2YVUA

Crystal structure of ape1195
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
179
structure length
179
Chain Sequence
KCIEKGIVVWLTGLPGSGKTTIATRLADLLQKEGYRVEVLDGDWARTTVSEGAGFTREERLRHLKRIAWIARLLARNGVIVICSFVSPYKQARNMVRRIVEEEGIPFLEIYVKASLEEVIRRDPKGLYKKALKGELENFTGITDPYEPPENPQLVLDTESNTIEHNVSYLYSLVKAVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of APE1195
rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Probable adenylyl-sulfate kinase
total genus 71
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2007-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2yvuA00
2JIZD 1OH7A 3AP3A 2P5SA 5SZHB 1N6KA 4RY2A 4KITB 5KSOA 5KYKA 1NVUQ 2FMXA 4WAUA 5CJPA 1E94E 2NIPA 2W2VA 2ZE6A 1GNRA 1U90A 3P1JA 4AKIA 3EZFA 1D2NA 1U8ZA 3FPAA 5BQ5A 2ZJ2A 5JZVA 3EZ6A 4QBHA 2NO0A 4PC6A 4YLGA 1CR1A 3SC3A 621PA 2YOFA 1GP2A 1A4RA 1G3MA 3RS7A 3T61A 3LX5A 4DDWA 4YDSA 3UG6A 4ILEA 2ZRJA 2VP4A 3A1TA 4BFSA 1ZUNB 4KXFB 2FFAA 3IIMA 4O2RA 5DHAA 2WBLC 4IXNA 2JJ2D 3IBYA 4BZQA 1XCPA 2X1VA 2W0MA 1Z0FA 2NOAA 1NLZA 1XEXA 3ASZA 3CX6A 2R6DA 4IKEA 4PPQA 5B57C 1CRQA 5EXXA 3BFXA 1X6VA 2VIIA 5FUWA 4NU0A 5CDFE 1VG0B 2WWXA 2ZUDA 2GEVA 4LJ5A 1P2VA 1WDTA 4OYHA 2QPTA 2JASA 2C9CA 3HU1A 2FX3A 2CVHA 4G5SA 1BH2A 3LX8A 5FOSA 3SFZA 1OIXA 3GMTA 4CYMA 3EA0A 1ZCAA 2YNMA 5C4MA 5DYGA 2ZRHA 2ZS8A 1Z5ZA 4B33A 1X86B 5FOWA 4Q19A 1GM5A 1JB1A 2ZI6A 1W0KA 4B2PA 2OLJA 3FHCB 1RZ3A 3GLHE 4B2LA 1XJ0A 1NMYA 5AWFC 1ZU4A 4DLVA 1Z63A 3PJRA 4YXWA 2HXYA 4A8JC 2YWGA 3P20A 4DUGD 3DM5A 1QRAA 1Z0KA 2NZ8A 3FKSD 1U8AA 3K0CA 3KKQA 1R7RA 2GEDA 4FIDA 4LYFA 4NYMQ 5CIQA 3QQ5A 2QEQA 4H1VA 3L8ZA 5EE3A 3I4LA 2QQ0A 1OT3A 1SQ5A 3GLFA 5EP4A 2QGZA 4NMMA 3W3AA 1A7JA 4Q1EA 1Q3TA 3Q85A 3D3QA 1JQLB 3VFDA 2XXAB 1D9ZA 2CVFA 1HT1E 3TRFA 2W83A 4YMSA 1CKEA 2BVNA 3FFAA 2WM9B 4N1AA 3WNDA 4B3DA 3NTUA 2DFTA 4TLEA 3A1SA 1Z28A 4NCHA 4NE2A 3C8UA 5FOVA 3V9PA 2AFHE 4AC9A 3H84A 5FPYA 2OBLA 4KJZA 4L9SA 1D6JA 2J7PA 3OIYA 2AD1A 4M1OA 4LHWA 4N0DA 1XPOA 3AKEA 1KMQA 3BRWD 3WRYC 1RKBA 1EFCA 4LHYA 2C04A 4WZ6A 3U3RA 3CRQA 1VCIA 4M21A 1PJRA 5GJWC 3X1WA 3MWKA 2IHYA 3ONWA 3BB4A 3TSOA 1XPRA 2DWOA 2QENA 1XBTA 1ZUIA 2OG2A 3GLHA 1Y3AA 3S1AB 3ZVNA 2FEMA 3AF0A 4FI3C 4JJZA 2YOHA 4FD2A 3OAAA 2ZE8A 4C3ZA 1SVWA 3ADDA 2GEUA 1F48A 5LB4A 3TJZA 2IBMA 2WKPA 2XOKA 2QI9C 2FPLA 1KSFX 5SZIA 4DLZA 1Z3IX 3K70D 2OFWA 5FL7A 1NLFA 2AWOA 2FJUA 1W4AA 5FUXA 3KUDA 4RFSB 2IUUA 4KFUA 4XVRA 2QY9A 4JYBA 4BFVA 4DSNA 1ZUHA 4OBEA 2OXCA 1U0LA 4X8HA 1Z0DA 4R71A 2AXPA 2FFQA 2CE7A 1E2IA 2O0JA 2GCOA 3EWAA 3LVQE 3M4YA 5AUOB 2DFNA 1HUQA 3K1JA 4JLJA 3K9LA 4LV5B 4R2IA 4BLRA 2GZAA 3HJNA 4HSEA 1M2OB 4LHVA 5IRCD 4AK9A 1U94A 1H8HD 5HKKA 1N5IA 1XTKA 2BBTA 1AZSC 1AS2A 3OESA 4L8GA 3LV8A 5AJZA 2QQEA 2F1IA 1G3IA 5CLQA 2WSMA 1GL6A 1XDBA 1ZIOA 4JBWA 3WMFA 2XTNA 4M9ZA 4OQMA 5B58C 1QDEA 5HE9A 4C2UA 4ZI3A 5JHHB 2CMKA 3TLXA 4C0HA 4OJQA 1OXXK 2G88A 1LF5A 2H57A 4LBYA 3GJ4A 2WV9A 4S2EA 2VSFA 4P4UA 5JRJA 1T4GA 4MRNA 4UJ3A 2DWPA 1W4RA 4TSFD 3T1VA 3B13B 3GFPA 1KI4A 3MG9A 3LQRA 4Q18A 3QKTA 4FXPA 2ZREA 2ZS7A 4ARZB 4EKDA 4RZXA 2F43B 1OHHA 1JAHA 1GL9B 2AKAB 5FBVB 2Q9AA 2A9KA 2W58A 4PXAA 1RW4A 4DCTA 1NVWQ 5HCNA 2OBNA 5BYKA 1GUAA 3K0FB 1WB9A 2WKRA 2B7BA 2IT1A 2FEOA 4EPWA 5GJBA 1GKYA 4G3XA 1FUUA 3T15A 2ZTSA 5LPNA 1AS3A 1UKEA 4L9WA 4GRAA 1KI2A 4EIWA 1M7BA 5TDHA 3TQCA 3CRVA 4IOMA 4M0LA 3L43A 3QF4A 1KSHA 5E4FA 1B23P 1N2CE 2E87A 1ZP6A 4Q66C 1HQYE 4XD7D 5KNCA 2ZJBA 3LD9A 721PA 2GCNA 3REGA 4Q4JB 4FCVA 3B1ZA 4DIEA 1NF3A 3MWJA 4UJ5A 3RC8A 1DG3A 1SHZA 4PHTA 4KODA 4D80A 3UMSA 1JR6A 5JJIA 4IJMA 2OT3B 4BFYA 5AK0A 4M8NE 2J0SA 1E2DA 821PA 3QPVA 2UVQA 3SDZA 4PQYA 2F43A 3T34A 4RD6A 3THOA 2XSZA 4BLTA 2P6RA 1KKMA 1NI3A 2BBSA 4HB3A 1ZBDA 4TYYA 3IHLA 2WAYA 5J4HA 3QE0A 2ZI3A 4HUQA 2QM8A 1E9EA 4RCYA 4EPYA 3JZMA 1H8ED 4XJXA 1AN0A 2ZRGA 1G64A 1ZM4A 1ZNYA 3M0EA 4O25A 4B6FA 4WVFA 4TT3D 1U0HC 2VP6A 2CHVA 1TAGA 2JEOA 3IILA 2V9PA 4RD4A 4WIAA 1Q44A 3FHOA 1RVDA 2WZQA 4R2HA 1R4AA 4PANA 4BZXA 3OIWA 1J2JA 2ZRDA 5F98A 3BERA 1H65A 1QF9A 4OI2A 2CJWA 2JLRA 1XB2A 1QVAA 1FFHA 4IVQA 3ZH9B 2W6JA 4CEHA 2BKUA 1OW3B 1IY0A 5FBLB 1IJEA 1Z0IA 2GETA 1NRJB 4KU4A 1IOZA 121PA 1ZIPA 4GOJA 4BFTA 2J0VA 1CTQA 4F7WA 1KDPA 2BV3A 2LWIA 2WJHA 4JZKA 3TK1A 1N6OA 3RANA 3QVUA 4XIGS 4Q47A 1F5NA 4NKRA 4L5BA 1SKQA 1E2NA 4DT1A 1JR3D 5JS7A 1DBSA 3LW8A 4I1SA 1WXQA 4C30A 4Q7MB 2GJKA 2EWVA 2GF0A 1ESMA 1BKDR 1G8HA 2NG1A 4OQXA 2PH1A 2FPMA 3PUVA 3FVQA 1KJYA 1XF9A 3FMIA 1ESNA 1AS0A 4Q9IA 3KJEA 1Q0UA 2HJGA 3RS0A 1NN3A 4IFEA 1Z06A 2MMCA 4L4UA 4LHZA 1KNQA 3QF4B 3DOEA 3IIKA 3W5IA 1C9KA 2IYZA 3CNOA 2GJSA 4JLNA 3O8CA 3WHLA 1N6HA 3VAAA 4B74A 5EQTA 3RDPA 1Z2CA 2DWQA 3O8DA 1N3BA 3DMNA 2XX3A 1KI8A 3GCGA 5IK2A 1GZSA 2CLCX 3B1WA 1E2HA 3EG5A 4JLBA 4FWIB 4S35A 5HKKD 1JNYA 2VL7A 3LA6A 4HLQB 3W6NA 1GKUB 2PJZA 1Z0JA 2WWWA 2YC2C 2V1UA 1KNXA 1E2JA 1IN4A 1XEXB 1GFIA 5KOYA 1Q3HA 4HZIA 2GK6A 4Q1AA 2EU8A 1BYUA 3GJ3A 4XTCS 2P0EA 3QJYA 1JXOA 3IBGA 2DYKA 3VR5A 2VA8A 1XMJA 1R5BA 5CB6A 1IY1A 1XU4A 3EIQA 1P9NA 5JRZA 1OH5A 1A5TA 3K09C 4MKFA 5F9HA 5J40A 1E99A 3QPWA 2BM1A 1YZTA 4MKIA 2R9VA 1DAGA 5AUPB 1IN8A 2GA8A 1G6OA 1JPJA 2XEXA 1KI3A 1JJ7A 2B92A 1HY3A 4DLXA 2P67A 1P6XA 4AIIA 4AG6A 4D4KA 3WP1B 4D26A 1LW7A 2ZSDA 4PFSA 5KDOA 3RHFA 4PC7A 5L3RA 3ADBA 1CR2A 1E1QD 4GFDA 2QBYA 2ZQ5A 4MGZR 5TY0A 1SGWA 1J70A 1MO5A 2QAJA 4DCNA 1U98A 2F9MA 4UXJA 3MJRA 4PAMA 2GXUA 1U9IC 4POAA 5BWMA 5KHOC 4TMTA 2N1BA 2PBRA 1Z6GA 1OFIA 1UEIA 2ZETA 5HR5A 4B47A 5JFGA 1QZXA 1P9WA 4QBFA 5FOXA 1GDDA 4U7DA 3THWB 4A6XA 3I62A 3DM9B 1SZPA 2ZI7A 3A8TA 3B5JA 4QGFA 4XSGA 4RZ2A 4EPXA 3NH6A 1VIAA 3UMRA 1EG7A 4M9SA 4HUQB 4BRWA 4NH0A 1VYVA 3LBHA 2ZSFA 2XNDA 2OILA 3AVYA 1KO5A 3CH4B 4KYUA 1W36D 4URVR 1ZD9A 3L82B 4DDVA 3FMFA 1NNEA 4V0MA 2BMDA 2BEKA 2ZJ5A 3SHFA 4TYWA 4D0LB 1CJUC 1L4UA 3TBKA 2IYYA 1U2RA 4B32A 2AHOA 3UATA 1Z2AA 1II9A 2WJGA 2QGNA 4KVAA 2GZDA 1W36B 3HU2A 1E9BA 5LBIA 3A37A 4DBLC 5FFMA 2ONJA 1DTSA 2WWHA 1XRJA 3SR0A 1GKIA 2J0UB 3Q5EA 3HPQA 2ODWA 2C98A 3GEHA 3TAUA 1U9IA 4GOXA 2YWFA 3DDCA 1XX6A 2C99A 4M9XA 4OJKA 1W5TA 4PPNA 4CF7A 4XOIA 3T06B 3QVVA 3OE7D 3AQ4A 3OFND 1LF0A 4PC2A 3TSWA 1OYWA 4HB2A 3ZGXA 2VP5A 3IKJA 2BM0A 1NVVQ 2Z4RA 5J4YA 3BIFA 3U3OA 2CDNA 4LJ8A 3BH7A 1G17A 1Z6AA 1YZKA 2GZHA 2VHUA 2FN4A 1EXMA 1Q1ZA 3DHWC 5JJKA 1SKYB 4PO1A 3NBZC 3H4MA 3GJ5A 4IEIA 2RB4A 4HAXA 3ZIAD 3VX4A 4CRWB 5JBQA 2VH5R 2JDIA 1E0JA 1G8YA 1RYHA 5JEDA 3ZQJA 4G0NA 1RIFA 2ZRMA 1JR3A 4Q02A 2XJ9A 1XCMA 4YQFA 2DHRA 1QHYA 3GP8A 3QXCA 3NXSA 4OL0A 1G4UR 1KJZA 2EFDB 1KK0A 3CB4A 1WRBA 4IRUB 3X1YA 2W6ID 4FINA 5FTMA 3WNCA 1QG2A 3DKVA 2D3WA 3AM1A 3BOSA 2RGNC 3TR0A 2IS6A 1CJMA 1XCGB 2SHKA 3KKOA 5GJVC 3CO5A 4JSTA 1OSNA 3JVVA 4RD2A 4HAZA 2EFGA 4AYTA 3CZQA 2CL6X 2EFCB 5KDLA 4F38A 1Q1EA 1YJ5A 4GP6A 2VBCA 2QMHA 4QM6A 5JI3E 2X8AA 3MWYW 2QAGC 1DEKA 3VHLB 2VSOA 3PR1A 1VCNA 4MRRA 5EE9A 1WBBA 5DNYB 3LLUA 1KK1A 3C5HA 3MAAC 4QNMA 3BORA 1E9SA 4B75A 4F4CA 4KV9A 1YR7A 3U7HB 1L8QA 1PV4A 4IXMA 3A1WA 3SFVA 2CK3D 2QMUA 1HH4A 4YMWA 1R2QA 2FFHA 5J47A 1E98A 3AVVA 2REOA 2QE7D 1M7GA 4DC9A 3GLIA 3I92A 5FBQB 2NTYC 2WKQA 3BJIC 3U61B 4LGMA 1SXJB 3CPEA 1ZD8A 2AN9A 2G83A 1GRNA 3TH5A 4IVRA 4OQLA 2H8KA 2K5UA 1HE1C 4H9GA 4P3YA 3O8RA 1UAAA 1SULA 5L3QA 2J7KA 2FSIA 4TLCA 2J1LA 1R8SA 4C0JA 1G7SA 3U7GA 1ZM3A 1E3MA 1TEVA 3W6OA 5JWOA 2OAP1 1DAIA 5DN6D 1TQ4A 4ZCMA 4BLOA 3A1UA 1N0VC 2BWJA 3QKRB 1HYQA 1KJWA 1E2KA 4OK6A 5G3YA 4IOKA 5DISB 1NSTA 3V00A 4DZZA 2A2ZA 3HYTA 3RRMA 5IF9A 2OM2A 1HT2E 4NL4H 5B2ZA 5CYPA 2GJ9A 1II8A 3TUIC 2P3SA 4U5XA 4NP6A 1XFAA 1XXHA 2R6AA 1OXSC 3C7KA 4CEIB 5JCPA 1QBKC 3A1VA 2ODNA 1YRBA 1W7AA 1XPUA 2IEYA 4P0TA 2NO6A 1NKTA 1Q12A 1VYUA 4WW0A 2OSBA 4W7SA 4HZUB 3THYB 1U8YA 3GFTA 3BBPA 1KI6B 4PPFA 2IW3A 4BEJA 3NEJA 5CB8A 1TU4A 4ASUD 2MSDB 1U0JA 1YQTA 2P2LA 1LVGA 2FZ4A 2J59A 4PZYA 2GXSA 3JZAA 3EW9A 2Y8EA 5J5CA 2PCLA 3T1OA 4C0BA 4V02A 1X8KA 4DCSA 1G3UA 3KFVA 3AEZA 4FW9A 5B64A 4ZDWA 2OAQ1 2A7QA 3UANA 1OE0A 3B1XA 2HXSA 3DL0A 2GHIA 2QTHA 3SHWA 3ZVLA 3WMEA 5IT5A 1XNJA 3VMFA 2D62A 4DDUA 5JS8A 4D4MA 3IIJA 3DZ8A 2BMJA 4FMDF 3BD9A 1AQYA 4AD8A 4Q21A 2PX3A 1CIPA 3GJXC 1N6IA 4MKHA 2CNWD 4XWKA 1SXJC 3NIBA 1Q57A 3PIRA 2PEZA 5J4VA 1P73A 5H8WA 4M53A 1RRFA 4CEJB 2H92A 3C14C 5FPSA 4DLSA 2OCYC 3AUXA 3EWSA 3B1YA 1N5LA 4LBVA 4AKEA 2RCNA 2ZU0C 2J41A 4EFLA 4D25A 1CR0A 1E2PA 4DKXA 2XITA 2KJQA 5K8IA 4ZCIA 3FWYA 3KKNA 4TMKA 1M34E 1LB1B 2Q0HA 5DGXA 5H1YA 3NHBA 1S3GA 2GESA 1DELA 1G1MA 2ZRLA 3FGNA 3AVXA 3TSZA 2QN6A 3FB4A 1N6NA 2XTMA 2IWRA 3RRYA 1TNDA 2GAAA 2P5TB 4ACBA 1E0KA 3K53A 3UK6A 2ZVQX 4Z1MD 4KBGA 4ZKEA 2FDCA 2X2FA 1Z07A 2FU5C 2VO1A 2ZRAA 4NCKA 4I81A 1EX7A 3K70C 3KL4A 3K0SA 1RPZA 1BIFA 2ATXA 3SYNA 3BFVA 1JEDA 3KB1A 1M7HA 2ATVA 2D2EA 1S96A 1ZVQA 2NZJA 1RRPA 2IYRA 1II0A 3FTQA 3SBEA 3GLGA 3W90A 1A1VA 2FWRA 5B30A 2H5EA 1IBRA 3K0CC 3IGFA 4BWYA 2WJJA 1YRAA 3Q7PA 4OKSA 3BE4A 2O8BA 3QF7A 4PO9A 3ZZTA 2L0XA 1NJFA 1W44A 3AKYA 3P4YA 1JECA 4Q7LA 2O0HA 1NP6A 1FQJA 4TZ6A 3EPJA 5K8UA 5DYIA 2V55B 4MH0R 2ZJYA 3SJBA 4E07A 4OQFA 2WOOA 2PZGA 3U6BA 4F93B 1P72A 1G7CA 2ZJ8A 3O8BA 3Q8XB 3NG1A 3TVDA 1DARA 3KX2A 1T8TA 2AK3A 4D0GA 3PEVA 5IK2D 5AUQA 2HYIC 1ZRHA 2JATA 1H8HA 4QGHA 3RSLA 2RHMA 3IHWA 1O87A 5FH9A 1EFUA 1KO4A 1RJ9B 2QPOA 3IDQA 3L2OB 4JKIA 1QHNA 1GITA 2CCGA 1VG1A 2QBYB 3EAQA 1GOTA 3F0TA 1CBUA 2BJWA 2RGNA 5EP1A 4ZDIA 1SXJA 1T8UA 3FYHA 1MKYA 1SXJD 3ADKA 3CPJB 1T0JB 1TMKA 4NZYA 4TL6A 4LX0A 3MJHA 4C0KA 2EVWX 1Z0AA 1XTIA 4WA7A 2ZITA 1NMZA 3BXZA 1VHLA 4A2PA 4Q1BA 4EQ6B 1XD2B 3DOFA 5C18A 4LV6A 1UKZA 3WRXC 1FP6A 1KY3A 1QVRA 2AR7A 1FX0B 4YC7A 2R44A 4LC1A 1TF5A 3OHMA 4C0QC 6Q21A 2VF7A 2BOVA 3X1XA 4YDHB 1CS4C 3T35A 5A5GA 1CRPA 3R8CA 4QM7A 4Q4JA 3WYAA 2G9NA 1II8B 3EZ7A 4QXAA 1MV5A 2RGXA 3EPLA 3QKSA 1R0WA 4PSAA 3HR8A 1IM2A 4BRUA 1P61B 2REXB 4BPBA 1B0UA 2WHXA 3QBTA 3KJGA 2XZLA 4GOKA 3RYTC 3VNUA 2ZR0A 1E0AA 4DCUA 1NIPA 5LD2B 2Z0MA 3O47A 3ZVMA 5JJLA 3LWNA 5FR2A 2IC5A 2DFLA 1G16A 5FTNA 1I4TD 2IUTA 1P5ZB 1HTWA 4L15A 1ZD1A 3F3YA 4EQ6A 1W49A 1IXZA 1Z47A 4ERNA 4V0ME 1OF1A 3U4QB 1T6NA 5TVKA 1OLOA 4BLPA 1Z08A 2G6BA 3LQQA 3ZVRA 1EWQA 4I1VA 2HUPA 3TGPA 3MLEA 4LPSA 3OFNA 4ZO4A 3DO6A 5EXTA 2FZLA 3EC1A 5CITA 2QNRA 4O2LA 3KFXA 421PA 1CLUA 4EPVA 1FL9A 1UF9A 2WSSD 4XVUA 2CNWA 3A4MA 2IXEA 4HLUA 2NO1A 2F1HA 3NBFA 4QC2A 4DLWA 1XXHB 2XZPA 3LDAA 1ZNWA 3CH5A 5FOUA 1E9DA 1M1YE 1BMFA 1RE0A 2PEYA 4X8MA 2MSCB 5TXGA 4BLSA 3I8SA 5BXQC 2KWIA 4MYCA 4PHFA 4Q4AB 2VEDA 1PVOA 2JIZA 3MCAA 2LKCA 1X8LA 2BIFA 2A3RA 2EW1A 1KO8A 3CIOA 4A4DA 4K81B 4NYIQ 1AJEA 4O3MA 3VR2A 2A5DA 3ZQ6A 3HYRA 1T5LA 2WIBA 4LDJA 1HA3A 2Z6VA 4LC0A 3KKPA 2CE2X 3IPYA 5KSYA 1U99A 1GWNA 4LSGA 4TMVA 2QP9X 5A0FA 4JLDA 2G1KA 2R8RA 4TLBA 1AKYA 4Q7KA 4D81A 2Z4SA 4V0KA 1W47A 3LLMA 1DAFA 4Q4HB 3WBKA 3A4LA 3VKGA 4A36A 5EZ6B 4JKYA 3BC1A 2ZROA 3VU9A 2ZI9A 1TQ6A 4TMXA 4US2R 1KMHB 2KB0A 2JDID 3KTAB 1COWA 1XD8A 1VCMA 4CEHB 1AK2A 2ZRIA 3QBVA 3CF2A 3AH8A 1D2MA 3VKWA 1RJ9A 1E1RA 4M1WA 2R62A 3KTAA 3JVUA 4CDGA 3QEJA 4LYJA 1XTRA 3V4FA 2Q3FA 3KQHA 1E2FA 1TUIA 3ZZUA 4D0NA 3SU8A 1TU3A 3NDPA 4CEJA 4JVMA 2GDJA 1Q1BA 2KE5A 1MO4A 3PFIA 2ZXUA 2I4IA 3SS8A 4JIMA 4GBMA 1FW6A 4ACAA 4V0LA 2NMVA 3OAAD 3X1DA 3PEWA 2WTUA 2HCJB 1P2TA 1US8A 4P33A 5BN3A 4OHZA 3L0OA 4DCVA 2ECKA 3C4JA 3GJ8A 4KLZA 3AVQA 4FMDB 1E79A 4FCTA 3CZPA 3UXMA 5CM9C 4ZDJA 1KDOA 4RKFA 2YC4C 5FOTA 4LK2A 1OH6A 2O8FB 1PZNA 4B48A 3AGQA 1XJQA 3TIFA 3LNCA 5G53C 5DI9A 2A5JA 1S3SA 1P60A 1ZYUA 4AI6A 1XJCA 2Q6TA 4JS0A 4PTLA 5EZ5A 3TE6A 5TARA 1HURA 3SI7A 2D74A 3PENA 4QBGB 1R5NA 1N5KA 1DS6A 1E69A 1NN5A 2A5GA 3HPRA 2R6CA 1KSGA 2Q3HA 4JYCA 3WYGA 5J4KA 1MT0A 2QZ4A 4F91B 3VKHA 3TUJC 2RAPA 2ZS9A 5L3VA 2FGJA 2FG5A 1NL3A 1NG1A 2FPKA 2UKDA 4IVPA 4HATA 1J7KA 1F2UA 4V0OA 2ODBA 2HLDA 1BYIA 3CWQA 3MWLA 2WPDD 1KGDA 3SZRA 1XTQA 2QSZA 3HU3A 1I4DD 1Z6TA 4MDEA 3TUZC 2VLIA 3P27A 2F7SA 4A1FA 1IN6A 1G21E 3KUCA 3PUXA 3RRZA 1KDRA 1AIPA 3TQFA 1FNMA 1HE8B 3DZDA 1QHGA 5ELXA 2ZR7A 1KI1A 1YR8A 2JLVA 1UKYA 4ASUA 1NBMD 1DAEA 1N5JA 1ZCBA 2FFBA 4JL6A 1KAGA 4OI4A 2O8CB 1NY5A 1E9FA 3RS5A 1D9XA 1VPLA 1N25A 1VMAA 1W2HA 2R6FA 1EWRA 2VP2A 3N5CA 1GNQA 1T5IA 1YHNA 1P75A 4PZLA 5FBRB 2OESA 5BN5A 3Q7QA 5IDVA 2FOLA 3ZJYA 2XB2A 3T5GA 3KQUA 4DXAA 2YKGA 3QPUA 1Q20A 5P21A 3AVWA 3Q72A 2TMKA 3WP0A 3IQXA 4QJ5A 2CJWB 4QJ3A 1JXMA 2QROA 1BO6A 4JVNA 2JJ2A 4A8JA 3W3ZB 3NVAA 4ESHA 2A78A 1G9XA 3A6PC 4CW7A 4PR0A 1WP9A 3KJHA 2RGAA 1VYTA 2AFIE 1WMSA 4A2QA 5JI2E 4OI0A 1X8JA 2A5YB 2IUSA 3CRW1 3AGPA 3BWDD 4CVNA 1NVXQ 3QKRA 4I99A 4EDHA 1ZC4A 2DY1A 3U3MA 3E70C 4JVLA 3AVOA 1GVNB 4E22A 1J8YF 4E09A 4G5GA 2E9SA 4W5WA 3TR5A 2VTKA 1IN7A 4HYYA 2REBA 3WBJA 4QOSA 4PX9A 5HCIA 2D4HA 4MRVA 3LBIA 3B9PA 2QTVB 3FE2A 1AZTA 1I4LD 4Q00A 5DIFA 1HV8A 3K0AA 1TQ2A 2ANCA 1RYFA 1SKYE 2WJVA 4G1UC 2XOKD 2RGEA 5JSZA 2IL1A 2O8DA 2ASEA 3OF5A 1MABB 2QORA 2HCBA 1T3HA 4GMXA 4LPKA 3KQKA 4HEJA 5KSPA 4P4TA 4RVCA 2BCJQ 3EA5A 5JLJA 1I2DA 1YZLA 4URYR 1VDZA 2JCSA 4PHHA 3F5FA 2UZ3A 1MO3A 5E3HA 2ZAOA 2Q9CA 5KNBA 2IXGA 4YONB 3VTKA 1TX4B 1ODFA 2HT6A 3GD7A 1W2GA 2OCAA 2V8OA 3OIUA 4LJ7A 3NKVA 5DH9A 1FZQA 2IYTA 5DN6A 1LV7A 3T12A 1OB2A 2YHSA 3QENA 3EASA 3H86A 4LOAA 3EX7C 4NHOA 2GK7A 2IYSA 4GPTA 4HLDA 2V7QA 1KY2A 3EC2A 2XXAA 2AXNA 2V7QD 3RWOA 2B8WA 4OHXA 4BLQA 4URXR 3I5XA 3SEAA 3K0FA 2N46A 3N70A 4KSBA 2ANBA 5AJXA 4A0HA 2CBZA 3U2QA 4UNRA 3CKLA 4MA4A 2ZIAA 1C4OA 4I4LA 3K8YA 4JLOA 3ASYA 4PAOA 4XVQA 4HAUA 4Q4LA 4Z54A 2C5LA 2HDNB 3D8BA 4ZIRA 5GVSA 1J90A 5CYOA 1EGAA 3X2SA 2G77B 1G7RA 1GG2A 5EE5B 5AJYA 1WE2A 1TEXA 1U81A 2FA9A 1QHXA 2Z5FA 4IDOA 5FPTA 4DDTA 1GILA 4UXIA 5LD2C 4AWXA 4ABYA 2C9YA 3SYLA 1NN0A 3D6TB 3LAWA 3NBXX 5GVRA 1R0YA 2V4ZA 3PUZA 2ZJZA 2YWEA 3TW8B 2IYXA 3R9IA 4DSUA 4LJ4A 3ADCA 4JT4A 2CLSA 4E5UA 1WF3A 4XH9B 5M04A 3EPHA 4PO8A 5DLQC 3AF3A 1Z83A 2PMDA 2PCJA 2VHTA 2C9OA 2HYDA 4Q1DA 1K5DA 1IAQA 5FTKA 3IPXA 2XSZD 3RAPR 1IJFA 1XTSA 4TMZA 1OFUX 1NG9A 3EZ2A 4JLAA 4YXWD 3UKDA 3OEHA 1N6LA 4F4IA 4C7OB 1T0HB 1C1YA 2O52A 1GSIA 3VR3A 5FUVA 3THXB 3K09A 3PCRB 4DVGA 3VR4A 2ZSAA 2KBEA 3I61A 4MYUA 3KXIA 1JAIA 2JA1A 1JJVA 1R8QA 1GL7A 2XTZA 2FNAA 4FMBB 4PSVA 3W5JA 4B3FX 4DB2A 2WJIA 4W5HA 1YZGA 3MFYA 1K5GA 2FV8A 2OCPA 4MYHA 1O3YA 3OZXA 4TSFA 3FKSA 4TL7A 5L3QB 3VQTA 5C46F 2O8CA 2NGRA 4TTQA 1G3QA 3OEHD 4OHWA 2ZJOA 4FMCF 4HAWA 2ZRCA 1DO2A 1K6MA 4RZ3A 2J46A 3C41J 3NH9A 4D82A 5HPYB 2ZSBA 3QY0A 3GPLA 2H7VA 3BH6A 4B3CA 1UFQA 4BZPA 3SNHA 2IYLD 3VX3A 2R6GA 2OEPA 1G4AE 5E95A 1P2SA 1PUJA 2PT7A 4RD3A 1E1QA 4EJSC 1SVLA 2GJ8A 1FUKA 1G18A 2HF9A 1DVRA 1Q1QA 1ZJ6A 1ONBA 2UZIR 5CK4A 4B2IA 1E4YA 2Z43A 2ZU6A 4IOJA 2J7PD 2GNOA 1X3SA 1FTSA 1TF7A 3Q5DA 2QMOA 5CM8B 3Q3JB 4UNPA 4TQ9A 2RMKA 2ZI5A 3WY9A 4G5OA 4B71A 3PEYA 2GVZC 1WBDA 4GL2A 2MSEB 1A82A 4MKGA 4Q9HA 1PLJA 4FMCB 1ZINA 3L0SA 1DO0A 2J0QA 2JGNA 2ZM5A 1YKSA 2I1VB 1GRRA 4NYMR 3K9NA 1CJKC 2IYWA 1CU1A 2W6IA 1KIMA 3CRMA 2IS1A 4EFMA 1X1SA 3EXAA 4RFSA 1G8FA 2H16A 1OJLA 1TF2A 1IXSB 2VSXA 4TTRA 5D3MB 4FWTA 5IHPA 1XTJA 1OB5A 4JBYA 1BMFD 4KSCA 3I5YA 3QUSA 1MH1A 1YVDA 3IO5A 2YJTD 4PZZA 3L8YA 2BEJA 3FDIA 4UNQA 4DT1B 5KUTA 4V0NA 2QSYA 1VKJA 1S1MA 1KKLA 2WPDA 1JPNA 2BDTA 1ETUA 1EFHA 2F1RA 2B8TA 2RKOA 4M1SA 1XEWX 3B6EA 2QRNA 1VG8A 3EIEA 4JVSB 3T5DA 3HP1A 2IWHA 4MRSA 1LNZA 1J8MF 5E7IA 5JECA 1S4QA 1KK2A 4FN5A 2JAQA 4B44A 3CWZA 2QTFA 4FCWA 2MMGA 3IO3A 4YMTA 1NLYA 3REFA 4K8OA 2GRJA 4KHZA 3SYKA 4QHYA 4DHEA 1G19A 3H0KA 2OCBA 1OXVA 2J5XA 3H1TA 3CUEF 1XZQA 3EZ9A 4TWZA 3DPUA 1G3RA 4N3NA 5JSZB 1KTVA 4ZI2A 2A5FA 1E2MA 1FTNA 4DIDA 1TL7C 3SQWA 2WWIA 1EX6A 4TTPA 2GBLC 4ESVA 4PC1A 5AUNB 2RGCA 2YV5A 3BB3A 2GXAA 3K9HA 4GI7A 3BFKA 3AF4A 1T9HA 3E5HA 3U44A 5L3SA 5H70A 3CNNA 1VTKA 2R65A 3M6AA 1GTVA 3WHKA 1KAOA 4Q9JA 2IHBA 4TYNA 4IDNA 4QG7A 2ERXA 3U7FB 4AYWA 3LVRE 1E0SA 4MUBA 4A0RA 1KZ7B 1MABA 3B78A 2YZ2A 4GDFA 2BMEA 1AQUA 4RSGA 1MRSA 4QJ4A 2V3CC 1UJ2A 3LY5A 3AUYA 4LHXA 3AV0B 2I1QA 1L4YA 4HB4A 4KO8A 3GLGE 4C0SA 2ZUCA 3QOFA 4IDPA 4M9QA 4Q1CA 3MRSA 1E9AA 4CZ2A 4HDOB 5F9FA 2KI5A 4GZLA 2J45A 2DBYA 1BS1A 2ZSEA 2EYUA 1XWIA 1W0JA 2GAOA 1CR4A 2EWWA 2QL6A 4PHGA 1YU9A 3SOPA 4MGYR 4TQAA 2W2TA 5SZKB 3W9YA 3RVBA 4Z8YA 2DR3A 3TAHA 1UBCA 4NYJR 3TVTA 5K8LA 1X1RA 1CULC 4ZDKA 1T3LA 2PZEA 1YR6A 4YMVA 2IA5A 2AKYA 1NIJA 2EFEB 4KFSA 1LS1A 2A30A 3NHAA 2HT1A 2IYVA 5E7JA 2NPFA 1AKEA 3I1FA 1T91A 1SVIA 1KI7A 2DFKB 4OQNA 3RNLA 3T1TA 3DVLA 1ZNXA 3R8FA 4UQOA 4M4SA 1BOFA 2I3BA 2G3YA 4MDFA 3I73A 1OFTA 3B9QA 5D3MA 1VHTA 4UNNA 2ORWA 1SVKA 3B7GA 1UKVY 1RRGA 3QNUA 2KBFA 3RRNA 2JLXA 2Q9BA 3UWKA 4Q4AA 3C5CA 4Z1MA 3X1ZA 4IEEA 2FSHA 3PVSA 5EJEA 3TKLA 2ZYWX 4LBZA 1R6BX 4PSKA 3R9XA 4URWR 4B3BA 2FE4A 1EFTA 3GFOA 1KHTA 2H18A 3CR7A 4BEBA 4LYHA 4GNKA 4B76A 3T1QA 4A92A 4W5JA 1P4SA 4BGDA 4XSHA 4LZZA 4BFXA 3R20A 5HZHA 2ZEJA 1D5CA 4JL8A 4JT2A 3VNVA 1SVMA 2XZOA 4BUJA 1IQPA 1COWD 1EFRD 3N2IA 5C1BA 3ND8A 4XD7A 1R5OA 3D7MA 4B43A 1OPXA 1F2TB 5FI1B 3SJZA 2JLWA 4A9AA 2ORIA 4JSYA 3RSOA 3VU9B 3ICQB 1LTQA 1F3OA 4HLCA 3VR1A 4ARZA 3S1AA 2QUZA 5FTJA 4M1KA 1MR3F 4ZV4A 2WMOB 1G6HA 4TL9A 4LJAA 1NMXA 1XEWY 3A58B 3LRPA 3WNBA 4OHYA 3A4NA 1JBKA 3AP2A 4HZUA 3THYA 2LCFA 3IQWA 5CK5A 3U7EB 4GSYA 2XNDD 4G5QA 5FL3A 5FR1A 3I8XA 1CJTC 2XGJA 2IF2A 2BKEA 2CHQA 2W0SA 5EE0A 3TNFA 2F3TA 1LS6A 2QP4A 4AURA 5KTYA 3QI2A 3I32A 2C2HA 1YZUA 1IY2A 2OHFA 4MRPA 4D6PA 3I72A 3GLFE 5JEEA 2AWNA 2O5VA 3HR7A 2XNSA 4C2TA 2BC9A 2GWHA 3U3JA 2D2FA 4XWOA 3CLVA 4DLRA 2D7DA 3ND9A 2RGBA 2YINC 4ON9A 2KSQA 1UM8A 2PT5A 4F92B 4A82A 3GEEA 2WOJA 3MD0A 5DHFA 5KPJA 1S9HA 4QBIA 1YE8A 1TTTA 4NBSA 2CCJA 3KB2A 1LFDB 5F2EA 4C0LA 3EARA 4O0MA 3KZ1E 3QIAA 4F4JA 2FSGA 2QE7A 4WZBE 2ERYA 2QAGB 3LBNA 4HDQB 3U5ZB 3GLIE 2ZI4A 2CHGA 4OK5A 1EESA 2QMEA 2B6HA 4DB4A 2IEZA 2OE2A 1TUEA 4A6PA 3SJAA 1S2MA 2H1LA 1D2EA 2QAGA 1VG9B 2VQSA 4BASA 4ZIRB 2GILA 3WYFA 3FHTA 5DI3B 1UBGA 2FH5B 5JHGB 3C15C 1AGRA 4JJKA 1XEFA 1QHHB 1SVOA 4CIDA 2W2XA 4A8JB 3THWA 3AVTA 3F8TA 1G291 2C95A 1F6BA 4Q03A 1P3JA 2RGGA 3G82C 2PX0A 4JL5A 2J87A 2O0KA 4G01B 4EFNA 5FI0B 1EFRA 1IN5A 1I2MA 2WSSA 2EYQA 2CCKA 4E03A 3P32A 4HI0E 4TLDA 1OH8A 2NO9A 3IUYA 1CEEA 3GEIA 4IOLA 5JMTA 1FMJA 1MRNA 3KQLA 3RC3A 1KI9A 2PLRA 3LO5A 4P4SA 2LKDA 3DKPA 1Q22A 1XXHE 1XMSA 3P4XA 5CIWA 2QRZA 3AB3A 4YMUA 1PLLA 4CT4B 1DAKA 2QU8A 1M6NA 5F3WB 2D7CA 4HB0A 2GVDC 1Y63A 2DCUA 4RKEA 3G5UA 4EPRA 3FFBA 3R9WA 3RS4A 4M22A 1E32A 4R7ZA 2ZRFA 1V5WA 3U4QA 3ECCA 2CL0X 3KDSE 4WXRA 1S0UA 4OK3A 1YZQA 1DAMA 3FMPB 3PEUA 5AJVB 1VECA 2VP9A 4U00A 1OV4A 2NPIA 3QG5A 3LXRA 4DLYA 4BFZA 2WMNB 3FKQA 3EPKA 1JI0A 2NO7A 1E4VA 5H68A 1KDTA 1OIWA 3CBQA 3RS2A 2G0NA 5E7MA 1ZAKA 2CL7X 4EJSB 4C7OA 5TV2A 4DRZA 1ZC3A 3K70B 4ZPXA 3V4RA 3NDBB 2ZAMA 4HAYA 3UG7A 2OBMA 1DAHA 1SHKA 3GJ7A 4JLVA 4A0FA 2FGKA 2G0TA 2ZRNA 3OIVA 4LJ6A 5FPHA 2VPPA 3QXHA 3DEFA 3HWSA 1E1RD 4DSOA 4IDQA 4NCJA 4CEIA 4W9MC 3AVUA 2ZYUX 5KPDA 3SBDA 1CJVC 1WCV1 2BBWA 3OEEA 4JLPA 4R9UC 1E2GA 2D06A 3OEED 4P32A 1FX0A 4M1TA 3R7WA 1P9RA 2QA5A 1FP7A 4RD1A 5D3QA 1NSFA 4URUR 2ORVA 4GZMA 4B6EA 2ZPTX 3LW7A 1KO1A 2QG6A 1RFLA 3OE7A 4RJLA 2IXFA 5ANRB 1UDWA 3ZLJA 5C4GB 2F3RA 2VF8A 2V54A 1TADA 5EUMA 4QGGA 1W48A 1XD2A 1OXTA 1EK0A 3BH0A 1AA9A 4BFUA 1TPZA 1W36C 5KNDA 2OV2A 4Q9LA 3UWOA 1XMIA 3P26A 2IYUA 2OZEA 2XJ4A 3A36A 4QGAA 1FOEB 3KQNA 1VCOA 1G7TA 1G41A 1KOFA 2C77A 5DE3A 4P4SB 4L16A 1YZNA 4US1R 2GTPA 2JJ1A 4D2IA 1CXZA 1Q21A 3AF2A 4UNSA 4AG5A 1A2KC 1UADA 2IK8A 1ZM9A 3GLGB 3E2IA 1XMVA 3CPHA 3G0HA 1IONA 4M2LA 2R2AA 4MYTA 2AL7A 2VYFA 4LWZA 2GBLA 5JCZA 2Q3MA 4C4PA 3BB1A 3GJ6A 2ONKA 4TYPA 1W4BA 1FMLA 2X2EA 4B34A 2GCOB 1UBEA 2ZYTX 3K0AB 2WJYA 2ZJAA 3CR8A 2OFOA 3PG5A 4HAVA 3CRRA 5EXSA 3QSYA 5DI3A 3ZZ0A 2VHCA 2J9RA 3PITA 2C8VA 3L0IB 1HQCA 4RFVA 5BYJA 1GAJA 5FPKA 3E1SA 2ZR9A 2XB4A 4MUAA 3CW2A 4MGKR 5K8TA 5UKDA 4NYIR 1F2TA 3W8NA 1OYYA 4KI0A 1JALA 1OHHD 3LXXA 3W34A 4A15A 3NC1C 5CLLA 3ETLA 4JLMA 3HDTA 2HLDD 2JJ8A 2AX4A 4KFRA 1S8FA 1QHSA 4WXPA 2QPAA 2DPXA 3J81k 4V03A 3RWMB 3U6KA 4AKGA 5DSZA 4NDZA 5SZJA 5JWRA 2ZRBA 4NPHA 4TLAA 1R0XA 3GLHB 2V6IA 1JR3E 1P62B 1HEIA 1AGPA 1E79D 3B2EA 4CT5A 3QKUA 4NONA 5TMPA 1Z6XA 3ZDQA 3AKCA 3B60A 1G8GA 2WWGA 2X77A 3L0PA 4Y0AA 1DPFA 3GLFB 5FTLA 4OHVA 1CF4A 4I1OA 2C96A 1OKKA 3K9GA 4C0AC 4X8LA 3CF6R 2HF8A 2RH5A 1NVVR 3WMGA 3FOZA 2B21A 3H2YA 3M1IA 1W0JD 1WA5A 4LV8B 1G5TA 2WVJA 1W46A 2EQBA 4MQBA 3SN6A 2WIAA 1NKSA 1N0UA 3UIEA 3AP1A 5KU1A 2GXQA 3GQBA 5GJCA 4B73A 2H17A 4DSTA 4D4JA 4KAXA 2BHRA 4KLNA 1W1WA 3ZIAA 3SQXA 4JLKA 4G5RA 2HJVA 2B7CA 2Q21A 3CF0A 3D31A 3KXLA 4TQUS 1KZGB 1ZM2A 4PAQA 3ZS9A 2P6UA 1OKKD 1N0WA 2YWHA 1E6CA 4MITA 1E2LA 2RGDA 2P65A 3NBYC 1S9DA 1A2BA 1KI6A 3N2EA 1UEJA 5G3ZA 4KFTA 1IHUA 1FNNA 3ZD6A 5FL7D 3MUFA 4LRWA 2XAUA 4NCIA 3CNLA 1QHIA 4WZAE 4LUCA 2GKSA 3KJIA 4P31A 2IS2A 3PUWA 1G20E 4EPTA 1ANKA 3AVPA 1W4CA 1AM4D 4LYAA 1E96A 1W5SA 4ZKDA 3K0EA 3QXXA 4RCZA 3MSXA 4Q1FA 3B1VA 3VR6A 1UBFA 4QRHA 1E9RA 2C03A 3EIHA 1E2QA 5AJWA 2IYQA 1N6PA 2YYZA 3B85A 4PQFA 1UPTA 3FMOB 5BN4A 2JLYA 2Z83A 3TMKA 1G5PA 1DE0A 3VHXA 4MGIR 5A4JA 4Z51A 4QNRA 4WBSA 1KO7A 1DADA 2AK2A 2HEIA 4AY2A 3BK7A 1F2UB 2O8BB 4GMDA 8OHMA 2ZVPX 2VHQA 2ZYVX 3QKSB 5EXPA 1NBMA 4A2WA 3AF1A 2V6JA 1JQJC 1TQDA 3CONA 4QFMA 3RABA 2P6NA 2X19A 2QT1A 1FPMA 2ZE5A 4J0QA 1R0ZA 4U02A 3U44B 4TL8A 2FF7A 5GADl 1SXJE 5G40A 1DG1G 2ZRKA 4QHTA 2ODEA 4HDCA 3CX8A 4TMWA 4CGZA 2O8EA 4EJSA 2QM7A 2CLDX 1UDXA 2F6RA 4PPGA 5DO9A 3LH5A 2GJAA 2ZE7A 5FUYA 4XTRA 1FQKA 2OFXA 3LFUA 3NC0C 4KYIB 4PC3A 5EE1A 1Z8FA 4D4LA 4QL3A 3RS3A 5C2JB 4Y0VA 3BGWA 1CP2A 1OFHA 1ZW6A 1JEEA 1GIAA 3QXJA 4WOPA 5LDDC 3PV0A 4BECA 4PQRA 5L3SB 221PA 3THXA 3KXKA 1N6RA 1R10A 2ZUBA 3AKDA 1NY6A 2GF9A 4IFBA 4TYQA 2W00A 4KCGA 3ZYCA 3QG1A 1KMHA 2F9LA 2GCPA 3CM0A 3R7WB 5CJ2A 3RLFA 1ELOA 4DEXA 2F1JA 4DEYA 5EP3A 2C78A 1ZMXA 1QG4A 1Z22A 2WAXA 3B8HA 3NWJA 3PUYA 2ZRPA 4LBWA 4LJ9A 2BJVA 1GRQA 4JMPA 4IDHA 1MO6A 1PLKA 4Z8XA 4B3GA 2O8FA 1L2TA 4BFWA 2BBOA 4QKQA 3ZS8A 1NBME 2PZFA 4M1YA 4UKDA 2E1RA 5KSZA 1VIYA 5KDDA 2YVUA 3IEUA 4AKHA 3Q9LA 5HZKA 4IW3B 4DJTA 4IHQA 1NJGA 2WICA 3PQCA 1P2UA 2CXXA 1QHHA 5JWHA 3BAFA 4LI0A 5LB2A 3MMPA 2BMFA 4II7A 3SJCA 5TB5A 4DUGA 1WQ1R 4UXHA 3GLIB 3PXGA 1XZPA 2PMKA 1US8B 4BQSA 1RC8A 1M8PA 2HV8A 4H1UA 1G8PA 1G5RA 4GT1A 2IF0A 4RD0A 3TW4A 4C9BA 1E9CA 3QXSA 3I3SR 4KVGA 4Q48A 4QHSA 1ZU5A 4X8OA 1Z29A 2OO7A 1W0KD 4XWAA 2JLQA 2YOGA 4DLUA 4NYJQ 2N42A 2ZANA 5HTKA 2JLUA 4R98A 1PUIA 4AYXA 1NN1A 2G1JA 1ZNZA 2WWFA 3UMFA 2EFHB 5AR1A 3BS4A 4NTZA 4JBXA 1D8TA 2QP3A 3W8RA 3C16C 2OUKA 3U3KA 4B35A 1IXRC 4I1UA 2W6JD 4Q7JB 4OI1A 2WWYA 4ZCLA 2J3EA 5G41A 5HE8A 4DWJA 1YR9A 1V43A 2V1XA 4HUTA 1ZM7A 2JLSA 1L7VC 1Z6YA 1T3SA 1DOAA 2BCGY 2DB3A 4TN1A 1OIVA 4NCNA 4LY6A 5BW8A 1K8RA 3B82A 4Q4HA 4TT3A 2O8DB 2PJRA 2PL3A 4A0GA 4K46A 2F55A 5FBWB 4BE7B 1GNPA 4KBFA 1M74A 2JLZA 4HLUC 5L8VA 5J4LA 3ICEA 1SVSA 3W6PA 3NEYA 1F60A 2CK3A 2RHDA 1H8EA 3KKMA 3CX7A 5EUQB 2VP0A 1RRCA 4EUNA 4US0R 2VHJA 3U60B 4ITRC 4N0EA 3QEOA 1KSJA 4Q01A 2IX3A 2NQ2C 4B3XA 1S1CA 2IS4A 4RZUA 2AD5A 3MGCA 2O8EB 2QT0A 1MOZA 4Q5IA 5EP2A 3IEVA 1XP8A 1LY1A 1J99A 3ZD7A 4URZR 2CEAA 4TZ0A 2OXRA 3GJ0A 4DLTA 3UPUA 4LCBA 2J0UA 3DMDA 1E2EA 521PA 3WXMA 1KK3A 2PLFA 4EAQA 1KYIA 4GP7A 1XD9A 4Q9KA 5CDFA 5KO2A 3SE0A 2OLKA 1P7CA 2JJ1D 2FSFA 1OXUA 2VRWA 4LJYA 4M1MA
chains in the Genus database with same CATH superfamily
1ZISA 1ND5A 5AYVA 3SD7A 4BCBA 3ADPA 1TCBA 1N6KA 4KITB 5KSOA 1GZHB 3T1YB 4PX5A 1TCCA 1DJOA 4FE7A 1NUTA 3H19A 2PGNA 4FR0A 1BA2A 2ODAA 2PWYA 2RIRA 3EQ2A 1Q74A 4RVSA 5CJPA 5BT8A 2W2VA 2OQ2A 2ZE6A 4J8PA 4QWWA 1Y7LA 1U90A 4AKIA 1SCQA 3MS7A 1MB2A 3NX4A 1SBIA 1UQTA 4FHZA 5KEIA 1SC9A 1XPJA 2D2XA 2ZJ2A 4HQNA 4OXIA 2E49A 3ZDYB 5CFLA 2PIAA 3EZ6A 3MELA 4PC6A 1S2IA 4GVPA 3GB9A 621PA 3JQAB 5H0IA 4J4BA 1KEUA 1GP2A 3L7YA 1A4RA 5BV0A 2UZ1A 1CDDA 1MX1A 3LT1A 2PO5A 2AQ8A 1C29B 3P52A 4YDSA 4EHIA 4DDWA 3J7AC 4ILEA 1VMDA 3T94A 1LWNA 1B0AA 3A1TA 4H60A 3CWCA 4KG7A 4BB0A 4BFSA 1RP7A 3P96A 4WQMA 5EAIA 4AG3A 3W5AA 3GLRA 2EJVA 1SRRA 1ZN9A 5DHAA 2WBLC 5LP6A 1XZJA 4RXUA 3SLGA 4L3VA 4HYQA 1FTGA 3OBIA 2UU9B 2IOYA 2PRJA 1XEXA 4IKEA 3H13A 1U0RA 3K73O 1CRQA 4WNYA 1X6VA 4W4TA 3AW9A 4R51A 3DL4A 4DCOA 3IULA 5IAKA 1U8UA 1N33B 2DWUA 1NBWB 1MJFA 2XQVA 2XYGA 1C8KA 1G1AA 2HCTA 2JASA 1LBTA 1XJWA 2O7QA 4PN7A 1ZONA 1WXWA 2WFZA 5EYPA 1UJ6A 1DEHA 3TLAA 4WFKA 4CYMA 2PNFA 3AOEC 4HN4B 2ZRHA 3C97A 2Q3CA 1ORWA 1Z5ZA 2ZS8A 3U7QA 1MOSA 4B33A 5B36A 4Q19A 1D6SA 3UT5A 2HDHA 3P94A 2ZI6A 3KG2A 4CU2A 3AR5A 4X3PA 1SKAA 1TRKA 4B2LA 5JVDA 5KQLA 2JFWA 4K9MA 1ESZA 1GKLA 4GXNA 3AEQB 2JAPA 4LZNA 2QTAA 5AWFC 4HRAA 4K86A 3QWHA 1C8VB 2NO5A 4ZQIA 1A5AB 3HBFA 4YXWA 5M34A 4YJGB 3CU5A 3A31A 1L7BA 1TCVA 4G4IA 4B17A 3PFFA 4PRZA 3FKSD 1Z0KA 1Q0QA 1U8AA 2GEDA 1GZDA 5IUJC 1V2HE 4EHJA 3QNWA 3LP5A 2QEQA 4QYIA 2Q6OA 4IO0A 2WUWE 1ZIYA 3L8ZA 4FMPA 2PJDA 4RF3A 4LF7B 1SQ5A 3MTDA 4QRIA 3E7WA 1W94A 2QGZA 4NMMA 1NRWA 1P81A 2X2OA 2NYUA 3N7UA 3UT6A 3CKYA 5L6LB 1KE1A 3LT5A 5J5AA 2EG9A 1NP7A 3D3QA 2XXAB 4QDTA 2HSDA 4YMSA 1E3JA 3DV9A 3WGKA 3BRQA 3CRNA 3PNSA 4WSOA 4OREX 3MGGA 5IXSA 4B3DA 4I19A 4UULA 3NTUA 3SLKA 3A1SA 1Z28A 3RYFB 1ZGAA 2AG8A 1U3VA 3LSTA 4M8SA 2NU9A 1I6LA 4U4AA 4W7HA 4L9SA 2J7PA 3OIYA 4JU9A 2AD1A 3ZUPA 1TZCA 5IAEA 3II6X 1XPOA 1VSUA 1A9YA 3KSBC 2AOTB 4QODA 2E5FA 3HZOA 1RKBA 4WZ6A 4BQEA 1QO0A 1VCIA 4DARA 1XL1A 2GYVA 5A62A 3LT4A 3MWKA 2V7TA 2IHYA 3TSOA 1MJGA 1V3TA 4LRXA 3TB4A 2B4RO 1M67A 1SB9A 1QWSA 2PLWA 3TMAA 4ESOA 1RAFA 1XBTA 5EIFA 4YAKA 4YQZA 3OO0A 3GLHA 3JY6A 1PV2A 3S1AB 4Z7NB 1I4WA 1FS4A 3I28A 3VDXA 1E8DA 2GYUA 2DQZA 5IEBA 1NNLA 4DMUB 1RXWA 1J25A 3L4BA 1I32A 3NTLA 5IKMA 1PU2A 5TGTA 3DFZA 4C3ZA 4DNOA 2V3WA 4C2AA 4F3RA 2QX9A 5LB4A 4RU1A 3TJZA 2WKPA 1QYWA 5TNXA 4AN0A 2FPLA 3FYUB 5SZIA 3DBVO 4ZRMA 4DLZA 4F6RB 1ZL2A 1Q19A 3M5WA 5IFKA 1HDRA 1NLFA 2AWOA 3D6UA 3OE1A 3OMLA 1OU0A 2P4UA 4X54A 1CY0A 1BW9A 1RKVA 1UL1X 4JI3B 2JI4A 1U28A 2GHQA 4KFUA 4Y1FA 1RPJA 1W88B 2ZRQA 3QHAA 3HJGA 4R2LA 4XWGA 3KHKA 1PJTA 3FWKA 5AI9A 3TQHA 2E6KA 1QE3A 1BG6A 1RKQA 4PG6A 1EJBA 3WYBA 1V1MA 3LXUX 3NVMB 5ELLA 4TWRA 2AXPA 4QPNA 3WL3A 2R97A 4KQ1A 2MYUA 3LVQE 3M4YA 2H07A 3DT8A 3LVBA 1HT0A 3F96A 2O2JA 2OGUA 1E7QA 4GI2A 1E6EA 1KU0A 4LV5B 1DIGA 3K94A 4R2IA 3MVEA 3QOYA 4H35A 4HSEA 4LHVA 5IRCD 4AK9A 1G8SA 1EGMB 1NRXA 3F7MA 1T3GA 1NXTA 1XTKA 1ZX1A 2IUFA 2OV3A 3QVXA 4QD3A 5AP9A 4IF4A 3LV8A 3DBHB 2F1IA 3EJ6A 2E4VA 5BWNA 2B4AA 1OAAA 1GL6A 1ZIOA 1XVLA 1C9YA 1SQ6A 1GPKA 2EX0A 2LNDA 3NATA 4JBWA 1JIJA 3T5TA 2VUIB 3IUEA 4YI5A 4BMVA 3GZJA 4LXHA 2WTBA 1QDEA 4TKZA 3PRHA 2P75A 2CMKA 3CCBA 3NRBA 3TLXA 2ZLBA 1LF5A 1V11A 4CIVA 2X3FA 2WV9A 4S2EA 5E0KB 1U8EA 4J2TA 1B74A 2VSFA 1EGQA 1T4GA 3PIIA 3WWEA 2XDWA 4EG3A 2JANA 4ZP1A 1AC5A 1O95D 2BLNA 2PHZA 1H4VB 4TSFD 4UJ3A 4UEJA 1J9GA 3SIRA 4X64B 4BYGA 1L7EA 1KJIA 3V9AA 3B13B 5TPZA 3MG9A 4YREA 1T3TA 1YBHA 4N5NA 2GR9A 3CUTA 4BNIA 2F43B 1OHHA 1XLWA 1RAAA 1GL9B 1SZCA 2AKAB 2QLJA 5ECGC 2W58A 2A9KA 1UDAA 2C88A 1PEKE 3HUFA 2YIDA 4PNPA 3O4GA 4UU0A 2GD1O 2XGSA 1GUAA 2XYQA 2J08A 4D4IA 5IUKC 4Z4GA 4OAQA 5DLYA 2Z8YM 2HHHB 5EL0A 2FEOA 2NPOA 1WCWA 4G3XA 5TS2A 4GO1A 4L9WA 1F6DA 1VL2A 3IA7A 4KNWA 3OICA 5JYCA 5KC8A 3DTVB 2VS1A 4PF1A 3ZPXA 2WILA 3E6AA 3KJZA 3TQCA 2NQTA 5HKOA 3ER6A 5IKEA 5IVPA 1YDHA 3L43A 4GZ3A 4TXJA 1KZ6A 1U4SA 1Q0RA 2FRVA 1N2CE 2E87A 4P7JA 1U1FA 5BR7A 2V7UA 2AOWA 4MCIA 4QU5A 3GT0A 3LD9A 3RSGA 5J5VA 1GFZA 4FPXA 3NBUA 4Y9UA 2BMAA 2J3QA 4Y6OA 4RXMA 3AWIA 3MWJA 2C2KA 1JT9A 1DG3A 2G0AA 3ESQA 3PYMA 2Q2QA 5EMKA 2Q7XA 2YS6A 3L7IA 4KODA 1R3UA 1RYNA 2R4QA 1JQBA 2V98A 3UMSA 4PPYA 1JR6A 3DL2A 1PTJA 4GSKA 5TT0A 3WIOA 1IPHA 3BJMA 1O96A 2HA7A 2MSLA 3T3HA 3GEBA 3S1SA 1ZZGA 2WINI 5J23A 1DSSG 2HO4A 3HZZA 4RD6A 3THOA 3LP6A 3TR6A 3VKFA 5HZMA 1MVLA 1KKMA 1NI3A 4IGKA 3DOHA 4OQ4A 1JEOA 4EM6A 2Z1MA 1F2VA 3AB8A 1ZH8A 1HC7A 2OCLA 4RWEA 1T9GS 5L95A 2H5JA 1RPNA 5K0ZA 3NU1A 4L5JA 1W5EA 3QWIA 3TLEA 1EVJA 3O8NA 4XJXA 3R5JA 3R6WA 5KAPA 1XYYA 2AYXA 3NWOA 1EQAA 1WUJS 5ALFA 3RU7A 3LHSA 1WD7A 3GLKA 4NY1A 1WXGA 1U0HC 1N3LA 3AEUB 2V9PA 2JJMA 3I45A 1Q44A 1Y5NA 3PYLA 4XJSA 3KT3A 1AOXA 4PANA 4XUDA 4IWYA 3QVGA 4M54A 3AHEA 2EATA 2R1VA 5EYPB 5F98A 5K3FA 3WJAA 1Z4IA 1DAOA 3CSSA 2XUOA 1E3TA 5DT2A 2CJWA 2VTVA 5CPBA 5GWXA 1RBZA 4GXQA 3UFXA 4J75A 4G5YA 3ZH9B 1VC2A 2WUVA 3FPEA 1TFUA 2BKUA 3MN1A 4Y2VA 4PIPA 3U7IA 1OW3B 4CEHA 3OMXA 1IJEA 1D0VA 1OXBB 2C57A 2ZT7A 2DLDA 1L3CA 4KU4A 2E1PA 3IJPA 1KZHA 4E21A 1D4OA 1ZIPA 1JSRA 2DGDA 4RYDA 2O8CA 2BV3A 4FYMA 3IH5A 2WJHA 4YJFB 5A5EA 1GSHA 4MROA 3PXEA 1N6OA 2AEEA 4M37A 3ZWOA 1FSPA 3O3OB 4F5WA 4IHAA 4X6UA 4IX1A 4R1NA 5JS7A 4R68A 1OWLA 3P4UA 4GLLA 3OD1A 3RVDA 5FNZA 4Y2SA 4J9VA 1UXHA 1YIAA 1JB9A 1LPNA 3LCRA 2EWVA 3AU8A 1G8MA 2GF0A 3UPTA 1G8HA 4PBTA 3K9QO 5F1PA 1CFZA 3VVBA 1F12A 4ZAXA 2CV1A 3PUVA 5BQ3A 1KJYA 1SZJG 1ESNA 4DRXB 2XKKA 2XRFA 4PZEA 3TLBA 5BQXA 3BSWA 1HI9A 2W71A 3IDZA 1Q0UA 4UVDA 1TGYA 1JQKA 3FDJA 4AT1A 1JDJA 2WIJA 5JQGA 2MMCA 4PBRA 3LM8A 1S89A 3LPCA 3QF4B 4MA0A 4DMFA 1GTMA 1XTUA 4UU8A 1FXWF 1GYRA 3ENNA 5BOSB 4H7KA 4RHFA 2O7SA 2HK6A 4IIDA 3V1YA 3ZBTA 5C1OA 5ADVA 2BEUB 2B34A 4F3CA 5C7LO 1FMFA 2HLNA 1N2CB 2G04A 1P77A 2G25A 2NVBA 2CXQA 4EELA 2PYZA 4RK4A 4BEVA 2G76A 4NE7A 4CLRB 9LDTA 1N3BA 1TOAA 4D8XA 5K8VA 3C7CB 4Z9YA 2XX3A 2B2XA 2ZSUA 4WFJA 1QPBA 1IY9A 5ALHA 1LRLA 3B1WA 1SBHA 2Y1XA 4WMLA 3AOEA 1E6UA 3FYUC 1JNYA 2VL7A 3W6NA 1A95A 3ZQUA 1Y6ZA 1KNXA 2AEFA 1IN4A 1Z8HA 1TYEB 5KOYA 4HZIA 1BFUA 3GPIA 4ZODA 3GN2A 4ZV7A 1JHMA 4LQCA 1Y8AA 4K6HA 4QQ8A 1BYUA 3JS5A 2EJTA 3MGAA 3PD1A 5EGSA 1QSGA 4ICIA 2I7VA 3IBGA 4I5DA 2CFTA 2DYKA 4LMAA 1K6IA 3Q10A 1T3ZA 3PU6A 2YYSA 1UBRS 4RSRA 4LF9B 3GNTA 3BWVA 4C6TB 1EDOA 2LCIA 4YACA 5FWAA 4JNKA 5IDYA 3G8CA 5G2OA 1P19A 1XAJA 3WA6A 4I1RA 4CCYA 1UBKS 4CR8A 4YIKA 3ULKA 2OWDA 1OH5A 4MKFA 3ZYZA 3BWEA 4C6SA 5IPFA 2OUIA 5J40A 1E99A 1O6BA 3HGQA 4CTKA 2HMAA 5EJ8A 5ALKA 3L4EA 1IN8A 3AFOA 2J6HA 1QPGA 4YALA 2EERA 5LMUB 2FQQA 1JQ5A 1ZOIA 2XEXA 3HC7A 5D5PA 1JDPA 5BWCA 2F8SA 1JJ7A 1MPXA 4DLXA 1HY3A 3DE4X 2VAVA 3TO5A 1JWAB 4ETWA 2P67A 2O5EA 1P6XA 3EHEA 4D4KA 2J5KA 4D26A 2V9ZA 3GFFA 3L49A 1LDMA 4UDXX 5KDOA 4HR7A 3W2FA 5BR4A 4JOSA 1RT9A 4ZJZA 2EL9A 3D7LA 3H2IA 3GEPA 3QLUC 5AJHA 1E1QD 4GFDA 4D9KA 2QBYA 1IHDA 4MGZR 2VCYA 5TY0A 2GLXA 4AX4A 3WLOA 4OJMX 4BMDA 4RDIA 2VNHA 2IV2X 1GGFA 3SMVA 2VKTA 2IXAA 3ETGA 2PMFA 4JI1B 2BFPA 2ZWIA 9LDBA 5A7HA 1DZ3A 2POCA 3MJRA 2B5OA 4KR9A 4AUKA 2RC6A 2GXUA 3HI4A 1AXRA 2N1BA 2PBRA 2V5AA 1TO6A 4UMDA 2BTQB 4WLVA 5F77A 3T99A 1ZK1A 2QW1A 2I6UA 5JFGA 1QZXA 2APJA 1P9WA 2XCLA 1YL6A 3BXGA 4R5MA 1USVA 3ECAA 1GDDA 2GAFA 3ZIUA 1POWA 2C5SA 5C51B 3I62A 2J5QA 2J9FA 2ZI7A 3HKEA 3Q3HA 3B5JA 4EEZA 2EHJA 4XSGA 1JSCA 5LOVA 4RZ2A 3DGEC 3C6YA 3JXEA 3NH6A 1LVHA 1QH9A 5CUQA 1SHJA 5HUQA 1QYDA 3EQ7A 3SYRA 4DIUA 4MTLA 1GPLA 1VYVA 4RL4A 5CTAA 2YCBA 4XUEA 4ZVVA 1W0CA 2OILA 4MIOA 5EWJA 1QTRA 5DCYA 1WSWA 4A5SA 4URVR 1ZD9A 2XZTA 1OASA 4JA0A 5GMOA 2V4UA 3RGWS 5HJ5A 4ZO9A 3LUCA 2BEKA 4ZQHA 1NQVA 3TBKA 2WF7A 4FFOA 5CDTA 4B32A 3TM5A 2O23A 4R8MA 4CKZA 5T5QA 1YNSA 1XN1A 1O95A 2AQHA 2LRHA 3P8ZA 5AKYA 4F4FA 4L02A 2GZDA 1AUPA 1W36B 4OYYA 4PLWA 1E9BA 1NKVA 4DBLC 4KKVA 2I6TA 3NGLA 4PGAA 1HE3A 1CNFA 2OZLB 1F0KA 3KQQA 2ONJA 4R40A 4I3HA 2OD9A 1DTSA 1SIBE 3SR0A 3NB0A 5JPIA 3VPDA 3H65A 4ND2A 4EMSA 3HPQA 2D1YA 2ODWA 4GLBA 1Y9ZA 2C98A 3ONDA 3TAUA 4DG5A 1B15A 1DQPA 1IDOA 2CNLA 2YWFA 3CPSA 4GOXA 3L46A 4HT3B 2XCSB 4BGIA 2HCRA 1OGIA 1SXGA 1ENPA 4OJKA 3ZHYA 3T06B 1JLLA 1UR5A 2VBGA 2XB8A 1NDUA 1KZ1A 1VHWA 1T2EA 2I80A 2OO5C 3OE7D 4UVGA 4XVHA 4OEHA 5JISA 4TS3A 4M89A 3TSWA 4BNDA 5LDGA 3ZGXA 3FF4A 4BO4A 5CEEA 2QN9A 3C3XA 4KVZA 3L06A 3IKJA 1X70A 3NHUA 3FX2A 2AE2A 2PGIA 4KN9S 3U3OA 4LVNA 3AI7A 1PR3A 2WQZA 1G17A 4UD2A 2VJLA 2DKFA 5B3KA 2QVZX 4ZXFA 3R7DA 1UKCA 4DRYA 5JJKA 1V16B 2DOKA 4MAFA 3GJ5A 2AI2A 2IUEA 4GW3A 4KQMA 3VX4A 2R87A 5JBQA 2Q3EA 4LGVA 4RF2A 4JY7A 3DLHA 1IYZA 1AX9A 5ALWA 1RYHA 5JEDA 3ZQJA 2HSGA 1FP1D 2MWMA 2ZBVA 4G0NA 1E77A 1HDZA 3ZV6A 2UUOA 3ENWA 4Y9SA 1MFPA 2XJ9A 5DLEA 4FQ5A 3GP8A 2XI4A 3TZCA 3QXCA 6CHYA 4OL0A 1G4UR 2XRYA 2EFDB 4I50F 4HWGA 3M3HA 4LJRA 5J2UB 3KSRA 5FTMA 1QG2A 3DKVA 4JLSA 4U2CA 5FHRA 3BOSA 4EKIA 3TR0A 2SHKA 3JQ8A 3KKOA 1AQIA 3JVVA 4OHPA 3P2KA 4HAZA 5EMJA 4M55A 5LN1A 4MW9A 2C4UA 3AJEA 1ZVKA 2BGIA 3F49S 4U2FA 2I6FA 2X8AA 3MWYW 4LJSA 5HF5A 1FF9A 1F8GA 1XYGA 1PL8A 2IZ1A 3PR1A 1YTUA 3O83A 4AO7A 2AG1A 3VZQA 3C5HA 3E4CA 2XDAA 4FKBA 4UU1A 5ARCA 5A6SA 1E9SA 3DEZA 3NWPA 2B69A 3RJ9A 1L8QA 1JA9A 3HXLA 4IXMA 3A1WA 5SICE 3SFVA 4TRMA 1HH4A 4YMWA 5A4IS 5IU6A 5EWMA 1YDWA 3NWEA 3NTVA 4KR6A 2REOA 3STXA 1M7GA 1EM8A 3WGMA 3EY4A 4L7VA 3I92A 5DGCA 4CV3A 5DCLA 3GLIA 1QVWA 5FBQB 2NTYC 5E8RA 3KETA 1BE6A 1JDVA 1SB8A 2ZYDA 4OMCA 3M1AA 3W9SA 4GF5A 5ECDA 4QYXA 3OCZA 3T5AA 2CFCA 4FYVA 1ZD8A 3NHWA 1FK8A 3L0DA 1DFIA 2B4KA 5CP8A 4G0UA 4F3KA 5F2OA 4IVRA 5DMXA 3VSAA 2GFIA 2K5UA 1DWOA 4ZHQF 3O8RA 3I1JA 1T9CA 5K0LA 4LEIA 5FULA 2FSIA 2B9EA 3PT5A 4N82A 2J1LA 2ONCA 1V41E 1G2OA 1GTG1 1R8SA 1I4OA 1V3VA 2ONYA 4C0JA 1E3MA 4IILA 3W6OA 3B7PA 1T2CA 1VRCA 3QX3A 2D3TA 4JSRA 5ARDA 3E7FA 1TQ4A 3GIWA 4ZCMA 5ICMA 1N0VC 2QVGA 1KJWA 5G3YA 8LDHA 1GPJA 4C3UA 1WQ4A 5K0FA 3ZDDA 3LCVB 4DZZA 1QVVA 5JOQA 5K6RA 5IF9A 4L0CA 3JQ7B 4GM0A 5B2ZA 5DK4A 3TUIC 1FDWA 3LGAA 3U48A 5BSGA 4NP6A 4O2AA 3C87A 1XXHA 5KB3A 3GJYA 1OXSC 2VUHB 1U9CA 2NYVA 4HVLA 1LSJA 5KOHA 1T6ZA 1LLUA 1RM5A 1UJNA 3ED1A 3P0HA 3EMVA 1XPUA 5LP6F 3A4IA 2JAWA 2Q5IA 5DCUA 4ECAA 2R7NA 3WDMA 3THYB 3HCBA 3GFTA 3BBPA 4MB0A 2V5VA 2YUTA 3CO0S 2IW3A 3ICOA 1SA0A 1R9JA 2GZ2A 1TW3A 4QUGA 2G7MC 2V58A 3WKAA 4EUKA 2WYHA 2HU7A 1I2AA 4PQGA 4ASUD 2RB5A 4ZAVA 4LFCB 3V5NA 2VPIA 3TECE 3OETA 3Q9SA 1O4WA 2OXEA 3P9QA 2GXSA 4AXXA 3EW9A 4BMSA 2Y8EA 4QXMA 5J5CA 3F71A 4HGYA 3H9EO 1J07A 1T43A 4DCSA 4BWGA 1G3UA 2Z08A 3KFVA 2RKWA 2BDEA 2AMJA 7REQA 5B64A 1B6RA 4WKPA 3I58A 4ZN6A 4ILKA 1CT9A 4JNCA 4CKYA 2HXSA 2GHIA 3E5RA 1D2AA 3ZVLA 5A9SA 1JL3A 2X9LA 2DP4E 1RBQA 4G37A 3IIJA 3TB6A 4FMDF 1BRTA 3VC1A 4G1EB 1Z7BA 3UOWA 5AUNB 5HRAA 5DHTA 2QW0X 3O92A 2CL5A 2H2FA 4P9NA 5HOQA 3EZNA 2IV3A 5BSEA 1J2EA 4MKHA 1JFFA 4YJDA 3NJRA 2CNWD 4XWKA 2PUEA 1Q57A 3PC2A 4Q93A 5J4VA 5BUSA 1RFGE 4KNVA 2HRQA 2K6GA 4OSOA 5A6VA 5FPSA 2AZ4A 4HNRA 3UKOA 1TEHA 3PFCA 3T1NA 1N5LA 1C7ZA 2OFFA 4AKEA 1W85B 4GPZA 3A9UA 1E2PA 1R6TA 2OGWA 3E9CA 3RODA 1P3DA 3DJFA 3N0VA 5DRTA 3SKXA 5B3LA 1ZRNA 4BNYA 4Y2TA 2QRJA 3A9VA 1M34E 2LP4Y 3M70A 3UMGA 4ZFNA 3FCCA 1PEAA 2GESA 2QMZA 4GKBA 4JQCA 2ZRLA 3G79A 4B4WA 2C82A 1BU8A 4HDRB 3FB4A 4DWOA 2I1LA 1PYDA 3GNLA 1OFGA 3RRYA 3LUKA 1IXKA 2ZT8A 4ACBA 1E0KA 3K53A 4QTXA 3UK6A 4ER7A 4Z1MD 4JI8B 3AHIA 4M0FA 2AG0A 3M81A 4M8IA 3MBOA 1MW8X 1VLQA 4NCKA 4GLFA 4MJ3A 4RKQA 1EX7A 1FE8A 2PLNA 3FY4A 4KJXA 4QJBA 4DKXA 1ZICA 2I6XA 2I6SA 3WRVA 1EI9A 3WYNA 2ATXA 4E13A 2A0WA 5B7GA 4AJ4A 3AM3A 5EINA 4EF5A 1MHPA 2E4YA 4PLZA 4CM5A 1YS6A 3FIUA 3B7WA 3GGGA 3G1TA 2D2EA 2NZJA 1ZVQA 2PAFA 1UFKA 2W43A 2XIQA 5CJJA 1II0A 1ZGHA 3M82A 3FTQA 4GE3A 3SBEA 1J5XA 3Q41A 4XWYA 4K1LA 1IBRA 4B4VA 4JFRA 4LRSB 4ZOLB 3HLTA 3JYOA 1SR8A 4KQWA 3H6GA 4RVOA 2C59A 4EY4A 4DM7A 3HBLA 4PO9A 5K3AA 3DZJA 1H5NA 4MIYA 3AKYA 4R4JA 1L6RA 1XCLA 3CBGA 3DBRA 1C9EA 4QLBA 2QVYX 3DMTA 1SRQA 2H4FA 1KRHA 3NAMA 4KN8A 3I0ZA 4M1MA 5EI5A 5JARA 1OXMA 4PIMA 2G7ZA 4XLTA 1LPOA 3KOWA 1LKZA 4S12A 4AJ2A 3ZY2A 4DC0A 1QK3A 4OQFA 2WOOA 2QD4A 4YRKA 3U6BA 2ZJ8A 1G7CA 3Q8XB 5BV2P 3IOBA 1YS1X 3KQYA 3PEVA 1ZRHA 5DX8A 4YAEA 1XDDA 4OFBA 1XRQA 4MPPA 1UZAA 2O2EA 4R16A 3N5KA 3L2OB 1QHNA 4EHBA 2H2WA 2ZB7A 2CCGA 3JV7A 4EJFA 5TC4A 4IIJA 1XTPA 3IEMA 1EINA 3MLBA 4ZDIA 4IDEA 1ZXLA 3S29A 3BGDA 4RCVA 3CPJB 2BGRA 4CIXA 4PV7A 1EVEA 1JYEA 4TL6A 5BV1A 4LX0A 3RYCA 1EP9A 3OZAA 2G71A 4HJRA 1VB5A 4ID3A 1Z0AA 4OHCA 3UB2A 5EMNA 4YYEA 3R0ZA 5ALNA 4MPRA 2VZEA 2QLLA 2WF8A 3ZCPA 2HFJA 2IZ6A 3B51X 1CQZA 2B3TA 3F3KA 3PCXA 4LS3A 3UH1A 3ZK7A 3DXXA 3OUUA 1Y4AE 4A2PA 3W79A 3EVZA 3JRWA 5C18A 1RKXA 4RS3A 5MN5A 3RUDA 3W5SA 1KY3A 1QZ3A 1QVRA 1S7CA 4Y1EA 3UY4A 3H42B 4JYAB 1FX0B 1KVQA 4BC1A 2X8JB 1TF5A 3LPDA 3ZHXA 1KEEB 3L6BA 1E6WA 5TR9A 6Q21A 2PANA 3EVDA 1KAEA 2BOVA 3TJRA 1L4NA 1M8GA 2G9VA 4EHHA 2HNKA 1TM4E 2D2IA 4WDQA 4GR5A 3H6HA 1B8OA 1V96A 1QGUA 4HDKB 4IDFA 1MV5A 2GM4A 1KFKB 1WEKA 4FS8A 5CT5A 4PSAA 1GT91 1KVTA 3HR8A 3H9GA 4XQ9A 1P61B 1VKHA 3HXKA 1B0UA 3X43A 2JFQA 3F2IA 3RYTC 4OYRA 1NXXA 3R41A 4DCUA 1NIPA 2IIBA 1RQRA 3O47A 4URHA 1LNQA 1WW8A 3A1DA 1CV2A 4KDRA 4RH3A 5E4YA 3RU3A 4KN5A 4GKVA 5FTNA 1ZK3A 1Z68A 4UTRA 4YRZA 3E23A 4BKQA 1YBVA 4L15A 5A9SB 2ZJ7A 4UZFA 2JI6A 2Q7OE 4EQ6A 5CU7A 2YRFA 3QX9A 1Y8ZA 4P5DA 1JE0A 4RMHA 3ZXIA 4D96A 4YUZA 1UT6A 4JQYA 1KIAA 2O3SA 3BMCB 1P74A 3F2VA 3U13A 3G9UA 5K51A 5BVHB 1UCFA 2WNSA 1EWQA 3Q40A 1NM5A 4JJ4A 2HUPA 4F5ZA 1XJ5A 3HCDA 3MLEA 2UYYA 4XIIA 4OHMA 3IVRA 3JAMA 5F2KA 4ZEXA 2RHWA 5EXTA 2FZLA 4NPAA 1E1NA 2LPMA 1IVSA 3MAGA 2QNRA 4O2LA 421PA 1BDJA 3D6AA 4Y2UA 5SY4A 4Q6BA 1V4VA 4QA9A 1W30A 3D6VA 3O9MA 4M87A 4XVUA 3DDNA 4HLUA 2Q1SA 2NUPB 4J6EA 3R2JA 5D85A 4QC2A 4DCCA 1R4MA 1XXHB 4XGQA 4BB9A 2O5CA 3LYAA 1ZNWA 5FOUA 3OCUA 4CCAA 2ACKA 4K9OA 1QAMA 1ZJJA 1K66A 3TLZA 1N0IA 2IEBA 1ZR4A 4BLSA 1Z37A 3I8SA 5BXQC 2B82A 3EQZA 1Q17A 4FNMA 4PYKA 4UHFA 3Q8MA 2FPXA 1Q3KA 1WWKA 2YL2A 2EW1A 3CIOA 5IYZB 4Q7QA 4HCJA 4K81B 3ID6C 2OC4A 2VHEA 3F7NA 2OVFA 3B3JA 5D6NA 4O3MA 3VR2A 1AJEA 2H0RA 1DCKA 2OVBA 3BJZA 4Z6KA 3ZGVA 1TCAA 2XCUA 1NAHA 2WIBA 5BSTA 3EPPA 1SJ9A 2Z6VA 2P0AA 5CFNA 2DMRA 1ADJA 2FDXA 3KKPA 1XNQB 1PW7A 1C7FA 1VKNA 1XELA 1U99A 2WK1A 1GWNA 4LSGA 3RC9A 3IAS1 3T7EA 2QP9X 5A0FA 3PKJA 3UM9A 2R8RA 1T8PA 3A3KA 4BTVA 2PKQP 1ZKMA 1TPYA 1AKYA 1YZYA 5IM5A 3TOZA 1D2GA 3LLMA 1I7LA 4J6FA 2VXCA 3WGVA 2GH1A 3I42A 3KEQA 3KLOA 1RXUA 4AS2A 4JP3A 4DLPA 3INGA 2H31A 5EZ6B 4ER5A 2AJLI 3BC1A 1VBMA 3VU9A 4GR9A 3WDLA 2O57A 1ESEA 3A9TA 3P45A 4US2R 5AVTA 3MHTA 2WUDA 1BTOA 4B2YA 1EB9A 1LFAA 2EJCA 3HBAA 3SR4A 5IULC 2WSYB 2YQ5A 4CLOB 1XD8A 1YC5A 1I2ZA 1RPTA 1ZXXA 1Z45A 2RGWA 2WU1A 3LUJA 4L75A 5A06A 1AK2A 5B1DA 1QQ6A 1BCRA 4FVTA 2AFHB 1JGTA 2W5UA 4MKRA 3VKWA 1X1CA 3VPBA 1JQAA 1U7UA 5GV7A 4Y9RA 4RGYA 4LW8A 1FTWA 2D1TA 1D0IA 1NV9A 2WJ4A 3NP7A 5G1NA 1RXEA 4HRYA 4A3SA 3MPUA 4MWOA 3ZZUA 3NEPX 3NDPA 1BU5A 1NFQA 4GKKB 3ELDA 4KL8S 4YASA 3HP4A 2GDJA 2PZ8A 5ER9A 5GV8A 3HVRA 2HHAA 1MO4A 4FP9A 5GZ1A 2OGSA 2GSWA 4JIMA 2NMVA 4ACAA 4V0LA 2JKZA 3O91A 3OAAD 1M72A 2HCJB 4P33A 1DKUA 1OA1A 2G4LA 2GLUA 2QYOA 1JWBB 3KAPA 4FFSA 4OHZA 2ZSJA 5ALZA 2ECKA 1NQWA 2BM9A 3C4JA 2PO7A 4DCVA 5BMOA 3G49A 4QREA 3GAMA 5E3JA 3I9JA 3AVQA 2OECA 1M2HA 3QVOA 4QT0A 3SQOA 3RJZA 1E79A 3L7DA 3M9WA 4WCFC 3HB7A 3IP7A 1XMPA 5DLPA 3UXMA 2QW8A 3V8MA 4AY3A 4ZDJA 3D3KA 4C06A 4BVAA 4MGHA 1QYCA 3C1TA 5FOTA 3PB3A 2HIMA 4ER6A 7MDHA 1GTSA 1KPIA 4B48A 3DE0X 3TSAA 3WVNA 3QFSA 1K7YA 1QQBA 4KO1S 4L95C 4AI6A 4MUKA 4UUOA 1U2GA 1NVTA 5C8DA 1HURA 5B3JC 3V1NA 1R5JA 3GT3A 4QBGB 2Z56A 3LA8A 4AIRA 5FUMA 1DS6A 1WDLA 1NN5A 1CS0B 2A5GA 2YHUA 2JI7A 2TYSB 1H5QA 3FPBA 1N32B 1Q1AA 5F4ZA 3UV3A 3N8IA 3QEKA 3X1KA 3K4PA 2RAPA 2D13A 1SUWA 2FGJA 4JDPA 4BAZA 2FG5A 3HR4A 2FPKA 2RARA 4RZQA 2ODBA 3HACA 4MA5A 1EBUA 3MWLA 1T2FA 4EI2A 4S2UA 1WY5A 3V7NA 3OZEA 1H2FA 1RLJA 5AHRA 2W8BA 3T41A 2HA6A 3DP9A 3LK7A 2VLIA 3D0KA 5D2CA 3NJ4A 2F7SA 4KN6A 1IN6A 1YUBA 1U63A 2ZAYA 2RONA 4G8JA 4LZWA 3S70A 1AIPA 1FNMA 1YJ8A 4YDQA 3DZDA 3FTEA 4ZWNA 5ELXA 2JLVA 3T7CA 1SKBA 3N0RA 1ZCBA 4KO4S 1F8UA 2FFBA 5HQTA 2ZXFA 4DGSA 2AT1A 4K9NA 2ATEA 2DWCA 2NN3C 3O3CA 4HBZA 4MP8A 1JA0A 1H0RA 2YVAA 2ZR8A 1D9XA 4N5DA 2M6LA 3DVQX 1B3BA 1QFMA 4MVJH 4YRMA 1VMAA 2R6FA 3RIGA 1L5HB 2VP2A 1GNQA 3FNHA 1ZRMA 1P75A 4PZLA 4NLLA 1JDTA 5FBRB 1OZ0A 3Q7QA 2UUBB 5IDVA 4XPIA 4DDHA 3O1LA 4IPTA 2XB2A 3WV5A 3ZY4A 5AM3A 3IXQA 4DXAA 3TXYA 3O4JA 4UHEA 3RBVA 1ZGCA 4CR6A 2DUJA 3Q72A 3WP0A 1U0FA 3F3SA 4QJ5A 5H80A 3FUVA 1R4NA 4QJ3A 1JXMA 2DHQA 3I53A 3JALA 3I1YA 3VVCA 1NASA 1C30B 5ALXA 3SVLA 4KWCA 4RGQA 1ZEJA 3I4CA 4J03A 2G36A 2A78A 1C14A 1WPXA 1Y1QA 4CW7A 4PR0A 5C52B 3KJHA 1VYTA 3KYCA 2BI7A 4FFRA 1WMSA 1DC6A 4ARCA 4DSOA 4QFDA 2P78A 3UWMA 1X8JA 1SUDA 4K6FA 4QNNA 3BWDD 4G97A 4E4YA 3JQ8B 1NVXQ 3QKRA 3ZQKA 4EDHA 1SVNA 1MUUA 2DY1A 4MUFA 2VYCA 3ZBUA 2XPCA 1GVNB 3FZYA 4Y6QA 4G5GA 2NU9B 3ILSA 3E3NA 3F6BX 4ZVPA 5T4BA 2VG8A 4W5WA 4JC8A 2P90A 1Y89A 2IKSA 3WBJA 4NAHA 5TLSA 3VNAA 4JFAA 4G25A 2ADOA 2QTVB 4UPEA 4L5AA 5AM4A 3DAHA 2EW8A 3G8DA 4WBNB 1YVEI 1PYGA 1WSBA 2QQFA 4WH0A 5DIFA 2ANCA 3D3WB 3JCZA 3QY9A 2BGJA 2DR2A 2XOKD 2RGEA 4MWGA 3SKYA 2IL1A 3R3ZA 3MXTA 1YJAA 2ASEA 3OF5A 4NG5A 4UM9D 1RHKA 1Z4NA 3H5IA 4X7RA 3LUGA 1A9QA 5KSPA 2X4DA 4NZ9A 4JBHA 4RVCA 3UJHA 5AVKA 3M1LA 2FRDC 3AUJB 4URYR 1VDZA 4ZVOA 5K2MA 1MBZA 4OB8A 3EMBA 5E3HA 2ZAOA 3OQ1A 4Z0HO 3AEKA 3IUNA 2IXGA 4M0KA 4RZSA 2P9QA 1SU6A 4XAQA 3MWDB 1E5VA 1KZYC 1KH2A 1QB7A 4YONB 3VTKA 5BSVA 4TTTS 1TX4B 1HEYA 1ODFA 2BFOA 4A91A 5FUQA 5JD4A 5K3OA 2J8ZA 4R1MA 4Q3LA 4LJ7A 4COOA 5DEOA 4JOCA 4ECEA 4JI2B 3NFYA 2ZAGA 4Q15A 5FFFA 2Z5GA 3BD7A 4NHOA 2GK7A 3VNRA 1JG2A 1KY2A 2H51A 2O48X 3EC2A 1B2LA 1Q0SA 3A32A 2JVJA 5JH7A 1XZ8A 2Y67A 4LQ4A 3FUCA 1W8DA 2WP8J 3K6KA 4J4TA 1AVTA 4A0HA 3G59A 3U2QA 5MGBA 1FYFA 3SSNA 3U1BA 3E05A 3K8YA 3S4YA 1U6IA 1K8QA 4Q4LA 1CQWA 3UAXA 1FDRA 4YAFA 1KJQA 2AQKA 2P9JA 2XE7A 3CFYA 4B4OA 3WWZA 1J90A 2QWXA 2JBAB 4M1QA 3X2SA 2CYBA 1VSVA 1A7UA 2WEKA 5EE5B 1WE2A 1XO1A 3O1IC 3PR2B 1RM3A 4OHRA 3SQMA 4EUSA 4PG4A 3IAUA 1NUAA 2DPMA