1YQGA

Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
b'MNVYFLGGGNMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPELHSDDVLILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPGKIGLGVSGMYAEAEVSETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQEMERQYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pyrroline-5-carboxylate reductase
publication title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 86
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 1yqgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yqgA01
1X0VA 5A1TA 1AXEA 4A2CA 3I4FA 3RFVA 4K9DA 2DPGA 1SAYA 4BO6A 3WX0A 5J23A 3RI3A 4EITA 4CMEC 3D1LA 1NR7A 3UN1A 1M2WA 1R0SA 5G4KB 3VZPA 3WB9A 3DZJA 4CQLA 1OC2A 3GG2A 3I9LA 4FDAA 4YA6A 5H83A 2B5WA 1N9GB 3IKTA 1EE2A 4AJEA 1JWBB 3K5PA 5TT1A 2H63A 3GN2A 3K31A 4YBZA 3ANLA 4GQAA 3K2BA 3ZHYA 3F1LA 4BQRA 3X2FA 2G76A 3NYWA 1QLJA 3CPSA 4UVGA 4LSWA 1DC3A 1B26A 1ISFA 2J6IA 1Y5MA 1PWZA 1EUCA 3ETDA 2DKNA 5KVVA 2J5RA 4XQCA 3TRIA 1WPQA 4CL8A 1YJ8A 1NFRA 5THKA 1GYPA 4BB5A 4MVJA 3MWDB 3GVIA 3OM9A 5T57A 3SBOA 3ZW9A 3IIEA 5IXYA 1CQJA 4NFSA 4B8WA 4R41A 4RF2A 3E8XA 1KY4A 3DDNA 3FR8A 2FR8A 2X9GA 5CDGA 1KIFA 3LT4A 3D4OA 4CLOA 2IYPA 4IDEA 4Y6RA 1ZK3A 4BQPA 3W4KA 2V6FA 1F17A 2ZK7A 3DTTA 4AJPA 1LA2A 2IRWA 4E5MA 1CYDA 4PLYA 4D3DA 3H2SA 3GF4A 1ONNA 2Q99A 2ZQZA 4NIMA 3T4XA 3WJ7A 1YOVB 2IXAA 1GCUA 2I99A 3PHLA 3OQ6A 2B4QA 4QFCA 4J3FA 2J3JA 2JAHA 3I9NA 3GGOA 1QMGA 5BSHA 1ZMOA 4BKOA 1SBYA 1VJTA 1N8KA 1ZH8A 2X5OA 3BMNB 4BUCA 1DC5A 3QRWA 3ZHXA 3Q2IA 5KTKA 3AK4A 2FR0A 2X22A 3AUUA 4CLRA 3JCZA 1B14A 4PFJA 5G0SA 5BNFA 1QRRA 1ZUD1 4KUEA 1NQOA 2AW5A 2PWZA 4GWKA 3GZNB 1EUDA 2XAAA 3WLEA 4AFNA 3OA2A 3JQGA 3ON5A 3COSA 3E9MA 1R0LA 1X7GA 5CDSA 4E30A 2X0IA 1KVUA 3T4EA 3VZRA 1I0ZA 4TRMA 1KYQA 4I9NA 3WFJA 1DIAA 5CP8A 1B8UA 1U7TA 4TRRA 2OP0A 3H65A 2WE8A 5FYDA 2O3UA 4PVDA 3WGYA 3B1JA 1E7SA 3F47A 4CQMA 5EL0A 1B3RA 3IOYA 1PS9A 2B37A 5JBIA 3LZ6A 4IBOA 4A10A 3JYLA 5DZSA 1NAHA 3H9GA 3QVTA 1YB5A 1MV8A 2E49A 8LDHA 4O6VA 3VVBA 3PPIA 2HAEA 2VWHA 1NPDA 4JQCA 4NBVA 4LGVA 3QIVA 4OXKA 2WE7A 4GX2A 1P77A 3MJVA 2ZCUA 2O7SA 3WIEA 3L6DA 4NNJA 4RDHA 1MB4A 3QWAA 2RCYA 3JQAB 2HDHA 1Y9EA 3GEGA 4CMKA 1VRWA 4FW8A 1FDUA 4CJXA 4WUVA 4S1VA 2VZ0A 3SXPA 5TT0A 1E6UA 4R69A 1R16A 5DBFA 1EUZA 5TRTA 1WZEA 4DL9A 3K6JA 3WTBA 3RSHA 1CERA 1EMDA 3WXBA 1CRWG 1UAGA 2BD0A 1ZSNA 3RIHA 3WTCA 2FSSA 1H94A 4NBWA 4N5NA 1O89A 1BXGA 2SCUA 3F3SA 4RZIA 4YTEA 2DBQA 4YT5A 4Z0HO 1HE5A 2BF7A 1RWBA 1I10A 2G5CA 4XR9A 4R1TA 1I3MA 3I9JA 4FBGA 3K96A 3VPSA 4H3VA 2J5KA 1NQ5A 3HE3A 3TWOA 3A4VA 2ZB4A 1H2HA 2Q46A 1Y1PA 3OECA 4WLNA 1DC6A 1EDOA 1VSVA 4U5QA 2EW2A 3UUWA 4RJTA 4OKIA 1PX0A 5KOIA 1T1SA 3T7CA 1I5RA 3GGGA 4XWYA 4CUJA 1HF3A 4E13A 4KTVE 5ER6A 1ISIA 4R54A 3NDJA 2QRJA 1C1DB 5A02A 4W7HA 3F9IA 6LDHA 3BMOB 3PIDA 1I01A 3DZHA 3LT2A 3KEOA 3ZWVA 3CMCO 3U4CA 3OIDA 2QRLA 1C1XB 1U5CA 4A27A 4B79A 1KC1A 1GUZA 2NACA 3VZQA 4DA9A 1NFQA 4BNFA 4WLUA 4XYLA 3DWFA 4EDFA 4ZN6A 2ZTMA 1E1MA 2NTJA 3KM0A 5DBIA 3W4JA 2V6BA 2NUAA 5B4UA 4BNKA 1ADCA 3GEDA 1KEWA 4MP3A 5JYEA 1BDBA 1Y8QB 4LVCA 4TKLA 2JFFA 2QG4A 5T8KA 4AJ2A 1IULA 4JJIA 3KEQA 3GFBA 1R66A 2NLOA 3INGA 1UDAA 4G81A 1LDMA 4CM8A 3DAGA 2Y1FA 1MG0A 2PFGA 3PWSA 3ENKA 1B0AA 3KZVA 4D3FA 4JJFA 4YJFA 4YWJA 3U3XA 2NM0A 2PY6A 3WQRA 4BO3A 5CEJA 3VH2A 1YO6A 1KBZA 4W4TA 1CDOA 2QX7A 1ZK0A 3E03A 3H3FA 5G0TA 4CM6A 4GBJA 1GD1O 4DVJA 2IEBA 3B6ZA 3PJDA 3KLPX 2GN9A 2EGGA 1ADBA 1NHGA 5BSGA 3FNGA 2YHIA 5JPIA 4MINA 1WW8A 2BMAA 3QVXA 4FS3A 1DAOA 1WWKA 2IDZA 4RZHA 3V8BA 4CM9D 3EVNA 2O50A 2ZCVA 3I9KA 2VRCA 3VPGA 4UEOA 4DRYA 3GOHA 3AWDA 3KYBA 3BYZA 1LLQA 1V35A 1ZIDA 4CR8A 5I7FA 3DBLA 4FN4A 4PRLA 1ZJYA 2X0NA 2Y05A 5JW6A 1DRVA 4IZHA 3ST7A 4D79A 5ADHA 3E1KA 3TDKA 1I3NA 3BHIA 3UF0A 3D7LA 3AUAA 3HSKA 3NV9A 4HFMA 4CMCA 1U8FO 2DBVO 2QIOA 3QVWA 1H5QA 1PJ2A 3C1OA 3U0BA 2JHFA 2I3AA 4L8VA 1AGNA 5TGDA 4B7UA 4D45A 4YRBA 1R4NA 1NX6A 1ZO8A 1I2ZA 1P1KA 1F8GA 1UAYA 2ZJ1A 3SX2A 3NKLA 3DEYX 3DO5A 1ISGA 5I9MA 5ER9A 4Q3BA 5ILOA 1OI7A 3PRJA 4YACA 1PQWA 4JN6B 2J3IA 1Q7BA 1ENYA 4S3MA 4CL3A 2GN6A 2VCYA 3ADOA 2EGHA 3ICPA 2Z1MA 4Q3NA 4GMFA 3D5TA 4RV9A 3ROMA 2VWQA 1EVYA 1GPJA 4RL6A 2J8ZA 2QQ5A 4NPCA 4B4VA 3ANNA 4YT8A 3U09A 3DZBA 2I76A 4NU6A 4HFRA 4O0LA 4WGGA 4PGFA 3AUTA 1BW9A 2JL1A 1FDWA 1TB4A 2OFPA 4GAEA 4ROSA 1GQYA 4LK3A 4XDYA 2NTNA 5BT9A 1U5AA 1HE3A 3GHYA 3RUCA 4FIZA 4LCJA 1U2DA 1PSDA 1C0KA 1KC3A 1YRLA 4CR6A 4R5MA 1A5ZA 2Q50A 1RKXA 2VOEA 5H82A 3I4CA 1PJSA 1QORA 1KY5A 3HQ4O 3KXDA 3P5SA 5TLSA 5JCXA 4Y98A 1PGOA 4A26A 3M1AA 1ONPA 1HDOA 3WS7A 2HJSA 2PZLA 1FDVA 4WLOA 1C0IA 2FY8A 1KVSA 4IDFA 5DCWA 2IYOA 4EYEA 1OAAA 1E3WA 3HDHA 5JC1A 1DHRA 4NK5A 1JKFA 4OOEA 2CVZA 4N5LA 2HRBA 2ZYDA 4RGBA 2X4GA 5A4DA 3C7CB 4WPGA 3TZHA 3RCBA 9LDTA 3HZZA 3GNSA 4TRNA 4A0SA 1GPDG 2X0JA 1P1FA 5IZCA 3E5MA 3LLVA 4ZVVA 5EESA 4DPMA 1RJWA 3TOXA 2ZYAA 4BKRA 2FSVA 3JQ9A 1KETA 4FGSA 1N5DA 2RIRA 1ZKMA 3RUEA 3ZU2A 3AM4A 3OIGA 1VL6A 3AW9A 4BB6A 3FF4A 2UDPA 3VH1A 3GMSA 2O7QA 3GVPA 5U9CA 1YWGO 2YJZA 4FC6A 3RUAA 5IDXA 4QX6A 4TVBA 4NFHA 4YT2A 4PIVA 3PEFA 4XGKA 3ROQA 3UCFA 1CEQA 5L51A 2J5QA 3CSDA 1S7CA 3PI7A 2Y68A 3EVTA 1T25A 3BMQB 4R68A 4DIFA 3OETA 2Y0EA 1B7GO 4PG6A 4ALNA 4R01A 2CF5A 3EMKA 2EP5A 4M55A 1U8XX 1LJ8A 2IEDA 5B4VA 5L7YA 4WLEA 4DQUA 1EDZA 1Y8RB 3BMCA 1KVRA 2C5AA 4RLHA 1ENZA 1I33A 1KEUA 1LUAA 3HG7A 1JU9A 5FEUA 3RBZA 2AG5A 3FN4A 1LXCA 1G6KA 5DBGA 3EK2A 4IIUA 1PL8A 2AQKA 4HV4A 2BRUA 3JD4A 3ZV3A 1EK5A 3DBVO 1XA0A 4XRRA 1TT5B 3TFOA 1GV1A 3F6YA 5CEEA 2RHRA 2D4AA 2P5UA 5LDHA 1BG6A 1VJ0A 4JXKA 2RH8A 5AYVA 2YUTA 3ADPA 4J1NA 2AEJA 4K6CA 1B16A 2ZATA 4LRSB 1HYEA 3CE6A 1PGQA 4BKUA 5IAAA 2EEZA 5IDQA 5ICSA 1R6DA 3RWBA 2OGUA 1DO8A 4AJ4A 4CLHA 3BHMA 4MPDA 1WDLA 1ID1A 5DOVA 1OBFO 2Q1SA 2HK8A 4G2NA 4RVDA 1E3JA 1X15A 1YBMA 2P9EA 5TC4A 4IJKA 5K6AC 4W9NA 1FK8A 1D1SA 1X13A 4R3NA 3ZU5A 4BO8A 1GCOA 4PLCA 3O4RA 2CDBA 4DC0A 5EERA 1DB3A 2G1UA 3U4DA 3JD3A 2VTEA 3F5SA 3MJ4A 3L77A 1P3DA 1X7DA 4Q3DA 3AOGA 3ONEA 4NH4A 4BGUA 2FP4A 3I3OA 3L0DA 4RF3A 4IGFA 3DBRA 4OAQA 4RPLA 4XYEA 4NZ9A 3AOEC 4TZTA 5ENVA 2O4CA 4BGEA 3OF2A 5KJFA 4WEQA 1IHYA 3A28A 5JCJA 3VHRA 2YV2A 4DGSA 1DFIA 3GAZA 3H3JA 3OEYA 2GZ3A 4KQWA 2NU7A 3OJEA 4EEZA 3DZIA 3HB4X 5HRUA 3FBGA 1GUFA 3JQ7B 1DPGA 3I52A 4BMSA 4M1QA 5EJ2A 4CODB 2BELA 4D43A 4DPKA 1Q0HA 1UP7A 2QHXA 5ES3A 1NR1A 3DXFA 4FC7A 4HNGA 3LT1A 4LVUA 4J91A 1A7AA 5T64A 1ZCJA 4AVYA 4N5MA 4BV8A 1EQUA 3AY7A 3FTNA 2W2KB 4E6PA 1Z74A 3H9QA 4I1IA 1SO8A 1HE2A 3HFSA 4TZKA 4BKQA 2O4UX 1E92A 3DC2A 3AY6A 5CFZA 2I66A 1E77A 4XKJA 3ZWYA 3CZMA 5JAQA 2VHYA 3EDMA 1NVTA 1K3TA 2HK9A 2JCVA 3HUDA 4YB8A 3S2FA 1I8TA 4CMIB 2C82A 5COQA 2Z1NA 3O8QA 1K89A 4IQGA 3MTJA 2WYWA 2VUTA 1LSSA 4NJMB 3JQFA 2NVUA 2PZJA 5I7EA 4IDGA 4B4WA 4J43A 4E32A 3KYDB 5IN5A 5TNXA 3QWFA 4A7PA 5AQ1A 1Q1NA 3JQAD 3I23A 1TXGA 5TIIA 3D3WB 3JYPA 3ONFA 3KUXA 2W8ZA 1U1IA 3PVZA 3HN2A 3TL2A 1ORRA 2FPPA 3V1YA 3RC2A 2CVQA 4PRKA 3OQ1A 4Z9FA 1R37A 2O3JA 2AG8A 3KRTA 3WGTA 1P74A 2EKQA 4ND3A 4HNHA 3DHNA 4OXNA 1JA9A 1GL3A 2P9GA 4AJHA 4KWIA 3GR6A 4ZA2A 2X7HA 3VTZA 3AI3A 4WLVA 1PTJA 3PWZA 4D0RA 3UXYA 5L53A 2EKPA 7MDHA 3MWEB 1ADGA 4WCFB 1DRWA 1AHIA 4PLZA 1GTMA 3QSGA 4YYZA 2G17A 1XDWA 3OHSX 2OMEA 1YDEA 4ID9A 3KHUA 3GC6A 3HHPA 5TS3A 1HLDA 4OO3A 3LQFA 4D3SA 2VYND 1BDMA 4ZD6A 1LLCA 1D1TA 1XCBA 3Q9NA 3GY0A 4PLWA 4FQ8A 1H9AA 1ARZA 2Q45A 1NASA 1XU7A 1X1EA 2R2GA 3GZ4A 4GMGA 4NG5A 2Y1CA 5A06A 2W2LD 5BNIA 5CDUA 4HFJA 2OO5A 2PD4A 5ILGA 3ANMA 5A9TA 5BSFA 2XPCA 4WNIA 2BFOA 4ZQEA 4J7CA 2WMDA 3ZNQA 1T4BA 1O5IA 4ALMA 3GHHA 1YL7A 2P4QA 4Z3KA 2Q4EA 3E5RA 1CQIA 5ITWA 5G0WA 2Q2VA 1LC0A 2EP7A 3CINA 1QYVA 2PA3A 2HLPA 5IF3A 5EMHA 5LDGA 3LYLA 1C0LA 4RVGA 3QJ5A 4W82A 3WYEA 5KVCA 3IKVA 4L4XA 4CQMD 3N58A 4UUPA 1WLYA 4ND5A 3UKOA 2B83A 4L4SA 2DUUA 1Q0QA 4BGIA 2C20A 4QO8A 5F5LA 3A9WA 2Z5LA 4EZBA 3EUWA 1Y6JA 1LLDA 1HL3A 5GMOA 3JQBA 3BMNA 2ZB7A 4MKZA 2VHVA 2I67A 3GNQA 1MC5A 3QLJA 1PGPA 1GFSA 3NDRA 5F21A 3EZYA 1GY8A 1RYDA 3N74A 2PGJA 2O3QA 4D42A 4E33A 2NWQA 4Z6KA 2V7PA 4FFPA 3Q11A 1KS9A 2ZQYA 3GVXA 3EYWA 3OMLA 3ZNNA 1ULSA 3GZNA 4NJOA 5JDCC 3V1TC 2YV1A 1PL7A 3ONDA 1AUPA 4I5EA 1BSVA 2GN4A 1PS0A 2JD2A 3VC7A 2G0TA 1N7GA 2OXIA 4OM8A 4F46A 2F00A 5DCYA 5TX7A 1LRKA 1L7EA 1E1KA 2VWGA 1MP0A 1IYZA 4FOSA 3WMXA 2LDBA 4CM7A 2X58A 3IJRA 2DBZA 2X8LA 4PLFA 1HDCA 2VZ9A 1SOWA 4I8XA 3DMTC 1J49A 4R5HA 4EJMA 5BR7A 3DZGA 1Q2XA 4OJNA 5JO9A 1A9YA 4O59O 4WE3A 3LC2O 1E7YA 4J4HA 4UUOA 3NGLA 1O94A 1XIVA 3NAQA 4GVXA 3RFTA 5A5EA 2PH5A 4ZQFA 4YCAA 2X9NA 3HN7A 3PQEA 1ZXLA 3K2EA 3L4BC 4XJTA 4OYRA 1ZK1A 5IZCC 3DONA 4B4UA 5A05A 2HCTA 3PDJA 1E3LA 1UXGA 3TNLA 5L40A 5AXAA 4PZDA 3WQQA 3ENNA 4UAGA 2GDZA 4NDNE 3U9LA 3BTOA 1VLLA 3CKYA 3G79A 3TZQA 1KERA 3E18A 4P4NA 3GK3A 3LLSA 4MVJI 4ZQHA 5GY7A 2GCGA 4W7IA 3HDYA 3I9OA 5L4LA 4DLLA 1W0CA 4HBGA 3U5TA 4CM4B 1EE9A 4IDBA 3VPXA 1T2FA 4G5HA 4DYDA 3S2EA 4MJLA 4XGIA 3GA0A 1ZW1A 1AHHA 3M1LA 3S2IA 3P2YA 4CMBA 2R00A 4ONEA 2BI7A 2P5YA 1P45A 4J49A 4U0KA 2V6GA 5B1YA 4RQTA 1Q0LA 3UVEA 4BMVA 4XB1A 5CPFA 1CWUA 5C7IO 4BNVA 2PH3A 3AU9A 1NVMB 1C1DA 2EV9A 1OMOA 3RJ9A 2X9VA 4XCVA 2QW8A 1P0FA 3SVTA 1Z73A 3JQCA 5L9AA 3IMFA 3BMOA 3RUDA 1UXKA 4CMAA 1C1XA 3VZSA 1PZGA 4TQGA 3TFQA 2CZCA 4Z0TA 2GERA 4KTTE 4E5PA 3JQ8B 3WYCA 5KWEA 4WEOA 1ADFA 2O3TA 4CLOB 1WDMA 3D4PA 1X1TA 1WAMA 3VKVA 1W4ZA 2TMDA 8ADHA 4U7WA 3L6OO 2Y0CA 4F45A 2UAGA 3GG9A 3WGGA 5IJZA 4I5GA 4H15A 3KO8A 5ENDA 4IPTA 4YJGB 3EHEA 1I32A 4H16A 3WGQA 4JBHA 2C0CA 1MGOA 4JP2A 4AL4A 2PGLA 3MJEA 2UYYA 4UVIA 3CUKA 1UDBA 4P38A 4IDCA 1QKIA 3DBHB 2VYVD 4BO0A 4GGOA 1IY8A 1DLJA 2X5KO 3C1AA 2X5JO 4INAA 2YZ7A 3AI1A 5F1OA 5JS6A 4FJ0A 1PJQA 1QSGA 3F5QA 4RF5A 4CLRB 4BKPA 3GVCA 3FTPA 4UEJA 4YQZA 4OGWA 4BOYA 1NWCA 5KJ6A 5DULA 4QO7A 2C7GA 4WCFC 4ZQGA 3JYQA 3X2EA 2GSDA 5U1PA 2GLXA 3HB5X 2H6EA 4MVJM 3W8EA 1Z6ZA 3NT5A 2FR1A 4B3HA 4EUEA 3CEAA 3UFXA 2DAPA 3KYCA 2DQ4A 5EQDA 1A7KA 2OOSA 3VTFA 4BO5A 3JSAA 1SZJG 5JLAA 3I83A 3SC6A 2OHXA 1NPYA 1Q7CA 3C24A 3PZRA 1FDTA 2AQ8A 3PQDA 3ZHBA 1E5QA 1B2LA 1RYEA 4N18A 2IE0A 4HADA 1YONA 1IHXA 3RC7A 1DIRA 3DOOA 1JDJA 3NJ4A 2D2IA 1X0XA 4CQMB 2P91A 5L4SA 5KIAA 4J1TA 3ZWCA 1DXYA 1GAEO 1YE3A 2BGLA 3L9WA 1BXZA 1MC4A 4UUMA 5A9SA 3QV1A 2WYUA 4Y6PA 5KVQA 3WWZA 2Y93A 3NJ8A 4GSKA 4PLTA 1LNQA 2ZJ0A 4RVFA 3A14A 1BGVA 1PEDA 3OJ0A 3AFMA 4DTIA 4K6FA 3U4HA 2EWMA 3QA9A 4D46A 4JP3A 5I8WA 2Y99A 3RUHA 3STHA 5B12A 4WLFA 1P1JA 4QECA 2EHDA 3IDSA 4E31A 3W6UA 4O5OA 4IQ0A 1D8AA 3QP9A 4DUPA 1EK6A 1ML3A 5CG2A 2JFGA 3IS3A 5A04A 2WD7A 4CPDA 2BFPA 2VWPA 1I3KA 5A3VA 1AE1A 3P2OA 1SMKA 3IP3A 4NQZA 5A5FA 5I7SA 4R9SA 2E82A 1U28A 2VHXA 3HADA 5KVSA 1O9BA 4P22A 2UVDA 2VN8A 2TMGA 3WGOA 2UUOA 4XX0A 4XJSA 2PZKA 2ZKLA 1BXGB 1ZZEA 4I5DA 4IQ8A 4YAIA 5I7VA 5JDIA 5EN4A 4N54A 4IMPA 4MKXA 3GRKA 4BNZA 4HUJA 4R3WA 4RPGA 4CLXA 5HBRA 4IMRA 3M2TA 2NU9A 4L74A 5DNAA 1KOLA 1LLUA 3A06A 2PZMA 3PJFA 1K5HA 2DM6A 1UR5A 3FNEA 1ISJA 3FBTA 4X54A 3K92A 4DPLA 1BRMA 5G2OA 5JXWA 3VH3A 1R15A 5G4LA 5GZ6A 1DEHA 2J3HA 1XKQA 3KVOA 4D7AA 3H5NA 3ZV4A 1RPNA 1SB9A 2AEFA 2FZEA 4TSKA 4B3IA 1DIGA 1GUYA 1V6AA 4K26A 4DXHA 1MA0A 4PLHA 1HWYA 1E7WA 1ZNQO 4ILKA 2EERA 5L45A 1BTOA 1J0XO 1LSUA 3ZWPA 2XXBA 3ETGA 5GZ1A 3RVDA 3INRA 1ZJZA 2A35A 2FN7A 3LC1O 5JO0A 4JCOA 4RF4A 3P19A 4OXYA 1AXGA 5THQA 4KWHA 2O3SA 2HJRA 1LDEA 2BHLA 2VNAA 2ZYGA 4AJIA 1PIWA 4RDIA 4B7CA 2WD8A 4KDEA 3HWRA 4PVCA 3FCOA 3PJEA 3CH6A 4CM8B 4EGFA 1V3UA 4WK6A 4CMEA 1WZIA 1H0KA 3MEQA 1G1AA 4BO7A 2B69A 3C85A 1TLTA 3JV7A 3OEWA 4PLVA 4I9UA 3OH8A 1LDYA 5TF4A 1VM6A 4GLOA 3BMQA 1UXJA 4JK3A 5CEFA 1XWFA 2EW8A 2E6UX 2PR2A 4GSLA 1LDGA 5JFOA 3OFSA 2QYTA 4JIGA 2YHIB 2V6MA 4IXTA 1ONOA 4F6CA 1Y8RA 5JY6A 3H4VA 2Y1DA 5TSDA 4BNYA 3UCEA 1R12A 2C2YA 1PU2A 4Q3AA 1ZSVA 2YQ4A 4CR7A 2A92A 3H6KA 2FPIA 4M8SA 1QV6A 2Z95A 1TA4A 2D1YA 2I3GA 1H6DA 5IFLA 3WBBA 2Y0DA 1YKFA 2JKVA 3RAJA 1RM3A 3DBLB 2JFHA 1HYGA 1F0YA 1K6IA 1EFLA 1U7HA 4CUKA 5ICMA 1DFHA 1P1RA 1VPDA 4ND1A 2WJPA 2AMFA 3G17A 5KJCA 3E9NA 3GN1A 3OJFA 1QG6A 3K30A 1GZ6A 1I2CA 1DLIA 1SCUA 5KJEA 5CAEA 2FZWA 2Q4BA 1UUFA 3ASVA 3I6QA 4IINA 1YH3A 1C0PA 1ZK4A 3AUSA 2CDCA 1OZAA 4ALKA 3PYXA 1X7HA 4JX8A 3ZU4A 4A03A 5G0UA 3ZV5A 1ENOA 3IC5A 2NSDA 4XQGA 4YJHA 1WMBA 5MDHA 2PD6A 4ZU3A 3WDSA 3PWKA 2J3KA 2FOIA 4CLEA 1N1EA 1JAYA 1ZMTA 1FXSA 2JAPA 3DMYA 1M6WA 1N2SA 4O63O 3UHAA 2OZPA 3AU8A 4HP8A 9LDBA 1VL0A 4XYBA 5KNLA 1NTOA 4J2OA 2DTDA 4AG3A 1GV0A 2X86A 4OSPA 5I9LA 4Y6SA 2PGDA 1XLTA 4KUGA 4ZICA 3L4SO 2LDXA 1B15A 2ZB8A 1R4MA 4D44A 2VUSA 1TT7A 3WYBA 1ULUA 5CDYA 3RQSA 3W4IA 3ZW8A 2B35A 2Q1WA 2BI8A 4J7UA 4CMGA 1BW9B 4GKBA 2PLAA 2R00C 3QWHA 1PJLA 2HMWA 1P0CA 1T4DA 4MVJF 1C3VA 2AXQA 3OP4A 1F8FA 5FFFA 3DAFA 4QTZA 1O0SA 2GZ2A 3MOIA 5A03A 4IUYA 1DC4A 1V8BA 1PWXA 2Y1OA 3AM3A 4WASA 4E4YA 1AN9A 1UDCA 2AE1A 4L0QA 3BAZA 2ILTA 1YQGA 1VSUA 4J0FA 3LF2A 1PQUA 3UH1A 1TVEA 1X14A 4I5FA 4K28A 1LU9A 4LMPA 4LW8A 5AXCA 3Q2KA 4BNWA 2W2KA 4J90A 4DBZA 1T2DA 2FWMX 3VDQA 3QVOA 1P9LA 2G82A 1P1IA 1PL6A 5HM8A 3B1FA 3L6EA 4FFRA 1L7DA 2GYYA 2BFAA 4GH5A 2VUUA 5CPBA 2CF6A 4R9RA 3UCXA 3AFNA 4FFLA 3FHLA 4XQEA 4NU5A 1YL5A 4BO2A 4CLDA 1K2WA 1Z75A 3M2PA 4RPJA 2YFHA 3EY4A 3QWIA 2PTGA 5I9NA 4YR9A 4NJMA 3L9XA 2B36A 4ZQBA 1LQTA 3QVSA 1T24A 2H9IA 3KYDA 1HKUA 1HSZA 2DU8A 5LCXA 1BVUA 1UP4A 4E2ZA 4O1MA 4RORA 1UZMA 3BTUA 4C7KA 3NRCA 5A3JA 3EGOA 2X0RA 1T26A 4XYMA 1O6ZA 3TQHA 1PGJA 1YL6A 2AEMA 5IG2A 2JJYA 3O9ZA 1KVTA 4DQXA 3HFGA 2WM3A 1HDZA 1E7MA 1LI4A 3PHIA 2E37A 4BNUA 4DWVA 3C3XA 4D41A 1EVJA 5L7WA 2A9FA 1NYTA 4OL9A 4LRTB 4FFNA 2IODA 2X6TA 3E6AA 3WBFA 4BNNA 2WEKA 4XZ3A 5F3RA 4ESOA 2NU6A 4CMHA 1Z45A 1DIBA 4KDFA 3BMCB 1HE4A 3UOGA 5CHEA 3WICA 1O95A 5C3MA 3WOHA 3NT2A 4IS3A 2CDAA 1N1GA 4U0JA 1CETA 2JD1A 1OFGA 1YDWA 4RPKA 2EJWA 2Y1EA 3MJSA 1G0OA 4AJLA 2RHCA 3RU9A 1QYDA 1U9JA 3IUSA 1YJQA 3HDJA 2O3RA 1E7QA 2O2YA 3VPFA 1WMAA 4MVJD 4TMFA 1CF2O 4URFA 4MVJG 3KSUA 1SPXA 4PG4A 1I3LA 4E5KA 1KVQA 1PZEA 4NHEA 1F12A 3ITDA 1OC4A 5T8KC 4ND2A 4KQXA 1Y7TA 3ZCXA 4C7JA 2WYVA 4IJWA 1WXDA 2HK7A 1NPTO 5JYDA 3A1NA 1IZ9A 2YV3A 2P2SA 2OP1A 4DREA 3H7AA 5G4KA 3V2GA 2RH4A 1A9ZA 2Q2QA 1F06A 4JNKA 1N9GA 1DHTA 4XGNA 4TRJA 1EZ4A 3VVCA 1Y81A 1J6UA 1LRLA 5L7TA 4P4GA 4PCVA 2VTDA 3H9EO 3LDHA 3RKUA 4BNHA 5DCUA 3VH4A 2PKQO 1U2GA 3OICA 1CJCA 2B5VA 1G0NA 3INTA 2ET6A 3ICCA 2I6TA 1DRUA 1SC6A 3UAGA 4RQUA 1XEAA 2CD9A 3DB2A 3MJTA 4OQYA 1XQ1A 3IAHA 2HO5A 1RM0A 1HYHA 3G49A 3PYLA 1WNTA 3PFWO 4EUFA 2GRAA 4WECA 4Z9XA 2GN8A 2QRKA 3WNQA 4EUHA 4II2A 3DHYA 3FRJA 3IJPA 1GYRA 2BLLA 5C37A 3DFUA 1Z7BA 3I5MA 4AJOA 1BXKA 1R0KA 1VC2A 4CM5A 4W6ZA 2GO1A 3UICA 2PKQP 4OQZA 2WSBA 1N92A 2V65A 4W99A 1IPEA 1MXHA 1GZ4A 2BGMA 3Q0EA 3LU1A 4HXYA 4Z0PA 3H9UA 4NMHA 2VT3A 3RU7A 1Q7GA 4BNIA 1YOVA 4ZRMA 2HRZA 1Z7EA 5COAA 1GEEA 1XHLA 2AHRA 1M67A 4PG8A 4M87A 1W73A 1UH5A 2CMDA 2PNFA 4ALLA 1H93A 1JW9B 2FPGA 2UUPA 4J6FA 1H6BA 3GDOA 3O8QB 4ND4A 2BGKA 1U3TA 4L4RA 3JTMA 1PJ3A 3E82A 2NVUB 1ZSYA 1LRJA 1LBEA 5DF1A 3KTDA 1QYXA 3D4NA 4MIEA 4JBGA 4WOKA 3V2UA 3PGJA 4E5NA 1Z82A 2E4AA 3IP1A 4NBTA 2IZ1A 5DT9A 3QHAA 4CM4A 3KETA 3NTOA 1P33A 3BZUA 3QY9A 4KP7A 4F6LA 1ENPA 3U4IA 2HSDA 2NVBA 4IXWA 4L75A 3DZKA 4XEHA 3NX4A 5LC1A 4BV9A 3FNHA 2YFQA 1MX3A 4ITUA 3ZWNA 3H9JA 4E3ZA 3QQPA 3FR7A 5TJHA 3RBXA 1HT0A 2Q49A 4LSMA 5B37A 4OMUA 2OBNA 3F1KA 5IDWA 3Q6IA 3K73O 3BHJA 4DMMA 4L9RA 2NV6A 3GAFA 5BSEA 1H6AA 4CM1A 1HXHA 1P31A 3I1JA 1E5LA 1GEGA 1JVSA 3JQ6A 1ZVMA 4KUHA 2W90A 3B1KA 3R6DA 4YAJA 4CV1A 5IZ4A 1P44A 3KOUA 5JC8A 5TJ9A 1NM5A 1EVIA 1JVBA 1ZBQA 3FNFA 2AQIA 1ZK2A 1PZFA 4RO0A 1M76A 4YQYA 1VKOA 4ALJA 1OOEA 1YXMA 1A4UA 4JROA 3JQ8A 1NWHA 1M6HA 3G1UA 2ZTUA 3JQAA 4GX1A 4BMNA 4OSOA 4NI5A 3NUGA 4PLPA 3H2ZA 3PQFA 4CM3A 2Q3EA 3RFXA 4ZHSA 1PQPA 2YDYA 1C14A 1U4SA 4BNTA 3RJ5A 4XIJA 3WWYA 3JQ9C 4FCCA 5MGBA 1LEHA 5JY1A 1GDHA 1JKJA 3W6ZA 3ZNPA 2Q1TA 2JCYA 3HNPA 1TEHA 1BWSA 3GDGA 3ZDFA 3EAGA 3EW7A 4FFOA 4YJGA 1UP6A 3WQSB 1P1HA 3FPCA 4GX0A 3V5NA 1I30A 1Y9AA 4XB2A 4B3JA 2UV8A 3DBHA 4CQLB 3ZU3A 1UXHA 1BMDA 4WOJA 1D4FA 1XGKA 4MP6A 1PR3A 2C2XA 3KSDO 1HTBA 2IZZA 5KKAA 2EJVA 4DC1A 2XOXA 4Y8VA 2HMUA 3JYNA 5JNLA 1IPFA 4BGVA 5FI5A 2VYNA 1GZ3A 1HSOA 1QP8A 4XYGA 1QV7A 1ISHA 4QUKA 4FOOA 1DDOA 2B0JA 3W8DA 1PR9A 3BA1A 3R3JA 4XD2A 4XR4A 5BNTA 1JN0A 3WG9A 4HY3A 2W2LA 4MOWA 4JLWA 2ZIZA 1PZHA 3AY3A 3ASUA 5HS4A 4XRGA 1WVGA 4QQRA 3G0OA 4B7XA 4U8GA 3VDRA 2FHSA 4E0BA 4RVUA 4J1QA 1JLLA 3RKRA 3ZI0A 2YHUA 2VRCD 2D59A 1IUKA 1PJTA 1W8DA 2DC1A 1NAIA 1MUUA 1Y8QA 3JYOA 2X23A 2DTEA 3D3EA 4FGWA 3QWBA 4N7RA 4QSMA 2E48A 4M86A 4ZGWA 4UREA 2DBRA 4Q39A 1V0JA 4PG7A 3WFIA 4E12A 4EJ6A 1XYGA 1LX6A 1H6CA 4YJDA 3HJAA 4YVFA 3FWNA 4GKVA 3PHGA 3CXRA 4IY1A 3ROPA 3VOSA 3KSZO 2Q1UA 4CV2A 2P68A 3LVFO 1DAPA 1LTHR 4TROA 4WKGA 3AJRA 4CV3A 3UW3A 5K6AA 3TPCA 3E48A 3PK0A 4W9NC 3PJGA 3GPIA 4GPD1 1TI7A 2CSUA 4FFMA 5KJ1A 4A5OA 5H81A 1HDGO 3IQDB 3TZKA 1YS4A 2JD0A 4RVHA 3T7EA 2GUGA 3R3SA 3OA0A 3GEMA 3TZ6A 5I8ZA 3ZWAA 1XELA 5K9ZA 3TN7A 3AOEA 1YB1A 3JQGB 4KOAA 3RUFA 4DIBA 3KBOA 4MIYA 2JCXA 1ISMA 2WWRA 3OSUA 1IOLA 4IGEA 2A4KA 3I6IA 4BO1A 5F1KA 1YQXA 4TVOA 1DJQA 4J4TA 5K0ZA 4QT0A 1RM4A 4YXFA 1LDNA 2Q2WA 1ZEJA 2NQTA 1SEPA 5T67A 3JD2A 4QEDA 3WIDA 5B4TA 2HKIA 1JTVA 3BIOA 1B8VA 1VJ1A 3Q1LA 1CIVA 2DFDA 4R1NA 1ZEMA 3KV3O 4R16A 5FWNA 2HMSA 1JWAB 2DVMA 4J16A 4B4OA 1U4OA 1V3TA 1E6WA 3BTSA 4IDAA 1IE3A 4QXMA 1HRDA 4BO9A 3R0IA 4YT4A 1LSOA 4IM7A 3DOJA 2AQHA 3DQPA 3OQBA 4CMJA 2VHZA 4FPXA 1QYWA 2D0IA 3F46A 1VL8A 5IXSA 3WJAA 3ULKA 3CZRA 3BXXA 2C7VA 4YDRA 1SEVA 2Y66A 4XDZA 2CFCA 4DMLA 3H8VA 3WR5A 3KLMX 3V1UA 4GI2A 3JQFC 2CNBA 4Z9YA 2OUIA 3C1TA 2X1HA 3LK7A 1O8CA 3CTMA 4Y9DA 3K8ZA 4BO4A 3TZCA 2POQX 2PD3A 1MXFA 1T1RA 3LT0A 1J5PA 4FD3A 4BVAA 4PN3A 5T5QA 3JQDA 1V3VA 5HA5A 3LSYA 3WGZA 1NNUA 2VHWA 1NFFA 2EKLA 3O03A 3PHJA 4BNMA 5U4QA 1E1LA 3S8MA 1D7OA 3DHEA 1SB8A 4XIYA 4F3YA 4M54A 1IB6A 3P7MA 2O48X 1PJCA 3PLRA 3KYCB 3WGHA 2I9PA 5JAIA 1Y5RA 2GZ1A 1MFPA 3ZH2A 1YB4A 2C07A 4BIIA 4GL4A 2VT2A 2GR9A 3EC7A 1NBOA 4EW6A 2D5AA 2CY0A 4E2XA 4OOFA 4J4BA 3ZWBA 3MTGA 4IZIA 3MJCA 2QZZA 4P4LA 4R1SA 3ETEA 2W98A 4XQ9A 3WSVA 1U3WA 3SC4A 2OL4A 1HLPA 4AJNA 2NU8A 3GGPA 1UJMA 4WJZA 4YRAA 5A9SB 1EQ2A 2VYVA 3GDFA 4EJ0A 1WP4A 4MVJE 3H5RA 1YBVA 3DR3A 3O26A 4Y67A 3S55A 3H5AA 2DPHA 5L4NA 1SOVA 2O2SA 3PIIA 2OBYA 3AI2A 3ORFA 4YJFB 3GUCA 3RC9A 3JQBC 2PV7A 4CUZA 4L76A 2H5LA 1EEHA 4IJUA 4YEDA 4TKMA 2WD7B 2HMTA 3GLQA 2B4RO 2DUWA 1LQUA 4R1UA 4NFYA 4CV0A 4B8ZA 1VE9A 1DFGA 1MLDA 2H1SA 1BVRA 5JDCA 4MP8A 5JAMA 2XXJA 2NNLD 5L3ZA 4GLLA 3VKUA 5AOVA 3OBBA 4YAKA 3ZZNA 1PJBA 3NTQA 3GFGA 4QFDA 2CVOA 1ZXBA 4L73A 2BKAA 2ZB3A 2NTVA 3B20A 1E3EA 1WDKA 3PYMA 3TOZA 1GADO 4I9HA 1PJ4A 3WMWA 1E3SA 1FDSA 3SLKA 3Q9UA 1K6XA 1KEPA 3NGXA 1DBVO 3RUIA 3S1LA 1EBUA 4G65A 1TT5A 5C5IA 2BFMA 2ZTVA 2GF2A 4E21A 3DMTA 3DL2A 1NQTA 4Q3CA 4FB5A 5JMWA 2VNSA 1E3IA 5CDTA 5JCJD 6ADHA 1NP3A 1N7HA 4PZEA 1E0DA 1JQBA 2D3TA 3SEFA 1HZZA 1RM5A 3M6IA 1UZNA 4Q9NA 3D64A 3CIFA 5JMPA 2YW9A 3PXXA 2GPTA 3JQEA 1E6EA 4YAEA 1IL0A 1DSSG 4ALIA 4FJ1A 4BNGA 5F1PA 4TWRA 3FWZA 4ZJUA 3MOGA 1NQAO 3TSCA 1MFZA 3ZWMA 2VOJA 1YGYA 1R4NB 4FJ2A 4U6SA 3L4BA 3VAZA 5L95A 2FMUA 5EINA 2BH9A 3QE3A 4IDDA 1PGNA 2YDXA 2XF8A 1UZLA 2HUNA 5JE8A 4CM9A 4KMSA 3ROKA 2GASA 4DLAA 3GH3A 5HWSA 4P8RA 2EIHA 4YRDA 4IJVA 3ZNOA 3U62A 4OH1A 3GMDA 4UVDA 4E2YA 3DTYA 3W1VA 5BQFA 1E1NA 3SJUA 3NTRA 5DP2A 4BHTA 3CMMA 4BNXA 3PHHA 2P9CA 2AE2A 1T2CA 1HDRA 4RCVA 3ZWXA 4E2WA 2CUKA 1GQQA 5KCZA 3PTZA 3C7DB 3RROA 1EBFA 3L07A 2P4HX 3GPDG 3JQ7A 4IIVA 3GUYA 4HFNA 1SNYA 1QXSA 1GR0A 2FRDA 1F14A 3GT0A 3RD5A 4OKNA 3FD8A 2ZTLA 2IXBA 3ZN2A 1I24A 4RPHA 3ZGYA 1K6JA 2HMVA 4I08A 1E3WB 3NDIA 4UVHA 4E5YA 3ABIA 3D5QA 1H2BA 1T2EA 1M75A 2O23A 4FR5A 2GGSA 4AJJA 2Y67A 3WSWA 5DOZA 4PZCA 4A73A 3TL3A 2OORA 3HDQA 3OJOA 4AICA 4MIOA 1HETA 4IS2A 4CMIA 5JAZA 4NR0A 3IL2A 4YPOA 4DIOA 3ZHZA 4EBFA 4NBUA 4UEKA 5AXDA 3UGKA 5HS6A 4ZRNA 3DOCA 2QYSA 2DFVA 2WTBA 1HDXA 1PS8A 4KZPA 4WNCA 3FPLA 5IN4A 1S6YA 4Z3DA 3GNTA 3I9MA 4PLGA 4LMRA 3G3EA 3C7AA 4DBVO 3D3WA 1KEVA 4PG5A 4WCDA 4R4JA 5EPOA 1FJHA 1UXIA 2F1KA 1LDBA 4DYVA 5AXBA 1QR6A 2A94A 1EFKA 4YJHB 4J2HA 3W8FA 1E7RA 5AVOA 1QLHA 4MVJP 3GQVA 3QW2A 4YAGA 5CG1A 1YVEI 5HTOA 3PFFA 1H9BA 2I5PO 4LN1A 4UVEA 3K9QO 4AJ1A 4RVSA 4HX5A 3LF1A 4D0SA 3PZBA 4GWGA 2VRBA 3WNVA 3TF5A 1ZFNA 4WCFA 2PK3A 1R4MB 3OIFA 4GX5A 4J9VA 2C59A 3DFZA 4J1SA 4BNJA 4J9UE 2HQ1A 2QZ9A 2EF1A 2DLDA 5F5NA 3MCVA 4MDHA 1A72A 4LISA 1D3AA 1FMCA 1FF9A 3GVHA 3RBVA 1B3BA 2IZ0A 4AJKA 2WDZA 2Y1GA 3RC1A 7ADHA 4H7PA 1MG5A 4R51A 5C7LO 3ZWWA 1XQ6A 4NBRA 1VI2A 3ZWOA 5FI3A 2R6JA 1A4IA 3ZV6A 1J4AA 3NEPX 1W6UA 5COBA 1YBAA 4JGBA 1GYQA 2YYYA 1DJNA 5JSFA 2GD1O 3OJLA 3F4BA 5KKCA 2C29D 2HU2A 2JHGA 2D8AA 3F4LA 1NVGA 2NVWA 1B8PA 4LCEA 1U3UA 1T2AA 3WLFA 3AM5A 3VPHA 1NHWA 3U49A 3DZFA 3DAPA 1A71A 3LC7O 5T6BA 1BHSA 4HKTA 4DLBA 3JD0A 5FF9A 4EI2A 4J0EA 3JD1A 1HDYA 4GGPA 3GRPA 3EZLA 3G1TA 1XR3A 2RBEA 2C5EA 4J7XA 4EEXA 3PDUA 4II3A 4OIMA 4BS9A 2EG9A 2EXXA 1DIHA 2VZ8A 3BTVA 3NT4A 1U3VA 4UULA 1A27A 1HZJA 2I65A 4GVLA 4OHUA 1I36A 3E9QA 2W4QA 5TQVA 3DBRB 1GQ2A 1XU9A 5DN9A 4DQVA 3WGIA 2C54A 2B4TO 4RLSA 4XA8A 5G0VA 5C7OO 3O38A 1GU7A 4C4OA 3D0OA 1VKNA 5JDIC 2DTXA 3N7UA 1XSEA 2RAFA 3C8MA 1I2BA 4UUNA 3SJ7A 3V2HA 4K1LA 4JBIA 5DP1A 2D5CA 2VQ3A 3SLGA 5DDIP 5EIOA 3ITKA 1JKIA 3Q3CA 1K0UA 1DOHA 2NADA 1LC3A 2YY7A 3PP8A 1V9LA 1JAXA 3B70A 4BNLA 1IZ0A 5EQFA 3FSRA 3PLNA 1YQDA 3RASA 3S2GA 3KB6A 3IUPA 3R1IA 4NK4A 4Q3EA 5ITVA 2PKRA 1L1FA 2AA3A 4BL5A 1QYCA 1LSJA 5GZ3A 4JJGA 1EVZA 2GNAA 2NQ8A 3PGXA 1XG5A 3FI9A 4M89A 4M49A 5IDYA 4MO2A 3TJRA 5A9RA 1NXQA 3MZ0A 2DT5A 4HWKA 4FSHA 1HEUA 2YQ5A 4U6QA 1M66A 4MVJH 4MKRA
chains in the Genus database with same CATH superfamily
3M1YA 4PRYA 1X0VA 1MAWA 1EI9A 4ITVA 2GPYA 4A2PA 1TMGE 3I4FA 4WACA 3WHLA 3F9RA 2PG3A 4OVKA 5D3KA 5EWMB 1IH8A 13PKA 1M8JA 2J5BA 4M22A 2OD7A 5CYOA 5KNDA 3LE8A 2AFIE 1BCSA 1XZGA 3M4ZA 4GYKA 5CMLA 4CMEC 3D1LA 4HTFB 1NR7A 3C70A 4UAVA 4JELA 2AG1A 5G4KB 4HDKB 1Q57A 2PBLA 1CC1S 4YA6A 4FDAA 5H83A 2WQ7A 4AJEA 1GSHA 4Q1EA 4WFQA 1VLZA 2I33A 3JQRA 5TT1A 4BRSA 4E51A 2FRVA 1ANKA 4YBZA 3DGEC 4NTZA 3F8TA 5FBWB 4GQAA 2IS6A 4W5RA 1L7PA 3WYGA 4DJAA 4BQRA 4ZOCA 3KVYA 5L8VA 2XCUA 2G76A 3NYWA 1SVKA 3P9SA 4CIVA 1WHSA 2RGDA 1OX5A 2A3RA 3ZBQA 4WD3A 1KYVA 2WJ4A 3HSSA 2YBDA 4IF6A 3KELA 1E99A 1Y5MA 3BAFA 4WNAB 3QXJA 3VR1A 2OD9A 3FG9A 2VP4A 3ETDA 4H77A 3RK4A 4L8YA 4KKXB 4HZUB 1FFXB 3ELUA 1BN6A 1WPQA 4FX5A 1YJ8A 3ND5A 4R6XA 2VBFA 4AY2A 2RK4A 4HWSA 1D07A 3ZDAA 5AJZA 4MVJA 4JC8A 4F2DA 4I8IA 3GVIA 2HM7A 5IXYA 4JV5B 1ATIA 3R8XA 1G16A 4WXHA 4R41A 4D8YA 3A9UA 1KY4A 3FR8A 4N48A 2FR8A 4O4LB 1QYRA 3DPSA 3DQQA 3DL4A 5AKEA 2X9GA 1T2NA 1WNFA 4KSYA 4N76A 2QRQA 3RSLA 2Q21A 2XWJI 3LT4A 2WUFA 3D4OA 2WT4A 4KLAA 4CLOA 1QH1B 2RGCA 3LBFA 4HL6A 5ALXA 4LFCB 4DILA 2V6FA 4FINA 4Q47A 5DO9A 1F17A 3K32A 5F3DA 1CQIB 4PPQA 1GSOA 2CK3A 4A9AA 4BYGA 2QLNA 2FPKA 4E5MA 4B83A 5D2CA 1QUFA 2JGAA 4PLYA 1GGNA 3WJ7A 3V7FA 3CW8X 4MS4A 4DCPA 2IXAA 1GCUA 1TQDA 1WF3A 2PSEA 5JISA 3OHMA 4TN1A 3ZGZA 3G5TA 4NRDA 3JR7A 3EH2A 2H2WA 1R6AA 4HEJA 4J3FA 2FXIA 4LXGA 4M1KA 3W3ZB 1G5RA 3I9NA 1DQPA 3A6PC 5KNBD 3H11A 3FPSA 2X5OA 4RIIA 4B81A 3Q7IA 1DC5A 4GRDA 4YWHA 5KTKA 5KYWA 3G2IA 4OB8A 3HUTA 3VUFA 2FR0A 3KBBA 4KXFB 3KQWA 4X44A 2KQUA 2C2ZA 1YQTA 1QQ7A 2ZIFA 4PFJA 4XGRA 5DJ5A 5BNFA 2D0DA 2IXEA 4RSGA 1M7BA 2QE7A 1CSEE 1EUDA 3UJ8A 3WLEA 3OA2A 3JQGA 3O31A 4UDOA 1ZJJA 4BX2A 16PKA 1T5DX 2X0IA 2PU7A 2R5WA 3N0XA 3IBFA 3P27A 4IO0A 4MCHA 2Z1DA 1TRHA 1Z18A 4AMYA 1G5HA 1DIAA 4LXUA 5HKKA 4R2JA 1K7XB 1GU0A 1MORA 2JBAA 4LNAA 1ULZA 4TRRA 3TS1A 3C0KA 4DS3A 4RH1A 1QHFA 3T3MB 1J00A 4ZI5A 4O2LA 4PW0A 1OLUA 4EG5A 4KVAA 3ABSB 2F3SA 3IOYA 3QKSB 4YXWD 1FU7A 5JBIA 3OZBA 1CR6A 1GRQA 2PXCA 4HXFB 3JYLA 4NAHA 3P0EA 2Z8ZA 2I4RA 3LLCA 1TQ8A 1MV8A 4W5WA 3E15A 3HFJA 4B44A 4O6VA 3O90A 5ULLA 3VVBA 4AP6A 1QOZA 3ZIAD 1TTTA 4IHJA 2H1OA 5BR8B 1MC8A 3O73A 3EDCA 3QKTA 2ZYHA 4UBOA 1U0EA 4C0XA 4HZGA 4OXKA 3TQQA 3V7NA 4GX2A 1W19A 1ORHA 4IVRA 1WUIS 1GQRA 4M2LA 4N0DA 3ISJA 3HZOA 4KNYA 3RIGA 3L6DA 4OJYA 4NNJA 2O5EA 4OBXA 4RDHA 4PE5B 1MB4A 5JRDS 5KYNA 1N33B 2P90A 1EP2B 2RCYA 3K71B 4XDHA 2ZBPA 2HDHA 3GNLA 1L5ZA 1SCAA 3L46A 3QKWA 2VPZA 2PPVA 4MUYA 2F3TA 2C00A 4AD8A 4EG7A 4ETNA 2AFHA 3ZI7A 3DGFC 3C7TA 2C2GA 4CJXA 1LPSA 2BMFA 4WUVA 2ZG6A 4YK7A 5CYGA 1TKCA 2EEPA 3SXPA 1WCIB 2G36A 2R1TB 2AOUB 4XDGA 2R8OA 1EUZA 1FBTA 5JPCA 1WZEA 3L8GA 2QRZA 1CERA 4ZOAA 2P65A 1TCVA 3EXEA 4J0CA 3TBFA 3V1KA 3ZWKA 4EGSA 3JAMA 4FCTA 3FUTA 4KZKA 5JT1A 1NUHA 2I7TA 3JY6A 3LXUX 3B1YA 1IDOA 4BDTA 1KMQA 4NBWA 3DM9B 4Q66C 1O89A 1AQYA 1T3ZA 3F3SA 3HU5A 2CUNA 2DBQA 3AG5A 1EFDN 2BF7A 3BCUA 5C31A 3SGLA 2RFLA 1RWBA 2G5CA 2EARA 3P9QA 1I3MA 3PL1A 4FBGA 3I5XA 4AX8A 5B3JC 3DTVB 4H3VA 2NO4A 3HE3A 4LWPA 5K6RA 3GYGA 5LD2B 1JT2A 2OXFA 2GN2A 3MMXA 2WSYB 1H1DA 1SK8A 3SXUB 3WLRA 4OKIA 2JIQA 3WLNA 1T1SA 2WI8A 1ZCFA 1XI2A 3GGGA 3AP3A 2C4WA 3GT7A 4CUJA 1WBJB 5ER6A 3ELDA 4MR7A 1XKXA 1H4VB 4P7KA 2EBUA 2LD4A 5AVXA 1KZ9A 1FCJA 1FX0A 3OEHA 1AF4A 5BN5B 1TU3A 5CFRA 2FPRA 2HGSA 1GKIA 3KEOA 3QYFA 3L1VA 2PGXA 1XL1A 5TVKA 1FYVA 1YIOA 3OIDA 2FW6A 3NTXA 1JALA 2IY8A 2AYZA 2ZVJA 3L1KA 4XYLA 3B8HA 1IBLB 2VAMA 2J9FB 1MC1A 4EDFA 3OQNA 4ZN6A 2W4MA 3KM0A 1SK9A 2AJCA 3OLWA 4F04A 2HIMA 4JHLA 4TYPA 1AKRA 1GXSA 1K4YA 1ADCA 2J67A 3OHPA 4M98A 5IT5A 1BDBA 1P0MA 3HL4A 4BJ1A 2OFWA 4RU1A 5T8KA 3D5EA 1BZYA 4ARBA 5KTTA 1XPRA 2PEZA 3HKDB 4U7JA 5HIKA 3KVRA 4URHA 6PFKA 3IAM6 2C8KA 1F9EA 1UDAA 3KL2A 4G81A 5IYZA 1LDMA 5HE9A 2FLWA 1T34A 5AM2A 2QT0A 1CZLA 1ULTA 1NMQA 2C8VA 3NH9A 3N8GA 4AIRA 4DSZA 4W5OA 3ENKA 1CP3A 1ST2A 2SBTA 4D3FA 5KX5A 5A5VA 2BMJA 1L5SA 3LQ1A 2CXXA 2NM0A 2PY6A 2GQ0A 3KS9A 3NOVA 3NUQA 3R4VA 4I36A 4C5BA 1KBZA 1TOAA 1CDOA 2JFVA 2JGDB 1J2YA 1ZK0A 4LJYA 3PCRB 1C7EA 4NOMA 1R50A 2IYUA 2Q3HA 4GBJA 4R1LA 5G0TA 4CM6A 4RE6A 4Q4CA 1QV9A 1QO9A 2IEBA 3B6ZA 3P4UA 3F73A 3CLKA 2PLWA 2B0CA 1JEQA 1JIVA 2GN9A 3WP1B 4O4JA 1VDMA 2G67A 1AV6A 4GLBA 4MYSA 2HJVA 1D2NA 5JPIA 2O07A 1JHPA 1SBNE 4QPNA 3QVXA 2JF0A 2UZ0A 2AOTB 4FS3A 4C0WA 3N2LA 3EVNA 4FBMA 4BMZA 3MFYA 2O50A 2WKRA 3OCXA 4R8MA 1CR2A 2Q0SA 4GXTA 3RAFC 3C6YA 3QUTA 3SDSA 4Q48A 1Y5NA 2YXDA 4BJHB 4GVPA 5B1IA 3EDRA 1ECLA 3UJ3X 5F98A 2JJ8A 3C3KA 2W6JD 3O3OB 4BVEA 4DLVA 5NULA 4ASUD 3RT1A 3Q6MA 5LP6C 1ZJYA 2Y05A 3G2HA 3VNQA 4KPYA 4YLEA 2F48A 3TDKA 1C7QA 4Q12A 3MS7A 1YIDA 4XPIB 2GSWA 3AUAA 3KE9A 2QVXX 4MA0A 1K2VN 1CZRA 1F3LA 3NV9A 1JE1A 4HFMA 3UFBA 1NSTA 1U8FO 1DWPA 2QIOA 2B1RA 2ZSHA 4EA6A 4B82A 2GA9A 3HJHA 4REQB 1KK0A 3BEDA 1JBQA 1VCIA 4L8VA 3K9CA 3LQ4A 3N2GB 3WRXC 4EJSB 5J4VA 3Q8MA 1CS0B 1ESNA 4B7UA 1BROA 2BFNA 3O8BA 1I2ZA 3DZCA 4XARA 2O19A 4H1HA 4CEJB 1UFKA 2PRKA 2J9GA 2Y6VA 4I66A 1V8DA 4ZYLA 5D7NA 1V11B 2CUZA 3NKLA 2JIMA 3VYWA 2GPSA 3U3JA 4PYNA 2M6LA 1G8KA 3ZJYA 2ODNA 2QMOA 3MD0A 4I3FA 4YACA 5EHQA 4MWDA 3TLEA 2J3IA 5KINB 2XCRB 4YRTA 2VCYA 3IP5A 2EGHA 1HG0A 2QA5A 3A6ZA 4LZNA 3KD2A 4RV9A 4WKOA 2VWQA 1T3SA 5C80A 4F5DA 1TW2A 5C1PA 1GPJA 1ZIOA 2J8ZA 2NSYA 2R6CA 2X4LA 3OOJA 4V1CB 1CZHA 3GP5A 4NU6A 4HFRA 3WHIA 4P5DA 2QL5A 1YK1A 4PGFA 3UTCA 2HF7A 5BOSB 1KDZA 2E6KA 3G9QA 3UT5B 1ZNWA 1V2GA 2D2FA 3O1JC 4DDTA 1GQYA 4LK3A 2NTNA 3GHYA 1HI9A 3JRWA 3NRJA 2VP6A 1U2DA 4LCJA 2QR2A 3EIWA 2NU9B 1C0KA 4G9BA 4R9UC 5INTA 5ALKA 3GEHA 1R8JA 3Q7SA 1EWRA 4MVCA 3MOSA 1GSAA 3LJKA 4IOMA 5G53C 5IVDA 3WKCA 5I4BA 5JMOA 3HPRA 1F8YA 1HDOA 4NMLA 2PZLA 1FDVA 2Q0XA 1YDMA 2PLNA 2Z3VA 3HR4A 3FSGD 5T4BA 4IDFA 3SZ3A 4BQSA 3K4HA 1M10A 1OAAA 3E3MA 3EZ6A 1E3WA 3MFQA 5ALMA 2IV2X 2L69A 2JATA 1EESA 2EW1A 4OOEA 3IMEA 4TT3A 1EG2A 2ZYDA 4A0HA 4RGBA 4GDFA 1ACLA 2VR1A 3K9GA 4FI3C 4ZYVA 4JI0B 1N8TA 2F62A 3M8KA 2X15A 3QLVC 5IJXA 3DF7A 2JAWA 3CKLA 1FW6A 5TMEA 1P1FA 1W96A 2G9VA 3E9EA 1IZYA 3MB5A 4J75A 4L4ZA 5IZCA 3LLVA 5BPHA 5EESA 1WIWA 2WHEA 4LC0A 4BASA 4H7DA 2X7XA 1NN0A 3RK0A 1JIKA 2NU8B 2JAOA 2G9ZA 1UIMA 2ZYAA 4LECA 4MMYB 1MU0A 3SF0A 1SXHA 3UHOA 5F23A 5JV5A 1KK3A 1TKRA 2FTKE 4EA7A 1DEXA 2RIRA 2QN3A 5EIBD 5HZGA 4RX1A 2ZRLA 3AJAA 3NOOA 5KQRA 1ZKMA 3RUEA 1ZOIA 2A86A 2D5IA 2HQOA 3ILYA 3OIGA 4O08A 2AIRA 4IQFA 2LCQA 3TSZA 3ER8A 3ZW7A 3VH1A 4NZOA 2H1IA 1KJZA 1W59A 1E9BA 4O5AA 3LVBA 1J07A 4KIWA 3RUAA 5F2NA 3TSYA 1SUBA 3T54A 4NFHA 4QJ4A 1TPYA 1L1QA 1J22A 1KAEA 3FAKA 5L51A 3F5DA 4ZYWA 1GCAA 4JITA 2WIAA 3TINA 5TQ2A 3MTAA 3ZE6A 2Y68A 1RWPA 3WLLA 4CL2A 3TUZC 1B7GO 2IHUA 4QD3A 4R01A 1EXDA 1Q5PA 2WAAA 4F60A 2CF5A 1PJZA 5B4VA 3F67A 2GYWA 2HJ9A 2DPYA 2WTUA 1KK1A 3OZAA 2UXDB 2WU1A 1CVIA 1Q3HA 1DBWA 2XB4A 1RYFA 4WLEA 3KFVA 3N0RA 1EDZA 2XRMA 5FWYB 3HNRA 4AURA 1KVRA 3I04A 1BE8A 1I33A 5FJIA 5H9VA 1W52X 3HG7A 3HA2A 2HT1A 3FN4A 1H0SA 4QC2A 1KAMA 1Y1TA 1G6KA 3DJYA 4FFDA 2PIDA 5DBGA 5JVDA 3BGIA 1PL8A 3MLAA 2GF9A 4OHKA 1XTKA 2BRUA 3A05A 5TV2A 1EK5A 4PZZA 5HPYB 3LNCA 5LFAA 4JFAA 3MPOA 5DFAA 1FW8A 2E5LB 4UBLA 2QAIA 3F6YA 2J87A 1SQ6A 1PHRA 5BW8A 1FXWA 1OXTA 2XWSA 3FMPB 3P2KA 3QPDA 1XYVA 3R0JA 5CA1A 1BKSB 3G2NA 3ZS9A 3AVVA 5JJIA 4EJ2A 2RH8A 1U0GA 5AYVA 1Z2AA 2AEJA 1C2TA 3OCVA 4L50A 2BBSA 1XFDA 4WZBB 3WRWA 1B16A 5AICA 1KFCB 5IKXA 1C9NA 2JRLA 4A92A 3E9DA 3ICWA 2IDKA 1JXOA 3RWOA 1P7PA 3DP7A 2CBZA 2OGUA 4DFDA 1DO8A 4AJ4A 4FFBB 1GZVA 2UZ1A 3CBQA 3PHBE 4O2BF 4OQQA 3I09A 3JZIA 1OBFO 1XTIA 3IBSA 5A1JA 4RJKA 5LQCA 2JAXA 2HK8A 4BLQA 3ANTA 1QTQA 1RLOA 3HKCB 4QGBA 5DM1A 4F8EA 2P9EA 1JLRA 5TC4A 2GPBA 4QBHA 5E9WA 4BO8A 1D4ZA 1IONA 2C94A 5C5EA 2FNAA 3GLRA 4KVFA 4GUAA 1CDZA 3SR4A 4OL0A 1DB3A 5EJ4A 3D7KA 2GEFA 4FGJA 5E2AA 3B9RA 3MJ4A 2QU7A 1P3DA 2YNMD 1WKCA 2DT8A 4P93A 4PCUA 1DC7A 3I3OA 3L0DA 2KHZA 1F1BA 4JC4A 4KE9A 1S2MA 4IGFA 4RF3A 4WN9A 5EKDA 3Q8KA 1M2NA 1N5OX 1CRQA 1OI2A 3CO5A 4HATA 2RHLA 2J3EA 4RQBA 4DMFA 1YFZA 1E9RA 1ZGGA 3A04A 3NHWA 4WEQA 1C1YA 1IHYA 5JCJA 1KSHA 1C8BA 3QEMA 4G09A 3V42A 3VJMA 1N6KA 3HC7A 1DFIA 3FOWA 3GAZA 5EXSA 4KQWA 2C95A 2GZ3A 2Q5HA 2B8JA 2HBZA 2VSOA 4L6AA 1RWNA 2X5XA 4KX5A 1USUA 2DSTA 3DZIA 3IQHX 1MKYA 3C6XA 1RLMA 4CODB 2H7XA 4DWOA 3GELA 5EJ2A 1NP7A 5AIAA 1RHUA 1RRKA 2Z08A 2FW8A 5ES3A 1SU8A 2O2IA 1Q3KA 2YL2A 3ZD8A 1WU8A 4HNGA 4KVZA 4YHBA 2QRHA 3PRHA 4AVYA 4BV8A 2O8NA 3EWNA 5DNCA 4QJ3A 4V0RA 3KUDA 3VKFA 3ER9A 1IVNA 4E6PA 5DGCA 5DGHA 1ADYA 2OM2A 4EWLA 2I6UA 5B30A 2Q3JA 3C4JA 1RDFA 1G8PA 2I6GA 1TC1A 1DOZA 4OLFA 3S1AB 4F4DA 2ATCA 5CB4A 2O8DB 2O4UX 2DYKA 2HPHA 3DC2A 4CYMA 2JIOA 3LXRA 2ROQA 5JAQA 5LOVF 3PNYA 3WA7A 2V55B 1WVIA 3R7LA 2DKFA 1K3TA 1SD2A 2HK9A 2JCVA 2PGAA 3NHUA 2F64A 1I8TA 3W8NA 3JASA 1KR5A 4CMIB 4OFBA 3CS3A 2R11A 2Z1NA 4KIGA 4E4TA 5JR3A 2YRFA 2L17A 5HFAA 3K0KA 1P19A 2WYWA 2VUTA 3AV0B 3WADA 1TA0A 3JQFA 5SY6A 4RMIA 1F6DA 3E3NA 4J43A 4FKZA 4B4WA 4E32A 3QTBA 3S40A 5TNXA 4A7PA 5AQ1A 3GCZA 2I55A 3U7GA 4HLUC 3GRUA 4YRRA 4LPKA 4TM7A 1T8PA 3KUXA 4IRMA 4KQKA 5DI3A 2FN8A 2JFQA 3TL2A 5IS2A 1AMUA 5BSTA 3G8BA 2ZR9A 1DG9A 1RVV1 3KQKA 1G20A 3V1YA 2D5BA 3DR5A 1B2RA 3G7NA 3RS0A 4W5TA 3KRTA 4PZAA 3TLMA 4JBWA 1OV4A 2BP7A 4OP2A 2ADMA 4XTRA 3R5SA 4P82A 2P9GA 4KWIA 4ZA2A 3K0EA 1X8KA 4WLVA 3VTZA 3IEUA 1D2CA 1PTJA 2VJMB 3PWZA 4RGVA 2WSSA 5TQ0B 3SCZA 3C8ZA 3UXYA 3WBKA 3MWEB 1H1LB 1ADGA 2REQB 3G0BA 4PAGA 1B74A 1DRWA 2PR7A 2ID4A 3L01A 4JSTA 4PLZA 1KWGA 3ONNA 1K63A 3VC2A 6GPBA 2C0QA 1XD2A 5JRZA 2OKGA 1XUOA 1HORA 1BS1A 3KHUA 3DTVD 1NVXQ 2VIIA 2EQAA 3D2BA 2PUAA 2GN0A 4BZWA 2OB2A 2VYND 3SHFA 5KYGA 1BVYF 4RL4A 1VA5A 1VL2A 4DM3A 5CLHA 1GJRA 2X3FA 3F8WA 3UH0A 3GY0A 3GD5A 3IXMA 2QXTA 1GVHA 1U0TA 3HJBA 1ARZA 2EZ9A 3NKVA 4RD6A 2OQVA 2BJWA 1XU7A 2R2GA 3GZ4A 2ECOA 4GMGA 4U7GA 2Y1CA 2A7XA 4DSNA 1KWKA 5ADVA 5IULC 5BSFA 2Y27A 2HLHA 1VZ2A 4NSNA 1MAVA 2BFOA 2WMDA 4ALMA 1T4BA 4KPUB 3L8HA 3GHHA 4QQFA 3T35A 1K1EA 2BE7A 5A6SB 4Z3KA 3E27A 4ZOBA 2C3PA 5ITWA 2OV8A 1ODFA 5LYYA 2EOAA 1JBEA 2V7QA 2PA3A 4ARAA 5IF3A 1WQ1R 3LYLA 1RXEA 4RVGA 3QJ5A 5LDGA 4BPBA 3I6YA 3N58A 1WLYA 4FNOA 4L4SA 2DUUA 4BGIA 1NLMA 2GKSA 4H4CA 2QD4A 4QO8A 3T3NA 4GOKA 4UTVA 2JGFA 1KMMA 2Z5LA 2P40A 1SQSA 2XBUA 3HI4A 1FFYA 1CEYA 1LLDA 2SKEA 4OD0A 4NCIA 1RKVA 3NWBA 3UG6A 3BMNA 1DVRA 2C9ZA 1BHO1 2VHVA 2PSDA 3NDRA 5F21A 5AI6A 4LKOA 2CSXA 1GY8A 1RYDA 3HEMA 4M60A 1W7AA 1QGED 4WZBE 2XSZD 2I1QA 1TC2A 2VSYA 3N8HA 2NWQA 3DMPA 4ABTA 1VHLA 2J45A 4LAFA 5FPTA 3LYAA 2IHVA 1C9JA 2FW7A 3Q11A 4RAOA 5C8YA 1J9EA 1BMQA 2VO1A 3GVXA 3OMLA 2OWEA 1D5WA 2YV1A 1PL7A 1BSVA 4UNRA 3EZ2A 2JD2A 2QZ4A 5TE9A 1KJJA 3LIIA 4DNFA 3H2GA 4W1PA 4Z1MD 4Q19A 2ZSIA 5CT4A 4DKXA 4Z7NB 2FP3A 4F46A 4F4JA 2GBCA 3DV2A 4IJ6A 4V0SA 3UAYA 1E1KA 3WGNA 1H2YA 3L0IB 4FOSA 2YWFA 3HBFA 1XHFA 4MS1B 1W36D 3KG2A 1NL3A 3IJRA 3S8EA 5K3DA 3OF5A 4BBAA 4RGQA 2X8LA 2XA9A 2ZJZA 3BB4A 2VZ9A 5K5EA 2WABA 2PTHA 1BA2A 1E5XA 4DCTA 1JEDA 4MO9A 1NVDA 4FQ5A 3R7WA 5BR7A 2VDOB 3MXTA 3V8RA 1N78A 4O4HA 3DZGA 5B64A 2FN3A 2UKDA 2ZXEA 2PUHA 2ZSEA 3T52A 4OI1A 4DA0A 2IS2A 5AK0A 3HBAA 2X2FA 5TARA 2P5TB 2KW5A 2PA0A 3BXEA 3IX7A 3BFXA 2DZDA 2G3YA 4KGXA 3T3PB 4EFLA 2AH5A 4J4HA 3RU2A 1P91A 2FZLA 2OCPA 3RTBA 5LLTA 1KSGA 2NP6A 2OD2A 5BRNA 1SUIA 4BXOA 3M81A 4L8GA 2XB6A 5A5EA 1N6IA 1MQAA 1F2DA 3R7DA 3KJQA 3ORRA 3HN7A 3HU2A 5BVHA 3L4BC 4XJTA 4OYRA 4BV3A 2FGJA 4UARA 5IZCC 4B35A 4YUYA 3PDJA 1I4WA 4BEBA 1I9GA 1RYYA 2XUHA 5GONF 4DEXA 5CGZA 2JARA 3LUPA 4FHFA 2ZT6A 5CVVA 3K3PA 4UAGA 3WQQA 5KQGA 3L8DA 4DV0B 2IZ6A 1TDJA 2QTAA 3CKYA 4NDNE 1BJRE 4FNAA 3GFQA 4HXEB 5C4GB 4P4NA 1CJVC 1W5AA 4CDNA 1C4OA 3SC3A 5AK4A 2WOJA 2LUOA 3UMMA 2Q5JA 5L4LA 1USKA 4GLJA 1W0CA 4HBGA 4CM4B 2FZGA 1BMTA 1VI6A 2XTMA 4L8LA 3UG7A 3VPXA 1R6VA 3O2NA 2PBRA 1A8UA 3W0LB 3L4EA 5DM4A 3S2IA 2IL1A 2QLJA 4RD4A 3WYDA 4QTYA 4ONEA 3HRHA 4JLUA 4BFTA 1VJ5A 3MSCA 2BI7A 2I7XA 4US1R 3T0GA 5LVAA 3ZOKA 1Y4SA 2HV8A 3S70A 2CFSA 2VP3A 1G7SA 3UVEA 5B1YA 2XBMA 4EB0A 5F9HA 5JNWA 2H7VA 4BMVA 2WUVA 1R5BA 2FVYA 2NZ2A 5BQXA 1JEOA 2XUJA 3T3OA 1L6IA 5C7IO 1JUDA 3BQ9A 4GXRA 1EUCB 2GXSA 3R8CA 3TNDA 1SKMA 4JLAA 3GJ0A 4HAYA 1M1NA 3MVEA 1XK6A 3L5KA 2XNSA 1C1DA 2IBTA 1XVAA 2G28A 3FETA 4E5VA 2X9VA 4HH1A 1UT5A 3H1PA 3OEEA 4XCVA 2QSUA 4C04A 3SVTA 5CIQA 3JQCA 3IMFA 3RUDA 2C4NA 4P9NA 3RVSA 1UXKA 3RS2A 1FJGB 2ZRCA 2BJHA 1C1XA 2QM3A 1YS6A 4X8HA 1HT1E 2ST1A 2O8CA 2W8BB 3CRW1 5K3EA 2C1ZA 3JQ8B 1EKXA 5B3AA 1ADFA 2VPYA 4WBSA 1MAUA 4ZVSA 3CYFA 5I6DA 2A84A 3WZ2A 3HVIA 4E88A 4J6EA 3QG5A 1X1TA 1G8AA 1WAMA 4MGEA 1W4ZA 1L4YA 4R9NA 4U7WA 2ZU6A 4V2UA 1THTA 2Y0CA 2FXVA 4L57A 2UYOA 3TI9A 2BKEA 3GG9A 5IJZA 4I5GA 3QBVA 2EP8A 5F35A 2F9MA 4JYAB 3C3WA 2FCRA 1KDRA 1Q1AA 2QJRA 2ZBUA 1YI1A 4O2BB 3UWDA 4IPTA 2CXRA 2W4IA 3P2EA 5A4KA 3AL3A 3BCSA 2V9PA 1N2BA 2C0CA 5BQ5A 3UWSA 3WL5A 4Y2UA 4KAFA 4TKUA 4UDXX 2UYYA 3Q3EA 2YX1A 3LA8A 1D2RA 4M1TA 4IGIA 2VYVD 4TQ9A 1CUWA 2R5NA 2PWPA 1SM4A 4RMGA 1Z35A 3NS7A 2J0VA 1RAHA 4EO4A 4G5RA 1QAOA 4A8JC 4GYYA 4O33A 2WW8A 1XDZA 5L6MB 4DW8A 3F5QA 4ZXPA 5J1SB 3LY8A 5SYAA 2MR5A 3GVCA 4BDSA 4UEJA 1P72A 1W34A 1PWHA 1NWCA 4MWCA 5A7FA 7GPBA 1TQ6A 1Y98A 2ZBEA 3ZQUA 1M0TA 1T0BA 5IXJA 3JYQA 2IZ7A 3DW1X 2W48A 5DX0A 3X2EA 4E1VA 5U1PA 1XXHA 2GLXA 3QE0A 3W8EA 3NT5A 4UTNA 2FR1A 3MUFA 4YMIA 3CEAA 3M89A 4X8MA 3U3DA 3JALB 3P9RA 1UZUA 3JSXA 3DOEA 4BO5A 4GT1A 4M9UA 2B30A 3EH1A 4S05A 5JLAA 1MO3A 4DYHA 1YUBA 1DT5A 4PHCA 1H3NA 1NPYA 1Q7CA 3PZRA 4LY3A 3VDRA 1FDTA 2AQ8A 2YS7A 3BBLA 3ASYA 4ZGGA 2C7QA 4K0KB 4JJ4A 5HMLA 2YW2A 4RD1A 3RC7A 1DIRA 2UVPB 3DOOA 1TJPB 3EQ9A 2GRJA 2HRDA 3DUWA 1BE0A 5KC9A 4LQLA 4QJ5A 4CQMB 1BS9A 3IO5A 3BD6A 4JJAA 4KQGA 1XVVA 1GO2A 4LHXA 3IVGA 2YOFA 4HS4A 4IIEA 2BGLA 1X7ZB 2I2AA 3CISA 4LRWA 4MGKR 4V39A 1UFQA 3SQLA 3MTBA 1UMBA 1NJ2A 2HF9A 1RCFA 5KNBA 1MC4A 3N2KB 3WJ1A 3SC2B 4KRXA 4Y6PA 1THZA 5KVQA 2XVMA 1U2EA 3OQMA 5HKOA 1OWPA 4PLTA 3P2JA 1ACJA 1RAEA 2QRVA 4BN0A 4ZIRB 5JBQA 2IC5A 4EMBA 4DZZA 3WWOA 2Q8QA 3J7TA 2XD4A 3OJ0A 4A16A 1V43A 3RHTA 2HDOA 1U80A 2I4LA 4K6FA 3N76A 4K5QA 2FF7A 3QA9A 5ILQA 5LOVB 2PLFA 3FI0A 3KOOA 4RQAA 2Y99A 1GQOA 4JU8A 3RUHA 3L7IA 3ZYZA 3IDSA 1PLKA 2JIDA 2FHPA 1ZUIA 2LP4Y 4PGMA 3TE6A 4IQ0A 3Q3HA 4DUPA 4E31A 1EK6A 1PQYA 3F96A 5TB5A 1P39A 3N70A 1EGVB 2XXAA 2IIQA 3I6MA 2I8AA 3LXXA 3KVVA 1TVKB 3T9EA 3T9DA 3WLHA 4HDMB 4PS1A 1GNTA 3WL7A 4V0QA 1T9AA 3P2OA 1SJ9A 1SN7A 2FMXA 3FCEA 3ND8A 4WFIA 4BC1A 5K4HA 2OG1A 3FLAA 4RFVA 4GE3A 4D0GA 5ESDA 5KEIA 2E82A 4PTLA 2VHXA 3HADA 1JQKA 1FSZA 3AHGA 2RHTA 3KHKA 1Z4OA 4GMKA 2VN8A 3WGOA 3F49S 2UUOA 3BXPA 4XX0A 1FQWA 3VR5D 4YXWA 4MEBA 2PZKA 2ZKLA 5P8WA 4H3KB 4I5DA 4KXLA 1RIIA 3BF7A 4MW4A 4MKXA 2QT9A 3C4QA 3EYAA 1W1IA 4HUJA 4R3WA 4Z49A 1UBMS 3H04A 1QRDA 3M2TA 4DV2B 1QO0D 3ZIAA 2WA1A 5FWAA 3ZDCA 1K5HA 4KN6A 2V9CA 4X54A 3SHQA 3R09A 1ISJA 1W93A 1RHJA 3N5KA 3UK2A 3GWGA 1BRMA 4DPLA 4F71A 1TZKA 3S2YA 4WXYB 3CQ9A 4AZ3B 1KZ7B 1M1YB 3U40A 3WHKA 4AP5A 1KYZA 4LWZA 1XKQA 3H5WA 1IN4A 1L7XA 1U7WA 5AJTA 3E84A 3H5NA 3OQIB 1E61A 1BGWA 1RPNA 1SB9A 1XYYA 3Q1KA 2WWWA 1QQ5A 1ZQ9A 2HWWA 4Q6BA 4UTXA 3AR8A 4F91B 1P5HA 2PQ2A 1M1XB 4KV9A 1VYVA 4ZFNA 2XRFA 3RU3A 1HWYA 2DQZA 2H8GA 4AUMA 1BTOA 1LSUA 1AHNA 1YR8A 2A9OA 2OBMA 3DB1A 4TMZA 3G6KA 3RVDA 1ZJZA 5AW5A 5FBHA 2MTBA 5KOHB 3OU7A 4RK4A 4K8RB 5FYQA 5B3KA 4JCOA 4Y6LA 2AFVA 2OBBA 3V33A 1L8XA 1QU3A 1YJXA 4HVTA 2RGNA 5AW1A 1XT6A 5EZ5A 4LMAA 3R76A 1U90A 3BPSA 1AG9A 5AK5A 5K8VA 2VNAA 3BCHA 2ZT7A 4IHKA 4D9EA 3LO8A 5CFMA 1IM2A 2WMOB 2PKYX 4RDIA 3FYTA 3B48A 4X90A 5DLPA 2WD8A 2UZAA 4KDEA 3TLZA 3K70C 2RK6A 2O57A 2ZKIA 3FCOA 4MRSA 4EGFA 1EVLA 1AUOA 1XMPA 1WZIA 4G0PA 4ZOLF 5ALYA 1H0KA 1VCNA 1WP9A 1G1AA 4LSGA 4BO7A 3BGOS 3NCHA 5B6PA 2WM9B 3TB4A 4HYQA 2IKQA 1E1CA 3JV7A 3ZVLA 3GLGA 4I9UA 4LDJA 4PFKA 3RR2A 1LDYA 4LGCA 5EFZA 3AFOA 1KI2A 4GLOA 3NALA 1N9KA 3BMQA 5JARA 3LPLA 2I91A 2HA4A 3AV3A 1CUFA 3KOZA 3QVGA 1XWFA 3C6QA 1G21A 5I9TA 2EW8A 2E6UX 4TV8F 2PR2A 4ZCPA 4HX2A 3I4LA 4I50A 2P6UA 1AO0A 3BL8A 4MB2A 4RJJA 1RWXA 2XDQA 1IEQA 4EM6A 4F3RA 4IXTA 1ONOA 1VIMA 3T7DA 1Y8RA 3SF8A 4F3TA 1R0YA 1L5HB 3PFNA 3A7DA 5H70A 1VG0B 2I34A 3UYLA 1R12A 2JLQA 2PKWA 1PU2A 3EVGA 3TQFA 1ZSVA 4N7BA 1DI0A 4QFBA 4E07A 3KU4A 3OPYB 2B5OA 3GFFA 3VX4A 1IXYA 4DJJA 2FPIA 3I5YA 3QPUA 2YMPA 1QV6A 4M8SA 4OHWA 3FY4A 3L49A 4KN5A 4U9UA 5IM5A 5EJEA 2IH5A 2HPZA 1ZITA 3K0CA 2Y0DA 3ZUPA 1YKFA 2YZGA 2AFIA 4X8OA 2WQZA 4IZ6A 2JKVA 2WWXA 1IBMB 4XXHA 1RM3A 4Q18A 3W05A 3IULA 2JFHA 1K6IA 2I6FA 5FFMA 4D25A 4TWZA 1X74A 1I6LA 1DO0A 3N2YA 4MITA 1MX9A 4R2WA 1DFHA 4LHYA 4EI9A 3OTWA 2WJPA 2GPWA 5KJCA 4R05A 4EG8A 3OJFA 1QG6A 1E62A 3PUJA 1CDDA 3HJCA 1SCUA 4W8OA 1P2FA 3O1LA 4R40A 4QELA 2GKOA 1XZHA 5E4YA 1YH3A 3RVPA 3TTUA 5EJ5A 3Q3VA 2QSJA 3NG1A 1J7JA 2AHOA 3AUSA 2CDCA 1OZAA 4ALKA 3PYXA 1X7HA 5EOVA 3HH8A 4C6HA 4JX8A 1GGMA 3ECCA 4KH1A 3UOAB 3AF6A 3T4PA 1CRLA 3ZV5A 2AWNA 1XZPA 3LT5A 3PC8A 4XQGA 4YJHA 5JLJA 5EIXA 3V8PA 5GONB 5FPHA 2PD6A 3PWKA 3F6EX 5J2UA 2NQ2C 3KZCA 3BT7A 4HNAA 3NQ41 1FXSA 3RVRA 4QU9A 1N2SA 4O63O 3UHAA 3ZDYB 2OZPA 1JSZA 3AU8A 1JEJA 1FYFA 3GXOA 4GOLD 4XYBA 1YNOA 3KK0A 4DIEA 1NTOA 3ADKA 4J2OA 1RJ9A 2YS6A 4HF7A 4CF6A 2NPFA 4BVHA 1RQ2A 4WA8A 4ZVTA 1RXCA 2YTZA 5TPWA 3ET5A 4ZICA 2ZB8A 2JJMA 2W6JA 2WUGA 1I4DD 2VUSA 2Z58A 3G68A 4ASUA 3WRYA 2O2EA 4OP1A 3OESA 3WYBA 4DNOA 5CDYA 2BI8A 1I1OA 4Z4IA 2BGWA 3RTGA 1XF9A 2ZYVX 3U7QA 2A9RA 1Y37A 2VHQA 2WVJA 3QU5A 4HMQA 5LZ5A 1BOOA 2EAUA 4X84A 2WKSA 1RPAA 2QUBA 2IXTA 1GILA 1P0CA 2PSHA 3K1AA 2AXQA 3FSJX 3UA4A 1VI5A 1PR1A 1ZIXA 3DAFA 3EPPA 2ODAA 3KCQA 3LLMA 4FN5A 3N6RA 2FN4A 3STVA 4C7VA 2Y1OA 5KNCH 4WASA 4E22A 4E4YA 5B2FA 3K0AB 1JQDA 3I32A 4G26A 3Q7QA 3C14C 1VSUA 2QXYA 4J0FA 4WESA 3LF2A 4KFTA 2WLSA 5DN6D 3UH1A 1TVEA 3ZCSA 4CQNA 1P17A 2QJWA 3CNLA 4LVOA 3BS4A 4M9QA 3Q2KA 3RJMA 4F84A 4R71A 1YAJA 4AECA 4NEQA 2FWMX 3R4CA 3P9NA 2BHRA 3REQB 3SIXA 4YCMA 3FTFA 1CPYA 1P1IA 4P7GA 1VB3A 2QVBA 2BFEB 2H4WA 2XDYA 3CLUD 4FFRA 4OAPA 1OWLA 4MARA 3CX4A 3VJKA 2VUUA 2IH2A 1VRCA 2CNOA 3C3MA 2B1GA 2BT4A 2H4HA 5EHXA 2PX3A 3I9V6 2Y76A 3IAXA 1K2WA 3DUFB 3E0QA 3IUNA 1NMSA 3M2PA 3OM1A 3PKJA 3BJMA 3TPFA 1M1YE 2JVJA 3QWIA 4FDVA 2JBHA 3I5AA 4NJMA 4QDKA 2B36A 4HQRA 4ZQBA 5MF6A 2O8VA 4JI5B 2GPJA 4HDOB 5E3IA 2YRXA 1BVUA 1L3BA 4KPFC 4O1MA 4RORA 1E1QD 1GZSA 3BTUA 1U9ZA 3EGOA 3NRCA 5A3JA 4TYWA 2EFHB 2ZS7A 1M1UA 3FZNA 4OAOA 3FF1A 3OZEA 5HJ2A 3VZDA 2JJYA 5IG2A 1KVTA 1HE8B 1GSIA 2E0IA 2HSGA 4WBXC 1S8NA 2DFNA 2WM3A 4IICA 3OT1B 5EG5A 4C4XA 1R3UA 1LBSA 2IEZA 1MZVA 4MA4A 1ZNYA 1R6TA 3WV4A 3TW6A 2RJ3A 3HKBA 5K3BA 1CUZA 1Y7PA 1VKZA 2Q5EA 1EVJA 4LZPA 5EJGA 3FSGA 1NYTA 4OL9A 4GXQA 4MHSA 4F86A 2AV6A 1NYRA 4FFNA 4BNNA 4DMHA 1QFJA 3VVMA 1JDBC 5F3RA 3VU9B 3D0RA 5DVZA 5JXHA 2O05A 2GN1A 4LDPA 5LU8A 3AZQA 4E1BA 1Z45A 4KDFA 1CUVA 3WICA 4HDNA 4WKBA 5DU2A 5C3MA 3J81k 2LIPA 1EB8A 4TLEA 4OMDA 1N75A 1NDHA 3WOHA 1G6OA 1KDPA 1ABBA 2H51A 1Q1QA 2IPOA 1ZIPA 1CETA 1E3QA 2JD1A 1R5NA 5LQRA 5AM0A 2I62A 4WXPA 1PEKE 5FA8A 1YDWA 2C83A 2DE0X 1P8JA 2BGJA 2Y1EA 4QHYA 4QPJC 4RPKA 4ZQIA 1YS1X 3FOBA 4R0NA 5AKKA 3VQTA 3ZKAA 4IKEA 3AEQB 3Q7TA 4DEVA 2FQQA 1PUJA 4G01B 4IRUB 3TNFA 2ZUWA 2VEOA 2ZWAA 2MR6A 2QAGB 1U9JA 1TKBA 3IUSA 4F9EA 2WY2D 2V54A 1NZDA 4EUNA 1RXIA 1OFVA 1U2SA 2O2YA 3QTTA 1WMAA 2YASA 4XUEA 1JE0A 4HYTA 4WUTA 1E2BA 3L7JA 3HHEA 4NCJA 1GZUA 1CY2A 1R8YA 4PTYA 4PG4A 4PR3A 1I3LA 3KPJA 2G06A 2IYLD 3GX1A 3QFHA 4NHEA 5HUQA 3ITDA 1E3MA 1JXAA 4K0RA 1NI5A 3B9QA 2OLKA 1E2KA 3HO8A 1VMDA 1Y7TA 5DM2A 4CN9A 4HAXA 4JT4A 5EWMA 5C46F