3FMPB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
b'LVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmpB00
4BFUA 4LV5B 3F0TA 4HLQB 1FFHA 2ODNA 3CB4A 1AKYA 3K1JA 2OBLA 3K9LA 5E7IA 4B3XA 5EP4A 4DLRA 1N6PA 2N46A 3D8BA 2O8FA 1K8RA 2C5LA 3BB3A 4EFNA 2TMKA 4OJKA 4CZ2A 3V9PA 3EA5A 3WY9A 1NN1A 2VHJA 1COWA 4YDHB 1NG9A 2BMJA 1P2SA 5BN3A 4ZDKA 3EPJA 2O8BA 4M2LA 4RZXA 1M6NA 1DAEA 4DJTA 4GPTA 4TMZA 2B8TA 4IVPA 3TH5A 2OSBA 3RRMA 1SVOA 1J8YF 4WW0A 3K70C 4CEJA 3D31A 2JLYA 1YVDA 3FHTA 2O8CB 3IHWA 4S35A 4Z51A 4PR0A 1ZM2A 4B3DA 2ZYUX 2RGEA 4IVRA 5GADl 1SKYB 2ZAOA 3PUYA 2J0SA 1FOEB 2WWXA 4KYIB 4M4SA 1S1MA 2JLRA 1SQ5A 5KNCA 4YMTA 5DSZA 1GTVA 4BLQA 421PA 1XMSA 1E9AA 3KTAA 4TMVA 2J41A 4FWTA 1W4CA 3BBPA 2RGNC 5F9HA 1OE0A 1JR3E 3T1TA 3C5HA 2YOGA 4DC9A 1G16A 4MRNA 1VCNA 5BWMA 1I2MA 3DMNA 4HEJA 2VO1A 4G5GA 2ORVA 1IQPA 3SFZA 3BWDD 1X3SA 4FINA 4LJ8A 1OHHA 1EGAA 3CONA 1KI6A 2A7QA 2IYTA 1JAHA 2NMVA 1E79D 2KE5A 4GSYA 4HUQA 1MO3A 2GJKA 3AP3A 4I1SA 5DN6D 2J46A 2F6RA 4M22A 4LSGA 2E1RA 3WRXC 1NBMA 3IPXA 4HAYA 2BBOA 1XD2B 3L0SA 1DG3A 1JXMA 4Q7JB 3BAFA 4GL2A 1XCMA 4I81A 1N5KA 2QM7A 3L2OB 1BKDR 2PX0A 5FOWA 2O5VA 3PIRA 4QG7A 4DZZA 1RRFA 4KLNA 2OV2A 5JCPA 3BGWA 1SXJC 3U7EB 4KXFB 3T5GA 2FSGA 1AQYA 1JXOA 3KQUA 1G6OA 1P5ZB 1WCV1 1Z6GA 2EFDB 3BORA 1ZNZA 3Q5EA 1OV4A 2WKQA 5P21A 1OXXK 2JJ1D 2BMDA 1DOAA 4TMXA 3THYA 3W6NA 1XTRA 2BVNA 3AUXA 1ZNXA 3AVXA 4F4JA 1Y3AA 3T1QA 1PVOA 3VX4A 2I3BA 3OEHD 1RYFA 4OQNA 5CM9C 1KO4A 2FPLA 3B13B 1KZ7B 2QPOA 2RGDA 3VAAA 1D9XA 2O52A 4AI6A 4HLUC 2EVWX 3U6KA 1U0JA 1TNDA 3EZ6A 4QGFA 1FNMA 4HB2A 1YZUA 4NCIA 4KBGA 4TLEA 5D3QA 5LDDC 2JDID 2W83A 3MLEA 2NO1A 1M8PA 2VL7A 2ZPTX 3CR7A 3MAAC 4KFTA 4LYJA 1DARA 2VP4A 2P6NA 5F2EA 5FUVA 4ABYA 2IHYA 4DSTA 1E1QA 1CF4A 1G6HA 4EQ6A 2BCGY 2FSHA 1NRJB 4MYTA 1OIXA 2R6GA 4HDOB 2V6JA 1S96A 3R7WA 2IT1A 2VLIA 4KITB 4P4UA 4F7WA 5SZIA 1E94E 5C18A 6Q21A 1RC8A 1Z2CA 2QQ0A 1HE1C 1KMHA 1L8QA 4NCNA 4Q4AB 4B48A 1QRAA 1TADA 5JCZA 2ZUBA 3FKSA 3E5HA 1J2JA 1IOZA 4C0KA 1XXHB 2JLQA 1G3MA 3B8HA 3BJIC 4AKGA 3W34A 5E4FA 2FFQA 4IDPA 4JLDA 1II0A 1QBKC 1E4YA 4Q21A 4G5SA 4LWZA 2IK8A 3OIUA 2J59A 3V00A 2IYYA 1J90A 1NL3A 3F5FA 5AUPB 2WZQA 5DISB 4G5RA 3RC3A 5A5GA 4FN5A 1E9EA 5L3VA 4TL6A 5K8IA 5AJZA 4C0HA 3GLFB 3PQCA 4C9BA 5KSZA 1CP2A 2XNDA 2YOHA 2EFEB 1VYTA 5JS7A 2OCAA 2Q3HA 1KI2A 1U9IA 1ZINA 2P2LA 2IBMA 3W90A 3Q85A 2I1VB 1DAIA 3A6PC 1NIJA 2IF2A 4E5UA 3IBGA 1DADA 2D06A 3Q5DA 4QNRA 5AUOB 2RGXA 1U8ZA 3EC2A 5CK5A 3SBDA 2GF9A 4GFDA 4DCVA 5DYIA 1OFIA 1E32A 2QEQA 3NKVA 3ADDA 2ATVA 3OAAA 4FXPA 2J45A 2KWIA 1KIMA 1VKJA 3PV0A 2XSZD 1H65A 1CBUA 3AF4A 4FD2A 4MRVA 1N5LA 1VHLA 2V7QD 5C1BA 3GLHB 4LJAA 3WMFA 2DYKA 1Z5ZA 2F43B 1Q21A 3KL4A 4IDNA 1TF7A 5J5CA 4MYHA 1QHIA 4F4IA 3CX6A 4B71A 3M6AA 4PHTA 3SEAA 4OHZA 3DMDA 1QHHA 1G19A 4KSBA 5J4LA 1XWIA 4MGKR 4D6PA 1XEXB 4A2QA 1GKUB 1UDWA 4LPKA 5TARA 3T5DA 1CR0A 1N0VC 3OIYA 5FBVB 4K8OA 1DPFA 4JVSB 4TMWA 1KSFX 1XPOA 2REXB 3A1WA 3X1DA 3T35A 4BZQA 2V8OA 5TDHA 3QXXA 4M9QA 1QZXA 3FMOB 2ZYWX 4M1TA 2AN9A 2ZRHA 3GEEA 4UXJA 2ONJA 4CRWB 1ZCBA 4UNRA 2OE2A 1HV8A 3BERA 4Y0AA 3SZRA 1T3HA 4R2HA 2DBYA 3LXXA 4LI0A 3X2SA 1G8HA 3DL0A 2GEUA 2QE7A 5HCNA 2N1BA 4DDVA 3SBEA 4TYWA 3U3OA 2A5FA 3RNLA 2YNMA 5JI3E 1T91A 4Q4HA 2D7DA 3ZS8A 1TEXA 1NMYA 4V0OA 2XZOA 2HXYA 3AVPA 3WRYC 3A36A 1NSTA 4DLTA 5IRCD 1Q57A 2CNWA 3GJ5A 1WQ1R 1AK2A 3ND8A 2ANBA 2REBA 1U0HC 1N0WA 4G0NA 4HAUA 3GP8A 4NL4H 3WMEA 1J7KA 1G8PA 1W4RA 2W58A 3P26A 3K70D 1F48A 2BIFA 1P62B 2DPXA 2X8AA 2NZ8A 3TW8B 1S0UA 2ZRGA 3DKVA 2OILA 1CTQA 2MMGA 1ESNA 2V4ZA 2E9SA 2ZSBA 4DVGA 4B3BA 4OHWA 2GBLC 1XD9A 1X1RA 2QP4A 2J5XA 5EUMA 4TTRA 1PJRA 2E87A 2BJVA 1U0LA 2WWGA 5FPKA 2Z43A 2BKEA 4XOIA 4ZIRB 3QXCA 2PEZA 4IDOA 2GZHA 4TT3A 2V3CC 2G83A 2PCLA 4EJSC 3MSXA 2VRWA 3LBHA 2FN4A 3G82C 1AN0A 4Q1DA 3BH0A 1F2UB 3ZIAA 2W2TA 3K8YA 2C99A 4B43A 5KSPA 1WBBA 1E98A 1T0JB 1Z07A 4JLAA 2QL6A 4GP6A 4Q9KA 2ZANA 2J0VA 1XRJA 2C2HA 1SKYE 1PLJA 1R5OA 1JECA 3G5UA 4MGIR 4V0NA 4RKFA 1XEWX 2ZRLA 1UKYA 5EUQB 4DCNA 3C16C 3M1IA 4ON9A 3NEJA 1XJ0A 4IVQA 3B5JA 2FV8A 2F55A 1MABA 3N2EA 2XTZA 1CEEA 3VNUA 3ETLA 3QPWA 4RD0A 4E03A 4KVAA 4EPXA 3F3YA 1Z6XA 1ZCAA 1KKLA 5JWOA 3ZQJA 4B76A 4LV6A 1LF5A 1UF9A 2VF8A 4US0R 4ZKDA 4BGDA 3AF3A 3DO6A 2FEMA 1M7HA 1ZYUA 4X8OA 4URUR 4A8JB 1SXJD 2ZRKA 3LLUA 5K8LA 3IEUA 1Q1ZA 3N5CA 5L3SB 2OAP1 3K9NA 3O8RA 1Q1EA 4LJ7A 4CDGA 1GL9B 1D2EA 3KUDA 3F8TA 1T4GA 1W5SA 2YVUA 4D0GA 2XOKD 4QBGB 5CLQA 1G7CA 4AYTA 3RC8A 1O3YA 2JAQA 2ERXA 3IO5A 4Q4LA 3RABA 1WMSA 2X19A 2J0QA 4AD8A 4B44A 1AIPA 3VU9B 3ZZTA 1XU4A 2QENA 4PX9A 4Q00A 2OXRA 3CPJB 2RHMA 5FR2A 3EG5A 4AC9A 4BEJA 1NVWQ 2HDNB 4OQLA 1XZPA 4XD7A 1GWNA 5IF9A 3MWYW 2YC4C 3THXA 5KPJA 1N6LA 3LBIA 1GUAA 1T3SA 3QVUA 1W46A 5H68A 1OSNA 4IDQA 4PC2A 2J7PD 1N3BA 1OFHA 1MH1A 1RE0A 1Z29A 2BDTA 3FFAA 3TAHA 4QM6A 3PEVA 1JQJC 5FOUA 1FTSA 3VKGA 3GFOA 1FX0B 3KFVA 1LFDB 4EDHA 5JJIA 1VPLA 1HY3A 4HAWA 2QU8A 2YWEA 4PANA 1Z6TA 3K09A 3LH5A 1R8QA 2HF8A 2G9NA 2Q9AA 2XGJA 4IXMA 4RD2A 2GAOA 1G21E 3BD9A 2FWRA 3KKMA 5FL7A 3TGPA 2KBFA 1TX4B 3GEIA 1D2NA 3ASYA 3GFTA 3QKUA 1QVAA 2IF0A 2H8KA 2ZJOA 4TZ6A 4A0GA 3VR2A 2ODEA 4PAOA 3IPYA 3IIMA 4RFVA 2Y8EA 1K6MA 1OFUX 3AUYA 3O47A 3PFIA 4Q4JB 3VKWA 2QA5A 1X8KA 1NIPA 3AVTA 2HYDA 1VG8A 2LCFA 4LC1A 4LGMA 3W6PA 1ZU4A 3Q9LA 3GFPA 3LXRA 3NC1C 4R9UC 2FX3A 3LDAA 4RZUA 1KI3A 4WA7A 4KFRA 4DSNA 2ZJZA 3LV8A 4LYFA 2IW3A 4UKDA 5IK2A 3RVBA 3VHLB 5CDFE 1BMFD 2ERYA 3KQHA 3B7GA 3EA0A 3U7GA 3PXGA 1ZMXA 2J0UA 4C30A 2ZE6A 1FUUA 3I32A 3EPLA 1UKZA 1MO4A 3FVQA 3SJZA 1SVLA 2PBRA 5JEEA 2HT6A 2ZE8A 4IEIA 2CBZA 2D3WA 4O2LA 121PA 4FMCF 4JL8A 4JLMA 2ZR0A 1E2NA 5UKDA 2FE4A 1R10A 5CB8A 821PA 4P31A 5E3HA 3RYTC 4DDTA 4L9WA 3GLGB 4AIIA 1II8B 5EE5B 4X8HA 3UWKA 3SQWA 2IYVA 1X8JA 1VECA 2OESA 2XB4A 4Q1AA 2VP2A 3N2IA 3WMGA 4YMSA 4D80A 3GLFE 2ZROA 5J4HA 1NY6A 5BN4A 2IUSA 3T34A 3C14C 4C3ZA 5KDOA 3E2IA 3RSOA 4ZCLA 1M74A 2GXUA 2NGRA 5TB5A 3B78A 5TVKA 3ZGXA 3AF1A 621PA 5JHGB 1RFLA 1S9DA 3WXMA 4B47A 1N6HA 3KB1A 1E2KA 3RS4A 3TR0A 1TPZA 4PZLA 1SULA 1XDBA 2A2ZA 2GCOA 1LF0A 2C77A 4LJ4A 3H4MA 2FFHA 3IQXA 3AV0B 5EE1A 4OHXA 4DIEA 2QG6A 4D4KA 3M4YA 1R6BX 4D82A 2C8VA 3QG1A 3NBYC 3EPKA 3GLHE 3L0IB 4B6EA 3GLIB 3SS8A 4QBIA 4HATA 3R9WA 4X8LA 2Q0HA 4S2EA 3AKDA 2VIIA 4IFBA 2WAYA 1DO0A 1TQDA 2ZI6A 2CK3D 5CYOA 3T1VA 2ZRPA 4YXWD 1HT1E 4V03A 1DG1G 4WZ6A 4ARZA 4PXAA 4LZZA 5KDDA 4LUCA 1VG9B 4QJ3A 4IXNA 3QQ5A 1Z3IX 1O87A 1TQ6A 1VCIA 1DAKA 2QTVB 1JBKA 3QG5A 4M1SA 5G3YA 1Q1BA 2RHDA 3TSOA 4CEIB 2FH5B 2YWFA 1QVRA 4DSOA 4M9XA 2ORIA 2PT5A 3CZQA 1H8HD 3UXMA 4A92A 1G41A 1VCMA 2D2EA 2V1XA 3HU3A 3K0FA 1NN0A 3EC1A 4TN1A 3DKPA 1RRGA 4LJ5A 3TUZC 4ZV4A 4JZKA 5KNBA 2ZRDA 3SJAA 2VEDA 3OIWA 1I4LD 2YYZA 2DFTA 2P3SA 3B1YA 2D4HA 1XP8A 3UMRA 1R5NA 2ZSFA 4ACBA 1AQUA 1T9HA 3FOZA 1ZP6A 3P20A 3BB4A 2GA8A 1Z0FA 2X2EA 2FFAA 2OFOA 3BFVA 1MR3F 2GZAA 4GOJA 4JIMA 1WA5A 4ESVA 4OHYA 1E79A 1JPNA 1ZC4A 2LKDA 4A82A 1UJ2A 3FHOA 2XAUA 5DN6A 5JS8A 2RGAA 1ZM9A 2UVQA 3KQLA 2ZTSA 1R0ZA 2JLSA 1I4DD 2I4IA 2ZJ2A 3IIKA 1JR3D 1A7JA 3LD9A 4JKYA 4UNQA 4NBSA 2JLZA 1P9WA 2UZIR 2A5YB 1HQYE 2GJSA 4JJZA 3FTQA 3GCGA 5JLJA 2A5DA 4PAMA 4LHYA 2RGGA 4P4SB 3LA6A 1U98A 4C2UA 3PEWA 1R7RA 2FJUA 2R6CA 2EFHB 1YR8A 3R8FA 3AVVA 1W49A 2Z6VA 1Z0JA 1A4RA 4BFZA 1L7VC 4TLCA 1A1VA 4BUJA 4AKIA 3OZXA 3TQCA 2JJ1A 3X1XA 4A0HA 2IYQA 4LCBA 5CJ2A 5H8WA 5FPSA 4QC2A 1GL6A 2OUKA 5FTNA 1LY1A 3GJ8A 2IWRA 4ESHA 3EZ9A 1L4YA 2JJ2D 2NZJA 3JVVA 4LV8B 1KGDA 4RSGA 2GVDC 5EQTA 3RS0A 3UWOA 3SHWA 1LTQA 4NKRA 2REOA 3EIQA 4Q19A 3FWYA 1W4BA 3I72A 3AKYA 1S9HA 3OEHA 1VYUA 4Y0VA 2IS1A 1ZRHA 2F9LA 3HPQA 1YZKA 4OI2A 2QROA 2ZU6A 3N70A 2ZR9A 1RYHA 4ZCMA 1W7AA 1SVMA 4AY2A 4GZLA 5GVSA 2G6BA 3S1AB 3MMPA 3CPHA 1TTTA 3AM1A 1YR6A 3SI7A 2JDIA 1GNPA 1LB1B 1TEVA 2C9CA 2O8FB 4RD4A 4LHVA 1CJVC 4M1MA 4C0BA 4XVRA 4P0TA 4DCUA 2ASEA 4QBFA 3QF4A 2CLCX 5TV2A 3B60A 1I4TD 2ZYVX 2H1LA 3PUVA 1HURA 4FCTA 3DHWC 1IJEA 2IYRA 3KX2A 1Z63A 3HU2A 1KJYA 2ZS9A 1KDRA 4PPNA 3QXSA 1NF3A 2CVHA 1FMJA 3RWMB 2O8EA 3JZAA 4NHOA 4RD3A 2XB2A 2RAPA 1YZQA 1ZM4A 3VR3A 4A6PA 2C95A 1OFTA 4CEJB 4WVFA 4D25A 3QKRA 4URVR 1YE8A 3K53A 4O0MA 1ZIPA 4EKDA 1NVVQ 3IILA 5C2JB 3C41J 4W5WA 1N0UA 2AK2A 4G3XA 1LS6A 2D7CA 5JRJA 3HWSA 4IOJA 4BFXA 3GQBA 1Q22A 2QQEA 2C9OA 3RHFA 1MT0A 2ZS8A 4LYHA 4JJKA 3EW9A 4ACAA 1WF3A 1ZD1A 1OYYA 4LHWA 4HDQB 1ZIOA 3I4LA 3LBNA 2NPIA 4I1UA 4JL5A 4ZCIA 1E1RD 3T06B 2F1RA 1OLOA 1DBSA 1TF2A 2IL1A 3KTAB 2MMCA 5SZHB 2ZM5A 3THWA 4HB3A 3NWJA 2G1KA 1CJMA 3WNBA 4OJQA 4DHEA 2FFBA 3TQFA 2WWYA 2PEYA 1UKVY 2Q21A 2F1HA 2YHSA 2ZRCA 1EFRD 2QAGC 4MDFA 1X8LA 5HKKD 2NTYC 3WHKA 2V55B 2PJRA 3QEJA 4HZUA 4MITA 2BBWA 1KI6B 4O25A 1Z0KA 5B58C 3W6OA 3E70C 4HUQB 1XEWY 3HR8A 3I3SR 4RCYA 4XSHA 4NYJQ 1ODFA 4DIDA 2FA9A 4UNPA 2XSZA 4UNNA 5CM8B 2IXFA 2ZU0C 1JNYA 4A4DA 2V7QA 4H1UA 1U90A 2IXEA 4QRHA 2F9MA 3KJHA 5HZHA 2XXAA 4ITRC 4V0MA 5TY0A 4KCGA 1Z2AA 4BWYA 2WBLC 2ZQ5A 1WBDA 4TZ0A 2ZVQX 1CS4C 4B2PA 4LHZA 2BMFA 1EX7A 1VYVA 2EQBA 5B2ZA 4ERNA 3RSLA 3W8RA 1FZQA 1ZM7A 4KYUA 4DCSA 5J4VA 5E7JA 1E99A 1IY1A 4HAVA 721PA 4JS0A 3GPLA 2QMOA 1GITA 3QI2A 4GZMA 4QGGA 3NC0C 3UATA 1B0UA 1D9ZA 3LX8A 3THYB 3A4LA 4RZ2A 2WKRA 3AGPA 5FBWB 5EE0A 2P5TB 2HYIC 5LBIA 2FSIA 1Y63A 2UKDA 3GLGE 2CE2X 2LWIA 4Q1BA 1ZAKA 4LHXA 3QPUA 2B21A 2A5GA 2QORA 3GJ6A 4B74A 2R44A 4UNSA 5JWHA 2KI5A 4KJZA 2VPPA 3DOFA 4LBZA 4M9SA 3SHFA 3R9XA 3BC1A 4XVQA 1N6KA 3FYHA 2XZLA 2ZRMA 2GVZC 3UMFA 4BPBA 3DPUA 2HJGA 4BLTA 2ZEJA 2QRZA 4BLSA 3RS7A 4IKEA 4EQ6B 3FMPB 1VMAA 2XX3A 4KV9A 1GDDA 4EFMA 1FW6A 4Q03A 3VR5A 3R7WB 1XJCA 4HB0A 3TVDA 1X6VA 1QG2A 3U60B 3QF7A 3QY0A 3CIOA 1ZC3A 2XZPA 1KMHB 2BBSA 1PV4A 1ELOA 2GJ9A 1G4AE 2WWFA 4PC3A 1F2TB 2GAAA 3SN6A 3GLIE 1OKKD 2WIBA 4NYMQ 1T5IA 1PUIA 3CRVA 1Q0UA 2DWQA 1A2BA 5JFGA 1IONA 1A5TA 1KYIA 3I5XA 1IXSB 4IOKA 4R2IA 2IX3A 4DLUA 2F1JA 3KUCA 4EPWA 1XMIA 1GKYA 2VHCA 1W36B 2RGNA 5J4KA 3EPHA 2OCPA 3KB2A 3RRNA 2C9YA 1GNQA 2QAGA 2VHQA 4YDSA 5FBQB 2VHTA 3ECCA 2P6RA 1P9RA 2L0XA 1U99A 2RH5A 1P72A 4KI0A 4GP7A 4CIDA 5EP3A 3PEUA 4DKXA 5FPHA 3SYNA 4MQBA 2CEAA 4QL3A 4EPRA 2YWHA 5HE8A 4BLPA 3DVLA 2AD1A 3K0CC 3ZDQA 2AR7A 4Q4AA 1KDOA 4PHFA 1RZ3A 1QHXA 2CL6X 4M8NE 3W9YA 3AVOA 2BM0A 3MJRA 4JSTA 1XB2A 1Z0IA 4TLAA 5EXSA 5FUXA 1ZUIA 3BH7A 1HYQA 1XXHA 4TYNA 4A2WA 5DI3A 4Q1FA 4C0SA 3K0AA 2WJGA 3P1JA 1KI7A 3ADCA 3B85A 3LY5A 4U00A 1E2HA 4PPQA 3WYAA 3WBKA 3Q8XB 1CIPA 1EWRA 3TJZA 1E2GA 4EPVA 4DDUA 4JL6A 5LD2B 3EIEA 3OFND 2HCBA 2FPMA 2FU5C 3WNDA 1XPUA 3O8BA 1SXJA 1NY5A 4RKEA 2WICA 4DCTA 4RVCA 3A58B 1HH4A 1E2EA 1NG1A 1UPTA 4A1FA 4O3MA 3TMKA 2XOKA 1S8FA 4XWOA 1QHHB 3CRW1 3DM5A 1OH6A 1P61B 2OCYC 2VTKA 2C96A 1KSGA 3A1TA 1UM8A 4OI1A 2MSEB 3RLFA 5HCIA 5CIWA 4TTPA 2RGCA 2AK3A 4YONB 3U61B 1EK0A 1E2MA 5L3QA 4ZDWA 4YLGA 1DO2A 1S3SA 1W1WA 4NTZA 2HF9A 4Q9LA 5G3ZA 1RJ9A 4NCKA 4AWXA 1DEKA 2C03A 2NG1A 1Q12A 4LJ6A 3SR0A 2FPKA 4HLUA 3Q7PA 3TAUA 1Z22A 1BO6A 2O0KA 2ZSEA 3BXZA 3QJYA 4TL9A 5LB2A 2J7PA 4PTLA 1NNEA 4EIWA 1Q20A 5E95A 1UBGA 2AHOA 4MYUA 1J99A 2ZSDA 5FI0B 4D0LB 4Q4HB 2R6AA 1U8AA 4POAA 4MA4A 1OW3B 2D74A 3FE2A 3FMFA 2O0HA 5IDVA 3CRMA 4TSFD 2O8DA 3PUZA 3CX7A 3CWQA 4URYR 3KQKA 4BECA 1BYUA 4A8JC 1NKTA 3LVQE 2QUZA 4MDEA 2FG5A 3QBTA 5HR5A 2FGJA 2LKCA 1Q44A 3DOEA 4QGAA 3EXAA 4F92B 1KKMA 2DY1A 1HQCA 5SZJA 3HJNA 2QRNA 3FHCB 4JLVA 1R0YA 4YMWA 3CRQA 3TLXA 4ASUD 2ZITA 1G9XA 3KDSE 5F98A 3R20A 5FI1B 1YRBA 5HE9A 1T0HB 3CKLA 1AZTA 1E2DA 3U4QA 4H9GA 1KK3A 4ZI2A 5LB4A 2DFNA 4ZO4A 3A8TA 1QF9A 3SFVA 3VKHA 3X1YA 3HP1A 1FUKA 3RRYA 1BMFA 4JBYA 1G8FA 4XWAA 2ZI9A 2XJ4A 3CWZA 4JBXA 1R5BA 2R65A 4QJ4A 5DE3A 2OLJA 4M1WA 1H8ED 2BKUA 2ZS7A 4P3YA 4Q02A 4QBHA 4PZZA 3QKSA 1ZJ6A 2CHGA 3U44A 4B73A 5L8VA 1E0KA 4QHYA 4XSGA 5KTYA 3AKCA 1BIFA 1G20E 3B1ZA 4NPHA 2BMEA 3U3KA 5CYPA 1P2TA 1E6CA 1WDTA 3PR1A 1Z8FA 4RY2A 4FWIB 5D3MA 1P6XA 3BRWD 2WV9A 1MABB 4BRWA 2XNSA 3KXIA 5BYKA 4ZIRA 5AUNB 3U3JA 2ECKA 3PITA 2CXXA 1U81A 2XTNA 3VR6A 4OK6A 4ZDIA 3DZDA 2NIPA 4QGHA 2QPTA 3KXKA 3QPVA 4OK5A 4A0FA 1AGRA 3B2EA 2ZUDA 5IHPA 2FGKA 2R9VA 1G3IA 2CLSA 3E1SA 1W47A 4C0JA 1G4UR 3H86A 2ZE5A 4C2TA 2VF7A 4GT1A 3GJ4A 1IJFA 2BEKA 1NBME 1PUJA 1W4AA 1E9SA 2ORWA 5EZ6B 1T3LA 1CRPA 5KSYA 3TNFA 2VBCA 4JMPA 3K0EA 3PVSA 2BC9A 3CNOA 2B7BA 1OH5A 2JLUA 4RFSA 4AG5A 1VIYA 3THXB 3MWKA 1KK0A 2CK3A 5JWRA 1YU9A 3I61A 2JGNA 3DEFA 3I5YA 4CF7A 2Z4SA 3LX5A 4OK3A 1KDPA 1OJLA 4JLPA 4IOLA 4YXWA 1ZNWA 4CT5A 4BQSA 5K8TA 2YV5A 1IN7A 1NJFA 1GRRA 5FTLA 2VQSA 5DLQC 4E22A 2QP3A 4WOPA 4LX0A 1OXTA 4HLCA 4NH0A 1IN5A 2EFCB 4NE2A 1JALA 2B7CA 4P32A 2YZ2A 3BH6A 2GK7A 3C5CA 4NCJA 2PZGA 3OE7D 1H8HA 2QTFA 2ZI7A 1KJWA 3VNVA 1G1MA 3CF2A 4YMVA 1F6BA 5KYKA 4DLZA 1E4VA 1UFQA 4NZYA 4AURA 2GJ8A 1QDEA 3A4MA 3LW7A 3RRZA 1RRPA 2VP9A 4GOKA 4M1YA 4D26A 3PG5A 3ZZ0A 1K5GA 1DAGA 2HCJB 1AS0A 4C0LA 1ZVQA 2GBLA 2GXSA 4I1OA 2D62A 3QENA 5AJYA 5FBRB 3I92A 4OKSA 1FL9A 3HR7A 3QXJA 5CJPA 3NH6A 4W5HA 2QMUA 3CNLA 1W0KD 2GKSA 1XD8A 5KU1A 1T5LA 4EJSA 2QBYA 2W6JD 1KMQA 1G5TA 2C98A 3B1WA 2CCKA 3WHLA 1P75A 2H18A 4JLOA 4Q47A 2DFLA 1E2IA 1NMZA 3U2QA 1JR3A 3UK6A 2J0UB 4D81A 5AUQA 4NDZA 1CKEA 2NPFA 4F4CA 4BFSA 4Q1CA 4UJ3A 1G5RA 3LO5A 1QHSA 3A1SA 3REGA 1G64A 3LW8A 1ZW6A 2GEDA 1IY0A 1E9FA 1ZD8A 2GCPA 3BB1A 1C1YA 3DM9B 3MJHA 1KDTA 3EWSA 5DI9A 3MD0A 4D4LA 4XTRA 2IYZA 2ZJ8A 2YKGA 2Z83A 1DS6A 5HZKA 4DEYA 2QY9A 4KVGA 1E2JA 1R0WA 3ND9A 3D3QA 3DDCA 2JJ2A 1D5CA 1G5PA 4W5JA 5FOXA 2IHBA 4JLBA 2WSSD 2C04A 3SDZA 3ZJYA 1AKEA 1Z6YA 5G40A 1G3UA 2J1LA 2F3TA 4FW9A 3ZLJA 2ZRBA 2KBEA 1Z83A 3AF2A 4M1KA 3GMTA 4QFMA 2R62A 3W8NA 3CNNA 1XTKA 5FUWA 4KFUA 4FCWA 4U7DA 2GCOB 2YWGA 1M7GA 3CH5A 2H7VA 4JLNA 3B1VA 1E3MA 5JECA 1FMLA 2ZIAA 2H92A 1NVVR 2OAQ1 4TLDA 4L8GA 5JBQA 5EP2A 1NJGA 1N6RA 3ZZUA 1E69A 1DE0A 2CJWA 2Q3FA 4IDHA 3SJCA 2GETA 1E0AA 1XF9A 2X2FA 1XMJA 3MFYA 4JBWA 3NDBB 4JKIA 5AK0A 1D8TA 4I99A 4B6FA 2HUPA 4MRPA 4ARZB 3AVUA 2PT7A 1IXZA 1LNZA 3I1FA 4B2LA 5AJVB 2ZJ5A 3H0KA 3UANA 2V1UA 5DHFA 4RD1A 5FOSA 2F1IA 5J47A 4BLRA 3H84A 4RCZA 4K81B 5A4JA 1CJKC 2JJ8A 2VSOA 1P3JA 1M34E 2KB0A 4TWZA 5G53C 3QIAA 1E1RA 4XTCS 1Q1QA 3K0FB 4MRSA 1E2PA 4UXIA 4DDWA 4V02A 1OXSC 2DWPA 4PPFA 2AX4A 4ZPXA 4G5QA 2OEPA 3D7MA 4C7OA 3G0HA 2BV3A 4NYJR 4GRAA 1XJQA 2WPDD 1R0XA 4N1AA 4I4LA 1TAGA 1AS3A 3EWAA 2UZ3A 3QUSA 4UXHA 3OEED 3SYKA 1EFRA 2J9RA 2OBMA 3R9IA 5EP1A 3KKPA 4A9AA 5HKKA 5L3RA 4DBLC 2VSXA 4HAZA 3W3ZB 4EPYA 1YHNA 4URZR 4TQUS 1YZLA 2JIZD 4YMUA 1WB9A 4ILEA 3TKLA 2ZVPX 3AVQA 4BFWA 5C4MA 1N6OA 1KO5A 2BEJA 4LJYA 3SC3A 1YKSA 3VTKA 2FF7A 3UMSA 3RANA 4CVNA 1CLUA 1DELA 3U5ZB 1FP6A 2Z4RA 1EX6A 4UJ5A 4CEHB 3BK7A 5EZ5A 4AG6A 1KNQA 5EE3A 5FTKA 3I62A 2CCJA 3CW2A 4TQ9A 1AS2A 5LPNA 1KSHA 4Z1MD 3HDTA 3HYRA 2ZRIA 2FOLA 2R6FA 5BYJA 4HLDA 1S4QA 1GAJA 2SHKA 2ANCA 1KHTA 1KOFA 1P7CA 3ADKA 1IM2A 4DLYA 1P73A 4PO8A 2H57A 2CL7X 4L16A 4MGZR 3LFUA 2AFIE 1A82A 3KKNA 1Z47A 4C0QC 3MCAA 2FZLA 1FNNA 4GMXA 2PLRA 4JT2A 3A1VA 3P4XA 4PO9A 4H1VA 5K8UA 1N2CE 1KY3A 4JLKA 4LDJA 5JI2E 3VX3A 3OIVA 3QVVA 3O8DA 3P27A 4HAXA 5DGXA 4NYIQ 3NHAA 5JSZA 5H70A 1S1CA 4OI0A 2RGBA 4ZKEA 3U3MA 4Q66C 2IA5A 4NYMR 2JLXA 1R4AA 4CGZA 3LAWA 4C4PA 5CLLA 1ESMA 3QF4B 2W00A 1XCGB 4LK2A 4PSAA 2ZREA 4D0NA 4PC1A 1Z28A 3SU8A 2PZEA 5FPYA 2AD5A 2ZRNA 2O8BB 1Q3HA 2IUUA 2O0JA 4TYQA 2O8EB 2N42A 1US8A 4B3GA 2GDJA 1HEIA 1CR1A 3OHMA 3ASZA 5B57C 3EZ2A 5B64A 2VP5A 1OKKA 4M1OA 4B2IA 5B30A 5G41A 4GDFA 3QKRB 4W9MC 4PZYA 2V6IA 4DT1A 1GFIA 4CYMA 3FGNA 3MRSA 5AJXA 3T12A 4YQFA 5FH9A 2WMOB 3MWLA 2GILA 1KI9A 3FPAA 1XTJA 2QTHA 2W2VA 2AWNA 2CCGA 4HI0E 1LW7A 2ZYTX 2RKOA 4IEEA 1MO6A 3NBXX 4FCVA 4JT4A 1HE8B 4NU0A 4GNKA 3NDPA 2P65A 5DHAA 2FEOA 2QM8A 3TRFA 3IGFA 3THWB 3AQ4A 4LBVA 4JVMA 2ZRAA 3V4RA 1E0SA 1TQ4A 3U3RA 2WM9B 4L4UA 4TLBA 3EIHA 5FBLB 4WZAE 4DLXA 1T6NA 1JB1A 1HUQA 3FB4A 1SHKA 2OZEA 1GOTA 1ZNYA 2ODWA 4MUAA 1K5DA 4HZUB 4PAQA 5E7MA 5C4GB 1C4OA 2EU8A 4LRWA 2WOJA 5HPYB 1CRQA 1NVXQ 1Z08A 2O8CA 1SVWA 4KSCA 3NIBA 3KJIA 2A3RA 1UBEA 3ZD6A 2WJJA 2ZUCA 4LYAA 4URWR 4IJMA 1KSJA 1X1SA 3OFNA 3C7KA 1Z0DA 2W6ID 4A0RA 4E07A 3BOSA 5KSOA 4N0DA 221PA 2BCJQ 1NMXA 4AK9A 2XXAB 4TMTA 2A30A 1EFHA 1YZNA 3EASA 3TUJC 2BWJA 2YC2C 4C0AC 1W36C 1CULC 1TF5A 1N5IA 1IN6A 3V4FA 1DAMA 1SKQA 1JQLB 5J40A 3KZ1E 5JRZA 2BJWA 1YJ5A 1SGWA 4TQAA 3I73A 3IKJA 4PPGA 4M0LA 4N3NA 4X8MA 4F91B 1ZUHA 1U9IC 4RD6A 2OO7A 4US2R 2DHRA 5KPDA 4NMMA 2JCSA 2H16A 4IHQA 4D4JA 2IYSA 4DLVA 4R71A 3SE0A 2AL7A 2GEVA 4IW3B 1W0JD 1E9DA 4EUNA 1XD2A 2VP0A 3I8XA 3NXSA 1OH8A 2DWOA 2EWVA 3I8SA 4LBWA 1XBTA 5FUYA 2A9KA 4B33A 5KOYA 1G3QA 2GJAA 4TSFA 2BBTA 5LD2C 5KNDA 2IYXA 1ETUA 1FPMA 1II9A 1Z0AA 1MRNA 3MG9A 3Q72A 4Q7LA 4CW7A 4OL0A 3TE6A 1F5NA 1W2GA 1XPRA 2G0TA 4GOXA 1G291 5CIQA 4B35A 1DTSA 2HLDD 2OFXA 2AXNA 4MH0R 2HEIA 3BFXA 4HDCA 3K0SA 4DUGD 4LOAA 3AGQA 3PUXA 3CH4B 3ICQB 3K70B 2X1VA 4ASUA 4A36A 4Q48A 5BW8A 1EFCA 1YR7A 2XJ9A 5BN5A 1JR6A 2DB3A 4AKEA 4TYYA 4OBEA 5J4YA 2F3RA 4J0QA 1E0JA 8OHMA 1YRAA 2DFKB 2ZJBA 3KFXA 1XEFA 1VTKA 2QAJA 3QSYA 2V54A 2G3YA 5JZVA 5BQ5A 1N6IA 1EFTA 4AKHA 5TMPA 4L9SA 2ZJYA 2ZETA 1I2DA 3CZPA 1U94A 4YC7A 1CU1A 1KAGA 2QMEA 1G7TA 1Z6AA 1H8EA 2HXSA 3R8CA 3TK1A 4DWJA 2QAGB 1W44A 1AA9A 3J81k 5ANRB 4LC0A 1COWD 2HJVA 2CL0X 2FDCA 4MKHA 5CDFA 1KNXA 1NN5A 2R2AA 2W2XA 5H1YA 4B32A 2HT1A 1AJEA 1A2KC 5BXQC 2D2FA 2OXCA 1E9RA 1OB5A 1JPJA 3ZS9A 1F2TA 2XITA 2PZFA 1RVDA 1M7BA 1SVIA 4OQMA 3KQNA 2V9PA 1TUEA 5DI3B 2NO0A 3REFA 3K0AB 3RAPR 4B3FX 2B92A 2EFGA 1G7SA 2FNAA 3RS5A 1JI0A 3EX7C 3UG7A 3QNUA 5AR1A 4MKIA 1CR2A 1ZBDA 2GXQA 1OXUA 3MGCA 3WBJA 1GRQA 5EXPA 2GTPA 5JHHB 2QNRA 4MGYR 3H1TA 1SXJB 1ZU5A 4G01B 2IYLD 4F38A 3U7FB 1P2UA 1KJZA 3W5JA 1E2FA 1WP9A 4Z8YA 1HTWA 4KFSA 3HPRA 3L8YA 5FPTA 1S2MA 2GRJA 2ZJAA 3TBKA 5DIFA 3GLFA 1KK2A 4EFLA 3PENA 2X77A 4Q1EA 1EWQA 1XZQA 3U7HB 2OHFA 2IXGA 4URXR 4JVNA 4Q7KA 4BZXA 2NO7A 2ODBA 5L3QB 4KBFA 1KO8A 1OHHD 1IN8A 3VHXA 1RJ9B 3VR1A 5DNYB 2CE7A 3ADBA 2FSFA 1E2LA 4WBSA 5FOVA 4BZPA 1DAHA 3L8ZA 2WKPA 3ZVRA 1R8SA 1NBMD 3L43A 4CT4B 4XWKA 5DO9A 1ZM3A 1G18A 3GLHA 2F43A 2GCNA 2ZI3A 3KXLA 4FMBB 5AJWA 1WRBA 4F93B 1RW4A 4MKGA 3TUIC 2XEXA 2O8DB 2VA8A 1SHZA 1XEXA 1VIAA 2QT0A 3OE7A 4UQOA 4GBMA 2RB4A 1NP6A 4R98A 2IS4A 5F3WB 3NEYA 1AZSC 2AXPA 2B6HA 2Z0MA 2VP6A 1IBRA 3VMFA 4HUTA 4PQFA 4TL7A 3TIFA 3LWNA 3LQRA 1TQ2A 1XFAA 2MSCB 1J8MF 1GILA 1OB2A 2W0SA 4LPSA 3A1UA 4XJXA 3QBVA 4EAQA 4R7ZA 3TW4A 2QGZA 4L15A 4KAXA 3U4QB 1W0KA 4JYCA 1J70A 5FL3A 1IY2A 1UEJA 3KJGA 3L0PA 3IHLA 2W6JA 1KTVA 5M04A 1IAQA 3B6EA 3FDIA 5JMTA 4A15A 1XX6A 2WWIA 4P33A 3C4JA 4DLSA 3BE4A 1GSIA 1NI3A 4DLWA 1RPZA 2NO6A 2FMXA 4NCHA 3K0CA 2CVFA 2XTMA 1T8UA 1E1QD 3K09C 3QKSB 3HU1A 4HB4A 2J7KA 2OG2A 2WJVA 4RZ3A 3WNCA 1N25A 1X86B 3U44B 3GEHA 5HTKA 1EXMA 1WE2A 4MYCA 2WOOA 2W0MA 1OF1A 2QSZA 3HYTA 5ELXA 1QHNA 4MKFA 3RS3A 4JSYA 4KU4A 3DZ8A 2WWHA 3MUFA 5FTJA 1ZUNB 2QMHA 5FOTA 3IO3A 4WAUA 5D3MB 4EPTA 3K9HA 2WWWA 2ZRJA 4KODA 5GJCA 3CM0A 3FKSD 1JAIA 2PCJA 2RMKA 1OXVA 3CPEA 1GP2A 2GF0A 1YQTA 2JEOA 4TMKA 3AP1A 1MV5A 2WSSA 4JVLA 4MRRA 4PHHA 1NKSA 1VG1A 2CDNA 5KO2A 5KUTA 2FZ4A 4LY6A 2BM1A 2WVJA 4DB4A 2IEYA 2YJTD 4PQYA 1W36D 3SOPA 4U02A 5FR1A 4Q01A 4XH9B 3W5IA 3BFKA 2ZR7A 1E9BA 1F2UA 1TL7C 1W48A 1VHTA 3IBYA 4PC6A 3UIEA 1IXRC 5FFMA 2DCUA 2QPAA 4G1UC 4V0KA 4QM7A 3GD7A 4Q9JA 4A6XA 3B9QA 3GJ0A 1GG2A 2H5EA 2JA1A 2GHIA 4PSVA 1G17A 2XNDD 2ZSAA 2PL3A 2CHVA 4BFTA 3B1XA 1XTIA 4V0ME 4DRZA 3NHBA 1TUIA 4K46A 3IUYA 1KI8A 4RFSB 2GNOA 2G1JA 3PCRB 3QXHA 1P2VA 1S3GA 5GJWC 2CHQA 1JEEA 1Q3TA 1CJUC 3TR5A 4FMCB 4WIAA 4WZBE 1EG7A 2J87A 2WSMA 1XNJA 3OAAD 1FQJA 4BEBA 2OLKA 5F9FA 4A8JA 3VFDA 2PLFA 3AVWA 3ZH9B 3QE0A 5L3SA 2KSQA 2QN6A 1D2MA 1IN4A 5C46F 5JJKA 5JJLA 1N5JA 1YZTA 2AKYA 2MSDB 3K9GA 1LV7A 1U2RA 3TVTA 3IQWA 4WXRA 1MKYA 1UKEA 2GK6A 1SZPA 2EWWA 3EARA 4HZIA 3VU9A 2ZI5A 4ZI3A 2IS2A 1M2OB 1KAOA 3C8UA 5DYGA 4Z8XA 3EZFA 3SQXA 3PJRA 1LS1A 1ZD9A 3P4YA 2YINC 2VH5R 2WHXA 2ZI4A 3A37A 2WPDA 3AF0A 3CRRA 5KHOC 3RWOA 2EYQA 4BASA 1E2QA 1ONBA 5SZKB 4M53A 3IDQA 3OEEA 2WTUA 1KI1A 3ZD7A 2HV8A 4DSUA 521PA 5EE9A 3NVAA 2QE7D 3MWJA 2ZE7A 2BOVA 1NVUQ 1GIAA 4EJSB 2QBYB 1FX0A 2JIZA 2CMKA 5EJEA 1Z06A 2OM2A 4G5OA 5IT5A 1E96A 2QI9C 4XIGS 3GJ7A 3ZQ6A 4FMDB 2C78A 2PX3A 2CNWD 4OQFA 1F60A 4QKQA 3C15C 2VHUA 3ZVLA 3QEOA 1BH2A 2Z5FA 3RS2A 4KLZA 1RRCA 1KY2A 2ZXUA 2QGNA 3H2YA 1KO7A 1DAFA 5GJVC 4PC7A 4Z1MA 4IOMA 1KI4A 4QXAA 4KHZA 3TSWA 1NN3A 4Q4JA 4Q9IA 1AM4D 1BYIA 4NYIR 4JLJA 2BHRA 1DVRA 5GVRA 3UKDA 1P9NA 4HSEA 2IC5A 3CF6R 5CITA 1VDZA 2VSFA 4BE7B 2ZAMA 3B9PA 3CUEF 4RJLA 1XTSA 1MOZA 4TT3D 2PH1A 4JYBA 4L5BA 3FFBA 4DEXA 1XXHE 2R6DA 1NSFA 3CLVA 4M9ZA 4P4TA 4A2PA 3ZVMA 3AVYA 3PEYA 3A4NA 3LNCA 3QKTA 1G3RA 2I1QA 3ZIAD 4US1R 3AP2A 1B23P 4BFVA 2K5UA 1M1YE 3FKQA 4HYYA 4D2IA 1OPXA 4LJ9A 5CK4A 2IYWA 4Q7MB 2B8WA 4LBYA 3L0OA 3CO5A 2IYUA 2PJZA 2GESA 3ICEA 1CJTC 2R8RA 3KJEA 1SXJE 2JLVA 4TL8A 1W2HA 2G77B 1BOFA 4FIDA 3WP0A 3QOFA 3GLGA 1II8A 2EW1A 3AH8A 4NONA 2QT1A 2P5SA 1PLKA 1V43A 1OIVA 1WXQA 2CJWB 3T61A 2F7SA 3LLMA 2RCNA 1HT2E 2VYFA 1QG4A 1LVGA 3UPUA 3X1ZA 1OT3A 1BS1A 2NOAA 1GVNB 1SVKA 1EFUA 4V0LA 2JASA 4Q5IA 3TSZA 1JJ7A 4B75A 1GKIA 4PHGA 1E9CA 2NQ2C 2GZDA 3EAQA 5AWFC 1OYWA 1GRNA 4FI3C 4B34A 4QNMA 2OCBA 4OI4A 1UDXA 4WXPA 4GI7A 3UG6A 1AGPA 2J3EA 3NG1A 4PSKA 1KZGB 5FTMA 3SNHA 4U5XA 4ZDJA 1G7RA 1F3OA 4XVUA 2YOFA 1GNRA 2JLWA 4PFSA 1L2TA 2IUTA 1EESA 1NLYA 2OFWA 3EZ7A 4Z54A 4IRUB 4PO1A 3GJXC 3GLIA 1G8GA 4QJ5A 4C7OB 4QHSA 4DXAA 1RIFA 2QSYA 4I1VA 1UEIA 3OF5A 2GWHA 3CBQA 2DR3A 4XD7D 2ATXA 4FMDF 2EYUA 2CLDX 2QP9X 1FP7A 1OH7A 1XMVA 2ZRFA 1PLLA 3ZVNA 3VQTA 3VR4A 1GL7A 2Q9CA 1L4UA 2IWHA 2WAXA 1QHGA 4QOSA 2NO9A 2IS6A 1JJVA 2G88A 3X1WA 4N0EA 4Q18A 4AYWA 3GJ3A 1ANKA 1UAAA 2ONKA 3KKQA 4TYPA 3LVRE 3D6TB 1PZNA 4Q9HA 5GJBA 2WJIA 1N6NA 2P67A 3IIJA 1KK1A 2Q9BA 2AKAB 2W6IA 3AEZA 4CEIA 1MO5A 3CX8A 1YZGA 3W3AA 1R2QA 1NLFA 3WP1B 3BS4A 1GZSA 5FL7D 1KO1A 1HA3A 4PQRA 2KJQA 3T15A 1CR4A 1TU3A 2A5JA 4GMDA 3T1OA 5TXGA 1G8YA 3M0EA 5EXXA 3CF0A 4OQXA 4AYXA 4E09A 1YR9A 4BFYA 1U8YA 5A0FA 3AKEA 4MUBA 4KO8A 2P6UA 3FMIA 3RDPA 2PMKA 3KKOA 3OESA 2WJHA 5IK2D 2OBNA 4OHVA 4O2RA 4QHTA 1XCPA 3L82B 4BRUA 1IHUA 3BIFA 5JEDA 1W0JA 3PUWA 1TU4A 1T8TA 1V5WA 3P32A 5KDLA 2P0EA 4II7A 4CEHA 3ZYCA 3Q7QA 4OYHA 1P4SA 2IEZA 1FQKA 1RKBA 2Q6TA 3NTUA 1QHYA 3LRPA 1C9KA 3NBFA 5DH9A 5JSZB 4P4SA 3Q3JB 1XTQA 4DB2A 4TTQA 1TMKA 1JEDA 2GXAA 2WIAA 2WMNB 2Q3MA 3ONWA 3THOA 1VG0B 3B82A 1NLZA 1SVSA 2HLDA 3JVUA 3WYFA 1D6JA 2A78A 4DUGA 1GM5A 4M21A 3JZMA 1W5TA 1OIWA 3O8CA 3SJBA 4W7SA 2WJYA 4IFEA 1VCOA 5EXTA 1UBCA 2PMDA 3SYLA 1US8B 1P60A 3IEVA 3NBZC 1FTNA 3NH9A 3U6BA 5CB6A 2AWOA 3LQQA 4BLOA 4B3CA 4DT1B 3AB3A 2QZ4A 1MRSA 2AFHE 2G0NA 1CXZA 2H17A 1UBFA 1UADA 2JATA 2OT3B 3CR8A 4NP6A 3WYGA 4D4MA 3S1AA
chains in the Genus database with same CATH superfamily
1JMKC 4LV5B 4WV3A 2MR5A 2GX6A 2P6OA 1FFHA 2ODNA 3NATA 3R3WA 3K9LA 4PINA 5LC1A 2N46A 2ZAGA 5I3CA 4P82A 2NSJA 2RHCA 2O8FA 4RTPA 4G0PA 5TEWA 5KX5F 1Q91A 4ZICA 2TMKA 2RKWA 3E7XA 3LXUX 3OT1A 1FDRA 3I52A 3NAGA 4CZ2A 1E4OA 4QUKA 4TRJA 5KYXA 3EAGA 1COWA 2QZPA 1L5ZA 4ZDKA 3SXPA 1SHLA 4RZXA 1KR2A 1X1CA 1NQUA 1DAEA 2XWJI 1GGNA 1U0TA 2A4MA 4IJKA 1T1JA 2B8TA 4TMZA 3CEMA 4IVPA 3PTLA 1F1JA 3T3DA 4ENTA 2WIJA 3OX1A 1IBLB 4DS3A 9LDTA 2AMYA 3IULA 4JI6B 4DW8A 2FR0A 4CEJA 5FD8A 2WYOA 1HLFA 2XD9A 4WBXC 4MR9B 1XRMA 2V7GA 2O8CB 4H18A 2YN0A 1IK4A 3HEBA 4MARA 1FRVA 4BDTA 5CBPB 1LU9A 4S35A 5FYDA 3P0JA 1TIKA 3N7TA 4Z51A 4PR0A 2P9QA 4YAJA 4ADSG 5GADl 1PV1A 3SXUB 2EJUA 4CTNA 2BGTA 1FOEB 4X1IA 1XLTA 3SDBA 1DQZA 3HK2A 5A0VA 1RLOA 3HZRA 4EHFA 5KNCA 4ZAGA 3LPLA 1RYDA 2C92A 4GXQA 1XMSA 5AICA 1FYWA 1YCHA 1Z9BA 2CD7A 2PBZA 4MDHA 5JSUA 4G86A 2XQGA 1JU3A 1ZRNA 2RGNC 2OO5A 5JPIA 4MUGA 4R01A 3OLQA 3T1TA 3IFSA 1V26A 3DFUA 1JLKA 3STWA 1MB3A 4DC9A 1QFXA 3MJTA 3I2HA 4M3NA 3H5WA 2GAJA 2CLFB 4NAVA 8LDHA 2QTRA 1QIJA 1XELA 3T4EA 3RBVA 5DBEX 1ZGGA 4LJ8A 3TEMA 4QUDA 2YYAA 1ONSA 3AY7A 3N53A 4Q9NA 2HHJA 4N0QA 4CKBA 4CQNA 2KE5A 5LOVF 2IYFA 4MV0A 3UC9A 4P3OA 4UHKA 5EIWA 1Q92A 5ULLA 1KAMA 2OYCA 3K5IA 2E1RA 3UT0A 5KTNA 4ZQFA 2R7LA 3B12A 2BF4A 4L51A 2P5UA 3RRBA 3TINA 1ZD5A 1UBJS 3H2ZA 3K7EA 4ZV7A 1L8AA 2XMPA 4F21A 4I81A 4BV9A 4FHGA 4P22A 2C7VA 1NQTA 3IAM1 3KVNA 3A2KA 4WDRA 4F96A 2TMGA 1BKDR 1P1IA 4PCLA 2PZ8A 3CISA 1S2GA 4QG7A 3RVRA 5HUQA 5K0EA 1TYDE 3OPXA 2OV2A 3IXMA 3ZV4A 2QQFA 1SXJC 3RSGA 1VYHA 1VMEA 1ZGHA 3C3XA 3N07A 5EIAA 3UB3A 2ZPUA 4AZ3B 3GH3A 4WY2A 1AQYA 1JXOA 2JH3A 4HNRA 3KQUA 1U3VA 1WCV1 4OQEA 3BJMA 1JFRA 3OTOB 1QFMA 5MGNA 4TMFA 2WKQA 3WL7A 3CY6A 5IWCA 5KNBH 2JJ1D 3BILA 3E8XA 3NIDB 3SJ7A 4TMXA 7REQB 2EIXA 2OKCA 3W6NA 1TUBA 1E2BA 1XTRA 4WLNA 3U3ZA 1WUHS 1I2CA 3MUOA 2ET6A 1QH1A 3AUXA 4R8LA 3AI1A 5AM0A 5FV7A 3WWCA 5LFAA 1XRQA 3OF2A 3T1QA 3E48A 3ONEA 3VX4A 3O8OA 4A8HA 4QU9A 3B7WA 3RF7A 1SH7A 2HIGA 5AM1A 1QTQA 1G21B 5A62A 8ABPA 3F71A 5GZ3A 1DU4A 3SM3A 2DBZA 4G25A 1GT91 1VPDA 3DZCA 4RE5A 3PJEA 3GC6A 4AI6A 3NVMB 1U28A 1UPXA 1PYDA 5LIPA 2XV1A 4R6XA 4QGFA 2POCA 3KBOA 2EJWA 4KBGA 4CL3A 1G60A 3HLKA 5ES4B 1NDUA 5LDDC 1POXA 4L4XA 3ZYZA 2QQGA 1CUEA 1XMQB 1DARA 3GDGA 2IHYA 2PGXA 3MQ2A 1E1QA 1DJLA 4GBED 4DSTA 4EENA 1CF4A 2W4QA 3H7AA 1JQ5A 5BVGB 1C7EA 3MQ4A 4MYTA 1KVSA 4N47A 2R6GA 2MSWA 1LTHR 1S96A 4PEVA 2IT1A 1ULHA 3JQ6A 1AQNA 2J4CA 3CRNA 2RDMA 4JUAA 1E94E 3VSCA 3E3MA 3LQ2A 3ZHCA 5C18A 6Q21A 1WG8A 1HE1C 3R5XA 4NCNA 1SHUX 4KLRA 4LCEA 2P35A 3VNSA 1EXVA 3QX3A 1C0LA 2YMMA 3F7MA 3E8SA 4Q4AB 2AFRA 1JA1A 5M29A 1IOZA 3UJAA 4C0KA 1XXHB 3NBQA 3ZDXB 1MHPA 1SIOA 4AIRA 2FFQA 4IDPA 4JLDA 1M73E 4N3CA 5CX4A 4X20A 1Y89A 1M1YB 4GPEA 2B8JA 4HH1A 1QGUA 2H6EA 3NV7A 2HFJA 2BTOA 4QUAA 2G0AA 4C07A 3DFMA 5E6UB 4UDOA 3F5FA 2GYUA 1RHUA 3KSDO 4Y2HA 2XHZA 1WPXA 2YRFA 3MTQA 4WINA 4BLVA 3RC3A 5A5GA 1F0NA 1WEHA 3U5TA 2O0LA 1KEZA 1S3FA 3QE4A 5IBRA 1TK2A 4EHNA 1U3WA 4AJ9A 3HFRA 2DJIA 1JUDA 5T6MA 2AMJA 1W2WB 3GCWA 4OA5A 4V2UA 5JC8A 4QXRA 5LXTF 3ANYB 3GGDA 1SFRA 3Q85A 3GYGA 4BUCA 3RH0A 4K6KA 1NIJA 3A6PC 1NW5A 4NFLA 5MN6A 4QNRA 1V8ZA 1WZ2A 3ID6C 1B15A 3VHXB 4DCVA 2Y71A 4WOJA 1T1GA 3P2MA 3RPEA 1DKNA 2EEZA 4TVKA 1EUCA 1RXCA 1RQPA 1E32A 1X7GA 1DWUA 6REQB 3I01M 2HK7A 1Y48E 3R9KA 1YT5A 4CQMB 1MMFB 2QJRA 4IQ8A 1X7DA 3ESYA 1RRMA 3PV0A 1VKJA 1OTYA 2BP7A 2FI1A 1CDOA 4X7BA 4JP2A 4B82A 1R0SA 4OV6B 3TF5A 1ZR2A 3GN1A 1N5LA 3LZCA 4DEVA 5HM8A 4LJAA 3WMFA 3DEHA 1Z5ZA 3RVLA 5TGTA 1F17A 1V4VA 4MHSA 2D1SA 4IHAA 1JDTA 5J5CA 4N8DA 1QHIA 8MHTA 1TVMA 1R27A 2J3JA 4X54A 3M6AA 1YB2A 1GPDG 2CDBA 3PC3A 4YGYA 1P9OA 1WLYA 2I22A 3DMDA 3T5BA 1B2LA 8ATCA 5J4LA 2OKGA 2X0KA 4JYMA 1GKUB 1QYVA 4KO3S 2VJNA 5LYYA 3UUEA 4INZA 4YV2A 5CNMA 4G41A 5K3SA 4TMWA 2AYXA 4WVLA 3A1WA 3Q88A 3ZGLA 1RXSA 3AV3A 4BZQA 2PH7A 4ZOAA 2P4HX 2EDAA 3D7NA 1JEOA 2M98A 3QXXA 4GECA 4TRRA 3AOGA 1V3VA 1NFQA 4CPDA 3T9CA 2AN9A 1K7SN 3GEEA 1PNTA 5JNVA 2XF2A 4DMGA 2AJBA 4C88A 3BERA 1L5RA 2VYVA 2D7JA 2DBYA 5BT9A 1IQUA 2NN3C 2ZXEA 3KSUA 3DL0A 2GEUA 4JD5A 5I8ZA 4REMA 1M34A 1E66A 2W2KB 4I3HA 4EGAA 2ZTHA 4DYDA 4ZRMA 3UT6A 2QMYA 1SPBS 4TYWA 2A5FA 2OY0A 2YNMA 4TTSA 1V8OA 2C2YA 3ORRA 4Q4HA 3ABQB 4UDNA 4WCFC 2FN3A 3HSKA 2H4HA 3EH1A 4WOKA 1E3TA 2J9FB 2JGRA 4X5OA 5AYVA 5A6SA 5DGDA 5ALFA 1M2VA 1FNCA 2QQ5A 4XA8A 1Q57A 4B09A 1AK2A 4MQFB 4D9IA 2HO5A 3DE3X 2CMDA 3WMEA 1J7KA 1W4RA 2DR0A 1ZHFA 4TTAA 2DUMA 2BIFA 7AT1A 1I10A 2DOKA 4NNPA 2WTXA 5MGBA 2ZRGA 4ECAA 2AXEA 4FOOA 4JT8A 4QIHA 3MT0A 4C4AA 3TRJA 1E1LA 2CXNA 1Q3KA 2CB0A 2D2VA 2WJPA 4Y3UA 1E3QA 1VLMA 2CB9A 2CFSA 3GW8A 2WVAA 1QKIA 4ATNA 3VDXA 4B3BA 1U1DA 2GBLC 2J4DA 3PDWA 1EA5A 1L5MA 1E8DA 1X1RA 4TTRA 2C61A 4PSUA 1Z45A 4YCJA 3SF8A 4F86A 3N6RA 2Z9CA 1SUDA 3LHKA 2Z43A 5JALA 2Y2UA 1KVQA 3QXCA 13PKA 4IDOA 2GZHA 4TUYF 3DYBA 1TGYA 1ZQ1A 3ZLVA 2PCLA 2VEOA 3KQWA 1H2FA 1QF6A 4Z0TA 5JCXA 1EK1A 2FN4A 3G82C 4YRDA 4CG2A 3PKIA 4RHCA 3UHOA 1Z33A 3WDSA 4M76B 5C5IA 1PWEA 4J94A 4P5DA 4B43A 5LA6B 5KSPA 3TWOA 3WV4A 1T0JB 5CFPA 3RRJA 3KJNA 3QMPA 2R79A 3VXKA 2G1PA 4NF2A 2C2HA 4RSHA 1JECA 3ZKAA 2GPTA 4OF4A 1XEWX 1C4KA 1P5FA 2XGGA 1N2CA 1B2RA 1F12A 1WKBA 2AOUB 1L8LA 1T9BA 3CSUA 4UAGA 3VR5H 4B8ZA 1T36B 5CDUA 4IVQA 3S1SA 3PQDA 4XJVA 5DB4A 2F55A 1MABA 2XTZA 3D8TA 5IUKC 3ETLA 1V5EA 3NANA 3N1UA 4X94A 4B6GA 4KVAA 3F3YA 1Z6XA 1CK4A 2E6KA 2ZUVA 1H0KA 1LF5A 3EIWA 2ETXA 4LV6A 3DF9A 1OYVA 3R3JA 3OIDA 4MR8A 1ZESA 4KXYA 2UVPB 3TLCA 4ETMA 1GPWB 4BGDA 3L0ZA 2FEMA 3C5VA 3KQSA 5E6RB 5CFLA 4F0JA 2WUVA 3V1KA 4HDNB 2XMGA 4LDZA 2FG6C 4LJ7A 3O8RA 1G9SA 2RBKA 1PWHA 3ULKA 3MGKA 3PSAA 4XRGA 1NJ6A 4PVCA 4UTOA 4D0GA 4QFDA 4TVSA 4D46A 3O7MA 2RD2A 3B53X 2VTDA 2GAIA 3EDRA 3CUWA 2JAQA 3IO5A 2Q1YA 3RABA 2J0QA 3QVSA 4TWJA 1IU9A 1LPAB 5AKKA 3SEQA 3F8SA 1DIRA 3CPJB 4K9LA 5CNIA 4CUJA 5AVRA 3EG5A 3VZCA 4DBVO 4BEJA 2Z2XA 2AFVA 1NVWQ 1E1CA 2HDNB 2O1SA 3WIDA 1XZPA 1UQTA 4IJUA 4XLTA 3L0BA 3R41A 4H1HA 3MWYW 2YC4C 3THXA 5KPJA 1T3SA 2WP0A 4BQFA 3U9SA 3JQGA 3ST7A 2I2BA 5BW6B 4K88A 4L5AA 1JDSA 4CQLB 3R8XA 1MH1A 3JQ9C 4BB9A 3LLVA 3UVEA 4ZXFA 1Y7HA 2GZMA 4JR0A 4KX5A 2IU0A 1JQJC 2QRKA 4RTJA 4COKA 1LSSA 4QM6A 4Q9DA 4QWWA 3GFOA 3KFVA 3VKGA 1LFDB 1HY3A 4HVCA 1C4WA 1L7OA 4BN0A 3OOJA 4EECA 3K6SA 4L72A 5BSGA 3TZLA 2Q9AA 2AC7A 2WABA 5LWQA 1K92A 1MVOA 2GAOA 1YE3A 2R6JA 2BEVA 4CM9D 2QLLA 4D3ZA 4ZRNA 3KKMA 1WD5A 1MAHA 1UIMA 3GEIA 3VNQA 2M1XA 3GGPA 4WXMA 1QH8A 1FXSA 1GR1A 2H8KA 2C88A 5CT6A 1VL5A 1UXGA 2ODEA 3IP7A 1XQWA 3AIMA 1PGPA 3IPYA 3LQFA 4MYDA 4EKNB 4K6CA 3LNTA 3L1JA 1HKHA 3R3VA 3ZU5A 1HETA 2Q0QA 3VKWA 2I6UA 1X8KA 3WKDA 1GQSA 2EKLA 2LCFA 3W6PA 4NV0A 1WCXA 2VRBA 4DM4A 2PSHA 1UZAA 2FX3A 4YAOA 3VV3A 1C30B 1DJNA 1C41A 3G7NA 1VI5A 5DSXA 4DSNA 1P91A 4XYBA 4BP9A 3SHVA 2ORED 5IK2A 1H0SA 3LHSA 5F23A 5AQEA 4UVGA 3DA8A 3K6RA 1VJDA 2YFQA 3RVQA 5KYUA 4EUKA 3LT1A 1L0BA 3ZJTA 1IBSA 1DIOB 1T8SA 4GH5A 4C30A 2C5FA 3INGA 1JZSA 4JBGA 2LW7A 1WSWA 4Y2RA 4U2DA 3ZXSA 3EPLA 1NXSA 1MO4A 4YLYA 5DDIP 5JEEA 1WXXA 4IEIA 4L4SA 1FTGA 1UJ4A 3DBLA 121PA 4KGVA 2C8JA 3UMCA 1JFLA 4O1IA 1O96B 2FE4A 2G9RA 4OGKA 5G4KA 3JPWA 2V0GA 3LK7A 1FRQA 1NONA 1ZGCA 3JAMA 3PE4A 1P1JA 2X4IA 4JFAA 3WE7A 4A2CA 3VZDA 4AIIA 2JJQA 3DDUA 3VTFA 1ZVVA 2G71A 3WYEA 5I7RA 2QVXX 1DTWA 1EFKA 1GUDA 3DOOA 2XB4A 3QUCA 1THGA 1WHSA 1LLUA 5J4HA 3GXBA 4QRIA 4C5AA 3QA3E 1GPNA 1YFJA 2VFAA 4Y6OA 1DX6A 5REQA 1RI4A 3T34A 1LBHA 5HILA 5ICSA 2DSNA 3DZJA 4ZCLA 1M74A 4G4GA 4MVJH 1WCWA 5F1PA 4ZFNA 4CKZA 3RU9A 4CKWB 1CC1S 2VUTA 4GYKA 3PT9A 3O2QB 5IS2A 1RFLA 1TKBA 1N6HA 1CYDA 1GU0A 1T5HX 3FJ1A 3TR0A 2V9ZA 4PZLA 1V16A 4NENB 4AECA 1XDBA 2VYNA 1EGHA 4ZXPA 4H6VA 4DABA 1MT3A 2Z2ZA 2WA2A 5CVTA 3N2LA 1I7DA 1N34B 3IQXA 3AV0B 3VSBA 4DIEA 1G0OA 3EJWA 3EGOA 3MCUA 3QG1A 3EPKA 3DE2X 3ZQKA 3VKUA 1BROA 3DGFC 4QBIA 4HATA 3R9WA 4X8LA 3PT5A 1RYYA 4S2EA 2W8BA 1FYEA 2QOEA 3PNKA 3DXZA 1GT6A 1DO0A 2P8SA 1TQDA 3QFFA 4KQKA 4URHA 1NT4A 4K9DA 2G70A 2QUHA 5CYOA 5LQAA 1M1NA 3VDQA 3ZJVA 2R47A 3GRFA 2A9JA 2VDLB 3STUA 1QQ6A 1FU7A 3PDHA 4I5GA 4V03A 4WZ6A 2D2IA 4ARZA 2YTZA 4AUEA 2JFZA 4L75A 4LZZA 4HTFA 4PGGA 1XAHA 2EFJA 2XQVA 5KDDA 2PKQP 4QUEA 1PE0A 1DXQA 1O87A 3EC7A 1ENZA 4M1SA 3T3IA 1BA3A 1CY2A 1EAYA 1GXSB 2GK3A 4CM5A 1CDDA 1XCBA 3OT4A 4CF4A 4E5MA 4EY4A 4UQLA 3A1FA 1QLWA 1JKFA 1K9SA 2PT5A 2DVMA 3KOXA 3LK6A 3UXMA 4DV7B 4N41A 5FWNA 1JVBA 2D2EA 5F5NA 1SBZA 1YQXA 2IEGA 3EN0A 3VU8A 5EJ8A 5LUAA 4JZKA 5IVHA 3DCNA 1T29A 1VJ0A 2C4NA 1HDGO 2VEDA 3OIWA 1I4LD 2YYZA 1QV9A 1W5BA 1HXHA 2ORYA 2D4HA 1XP8A 2J4FA 4UU8A 2H7XA 3WDLA 3NV9A 5LNK1 2P7HA 3R4VA 1LJLA 2O7SA 1T9HA 2C7PA 1RLIA 4UMFA 3P20A 4L6CA 2GA8A 4Y2JA 3E5NA 3ROTA 5KX5A 3L40A 1AV6A 3BAZA 5COQA 1OBHA 5H4HA 2GZAA 1JQKA 3GDOA 5DGTA 1JEYA 1Y6FA 2M1ZA 1JPNA 2H3HA 3LY7A 4MA5A 1OY1A 4A82A 5JH7F 3FHOA 3H1EA 4RHEA 3QVMA 5DN6A 5JQGB 3MWDA 1ZM9A 4FC7A 4X60A 3GBPA 4QTUB 2CFCA 1LZLA 1VE6A 2IXAA 2ZJ2A 1XTPA 3IIKA 1K8QA 4JKYA 5GGXA 2NP6A 2DKOA 4C5CA 1LTKA 2O9JA 3FCYA 2JAXA 4PW0A 2A5YB 1HQYE 4INPA 4JJZA 3GCGA 3FLMA 2A5DA 1C3LA 1KYWA 3QFHA 4NICA 3IUMA 4G1EB 1E18A 1U98A 3LA6A 2REQA 4P4SB 3NHYA 3VNRA 1R7RA 2I4NA 2VLBA 4BJ5A 4HQRA 1U4OA 3AVVA 2JZCA 1TYEB 3EYWA 3SZ3A 1V0JA 1RFGE 5H3LA 2O3JA 3TXYA 4NVRA 4OOEA 2Q46A 1LKZA 1KY5A 1QVZA 4BUJA 2X3UA 4QZVA 4CN8A 2R5WA 4RY8A 1KWGA 5B5SA 5LL6P 3U7IA 2IWRA 4NK4A 2Q45A 4Y9RA 3SP1A 2OXFA 1L4YA 3K2IA 3OCUA 2RH4A 1IFXA 1KGDA 4LV8B 5H80A 1N9GB 5E9WA 3RS0A 3SHWA 3UWOA 4NKRA 3WSTA 3PTZA 3TB6A 5C5EA 1ZH8A 1MG5A 2KYRA 3LX6A 2WZDA 4PXYA 3OEHA 1VKRA 3AHEA 3LLSA 4AY3A 4OI2A 4LN1A 3HPQA 3IR5A 4ID9A 3W9SA 2IS1A 3N70A 3M9LA 3VZPA 4C7KA 1GTL1 1KRWA 4MGHA 1REQB 1NW9B 3B48A 5DN9A 1SVMA 1QCDA 4RXTA 3GK3A 1SU7A 3IKLA 4MW2A 5ENZA 2H0RA 5IYZB 4GZLA 2G7ZA 3T9BA 5KS2A 2HC9A 1O6BA 1V5FA 2O5RA 3CPHA 3HUUA 1NQVA 3H0CA 4Z3KA 4RK5A 5DTQA 3C3YA 2Q2VA 3SI7A 2HIHA 2JDIA 4L8FA 2IU4A 1T0PA 1N3LA 3RYHA 3SM9A 4BVAA 2QYSA 3PEFA 2PXCA 1CJVC 3FVTA 4LHVA 4C0BA 3HB7A 4DCUA 2ASEA 1MD9A 1I6WA 3CRZA 3D0QA 4QBFA 4QTTB 5TV2A 3G1TA 5SYNA 4D9CA 1KJ8A 3F3MA 4LGYA 1BHSA 4QA9A 3BMNB 4FCTA 4AWAA 3DHWC 2WIKA 2AIRA 2X76A 5I01A 4JXJA 1IJEA 2IYRA 3KX2A 1Z63A 5CDTA 3I1IA 3WMWA 2ZS9A 1N78A 1DIBA 1KDRA 2CSUA 3LU1A 3MWEB 4FFRA 3RKSA 3BDVA 3L8EA 1P0IA 3C97A 1TYZA 4B3JA 1QWSA 2FW7A 3JW8A 4R05A 1ZM4A 3FSRA 3VO9A 4PQGA 1HEYA 3IX7A 5CRIA 2HOQA 3UMBA 5C8VA 4OCZA 5EMHA 4KUGA 1FIUA 3NCTA 1OYOA 4WVFA 4CCWA 2YWCA 3FMGA 4J29A 4RXMA 1B8PA 1IZ0A 4OLHA 5J59A 5T8KC 4URVR 2EHJA 2EERA 1IL0A 3ZHOA 4WUTA 3ODPA 3ZLUA 1E1KA 5JRJA 2H00A 4J7UA 1NOKA 1Q22A 2CLIB 4I50B 4EA6A 2ZS8A 1M1UA 4JJKA 4LYHA 4DQVA 4EUFA 2G08A 1UQRA 2MOKA 3FJYA 1WHTB 3BWMA 3PXEA 2HPAA 4PLWA 1OYYA 4LE2A 4OM7A 2VWQA 4HDQB 5T4FA 5JNSA 1AVTA 4Q3LA 2EBWA 1NJ2A 4ILKA 5COBA 3RTAA 3TD9A 1UK7A 4RHXA 4Q9AA 2YWBA 5LBTA 2D5LA 1EIZA 2JJYA 2E6UX 2OP1A 2UUCB 4P7JA 5C8YF 4IQ4A 1A9XA 4PLHA 3CZ9A 1C1DA 3GMDA 3CUYA 5IC6A 5JNRA 3R0XA 4P4NA 3USZA 3L01A 1BJTA 2YHSA 2C2WA 5IASA 4E5YA 2ZCVA 5CXXA 1R16A 1GG9A 2Q4RA 3F3KA 4J9VA 4KXXA 2NTYC 2AC4A 2P5YA 1RTKA 1EE9A 1YK1A 2P62A 1NW8A 2PGDA 2Z95A 3B2NA 3L7JA 3NHJA 3PUIA 1CQXA 3QEJA 3KZNA 4O25A 2CLOB 4RLHA 1BE6A 2EOAA 3OOSA 4FFOA 3V1UA 4J4BA 4HQNA 3BF8A 3HR8A 2R7KA 2WHQA 1DLIA 1PFYA 2HX1A 3K1AB 4LSMA 4RCYA 5T67A 3ZWVA 4NYJQ 1N1DA 1ODFA 1TZMA 2O7NA 3DT8A 4UNPA 5CR9A 4KWEA 1XU7A 2H51A 2O3TA 4OU4A 1JNYA 5ILQA 4A4DA 2OYRA 2F9MA 3KJHA 1LRJA 5DHUA 2E4XA 4ITRC 2QYHA 4V0MA 3NCHA 4KHPB 1U5BA 5TY0A 4KCGA 1JIKA 1QM5A 1Z2AA 2CXRA 3H97A 4R6WA 4DUZB 4DOMA 4J4HA 3A9WA 1ZIYA 1W34A 5KJFA 3HXTA 2ZVQX 3IXQA 3JSXA 3L9XA 2O3UA 3F47A 1HLGA 1KVUA 1XMPA 3NGLA 4S1WA 3ZLBA 4B2PA 1EX7A 4Y6LA 1VYVA 2EQBA 3EFHA 3T38A 4BMVA 3W8RA 1Z8HA 1FZQA 1J07A 1AMNA 4FFPA 5D7BA 4DCSA 3E84A 1WSBA 2GN2A 4F9TA 721PA 2FE1A 2QMOA 1IATA 2XE6A 4EG8A 3UATA 1CQWA 1D9ZA 3HYNA 4IIGA 3TR6A 4DM3A 3THYB 4RZ2A 1Q1GA 1XNHA 2N1MA 2O2IA 3MVEA 4I3GA 2AMLA 3H9JA 1UPUA 1LC0A 1K5PA 2QTLA 3F78A 2HYIC 1RXYA 2DUWA 3O3MB 1T34A 4ZAWA 1KPIA 1RRKA 2UKDA 4A0QA 1XNGA 2AQ8A 2CE2X 2NV6A 2PL9A 1L3BA 2ZIEA 4E31A 1D6NA 4AG3A 5LXTA 5I4CA 4E30A 3O90A 4LOHA 4BU0A 2C29D 5TMEA 1YBAA 4QQNA 4LBZA 4A8TA 1RQ2A 5E0OA 4OP2A 1TO1E 3CLRD 4AICA 4OQZA 3X1MA 1N6KA 2CJPA 4U3JB 1OT5A 2QRPA 4QFBA 3R44A 4BPBA 1RHQA 4U2KA 5JO0A 3PC8A 2DPMA 1AURA 1B42A 4KK3A 1ZOOA 5BRAA 1Z0UA 4JYPA 4YJ2B 1Q0LA 3VPDA 1L5OA 1FW6A 2DUNA 2AUNA 5IUJC 5AK3A 1DV1A 3AR8A 3DNFA 4I1IA 3BX1A 4HB0A 5AMXA 3K4QA 1MAVA 1X6VA 4HNAA 2FAXA 4MUKA 5ALUA 5TPWA 1ZC3A 8GPBA 3ED5A 2V0CA 4ZGGA 5AXAA 2WFLA 3HV2A 3I2GA 1ELOA 5J9FA 2GUGA 2YH2A 5EIXA 3SN6A 3D5QA 3GLIE 1OKKD 3PRJA 1NM5A 4QYMA 3RC7A 1WNFA 1Q0UA 2DWQA 3CRVA 4LDAA 2GM9A 3JWJA 2G7MC 4QE3A 2HWYA 1UH5A 1N0HA 4O4IA 3S2UA 2ROQA 3TQSA 3I23A 1A9OA 4V1CA 1JQBA 1IXSB 5H3HA 3B3JA 1N2BA 1L5WA 1Y1QA 2F1JA 2I5PO 2EKPA 1GKYA 3WKCA 5EJ9A 3JALA 2VHCA 2Q2OA 1JKIA 3QLTA 3K9QO 4I8XA 1W36B 4KXUA 3BKWA 2OCPA 2ZSJA 3OE4A 4YP5A 1GNQA 1BD4A 3A6KA 3H16A 4R9NA 4C7BA 1Z38A 3ECCA 1L4HA 4HH4A 2FUCA 2L0XA 3I58A 5DXFA 3PEUA 4DKXA 5FPHA 1B8VA 3FCAA 5B3LA 3IUEA 2YWHA 3PRYA 1MJGA 4BLPA 1OFGA 1BCRB 2IDMA 3AXSA 3T41A 4CUZA 1YO6A 2H4WA 5IFKA 5JTUA 4XQ9A 1PD0A 4C1NA 4F06A 1QHXA 3W9YA 1TQHA 1O9BA 1XN1A 1XROA 2BM0A 2XIQA 3QWIA 4JSTA 5FUXA 1ZUIA 2VYQA 1HYQA 1DZIA 4Y2SA 4TYNA 2O2YA 1Z4QA 4A2WA 3N6XA 3SKXA 3K0AA 4B31A 5IZCC 2IW1A 2OC9A 1W1UA 4RETA 1Y4DE 1O2DA 3QPAA 4H7HA 3ADCA 3C6YA 2PRZA 3G9XA 4U00A 3LGAA 1E2HA 3W04A 3D2CA 1EWRA 1YKFA 1JDZA 2J5QA 1B26A 2HDHA 3DE7X 4YT5A 3ZGNA 5ILOA 2V7WA 2FPMA 4ZI7F 2WHPA 2XB6A 2PUFA 4R69A 1QOPB 4DCTA 1P2FA 1U0OC 2B8EA 3H4IA 3MTIA 4IDAA 4IL5A 3GFGA 3GR6A 5CPBA 4A1FA 3OX4A 3PPXA 3TMKA 2PWAA 4HDAA 5CH8A 2ZJ7A 3GHYA 1S8FA 3L3BA 4XWOA 3CRW1 3DM5A 3LQYA 3RK0A 3PQ8A 5B12A 1U1EA 5A9TA 4A8PA 1ID8A 2FVYA 2I2FA 2NWQA 3IIIA 2OLEA 3NORA 3HNRA 5L53A 2JVIA 4PRKA 5GIPE 1UM8A 2ECOA 2WUDA 5CIWA 1XZEA 1ACLA 1P4GA 1DP4A 4IS3A 4YONB 1LPBB 5L3QA 1AKVA 1H2BA 4ZDWA 3L7MA 4YACA 4KIUA 4ENSA 3PFNA 4NCKA 3W5HA 1UKAA 5I8PA 3A2MA 1CZNA 2FPKA 4XARA 3RFXA 2H11A 1WO8A 4NOLA 1JBQA 1Z22A 2PHZA 4YHBA 4TL9A 5ICMA 4I55B 2NU8B 4GKBA 5LB2A 2J7PA 4PTLA 1AH2A 5AT1A 4D3SA 1IG3A 1MPTA 3ELUA 5E95A 4ZK6A 2AHOA 2XVZA 2L42A 2ZSDA 3VU3A 1R0LA 2HA3A 3IQEA 1QZ3A 1UC9A 3L4EA 2VNHA 4JAVC 4POAA 1SXQA 3I04A 1ULZA 3WZLA 5KHAA 3VHRA 1Y8CA 3GBVA 3CX7A 3BJRA 1RAFA 3CWQA 1ETHA 3AJDA 4KDEA 4BX9A 1CQIA 4LFAB 1HOXA 4AJ1A 1X9GA 1QRRA 2QUZA 3IQDB 3OCJA 4OHKA 2FG5A 3RU3A 3UT5A 5DM60 5IG2A 5KIAA 1A9QA 3HXPA 1E5TA 2HRZA 3AM5A 1CR6A 1Q44A 2WD7A 3HA3A 4HJXA 4R1SA 5C5DA 4U4AA 1JA0A 3EXAA 4F92B 1JSCA 3GARA 1HQCA 3HI4A 3N6VA 1M72A 4QOFA 1NXXA 4TSRA 3QEKA 5B7QA 1J00A 4KUHA 1GZ6A 5AW9A 3DBOB 3KL2A 4NATA 5EWLA 1T3TA 3IP6A 2C2MA 4M0CA 4UARA 5F98A 3D8SA 4YAKA 1JIIA 4NPCA 3C8DA 3CKLA 4ERXA 3CNEA 2BFDB 3U4QA 2RHTA 2YL2A 4RBNA 1FF9A 3RUEA 1EVKA 4N01A 2HIAA 4XB1A 4DIFA 4EF4A 4YECA 1XKXA 1U1CA 4HN4B 4MQEB 3TPFA 3AG5A 1YJQA 5JCOC 2GGSA 1DKPA 1TRHA 1X2EA 3OTHA 3GEDA 4J1TA 2XJ4A 4LHSA 4BRZA 1NNSA 1EFVA 3KT0A 3T95A 1G8JA 2R65A 3DB2A 2IOYA 5F78A 3O8QA 2BKUA 5DNUA 5ALPA 2IP4A 4PZZA 3E9YA 3U7JA 3ZBPA 3NRCA 3U44A 5L8VA 3ZZMA 5EPUA 3RCBA 1E0KA 1DC3A 3HXQA 1CNEA 2BM8A 2Q4TA 9LDBA 4U7JA 3A25A 1BIFA 3B1ZA 1K7EB 3KV1A 1GPYA 4FHZA 3U3KA 2CLEB 1ZQ9A 3UUFA 2EBFX 2QM3A 2PU7A 3FSEA 3PR1A 5D3MA 1R74A 3WLHA 3FYUB 4DCCA 2WV9A 1JTVA 4RACA 5FTWA 3SF0A 1ZG3A 4GIBA 4PYIA 4CTMA 1T1RA 3DJFA 2XNSA 5HRCA 1BQEA 3J80A 3FUCA 2B3TA 3ELYA 2ZIVB 1ILEA 4ZIRA 2NVUA 5J2UF 3U3JA 4UFPA 1WSAA 2NX2A 3PITA 2CXXA 4GI3A 2XTNA 1P1CA 3GPBA 3M3PA 1VPTA 3VR6A 2W6OA 1T1IA 1O77A 3MMXA 4U2EA 4QGHA 5K8CA 4O2BF 2B25A 3K94A 5DWVA 1V96A 1YAHA 3P0RA 2Q3CA 2WTMA 1W85A 3WBFA 5IHPA 1W59A 2CLSA 1TD9A 5ALSA 1R0RE 3E1SA 4CUKA 5HQ3A 5ALLA 4RIFA 1FBNA 2GHRA 3A6GA 1TOAA 3A05A 1J06A 2QVBA 4MJ7A 2J09A 4EA8A 5CXQA 1YQGA 4X3OA 1NBME 1L7PA 4HH3C 2X9NA 1N5OX 3PXBA 4RENA 1KJ9A 2XDQA 1D1SA 4KTVE 3TNFA 2OCDA 3CE9A 3BGSA 3H83A 3LE8A 2AOVA 3SVTA 1RXEA 3PVSA 3PFGA 1OXKB 4L95C 5GIOE 2EW2A 3UQZA 3D1VA 1T2EA 4LF8B 1E7QA 3G2QA 4EF6A 1UFKA 1VIYA 2CK3A 1XU9A 2JGNA 2VHEA 2PGJA 3DEFA 4ZOLA 2QRLA 1KDPA 4KDCA 4JLPA 2BFNA 2Y2VA 3ESQA 4XI9A 4CT5A 2QXUA 3NMUF 3HO8A 1UC5B 5U4QA 4OHPA 4FX5A 1MAUA 1RC1A 3Q40A 5EMJA 1JPVA 3MB5A 3CYFA 4WOPA 1SBNE 3ENZA 1O95A 2FUEA 3FLAA 4HLCA 5IJXA 1CWUA 4MYRA 1NJ5A 4NE2A 1UFRA 2R87A 5DBGA 3EVCA 3VVMA 1NJ1A 3BH6A 2GK7A 2VPQA 3U49A 4MUIA 2I9KA 2PZGA 3ZY2A 2R8OA 4K05A 1JHAA 1H8HA 1H3EA 5HBRA 1EK6A 8AT1A 3CF2A 5KYKA 3GJYA 4FWBA 2MINA 1M2OA 1UFQA 1K8ZB 4JWKA 1UOQA 5ADHA 1YVUA 4M1YA 1JV2B 2JIDA 2FLKA 3NW9A 2DAPA 4WT7A 4ZGWA 3WGVA 3GD5A 1WVIA 4DV1B 3IV6A 5EIBC 2CNKA 1ZVQA 2FRVA 2RH8A 2UZAA 4X71A 3V8NA 4C0LA 4ID3A 3QENA 1TA0A 4LZPA 4I3FA 1IY8A 4G89A 4U7WA 4UM7A 5AJHA 1UMCA 5FBRB 5GM1A 4ZYXA 3QXJA 2Q5IA 4R68A 2WNHA 3NH6A 4W5HA 2V7VA 5TGDA 3WOVA 1W0KD 4GVLA 1XD8A 3HHEA 4JIGA 1VGQA 4RL4A 5AW4A 5MFPA 1FSPA 2AJDA 1EB8A 1G2OA 2ZDQA 3K0HA 1KMQA 4PRZA 1G5TA 1W4LA 3B1WA 2QBYA 3AUFA 2P4UA 3LUGA 5IBPA 4HQ6A 7YASA 2CCKA 4J91A 2NSHA 4N5IX 2P1RA 4JLOA 2DFLA 1E2IA 2J0EA 2FW8A 4JXZA 3DXYA 4JBNA 1WV0A 3WNQA 2RIRA 4LY0A 4RJIA 3TZBA 2JGDA 4P38A 4UJ3A 1G5RA 2R8EA 3LO5A 1KP9A 2IV7A 1ZMOA 4MGEA 3U44B 4E7OA 3IA7A 5BWCA 5JDCC 2X5XA 1WZIA 1ZW6A 3LF1A 4XWGA 1QLHA 2Y9MB 1T35A 1IY0A 2GCPA 1ZD8A 2Q0XA 1OWMA 3KQVA 1ZOSA 1SRRA 2AZTA 3ONVA 4UPDA 4C4ZA 1Y6JA 3EWSA 3KCQA 4D4LA 2PWZA 1MB9A 1CHNA 2NLOA 3LWZA 3ND6A 2ZJ8A 4KQEA 4NZOA 3VGPA 5F7ZA 3TTSA 3RYIA 3TPZA 2XMQA 2GCEA 4RMIA 4JDUA 3STYA 3BHNA 3OLYA 4DEYA 1WMAA 3ZE7A 3ILXA 4FR0A 1R0WA 3ND9A 2Z30A 4IUYA 4XWTA 1D4OA 3KCNA 4HVTA 4LFBB 4E5SA 9MHTA 1LXCA 4B3HA 2PMFA 3SQOA 3QYFA 1E1YA 1U9JA 1YL7A 3EXHA 1JJFA 2BELA 2PBLA 3L41A 1S7GA 4JLBA 3K0KA 2WSSD 3ECSA 2C04A 1FFYA 3SDZA 5FDFA 1AKEA 3EMBA 1U0GA 1G3UA 3M6VA 2F3TA 1KHHA 1O94C 3KDPA 5D6NA 3ROZA 1AK1A 1DWOA 1T9GR 1VSBA 3U31A 2R62A 5FUWA 5F1YA 4KFUA 4P84A 2V9CA 4M38A 4U7DA 2YWGA 1NUAA 3DVQX 3LA8A 5JH7A 1M7GA 3TQRA 2H7VA 3WX0A