1YQGA

Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
MNVYFLGGGNMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPELHSDDVLILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPGKIGLGVSGMYAEAEVSETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQEMERQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords pyrroline-5-carboxylate reductase
publication title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 86
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 1yqgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yqgA01
4EITA 2FOIA 4B8WA 4YTEA 2VYVD 2ZQYA 5T5QA 4DPKA 3DBLB 1PGPA 3HE3A 4Q3NA 4XGNA 1G6KA 3S55A 1HLPA 2NVUB 1T2FA 2VZ0A 2YV3A 3B6ZA 3JQ8A 5A3JA 3RIHA 4RPJA 5GMOA 3UCEA 3QVXA 3NAQA 1IPEA 5DP2A 3P19A 3IIEA 3N74A 3UF0A 3LF1A 3VPGA 1GPJA 2FN7A 2R00A 4JN6B 4NBUA 4YT8A 3WJAA 2DUWA 5F5LA 4E5NA 4IDDA 4ZQFA 4O0LA 1A7AA 3COSA 4JXKA 1HDRA 1P1FA 2H9IA 3VDRA 2AQ8A 2OL4A 2W2KB 2ZTLA 4AJ4A 3GZ4A 5KVCA 1RWBA 3LT2A 1MV8A 4B4WA 1KY5A 7MDHA 4MJLA 4ZHSA 1NVMB 5JLAA 3QWFA 4B7UA 3GDGA 4Z0TA 2O7QA 3MJTA 1O5IA 1OMOA 2CY0A 3CEAA 4HX5A 1GQQA 3AWDA 3B1FA 4J9VA 1HSZA 2VUSA 4HBGA 5MGBA 3OFSA 1OFGA 1PJCA 3WGYA 4BNGA 4NPCA 3WS7A 3M1LA 1TEHA 4J91A 1U7TA 1YB4A 5JBIA 4Q9NA 2PD4A 4K6FA 4EUHA 3TFOA 1IL0A 1X7HA 3JQAD 1NTOA 5G0SA 4BV9A 3PQEA 5F1OA 1OAAA 2HDHA 1HTBA 1P1JA 2DUUA 3QWIA 4HNHA 2PH5A 5FI3A 4CLEA 3PWZA 2TMDA 4IJVA 1ZCJA 4BKPA 4H15A 2W2LA 1E6UA 3T4XA 1LI4A 1UAGA 1GCUA 3PLNA 3CSDA 1AGNA 1R4NB 1ZVMA 4KUGA 9LDTA 1NHGA 3L9XA 1GEGA 2D4AA 4U7WA 5G0VA 4BNHA 4XYMA 5CG2A 1B8VA 3FNFA 1I3MA 1O6ZA 2J3IA 1GUZA 2DFVA 3JQGA 3M6IA 4O63O 3TZKA 2I65A 2NVWA 4CV1A 1YJQA 1ZUD1 1HT0A 1YQXA 3QVSA 4F6CA 1WW8A 1PJLA 4CM9A 1H2BA 4AJKA 4F6LA 1GFSA 1P77A 2O3TA 3MOIA 3FWZA 2QYTA 5JAZA 3DBHA 1ZMOA 1Y7TA 3RJ5A 2NV6A 3DXFA 1HDOA 4MVJG 5ITVA 1PS0A 4DA9A 3L0DA 4E2YA 1E7YA 2P4HX 1GV1A 1E5LA 1DIGA 4FC6A 5TC4A 1QXSA 4GI2A 4AVYA 4E12A 4YJFB 1VI2A 4J2OA 5HBRA 4DXHA 3RKUA 5I7SA 2O23A 2SCUA 1YONA 3ZWYA 3DBRB 1T2EA 1M6HA 3G0OA 3FBTA 2NTJA 3GMDA 3MCVA 5HS4A 3JQAB 4ALLA 5ICMA 4INAA 1A71A 4Y6PA 1M75A 1DBVO 4NZ9A 2JD1A 4R5MA 1QLJA 3GT0A 3WFIA 1I01A 4DC1A 2HLPA 3E9NA 4QECA 3PJDA 1YB5A 4BO7A 4RF2A 3ZI0A 4UAGA 3HDHA 1JVSA 5T8KA 4AJ2A 2FPIA 2NU6A 4CM5A 1LQUA 5BSFA 3E9QA 2BFPA 1YJ8A 2RH4A 5ICSA 4FS3A 1OI7A 4OKNA 5KNLA 4D3FA 3Q6IA 2B69A 1H2HA 2A94A 2Y0CA 4JK3A 4RVFA 3I9KA 2NU7A 4M89A 4CLXA 5I7VA 4IS3A 5EN4A 2GUGA 2Y0EA 1NHWA 4DYVA 4JP2A 4IDBA 2B35A 4IJUA 1C0IA 2DBVO 2PD6A 3VPXA 1YQGA 2XXBA 4CLHA 3OEYA 4ND1A 1H6DA 4XJSA 3M2PA 4EZBA 3AU8A 5KOIA 1PZEA 1DJQA 3IP1A 4FJ2A 2CDBA 1Q0LA 3LT4A 4I5EA 3H9EO 2JD2A 4TVOA 3P7MA 3F47A 2F00A 5TS3A 1X7GA 3KYDA 5JMWA 3CXRA 3HWRA 4MP8A 1Z74A 5BSHA 5AXDA 2DVMA 3L4BC 1KBZA 4RVUA 3ZH2A 5GZ3A 2ZK7A 4TQGA 1QP8A 3AM5A 4OIMA 2DPHA 4UVDA 5DCYA 4BGVA 4XKJA 4KDFA 1IUKA 4U8GA 1YBVA 1EUDA 1P9LA 3VH4A 1H93A 4WKGA 1QORA 1OBFO 4W9NA 5F5NA 3SJ7A 4UUOA 5JC8A 3GPDG 4Z9FA 3KZVA 2EGHA 3MEQA 4MDHA 5ENDA 2X9VA 2VNAA 4NJMB 4BGIA 3M1AA 1G1AA 1GQ2A 1E6WA 1SEVA 2FR0A 3AU9A 1VRWA 3RROA 4WJZA 4K9DA 1NPDA 1PGQA 4KDEA 2BFOA 3JQFA 1EK6A 1KVRA 1ZK1A 4F46A 2VT3A 1LRLA 4WE3A 5A1TA 4XGKA 2I6TA 4ROSA 4E31A 1E92A 1PU2A 1BVRA 3DOOA 1AE1A 5EMHA 1Q7GA 3L4SO 4U0KA 5JW6A 3CKYA 4DTIA 3VTZA 1NM5A 1GQYA 4XQCA 1R15A 1O89A 1U4SA 2D8AA 4PRLA 2V6BA 3VPFA 4WNIA 5L95A 1YS4A 1PL8A 1IOLA 3ROMA 3PHLA 1V3TA 3FF4A 3G3EA 4WUVA 4JJIA 1I10A 4XRGA 4E30A 4PLHA 2WMDA 3NT5A 1QLHA 1V9LA 3L9WA 5ILOA 3F46A 4UEOA 4ZQBA 4ZQGA 3NV9A 3ZV4A 4DLAA 5H82A 1Y5MA 5LDGA 3KVOA 1EVZA 1TLTA 3SXPA 2X8LA 3M2TA 1HE3A 3TDKA 1K2WA 2Y99A 1Z75A 3ADPA 3CINA 4P38A 3ZNNA 4R4JA 4EUEA 3ZU5A 4YAGA 2ZCVA 4PLVA 1P3DA 3JQDA 5B12A 3L6DA 1DC6A 2X1HA 4LVUA 4D41A 4EBFA 4XJTA 2NU9A 3H2ZA 4CMEA 3ZZNA 1E3IA 3GRPA 2EXXA 5DN9A 3T7CA 2HKIA 3PIIA 4FCCA 1YXMA 2HUNA 4BKRA 3DZIA 2C54A 2HJSA 4W6ZA 4BO0A 3E5MA 1WXDA 3U62A 2ZB8A 2OZPA 4JCOA 4DBZA 2EV9A 3UICA 2AQHA 4WPGA 1RKXA 3JQBA 1XKQA 2AMFA 1MA0A 2YQ4A 5JAQA 3WICA 3JD1A 4GPD1 3QWAA 1M6WA 1CYDA 3QRWA 1KS9A 4WLNA 3KXDA 2AQIA 1ADFA 1U1IA 1CEQA 4I9NA 1N1EA 4J1TA 4II2A 5CPFA 4BO3A 5TJHA 2PA3A 1UAYA 4ALKA 3RUCA 1H6AA 2EF1A 1OC4A 4BNYA 3OHSX 3L77A 1NQOA 1S6YA 2ZYDA 1H5QA 3UUWA 3Q9UA 1NQAO 2C82A 4ZICA 1LLCA 1VE9A 1Y8RA 4NJOA 1LLQA 2Q99A 2CVOA 3ST7A 3F9IA 3DBLA 3S8MA 3KB6A 4FFRA 4W7HA 3ASUA 3ADOA 2NVUA 3AY3A 3PXXA 1MXFA 2EJWA 1ZBQA 1R16A 3IP3A 1JWAB 4OXKA 5ADHA 3AUTA 3KLPX 4N18A 3ZWOA 1JWBB 2CVQA 1QV7A 2ZJ0A 2QYSA 1SOWA 1GPDG 4GL4A 3WGZA 4M49A 2C0CA 4IIVA 5KVSA 4KWHA 3ZHZA 1HEUA 2DTXA 5COAA 4A27A 5DBIA 2UUPA 3WIDA 3ZWVA 4WCDA 3QW2A 1FDVA 2EW2A 3DFUA 1KVQA 3LLVA 4R16A 3WSVA 4UVGA 3HDQA 2W2KA 4IDCA 1C0LA 2Y1CA 1WNTA 2B0JA 4CMCA 1DFIA 3BAZA 5IZ4A 1VL0A 1V3VA 1I2CA 4RPHA 1VJ1A 3I23A 2ZCUA 4OXYA 3W8FA 1A4UA 3AK4A 1VL8A 1YRLA 4OL9A 2VTDA 4U6QA 1WMAA 3VH2A 3PHJA 2AE1A 3IAHA 1GYPA 1EE9A 2VUUA 3K2EA 2JCVA 3KTDA 1F14A 1P74A 4E13A 2A4KA 1B7GO 1HYGA 1E3EA 1JU9A 2P4QA 2DTDA 2VYVA 3CPSA 3G1TA 4NU5A 4R9SA 4AJEA 3H5RA 5G4KB 3HB4X 1U2GA 2JD0A 2DFDA 3X2EA 4D7AA 3W6UA 4KUEA 2D1YA 3WLFA 3I83A 1SOVA 3WGOA 4L75A 3CTMA 3WMWA 1NAHA 3OSUA 1MFZA 1XG5A 3H5AA 3WBFA 2I66A 5CEEA 3OECA 4NU6A 4Y6RA 1Z82A 1R4NA 5DZSA 3VZQA 1N8KA 1T4DA 3WG9A 3PLRA 4N7RA 1I32A 4N5LA 4CMKA 4NBVA 3PDUA 5GZ1A 4MVJP 3ANMA 1CJCA 2RIRA 5JO0A 4EDFA 1NVTA 1UXGA 2JHFA 3QLJA 4CM8B 5TT0A 4CQMD 2IEDA 2NNLD 4YDRA 1XR3A 1T1RA 2WD8A 3AY6A 4AJOA 1T4BA 3GAZA 4L4XA 1RM3A 1IB6A 3JQ9A 4PG7A 3V5NA 1KEPA 3K8ZA 1ZKMA 3F3SA 5B4VA 1I36A 4UVEA 4RPLA 2OMEA 2VHXA 1O9BA 4M8SA 3OF2A 1C3VA 3WFJA 2X9GA 1ZEMA 1FDTA 3H7AA 3ITKA 4YJFA 4K26A 5A5FA 3H2SA 3FNGA 1Z6ZA 5G0TA 2Z1MA 4DBVO 3DBRA 4UEJA 1J0XO 4MKXA 4QFDA 3JQAA 4YT4A 3LVFO 4BNVA 3IKTA 4NK4A 2FRDA 3SBOA 4LK3A 2ZB4A 2EG9A 1C0KA 4XWYA 1Y1PA 1Z73A 6LDHA 3LC1O 1T24A 3H4VA 2UDPA 5EPOA 3RWBA 1F12A 4OM8A 4BQPA 1VSVA 2V65A 1EBUA 1U8XX 3UHAA 3HDJA 2B5WA 3AI3A 3Q2IA 2O3JA 3ZWPA 4ZQEA 3BA1A 2WEKA 5K9ZA 1XSEA 4L76A 2GSDA 4DL9A 4MIYA 1IPFA 2X22A 1B8UA 1K89A 1PJ3A 1BXGB 3DR3A 3Q3CA 2P2SA 4O6VA 5K0ZA 4BB5A 2Q3EA 4PLZA 3V2UA 1E1NA 1ZSVA 1X14A 3G17A 1E3JA 3NJ8A 3OJOA 3INTA 2OOSA 4UREA 3OETA 2BF7A 4B4UA 1ZSNA 4NFSA 4NNJA 4PN3A 4E3ZA 3FHLA 3FPCA 1I2BA 1NASA 4TRNA 1C0PA 4B7XA 4Y8VA 1P1HA 3UFXA 3WIEA 3KYDB 2OHXA 3RUHA 4II3A 5TIIA 1PWXA 3WNVA 2GERA 3BMCB 4MKRA 3GEDA 4C4OA 1NAIA 4AJJA 5L40A 4IQ8A 2JHGA 3V2GA 3LYLA 5JPIA 3RBXA 2HSDA 4CUJA 2BELA 3CMCO 5AOVA 3RQSA 3I4CA 4GQAA 2DQ4A 3IJPA 3RC2A 4W9NC 4CMAA 5L7TA 4FIZA 2FZWA 4NJMA 4G81A 4BKUA 4QX6A 4CM6A 1B3RA 4P4LA 4FFNA 4I5FA 4I9UA 3NTQA 3D4PA 4BVAA 1PL6A 1YDWA 4Y6SA 1E5QA 1CERA 3E1KA 4R54A 4B7CA 2Y05A 1YDEA 3X2FA 4KQXA 3RSHA 1PGNA 4XB2A 5A3VA 3AW9A 3NT4A 4DRYA 2BI7A 4C7KA 3SC6A 4IM7A 1UJMA 4Q39A 4DIFA 3UCXA 4WLOA 5L4LA 3LLSA 3RKRA 4CM4B 2YY7A 1DIRA 1XDWA 3HUDA 1DC4A 4LW8A 3SX2A 2H63A 2BLLA 5JNLA 3CZMA 4PLWA 3JTMA 1MC5A 4DLBA 4B79A 2YDXA 2QIOA 2CF6A 1JKJA 5BT9A 5JDIA 1DJNA 4N5NA 3RFTA 2JAHA 3OH8A 3PEFA 3IUSA 2CDAA 2I76A 3WB9A 3CE6A 4Q3DA 2PGLA 1UZMA 3DZBA 1HYEA 2O50A 3R1IA 1UUFA 2ZJ1A 4PG8A 3PWKA 1ISHA 1QYXA 4R3NA 3VH3A 2Q50A 3RBVA 1YWGO 3CH6A 1NPYA 1V35A 3B1JA 2EWMA 2YJZA 3ZNOA 4KZPA 4ZVVA 4BNKA 1FK8A 4E21A 2P9GA 3GNSA 3C3XA 1TXGA 4YACA 3ZWXA 3C1OA 3GH3A 3I5MA 4XQGA 4OHUA 1KVSA 1LSOA 2YZ7A 3C8MA 3JQBC 2VOJA 3D3WB 1SPXA 1J4AA 4YAKA 3VDQA 3I9JA 3I9OA 3GFGA 3GN1A 1O94A 3BTSA 4D44A 3TNLA 4FJ0A 5EQDA 3ZWBA 2AW5A 5TSDA 1TVEA 4IDFA 3QVOA 5JCXA 1P44A 5EJ2A 5MDHA 1GD1O 3ZHBA 4EEZA 5C7LO 3IJRA 3BYZA 2DPGA 4K6CA 3JCZA 4A10A 3CUKA 3H3JA 2ZB3A 4BNIA 3IC5A 1VL6A 1YQDA 1BG6A 5THKA 3FR8A 1SB9A 4D43A 3KETA 3OMLA 2FZEA 3RUDA 4S1VA 2DBRA 1ISIA 1GZ6A 5LDHA 4LSMA 3G1UA 3DHNA 1JVBA 3U0BA 3UN1A 3WTBA 4A03A 1BDBA 4IZHA 5JMPA 2CD9A 4I9HA 1UH5A 3DZKA 3ZHXA 4BNTA 2C07A 3NDIA 2CMDA 5KTKA 4EYEA 4WECA 5L3ZA 2RH8A 1W6UA 3RFVA 4E5YA 5CAEA 1YGYA 1EQUA 1JW9B 3JD2A 4BQRA 4BUCA 3FTPA 4NH4A 5KKCA 2FR1A 1U3UA 4UULA 3D1LA 1CQJA 3TJRA 3UVEA 2Y1FA 3GVPA 2OUIA 2QZ9A 3KYBA 3OA0A 4URFA 4ALJA 4GLLA 1L1FA 3C1TA 1D7OA 1UXHA 4MPDA 5GY7A 5C3MA 1EUCA 4E33A 1HZZA 3E5RA 4IDGA 2VWQA 4PGFA 4BO8A 2JCXA 4XQ9A 1A7KA 5TT1A 1U9JA 5IDXA 3GR6A 4S3MA 1FMCA 3H6KA 3BHJA 3DZJA 1BHSA 1SC6A 2OP0A 3MJ4A 1E6EA 3TN7A 4KWIA 5ER6A 2XAAA 1A9ZA 1PJQA 2I99A 4GGOA 5L9AA 1PJ2A 2PNFA 4L0QA 4J1NA 4IXWA 5HS6A 5G4KA 3I9NA 2UVDA 4YRBA 3H8VA 4BNJA 5I9MA 1EQ2A 3WGTA 4DUPA 1UXJA 5JE8A 4XX0A 4OSPA 2Q2QA 2X23A 1KIFA 4H3VA 4QO8A 1ISMA 3INRA 5CDSA 2QQ5A 4FOSA 3DOJA 4NQZA 4PG5A 2RHRA 4ILKA 3HFSA 4JNKA 3BIOA 4ZA2A 2VWPA 4U6SA 2NQTA 3FCOA 3VKVA 4TWRA 3KEOA 1LSJA 4GAEA 1I2ZA 4CM8A 2I9PA 2X0JA 3RUEA 2PKQP 2ZQZA 4ALIA 1C14A 2X5KO 1HE5A 4RVHA 3OJFA 3PWSA 2C7VA 4CJXA 4W82A 4TRMA 2GF2A 1OZAA 2ZB7A 4TKLA 4AJNA 3KO8A 4J4TA 1DLJA 1R66A 1H6CA 5EIOA 3BMOA 3R0IA 2ZIZA 1QYCA 1WDMA 3VOSA 3HN7A 1A9YA 2O3SA 2IXAA 3O26A 1ZW1A 2EIHA 4E5PA 1VSUA 1MC4A 2CNBA 1F06A 3H9JA 5IN5A 5AQ1A 3KBOA 4UUNA 4IMRA 1QYWA 1U5AA 2NVBA 1GY8A 1D1SA 3TZQA 1NPTO 5BR7A 4DVJA 2BGKA 5A5EA 2VRBA 4KTTE 4IQ0A 1L7EA 3HADA 2X0IA 5U9CA 3DWFA 4XDZA 3ON5A 4Z3DA 3IKVA 5B4TA 3WDSA 1LBEA 5AXBA 5KJFA 4RQTA 2NACA 5FYDA 3V8BA 3VVBA 3AUSA 2VQ3A 1H9BA 3NDRA 4GGPA 4YAJA 1W73A 3TL3A 1EBFA 2R2GA 1CWUA 3PZRA 4WCFC 5K6AA 3ROKA 4HKTA 3LQFA 4CR7A 5T67A 1EMDA 1BXGA 2OP1A 1AHHA 3D64A 4R9RA 1FDWA 4RF3A 4Y67A 3TOXA 4CQMA 3FBGA 2DU8A 4IZIA 2F1KA 4YXFA 5JCJD 3DBVO 4CMIB 2C59A 3FI9A 1U28A 1UZLA 2UV8A 3I6IA 3NGLA 4J16A 1ZJZA 1DHTA 1IYZA 2LDXA 3LSYA 3D4NA 4MVJF 4XRRA 3WXBA 4GLOA 5CDTA 1PS9A 5IG2A 1EFKA 1FF9A 1WDLA 3AOEA 1EZ4A 3AI2A 3BMCA 3EYWA 4LSWA 1HSOA 5HTOA 4RL6A 1Y6JA 1YKFA 4YB8A 3TL2A 4P4NA 2J8ZA 1MP0A 1Y9AA 2NQ8A 3HN2A 3PJEA 4DIOA 1P0FA 4IGEA 1FXSA 4IXTA 4BO4A 1T25A 1GDHA 3GN2A 4A7PA 4D42A 6ADHA 2X86A 1OC2A 3OJ0A 4BKOA 3BMNB 3Q2KA 4M55A 3W4KA 1LQTA 4ALNA 2HJRA 4GKVA 4FB5A 2X9NA 3LDHA 1U3WA 4YT5A 3JQEA 1UP7A 2BGMA 1JA9A 3EVNA 8ADHA 2PGJA 2HK9A 3PHGA 3QJ5A 2X7HA 1DXYA 4R69A 1D1TA 4NR0A 4PLCA 4CR8A 1WZEA 4FC7A 1XQ1A 3LC2O 3K6JA 5COQA 3SLKA 1BW9A 2BKAA 2HK7A 1AXEA 3GDOA 3L07A 4OH1A 5G0UA 4UVIA 2B4RO 3INGA 2PFGA 1CETA 3NJ4A 4CM4A 2G0TA 2PV7A 3GDFA 1DIHA 1I33A 3KHUA 3OIDA 4CLRB 2O2SA 4Y98A 2GRAA 1R12A 2Q49A 1HE2A 2GGSA 1HDCA 1BTOA 1F17A 2J6IA 2Z5LA 4ESOA 3G79A 5DULA 4WASA 2G82A 1DIBA 1PSDA 3DTYA 1ENYA 3AOGA 4MP3A 4ND2A 4TSKA 3RI3A 1V6AA 3D0OA 1BWSA 3OICA 3OJLA 2C20A 3EY4A 3DZHA 4J0FA 4A2CA 2QX7A 2IDZA 3JD3A 1I5RA 2AEJA 2IYPA 1KC3A 4J1QA 4F3YA 5IZCA 4EGFA 8LDHA 3HFGA 4CQLB 4E0BA 1B2LA 1ISFA 3NTOA 3RCBA 4B3HA 4Y9DA 1AN9A 3VPHA 4YAIA 1HDYA 1M67A 2FMUA 1JKFA 2Q1UA 3JV7A 2Y1DA 3GY0A 1B26A 3RUIA 2OO5A 1G0OA 5L7WA 5I9LA 5JS6A 3QWHA 5L51A 1EE2A 4ZN6A 4UEKA 1XCBA 4A26A 3U4IA 3D3WA 1XELA 4D3DA 1VKNA 4RGBA 4PCVA 3NGXA 4TZTA 4XYBA 4XIJA 3STHA 5KJ6A 4MIOA 4HWKA 2ZYAA 4IPTA 1EVJA 5CEFA 1VLLA 1N1GA 1QYDA 3E18A 3ETDA 5ITWA 5ER9A 4L8VA 4YR9A 3R3SA 3TSCA 1T2CA 4BMNA 5F1PA 1DAPA 1BRMA 1ULUA 4RPGA 1H9AA 4WEOA 1JDJA 5FI5A 4OKIA 1Y5RA 3ENNA 3OQBA 3N7UA 1GAEO 3TZCA 4TMFA 1DC3A 1K6XA 1KEWA 4TROA 4HFRA 1ENOA 2X6TA 4GVXA 2PR2A 1DC5A 1RJWA 2IODA 3VKUA 1U4OA 4ZRNA 3WGGA 4HV4A 4YWJA 1DRVA 3BXXA 3JD4A 1KVTA 3GF4A 3T4EA 4FD3A 1UDCA 1SNYA 3O9ZA 3GC6A 1T2DA 2R00C 2VRCD 3DC2A 3ONFA 1WZIA 2E48A 1DRWA 3HZZA 4BNNA 2Q1SA 1FDSA 1MLDA 1OOEA 2GZ3A 1EDOA 3OQ1A 4RO0A 5AVOA 1N5DA 1RYDA 2YYYA 3GFBA 3U09A 3PZBA 2EGGA 5BNFA 3GHYA 3TQHA 5JYEA 3D7LA 4YRAA 1IE3A 2I5PO 4DPLA 4E5KA 1DHRA 2PTGA 3LU1A 2C5EA 4FSHA 3ZU2A 2GN4A 3MJEA 3HB5X 3I4FA 4AJIA 4DQVA 4A5OA 1MG0A 2D5AA 3BZUA 2GDZA 3RD5A 4U5QA 4CLOA 4YAEA 1HXHA 1RYEA 3PDJA 5A4DA 3ONEA 4RQUA 2FHSA 5A02A 2Y1GA 3NDJA 3LT0A 4MVJE 2OFPA 2CZCA 2OXIA 3ICPA 1D4FA 3FTNA 2JFGA 1LDYA 4FBGA 3F1KA 1I3LA 5I9NA 2X0RA 1O95A 5LCXA 5JFOA 1DIAA 3IL2A 3V1YA 1MGOA 2B4QA 2NUAA 4YPOA 5I7EA 3L6OO 3DFZA 1Y81A 1PIWA 4Q3CA 2G5CA 4IJWA 4K1LA 1X0XA 4J90A 3AJRA 3DOCA 4LVCA 4AJLA 5JAMA 5DOZA 3QV1A 1YOVA 1ZNQO 3KOUA 2DT5A 4I5DA 2VN8A 1P33A 2NADA 4NDNE 3EC7A 4GBJA 3JQ7B 2VZ9A 4GX0A 4BOYA 4B4VA 1ZJYA 3RC7A 3ROPA 2RAFA 5U4QA 1GZ4A 3P2OA 3FN4A 4UUPA 3VHRA 3W6ZA 1Q0QA 1R0KA 1NWCA 4GWGA 4WLFA 3HJAA 2C7GA 3PQFA 5AXCA 4BO2A 1LEHA 2AQKA 1X13A 4CUKA 2PZLA 5I7FA 4FFMA 1J49A 5IDWA 3OM9A 3OIFA 4I08A 2Z95A 3PIDA 4HFNA 3V1UA 1MB4A 2P91A 3ZV3A 4J43A 3BMOB 2YW9A 2Y93A 1LXCA 2GN6A 1N7HA 5A9SB 4W7IA 2IRWA 1TI7A 5CDUA 3ETEA 1DFHA 2YHIB 4WEQA 1MFPA 2J3JA 4MOWA 3U3XA 5H83A 4MVJH 1P31A 2GO1A 3HSKA 4XDYA 3AM4A 1U5CA 1PQPA 1ULSA 2WDZA 4J3FA 3V1TC 1P1IA 4DYDA 3BHIA 3EGOA 1TA4A 5JYDA 1LSUA 4ZU3A 4Z3KA 2DC1A 4RZIA 3I9LA 3CMMA 1HRDA 3NYWA 3DMYA 4OYRA 4OQZA 1LUAA 1GL3A 3HQ4O 1PX0A 5JC1A 2HO5A 5T8KC 4E6PA 1ENPA 4QTZA 2V6FA 3U4DA 3GEMA 2JKVA 4MKZA 5IXYA 4CMHA 3FRJA 4ALMA 4EI2A 3NT2A 1T2AA 1U2DA 3QVWA 4ND5A 2O4UX 2HRZA 4DMLA 1LRKA 1GR0A 2I3GA 4CQMB 5KWEA 1LTHR 1RM5A 4NMHA 4B3IA 4DPMA 1X0VA 1M66A 3SJUA 5JXWA 4D3SA 1C1XB 2FSSA 1E1KA 3L6EA 4BKQA 5HRUA 3BTOA 2AG5A 1JKIA 1ARZA 4OO3A 4CMIA 3DZFA 2J3KA 3FNEA 4J7UA 4XR9A 1PTJA 3BMQB 3S2EA 2OORA 2FSVA 3PRJA 3VZSA 4XGIA 3TZHA 4R1UA 4IY1A 4WGGA 1V3UA 4BHTA 1ISJA 3K73O 4XA8A 2EP7A 3HNPA 5JO9A 4TRJA 4CM1A 1EUZA 1ORRA 1T1SA 4QQRA 2NTNA 1XHLA 1X7DA 2IZ0A 4BNFA 1UR5A 5DDIP 1SO8A 5AYVA 3KV3O 4J2HA 1GV0A 4BMSA 1HDZA 1NQTA 1GUFA 1L7DA 4OGWA 9LDBA 4J7XA 1PJTA 1ENZA 3BMNA 4YRDA 3HHPA 1ZSYA 1WDKA 4PLYA 1NR1A 1YBAA 4EW6A 2BFAA 1CRWG 4LN1A 4BGEA 1LSSA 2JCYA 4J7CA 1WPQA 1TT5B 4HNGA 3WNQA 4QO7A 4B3JA 1ML3A 4JBIA 2D3TA 2JFFA 3JQFC 2CVZA 4GMFA 4OOFA 1XGKA 3FR7A 1DEHA 4CM3A 3Q0EA 4I1IA 1HDGO 4E2XA 2GCGA 3PVZA 4OSOA 2B37A 5F21A 3EW7A 3DZGA 1G0NA 4ND4A 1ONOA 1UXIA 5T6BA 1BW9B 2PY6A 1PZFA 5JCJA 3G49A 1EVIA 1XLTA 1GU7A 3KEQA 5C37A 4IUYA 3NRCA 5EINA 1PJ4A 3ZDFA 2WTBA 4HFMA 5DBGA 2VT2A 4CLRA 2AG8A 3OJEA 5B1YA 3PHIA 4AJPA 1ONNA 3EK2A 3QQPA 1BXZA 1XEAA 3PJFA 4BNUA 3PK0A 4N54A 3F4BA 3LT1A 4WLVA 3H65A 4AJHA 3QIVA 5TRTA 4D0RA 2PK3A 1LDMA 4R51A 3EVTA 4KUHA 2C2XA 2PZKA 5ENVA 1QKIA 1MX3A 4LGVA 1DFGA 4CQLA 2GZ1A 1E7RA 3I9MA 4G2NA 3VPSA 2AHRA 5CP8A 1GUYA 3GK3A 3LF2A 4CMEC 4YYZA 1FDUA 1P1KA 5CG1A 4DGSA 4XEHA 2VZ8A 2VYND 4JLWA 1QV6A 1PL7A 3C24A 3F4LA 2X5JO 1LDBA 3TRIA 1HLDA 4NBRA 2Q1WA 3D4OA 1F8FA 4YQZA 2BI8A 1F0YA 1PQWA 2YFHA 1ADGA 1LLDA 4PVCA 3KSDO 3JYQA 5TX7A 2POQX 4HFJA 1C1DB 1HDXA 4O1MA 1PGOA 4QUKA 3E03A 2P5UA 1Q0HA 4UUMA 4Z9YA 1M76A 1GADO 3KSUA 5JY6A 4XIYA 2H1SA 4RZHA 4W4TA 3DHYA 5A06A 4FN4A 3DMTA 3U9LA 1KEUA 4FFLA 5H81A 3K96A 2XOXA 3NX4A 3ICCA 2GLXA 4DQXA 4YJHB 4XYLA 3AI1A 4D79A 2HMVA 4XD2A 1VJTA 1B16A 5A9TA 2VUTA 4OJNA 4XYEA 4TVBA 2Q1TA 1DOHA 1YL6A 3E8XA 4IDEA 5KVQA 3WYEA 3KM0A 2Q45A 1BMDA 3PJGA 2Q2VA 1MG5A 1I30A 3K2BA 3ZWCA 2WD7B 2WJPA 1WVGA 3DDNA 3NEPX 4XYGA 1E7QA 5CPBA 2ZYGA 3MTGA 3GG9A 4WOKA 3TF5A 4A73A 4FFOA 3S2IA 2AA3A 1ID1A 2B5VA 2V6MA 3D5QA 3WYBA 5CFZA 4CV0A 5EERA 1WAMA 2EEZA 5KJCA 4LISA 4R1SA 3EHEA 3E82A 4CLDA 4Q3BA 4CLOB 3ULKA 5A9RA 4PLTA 5DCWA 1DDOA 3PGJA 2GYYA 4CUZA 2BFMA 3EUWA 3I3OA 2GR9A 1HL3A 4D45A 4ZQHA 2CSUA 4L73A 3RVDA 4ID9A 3GEGA 1DB3A 3E9MA 5COBA 3PGXA 4YJGB 3RFXA 3WQSB 3AFNA 5THQA 5A05A 3PTZA 4MVJI 1QYVA 2Q2WA 1ZEJA 5BSGA 2NSDA 3GHHA 3SVTA 2QHXA 3RC1A 3NTRA 3D5TA 3PP8A 5A03A 4ZD6A 1XU9A 1YOVB 2GASA 3PQDA 4CL8A 2DM6A 4JBGA 1XA0A 5GZ6A 2UYYA 4J4BA 1IZ0A 4L74A 2VRCA 2EP5A 5A04A 3JQ7A 5CEJA 3K92A 2HAEA 4RV9A 5CHEA 2O2YA 4FFPA 1PZGA 4QSMA 2IYOA 3C7AA 4LCEA 2XXJA 5G0WA 1A72A 1IULA 1DLIA 1I3KA 2A35A 2HMSA 3PI7A 2AEMA 1ZK3A 4M1QA 4WOJA 3ETGA 1J6UA 4OMUA 2BHLA 3ZN2A 4DLLA 3ORFA 1LA2A 2W4QA 3DAGA 2EERA 2AEFA 2YV1A 1D8AA 1E77A 3JQ9C 3VTFA 4E2WA 1Y9EA 2QZZA 2WM3A 4XB1A 2VTEA 5BSEA 1PEDA 2HMTA 2X0NA 3Q11A 1CDOA 4OAQA 3PYLA 5B37A 3WYCA 1H6BA 2FY8A 4FR5A 2CF5A 5IDYA 5A9SA 4NG5A 4RJTA 3C7DB 5IAAA 1Z45A 1E7SA 5CDYA 2HMWA 1JAXA 1X1TA 2YHIA 5DNAA 5BQFA 2YHUA 1B0AA 1S7CA 2VHZA 1E3SA 1HF3A 4JJFA 4DREA 1Y8QB 4GSLA 2DAPA 4GH5A 4HXYA 4PVDA 4ITUA 2Q4BA 4Z0PA 1EEHA 4CMJA 1ZK0A 2PKRA 1ONPA 1R37A 4RDHA 1PR3A 4NBWA 4H7PA 5IN4A 4MO2A 5HWSA 1XU7A 3GUCA 4JJGA 5L45A 5DP1A 4FGWA 5DF1A 1DAOA 3DEYX 4LRSB 3BHMA 4GSKA 2R6JA 2HCTA 4G5HA 1DRUA 1NNUA 5IXSA 5EQFA 3GGPA 1KVUA 1Q2XA 1AHIA 2X4GA 4HY3A 4R01A 1YL7A 4XR4A 4YQYA 5FWNA 1E3WA 1B15A 1YL5A 2HMUA 4NBTA 4RF4A 1D3AA 2WYVA 1DO8A 4LMRA 1W8DA 2E4AA 4EJ6A 1N7GA 1KC1A 4R5HA 3KYCB 3OIGA 3R6DA 1PGJA 2Y67A 1GTMA 4J6FA 1C1XA 3GVHA 5JDCA 1X15A 3TZ6A 1LDEA 2PLAA 3UAGA 2VNSA 4JX8A 4WCFB 3VZRA 2C2YA 1PS8A 2DBQA 3BMQA 3F6YA 2PWZA 2OBYA 3BTUA 1ZXBA 3GGGA 3KUXA 1V0JA 3O8QB 4NIMA 3Q1LA 2DLDA 3HG7A 2ZTUA 1N9GA 4OQYA 1I24A 1HKUA 1R4MA 4A0SA 4ZRMA 2RBEA 3MJSA 3GGOA 1KETA 5T57A 3WLEA 1KEVA 4CM7A 3MOGA 1SBYA 4Q3AA 2EHDA 2X5OA 4PG6A 4ZGWA 2NM0A 4U0JA 4PRKA 3QVTA 4N5MA 3QA9A 4MVJD 1NQ5A 2B83A 2WSBA 3K9QO 5DBFA 2VOEA 2ET6A 2G1UA 4FJ1A 3PPIA 3U4CA 1XQ6A 2YDYA 1TT5A 3BTVA 4E2ZA 4GKBA 3U5TA 3WSWA 1NFFA 1IY8A 3ANNA 4AL4A 1E3LA 1I0ZA 1Q7BA 3ZWNA 4RORA 1KY4A 3AFMA 3AUAA 1JAYA 3RAJA 1HE4A 1SZJG 2O4CA 4Q3EA 1YB1A 3WR5A 3ZWAA 1QG6A 5BNIA 1X1EA 1LRJA 1NX6A 4CL3A 3AY7A 2AXQA 2FPGA 4KOAA 4JP3A 4PLPA 3ZGYA 5FEUA 2UAGA 4RVGA 2O3RA 2AE2A 3B20A 5HA5A 2WWRA 4J0EA 4QT0A 3WBBA 4DC0A 3DAPA 3WTCA 1LC0A 2ILTA 1UZNA 4KQWA 3AUUA 3DHEA 5IJZA 2HRBA 1QMGA 1P1RA 2NWQA 3TWOA 2P9CA 1U3TA 3ZU4A 1EVYA 1TB4A 2HU2A 1SCUA 3FWNA 3OP4A 4K28A 4PIVA 2W90A 3QE3A 4IJKA 4KP7A 2ZKLA 1VC2A 2ZTVA 1NP3A 3LC7O 3GVCA 5JDIC 1EFLA 4ONEA 5T64A 1U3VA 1R0LA 2FR8A 3QY9A 2I67A 2E49A 1PJSA 3SEFA 5IF3A 4E5MA 3GZNB 4R1TA 3E6AA 3W4JA 1BXKA 5DOVA 1VM6A 4TRRA 1LDNA 2YUTA 2YQ5A 4ZJUA 3B1KA 5J23A 4L4RA 1B14A 2CFCA 4X54A 4AFNA 3DB2A 1KOLA 2O3UA 4G65A 1NBOA 1XWFA 5L7YA 3A14A 1NFQA 4BGUA 3S2FA 4DWVA 7ADHA 5L4SA 5I8WA 3ITDA 4QEDA 5KVVA 1K6JA 1HZJA 3DQPA 4BIIA 2BD0A 1DSSG 4CMBA 2EKQA 4J4HA 3QHAA 1GEEA 1A5ZA 4AICA 3P2YA 2DBZA 2XPCA 3N58A 2GZ2A 4IS2A 3S1LA 3T7EA 3RASA 2CUKA 3IUPA 4P4GA 1WLYA 1C1DA 4GWKA 1K3TA 4I5GA 1AXGA 4IQGA 3WJ7A 4IMPA 1ZZEA 3P5SA 4OXNA 3IOYA 3DONA 3TOZA 4D0SA 1RM4A 2QRLA 4GVLA 2Y0DA 3C1AA 5FFFA 1H94A 2D2IA 3UOGA 1W4ZA 4L9RA 2I3AA 3W8EA 1UXKA 1YVEI 3OEWA 3FD8A 3H9GA 3U49A 3DMTC 3VVCA 4NFHA 4YJHA 4Z9XA 3U4HA 2Y66A 4MVJM 3KRTA 3UKOA 1ZH8A 1VPDA 4NHEA 1LJ8A 1QR6A 3GAFA 5TF4A 3ROQA 5BNTA 3KLMX 5G2OA 3RC9A 1U8FO 2B4TO 1ISGA 3A1NA 1PWZA 3GPIA 5DCUA 1GYRA 4GX5A 2PZJA 2O7SA 3A28A 1YO6A 3EMKA 2VYNA 1JTVA 4JGBA 3UCFA 3ZU3A 1RM0A 2V6GA 1KYQA 2H5LA 3MJCA 3NKLA 2UUOA 3JQ8B 3TFQA 2IXBA 1BDMA 2FPPA 4B4OA 4UVHA 2JJYA 1PZHA 2W2LD 2WD7A 2WE8A 4YEDA 4TKMA 5KJEA 3O38A 4WLEA 3ASVA 4H16A 3H9QA 4CPDA 4NFYA 4WK6A 5HM8A 2RHCA 4HADA 1UP4A 4FDAA 4RVDA 4YA6A 1IZ9A 2YV2A 3ZW9A 4M87A 2J5QA 4EJMA 3GG2A 3O4RA 1HWYA 2J3HA 3MJVA 4AJ1A 3K30A 1H0KA 2D59A 2Z1NA 1E0DA 3ZV6A 1T26A 3A9WA 4O59O 1WMBA 1LDGA 5JAIA 1HYHA 2VHYA 4MP6A 1LNQA 3ABIA 3HDYA 3ZWWA 2BRUA 4CM9D 1FJHA 3FSRA 1MUUA 1WP4A 1ZXLA 4YJGA 2FP4A 4QXMA 4DQUA 4RF5A 3JQCA 3CZRA 5DT9A 1CIVA 4KTVE 1TT7A 4J1SA 4R41A 3WOHA 2PKQO 2O48X 3VC7A 2Y1OA 1IHXA 4EEXA 2GD1O 1W0CA 3C85A 3OA2A 2IZZA 1O8CA 1Q1NA 3B70A 3RUAA 2RCYA 1PQUA 4PLFA 4RDIA 4PLGA 3EDMA 1ZK2A 3FPLA 3Q9NA 1XYGA 4YCAA 3CIFA 5I8ZA 3PHHA 2WYUA 1P45A 2Q4EA 2HQ1A 4YJDA 5IDQA 4F45A 4IDAA 5G4LA 1ZFNA 3RU7A 4BO9A 4PFJA 4RVSA 4CMGA 4MIEA 5TJ9A 2W8ZA 1YE3A 1NXQA 2VHWA 3FNHA 4BNWA 1ZK4A 1VKOA 4FW8A 4BNZA 2EJVA 5L53A 4J9UE 4W99A 5FF9A 2J5RA 2OBNA 2PGDA 1MXHA 2QRJA 1VJ0A 3QSGA 3S2GA 2BGLA 3JQGB 3E48A 3ENKA 4JBHA 4YBZA 3PFFA 4BB6A 1SMKA 5C5IA 1NYTA 1A4IA 4RPKA 1PR9A 1E1MA 1NFRA 3QP9A 4R3WA 3RU9A 3ZW8A 3PFWO 3ZNPA 3PYXA 5TLSA 1E7MA 2P9EA 1Y8QA 3I52A 4RLHA 2P5YA 5JY1A 3DBHB 5KCZA 1UDAA 3RUFA 3DTTA 4QFCA 5F1KA 1XIVA 3GMSA 2E82A 3IS3A 5TQVA 4PZEA 2V7PA 5ILGA 3GA0A 3GVIA 4JQCA 4YVFA 2E37A 2Y68A 4BV8A 1WWKA 4BO6A 1E7WA 2BMAA 4BNLA 2IEBA 1EDZA 5EESA 3QWBA 3W8DA 4CV3A 3JYNA 3SC4A 3WGQA 3H3FA 1E3WB 4P8RA 1Z7EA 4PG4A 4XCVA 2E6UX 5ES3A 5K6AC 2JAPA 2WE7A 4AG3A 5F3RA 3EAGA 2NLOA 1QRRA 2TMGA 4BNXA 5L4NA 2VCYA 3UGKA 2PZMA 4LMPA 4R68A 3W4IA 1YBMA 1GYQA 3KYCA 3VH1A 1ZMTA 3MWDB 2O3QA 1B8PA 2VWHA 3W1VA 2PD3A 5KKAA 3GVXA 1UDBA 3WWZA 3JQ6A 1M2WA 4CR6A 4XZ3A 5JDCC 4WCFA 3SLGA 4KMSA 1K6IA 2G17A 3IDSA 3O8QA 1BSVA 4Z6KA 1B3BA 1N9GB 3H5NA 1JLLA 1NVGA 4FPXA 3A06A 3WGIA 1R4MB 1CF2O 4Z0HO 3AOEC 4RLSA 5TNXA 3VZPA 1I3NA 1EK5A 2C5AA 2GPTA 3DO5A 4GMGA 1U7HA 3WMXA 3C7CB 3OBBA 4D46A 3GOHA 3K31A 4IGFA 1A27A 1LC3A 1SAYA 2X58A 2C29D 2IE0A 5CDGA 4TZKA 4ND3A 4DIBA 2DTEA 5KIAA 1LLUA 3OQ6A 1HETA 3WQRA 4L4SA 5JSFA 3DAFA 2NTVA 1K5HA 3WX0A 4R1NA 2CDCA 2DKNA 3LZ6A 3WQQA 3WWYA 2XF8A 3K5PA 3L4BA 2JL1A 3R3JA 4C7JA 1AUPA 2B36A 3VAZA 5C7OO 4M86A 4BL5A 4NK5A 3NUGA 1RPNA 2EKPA 2A9FA 1BGVA 4FGSA 5LC1A 2VHVA 3UH1A 2ZTMA 2BH9A 2ZATA 2D5CA 2QG4A 4PZDA 3GRKA 4JROA 3MTJA 4OOEA 2GNAA 3ZV5A 1LU9A 1SEPA 1PJBA 1ADBA 2EW8A 3GQVA 3A4VA 3AM3A 1KERA 2IZ1A 4GX1A 4FOOA 4IIUA 2QRKA 3F5QA 1CQIA 4BNMA 3LK7A 1ZO8A 5TGDA 4DMMA 2YFQA 3I1JA 4J49A 3RJ9A 3JD0A 4B8ZA 1GZ3A 3O03A 3I6QA 3ONDA 2QW8A 4HP8A 1ZIDA 2H6EA 4WLUA 1JQBA 1BVUA 1ADCA 3MWEB 2WYWA 5B4UA 3ANLA 4MINA 3ZWMA 1I8TA 1YH3A 4IINA 4EUFA 4E32A 1DPGA 1F8GA 2EKLA 1IHYA 3GZNA 4EJ0A 1NR7A 3F1LA 1UP6A 2VWGA 1E1LA 4NI5A 4MVJA 3JSAA 4HUJA 3IQDB 5IZCC 3KSZO 3V2HA 5EL0A 3GNQA 4BMVA 1P0CA 3H9UA 1LX6A 3GLQA 1Z7BA 3EZYA 5IFLA 3GUYA 1SB8A 4LRTB 4CV2A 2PH3A 4IBOA 2LDBA 5U1PA 4BO1A 3IMFA 2JFHA 1V8BA 1NWHA 2HK8A 3UXYA 2OGUA 3ZCXA 2GN8A 3RBZA 3WGHA 1N92A 3JYPA 3DL2A 1R6DA 3PYMA 1Q7CA 4P22A 5KJ1A 3MZ0A 4LCJA 4PZCA 2GN9A 4XQEA 1QSGA 3EZLA 4RCVA 3UW3A 3D3EA 1N2SA 4FQ8A 2G76A 4CODB 1JN0A 3ZNQA 4E4YA 4BS9A 4JIGA 5C7IO 3JYOA 3ZHYA 3TPCA 2W98A 2D0IA 1GCOA 4GX2A 3F5SA 4WNCA 2NU8A 3JYLA 2A92A 1J5PA 2P68A 4M54A 4O5OA 1R0SA 4I8XA 1K0UA 1O0SA 2J5KA 3GNTA 2Y1EA 4BO5A 2FWMX 2Q46A 4YT2A 5AXAA 1Y8RB
chains in the Genus database with same CATH superfamily
3TVDA 4LF7B 5F64A 3DB1A 2BGNA 2OXRA 2PMCA 4DPKA 4Z9AA 3J81A 4N6OA 4KJXA 2J59A 2O0JA 2P0YA 5EGSA 5JSQA 3CVWA 4EI9A 1C8KA 4Q3NA 4EHJA 5IJ9B 2FF7A 2AOVA 1HLPA 3HKCB 1T2FA 1J24A 2VZ0A 2PCLA 3MRVA 3TM4A 4A2QA 2WFAA 1TVKB 1WUJS 2KI5A 3O73A 5MGNA 1EVLA 2N0SA 1MJGM 5D3KA 3U4QB 5KO2A 4I1UA 4A16A 4BJ1A 3SFVA 3LF1A 3O21A 1GPJA 2XQFA 1E2EA 1QHGA 1A8HA 1E58A 3K2QA 4X71A 1KYVA 1U9IA 4A6PA 1FDOA 2QTBA 4NBUA 3EZ9A 3OTQA 1K7XB 1IEQA 1ZJ4A 2DP4E 4W5HA 4WRRA 5F5LA 3WJAA 2HR1A 2EL7A 4MA0A 4JYPA 5DNEA 3QFSA 4PIMA 1INLA 2W6MA 3UA3A 1AKVA 2XA2A 3HJBA 2FHPA 3COSA 3AR8A 1XZFA 4JB8A 2IE8A 3SZLA 1HDRA 1TM1E 2BSQA 3KUKA 2WUEA 3MUNA 2H9IA 2TMYA 1TVMA 3M3PA 3VDRA 2AQ8A 1OIXA 4MRNA 4BDSA 3ZJTA 1GKYA 4TYWA 2ZTLA 1MOZA 3H4MA 5B3JC 5FO1A 3ZEIA 3PENA 2XF2A 1RWBA 3HBJA 7MDHA 1HM5A 3FDIA 3BERA 1Z5OA 2YRXA 3KQMA 3VHXA 2FZVA 1M1YA 4AT1A 2VXYA 2FSFA 3KLNA 5FAXA 2VAWA 3ZS9A 1SY7A 2CY0A 3IR5A 3S2UA 1RC8A 1P5RA 3T52A 3AWDA 2FDXA 4JBWA 4FX5A 4TUYF 3JAKB 1RAAA 2PX0A 3BRQA 4HBGA 3AHGA 1DCMA 5I9TA 1N9ZA 3D59A 4JI1B 4KFSA 1C5KA 1QKKA 2G9RA 5K3AA 4P93A 3SVLA 3GI1A 4J91A 1JFLA 3EXG1 2PD4A 1II8A 1OHHA 4RTNA 4FXPA 4RH3A 4C5CA 4EUHA 3GH1A 2VDJA 3C3YA 1NIPA 2DUUA 2O8DB 2PH5A 3FHOA 1LI7A 4LBYA 4I4IA 3DD5A 1BH6A 2TMDA 5IMSA 2CHVA 3JVDA 4KE6A 2ZJZA 2QXYA 1DDGA 4H6XA 5G40A 4KXLA 3T4XA 3PLNA 4RK6A 3CSDA 1N4AA 3T5MA 3VSCA 2O8BB 2Y76A 1FUYB 2WAAA 1N2BA 3QMPA 5BWCA 2P1ZA 2D4AA 4L3WA 2BFEB 3S68A 2P8JA 3ZHRA 4CU2A 4U7WA 4C7OA 1KH1A 1V4BA 1WIWA 2B20A 2RGUA 5CG2A 1B8VA 1LZKA 3M6IA 3GLTA 2DFVA 4INPA 3JQGA 4NF2A 3TZKA 4CV1A 2NVWA 3WAJA 1YJQA 4IGAA 4MX8A 3UHOA 5AWFC 2WSSD 3RT9A 3FOZA 4YRZA 1PJLA 2CJWB 1GG8A 1T6NA 2IC5A 1TZ2A 3NTVA 1PI3A 1RXCA 4NAHA 3RKSA 4F6LA 3VSEA 1GGEA 2QYTA 3FWZA 4E4RA 4HLQB 2WV7A 3TIGA 2R7KA 4Y2GA 5TARA 4M98A 2FW1A 2HNKA 2HQBA 4GRIA 1HDOA 2ZR8A 3DWIA 5FBKA 4ZEMA 5ITVA 1PS0A 4DA9A 3L0DA 4BX0A 4F3CA 1E7YA 2G7MC 3BGOS 2YWGA 5BMVA 3REQB 4AROA 4OLBA 4E12A 1AQJA 1E3MA 1N5OX 2J3QA 2MWMA 4L7VA 2A33A 4WK2B 2OBXA 5I7SA 5LL6P 1RZRD 4Y9SA 4RVCA 3O1HB 1J2YA 1KJ9A 4A4DA 1TZKA 5ICMA 1KMQA 4C76A 4INAA 4EB0A 4GKKB 1WZNA 3HDGA 4Y6PA 4ZVLA 1DBVO 1J2EA 1MT3A 4IEIA 4OBEA 1UJCA 2GPJA 3GJYA 4KCGA 3WFIA 4N7JA 5D3QA 2HLPA 3E9NA 1KOGA 2NTEA 4UARA 4E46A 4RF2A 1TTQB 2DQYA 4FZVA 4CIBA 5D85A 2XXAB 4ZQIA 1KR5A 4WMLA 2X15A 3HDHA 5BQ5A 4B48A 4E1VA 3I01A 4RSHA 4F1KA 4MJ3A 2ZPTX 4CM5A 5AVJA 1H1LB 3CO5A 1QBKC 1XZAA 2BFPA 1I4TD 3KTFA 2HSJA 1CX9B 1KZ4A 3OQHA 1SQ5A 4O4HA 4JB2A 1P3JA 1ULTA 3NHMA 5K4AA 4ARCA 4JT4A 4ENPA 2OORC 1SOUA 2ZRNA 2ZWAA 4A23A 4JC8A 3A4MA 4OYHA 2UU9B 4JK3A 4RVFA 1V8FA 3TLGA 5I7VA 1RQNA 3CUYA 3KWMA 1L4MA 1RQLA 2YIMA 2VEOA 2IP2A 2PQ0A 1S5PA 4LNUA 4JI5B 2VXOA 1T9DA 4KAFA 1VMDA 2B35A 4IJUA 1N2JA 1OGYA 2PD6A 1YQGA 4D8TA 2XOEA 4XJSA 4JEUA 4PAMA 5DTIA 1DJQA 1FS6A 3IP1A 1Q0LA 4ZANA 1G2PA 2B82A 4QOFA 1UT6A 3TZLA 4EF6A 1P19A 3P7MA 4B47A 3L05A 1A8QA 2P67A 4EPRA 1NJ8A 3KYDA 3CXRA 2G08A 1SKMA 3TI9A 4PR0A 5JEDA 5AXDA 5BSHA 3CVVA 1LB1B 4QOEA 1B6TA 4B6PA 1Z63A 4NAVA 2I4MA 1BDJA 3R20A 4TQGA 4OIMA 3ESAA 5DCYA 3E58A 2C95A 4V0MA 4XJXA 3VH4A 1EUDA 1P9LA 5TB5A 1A50B 1H93A 1QH0A 4EG3A 1RPTA 1QORA 1OBFO 4IF6A 5F5NA 5SZJA 3L7LA 5JC8A 4OMCA 2VDUE 1CNMA 4ARZA 3V4RA 2AC4A 2CZQA 3A25A 4CFSA 2TS1A 3IPCA 3T7JA 2JFUA 5AW5A 5LZ4A 3RROA 4KG7A 1DOZA 1T0UA 3NWJA 3I45A 3IV7A 3AO0B 2I6QA 3GYGA 3JQFA 3QLUA 4KDEA 1KVRA 5C1OA 4GM1A 5IJWA 1J5EB 1OWPA 3CW8X 1JZQA 1U3CA 1D2GA 2VSNA 5ICFA 3NASA 4DLXA 4P58A 3DE6X 4TLLB 5CFPA 1ILWA 1PNRA 3E0QA 3Q87B 3OPVA 3MWFA 3UMBA 2PRZA 4S0ZA 5I9BA 1JAIA 1XEWY 3C8UA 3MGBA 3OY7A 3P0JA 4E31A 4JJ8A 1AE1A 5EMHA 4K46A 3L4SO 4YP1A 2XMSA 4DA7A 5BXQC 1D2EA 4ZU6X 3M0EA 2FG7C 3LX8A 4XQCA 1OY1A 4UTNA 5JRZA 5JQWA 1SBTA 1D7AA 4HDMB 3KL2A 3TRHA 1J9ZA 4IVRA 1YS4A 4UTXA 1L4LA 5JNWA 4I6GA 1P0MA 1Y34E 2Q4OA 5LYJF 4KFTA 2BKEA 4JJIA 4Y2PA 3AERA 1T9AA 4XRGA 1IWPB 4E30A 2QVLA 4PLHA 1WG8A 4XUEA 1MZPA 4S0XA 5TXGA 1GCIA 5GAJA 1MVLA 2DZDA 5I4BA 4ZQGA 1J5XA 4ZOLA 2QUZA 3L93A 3W5AA 4C4RA 1JKJB 2YZMA 3LPAA 4HO1X 3DE2X 5H82A 2W70A 5LDGA 3KVOA 5I7WA 1TLTA 3HUUA 1BCSB 1PG5A 3E84A 4Z7QB 4GZ6A 2LIPA 1CUVA 1K2WA 2XCLA 3PGLA 3C3EA 3J81k 3ADPA 3VNVA 2NV0A 1PWYE 4R4JA 1QFMA 3LO5A 2E1PA 3ZU5A 1AKMA 4YAGA 1TQ6A 2XMBA 1Z08A 2GEDA 2YJNA 2ACVA 4NS4A 4D41A 4HNQA 5JAHA 5KPJA 1EHYA 2ZAIA 1RWXA 2GM5A 1KI6B 1MW9X 4M1MA 3R7BA 3HWWA 1ORTA 1LS6A 3P4YA 3RRXA 3PIIA 3WHLA 2A1IA 5A7HA 4AG5A 2R3SA 821PA 5I5EA 1FE8A 3KSBC 3P0IA 3M9XA 2X8BA 2PZEA 2ZB8A 4JCOA 1K6EA 2EV9A 1HYQA 4XM2A 4AX4A 1Q0RA 3TIIA 1IEXA 2VT6A 1BH2A 1W1UA 2YQ4A 3RNOA 1C3EA 3QWAA 1M6EX 3EZXA 2A86A 2IHYA 3HDVA 4MPJA 3N6VA 4F3KA 2AQIA 1ADFA 3U2QA 4R8MA 3TD6A 3PSHA 3HV0A 1TAQA 1Z4QA 1Q0UA 2AOUB 2NNWB 3B5IA 4LRQA 4N82A 3O8OB 4BO3A 4QODA 2GESA 5A7FA 4ALKA 5KEIA 2J0SA 3VR2A 3EGDB 2EF1A 4MVWA 1OC4A 2A6PA 4BNYA 4MSUA 2ZIAA 2YTZA 3OHSX 5ITZA 2AUNA 3CW9A 1PEAA 3SIWA 2C82A 2P4EA 4YMTA 2XWBF 2UUBB 4ZVPA 4ZICA 5JS1A 2CHQA 1EK1A 2JI4A 4TSFA 5F2NA 4E5VA 2AN3A 3UAOA 4EATA 1J09A 2JJMA 3EXEB 3GB9A 2OPHA 1WDWB 1FBNA 2DSNA 3W05A 4A8JA 2OLEA 2A0FA 1GPWB 4OSEA 3QPVA 3SVZA 3KPVA 3TBFA 5LKAA 4KQGA 1I7LA 2NVUA 3AKYA 2QIPA 1Y6GA 1T1EA 1MX1A 2IV7A 4ZDKA 2IBMA 3GZJA 2A9QA 5ADHA 4M1WA 1F4PA 1LH0A 4UMVA 1JLKA 4N18A 5ALMA 4BBJA 5FOVA 4AI6A 2ZJ0A 3OFND 3B78A 1ECLA 5C3MA 3D8BA 1UMCA 5SV2A 3WGZA 1E1QA 2C0CA 2YXLA 3HLKA 4R1MA 5KVSA 5AI0A 3ZHZA 2D5IA 5COAA 2F8LA 5EXSA 4A27A 2COUA 3WIDA 4UBKA 2WFLB 1LPPA 3DKVA 1T15A 4OTZA 5ALZA 1VFPA 3QW2A 2Y1LA 3LA8A 1FDVA 1M6YA 1QCCA 1U0GA 3DFUA 4WJKB 3ZBQA 4DLSA 4Q7EA 1YNOA 4IDCA 3RVKA 4LI0A 2Y1CA 3ICQB 3WLQA 1WNTA 4H3KB 4CMCA 5SYMA 5C81A 1DFIA 3OZTA 2FFJA 1V3VA 3BICA 1JJAA 4GECA 1OYVA 2VK1A 4EYQA 4MZDA 4V02A 4K6GA 3I23A 3U19A 1A8PA 1POWA 2HDOA 2PX5A 4DRXB 3EWAA 1SCJA 3OD1A 1VL8A 3A6GA 3QEMB 3WGMA 2VTDA 3W5UA 3B8HA 2AE1A 5M04A 4EL5A 5JCOC 3IAHA 3QLTA 5ALTA 3D0KA 2QVBA 2X4IA 5KYWA 4JQOA 1F14A 1XNJA 3LYHA 5HOQA 1TEXA 1XUOA 3CPSA 1E3EA 2P4QA 2KQUA 3GLUA 1O6BA 3FRHA 4G0QA 2WHPA 2JD0A 4Z4FA 2DFDA 3SBEA 4D7AA 1H42A 2IY8A 1PVDA 3L46A 2N1BA 4IIJB 3WLFA 4QE3A 5FQOA 4A3SA 3PT9A 4LBWA 2EHJA 4D3ZA 2VH1A 3H5AA 3WBFA 2I66A 1RHUA 3GLHB 1ZD2P 3K9WA 2YL2A 3IA2A 4GPZA 4XX0B 1VHDA 4DOMA 3F6CA 1R4NA 5DZSA 3RT7A 3VZQA 1ILEA 4JP1A 4YMUA 4I55A 1DWUA 2MSNA 4XB6B 4N7RA 4CMKA 1RTTA 2W58A 4G37A 4WX2B 3IPAA 2X3UA 1NSFA 4KMRA 5EI5A 3WRVA 3LCMA 3OPYA 2JFXA 2RIRA 5JO0A 4LF6B 4CF7A 4EDFA 3KQWA 1ORDA 2WF6A 3MN1A 2O2GA 3QLJA 4UHBA 5FNVF 3C6QA 1EVKA 2PSFA 4ESVA 3BE8A 3N8GA 1RJ9B 1M83A 3NOXA 2NNLD 2CEKA 1CB7A 4GMHA 2D2EA 2AYXA 4QBKA 5HKLA 4BYMA 1MD9A 1KEPA 2JF0A 2IBSA 3BREA 4PHHA 4UVEA 4RTKA 4DDWA 1R8QA 4RPLA 1POXA 2OMEA 2V96A 2VHXA 4I81A 5A0VA 4IAOA 1EGQA 4CKWA 1TCVA 1CEEA 1ODFA 1C3VA 4JC4A 5JMTA 4B83A 1G9XA 2CYBA 3GJRA 1ZEMA 1FDTA 2RMKA 3H7AA 1JEDA 3ICOA 4YJFA 2DEUA 5A5FA 1S0UA 1SUIA 2EZ8A 3OCJA 3V7FA 4DJJA 5G0TA 4B34A 3R6WA 4MIKA 3KK0A 3DBRA 4UEJA 4YXWA 4YO8A 1PZMA 1J0XO 2V7EA 2H2IA 1V37A 4YT4A 1DAFA 4Z7JA 1Z8HA 1EH5A 1CUAA 2FPOA 5E7MA 3CPEA 4LK3A 4F91B 4IDPA 2OHIA 5GM1A 1YUMA 5FPYA 3STWA 2PVCA 1FTYA 2MMCA 1Z73A 4GZMA 3LWDA 10MHA 5DK6A 4HNUA 3AJDA 1T24A 4OHWA 1MEOA 1C9NA 1U02A 3ANXA 3RWBA 4ITVA 1NLFA 3PB3A 5D2CA 2V65A 3ZD9A 1EBUA 2VHQA 1XDDA 3Q7SA 4UM9D 2B5WA 1RWPA 2XSZA 3VYWA 4AULA 3Q2IA 5TF0A 4BJ3A 2LUOA 2O3JA 3TQFA 5I4KA 2IS4A 4ZEOA 4LYGA 4QUAA 5A0FA 4O4IA 2J87A 1XZDA 2R6FA 3CM0A 3WB0A 5K9ZA 3RAGA 2AFIA 4ZOQI 2GSDA 4D25A 1IPFA 1PJ3A 3Q3CA 1IUOA 2BFFB 4BVBA 3FYUB 2ZT8A 2QE6A 4TWBA 1AKQA 4UTPA 2Q3LA 3ZBPA 5EKTA 5KQSA 3MLAA 2D1TA 3C5EA 4Q4CA 4OPMA 4E3WA 1GQRA 1LFDB 4UREA 4XCQA 4D9KA 1E20A 2ZIXB 1ZSNA 2BE9A 4NNJA 2J32A 1J22A 3G2KA 3R3YA 1Q6YA 2G72A 1OFUX 1HBJA 1YZVA 2ZRFA 2QPAA 2EARA 1Z5WA 2WHXA 3CRW1 4QXAA 3N70A 4TRNA 4UHEA 1EFAA 4Y8VA 3UFXA 5K8JB 4WZ6A 5EWJA 4D56A 4PF1A 2DJ5A 2QJWA 4II3A 4NSNA 5HFJA 3WNVA 4IWNA 4MKRA 3M7IA 1VYHA 2ZWPA 3GLSA 5L40A 2B6HA 3PBKA 1D9ZA 2AUTA 3DMNA 4Q4HB 4IQ4A 3WVNA 2QL6A 1YQTA 2PM8A 3ZZUA 3HYRA 1A8IA 4H1TA 1F3LA 3TUJC 2ZUDA 4NJEB 5A3RA 2IH5A 2ZUBA 3O4HA 3RQSA 2C7PA 2WSIA 5J4VA 2XE7A 4AD8A 3WYGA 3IVXA 3IAM6 5CXQA 4M0FA 4CMAA 1BOFA 3G0IA 3O4VA 4G5GA 2Y9MB 3S27A 4L28A 1Q12A 1YRQA 3H16A 1QDUA 3G2MA 4JT9A 2VSXA 1NTRA 4LECA 2FPSA 2ZWMA 3EIUA 5SY6A 1NU8A 4H08A 4BKUA 2NYUA 1EFRD 1KDTA 4HB2A 3DVAA 2W2NA 3NHZA 4P4LA 4FFNA 4UM8B 3V9AA 2XUGA 3D4PA 4B71A 4UM9B 3OPYI 2Z57A 2IA5A 1QYRA 1XNHA 4Y6SA 1IUNA 4ZAZA 4FCVA 4MICA 1CPYA 5G41A 2Y2UA 4OREX 3FSJX 5AP9A 1QHIA 3D8RA 4NCIA 2FVYA 4WZAB 3UWMA 1B8OA 3ONVA 4MHSA 3SC3A 4OP1A 1KDPA 5A3VA 4ZEVA 5JAPA 2B2CA 3AW9A 4DRYA 3GLRA 1CF4A 1KI9A 3CLSD 4NCNA 3SC6A 1K8XB 1RHMA 2HEGA 3FM9A 1SCKA 3BIJA 4INJA 1EKXA 5H5JA 4DIFA 3KV1A 1S3FA 1VKHA 3A6JA 3GLGA 3T1HB 3ZCPA 1RVV1 5CT4A 5FTLA 1CJTC 3ZEAA 4GXTA 5CDFE 2IU4A 3DZCA 4NP6A 2FMTA 1HURA 7AT1A 3IQIX 1CDDA 2WYOA 3CA8A 4BWYA 4XPIA 1Y3FE 4BFYA 4H7JA 5IAOA 2XIQA 5JNLA 4H7EA 4BP8A 4IOKA 2M32A 4JBYA 2XWPA 4PLWA 3JTMA 5CYFA 1Q1AA 4PC1A 4IHQA 4JYBA 5AHWA 2HLNA 5LU9A 2WWGA 3AF3A 4R98A 2N3ZA 5JDIA 1Y37A 1GTL1 1DJNA 4Q4AB 4RD3A 3TAUA 5KUTA 2JNWA 1YS1X 1JHUA 1SHLA 1TCAA 3PC2A 3UUFA 2WK1A 3EIEA 1YE8A 3DZBA 3W5SA 1HYEA 2FMFA 4NCAA 2XLCA 4GG1A 3WK4A 4C08A 1Q2UA 3IQHX 4D96A 3QEJA 3PWKA 3LOUA 3OTWA 1VI5A 4BTLA 1Z88A 3FZQA 1G17A 4DG9A 1P4GA 2PMDA 4MS1A 3EAQA 2ZJYA 5ESWA 1YWGO 1DBSA 3RIYA 2PKXA 3HXPA 3P45A 3FUWA 2Q0XA 2PWYA 2H08A 4Y6LA 3V4ZA 4R2KA 1U0EA 4OHMA 4E21A 6GPBA 5HVNA 2YJ4A 1KP9A 3HB1A 5AT1A 4ZMBA 4GXQA 3ZWXA 3GH3A 4XQGA 2R48A 3CXUA 2JLAA 5DHRA 2ZGVA 3ZY6A 2YZ7A 1UQUA 3C8MA 3JQBC 1VFNA 2GM9A 1W581 2QG9A 2VOJA 5EZYA 4YAKA 2QGFA 3I9OA 4EKDA 5DISB 3BTSA 2Q5JA 5EQDA 4WKOA 3WK6A 5IANA 4GXRA 4Q9JA 5IMBA 4ND8B 5EJ2A 1TIKA 1NI4B 5LA6F 5C7LO 3BYZA 4C6SA 2DPGA 5GOTA 1P6XA 3JCZA 4AN0A 2H4FA 2PR7A 2PMBA 4NEHB 3S7ZA 1RTKA 5E9AA 4ZJYA 2IYAA 1QO0D 4BFXA 3COYA 2VBIA 2PUEA 3L0BA 1D0IA 3BIXA 3PHCA 4KXNA 3QSYA 2LWIA 2XH8A 2IYFA 5LXTF 1J7JA 3KETA 1WKCA 1XJ0A 3HZRA 4KGVA 4LXHA 3B3GA 2AOTB 2DBRA 4AWBA 2WUGA 1GG9A 1H0RA 5KSYA 4MW5A 2C9DA 521PA 4GBMA 1JVBA 3AIOA 2R44A 4A03A 1ES9A 1BDBA 3ESYA 3GJ7A 4IZHA 1UH5A 3DZKA 5FL7A 1XKXA 3HJHA 3JWGA 4BNTA 3BRWA 3R5FA 4OJTA 4DAOA 2CMDA 2AI3A 5L3SA 5L3ZA 1M5UA 1E2LA 1WXQA 2RH8A 4FKZA 1GZ7A 3LPLA 1JPNA 1Z3CA 2JK0A 2IYWA 3FTPA 4Q7LA 1SVOA 2FR1A 3MLEA 5FOUA 2PYDA 4UULA 3SSOA 2DUMA 1CQJA 4B2LA 1L8AA 4YRKA 2Y1FA 2YJGA 3GVPA 3O4JA 3QOXA 4I1SA 4OJYA 5TV2A 3AEYA 4HVCA 1Q19A 4AS2A 4UHJA 3P9CA 4GLLA 4RSGA 4AKSA 1YAJA 1TX4B 3NW9A 4V39A 3C1TA 3O84A 4N1AA 4XGRA 2B0CA 1L1FA 4MW6A 3FJ1A 5DEIA 2VG8A 1NW4A 2D3WA 3AZPA 5AOBA 4TXMA 5GY7A 1ORVA 2P9TA 4MQEB 1RP7A 4X00A 5CFOA 2HCFA 4M0DA 4TOIA 4ZI7B 1R50A 4M3NA 4LXYA 3Q8WA 4REOA 3PGKA 1XN4A 3STXA 5B7PA 4XQ9A 1NBAA 1GUDA 4TV8B 3WYAA 1V3QE 4FOPA 3RVQA 1BX0A 5BY2A 3EEOA 2A0WA 2PJUA 1NY6A 1EM8B 1COWD 4MUJA 3V3KA 121PA 1YCFA 2QZSA 4S3MA 6PFKA 3H6KA 4DLWA 1BHSA 2OP0A 3FYDA 2Z30A 3MJ4A 4UE3S 5L6LB 4X90A 1A8UA 3S1AA 5DE3A 1UFKA 5FTMA 1RPAA 4YCLA 2O0HA 1XMOB 2C0QA 4ETMA 4TPKA 5IXJA 4GGOA 1E99A 1UBRS 2Z5FA 1JFRA 4TN1A 1PJ2A 4K0RA 2PNFA 3MHPA 2O2DA 3F90A 3AIMA 4L0QA 5AK6A 4AYTA 1KNQA 4Q9KA 4DDUA 4JLUA 4ENQA 3H97A 3MQ2A 2H5JA 1AN0A 5FV7A 2NSHA 4AN1A 3Q98A 1PNVA 3QYJA 3OTGA 2PQ2A 1Z36A 4HWTA 1FNBA 2IQ5A 1FA9A 2QAIA 5ARCA 2JKZA 1E2PA 3EDCA 1EQ2A 4QIHA 4MR8A 4CXMA 4OY3A 4DUPA 1CUHA 1UXJA 5AK5A 4ZVRA 5JE8A 1RLJA 4LYAA 4R9VA 4OSPA 2FPXA 3MS7A 1CY2A 3HA2A 1V7QA 3GPBA 2DT8A 4JQZA 4QO8A 1L4GA 4R05A 3INRA 2OYSA 3KOYA 4QRDA 3SQXA 1NT4A 4NQZA 3VPBA 3VU9A 1WHSB 4UHCA 3BIOA 3I12A 3WLJA 1NDUA 3FCOA 4I3FA 1JHXA 4HLUA 2AXEA 4TWRA 3KEOA 4FQ5A 3VKVA 5K8IA 2BH2A 1YRAA 1I2ZA 4CM8A 1T36A 2X0JA 3RUEA 4MDYA 1GPLA 1K08A 4QDOA 4DT1A 2JI6A 4N47A 1Q7RA 3KJXA 3UHJA 3CX7A 5EMJA 5K05A 4RVHA 1KI7A 2GJ9A 2Z1DA 3I30X 2C7VA 4CJXA 6CHYA 3I5YA 4W82A 1ECJA 4ZCQA 2PS0A 2GF2A 1OZAA 4HCJA 4P3YA 4TVKA 4AJNA 4MMYB 2HO4A 1GCAA 5HF8A 1DLJA 1WCIB 5G1NA 1BN7A 2ZSAA 1QHXA 2O5EA 5EIOA 3VYTB 3BMOA 4KK3A 2PFKA 4FT4A 2W0SA 2ZIZA 4RKFA 3U1BA 1QYCA 1CRPA 5D5PA 2QW0X 1XQ9A 4LY0A 3QE4A 1KNXA 1RZ3A 2UZAA 4RGQA 3UW1A 3O26A 5HUJA 1T5HX 2BKVA 2WJZB 5KQLA 1AKWA 2HBQA 2A1TS 3RRFA 3ZE0B 1UPUA 3BXOA 5IN5A 3H9JA 1BAPA 2ZRMA 3OZAA 4X91A 5LU8A 3KBOA 4IMRA 1OLSB 1YB2A 1U5AA 2NVBA 1G38A 1IRIA 1D1SA 3TZQA 3T54A 5BV0A 3IO3A 4IKEA 1AKRA 2XR1A 4JEHA 5A5EA 3CKLA 3A2MA 3KKPA 2OGTA 2NUPB 4TV9B 5EE9A 2PTHA 1L7EA 5A2GA 4LZLA 5LQDA 5D51S 4B3DA 3SN6A 4F5YA 5U9CA 4Z3DA 5INTA 3AHFA 3SHOA 1K98A 4KNVA 5DNWA 5KJFA 2GZMA 3QVVA 2WQZA 4I4CA 5H59A 3V8BA 3VVBA 2D0PB 3DOEA 4CCAA 5CB6A 5LVAA 4PW0A 3VUFA 4JLMA 4YAJA 3TLXA 2ZDQA 3AZQA 3ENVA 3GRVA 3QTBA 4M8LA 2R2GA 5KZMB 1OB2A 1CWUA 3OURA 1TC2A 4GOKA 5K6AA 3PFNA 4ZMRA 3W2IA 3G7NA 2FXVA 3FG9A 4X1KA 4CNBA 4N49A 4OHXA 5DLDA 4LKOA 5DNVA 1X80B 4JJ7A 4CQMA 1AHHA 3N28A 3FCCA 4RF3A 3CNBA 3M4YA 1F6DA 3N2EA 4RHFA 1KE2A 2UXBB 3WAKA 4GLFA 1G16A 4TT3D 4EIWA 4M6WB 4IZIA 3FPHA 5B6PA 5JCJD 4NH0A 2P27A 4JVOA 5DSXA 3EQZA 3QBJA 3DUFA 4BMZA 1BS2A 3MW8A 5KDDA 4NCJA 3UO8B 1MQ9A 1UZLA 2P3SA 3I6IA 4HMQA 4J16A 4NAUA 4XWGA 5JG7A 3EVEA 3GJ4A 3Q6NA 4RIIA 2H1WA 3R7WA 3LSYA 4KR2A 3D4NA 1U0RA 2CMKA 3WXBA 2FWNA 5PGMA 5CDTA 4UAVA 2W2QA 3NRBA 1U0SY 3MYYA 3TTVA 1QIIA 1EFKA 3QTLA 1WCV1 3AOEA 1EZ4A 3B7PA 5F2KA 1JYEA 3IB6A 1GILA 3TL2A 4YB8A 1NV8A 3O4FA 4P4NA 4URVR 2J8ZA 3ED5A 4NKRA 3CWCA 4BZQA 2NQ8A 3HN2A 4OBWA 5KYVA 4IGEA 4DIOA 1FXSA 3HP7A 3JS5A 1GDHA 4GW3A 2QSJA 3P9YA 4MWTA 4NZNA 5IM4F 3GRFA 1FVFA 2X86A 2EW1A 1OC2A 3OJ0A 1UKEA 4AMBA 4BKOA 4M0LA 5DMHA 4MUFA 2FFAA 2O54A 1LWNA 3BMNB 3BZWA 4GKVA 2JBAB 2F3PA 2PIAA 3ED1A 4YY3B 1ULZA 2WBLC 1D4OA 4AMZA 3HXKA 3PHGA 3MGAA 5FX2A 4WAUA 3X0DA 1FY2A 2X7HA 1X7YA 3UT5B 5CT8A 4EQZA 4NR0A 4PLCA 1DBIA 4AIRA 1WZEA 2FQXA 3WLTA 3IEUA 4YRTA 3SQMA 4EGCB 3GLIE 3M6XA 1U99A 3R7SA 2CLFB 5BYAA 2PLWA 2ZI4A 1BW9A 4CDGA 4ZVNA 3IT3A 1AXEA 4MQMA 1MO4A 2QW1A 2FZCA 1X8LA 3L07A 2VTKA 4UVIA 2BP7A 2B4RO 3TQRA 3BGWA 2BEUB 3INGA 1W29A 2PFGA 3WJ1A 3MMNA 1P2GA 3NJ4A 4KV9A 1F51E 1JX6A 1MZVA 3GFPA 4LYYA 4QGAA 3ZVNA 4CLRB 2YCBA 4NYJQ 4Y98A 1WCWA 3CLVA 2LCQA 4AUNA 4QYIB 2VAXA 4TS3A 2WC1A 5FPKA 1TW3A 2K87A 3B3QA 1BTOA 3KOOA 1GPKA 4UNPA 2N47A 3G79A 1DINA 1Y82A 3O8BA 1DIBA 1CJUC 1EK0A 1PSDA 3DTYA 3VU1A 4EKGA 4ND2A 4CW7A 5KYXB 1TKAA 2W2XA 1PJZA 1OW3B 4GLJA 3SICE 5AUNB 1JSXA 1V6AA 4ER7A 3K0CA 1OI4A 2QN8A 4KPUA 5CVVA 4HEHA 1FX0A 4GSYA 4BMOB 4Q93A 4OGFA 1VHWA 2IDZA 1W88A 1QNFA 3RS8A 5CITA 1O03A 5FPQA 1JEYA 3FYSA 4HH0A 1Z7WA 5EVCA 5B58T 1SUCA 3LVRE 4EGFA 5LQJA 4CQLB 4TQ9A 1Y63A 4E0BA 1B2LA 4A6XA 5AVQA 2Y0PA 3RCBA 3OLQA 5C4GB 1AN9A 1NBEA 5AVZA 5F33A 3UUGA 1HDYA 2CXNA 1CVRA 4QUHA 2XEXA 5ELLA 1E3TA 4QELA 3G89A 3KALA 4Y1EA 4RXMA 3GY0A 3ESZA 3RUIA 4DCCA 2WF7A 4GYYA 3E61A 1DX6A 1G0OA 1K92A 1TU4A 4X94A 1EP9A 3DE3X 4AP9A 3EGEA 3D3QA 1P5JA 3VUEA 5HYVA 2ZTHA 3RFFA 1JR2A 1U9CA 1UC9A 3ZQJA 4PCVA 4R1PA 3THWA 4NU8X 1MQSA 4HWKA 1YCGA 2ZYAA 2AVNA 1WHTA 3C0KA 5ALIA 1NSTA 2PUTA 1IN5A 1SELA 1GXSB 4IPTA 4LJ5A 3WLIA 5CEFA 3ZIUA 5HXAA 4UNQA 1NU6A 1QGDA 3JRXA 3RE1A 1V2GA 3SM3A 3KXPA 4D4KA 3KEFA 1KZ9A 4RX1A 3NI2A 1H2ZA 1B8NA 1Q15A 1T2CA 2A0YA 2RH5A 3HKDB 3T61A 4A8TA 2E21A 4UJ3A 2ZUFA 1BRMA 1TRKA 2JH3A 2QLFA 2YJ5A 4RPGA 3W5IA 3DVQX 1G21E 3G6WA 1EFHA 4FYKA 1YDFA 4OKIA 3W9SA 1Y5RA 3OQBA 3H1EA 3OZUA 4I4TA 2A0KA 4RXTA 1NDQA 1B42A 5D3ZA 4B6JA 1RRCA 2JFPA 4HNTA 1C3XA 1YFJA 1KEWA 2OYRA 3P9SA 2C04A 3HA5A 1ENOA 4FHEA 2CNKA 4GVXA 1DC5A 4RZ2A 2M6KA 2GK3A 4KX5A 1NN5A 1LPSA 4FE7A 4YWJA 3HMQA 5ALUA 1XZGA 3URKA 1DRVA 4FEAA 3V4OA 1XHEA 1JHQA 5K0BA 4I4NA 3T4EA 1NVVQ 2ADOA 3K70D 5FHQA 3S99A 1JQAA 2FW9A 4PFSA 4XD7D 1JJ7A 2R00C 2AV6A 3AL3A 4K6KA 5BN5A 1HNXB 3FLMA 2E48A 4REMA 5AO9A 1DRWA 3HZZA 4BNNA 2GPAA 1UBGA 1ZESA 4DBLC 1MLDA 1OOEA 2GZ3A 1EDOA 5AVOA 4OX9Y 5L8VA 4I2VA 4EKIA 2WJ3A 3PZBA 2WUWE 2ZB2A 3KQSA 2EGGA 4HEA6 4G2TA 1QE3A 5BNFA 3EFBA 4N4AA 2FCRA 3RAEC 1VLJA 3TQHA 1C7FA 4UCWA 2PYIA 3JZFA 1YE5A 1SU8A 3HZHA 2I5PO 4UNNA 4BFZA 4GDFA 1DHRA 2PTGA 3KWLA 1KJNA 1AC5A 1LJUA 9ATCA 5T41A 1QU3A 3AETA 1J0CA 1YU9A 3CPJB 1QVAA 4P32A 3ZCQA 5H8WA 5B30A 3AWIA 3H7IA 1MDFA 2LTAA 2Q0QA 2H07A 4Q7JB 3RD5A 3O2QB 4MWGA 4W9RA 2CLLB 4DRZA 1HXHA 3UJ3X 3CT6A 3EH2A 3PDJA 3UJCA 1QF9A 2YFYA 5A02A 3IBCA 3CLUC 3NDJA 5AK3A 1WMFA 3DPIA 4Q1BA 2OFPA 3OPMA 4MGKR 4LWZA 4DF3A 3NHRA 4MMZB 5CVDA 5J5CA 2JFGA 3X1YA 2OHVA 1FTNA 2E4UA 2X0RA 5KWJA 4EY6A 3TBKA 3VPCA 1MGOA 2HJ9A 2NUAA 3JR3A 1I6MA 5I7EA 2BYTA 4C0AC 1QM5A 3DFZA 4IIYA 4BTVA 1C9MA 4QPCA 4XIFA 1DBWA 5IAGA 3AJRA 1RXEA 3UJ7A 4AJLA 4MUMA 5EUQB 3RUPA 3BCSA 4KQEA 3DLPX 4ICIA 5DI3A 3CZ5A 1N6IA 1ZNQO 4IVPA 5EWLA 4ZYUA 3K70B 4CKCB 3JRWA 3L01A 2DT5A 4EG7A 2O8FB 1LCIA 4WXHA 1XEXA 4GBJA 2ODEA 2FOLA 2I3BA 3NOQA 1FZQA 3OX3A 3PC8C 4GX0A 1P9NA 3CR3C 2ZUTA 2RBKA 4P0TA 5AM0A 2OV6A 3TD9A 4X3CA 1ZISA 4PWZA 4ZK6A 2H3EA 1YIAA 2PZGA 2YN4A 2HA5A 4QREA 5KTNA 4BCCA 1YVRA 3P2OA 4M9SA 4BYGA 2YZKA 3QITA 4UUPA 1MB9A 5AXCA 1NI3A 1NWCA 1WOMA 2HF7A 3TCXB 2C7GA 1XAHA 3PG5A 1WM1A 3PQFA 4NOLA 1X13A 2ZE7A 4TMVA 5HK8A 4FFMA 3WHPA 4AXBA 3OM9A 3MOSA 4H77A 2P2GA 3BSYA 5C1BA 3KZNA 4I08A 3L18A 4RYLA 3BGVA 3PIDA 4HFNA 4WKBA 3V1UA 2VKTA 5BVHA 3FHTA 1L4YA 4QBIA 1AGYA 4J43A 2W6JD 2Y93A 2GJSA 2J9XB 2GN6A 4ND6A 5CNMA 3AJ8A 2JH8A 3QJGA 5ALGA 4W7IA 3RFCA 5K3BA 4JELA 3L0SA 4WEQA 1YV9A 4RACA 4DMCA 1NMZA 4PNPA 5AW0A 3LRTA 4MVJH 4JFRA 1A3CA 1K9VF 1KTVA 5JQGF 4C07A 3W78A 1DS6A 4YJ3F 1JALA 1VGRA 5HZMA 3DEJA 1KQOA 3H2HA 1YFLA 1L5YA 1AS0A 1REQB 3SZRA 3V1TC 1HE1C 3M3HA 5KBYA 1VE1A 1QK4A 4D9CA 5JYDA 1CUXA 4Z3KA 2DC1A 1ZCZA 3LX6A 2YBEA 4IH4A 2WFMA 4KQIA 4IIXA 2VHCA 4MS4B 2P9YA 4RZIA 2D2FA 4A0HA 1E63A 1L5WA 5JYBA 1QAMA 4OYRA 4ZAGA 4OQZA 3IP9A 2DWUA 5DH9A 1GUBA 2YOGA 2BOVA 3HQ4O 2P1RA 3LAWA 4OQQA 5I7AA 5B58C 3G9UA 2HO5A 2OUKA 1YA4A 4LHWA 5T8KC 1ENPA 4C89A 4ME6A 1D04A 3ZK9A 3JWEA 3C41J 1VI6A 1TM3E 2G8LA 3GEMA 3K9GA 5IXYA 4ALMA 4M60A 3W2TA 1FS4A 4Q02A 1M2JA 1SUPA 1MRSA 5EMKA 3H1AA 1R5BA 2HD4A 3JVUA 4ZZ2A 3GP3A 3OLYA 2OBMA 1KL7A 4Y9TA 4CNQA 1X3SA 1LTHR 2ZXUA 3V1LA 3TXAA 1YI1A 2QBYB 3EGIA 2OD9A 3HY3A 4B3IA 4W1RA 3FYUC 3F98A 4DPMA 1QTRA 3ROFA 3KQNA 1PFWA 1JJBA 5B1EA 5JXWA 1C1XB 2V59A 1E1KA 3AEUA 3MWKA 4QOIA 4BKQA 4EHBA 3BTOA 5C5EA 1H85A 4WADA 1JKIA 2P2NA 5FA5A 3W0LB 3DZFA 1OIWA 4CN9A 1NVXQ 1Z0UA 4DIKA 3RYCA 4G84A 5HCNA 3IQZA 2OORA 3N2IA 2OQRA 3BQNB 4LDAA 2PNJA 1N33B 5HQ3A 1HKHA 3VYRB 4R1UA 3W9UA 1J25A 1ISJA 2HFKA 2OCIA 4IYJA 4X1OA 5JO9A 4AX8A 1ZL2A 4LE0A 1EUZA 3E81A 3F49S 2GMWA 1WBDA 2IZ0A 1DPFA 3HYCA 3V55A 4B74A 1UR5A 5BNWA 5AYVA 3KV3O 4RE5A 4BMSA 1HDZA 2QENA 4KI0A 1NQTA 2FSUA 3FLBA 2RB4A 1GUFA 5K1ZA 4D6XA 9LDBA 4RD6A 5EA2A 5KYUA 3RTCA 2WI8A 4KYTA 5JJIA 3QOYA 2JIDA 1FUUA 4LA4A 2BFAA 1CRWG 1GTG1 2Y8EA 2JGEA 1A9XB 1N1MA 4KQCA 2VP0A 2WVAA 3CEPB 3DEHA 4D4GA 1TT5B 4F1WA 3WNQA 4FB4A 2B99A 3S7TA 4HNAA 4ITRC 4ZP1A 1S3SA 2D3TA 2OKGA 3BB4A 1WE2A 3SJZA 2Z83A 4GMFA 1XMPA 1XGKA 4Q1CA 4IUCS 3SXUB 2VSQA 3GBPA 3ADBA 4I1IA 2ZM6B 4IZOA 1G19A 3N87A 3N76A 4JA2A 4KAJA 4DV6B 2DB3A 3A70A 1NLYA 1PUJA 1TM7E 2HEIA 2O20A 4FMPA 1W5TA 5AI8A 1FYFA 4BJHB 1O0BA 1G4UR 1OX4A 2RGBA 4PYQA 5FUYA 3HNRA 3MCUA 3O91A 1PZFA 4YUVA 1VL2A 1K3FA 3G49A 3I6MA 1IDN1 3I01M 4JBLA 4L27A 4MYSA 4PY2A 1QO7A 3LBNA 3VFDA 3KEQA 5C37A 1QG4A 1WO8A 4TS4A 4IUYA 1CQZA 1YR1A 4RFSA 5EINA 2PWBA 1ZD3A 2VLBA 2WG1A 3UTCA 3ZDFA 4W5WA 3ECCA 1UBJS 4HFMA 4LVOA 5JBNA 3GA5A 4OJMX 2GS9A 5LR6A 5GJCA 3LOPA 2EF0A 1QS0A 2OCBA 3LBHA 4K9OA 2QMEA 4X20B 3WGKA 4AJPA 3UOWA 1T1IA 3DDZX 1LVGA 1BXZA 4B3XA