1YQGA

Crystal structure of a pyrroline-5-carboxylate reductase from neisseria meningitides mc58
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
263
structure length
263
Chain Sequence
MNVYFLGGGNMAAAVAGGLVKQGGYRIYIANRGAEKRERLEKELGVETSATLPELHSDDVLILAVKPQDMEAACKNIRTNGALVLSVAAGLSVGTLSRYLGGTRRIVRVMPNTPGKIGLGVSGMYAEAEVSETDRRIADRIMKSVGLTVWLDDEEKMHGITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATFKGAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQEMERQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pyrroline-5-carboxylate reductase
publication title Crystal Structures of Delta(1)-Pyrroline-5-carboxylate Reductase from Human Pathogens Neisseria meningitides and Streptococcus pyogenes
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 86
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent
A PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3730.10 Mainly Alpha Orthogonal Bundle ProC C-terminal domain-like fold ProC C-terminal domain-like 1yqgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yqgA01
3O03A 3PHJA 2DTEA 5CDYA 3ZWBA 1NTOA 4D42A 4IINA 1EQUA 5HS6A 1VRWA 4J7XA 4TWRA 4DVJA 1E7YA 2RHRA 1XKQA 2CNBA 4RORA 2Q3EA 2QRKA 3WQRA 3ZU4A 4NFSA 2DUUA 1IB6A 2O50A 1I3LA 2Q50A 4NNJA 2GZ3A 2YV3A 4Q3DA 4J2OA 3D3WB 1KVUA 4GPD1 4HFRA 1V35A 1I30A 2LDXA 3GDOA 3ICPA 1Q7GA 1M2WA 3RUEA 1KEWA 2OXIA 1JA9A 9LDTA 5JDIA 1ENYA 1A7AA 2I76A 5HBRA 3D5QA 5JO9A 2VWGA 1E6WA 2C0CA 4E5PA 1NM5A 2FRDA 2CVQA 3AWDA 4MVJM 4M54A 2WSBA 3PHLA 1HLPA 4LRSB 2DBRA 3EVTA 1DEHA 3PLRA 5A9RA 5CPBA 4M55A 5IZCC 1U2DA 1F8FA 1JAYA 4H16A 4NZ9A 3U62A 1B15A 1X7GA 4FJ2A 4D44A 1WMAA 4OSOA 5DULA 5JS6A 1DO8A 3PYXA 2BELA 1CF2O 3GG2A 4LK3A 4X54A 1HZJA 1K3TA 4HUJA 3VPHA 6LDHA 4PG7A 3PGXA 1B3RA 5JC1A 3I5MA 3GZ4A 4YJHA 3Q6IA 1VE9A 3IP1A 5EN4A 1EDOA 4BNHA 2PR2A 3TSCA 1E7SA 4L4RA 1LEHA 4YQZA 1B8VA 3G1TA 4QUKA 1Q0QA 4QX6A 3DOOA 3FD8A 2AHRA 2WYVA 1Q7CA 3IQDB 4RZHA 2C7GA 3BMOA 4DIFA 3PFWO 3PP8A 1YGYA 5KWEA 1P31A 3JTMA 4YVFA 2TMGA 1PJBA 3H9EO 3G0OA 5A9SA 4XDYA 1A4UA 1QR6A 3BYZA 3JQCA 1ZZEA 4J9VA 2IEBA 2CVZA 2QZ9A 2JAHA 3D4NA 1YL5A 3I9NA 3T7EA 3ANNA 1ZSVA 2PZJA 1GU7A 1PS0A 3RIHA 5T64A 4XJSA 5BQFA 1QYVA 5H82A 1GEGA 3JQBC 5B1YA 3OF2A 3EGOA 4K26A 4PGFA 3OFSA 2WD8A 4CV0A 1SB9A 1DLJA 1NX6A 3CMMA 1JDJA 4GGOA 4IZHA 4MOWA 3M1AA 1T2AA 1KVSA 1B0AA 2C59A 4WE3A 5F21A 2FSSA 1RPNA 4BGIA 4O59O 4FFNA 4MKZA 4CQMD 2OHXA 1S7CA 3G49A 1FXSA 4D45A 2VUSA 3HDQA 1TLTA 1Y7TA 4NK4A 3F9IA 1V0JA 5U1PA 3PHIA 2GGSA 5T8KC 1FDUA 4TMFA 1YQXA 1JAXA 1AHHA 4CM1A 4BV9A 1Y9AA 2YYYA 4FFPA 4JXKA 4BGVA 4WCFB 5CAEA 2E49A 3BAZA 1LLQA 3ZH2A 5K6AA 2JHFA 3ROMA 4R9SA 5I7SA 5KKCA 2YW9A 3UXYA 4JBGA 2VWPA 3OA2A 3PZRA 4IIUA 5F1PA 5JCXA 2NU9A 1MB4A 2Q46A 1O0SA 3NJ4A 3BTSA 1ZVMA 1NPYA 3NX4A 2D2IA 3ETEA 4NU6A 1YO6A 4IDBA 3C1AA 1A7KA 4MDHA 1BMDA 4RLSA 3RC9A 1E3LA 1ISMA 5TJHA 3ZWAA 1NQOA 1UXJA 3PHHA 5DNAA 3I3OA 5JBIA 1DIAA 1ID1A 2FR8A 4DGSA 1ZUD1 2Q1UA 5GZ3A 4YAEA 5FWNA 3PXXA 1ZO8A 1LDEA 3WIDA 3GFGA 2PNFA 4PG5A 4CMBA 5L7WA 3KZVA 2Q99A 1NAIA 4BO5A 5BSGA 4DLLA 3S8MA 3HN7A 3ZV5A 3UCFA 4MKXA 1IHYA 4B79A 1O8CA 1QV6A 2YV1A 1VSUA 2VTDA 4CQMB 4MKRA 4ALNA 2FWMX 4K28A 1UXIA 4YJDA 1N8KA 4B3JA 1DFHA 5LDHA 4IJWA 3ABIA 5CDTA 1VL6A 2AQKA 4JJIA 3BMCA 3JQ9C 4R3NA 5HS4A 2O3RA 1SC6A 1CJCA 5KJEA 3DR3A 1AE1A 4DMLA 1YWGO 1P1RA 4BO4A 4YCAA 5BT9A 4TRJA 4XYLA 4GVLA 4N5NA 4OXKA 4K1LA 4D43A 2PWZA 3NV9A 1YRLA 2UAGA 4YBZA 4B8ZA 4OOFA 4PLGA 2FN7A 4Q3BA 3OETA 4BKPA 1NBOA 1Y5MA 5ADHA 2B35A 4W99A 1E3JA 1Q0HA 3MOIA 3U4CA 3GPIA 1DDOA 1TXGA 5FI3A 5H81A 3WGYA 2PZMA 2Y1FA 3KEQA 4BMNA 3QWHA 1U5CA 1T24A 5TF4A 3JQAD 4GX1A 2HMUA 4D7AA 1DIRA 1XU7A 2Z95A 3AU9A 4R5MA 3GVIA 3SXPA 3CUKA 5LDGA 2QYTA 4DYDA 3FHLA 1N2SA 3E5MA 1QYXA 2D5AA 2PFGA 2PY6A 2DKNA 4A0SA 5BSHA 4L4SA 1SAYA 2DT5A 3HZZA 1IE3A 2V6FA 3DAFA 4YRDA 3WTBA 2PZLA 4KZPA 1SEPA 4D41A 1NNUA 2CUKA 2WE8A 3INRA 1HWYA 2P5UA 5ES3A 2DBZA 4BNTA 4DBVO 1MG0A 4L75A 1DSSG 4G81A 2TMDA 2EIHA 3S1LA 4FC6A 3ZWNA 2VZ9A 1GYPA 4YYZA 4I1IA 1YB4A 1V3VA 1E3EA 4EGFA 3DZGA 1EFLA 4NBVA 1H2BA 3EDMA 2RBEA 5EERA 1MUUA 3FTPA 3M2TA 1G1AA 1GZ4A 2B83A 1LU9A 4ZQEA 4B4VA 4EDFA 1MGOA 1EFKA 3PJDA 2X5KO 3ETDA 3JYLA 4MP6A 1QMGA 1LUAA 2R2GA 4FOSA 5L4SA 4WCFA 1Y81A 1NQAO 1QKIA 2ZKLA 2BGMA 1NVMB 4I5EA 1B8UA 3OEYA 1JKFA 3Q2KA 3F5QA 4R16A 1GYRA 1PGQA 2F00A 3DHEA 1I3KA 2P4HX 3A06A 3MEQA 2NQ8A 4GBJA 3WIEA 4YACA 4BHTA 3AUAA 4ALJA 4II3A 4FFOA 1V8BA 4FFRA 4DYVA 4Z9FA 3WOHA 1JVBA 3N74A 3B6ZA 1D3AA 2Q2QA 5A3VA 1T1RA 1T2EA 1B16A 3NTRA 3WXBA 1X14A 1E0DA 1SOWA 2IYPA 3OHSX 3VVCA 1V3UA 4IJUA 3WFJA 4CLRB 3VKUA 2I65A 2NUAA 4E2XA 1H93A 3PIDA 3GGGA 3TZCA 3ZW8A 1E6UA 3PQDA 1R4MB 4DLAA 3OQ6A 3MJCA 1ONPA 3TL2A 1DAPA 1SO8A 4AJIA 2VHVA 1PL6A 4CQMA 4Y6PA 5ER6A 5JYEA 2DFDA 4NBTA 1T26A 3S55A 3GUYA 3MJTA 4D0RA 3PPIA 5FYDA 3H4VA 5JCJD 3H5AA 4P8RA 2NVUB 1HKUA 4RJTA 2EKQA 2J5QA 2VNSA 4JN6B 1HE5A 4NJOA 1G0OA 4XJTA 2I3AA 3FBTA 1HYEA 1PGPA 1DOHA 4DL9A 1Z45A 1ONNA 3LYLA 5T6BA 4YDRA 1J5PA 1GAEO 2AE1A 4J6FA 4MINA 1DRUA 1VJTA 2HO5A 4DREA 1PZGA 2FPGA 4KTTE 4BO6A 5KJ1A 2CDCA 4J0FA 1HETA 3GEGA 2W90A 4I08A 3AY3A 2B0JA 3IS3A 4A7PA 1LDGA 3NT5A 4CR8A 1U3VA 4IJKA 4WCDA 3DAPA 3VZQA 4IBOA 1GQQA 3C8MA 1KS9A 4BGEA 4XZ3A 4JGBA 5TLSA 1JU9A 3UUWA 4DC1A 2GSDA 2V6MA 3DTTA 3QY9A 5DOVA 2DBQA 3ONDA 4EJ6A 1ENOA 3LF2A 1C1DB 1LDMA 4JK3A 1TB4A 3WNVA 3AUUA 1MP0A 1GCOA 3AI3A 1KERA 3DO5A 1XHLA 3WWYA 1QXSA 4ZICA 1E7WA 2VN8A 4RF4A 3RUAA 4BKRA 2NWQA 3STHA 5GMOA 2QW8A 3UGKA 4AJ2A 4RDIA 3M2PA 3DDNA 4XRGA 1F8GA 3HFGA 1HYGA 4XR9A 4IGEA 4EUEA 5KOIA 2A94A 4LSMA 2RCYA 5K0ZA 2JFHA 3BHJA 2IODA 2GYYA 3AY7A 3W6UA 4BO8A 2NU6A 1KY5A 4OKNA 3KOUA 3GHHA 4G5HA 2VZ0A 3GAFA 2H1SA 2GN4A 4PG6A 4PZCA 4CM6A 1NPDA 1U7TA 4JJFA 4NFHA 5G0WA 2QHXA 4U0JA 3ROQA 5KVSA 3VPXA 4OO3A 2I99A 1ADBA 2X0RA 1E1NA 3QWFA 3GZNA 5A9TA 3TRIA 2FPPA 1X1EA 3F1KA 2PA3A 3D0OA 3T4EA 4BOYA 3CH6A 3WB9A 1GD1O 4B3HA 1GEEA 4N7RA 4O63O 4JCOA 4MVJE 4GL4A 1X7DA 1NHGA 1J0XO 4DWVA 3E48A 3S2GA 1NR1A 1HE2A 3MJVA 1XR3A 4MP3A 4P38A 4I5FA 4CR6A 3N58A 4NBRA 1ZK4A 4IXWA 1KVQA 2EKLA 4ID9A 3I4FA 1GZ6A 3L4BA 1PQWA 3QE3A 2HRBA 3FCOA 1Y8QB 5TX7A 3ZHYA 3LZ6A 1YJQA 4IMPA 1KEUA 1PQPA 3CPSA 3Q3CA 4M89A 4S3MA 3E9QA 5TSDA 4CLRA 5I9LA 1LSJA 3AOEA 3KXDA 5U9CA 3VTFA 2HK9A 1OI7A 3R0IA 2QG4A 4IIVA 3HDYA 1R4MA 1PGNA 3RQSA 4BNWA 1H6BA 1V3TA 2WTBA 3O4RA 1A9YA 3DFZA 3ETGA 4CM3A 2JL1A 2D3TA 3EAGA 3H5RA 4ZRMA 3ITKA 3H9UA 1PS9A 2O4CA 4CUKA 5EL0A 2BD0A 3GR6A 5G4KB 1ML3A 1ZSYA 2O2SA 1QLHA 2JD2A 3EZYA 3JQ8B 4XCVA 4XYGA 3RASA 5B12A 2WWRA 1ZIDA 1WNTA 3Q1LA 1LLCA 2NVUA 1KETA 2WYWA 3KEOA 5A05A 5ILOA 3RUDA 1TA4A 2J5RA 3DEYX 4Q3CA 3ICCA 4D79A 1HTBA 1QYCA 4OJNA 3NT4A 4W7HA 2UUOA 4UVEA 4URFA 2PLAA 3D5TA 3GC6A 2EXXA 2G82A 2WMDA 2NQTA 5IDQA 3KLMX 4TVBA 1RKXA 1IY8A 1DIHA 1EK6A 1WPQA 1MXHA 1SOVA 1BVRA 1VL8A 2RIRA 1AXGA 2H9IA 2UUPA 1HSZA 1HDYA 1LX6A 3JD0A 4Y67A 4IY1A 2ZTLA 3RKRA 1DHTA 5AXCA 4XYEA 4UEJA 4CMIB 3JQ6A 3TFQA 5COBA 5JAZA 4Y98A 1FJHA 3TN7A 1UP6A 3W4KA 5B4VA 1H5QA 3SX2A 4M1QA 4ONEA 2IRWA 2EGHA 4BO9A 4R4JA 2J3KA 2Q2WA 4LN1A 1DXYA 3HWRA 3S2FA 1DC3A 1X7HA 4UVHA 3WMXA 3G1UA 5A5FA 2Z1MA 1C1DA 1P44A 1L7DA 4LVCA 1QYWA 2P5YA 3QV1A 4PVCA 3RAJA 3U4HA 3VH3A 3WQQA 3C7CB 4RPKA 3NYWA 5EJ2A 2OORA 3O38A 2NTNA 3RUHA 3A4VA 3A14A 2NV6A 1ZK1A 3PWZA 3WGTA 2NNLD 3WBFA 3IOYA 5JCJA 2Q49A 3K2EA 1K5HA 1ZK0A 3H8VA 4YA6A 3C7DB 5G0SA 4FFLA 4XEHA 3INGA 4YJGB 1KVRA 1NVGA 1P9LA 1P45A 4CM7A 2YZ7A 1BVUA 4C4OA 3PWSA 3KO8A 1MC4A 3DBRB 4XR4A 2Q4BA 3C7AA 1C0PA 3ZWOA 1I2BA 3VC7A 1HT0A 1WDLA 4UVDA 1PX0A 1QORA 4PG4A 4CLDA 4F46A 5CPFA 5LC1A 1XIVA 3QVOA 4WJZA 3ZCXA 2BFMA 3C3XA 3JQGB 4N5LA 2CD9A 2GNAA 1E1MA 2IZ0A 2O3TA 2YV2A 3BTUA 3TZQA 1ZH8A 2AW5A 2WD7A 4CV2A 3AUSA 4BNGA 1EBFA 3GRKA 2O4UX 3NUGA 3ZU2A 1GUYA 1BDBA 5IZCA 4NBUA 1T4BA 1ZXBA 2JJYA 3NAQA 1PL8A 1LSOA 3OIGA 4Z0HO 3SJUA 6ADHA 3RC7A 5L9AA 2Y67A 3OA0A 3GQVA 4NPCA 2C82A 4O5OA 1I36A 1Y8QA 2VHZA 2XF8A 5T67A 1A4IA 2FY8A 3AOGA 3C1OA 3B1FA 4M8SA 1CQIA 4GX5A 3K92A 4II2A 1CRWG 2O2YA 5THQA 4OMUA 5G2OA 3GDFA 4F6CA 1EE2A 4QECA 4LMRA 3UCXA 3W8DA 1NQTA 1IPEA 1PGOA 2BI7A 4GSKA 1HEUA 4K6CA 4Z0TA 5G4KA 3JQ8A 3NTOA 3IKTA 2ZQZA 4RPHA 2AEMA 4LVUA 1U4OA 1UH5A 2JHGA 2O3SA 3QVXA 4TRRA 1B14A 3W1VA 4B4WA 3PIIA 3OIDA 4NQZA 4YXFA 1AGNA 3BMNB 1G6KA 3AM3A 1R66A 1U3TA 5EINA 2D59A 1MFZA 2YDXA 2YDYA 5AVOA 3DZKA 4WLVA 2YUTA 2B4TO 1I0ZA 3T7CA 4B4OA 1U5AA 3HNPA 4GLLA 4L9RA 1N1EA 3O8QB 4DRYA 4ZHSA 4WLEA 5L4LA 1QP8A 3ZWPA 1BHSA 1X0VA 4D46A 3KETA 3ZHZA 4J91A 4ZQBA 1PZEA 1C0KA 3KV3O 4XB2A 3TOXA 4Q3EA 5DCYA 1WW8A 1F06A 3W4IA 3WYCA 2Z1NA 3H5NA 1YBAA 1GUZA 1NHWA 4CMIA 1XQ6A 3EK2A 1O94A 4NHEA 3AFMA 5I9MA 3TOZA 3H3FA 1P77A 3PRJA 1Z7BA 3JQBA 2NSDA 2V6GA 1GPJA 2DPHA 2HMWA 1XU9A 2Q45A 3TF5A 4Z3DA 4KWIA 4WLNA 2B5WA 2EEZA 4DTIA 4IDFA 4CODB 3ULKA 5T57A 4ITUA 1PJLA 5TC4A 5C3MA 5DCWA 1ZMTA 2GN9A 4M87A 4GMFA 1I32A 1Z7EA 1B2LA 3EYWA 1AUPA 4TQGA 3TL3A 1W6UA 2XAAA 4DPLA 5H83A 3NDRA 3PJGA 5JLAA 2V65A 2ZJ0A 4GQAA 5A06A 2DTDA 1YDWA 4CJXA 3DFUA 2Y1CA 4QFDA 5T8KA 1CYDA 1M6HA 1LA2A 3PVZA 2PZKA 4L73A 5G4LA 5L3ZA 4J1NA 3HUDA 2X6TA 3E9NA 2HQ1A 3DHYA 5AYVA 3B1KA 1GADO 1I2ZA 4YJGA 4XRRA 3RFVA 1K6XA 1IUKA 1B8PA 4J2HA 4GGPA 2NM0A 1Y8RB 1R0KA 3W4JA 2D1YA 4J4HA 2EP7A 3FNEA 4JLWA 3DBRA 3GGPA 1JKIA 1TT7A 2HMSA 3LF1A 5DP1A 1PJCA 3OJOA 5FEUA 4CPDA 3TNLA 4E2WA 1KC3A 2C7VA 4FCCA 7MDHA 1EVJA 5TQVA 1EUDA 2X58A 4FB5A 1WDMA 1EVIA 4PRKA 1K89A 3JQGA 1K6IA 4XGIA 3PJFA 4PG8A 5JNLA 1ZEMA 2YFQA 4AL4A 2J3JA 4P22A 1R16A 1ZK3A 3DBLB 5CP8A 1ZW1A 2FZWA 5IF3A 4L74A 2Q1TA 4ND5A 4R1NA 1JTVA 3PDUA 4IJVA 2DVMA 4QXMA 3GHYA 2POQX 3G79A 4KDEA 2QYSA 3RCBA 2HU2A 3JQFC 3KRTA 3BTVA 1OFGA 1U3WA 3JQ9A 4FD3A 3B1JA 5EESA 1AN9A 3VDQA 3TDKA 3DZBA 1GQ2A 3CXRA 3ASVA 4MP8A 4B4UA 1DRVA 4A27A 4ZU3A 1LC3A 1EUCA 1PEDA 1BXZA 4J1SA 3RROA 4CL3A 2GZ1A 2ZTMA 4ZQHA 1LQUA 3F3SA 4J7CA 3ANLA 3GVPA 4J16A 4OYRA 4RL6A 3QHAA 1U1IA 1YQDA 1BXKA 3ADOA 3QRWA 4RF5A 2ZK7A 4INAA 3KSDO 2I3GA 2OGUA 2AG5A 2BMAA 1QLJA 3I4CA 3PZBA 3R1IA 4I9UA 4ND3A 4FPXA 4RGBA 3BMNA 1PJTA 1ULUA 3JQ7B 3GLQA 3D3WA 1HYHA 1ENZA 4NH4A 2UYYA 1HDGO 4KUEA 5KVQA 3RU7A 5IJZA 2Y93A 1RJWA 2O3JA 4JP2A 1IZ0A 3O8QA 4D3FA 2Y1GA 3PI7A 3RVDA 1EUZA 2VOJA 3KM0A 3O26A 2ET6A 2HMVA 4YT2A 4Y8VA 2EG9A 4BNMA 3DZFA 1C0IA 1M76A 1K2WA 1O89A 3H6KA 3L07A 3M6IA 3PQFA 2ZTVA 3RD5A 1UR5A 2C2XA 4EBFA 2H6EA 1E3WB 4PLFA 4RZIA 5C7IO 2ZJ1A 1I8TA 4Y9DA 3GK3A 1A72A 4RVHA 2G17A 4GMGA 4BO0A 2FR0A 2J3HA 3KBOA 2BF7A 1UZMA 1CIVA 4TKMA 3DOCA 4XB1A 1PR9A 3FRJA 4H3VA 4PCVA 4GH5A 3VDRA 4L8VA 2VTEA 2YFHA 2B37A 5CEFA 1IZ9A 1B3BA 1EQ2A 2VYNA 4R69A 5TIIA 1JVSA 1E1LA 4AJEA 4MVJH 3DHNA 5DN9A 1RWBA 1LTHR 4AJHA 4CLEA 1XG5A 5ER9A 1UDBA 3ZU5A 4E0BA 4UUPA 1FDWA 2B69A 5JPIA 3WDSA 3EHEA 3PEFA 4YQYA 2V6BA 3OM9A 2PK3A 5AQ1A 4BKOA 1OBFO 1Y8RA 2P2SA 5MGBA 1A5ZA 4GKBA 1N5DA 2ZYGA 4PLCA 2PKQO 5F3RA 4E12A 3I9MA 3CZMA 3BMQB 3JYQA 4PLVA 4W82A 1PZFA 2SCUA 3QWAA 4J1QA 3EW7A 1T4DA 3ZNPA 1OOEA 2XXJA 4NR0A 3WWZA 2AE2A 1RM4A 5I8ZA 4PLWA 4F3YA 2GERA 1XWFA 3TWOA 1T25A 5I7VA 4MIOA 3WNQA 1A27A 2B4QA 4DA9A 3NTQA 3DBLA 3E6AA 2Y0CA 5T5QA 2RH8A 5L7TA 1WXDA 1W73A 3IIEA 4E4YA 1NYTA 3JCZA 5EPOA 2A9FA 2WE7A 1Z82A 4Z3KA 5I7EA 4E13A 4U6QA 5A02A 2GN6A 4N18A 5DZSA 3RI3A 1PGJA 4IDCA 4O1MA 1T1SA 3R3SA 3I6QA 4W7IA 1EVZA 3GG9A 2DPGA 4K6FA 3ZWMA 1UXKA 1PWXA 3DL2A 3GNSA 3NT2A 3RC1A 5ICMA 3VAZA 2GN8A 2BI8A 1UDCA 2PD4A 1YS4A 1HSOA 2O3UA 4RVGA 1MG5A 1PJ3A 5JDCC 4Z6KA 3OH8A 2NTVA 4XKJA 3SLKA 4ZQFA 3DXFA 4OSPA 2EW8A 1E7MA 1R0LA 5BSEA 1E1KA 5JAQA 1QRRA 1YOVB 2Y66A 4QQRA 1VPDA 3L77A 1P74A 2VHWA 3W8FA 5KVCA 1MXFA 2W98A 2ZB4A 3ZHBA 3N7UA 2DAPA 3OIFA 1H6CA 2I67A 3FBGA 1KYQA 2JFFA 2JCVA 4AJJA 4AVYA 4WEOA 5I7FA 2BH9A 1DJNA 5IDXA 4NIMA 4F45A 4KQWA 3H7AA 4M86A 3JQ7A 3WJAA 4WOJA 1XYGA 1E6EA 5JXWA 2Y1DA 3ZWCA 1NFFA 1H2HA 1ZMOA 5FI5A 4YAKA 1LNQA 2I9PA 3QWIA 3RFXA 1ZBQA 1XELA 1H0KA 2RH4A 4JIGA 3KYDB 4Z9YA 5A5EA 4JBIA 1YBMA 3F1LA 3L6DA 4IDGA 2CZCA 3F47A 1N7GA 1E3WA 3L4SO 5IN4A 4FGWA 5G0TA 2FZEA 2GLXA 1HDOA 4BNUA 5J23A 1E92A 1LSSA 1PJ4A 4ND4A 1TT5B 1OC2A 3VH2A 4M49A 1ZNQO 4ROSA 4AFNA 1SEVA 5JAMA 2CFCA 4J49A 2PGDA 3V5NA 1KY4A 1DAOA 1GV1A 1UZNA 5IXSA 2HMTA 3BZUA 4ALLA 3ITDA 4R68A 4E5MA 2ZYAA 3AI2A 3GMDA 2W2LD 2EHDA 5A04A 1T2CA 4XX0A 1PTJA 4JROA 3P7MA 4DQUA 4XQ9A 3ZV4A 4IDDA 2HJRA 4R01A 2HKIA 3F46A 2OP1A 2E37A 1YKFA 4I8XA 3W6ZA 3HHPA 2PV7A 5KJCA 2ZIZA 1XA0A 3H9QA 2DQ4A 4ZD6A 4FIZA 1CERA 4BO7A 3LT4A 1LXCA 3PLNA 3G17A 3RC2A 4R51A 1Q2XA 3ORFA 2Y0DA 4QEDA 4ZN6A 3BMQA 1LSUA 2OOSA 2FHSA 2X9GA 2WYUA 3WLFA 3GOHA 4Q39A 2ZB3A 4XQCA 5GY7A 1GZ3A 2DFVA 4A26A 1GUFA 2XXBA 4J4BA 3LC2O 1DPGA 4IS2A 4HFMA 2X86A 2VHXA 3FSRA 4W9NC 1A9ZA 2BFAA 4E5KA 5JY1A 2FR1A 3GDGA 3TZHA 3HB4X 1RYEA 1N1GA 2DUWA 2QQ5A 4FFMA 3VTZA 1Y9EA 3NJ8A 5GZ6A 3UF0A 5ENVA 1P1HA 4C7JA 3RUFA 5F1OA 3TZKA 4H7PA 1GV0A 3CEAA 1U9JA 5BR7A 1Z73A 3WBBA 3GGOA 4P4LA 4XGKA 1K0UA 3GY0A 1EVYA 4PLYA 4R54A 1QV7A 3LSYA 1XQ1A 3GEDA 2C2YA 5A03A 4KUGA 4TRNA 1YL6A 1IULA 5B4TA 3GMSA 3WYBA 4BNXA 1NASA 1ISHA 3E8XA 5KIAA 2D5CA 1PZHA 3GN1A 3DAGA 1XEAA 4HFJA 2OBNA 4IQ8A 3ZN2A 8LDHA 4PLZA 3DZIA 2DC1A 2JD0A 4WOKA 4LSWA 3AUTA 1I33A 1VKNA 3AW9A 4QO8A 4LW8A 3HJAA 2P9CA 5HM8A 2HK7A 1DB3A 1YVEI 3JV7A 3W8EA 4PIVA 3NDJA 1M66A 4CM8B 3U49A 1HE3A 4HADA 4IXTA 2B4RO 5CEEA 3ENKA 3ONEA 4RO0A 1G0NA 1WLYA 2Y99A 3ZWXA 2H5LA 3LT2A 3KYDA 2GR9A 4D3SA 1H9BA 2O7QA 3OQBA 2HLPA 2F1KA 2W8ZA 3JSAA 5TS3A 3O9ZA 4CM9D 4DPKA 3I6IA 1WMBA 4BNNA 4R41A 2ZYDA 4UUMA 2NU8A 2IDZA 4WKGA 4PFJA 1MFPA 4YT4A 3WSVA 4CM4B 3CTMA 1LRLA 3D3EA 3IJRA 1IYZA 3KB6A 1TT5A 4U8GA 3OJEA 4JJGA 4E5YA 2G1UA 5TGDA 1NP3A 2W2KB 1FK8A 3D64A 3BIOA 3L6EA 1O95A 3ZNOA 1ARZA 3GVHA 5KJ6A 4BNLA 1FDVA 4N5MA 1J6UA 5TRTA 1EE9A 3P5SA 1H94A 3OICA 4KP7A 4U7WA 4MVJP 4RPJA 2UDPA 3GAZA 4I9HA 4WEQA 2VYVD 3WR5A 4HKTA 5F5NA 3DBHB 4BO1A 1TVEA 4FSHA 1PWZA 4ND1A 1P1FA 3ROKA 5CDGA 3ZDFA 4BO3A 2JFGA 4AJNA 1VKOA 1XLTA 3LDHA 4ALIA 4E5NA 2BRUA 1GFSA 4AG3A 1ZFNA 1A71A 4R1SA 3FPCA 1E5LA 5AXBA 5B37A 5A4DA 4MVJF 3K30A 3MJEA 4CMEC 2C5EA 2Q2VA 4DIBA 1GYQA 3H9GA 3QLJA 4H15A 1W8DA 5JW6A 4QSMA 3OJ0A 1OZAA 2PH3A 3ZZNA 4TVOA 3WGOA 4RDHA 3UOGA 1RM0A 2X7HA 2BFPA 3F4BA 3V2UA 3KSUA 2JCYA 4BMVA 2HRZA 1L1FA 4HV4A 4I5DA 4ZGWA 3PGJA 4YEDA 5DF1A 1X15A 3UAGA 4TKLA 1WDKA 4LCJA 2I66A 1LLUA 3R3JA 1RM5A 1YB5A 2W2LA 7ADHA 3FNHA 2VHYA 3LLVA 5LCXA 1HL3A 2P9GA 4D3DA 1OMOA 4DBZA 5JMWA 3WGHA 4FN4A 4NJMB 4D0SA 5C37A 3D4OA 2VUTA 3E18A 4QFCA 1KBZA 4TZKA 4UEKA 1F12A 4IMRA 5TT1A 2CDBA 1P1IA 1J4AA 1I3NA 1Q0LA 3WQSB 3VZSA 3D7LA 4BNZA 3TFOA 1GY8A 4DPMA 3JQEA 5KJFA 1ISGA 1FDTA 4FC7A 4CV3A 1WWKA 2A4KA 2GD1O 1XSEA 2OZPA 4XWYA 5DBGA 5TNXA 3KSZO 2QRJA 4EEXA 1NR7A 4RF2A 5L7YA 1ZK2A 2VQ3A 2ZB7A 3NRCA 1JW9B 3Q2IA 3U5TA 4CMKA 5HA5A 3SBOA 4EJ0A 3VZPA 3PYMA 1VJ1A 3FNGA 3S2IA 1ADGA 5ENDA 2BKAA 2AQ8A 1NWHA 1E7QA 2QIOA 2E4AA 2EJWA 3FPLA 3QJ5A 4J4TA 3PDJA 4CM8A 4UEOA 1L7EA 1NXQA 1U2GA 1MC5A 3HFSA 3ZU3A 4W6ZA 3GT0A 2A92A 2YY7A 4HWKA 4UULA 2P68A 3MJ4A 2NADA 1IL0A 1RM3A 5IDYA 3AFNA 5TT0A 2VCYA 1O9BA 2VYND 2GCGA 5G0UA 4CM4A 1UDAA 2VRCD 4OIMA 3PFFA 3GPDG 4HX5A 1WZIA 1YB1A 4BNIA 2O48X 1PJ2A 4BIIA 1YDEA 4B7XA 3I83A 1HF3A 5CFZA 4IUYA 1DFGA 5FF9A 2AMFA 1DC5A 4IQGA 2W2KA 2PD3A 4RLHA 3P19A 5KTKA 3ZV6A 2HJSA 3OEWA 1NWCA 1UUFA 5THKA 3L0DA 3QQPA 3F4LA 4XIJA 1E7RA 3ANMA 4YTEA 4FGSA 4RF3A 1LQTA 5ITWA 3WYEA 1KOLA 1ONOA 5L95A 4XA8A 2D0IA 3HDHA 3DBHA 3FR8A 5CEJA 3RKUA 3TJRA 3F5SA 3KLPX 3AM5A 2D4AA 2GF2A 3ZWVA 1D1TA 2EJVA 2R00C 1UAGA 3HB5X 1LI4A 3LT0A 4IPTA 2FP4A 3V1YA 1PL7A 1HRDA 1W4ZA 1ZKMA 1FMCA 5C5IA 2IEDA 2VWHA 2VOEA 2O7SA 1AXEA 3DMTC 3D4PA 3KUXA 4YJFB 3ST7A 3ZGYA 3E9MA 3FWZA 5MDHA 1SZJG 1HLDA 4ZRNA 4IM7A 4GX0A 4JX8A 4U5QA 2DBVO 4FJ1A 4CM9A 4O0LA 1DJQA 1I3MA 4FQ8A 3K9QO 2OO5A 4E6PA 3V1TC 3JQFA 4ALMA 3C1TA 4EW6A 4IGFA 1TI7A 2G76A 1NFRA 3AI1A 1R12A 4XD2A 1F0YA 3ROPA 1BTOA 1YONA 1U8XX 3UCEA 3BMCB 2Q1SA 4KUHA 5ILGA 4PZDA 3AY6A 3CE6A 3IUPA 4RVSA 1ZXLA 1VI2A 4GWGA 1ISFA 2X9VA 1T2DA 3GN2A 3OP4A 3ZI0A 5L51A 5KCZA 3X2EA 1R15A 4BQRA 3RUIA 4WLFA 3WGQA 4WECA 4R9RA 4PRLA 5IDWA 1KEPA 2CDAA 4NJMA 1YXMA 2VYVA 1ADFA 1JQBA 5JFOA 3Q0EA 3NGLA 2RHCA 2BLLA 1D1SA 2X5JO 4JQCA 3EZLA 3LU1A 2C29D 3NKLA 1BSVA 4AJ1A 4J1TA 3BHIA 3K8ZA 1P33A 3EVNA 4BO2A 1PQUA 4PLTA 1HDRA 2EV9A 3PWKA 4RVDA 4GAEA 1VSVA 5DDIP 4AJKA 3QWBA 3WS7A 2PKRA 2RAFA 3P2OA 2PD6A 2DU8A 4BQPA 4Q3NA 3V2HA 1P1JA 5EIOA 1OC4A 1P0CA 1WAMA 2P9EA 4NFYA 2E48A 2OUIA 1SBYA 4NBWA 4OGWA 2DLDA 4HNGA 4GWKA 4A5OA 1E3SA 2NVBA 4FW8A 5A1TA 1SB8A 2UV8A 4IQ0A 5IG2A 4KDFA 3GF4A 5HWSA 3FF4A 4JBHA 5IN5A 3SEFA 3CIFA 4IS3A 2GPTA 4OH1A 1MLDA 2B5VA 3DQPA 1BWSA 1M75A 4ND2A 4GVXA 3TQHA 3K31A 3VHRA 5C7OO 2IZZA 3H9JA 2EW2A 3VVBA 4S1VA 3NGXA 2YHUA 5DBFA 1ULSA 4RQTA 1SMKA 5L45A 1Q1NA 3KHUA 1NQ5A 5B4UA 4CUJA 4YRAA 1ORRA 3Q9NA 3DZJA 2WM3A 4CLXA 5TJ9A 1I5RA 3E5RA 4EUFA 4GI2A 2ZB8A 1XGKA 2GDZA 4DC0A 3NDIA 3MWEB 5I8WA 4FOOA 4CV1A 3OJLA 2ZATA 1IOLA 4BNFA 2W4QA 4CLOB 4DXHA 5JYDA 1I2CA 2VT2A 5I9NA 2OMEA 3VPFA 1ZSNA 2G5CA 5K9ZA 3QVTA 5IFLA 3DZHA 3OSUA 3A1NA 4UVGA 3MTGA 4OXYA 4RVFA 3RBXA 5HTOA 1D7OA 4LCEA 4EUHA 1P3DA 4HY3A 4XQGA 1C3VA 4Q3AA 1CEQA 2ZTUA 4BNYA 4BV8A 2BHLA 1UXGA 2YHIB 3WICA 9LDBA 4BKQA 3VZRA 1C1XB 4DUPA 1JWBB 2PH5A 4YJFA 3ZW9A 4F6LA 2Q1WA 5KKAA 5IAAA 3ASUA 2GRAA 2DM6A 2JAPA 4WNCA 1D8AA 3GVCA 1CQJA 2AEFA 4GKVA 1YJ8A 2NLOA 4TRMA 3I1JA 4WUVA 4ZQGA 3VKVA 4BNKA 3EUWA 5L40A 1ZEJA 1CETA 1YBVA 1T2FA 2WEKA 3UICA 4ZJUA 3PHGA 3UH1A 1BW9B 2VRCA 3Q11A 3KVOA 3DB2A 4CMGA 2R6JA 4RVUA 3UFXA 5JDCA 4AICA 2QZZA 5HRUA 3HQ4O 3PYLA 3IJPA 4UUNA 3U09A 2CVOA 3JYPA 4CQLB 3RUCA 1PS8A 4WNIA 3WGZA 1R4NB 1JKJA 2NU7A 5K6AC 1C14A 1YE3A 2X0JA 3RJ5A 4CM5A 1DHRA 5GZ1A 4OL9A 3U4DA 3INTA 3RJ9A 2B36A 2Y0EA 3F6YA 3GVXA 4A10A 2X1HA 3GRPA 4BB5A 1O5IA 3ZHXA 5DP2A 8ADHA 1LDYA 1LDBA 1LRKA 4K9DA 4XYMA 2FOIA 4YT8A 2YQ4A 3I52A 4YAGA 4I5GA 3EY4A 4PVDA 3MCVA 5COAA 5AXAA 3A9WA 2EGGA 3SJ7A 5BNFA 3IAHA 2EKPA 2X4GA 4N54A 3I9OA 1SNYA 1EBUA 2G0TA 4OKIA 3AU8A 3K73O 1MX3A 3H3JA 4DQVA 1U28A 3IMFA 2VT3A 3KYCB 5BNIA 1DC6A 3JYOA 3L9WA 2C54A 3WSWA 3WGIA 3WTCA 1KVTA 1XDWA 3B70A 1PU2A 1NVTA 3ONFA 1H6AA 5CG1A 2NACA 4NG5A 4Y6SA 4YAIA 1VLLA 1WZEA 2IXAA 4E21A 1ISJA 2QX7A 4OHUA 1PSDA 3QVSA 1GDHA 2ILTA 3CMCO 1O6ZA 1E5QA 4J43A 4R5HA 5EMHA 4YWJA 3ZNNA 2Q4EA 1HXHA 5F1KA 3ON5A 4E31A 3ZWWA 3IDSA 1S6YA 3U3XA 3VH1A 1R37A 2HSDA 1UJMA 3EC7A 3JQDA 4A03A 3QIVA 4YPOA 5BNTA 1HE4A 4GSLA 1VJ0A 1Y5RA 1C0LA 4B7UA 3A28A 1Y6JA 3JYNA 2Y05A 5JMPA 3GZNB 1LC0A 3FN4A 3LC1O 3IKVA 2HAEA 2AEJA 3C24A 4CLOA 4QTZA 4DLBA 3D1LA 4XQEA 3WX0A 4CUZA 1X13A 4ESOA 3JQAB 5EQFA 2BGLA 1FDSA 3VPGA 3AJRA 4YB8A 3QP9A 1QSGA 3ENNA 4WLUA 4ALKA 3CINA 5F5LA 2AA3A 5COQA 1BXGB 4MVJI 1EDZA 5ITVA 1F14A 2YHIA 3HE3A 2X5OA 2XOXA 4W9NA 1P0FA 3GFBA 3LT1A 1ISIA 4HFNA 4J9UE 3E82A 3K96A 1C1XA 4LRTB 4OQYA 1PR3A 1XCBA 2E6UX 1R6DA 4OM8A 2FPIA 2J3IA 2ZCVA 5DCUA 5G0VA 3Q9UA 3OQ1A 1KC1A 4HNHA 4IDEA 4L4XA 4U6SA 3DMYA 1LLDA 3H65A 3M1LA 4GLOA 4R1TA 3U0BA 4AJPA 1DIGA 4EJMA 4WK6A 4P4NA 1BW9A 4BMSA 2AG8A 3RU9A 2C20A 2XPCA 2ZCUA 4B8WA 3OBBA 4MO2A 3GEMA 1WP4A 4KWHA 4DMMA 4C7KA 3K6JA 1DFIA 4FJ0A 2J5KA 4EITA 1PJSA 3QW2A 2X0NA 4CMAA 4EEZA 5L53A 4CQLA 4EZBA 4QO7A 4WLOA 1U7HA 4WCFC 4E3ZA 2DTXA 4J90A 1R4NA 2QRLA 2IZ1A 1TEHA 2PGJA 5FFFA 5DBIA 2O23A 2FMUA 3OJFA 4Z9XA 5JSFA 4UUOA 4BGUA 2X23A 3VPSA 4W4TA 3UKOA 3WGGA 4R1UA 4BKUA 4KOAA 4MVJD 3DONA 3DC2A 3IUSA 3CSDA 5IXYA 2Y1OA 4MIYA 2HUNA 5A3JA 1FF9A 3COSA 3FWNA 4U0KA 3LC7O 4XYBA 3MWDB 4JNKA 3E1KA 4MJLA 3MJSA 3MOGA 3QVWA 2D8AA 4J7UA 3HADA 4A73A 4JP3A 3H2SA 3SVTA 4BNJA 3H2ZA 4CMHA 1EEHA 4TSKA 4OOEA 3KYCA 4O6VA 3BTOA 3OECA 3HN2A 5IZ4A 3CZRA 3BXXA 3GH3A 4HXYA 5CG2A 1PIWA 1EZ4A 3LLSA 4WPGA 5JY6A 3SC6A 1NAHA 4NI5A 4QT0A 1M6WA 4WASA 2EP5A 2J6IA 2FSVA 3RBVA 1YOVA 4A2CA 4KMSA 2E82A 2C5AA 2PGLA 4I9NA 1NFQA 1HDCA 3X2FA 4PN3A 3I23A 1I10A 1U3UA 2GUGA 3JD1A 4BNVA 5DOZA 3OMLA 4RPLA 2AQIA 4MVJG 1WVGA 3FR7A 4HP8A 3ADPA 1ADCA 2CF5A 1B26A 3LK7A 3U9LA 1JWAB 3I9LA 4NDNE 4E2YA 1N9GB 3DWFA 4OQZA 5AOVA 1IPFA 5JC8A 3L6OO 5BSFA 3EMKA 2I6TA 2C07A 1Z75A 3JD2A 2P4QA 1UP7A 3B20A 4LMPA 3RFTA 3UW3A 2WD7B 4CMEA 4BUCA 1BGVA 3JQAA 4E30A 1EK5A 2YQ5A 3JD3A 1SPXA 3I9KA 3PK0A 1F17A 3HDJA 3C85A 1YL7A 2VUUA 1I01A 2GZ2A 3P2YA 2CSUA 2WDZA 3PQEA 5JE8A 1Q7BA 1BXGA 4CL8A 3I9JA 3LVFO 3GNTA 2OP0A 1UAYA 4NMHA 3DOJA 2Y1EA 2Y68A 2YJZA 4AJLA 3TPCA 1U4SA 3CKYA 3JD4A 2OFPA 4RPGA 3DBVO 3U4IA 1DC4A 5CDUA 1X1TA 4CMCA 1ZJZA 4MIEA 2UVDA 5AXDA 1K6JA 3E03A 3FNFA 3WLEA 4E33A 2JKVA 2X8LA 4ILKA 2AXQA 1QYDA 3KTDA 3L9XA 3IP3A 3MTJA 4GX2A 2CF6A 3UVEA 5KVVA 3WG9A 1VM6A 1HZZA 4WGGA 4FBGA 2OBYA 4FS3A 4P4GA 4EI2A 3SC4A 1VC2A 2LDBA 1HDZA 4R3WA 5JDIC 1BRMA 3GNQA 3HG7A 4MPDA 4ZA2A 5KNLA 4XDZA 2CY0A 4IDAA 1RYDA 2PKQP 2AQHA 2BGKA 4EYEA 1GCUA 3KYBA 1J49A 1BDMA 2Z5LA 1U8FO 1B7GO 4OAQA 4DIOA 1UZLA 3RSHA 1LRJA 2O3QA 1GPDG 2JD1A 1LDNA 1MA0A 2GO1A 3VOSA 4CLHA 1E77A 5L4NA 4E2ZA 1IHXA 1H6DA 3IC5A 2EERA 5DT9A 3G3EA 4Y6RA 4YT5A 1CWUA 4G2NA 4KQXA 5JAIA 3PTZA 1OAAA 1JN0A 3AM4A 4UVIA 5ICSA 3V8BA 3L4BC 3IL2A 2CMDA 3FI9A 3FTNA 1YQGA 1V6AA 3ZWYA 4RQUA 2BFOA 3NEPX 2X22A 4G65A 2IYOA 3PJEA 4UREA 3AOEC 3S2EA 3K2BA 1D4FA 2IE0A 1Z74A 4ZVVA 4B7CA 3ZNQA 1EMDA 2EWMA 3WFIA 3GA0A 4YR9A 4YJHB 1X0XA 1HDXA 4IZIA 3VH4A 1AHIA 4BVAA 4L0QA 4UAGA 2HCTA 3QA9A 4LISA 4RCVA 3RBZA 2IXBA 2X9NA 1V9LA 1GL3A 2NTJA 4NU5A 4LGVA 5CHEA 4PLHA 5C7LO 4KTVE 3BA1A 3ZV3A 1JLLA 1DIBA 1LBEA 1DRWA 1KEVA 1MV8A 1ZCJA 3R6DA 4J0EA 3BMOB 5U4QA 4NK5A 1R0SA 3GUCA 4Z0PA 3UHAA 2H63A 4FDAA 3MZ0A 4XGNA 1H9AA 4AJOA 1GQYA 1Z6ZA 1BG6A 4E32A 2HK8A 5A9SB 1Y1PA 1N92A 3V2GA 2I5PO 1UXHA 1ENPA 3BHMA 1ZJYA 1GTMA 2A35A 3DTYA 4J3FA 2HDHA 1SCUA 1W0CA 1P1KA 2OL4A 4AJ4A 2R00A 4YRBA 1GR0A 3AK4A 1N9GA 5EQDA 1UP4A 2JCXA 4MVJA 1NPTO 4OXNA 1I24A 2P91A 1DBVO 3UN1A 1VL0A 1LJ8A 2GASA 2V7PA 5CDSA 2J8ZA 1KIFA 1N7HA 2VRBA 2PTGA 2VWQA 3DMTA 2WJPA 4XIYA 3RWBA 4B3IA 1YH3A 3HSKA 2X0IA 3TZ6A 3SLGA 3LQFA 4HBGA 3WMWA 4TZTA 1E3IA 1DLIA 4RV9A 3QSGA 3WJ7A 4DQXA 4Q9NA 3K5PA 5JO0A 4YAJA 4FR5A 4L76A 1CDOA 4BB6A 4CMJA 3V1UA 1PJQA 4TROA 1QG6A 2ZQYA 4PLPA 2EF1A 4BL5A 4PZEA 3T4XA 2VZ8A 2VNAA 4CR7A 4BS9A 1M67A 2NVWA
chains in the Genus database with same CATH superfamily
3PHJA 3B2QA 3LQRA 5CAEB 3KCNA 1OLOA 1BN7A 1U90A 4ARZB 4CT5A 1JA0A 4ZAYA 4B40A 2BKVA 2JATA 1S9HA 1O5OA 2QU8A 3AILA 1CU1A 4WZAB 2CB9A 2RHRA 2NU9B 1IXZA 1OJ7A 4OM7A 4C6SA 2QRKA 1M1XB 3X1MA 4GOJA 4FCTA 2BH2A 1X74A 2XIJA 1P6QA 1PJAA 4PQFA 4U3JA 3WNCA 1S2MA 3I6ZA 5GONF 4J2OA 3HXTA 3L8CA 4MGKR 4WA8A 4F5WA 1KVUA 1X1QA 3AF4A 4HFRA 1DUVG 1V35A 2LDXA 1S3IA 2Q5JA 2BY4A 2YMPA 2VAVA 1Q7GA 3AX6A 3GDOA 2IX9A 1KEWA 3BERA 2ZJ8A 1JA9A 1P0QA 4KX3A 4TMKA 2OXIA 5JDIA 2I76A 1A7AA 5BSUA 1MC1A 3JX9A 3KKZA 4RYDA 2HR1A 1Y3BE 4G1MB 2I2BA 2HQRA 1NM5A 2FRDA 3OOYA 3ZV7A 4RULA 4MVJM 5A4MS 3MTEA 1IOVA 2WSBA 3X3HA 2RJ3A 5GPBA 2P2LA 1IPHA 3IBCA 4LRSB 5KSZA 3M4XA 3EVTA 3PLRA 4ZT2A 2CMKA 5A6VA 3HRIA 1F8FA 3PCXA 4H16A 4KIUA 4NZ9A 2OCKA 4XFKA 3BIJA 4ARBA 1X7GA 1VBMA 2AZXA 3AETB 2QUBA 4FJ2A 3D59A 3UKJA 1WMAA 4V0SA 2YVQA 3PXCX 4G23A 3LPLA 4NCKA 4ESHA 3PYXA 2BELA 4KV7A 3GG2A 4IH1A 2OHJA 2E55A 1W85A 4B6OA 3JASB 4QU5A 4RJ2A 1XVTA 1CJVC 4HUJA 2GTHA 6LDHA 4UFPA 2IUFA 4PG7A 1IXKA 4W1QA 4PYKA 5KINB 3I5MA 3R75A 4HUTA 4I2NA 4D99A 2W2QA 4OLFA 1UL1X 4RXUA 3V3KA 3MQ4A 4WZBE 5EN4A 2NAFA 4TOIA 2PR2A 5AM4A 3MWYW 2ZULA 3P45A 4B9EA 4V24A 1JQ3A 3HK2A 1RABA 4RHUA 4PYQA 2CT8A 4YQZA 1RXEA 2V7TA 1B8VA 1KMNA 2RGUA 4BC0A 1Q0QA 2J9RA 1YR1A 3PDIA 1Q7CA 3W7AA 3DP7A 4P36A 4RZHA 5JSYA 5JSHA 3PFWO 4YRPA 4JI1B 4BC1A 1XZEA 1KI1A 3F67A 2OV8A 3HY4A 4G4GA 5CNKA 2B34A 2IF0A 1P31A 4L3OA 2D4HA 4BMDA 2I2AA 3P20A 3PUIA 2CJPA 4HUQA 2H31A 4L5IA 2CE2X 2A9OA 3I58A 3BYZA 5CT6A 5BN1A 1GR1A 5EIBD 4LF5B 1AX9A 4JGIA 4J9VA 4OHYA 2IEBA 3D4NA 2HHCA 2JAHA 1T3SA 1ZM2A 1FRFS 4HQKA 2O59A 4P3PA 1Q1ZA 1UOQA 2H18A 3H0CA 1ZSVA 4QAJA 4X8HA 5F64A 3E22B 3VZCA 4DUYB 4KIJA 1XF9A 1FPMA 3LXXA 2GARA 3NH6A 4Q9HA 1Z5NA 4LA4A 1Y8CA 3V1LA 4N5DA 1GEGA 3PFGA 4ZOLF 1I9CA 1JHOA 4CCYA 4DCJA 5B1YA 2VTVA 3IEUA 4W1RA 5KYTA 3EGOA 4K26A 4PGFA 4HVAA 4MEJA 1MO2A 3AYZB 3RYFA 4CV0A 1FNNA 2F9LA 1H1LB 2HXGA 4I55B 4PF1A 4UASA 3ZZ1A 4C7MA 1NX6A 3CMMA 1OWOA 2O8BB 2WI8A 4LY3A 1DO0A 4B17A 4B1FA 3M1AA 3NWOA 4Q15A 3UA3A 1T2AA 2GK3A 3EOZA 4J94A 1OH8A 4MRSA 1THZA 3RJZA 3ZY2A 4DG5A 4AKTA 3OQHA 1JDNA 2BKUA 3JRNA 4OHFA 1QHHA 1YCHA 4MKZA 2AMYA 4XH9B 1S7CA 5DT2A 2AS0A 3QI2A 1IOZA 3K8QA 5DO9A 3TW8A 5CA1B 3O4HA 1Y7TA 1GPUA 3C98A 3GT3A 2JC3A 1XZKA 5U1PA 3PHIA 1TKRA 2FG6C 5DHRA 1N6PA 3CS3A 3MWLA 4OBEA 1HT1E 1YQXA 1JAXA 1AHHA 2HGSA 2QU7A 4IJMA 2BDEA 1FS6A 3LI2A 4L3VA 4CM1A 5JXJA 1DG3A 2XDQA 2M32A 2PTHA 4FFPA 5CAEA 3DJYA 4YDSA 4ARZA 4JP5A 1LLQA 5K6AA 1HE8B 4B44A 4BQOA 5KKCA 2IH5A 3PX7A 4LI3X 3IBSA 3NBFA 4WZAA 2VWPA 1J8DA 2NU9A 2Q46A 4ID3A 4O2RA 3BTSA 4TQAA 1BX1A 2C8LA 2D2IA 2V03A 3DP9A 2ODPA 2YTZA 3OZBA 3CCFA 4NU6A 2FE4A 4TMZA 1A7KA 3V97A 3WLPA 4DNFA 2ZSDA 3R24A 4MDHA 3D0QA 4QYWA 3DPUA 5CB6A 1RJEA 2ZWMA 3OCZA 4HMPA 1ZITA 3RTDA 5JRJA 2RHDA 2ZRHA 4QYTA 5TJHA 1NQOA 2X3YA 1KHTA 1AK2A 1YF3A 5BRAA 3IGFA 3L7MA 3R7DA 3B6EA 1USWA 1FBTA 3LIPA 3MWGA 2V9PA 1Y34E 3WFZA 2B1GA 5JFGA 4N6OA 4YX9A 2NUAB 2A67A 4KN9S 1MZVA 4RAQA 3GFGA 4CMBA 2DGDA 5BV2P 1Z6YA 5LU9A 1HA3A 4F8JA 3MLAA 4IV0A 3T3PB 3BKWA 4LQ4A 1GTZA 3B3QA 1GUAA 2YV1A 3I4LA 4ALNA 3AETA 1W36B 1X3SA 2KM1A 2A0XA 3GT4A 1UXIA 3PSHA 4NHOA 4XVRA 4BLRA 1C7FA 3H8WA 4HJRA 3LHKA 4FT2A 3BMCA 3JQ9C 4XE5A 3P2IA 4IICA 1SC6A 2WIKA 3FJOA 2GXUA 4HB0A 2DE0X 4Q9JA 1BCRB 1YR3A 1CJCA 5EGNA 3JASA 3OMXA 1K68A 4XVQA 4U7HA 5F3WB 3TW0A 1I1QB 4MGHA 4HWOA 1KP3A 3GBVA 5CGQB 3RRMA 4QEZA 5F4BA 4YRLA 4XUGB 4FONA 2R86A 2IY9A 3EDOA 2F9FA 3IYLW 4HXGA 2W5UA 3HWSA 4P9NA 1V7CA 4XX0B 4KFTA 1B0UA 1YRLA 5J5AA 1NNEA 4POAA 3DFFA 4MK4A 1PR0A 2FPGB 2JEYA 4Q3BA 3BCHA 1XCJA 3OETA 3P0HA 4BKPA 1G2QA 3UJDA 1Y5MA 2QE7A 5EHIA 1GUBA 1FQKA 1Q0HA 1E18A 1WLSA 2WVAA 3LMKA 3RSOA 1XYYA 1EFRD 5KSWB 4JR1A 1KZ1A 4NSNA 4X1IB 3WGYA 2J85A 3UT6A 4YUZA 3QWHA 3OQVA 1U5CA 1X3LA 1T24A 2X0KA 4PHCA 4DTCA 4GX1A 2MYNA 4D7AA 2F7SA 1T5IA 3TTXA 4C5BA 2RHLA 2Z95A 3M8KA 4ZZ1A 4R5MA 4LJYA 5IPFA 1VGVA 1XLWA 2AKAB 1ZMBA 4OQXA 4DYDA 2PRJA 3FHLA 4EG7A 3E5MA 3TYXA 1QYXA 1P7ZA 2ORYA 2PFGA 3WAJA 4RMHA 1Y1KE 1XAGA 3E22A 4RA9B 1PJRA 2DT5A 5J4KA 1PTKA 5EPUA 1L8QA 3U7GA 5D7BA 1ADYA 1T9BA 2V6FA 4ADSG 4EFNA 3A6EA 5LVAA 3Q7TA 5T3YA 4B0PA 4CIXA 4Z4GA 3ZBUA 4UNSA 3VNVA 1H1LA 3AVPA 2PRYA 5BQPA 1TZ2A 1NOKA 3INRA 1OZHA 1L8OA 4DBVO 5TQ2B 3S81A 2O8BA 1GM5A 1YCGA 3JZMA 1MG0A 3DS8A 3KAQA 4LZOA 1JHYA 2RKOA 3MUNA 1GYPA 3NQ41 1KFKB 1TA9A 4YYZA 1WIWA 1S2NA 3QLTA 2PT5A 1RVDA 1IRIA 1EFLA 1PV1A 3EDMA 5JQWA 5CA1A 2G3YA 2KX7A 3M2TA 1M8KA 3BK2A 1GZ4A 3FSGA 1DAIA 1KMCA 1W1WA 4NTZA 1PKXA 3HZRA 4GHWA 4TTVA 1SUDA 3R09A 4J6EA 3HO8A 3UMVA 3T7TA 3AR8A 1BKSB 1AXRA 2DWQA 1NG1A 4B87A 2HWXA 5D1HA 3BRWA 1LJLA 2ZXFA 4H6WA 4DA8A 3KWFA 1NQAO 4OU5A 4YY3B 3BGIA 3OEYA 2CFOA 1JKFA 2QJRA 1NXOA 2VBGA 3QKWA 2FN8A 3FVVA 4W1SA 1PGQA 2F00A 4C3OB 1XFAA 4OHZA 3C43A 2PT7A 4ENSA 3AVWA 4H7HA 1YAJA 4BHTA 4H9GA 5SY9A 2RH5A 3IPAA 4ZCRA 4DYVA 4EQZA 2HSGA 1JVBA 2A5FA 3N74A 4YRJA 1AKMA 3B6ZA 1XP8A 2Q2QA 2ZWIA 5A3VA 5HKKD 4OGKA 1T2EA 3KUKA 2NYAA 2G9RA 1Q2UA 3OHSX 4CLRB 3WFJA 4JXJA 1Y1TA 2YXLA 3OFVA 4G63A 2I65A 2NUAA 3VKUA 9MHTA 4PGGA 3PIDA 1YRBA 1PL0A 3R6GA 2R85A 1E6UA 1E9RA 3PQDA 4HDMB 1CUXA 2AG1A 1JDPA 1JV2B 3R8CA 2AB0A 4AMUA 2GCNA 1W0KD 1GRRA 1WV1A 5AJHA 4DLAA 5BOSB 1ONPA 2B2XA 2XGGA 5SY4A 3L8YA 1DAPA 1SO8A 2NYRA 2D6FA 4M1WA 2P3SA 2APJA 5FHQA 4GYKA 1UK8A 2NU8B 3FNBA 1ORIA 5JYEA 1TMGE 1JEQB 1TW2A 4K8OA 4NBTA 3WWDA 2Q7XA 1TVMA 3GUYA 4Q4HB 1JHXA 3RE1A 4D4LA 3EPRA 4YJ2F 4MS4B 4D0RA 5KTPA 3H4VA 2Q5CA 4P8RA 5JCJD 3SI7A 2NVUB 1RWNA 3ZDQA 4LDRA 5AW4A 1HKUA 1BCRA 3DXXA 1UBUS 3JAWB 3RRXA 4RJTA 4XVUA 1V8OA 4HH3C 4C0AC 2VNSA 1X2BA 4JN6B 1Y80A 1Q0SA 4Z9AA 3WYDA 4HAZA 1G0OA 4F9TA 5BQ3A 3OIUA 3FRHA 2J7PA 5IWCA 4WN9B 4KLAA 3FBTA 1HYEA 4OJTA 2AJBA 1PGPA 2G9ZA 2RAPA 3LUGA 4O2AF 4BP9A 2H9YA 3A1UA 1H2FA 3LYLA 4Y2HA 4YDRA 4UJ3A 4KU4A 2AE1A 4GW3A 4MINA 2HRQA 1A9RA 5KSYA 1VJTA 2HO5A 4DREA 4AXBA 5C1PA 1J7JA 2FPGA 4KTTE 3SS7X 4BO6A 3FA2A 5JATA 3VYRB 4I08A 5J58A 3CB2A 1A4RA 4X64B 2GRJA 2PPVA 2V4UA 4PBRA 4YRGA 4ZIRA 4LKRA 3DAPA 1FQJA 4FBLA 3F3YA 4LNHA 1JR3A 2V6JA 4X1IA 5DHFA 4BEWA 1YB6A 5ADUS 2VS1A 1VHTA 2PRZA 3KU4A 1JDBC 1GQQA 1PFGA 5CLLA 4DANA 4ETNA 3LQ4A 3C3DA 4JGBA 1JMKC 4NY1A 4TL7A 3UUWA 2N1MA 4BGEA 4NCXA 2UZ4A 4Y9TA 5AW8A 4EPRA 1JGTA 5DOVA 1ML4A 1TNDA 1C1DB 1RQ2A 2E4YA 4JK3A 3WNVA 3C3CA 2WMNB 3AUUA 3HYRA 1KERA 3BKXA 1XHLA 3NC0C 4PX2A 2BP7B 5EGSA 4ZICA 4RA9A 3OM8A 3EG5A 5E0OA 1JXQA 2LUOA 4FFBB 2D62A 1W1IA 3LDUA 2QW8A 3MJDA 4AJ2A 1F5SA 4RDIA 3OY7A 4PC3A 3HJBA 4F21A 1F8GA 4EMBA 1VRCA 1HYGA 1I2MA 4XR9A 4EUEA 1BFDA 4MUYA 1AV6A 2OHGA 4LSMA 2JI4A 3PG5A 4Y1FA 1ZCBA 1VL5A 2JI9A 3H1AA 4A0RA 5LNK6 2ZBEA 3EULA 5ICGA 2XLBA 3BHJA 5TQ2A 3Q5GA 2IODA 4D2IA 3GFSA 2GZMA 1TO6A 2BFNA 3I64A 4KC0A 1UPBA 3MLEA 2F1IA 3HI6A 3JRWA 2OPBA 5SY6A 4QBKA 3KOUA 5ALTA 2H3HA 3NI2A 3ZBPA 4H3SA 2AI2A 3GP3A 5DRYA 2C4KA 1GILA 2YJ5A 3GAFA 3TGPA 1PTJC 4PZCA 3E53A 1YE8A 4CM6A 2H1HA 4AP5A 1J09A 4C0WA 2C92A 5C0OE 5FAXA 5BORA 5DEIA 1G5FA 2O52A 3H6GA 4NFHA 1F7UA 1FLVA 2QHXA 3IMKA 2X5XA 3N8KA 4U0JA 3ROQA 3VPXA 5I45A 5J2TB 1N0VC 4R6WA 3ZHRA 3GZNA 3FPJA 2XHEA 1QHXA 2FWPA 3H2IA 3OZGA 2FPOA 2WJYA 4U9UA 2OAEA 3QVGB 3SG0A 3T4EA 5KQLA 2AGVA 5FTWA 1J5XA 4B3HA 4AXXA 5DMXA 4PX5A 4Z1MA 1NHGA 4O2BF 3NZEA 1VLQA 1Y4ZA 4PZYA 1ECGA 1SUSA 1HE2A 2QSZA 2IV7A 5J1SB 3AC0A 4EQ6A 3EN0A 5F78A 1CR2A 4KJZA 2EATA 3DL0A 4CR6A 3N58A 2YN2A 3H0KA 1BKYA 4KO2S 5JTTA 4IXWA 1O94D 2FZCA 3RODA 3I4FA 2R47A 4FNMA 5ICFA 5AW6A 2ZP1A 3L4BA 3FAZA 3T7JA 1W52X 4DDUA 1F1JA 1JJBA 1UFQA 3GELA 3EGVA 1RDFA 3PD1A 1O4WA 4KN5A 2G72A 2PWPA 4UMDA 5TX7A 1OZGA 4J8PA 2H1IA 3CPSA 5EE5B 5I9LA 3HCDA 4CLRA 1LSJA 3AOEA 4FYHA 4N7BA 4E1AA 5B6IA 5U9CA 3IDFA 1NT2A 2HIAA 4HDMA 3R0IA 4ZT4A 3HDYA 1PGNA 1P2SA 3RQSA 3TL6A 5BOSA 1XDZA 3DFZA 3VHLB 2A5JA 4ZAZA 2C5GA 1ZM3A 2JL1A 3MT7A 3H5RA 2R8RA 4D96A 1CNEA 2ZEJA 1XOIA 3E9DA 1JEQA 2XZDA 4X3PA 3EZYA 4BAGA 4Y1RB 1ZP6A 4JC4A 4Q4HA 1LCIA 1K86A 4FGJA 1KR5A 4MS4A 3QLVC 2IGBA 4PNHA 5H7XA 1OTYA 1WNTA 4ZTBA 3RVNA 2FW6A 2SKDA 5AM2A 2NVUA 1CRLA 1KETA 4ZVRA 5IJWA 121PA 5FHRA 2NO7A 2A6PA 4QXRA 3RUDA 2J5RA 3JAWA 2L69A 3FMVA 3ZVNA 4EW3A 2VP5A 5IYZB 4OJNA 4KBGA 3NT4A 4W7HA 4MRMB 4C78A 3QG1A 3SZLA 1NXXA 2H7VA 2P65A 1UOEA 1J0BA 4WN9A 2AYYA 1NTRA 2Q5EA 2A88A 3D5TA 2WILA 2EXXA 2IPXA 3ZE2B 3L46A 3QEJA 5A4AA 5BW4A 1PD1A 4XTCS 5IDQA 4ND7A 1RKXA 1WNFA 1L4YA 1YRYE 1DIHA 1EK6A 2AMJA 3Q5EA 4JEMA 5F7OA 1BVRA 1VL8A 1AXGA 3JD0A 1WXFA 2HL6A 4OIFA 3M6FA 2E1RA 4OL0A 2ZTLA 5DEOA 1STOA 3DM5A 4TWZA 3OKAA 3QKUA 4MRRA 1VL2A 1HTWA 4OQDA 2HIGA 3JQ6A 3TFQA 3HDTA 3MK31 2PJRA 1NY6A 1KK3A 3EIFA 3LBAA 3BSSA 2C9MA 4GRIA 5JAZA 3TN7A 3UXHA 4OATA 3U4GA 1H5QA 2Q3CA 4Q6WA 4LYYA 4UBNA 1M7BA 1E2QA 3GLUA 4BO9A 5JH7B 2FPSA 1N5RA 4LXHA 4MMZB 2JHAA 3HWRA 3RG8A 5C1BA 3WKCA 2ZR7A 3NHSA 2X19A 4MW0A 3I92A 3ONNA 1M5TA 4P2GA 4P34A 5JZ9A 2CXQA 1C1DA 3K0CC 1NBMD 3RAJA 1VJ5A 2P5YA 2Q3MA 5L95A 1FC0A 4RPKA 4PM4A 4F12A 2BP7A 2H92A 2OORA 3DV2A 5EIAA 1Z7GA 5EVJA 1XVVA 3UK2A 5BURA 1Y3FE 4FFBA 2XZPA 2AFVA 3MMXA 5BSKA 3P4YA 3KC2A 1AKYA 5EMMA 3QGMA 3R9XB 3KYJB 3PWZA 3WGTA 3IOYA 1W59A 1D4ZA 3EGCA 2Q49A 5HDQA 4K9LA 1U3FA 1K5HA 4I46A 4Y2UA 2Z4SA 3L7NA 1FFBA 3C7DB 4EWLA 2QKYA 4QNMA 5G0SA 3WL4A 1O2DA 3A26A 3OZIA 1WXIA 2WA1A 4FMDF 5JJ5A 1P45A 5AW2A 4K9NA 2NYUA 3EDYA 4A0FA 2R68A 3D2LA 1M2EA 2VPTA 3KO8A 3FG9A 3LLMA 5IKEA 3DBRB 4Q7EA 6CHYA 3VC7A 4BJ5A 5KDLA 4TV9F 1QORA 4BJ1A 4FILA 2CV2A 1KORA 1BRTA 2GJ9A 2WUVA 4XFJA 3NUQA 5JJBA 5CPFA 1CJSA 1PDVA 3IUYA 1CZRA 4EB0A 4F2HA 5LC1A 1XIVA 3OE1A 3QVOA 1DEXA 4G8BA 3T1QA 5J2TA 2XVYA 4IX1A 2YXDA 3JQGB 3KEGA 4N5LA 5IT5A 3A58B 2GNAA 2HBYA 4M0DA 1G5RA 2IZ0A 1V71A 3U1VA 5CFOA 3G0HA 1WDTA 4R1MA 3TZQA 2BRUC 2RFLA 3NALA 3QVGA 1AZWA 1JIVA 3OKCA 2WD7A 3VR0A 3KQHA 1COWA 4YK7A 2QD2A 1G4AE 1S8OA 2O4UX 2OV1A 3IO5A 4Q3KA 5HMLA 2VPYA 2PSSA 4XAQA 5HK8A 5ITSA 2HLNA 3ZU2A 1A4XA 2YJTD 2ZUBA 1WKCA 1L5YA 4LJ5A 1P8AA 3IDOA 4FEAA 4NBUA 1XEXB 2ASVA 1KJYA 1R7RA 2CNDA 2YIDA 3NAQA 3SJUA 1Z35A 3NDBB 5L9AA 4AQ7A 4CQJA 4M21A 4K6OA 2FLWA 5DHTA 2J46A 2PKXA 1OPXA 3C1OA 1Z6PA 2ZE7A 3CRW1 2XDWA 4LXGA 1TMOA 5CIYA 4M8SA 2VPWA 2XYGA 3LLCA 4YPFA 3ADCA 3E7XA 3K92A 1CRWG 4Y6OA 5THQA 2W2OA 4HAIA 3AL3A 4KE7A 3COZA 4E51A 4DJJA 1JG4A 4JVNA 3GDFA 2WWVD 3LV8A 1RZVA 4MQ5A 2QN1A 3H2GA 3UCXA 3K0AB 1UBMS 4KQJA 2I6QA 2PQ2A 1I1NA 3PBKA 1IPEA 4GSKA 2C8JA 4Z0TA 4HWPA 1XEWX 3NTOA 4Y1RA 1JBQA 2ZQZA 4NDZA 2AEMA 2JHGA 1WUJS 3BL5A 4EX6A 5KUTA 1RXYA 5AI5A 4OI1A 1U2QA 3HU5A 3SSAA 4HNSA 1OZFA 3AM3A 3P2JA 1U63A 1N2CE 5IYZA 1XPOA 2ZDHA 4MRMA 2MWMA 2YDYA 5AVOA 2JHPA 4ZQIA 1QDUA 4YMSA 1ZNWA 2HJGA 1ZUIA 4DAEA 4CN9A 1IXYA 4DRYA 2QROA 3WDLA 3UJCA 1YD7A 2UUAB 2VP2A 3OQMA 1QYIA 1ZN7A 1ZVKA 4WLEA 5L4LA 1QP8A 4KXFB 1MBZA 4LX0A 1NXSA 4LV6A 2P7HA 4RIGA 4J91A 1JEDA 5EUMA 3ZHZA 4DUGD 5LP6F 1EGQA 2I4LA 2WT4A 4GQIA 5DCYA 3U3DA 1A8QA 1R5BA 2ACKA 1AC5A 2Q5QA 2Z1NA 3I1FA 4JU8A 4AWAA 4Q18A 1R2QA 1YHNA 2QT9A 1CZHA 1EK0A 1TO2E 3FFAA 4NHEA 4WZ6A 3TOZA 1N34B 1E63A 5I4BA 4D9CA 4G9GA 4YMHA 1WQ4A 5BN3B 3JQBA 3IKLA 3BGDA 4ZPJA 1X1CA 3U26A 5JH7A 2HF2A 1KMMA 3ED5A 3OE7A 2A2ZA 2R65A 3TLMA 5F7ZA 5IJ9B 1U2GC 1LBIA 2HK6A 1XKXA 3B9BA 3QVVA 4XM1A 3VO8A 1L5QA 2I8CA 5TPZD 1KDTA 3FTQA 4B31A 5C3MA 1RBMA 1QCZA 2FV8A 2JIOA 1VCMA 1ZMTA 1A8HA 1ISSA 2XMBA 4RSGA 3MCAA 1B2LA 4K9PA 4TQGA 5AW3A 2B1QA 3EOAI 3H1BA 4II7A 5JLAA 3NYQA 1FU8A 2ZJ0A 3LCJA 4UM7A 4ZO4A 5A06A 4UCXA 3R9XA 3SSOA 2HF9A 4UPDA 2XB6A 5CVEA 5LQJA 1CYDA 1P0IA 2AFHB 5G4LA 4RTSA 4ER5A 1XPUA 2HHAA 4KVFA 4CEJB 4QOGA 5J40A 1T5OA 1PVDA 3A7EA 3M6LA 1KPIA 1TVCA 4IG4A 1DXHA 1UF9A 1KAMA 4XRRA 1K6XA 3RFVA 5LDDC 1KOGA 4J2HA 1SBCA 2NM0A 1XFDA 2LVBA 1Y8RB 2XWSA 2Z2XA 3N5KA 4GGPA 4JJEA 2BHNA 5FJJA 1T4GA 1Q95A 1QQ6A 3FDJA 1NVEA 2CD7A 4KO3S 3DBRA 2OLJA 3LX8A 1AQUA 2IHYA 2PL5A 3OJOA 1JHUA 2WTNA 5KNBH 3TNLA 4X92A 2C7VA 1TMKA 2F55A 4C7OB 1WG8A 4FCCA 1G5IA 3IKMB 1H42A 1EVJA 2VSXA 3NXKA 5TQVA 3SM3A 2CL0X 1Z2OX 1EBBA 3JQGA 2AH5A 1MOPA 5JNLA 1CRZA 1DBQA 1TK3A 4GIBA 4JLAA 3RRZA 4CHTA 1KFJB 4P22A 1ZICA 2R8OA 5ALIA 3V4ZA 4ETWA 1ZK3A 3OWXA 3R7BA 2UKDA 1L6RA 1KQGA 3LX4A 1SURA 4KXMA 4F7DA 1VYHA 2RGYA 3QKRB 4N3CA 4L74A 5CDFE 2Q27A 4L85A 1D2AA 3IDZA 4R1NA 3CNOA 5KYNA 1XEXA 1P7WA 3GHYA 2POQX 3H5OA 2QEQA 1QFYA 3O4FA 4OB7A 3G79A 1N2OA 2BM1A 3GGJA 2IPAB 1U2ZA 3RCBA 3TX2A 1IU9A 1RC1A 4H1VA 1NJ2A 3BTVA 1Q7TA 3P96A 2WFMA 1SQGA 1L9XA 1V37A 3B1JA 5EESA 1AN9A 3VDQA 3DZBA 1THGA 1VG9B 4ON9A 3ASVA 4C7BA 3MGAA 2BE9A 1L7AA 4EPTA 2HJ9A 3DE5X 3SNHA 2XYHA 4B4UA 1SG6A 4A27A 4ZU3A 2PDAA 3IP6A 3P8ZA 1BXZA 2J9ZB 3EYAA 3KTFA 4K6MA 4N0PA 4TMVA 4J29A 2CJFA 1FS4A 4ZQHA 2PMFA 4D81A 3F3SA 3TJMA 4J7CA 3ANLA 1GPBA 3K9HA 4AUKA 3K0AA 2PPLA 1T8SA 4HCJA 5FP0A 3ADOA 3KDPA 5E4FA 1EEXB 2VC2B 2CLKB 3ZWDA 5TEWA 4RTJA 2XCTB 1RPZA 1CSEE 4XCQA 1RQNA 2AG5A 3AESB 3KQPA 3L6UA 3PQ3A 3GXBA 4PO8A 5G1NA 3PZBA 1DKPA 4KGZA 4WA7A 5H1YA 3AWIA 4IGIA 3OF5A 1PJTA 3DH0A 3GLQA 1XI2A 4WH0A 4WKBA 4DDWA 3NATA 1H2YA 1JKXA 1HDGO 2QL6A 2Y71A 1IOWA 1BGWA 1DX9A 4KUEA 5KVQA 5B1EA 4PAGA 1RJWA 5FO0A 2WINI 2P3OA 3SZRA 1O9HA 2M2IA 2B82A 3PQ7A 4EB3A 2I7XA 1MJ5A 3M4JA 4UATA 2HMVA 2EG9A 4G85A 3DZFA 3A3PA 2V4MA 4WIAA 5T7BA 3CEJA 1TQHA 3H6KA 3DLAA 4OBBA 3T54A 4BB0A 2AZTA 2QRGA 2ZTVA 4UTXA 3RD5A 2V45A 3H42B 2CLCX 1B76A 2G28A 1PZXA 3BAFA 2WP0A 1M0SA 2GKSA 3FB4A 2GEKA 4WXHA 1ULTA 1VSTA 4PYIA 1ESMA 3NP7A 4E03A 4PLFA 1R4AA 1XKLA 4RZIA 2ZJ1A 4AKEA 4Y9DA 5FIUA 1DMSA 4RVHA 4G5RA 2NZYA 4DFDA 4GMGA 4KLNA 4BO0A 5M29A 2AMVA 4HLUC 5I8PA 3ZIAA 5F35A 4XVHA 1B0PA 1PR9A 1Z4PX 3LWBA 5AVRA 1R0CA 5CX1B 3F6BX 4H6VA 4KXVA 5AKXA 3FRJA 4H3VA 4GPBA 2VA9A 3DC7A 4L22A 1G8GA 1E79D 4MULA 3IAS6 4RJIA 2YFHA 2WF9A 1CRPA 5CEFA 3C8DA 4CIWA 1IZ9A 1QGDA 3G9TA 2CHGA 1EQ2A 1VLMA 5F9FA 4R69A 2IA5A 1APBA 1D7AA 4JSYA 4NAUA 2JFYA 1JVSA 2SECE 1T6ZA 1WW3A 3O82A 4CLEA 1VE3A 5ER9A 2AFHA 2BJWA 4ZCTA 4MITA 4LHYA 4DCUA 1YZTA 3UUGA 1J99A 2K2QB 3EZ6A 4V3BA 2GN0A 4ZCSA 5C4IA 1L1EA 5F3DA 4CEJA 4KR6A 1QGZA 3QFHA 1PV2A 4PXYA 1CS0B 3BQMB 3NETA 4YQYA 2V6BA 5AQ1A 2PK3A 1IJFA 2OHFA 2OWEA 3K8YA 4RJLA 4WESA 2HQOA 1W96A 1Y8RA 1R5NA 1ZN9A 4BKOA 2ID8A 1A5ZA 4PLCA 2GHTA 3CZMA 3UWPA 3OMWA 3FPAA 1CC1S 3BMQB 3QW4B 4YRTA 4FMBB 1JJ7A 1B0ZA 5DYNA 4CI0B 2ZPUA 1L8AA 3NB0A 4PLVA 3TIGA 3AKEA 1TU0A 1Y6QA 5AK5A 4DSAA 4C7OA 4J1QA 3EW7A 3Q7RA 3ZNPA 2VPQA 1KSFX 2PL3A 3C3EA 3KYIB 4ROTA 2W6CX 3KOMA 5I8ZA 3M6WA 2FFRA 2JDID 2LWIA 4XEUA 5K8TA 4F3YA 1J8FA 4F11A 5K0JA 5AVXA 4ER3A 4MIOA 2GF9A 1QHGA 1QE5A 2BBTA 4JKIA 2AFRA 3FKJA 3Q2OA 1M34B 4EHNA 1F20A 1JRLA 2BBSA 3AL0C 2X40A 1IG3A 4X8LA 2QMQA 2A84A 2C2HA 3JCZA 2C61A 4V38A 1Z82A 2EBHX 3HZOA 5A0FA 3QKRA 5EFOA 1TF2A 3W3AH 1V5WA 2MCFA 3DTNA 4ZEVA 5FUMA 5DZSA 1L5HB 2WWGA 1PGJA 1YR8A 3DLIA 4NYMQ 3E4DA 1NVWQ 5G1PA 5J4LA 1XAJA 1EVZA 2R6R1 4MDYA 3OX4A 2PT6A 1O97C 2Z4TA 3ZWMA 1D8TA 2X5NA 3RKSA 4HH0A 1GNVA 2QTBA 2ZW9A 2J48A 4L6IA 2QSYA 4MYRA 1NXPA 1OIVA 1XRRA 4FMCB 1YS4A 4RVGA 3SR4A 4JU9A 1PJ3A 3IXMA 4E6EA 2X4DA 2IHNA 4OFZA 4RIFA 3ASZA 4XKJA 4OSPA 1KPHA 3DDOA 1MW9X 4RW0A 1O95D 1R0LA 2X8AA 3F3MA 2AYXA 1WABA 3B12A 5AHRA 2QDKA 5IAJA 3USCS 4OLHA 4A2PA 3ZTWA 4OI0A 3O0DA 1Y9DA 2B3TA 5BWCA 1T1GA 3SFTA 3KZOA 1P74A 1MXFA 2W98A 1E2FA 3KELA 1CULC 3EUEA 1FTNA 3N7UA 4AI6A 1KYQA 2JCVA 1QHIA 5A1JA 2R6FA 4NU0A 1S8NA 1Q20A 3AESA 3RHFA 5IDXA 3BWCA 3EH1A 5LQKA 3RIXA 4RK0A 1T0UA 3M5WA 4BLQA 2C3YA 3KU1A 4M86A 3SMVA 4WOJA 3KSMA 1E6EA 1RWKA 5JXWA 2DJ5A 1Q91A 3IOBA 2Y1DA 3LO8A 1FZTA 1H2HA 3FTDA 3CH7A 3IKJA 1EX9A 1UC4B 3ELWA 3VHQA 4YAKA 2M9MA 1BEEA 4Y2GA 1AH2A 3R5HA 2FN9A 1OX6A 1P5FA 3FFWA 5IEBA 4EKGA 1XELA 4GLJA 1MC8A 2RH4A 4JIGA 4XXHA 4Z9YA 1TKAA 2WJIA 3L4EA 4H3HB 3F1LA 4CUKA 2Y2VA 1EG2A 4V0MA 1D6JA 3IV6A 1RYNA 4PFSA 3WL7A 3MMPA 4IDGA 2CZCA 3A9CA 3BB1A 1LH0A 4K05A 3RS3A 3K8OE 3GP8A 4J0CA 1WXXA 4YMLA 2G5PA 2X3UA 1QFSA 4EG8A 2GPYA 5KNDH 2B4YA 2P2CA 5A62A 5G0TA 3GRAA 2XGJA 3KXKA 2FZEA 2GLXA 2LNDA 1R8YA 3I28A 4HAWA 4P98A 1B93A 4ND4A 1TT5B 3R0XA 4RACA 1ZNQO 2C1XA 4ROSA 2JFXA 2W00A 4OFWA 3V5NA 4J49A 5JS8A 1KY4A 5CX1A 1ZZGA 4LF8B 1E5VA 4XWWA 1W34A 1OZ0A 2H5JA 4OKSA 3KLNA 4E5MA 1YS7A 1U0LA 2EJTA 3ER9A 3OESA 4LVNA 4G56A 5A04A 2K7FA 3P7MA 4GNKA 4LQCA 1EE1A 4TM7A 1QZUA 1JLMA 2XCLA 3ZV4A 4MKGA 4BV3A 1V5EA 1RTKA 2X4IA 2PS3A 3TEMA 4E70A 4ER7A 5H9WA 4QGGA 1Z2PX 3F46A 2OP1A 1CUIA 3W5DA 4I8XA 3W6ZA 1SQ6A 1FTSA 1ORWA 3VKWA 4QVGA 3ZGXA 1V7ZA 1CS0A 2BKLA 2CYBA 4FIZA 3FGZA 5FOXA 4BO7A 4X66B 1LXCA 2IYZA 2VRWA 2WICA 1M9NA 2IHZA 2R5FA 3OKPA 4R51A 3L4KA 1IVSA 2AC7A 3VPBA 1RI1A 5E9QA 1GRQA 4TT3D 2Q6OA 2Y0DA 4EJSC 4ZN6A 3BMQA 3AR4A 1LSUA 2OOSA 2G4CA 1JVNA 4LF9B 5KTYA 2BUCA 2ADMA 4NG4A 1Z2DA 4XQCA 2ZT8A 3VOAA 4A26A 2DFVA 3CWCA 3I53A 1GUFA 1AKQA 2XXBA 4J4BA 4H17A 1BOFA 1B2RA 1DPGA 2HSJA 4MYDA 5KDOA 1G3UA 3NAZA 2PBLA 1ND6A 2PRIA 3PS9A 4UEWA 3DT8A 1NC3A 2VJOA 3OLCX 1T43A 1T8PA 4C30A 3T5GA 1RLMA 2PLFA 1M34A 1QPGA 2WM2A 3MXOA 4YRFA 3X1DA 4AK9A 4D26A 2FR1A 1U9CA 1NE2A 3HB4X 3HTXA 3PTLA 4CKCB 1JXMA 2NZUG 3MC1A 5E1MA 2DFKB 2ZT7A 2QQ5A 3F90A 4FFMA 5K1ZA 5GZ6A 1Z16A 3AV0B 3FWPA 5LWQA 1P1HA 1DEOA 2FQWA 3FOZA 1RFGE 1Z28A 3AB3A 4EVIA 5C81A 3SS9X 4EBBA 1TKCA 2HDWA 5HF9A 3TSOA 4H7PA 3VC1A 3GRRA 4WVLA 4EUNA 3HYCA 1T0HB 4HRVA 2NW6A 4ZVLA 2UYOA 3LQQA 3GGOA 4QBHA 2CSXA 4RCYA 3PQCA 2IXFA 3A31A 3T0IA 1EVYA 2C9YA 4QGHA 2K2WA 3FCEA 4L15A 4TGLA 3AINA 2NZJA 3LSYA 2G9NA 1P2VA 1FNSA 2F3SA 3U9TA 5A03A 2B61A 1IQ0A 2JH9A 1JYFA 1NBEA 2C9DA 1HLFA 1PYGA 1S3SA 2B30A 2NV0A 2OK7A 2PCLA 1X86B 3GMSA 5LL6P 1MJNA 1G3RA 4UBLA 1BS1A 1UBEA 2YZGA 4ZVUA 4LXIA 2JFWA 1BMTA 3FBWA 2NMVA 1R0ZA 4HFJA 2ICAA 3UWKA 1G5PA 1JQKA 2IYLD 4PLZA 3IEPA 2IELA 2O8FB 1NXWA 4LJSA 4H4CA 3RB8A 3VO1A 1TPYA 4M1TA 4MMYB 2O2CA 4D4JA 2DHDA 2ZIUB 3MWKA 3TG8A 4IKEA 4UHBA 1JPNA 1KWKA 2JAUA 3VUFA 2D00A 4HGZA 2DF8A 1E5DA 3TBKA 1RI4A 4ZAGA 1CF4A 1AGYA 4KSYA 4Y3UA 2VQFB 4L6AA 4Q7QA 1M2OB 1T2UA 3TMAA 1YVEI 2A1UB 4E5DA 3EQ6A 5FEMA 2D74A 1DI0A 3W8EA 4PIVA 1JDZA 2WNIA 1M66A 1OI4A 2XEDA 4HADA 4IXTA 3AFIA 1TE2A 3A6GA 4TLCA 3RREA 3AIIA 1WLYA 2Y99A 3PEVA 2EARA 4E5NA 1W93A 2GR9A 2C9ZA 1Q11A 4D3SA 2OGTA 3BG5A 5EHQA 1G8HA 2W8ZA 2VYCA 3JSAA 5TS3A 1H4TA 3SOPA 4A8TA 2GX6A 1H8HD 1S7GA 4CM9D 3FVTA 3I6IA 1WMBA 1VB3A 3GLHE 5FPTA 3DF7A 3EEBA 4TS4A 5KOJB 1XMQB 3FDXA 5BUQA 4PW0A 1MFPA 1DU4A 4BX8A 4YT4A 4IGAA 3BH7A 3IJRA 3E61A 4UDYX 3RFUA 3A6DA 5TQJA 4DQ0A 1KAHA 1TT5A 4I2VA 1V48A 4U8GA 1NSYA 5BO5A 4E5YA 4QA9A 1I4OA 1IJBA 4OH7A 2PMCA 1YCFA 3L6EA 1J8VA 1OCEA 1ARZA 4K6GA 3PI6A 5DXJA 1P73A 4J3NA 5H70A 2EFDB 4Y2SA 1T4CB 1ZX1A 1EE9A 2JCGA 3P5SA 3CLVA 4DIDA 5ALNA 4G4IA 3AKDA 3AGPA 1EFTA 1LK7A 4KP7A 1JEYB 2IW3A 3V4LA 1DCKA 5LP1A 4KXUA 1SHTX 2QB5A 2DSNA 2ZSEA 4FGKA 4D6XA 4HKTA 2PQ6A 3DBHB 3AEQB 3IPLA 3MD9A 4KI7A 4M9ZA 4DR6B 4D02A 5KI6A 4ND1A 3G5TA 4GC5A 3PX3A 2JFGA 1VRVA 1VKOA 4EJFA 4EH1A 3OM1A 2ZJ2A 1PN3A 1UZAA 2ZFUA 1JB1A 1A71A 1SUPA 3FPCA 4AZWA 4Q12A 5B37A 3K70B 5A4DA 4MVJF 4EGQA 1L7XA 2VSOA 4UTPA 1Z4KA 5KQPA 3QLJA 3LK6A 4EPVA 2HPZA 1G17A 3BJEA 4H15A 5B3JA 2VXOA 1XTJA 1YRHA 4I1VA 4U2CA 5AW7A 4LS3A 2NUTB 2CFSA 5BXQC 3DNFA 1L0BA 3OJ0A 1LPAB 3WLNA 2HW8A 2YN4A 2OM6A 3B1WA 4UU8A 2AKEA 4M4SA 2R1VB 3CQ9A 4RDHA 1GVHA 3T52A 2PEYA 3VPDA 2X7HA 1GPH1 2KBFA 4Z86A 4ZV7A 1W8IA 2NT3A 2XB8A 2J9YB 4CKCA 1J9EA 2WDPA 2HRZA 3MVEA 1L1FA 4HV4A 3LGXA 1ZJ6A 1QHSA 4FN5A 3RRBA 3RYTC 1IAVA 2O6HA 3C6QA 3ROGA 3KR0A 1IQPA 1ZD3A 4JL5A 2XMRA 4MV0A 1WDKA 3UAGA 3C7KA 5I6DA 5IAKA 1LPMA 1Z26A 4LY0A 7ADHA 2WB4A 2CK3A 3LLVA 1T0BA 4KRYA 5LCXA