 4GX0A 4JVMA 4OFXA 5FEMA 3BE8A 3AGPA 2VP5A 3VSAA 1XVAA 2QORA 3QXHA 1QQAA 1WW3A 4L8LA 4PLGA 1P4JA 4LX8A 1R15A 1I36A 3C6QA 2WMDA 5B7GA 2GUWA 1T3SA 4NNJA 2C7OA 2X2FA 3T4EA 1Q7TA 2FEKA 4B7AA 3C1AA 4IPTA 5KPJA 4AZVA 1GNLA 2ZCJA 4BTEA 4D6XA 1D1PA 1JA9A 5L7WA 3DEIA 4G0ZA 3FVWA 3BFVA 3HHEA 4I5FA 4K9KA 3U1VA 2VHYA 3LKDA 3QY0A 2VCEA 1V71A 1GYQA 3KELA 3ONNA 2XUAA 3HXLA 3UB4A 4EGAA 1MTZA 2B2CA 3C7AA 3GZTB 1FBNA 2R8RA 1P0MA 3IHWA 4JT8A 2PX8A 1RKXA 4HWPA 3A3KA 4FGJA 3DYIA 4U00A 1TPZA 3GRCA 4RVOA 2VJKA 4HDOB 1YONA 2VJYA 3TOVA 3S55A 3L6OO 4LRSB 1L8OA 3G1WA 4CM4B 3X2FA 1SHUX 2ZIXB 2XT6A 1TVKA 2QMQA 1KETA 3Q9NA 3T7SA 4XD7D 3VH3A 4YRLA 1I4DD 3S2SA 4CT4B 1IFXA 4LRXA 5AUNB 3BJZA 3U61B 2FN4A 1I4LD 4CKZA 1ORTA 1UDBA 1QX4A 2FRDA 1ZUWA 2IIVA 4OVKA 4KO4S 1ZK4A 2OV2A 3CVJA 3STYA 3ZPXA 1EZ4A 2QGZA 4U2DA 4E2XA 4XSHA 4ND4A 1JXMA 4LIPD 4PANA 1RXSA 5JDIC 4EEXA 1QTIA 2AV6A 4MIYA 4QQNA 1HFEL 2QI9C 4EYOA 2N42A 4QQKA 1XU7A 3DPIA 4PHHA 3EBPA 4P0QB 4DCVA 3A4MA 3JZDA 4Y9DA 4MWBA 3PDIB 5CHYA 2VYVD 4CM3A 3UICA 2X0JA 3G0HA 3HP1A 4JN6B 3FTPA 1BIFA 3B53X 1M6YA 1MZVA 4JQSA 4R8RA 3E48A 4M9CA 1W35A 1P81A 2FFAA 2P9CA 2MSEB 3BKWA 4I66A 3JQFC 4WZAA 5DGCA 3ETJA 3VAYA 1K75A 1Z6YA 1ZNZA 3A4LA 3P0IA 5JSHA 2VTBA 1YB2A 1TL7C 1P8JA 1EFKA 1FFEA 3RUHA 2GF2A 2CEAA 3L7KA 3BCUA 4FN4A 4I5EA 4D4HA 4TUYB 4DRYA 3A1CA 4DV0B 1BE8A 3W6ZA 4BXOB 3W5IA 4MCIA 4IUCS 3SXJA 2BEWA 2YIMA 3ED1A 1P2SA 5JQGF 2XNJA 4X1KB 1AKWA 2I8AA 3KB2A 3HN7A 1GU7A 1PAUA 2G7ZA 2RK4A 3CX7A 4FYMA 3RKSA 5LQUA 3KYIB 5CB4B 2QLTA 1M2KA 3CG4A 2GYVA 1MDBA 3PJFA 5EE9A 4BKUA 1EJBA 1MEEA 4O0MA 4RTNA 1CSEE 1G60A 2WPDD 5BVGA 4LZOA 2I7CA 4I1OA 4C01A 4CF7A 4NCNA 4QICA 5BSMA 1X2EA 2DBRA 3FMIA 4COKA 3WNBA 3M1LA 4CKEB 4EFLA 4W5QA 2IS1A 1FC0A 2BLNA 3QX9A 3FGOA 1GNSA 3FSGA 4BCCA 3LUBA 1G20A 2DHCA 1Y4SA 1H2BA 3C97A 4MP3A 4IGKA 1DV2A 2VP0A 4LHSA 4PSAA 3M6MD 5J5AA 3AOGA 4ZVOA 2I6FA 4QOSA 2HM7A 2XKAA 3E35A 3MCUA 4OLBA 4PGFA 4QOEA 1VE1A 3NT2A 4LAFA 2G70A 1AKUA 4G9GA 4BGIA 1FVHA 2QWXA 2GZHA 3OAAA 1BQEA 3OIVA 1HYBA 3T7RA 4C14A 3WO1A 5F5XA 1AZTA 5EWLA 3DWEX 3VAZA 2LP4Y 1OWPA 2CEKA 1XD2A 2XE4A 3ET5A 3FDFA 4XB1A 1ST2A 1IHDA 4TS3A 4XOIA 5DHRA 3L4KA 3C1TA 1PSWA 1JKXA 4RHUA 4C0QC 5H1YA 4G5QA 2GBFA 3VZCA 1YZQA 1DAPA 2L18A 3LOPA 1QGAA 4GICA 4RV4A 3CH5A 1O96A 2A9RA 1F3LA 3D5TA 4C29A 4FCWA 1P1BA 5BXYA 1ZFNA 2W48A 2POQX 4II2A 3R7WB 3OQNA 1AF4A 2XADA 3H87A 4KB5A 2X15A 2PAFA 2ZSJA 1DXHA 4M21A 3FY4A 4PLCA 4MQMA 4QJ4A 3T7IA 1EBUA 1XVUA 4EPWA 2D8AA 3E2PA 2QGFA 1HLPA 2MOKA 4RIFA 1GL7A 3DF9A 2FVYA 5CH8A 4Z3DA 3TLZA 2WUFA 1C41A 1A8PA 2FPRA 3NAQA 1UKEA 1UK8A 3Q8WA 4LVCA 4FHCA 1UOEA 4MJ7A 5KOJA 4M9RA 4BNMA 2PK3A 2QSZA 5ALDA 1HR0B 1K6XA 2AK3A 1I7NA 2WSSA 5C2JB 2Y0CA 4REQB 3RFCA 5L40A 3IESA 4K6HA 1F8UA 1BXRB 4MROA 5FPPA 2E55A 4ZCRA 5BT8A 2C2YA 3B6JA 5DHTA 3LUDA 2GN2A 13PKA 1C7JA 2RGWA 1HBJA 1R5OA 2GARA 1Q0PA 4XYMA 1MQSA 4A2PA 1XTUA 4M1KA 1EXMA 4BNVA 1MJFA 2VPPA 2J0SA 4P32A 2X2PA 4H08A 1E5LA 1EWKA 3AEUA 5AOVA 2HHJA 4MKIA 2ZJ1A 4QULA 3VTZA 3Q5GA 4BMOB 3PXEA 2CDNA 2DPGA 1M2NA 2WYUA 4M1MA 2I6TA 4UARA 1ZBQA 5EMMA 4OIFA 3A8TA 3S1AA 1B8VA 2B36A 4Y67A 1B41A 2IU6A 3WWZA 2O2SA 4MJLA 5TQJA 10MHA 1NUSA 3P96A 4IV8A 1VE5A 1LDMA 1NVBA 2QE6A 1P7WA 5K8LA 2FN9A 3PYLA 5KX5F 1WNTA 3FF1A 1FTQA 1OJLA 2PPLA 4IHKA 3AT1A 3DZHA 2C31A 2WJVA 3P9QA 1U7PA 1T1GA 5AVZA 1RYBA 4B0PA 3AP2A 5FEUA 4YRGA 2R4QA 1WY7A 4KFRA 4DLKA 2PU5A 4OGGA 4M7RA 3L92A 4WKCA 5KYUA 3T7AA 4NZPA 3ZYCA 3IMEA 3DP9A 4ER7A 5JJKA 4AW9A 4L7QA 4COOA 3V55A 3N53A 4Q7KA 4RVNA 2WHPB 2B4AA 2ZJ6A 4EBBA 2C3PA 4LXGA 3DEHA 5EIXA 3A4TA 4MVJE 2ZR9A 1QBGA 1V3VA 4L4YA 4UJ3A 4ZT4A 1NFFA 3SKYA 3ZD8A 4D9HA 1F8YA 1QG4A 2R7LA 2W22A 3C3WA 3IODA 4GKAA 5AW2A 1E63A 2MTBA 1IXKA 3PDWA 5E8RA 1IBMB 4R0VA 1P6XA 1EA5A 2IEBA 4Z7JA 4H31A 4YP1A 1IQRA 4WLVA 4QLBA 1PF7E 3Q0EA 1QH8B 1CY6A 4FT2A 5FUWA 5L4SA 1PLJA 1LQUA 2VBCA 4PLPA 2WNIA 3NT5A 4KIJA 3WXBA 1BZYA 1DT5A 1F4VA 4I9UA 4QNMA 4TMFA 5CX1B 4RESA 1D5CA 5EZYB 5H80A 2ORIA 2P91A 2Y1GA 4E1AA 5C8YF 2OYRA 1JEOA 1SCJA 1UFRA 2CFTA 2YINC 3KKMA 2P7IA 1AO3A 3M6VA 4GGPA 2F1JA 1T6ZA 4ZP1A 4AJJA 1D6JA 5BWBA 2JL1A 1JNYA 5D5PA 3TSCA 3KFVA 4YAGA 5IM4A 3BRSA 5D2CA 1KZ4A 2JIMA 3ZWMA 2QXTA 3UPUA 2EFYA 5ILGA 3FLMA 4G0OA 4HDNA 2XRMA 5JVDA 3T3OA 3U39A 1YB5A 4ZOCA 5E7JA 1KYXA 4NZNA 4R16A 1KI4A 3I72A 3GGJA 3NDRA 2OGWA 2YHIA 4FYHA 4PGAA 5AM0A 3B78A 3MPUA 3T1VA 3QNUA 2CCKA 2JD0A 2FWMX 4OP3A 4H0CA 1S2OA 2ZATA 1QWSA 5FWYA 4KPEC 5DHSA 5CFLA 1BC5A 3R5TA 5KTTA 2W4QA 4YRNA 2R86A 1XP8A 1Y5MA 5TMPA 1W87A 4J91A 4U7PB 5AJHA 3ST7A 5P8WA 1Y3DE 2X22A 3FPHA 4ZIRB 3M83A 2A9PA 2D2XA 3WJ1A 1PDWA 2C4NA 2NO1A 1OT5A 2J3KA 3A0RB 1IN6A 3HL4A 4JJEA 4NFLA 4IIJF 2AFHA 3KKNA 4IOLA 4QELA 4L27A 4L8VA 3JQ6A 2ZUWA 1DPFA 4YV1A 4O1HA 1BEEA 5A5VA 5C8YB 1IUOA 1Y3FE 4BIMA 4OB6A 3DTNA 3OIYA 2CJFA 1J33A 4LJ4A 4BO8A 2RIRA 3BTVA 2H08A 4HT3B 3QJGA 1EFDN 4J3JA 3NYWA 4BVLA 5BW4A 1MR3F 2Q2NA 4A8JA 1Z6TA 1OIXA 1EUDB 1E2NA 1WIWA 3PI7A 3O92A 4CTJA 4YDHB 1UDWA 4PPFA 1NONA 5IXJA 5JNRA 3ABOB 2GKGA 2ILTA 3PG5A 4A0GA 1T2VA 1YTUA 4YJKA 3GZ4A 5SY6A 4DTIA 3IR7A 4NVRA 3DB1A 2OTCA 3EVNA 2FSUA 2GN0A 3SWWA 4K9NA 2XCRB 2I99A 1OBCA 3K2QA 2CLLB 4TL9A 2IODA 2GETA 1EB9A 2VDVE 4AECA 1V9LA 2VHCA 5T3YA 1NPDA 2H1FA 4S12A 4YDSA 1IOWA 2OQVA 3SZRA 4BMZA 1DBQA 2GZAA 2B4YA 2B2XA 2HRBA 2BJVA 5ALSA 3G8CA 2JATA 5CDTA 5DEIA 3JR7A 1UT6A 1YQ9A 1H6AA 1SPXA 4NYJR 3VUFA 4DDVA 2ZKLA 1EQAA 1OA1A 1MABB 3C8HA 3N8DA 3K5WA 4DXHA 1PBNA 4ZWNA 3PKJA 4YO8A 5HZGA 1FX0B 1VGQA 1C8KA 2A1UA 2ZUUA 4OHKA 3CN9A 4Q1FA 2EFJA 1O95D 2CVPA 1DSSG 2NYAA 3EOBI 2PH5A 3HKDA 4HB2A 2JH8A 4C6TB 1FEZA 1J2JA 1NY5A 2QRNA 3B70A 3OPXA 4IY1A 2YRXA 1R5JA 2ZDHA 1ZGBA 3OTWA 1OV6A 5A5DA 1MORA 1SC3A 3B8EA 3STWA 3NJ4A 1USWA 2XSZA 4D56A 2W8BA 2XMQA 2A9OA 4KH1A 1ADCA 1P62B 5H8WA 3H4IA 5LKRA 1JJIA 2C7VA 3DXZA 3U9TA 3UMJA 4DQLA 2PJUA 2FSSA 1WXWA 1ESEA 1AQLA 1L5GB 3F7NA 4RK5A 5B2FA 3FWKA 2ZTUA 3L6RA 3MLAA 1JECA 2W0SA 4GR5A 1R7RA 2CC2A 2DPXA 4MS1B 5GZ6A 4JNCA 5ILQA 4A0SA 2O05A 4QYXA 1KYYA 3U9SA 2FZVA 3LHKA 2W8ZA 4PLTA 4HI0E 1Q6ZA 4HEQA 4R6XA 1TQ6A 5CIWA 2WRZA 2QEQA 4ANFA 3C6BA 3CRVA 3II6X 3UK7A 1W4CA 5DO9A 3SNHA 1L9XA 2FWIA 2BZ1A 3ZK8A 3K4PA 3CLHA 3OA0A 2QN2A 3CLSC 1DOHA 3AW9A 4HGOA 1HZJA 1NVFA 1AZWA 2H63A 2P78A 1Y82A 1Z0FA 1M76A 2ZOSA 3KT6A 1JSRA 2RGBA 5K2OA 2GR9A 3OPYB 5E95A 1KVSA 1RAGA 4PZAA 1DAIA 1G63A 4C7OB 1X80A 3A32A 3WHKA 4A1OA 4EG8A 4BFZA 1R6BX 2HB6A 2O14A 2BDUA 1JMVA 3PWSA 2IUSA 4M53A 3EEQA 1VC2A 3ZEIA 3DOCA 4FZ5A 4OM8A 5H02A 4B3FX 1ZGHA 4CNBA 4G5SA 4BO0A 2X14A 4XR4A 1GLNA 2J6HA 1IUPA 3NB0A 4OD0A 3LGAA 4ZARA 5IC6A 1OROA 4EW2A 4YIHA 3ACBA 4MS4A 4UNIA 5ES4B 3PQ2A 4BKMA 4Y1FA 4JZYA 4FLFA 1QNLA 3LDFA 1JILA 1QP8A 1W85B 2R2AA 4IUDS 4QHTA 1KEKA 3FOZA 2V74B 3SF8A 3BORA 1U4NA 3T9AA 1KRXA 1F6WA 2HHCA 3LCRA 1TD9A 3VHXB 1J2UA 3DHYA 1UBSB 2I6SA 1ZGAA 3RBZA 1GQOA 2C77A 3CPHA 4B33A 4DAEA 1CRWG 4ZO7A 1WKBA 1WQ3A 3GP3A 4TL7A 2ZT8A 3VDQA 5I7UA 1EIWA 2OMEA 2JFNA 2QL7A 3PFWO 2OCXA 1T3HA 1PWHA 2GN6A 3WLSA 2GVDC 5CAEA 4DMRA 4DPKA 1ZINA 4NFYA 3LUHA 1ZUHA 3MSXA 1K06A 4LV6A 4FFMA 4Y2UA 5JVDF 1XQXA 3VDNB 1DCFA 2D2FA 2FR0A 1NKSA 3ZCPA 1E9BA 1OPRA 4EWLA 2V96A 2WC1A 1CY0A 1JHUA 2FE1A 3CUVA 5C8VA 2WYHA 3VV2A 4WY8A 4M87A 1LDYA 3GMTA 4JB2A 2IL1A 3HFJA 2OBYA 3OVMA 1KI1A 4QU9A 4DSUA 4N5IX 1QX3A 2CSUA 1SBZA 4NJMA 4DNPA 4F5WA 4WI1A 2I3GA 4QVGA 4EB6A 4DN6A 2C2XA 4OBWA 3WBBA 3NTQA 1L4NA 2FZ5A 3TB4A 4A0HA 5A5EA 2IU0A 5LP1A 3OX2A 2R60A 1F1JA 1C9JA 2PS1A 5JNUA 3ZHZA 1WXXA 3QYAA 2EZ9A 5CM2Z 1NDQA 3IP8A 3EYAA 5IEBA 1OT3A 4R69A 1F2TB 4D5GA 4R2JA 4U0JA 1QZTA 4JBWA 3LXMA 3QX8A 3MUEA 1AURA 3HPRA 3OLWA 1HX7A 1P39A 2PNJA 3OZDA 4OXKA 3WLJA 1O0SA 3GRFA 3R1IA 4KEAA 2YXLA 3ZYZA 4J0KA 4IWYA 3H9EO 5JXHA 4MULA 4F12A 2BP7A 5FA6A 5HCUA 2ANBA 3KKOA 5IARA 3ABIA 4D02A 2Q4RA 4FOTA 1AKNA 4UBIA 3TXXA 2NPFA 3BDAA 2WE8A 3EXEB 2WD7A 1AD2A 2NTYC 4LCBA 5C31A 1T5HX 1TM5E 4CM7A 4YECA 3SHOA 4M0CA 4NENB 4L5JA 2ADOA 1RE1A 1UODA 2PV0A 3LQQA 4NYIR 2C4KA 3FCXA 4CLDA 4R68A 1V3UA 4IJ5A 1UJ2A 4DG5A 4EO4A 1GGVA 4LZZA 3HJAA 3KQVA 4WCDA 1RWOA 3HE3A 5FULA 2JIDA 4WNCA 3LKBA 4FYKA 5EKXA 3TTVA 3AESB 1QP7A 1KH3A 2IIQA 5EI5A 3DYBA 1A9QA 4AJEA 1QIDA 3UC5A 1Q3HA 4DGQA 1N3YA 4D9JA 2ZRMA 3RBAA 3VU9A 4PO8A 3EGXB 2OM2A 1RRFA 2IPMA 3RVMA 1DRWA 3R9KA 2ONKA 1Z36A 4OP1A 4TWBA 1LBQA 5FI3A 2CBGA 2B21A 3OP1A 2VR1A 4PYQA 2HMWA 4LBVA 1L4GA 2WYWA 3MTGA 2GCIA 5AKIA 1E4EA 4G07A 4BFCA 1MX5A 1RIFA 3EW9A 4TN5A 4WZBA 4IKOA 4FIZA 4FYJA 3OZIA 3PUIA 3HVKA 2P7HA 1QPBA 1TJYA 1THZA 1ADJA 5ECWA 2ZE6A 3CJTA 1YE5A 1E7WA 3MGKA 4YPFA 2IZOA 2XT0A 3NUZA 1M34E 1RBQA 3OKCA 5DNCA 3LUKA 1D4ZA 3TR5A 2P68A 2V9ZA 1WM1A 4LC0A 4LV5B 1UIRA 4RZUA 3AB8A 4QJIA 1MFZA 1D1QA 1HG0A 1T0UA 2VDJA 4KVZA 3RVNA 2Z2YA 1M7HA 1CRZA 1FJHA 3JALB 3LDHA 4EEKA 2I2XB 2QSJA 2H1RA 3FTNA 1QAOA 2EKQA 5ER6A 4MDEA 1U8FO 3EUAA 1OYWA 1IATA 1SCBA 5HWSA 4XA8A 4HRXA 4ZVKA 4WWHA 2P0YA 1BKYA 5FFFA 2QZZA 4I36A 4B5LA 4IBOA 1N2ZA 1OW3B 1E5XA 1VMEA 4LWOA 4QFDA 5HNKA 2DGDA 4N54A 3HFSA 3NHBA 2P2CA 3BWVA 4BO2A 1GEEA 1NXSA 4PR3A 4CDMA 5C32A 3CX8A 2WEKA 2ZYUX 2GQ0A 1D8AA 1L4YA 4I3FA 4OCZA 2ZUFA 4CM1A 2CNKA 2NNWB 4WKGA 5GM1A 3C3BA 5DGXA 3K9QO 1SVOA 5IYZF 2OYSA 1QLHA 3P1JA 4E46A 1IXZA 1RZVA 3BRQA 2NU8B 3KLMX 5B57C 3L7LA 1EM6A 5JD4A 1NVAA 3EDYA 1N8KA 4LHXA 1DCMA 1JDZA 4PX9A 1C4OA 1YVDA 2W6CX 2C78A 2VDPB 2P9TA 3ORSA 3OPMA 1MD9A 1YS9A 2A5JA 3NBQA 1G5IA 2UAGA 4XWGA 3A9VA 4WFKA 1J8FA 3FWNA 2LKCA 4B4WA 3CGWA 1FZQA 5HQ3A 1TAHA 1YE3A 4YMHA 5IRCD 2IYSA 5EP4A 4CMCA 2EQAA 2QG9A 1N5DA 4M8IA 3M0EA 2QMUA 3TW0A 4Y2GA 1AIPA 5IJ0B 5KSZA 4OGLA 3GROA 4YONB 3R7NA 1SG0A 1T9ZA 1S8AA 2O2CA 3EN0A 3DFFA 2D2IA 1PQ4A 1TAUA 2O0LA 4NU8X 2IYWA 2BBWA 1N25A 1CR2A 1AC5A 3PEWA 1OFUX 4CR7A 1LD3A 5HX7A 4IXTA 1D7OA 2CXHA 4RKRA 1U31A 2R1UA 4B6EA 3D64A 3LNTA 4UAGA 1JEQB 1W85A 2OVFA 4ZA2A 3TQFA 5ALZA 2RGDA 3E70C 3H3XA 1EFAA 2Z08A 4CCAA 2QBYB 5EXSA 2QA5A 4AG3A 3ROXA 2H7VA 3GLTA 1NBME 5FFMA 1QYVA 2EXXA 2QRVB 4EA8A 1SUFA 2J3DA 1JQ5A 4IIEA 5C53B 1SKMA 2IA5A 5CT4A 4YJHB 2HWYA 3CINA 3D6JA 4RD6A 2JLXA 4DOMA 4IXDA 1T6NA 5D86A 2FH5B 4UTVA 3ABRB 1RTTA 3LCCA