3FMPB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
LVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein/hydrolase
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmpB00
5J4YA 3MGCA 4MYTA 1RIFA 4DLUA 4DVGA 1VPLA 1P9WA 2WSSD 1P72A 3NXSA 4PHGA 2IWRA 1J99A 2WVJA 1KDTA 1S9HA 4LHWA 4BLQA 3GLGB 1O3YA 3PUYA 3FMFA 4D25A 2GZDA 3BK7A 1E9EA 2ONKA 2AD5A 1SVOA 2CBZA 2GCOA 3DZ8A 3QJYA 4NCKA 2Z43A 1C1YA 1KNQA 2ZJ8A 4M9QA 3DOEA 2NPIA 1S3SA 5EXSA 3T1TA 3EPJA 1GIAA 2AWOA 1XPUA 2F6RA 2CE2X 3H0KA 3D3QA 4DRZA 4C7OB 2QAGA 3SJBA 1F6BA 3K9NA 3QXHA 4WXRA 2IEYA 1W5SA 4Y0AA 3LWNA 4DIEA 5B2ZA 4JBXA 1P5ZB 4OJKA 5D3QA 2GAAA 1W4BA 2MSEB 1G17A 4TMTA 4Q4LA 1MO6A 5EJEA 1IOZA 1NKTA 4YMUA 2G83A 4WA7A 1XTJA 4UJ3A 5FL7A 2XJ9A 5UKDA 4NCNA 5DO9A 2JGNA 3VR6A 1IQPA 5AJYA 4QNRA 3WRYC 4DLWA 2JDID 2J87A 4TTRA 3BB4A 4JLAA 3EW9A 1IY2A 2V8OA 3LLMA 1XEXA 2BMJA 3PVSA 1U9IC 3EAQA 2N42A 3WHKA 3PUXA 4ZI2A 2WM9B 1XMSA 4EJSB 4URUR 5B58C 3CZQA 1KSJA 1KO8A 1KI3A 3A4LA 4RZ3A 1QHIA 3D31A 4CEIA 1E1QD 1PVOA 4PO9A 1T3LA 3VMFA 1J70A 1T8TA 2AKAB 1SKYE 4FMBB 3CUEF 2R6FA 1HT2E 4PZYA 2FE4A 1Q1BA 4QNMA 3P1JA 1FQKA 3B78A 4UXJA 2ODWA 2XJ4A 3ZVLA 1XFAA 2ZE6A 4G5RA 4CF7A 2GVDC 1CJVC 2F7SA 3EZ6A 2REOA 2NOAA 1FMJA 2PZEA 1EGAA 3C4JA 1CBUA 2FA9A 1KI2A 1T91A 3MWJA 2GXQA 3GFTA 4C2UA 1UADA 1E9CA 4LBZA 3DZDA 2JLXA 3BH7A 1DAHA 3AVOA 1AA9A 2BEKA 2PBRA 2JLSA 4NE2A 2IA5A 2UKDA 4AI6A 2JCSA 3TLXA 4N1AA 4LGMA 4TLEA 5EZ5A 1G6HA 3HPRA 3SFVA 3THWB 2ZRKA 1YR6A 1G3UA 2GILA 3R8FA 4CGZA 5F98A 5FPSA 5TY0A 3KKOA 3T5GA 1Z0AA 3LO5A 3NG1A 2NIPA 4LOAA 5KDLA 1JEEA 2GETA 5AUOB 2QP3A 2DCUA 3PQCA 3U44A 5DYIA 3RVBA 4MDFA 4LI0A 1T9HA 1Z6XA 4BLRA 4N3NA 1SKYB 1X6VA 2WZQA 4OI2A 3L43A 2JLUA 1EFTA 2CNWA 4GL2A 1A5TA 1ZD1A 4EPTA 3LX5A 4MRPA 1M7HA 1QHHB 1COWA 2ZYUX 3SJZA 5FR1A 3SHFA 2CCKA 3CPHA 1UFQA 1JJ7A 1LNZA 1Y63A 3H2YA 2WSSA 4F7WA 1KMQA 1L7VC 2O0KA 4ITRC 1JBKA 1ZC4A 3BERA 4IKEA 3K0SA 3P4YA 2FWRA 3RS3A 1L4YA 1VCOA 3WY9A 5A4JA 3Q85A 3QNUA 3RWMB 2MSCB 2HCBA 1IXSB 1N6HA 4CIDA 5FUVA 2IL1A 3EZ2A 4S2EA 3CONA 4EPWA 2J5XA 2WOOA 2AWNA 1GILA 4ZCLA 1NMYA 4I99A 4ESHA 3U6BA 3CR8A 4PQYA 2F9MA 4EUNA 1MKYA 3BXZA 3KUCA 4BZQA 2FSGA 3C15C 4P0TA 4LJYA 1A1VA 4G5QA 3EPKA 2DB3A 4RFSB 1R8QA 1R5OA 1OE0A 3A1SA 2C9YA 3IGFA 4M4SA 5BN5A 3KTAB 2QN6A 3QF4B 4CT5A 3WMEA 2DR3A 4M9ZA 4YMVA 3ADBA 4YDHB 1GNQA 2JDIA 4Q4AA 3OE7D 2PMKA 1ZU4A 2ZI5A 4P4UA 4GZMA 4XVRA 3LXRA 2YINC 1S1CA 1Z2AA 3KKPA 1OXVA 5JS8A 5L3VA 2YHSA 3AVXA 2OM2A 1UEIA 5CJ2A 3FTQA 1UM8A 2V7QD 1KO1A 4B35A 3EX7C 4Q9LA 5CM9C 4EPRA 3RC8A 4A8JA 4MRRA 2R65A 1E1QA 4Q48A 3W3ZB 2ZYTX 3SYNA 5LD2B 4QBHA 4QHSA 3PFIA 3LX8A 1UKVY 3RANA 3WYFA 2DBYA 2J1LA 4OK5A 1G8GA 1DPFA 1QHXA 2ZQ5A 1CS4C 5E4FA 2XOKD 2IXEA 1UKYA 1VIYA 1J90A 1G18A 1Z06A 2IYYA 1SZPA 2MMGA 1HE8B 4W5HA 4C0KA 1N5IA 2HEIA 2A9KA 1G7RA 1R0ZA 2P5TB 2HJGA 3CNNA 2O8EA 1FX0B 2OEPA 2R6AA 3BFVA 1N2CE 1XNJA 4JS0A 3QKSA 1VIAA 4WZ6A 2REBA 2P6RA 1FP7A 1HY3A 2VH5R 5G53C 3UPUA 1R5BA 3GMTA 4C3ZA 2FSIA 2X8AA 4RD3A 4BWYA 1TAGA 3T06B 3BORA 3QBTA 3K9HA 4GOXA 4AKHA 1YR9A 4Q1AA 3SZRA 1AKYA 2D2EA 1Z2CA 3V00A 1YZQA 3GJ3A 2QL6A 3BC1A 2I3BA 2KBFA 1KO5A 4LV6A 3K0CA 2A5YB 4V0ME 1ZBDA 4G0NA 1GP2A 2QROA 2ZRNA 3O8DA 1Z6YA 5C2JB 4TL9A 1Z6AA 3RRZA 2W2XA 3IPXA 3K0EA 4PC3A 2UZ3A 2GCNA 4QJ4A 3W8NA 1NLFA 4ERNA 4WBSA 2ODBA 2FFQA 2VIIA 4F4CA 5KNBA 3NHBA 3QKRA 5JWHA 2D3WA 4MUAA 4AYWA 2RGDA 3KKNA 2CEAA 3LV8A 3E2IA 2W2VA 5FOUA 1FQJA 5FOSA 2JIZD 2Z4SA 4FMCB 1PLLA 2ZSBA 4EJSC 5SZKB 3VU9A 4QHTA 3TR0A 5BXQC 2VHCA 3IBGA 4M1SA 1DTSA 2FSFA 1KAGA 2ONJA 2QSYA 1XXHA 2O0HA 2O8FB 4UNNA 1AZSC 2FF7A 4HEJA 3N70A 3RLFA 4AYXA 5HCNA 1YVDA 4NCIA 1U99A 4BEJA 1DOAA 3FWYA 1I2DA 3ICQB 4ZI3A 2A3RA 3U3OA 2DHRA 4LJ7A 1YKSA 3RS7A 1IXRC 2FGKA 2VF7A 4B71A 2KWIA 3K0FA 3U2QA 4BGDA 3VR4A 3LBHA 4B2PA 2VP6A 2V3CC 2RGBA 3U4QA 4GFDA 1OH6A 2IXGA 4GZLA 1XZPA 5F3WB 1AS0A 1N6IA 3KB2A 5ANRB 2WTUA 1G1MA 2C5LA 3HU2A 3I73A 4QM6A 2ODEA 4Q7JB 1EESA 1N5JA 1E9BA 3OEED 5JS7A 1HYQA 2A5DA 1Q3TA 3W6PA 3SJCA 5EE3A 2V7QA 2C9CA 4YXWA 3GLHA 1IXZA 3CRW1 4FCWA 3SC3A 3UATA 1G4AE 1ZU5A 1ZM2A 2IYWA 6Q21A 2Z6VA 4C0QC 2NZJA 2QRNA 4IDPA 2PCLA 2RGEA 1CULC 2XNDD 4OK3A 4A2WA 1G8HA 3THXA 2HYIC 3LVRE 2R2AA 3KKMA 2W00A 5KNDA 1EWRA 2QP9X 1LS1A 5JSZA 1XCMA 2H92A 3IQXA 4AKEA 1U81A 1F3OA 5GJCA 1BS1A 4JBWA 3CH4B 1YZUA 4IHQA 3EXAA 1OXXK 1OYWA 2GEUA 4DT1A 1GUAA 4HUTA 1KMHB 1M1YE 2ZS8A 4X8LA 1JEDA 2PX3A 1XTKA 3KQHA 5JLJA 1T3HA 1W0JD 2AR7A 1T0JB 2QTHA 1UBGA 3SDZA 4DCTA 3O8BA 3KB1A 1DS6A 1G20E 3KQKA 4PTLA 2CL6X 1AQUA 4KJZA 1ETUA 4QBGB 4BFVA 1TNDA 4XD7D 3H4MA 2CLCX 1PLKA 1KKLA 5A0FA 5E7IA 4C0SA 4PHFA 2BJWA 3LQRA 1LTQA 2NO7A 2JATA 4KVGA 3AGQA 1TPZA 3AUXA 2QMHA 1ZD9A 3E5HA 1NSFA 3GJ0A 3AF0A 2RGXA 1Q1EA 2WSMA 3ADKA 1QBKC 1A2KC 2ZEJA 2ZS9A 2EFEB 2V1XA 1IN8A 2FOLA 3LLUA 2ZI4A 1NN3A 2FX3A 2ZUBA 3E1SA 3BE4A 2ZIAA 2JIZA 4L4UA 5IF9A 1SQ5A 1XPRA 1GTVA 2WJGA 1CJTC 4JVLA 2VF8A 4UNRA 3DMDA 1BMFA 2OG2A 5FTJA 2QSZA 3TKLA 3NC0C 4HAYA 2WMOB 4I1OA 3U61B 5FI0B 521PA 3UG6A 1ZC3A 2BC9A 4B48A 5LD2C 2QQEA 2ZE5A 2ZRFA 4A0GA 2Q6TA 4KXFB 4B3XA 1AKEA 1OKKD 5J4KA 2QBYB 4H1VA 4CEJA 1GKUB 3WNCA 4LZZA 4DSUA 3CRRA 1E96A 2OSBA 3NTUA 4UNPA 3A4NA 2QTFA 3IHWA 5CB8A 1T6NA 3BB1A 4IXNA 4P4SB 1IM2A 4R2IA 3QF7A 3Q5EA 1TU3A 4EIWA 1W36D 3ZGXA 2F3RA 3RS2A 2XXAA 1WMSA 5TV2A 4GP6A 1RYFA 1WBDA 3IPYA 4PSKA 5SZHB 3CW2A 2OUKA 1VCNA 1W1WA 2F43B 4BFZA 4C0HA 3LW8A 1LS6A 2HJVA 3ASZA 1FP6A 1EWQA 2NGRA 1W5TA 2OV2A 2GZHA 2GJKA 3GLFA 4JL5A 3W5IA 2R9VA 1IN6A 1NJFA 1UJ2A 5KPDA 3RHFA 3THYB 1G8FA 4BQSA 5FUYA 3NKVA 3G82C 3KUDA 4CEHA 1X86B 2WKRA 3L0IB 3VTKA 1X3SA 2L0XA 2QGNA 1Z0DA 3JVVA 2EQBA 2V9PA 3BS4A 2ZPTX 1DAIA 3EWSA 1WXQA 3QPUA 5K8TA 4DUGD 5CB6A 1CJUC 3NEJA 4TQAA 1RKBA 3OESA 4M21A 3T35A 3HU1A 4LDJA 4JVMA 4YQFA 1P2TA 3N2IA 5FPTA 1KSFX 2W0MA 4B2IA 4XTRA 2VQSA 4HB3A 4JLBA 3TVTA 2GEVA 2ERYA 1IY0A 2GK7A 2EU8A 4LC0A 1GAJA 1S0UA 2RAPA 1TUEA 2A5FA 5BWMA 4WAUA 3VX3A 3B82A 2J46A 1PJRA 1QZXA 2Z5FA 4RFVA 3QXCA 1D8TA 4PSAA 2QE7D 1I4DD 2WPDD 4LYFA 3CPJB 3C8UA 3RRMA 3I8XA 3NBXX 1MRSA 4TSFD 1IY1A 2RGNC 1CR4A 4TL8A 1FW6A 2WAXA 1OFUX 1C4OA 2YNMA 4O2RA 4BE7B 1CJMA 4QOSA 2IUUA 1YE8A 1UPTA 1D6JA 1W2GA 1R5NA 1YU9A 4ARZA 2BCGY 4HYYA 5ELXA 2SHKA 4ZO4A 4DC9A 2O8EB 3OF5A 4EAQA 1TUIA 3UK6A 4D4JA 4V0NA 1XD9A 2JJ2D 4JZKA 3WRXC 2F3TA 2JLQA 4FN5A 5CIQA 1DVRA 1E1RD 3VR3A 1GG2A 3U3JA 1CTQA 4HB2A 2RGCA 3TGPA 4OHYA 3I4LA 5KU1A 4FIDA 2VYFA 1V5WA 3RRYA 2JJ8A 2AKYA 1LVGA 4I1SA 5M04A 3CF6R 3SOPA 1AS3A 1W48A 1VG1A 4D81A 2BOVA 2QT1A 1EX6A 2D2FA 1S1MA 1XCGB 1FPMA 4M0LA 4P32A 4QBIA 2G77B 2K5UA 3RABA 3GQBA 2W83A 3REGA 2VHJA 3O8RA 2AFIE 1YZNA 2XZPA 1IONA 3B60A 2BBSA 3MWLA 4EPYA 3EZFA 1RYHA 1E4VA 1NY5A 2WAYA 4NYJQ 5KSYA 3TUZC 1OFHA 3UIEA 5EXPA 5FUWA 2B7CA 4CZ2A 2OLKA 2WWYA 2XTMA 1IJFA 3V4RA 2WOJA 4HDOB 2OLJA 3BJIC 5DYGA 1G3MA 4L9WA 2IWHA 2C2HA 4MDEA 2WBLC 2FPKA 1NL3A 3LXXA 1CRPA 4XWOA 1Z83A 3KJGA 3HDTA 5KSZA 4HLCA 4MQBA 2RB4A 4B32A 3B1WA 3GLHE 2HLDA 1P2SA 4TLBA 1R0YA 4D4KA 4LWZA 4FI3C 1ZIOA 1KSGA 4Q4JB 1QF9A 4RKEA 3KQUA 1SGWA 1I2MA 1WDTA 2ZJ5A 2QQ0A 4A92A 4RCZA 1G7SA 3TQCA 2BBTA 3T1OA 5L8VA 3S1AB 3IUYA 2ZRMA 3OIWA 4BZPA 1SVMA 3UWOA 3LW7A 3EA5A 4HLUA 1Q0UA 1JQLB 2DWQA 4LC1A 3TAHA 4NBSA 1KY3A 2OBLA 5CM8B 1JR3A 1E9RA 3LDAA 1DG3A 3HU3A 1RRFA 4FW9A 3T61A 4BLOA 2HXSA 4HDQB 1G7CA 2B92A 2G9NA 3RDPA 4DUGA 1U2RA 2OCYC 4KFUA 1VECA 2GDJA 4L8GA 4TYWA 2EYUA 5G3ZA 2Q9AA 3MD0A 1E79D 3AVTA 4Q4HB 5J4HA 4BECA 5AUQA 1VDZA 4IDNA 3LNCA 4MYCA 4GBMA 3CNLA 5JRJA 4C0JA 3T34A 5EE0A 1OH8A 3G5UA 1Z0KA 4BLSA 2P2LA 2XTNA 3MJHA 3BFXA 4DCNA 1G16A 3B1YA 3AQ4A 4M1TA 3TVDA 3GP8A 4PR0A 1NIPA 1GNRA 3QEJA 3GLIB 3LD9A 3TW8B 2EFHB 1JAIA 1PUIA 3R9IA 5C1BA 3EARA 4BLTA 4O0MA 2ORIA 1P6XA 4M53A 3NBYC 1F48A 1G3QA 3AKCA 4TTQA 4Q1EA 1BYUA 1N6PA 3K9GA 3C14C 4TMVA 3CWZA 4DLYA 4AKGA 4WW0A 4QL3A 1R0XA 1C9KA 1RJ9B 1Z6TA 2F1JA 2ZRDA 2JJ2A 4G3XA 2FFAA 3TR5A 2ZJAA 3ZIAD 2FMXA 1E1RA 1YRAA 1Z29A 3AF2A 5FI1B 3TUJC 3FMPB 2J7KA 1ZNZA 2HT6A 1H8ED 3PEYA 3BFKA 3GJXC 3AH8A 2BWJA 4QG7A 1W47A 2FN4A 4PPFA 4F93B 1SXJE 4KV9A 3KXLA 5J40A 621PA 5DE3A 1Z07A 2XNSA 3WHLA 2WWXA 4OJQA 4O2LA 3B9PA 1GWNA 1G5TA 2A30A 2C78A 2ZJYA 3GEHA 1KI4A 3VR2A 1OLOA 2VEDA 4JMPA 1NNEA 1FTNA 4GDFA 1VYVA 1G5RA 3WP1B 5AUNB 5DIFA 4IXMA 4PPNA 4URZR 4EPVA 1VTKA 1M2OB 4NHOA 4DKXA 3EZ9A 3L0OA 1GL9B 1DO0A 2WJJA 1G7TA 1NBMD 1XD2A 1U8ZA 5DSZA 3U6KA 4HATA 1GZSA 1WE2A 3A1VA 4MKFA 3IO3A 4TMXA 4PPGA 5CLLA 1T5LA 4XIGS 3X1ZA 4P4TA 1CKEA 4B6EA 2HF8A 1ZMXA 1GITA 121PA 1IN7A 3Q9LA 4HAVA 1DE0A 1FTSA 1Z8FA 4A8JC 1U8AA 3QVUA 4B76A 2E87A 2O8CA 1F2UA 4HAUA 1D2EA 3QXXA 4OKSA 3SFZA 1SXJB 4KYIB 3NBZC 5L3SB 1F2TA 4LV5B 2QGZA 3CNOA 1E2GA 1CR0A 1NN5A 1AZTA 1R2QA 1L8QA 1MO5A 1MOZA 4JYCA 5C4MA 3HYRA 1LV7A 1YHNA 3U5ZB 3HP1A 1AQYA 2Q3MA 2BM0A 2WWGA 4U02A 4TYNA 3VNVA 3VKGA 2GJSA 4PZZA 4OQFA 1P75A 4LBVA 5K8UA 5DN6A 1FUKA 3EPHA 1TU4A 2GXUA 2KE5A 1GRRA 2BV3A 1XP8A 1OXUA 2ANCA 4JL8A 3GJ6A 1HV8A 4W5WA 1SVSA 4H9GA 1X8JA 4W9MC 221PA 2VBCA 1E79A 4D4MA 3TQFA 3CZPA 4MGKR 3R7WB 5AK0A 4HB4A 3QI2A 2IYTA 3MG9A 2F9LA 2H7VA 4TL7A 4PC6A 5GJVC 4C2TA 5F9FA 2RHMA 5KDDA 3T1VA 4X8OA 1RRGA 2UVQA 4ZKEA 4Q1DA 4U7DA 1KJZA 5BQ5A 3CX6A 3TH5A 2J0SA 3DO6A 2Q3FA 3PEUA 1NI3A 2DWOA 1WP9A 2PJZA 5D3MB 2PLFA 1G3RA 5LPNA 2JAQA 3QPVA 1ZCBA 1TQDA 4LHYA 3KXKA 1H8HD 2ASEA 2ZI6A 1XB2A 1M6NA 4Z51A 2QNRA 3SYKA 1GVNB 3B5JA 3K0AA 4L9SA 2FSHA 2IUTA 5JEDA 3TE6A 3ETLA 2J0UB 1QVRA 1T0HB 4IRUB 4RVCA 1MABA 4BRUA 1U90A 2AXNA 3HPQA 5AJVB 3EPLA 4DSOA 5CITA 4M1WA 1Q21A 1XTQA 1KK3A 2VHTA 3TSZA 1YZKA 4E07A 3EC2A 1E2PA 2GXSA 1KI1A 1Z0IA 3FB4A 4ZDWA 4XVQA 3GEEA 1U9IA 4LHZA 4G1UC 1W46A 2IW3A 2CMKA 3PR1A 4JLJA 2OAP1 5FBWB 2F55A 2PX0A 4B34A 2D62A 2FH5B 4RD4A 3VR1A 4EDHA 1XMJA 2DFNA 3DKVA 4GOJA 5E3HA 3QSYA 4AG6A 3G0HA 3AF1A 3OFND 4MGYR 4H1UA 4HZUA 4YLGA 3FVQA 3EA0A 3RNLA 4A9AA 1Q44A 2OFWA 1QVAA 1SVKA 2ANBA 2FGJA 2DFKB 3ICEA 1U0LA 1EG7A 4AC9A 2NO6A 1XMVA 4TYPA 5HZHA 4MRVA 2NG1A 3CPEA 3DM5A 2WJIA 4I4LA 4NYIQ 3VKHA 1Z3IX 4G01B 3CRQA 2JJ1D 2IEZA 2AN9A 2O8BB 2CK3D 5DI9A 4KHZA 1ZP6A 5HKKD 421PA 2J41A 2N46A 4L16A 2EYQA 3GEIA 1NVVQ 1JR3E 3R9XA 3OIUA 2D74A 2YWFA 1E2LA 1WBBA 1NP6A 1DAFA 4IOLA 1II0A 4JKYA 2ZI7A 2HDNB 1EFCA 1XWIA 5EP3A 2NMVA 2E9SA 2FZLA 4GMXA 4ZCMA 4EKDA 4C4PA 5FOVA 1N6NA 2PT7A 4AKIA 2A5GA 1N6OA 1KI7A 2V6JA 5FBRB 2BMFA 4JIMA 4FMCF 1NRJB 4DLVA 2GKSA 2CJWA 3CWQA 4BRWA 1P2VA 1OXTA 2Z0MA 3RS0A 2A78A 4D4LA 3IO5A 3NH9A 1S9DA 3U7EB 4B6FA 4FCTA 1X1SA 2DY1A 2JA1A 4EQ6A 1HUQA 2FU5C 2G88A 3IEVA 4FMDB 1US8A 2GHIA 821PA 2ZUCA 1TL7C 1E32A 2BDTA 4A6XA 2GJAA 2GRJA 3ZQ6A 2XSZD 2VHUA 3I62A 4PAOA 3PXGA 1G8YA 1M74A 3OAAD 4HUQA 2OFXA 4UQOA 4IDQA 1PV4A 4OL0A 1P3JA 2BVNA 2GA8A 3B1VA 4W5JA 2NQ2C 2XTZA 2ZRGA 2WICA 4UNQA 2HXYA 3DMNA 3U3RA 4TQUS 1QHSA 1F60A 3X2SA 3QEOA 1AM4D 4ACAA 1E2MA 2H57A 3REFA 3W5JA 4EFMA 1H8HA 4Q01A 2J7PD 1OHHD 3K09A 3ZZUA 2R62A 3GJ5A 4F92B 1UBCA 1T4GA 4ON9A 4UKDA 4DLZA 4DDWA 2Q21A 4B33A 1OYYA 3ZZTA 4P31A 3WBJA 3ADCA 1MO4A 1S2MA 1U94A 1OT3A 1JB1A 1MO3A 5E95A 1Z08A 4FD2A 1KI6A 1SXJC 1SULA 1Z5ZA 1II8A 4N0DA 1CIPA 3OE7A 2GCOB 1NKSA 4PQRA 3MJRA 3AUYA 1CR1A 2CLSA 3NIBA 1G8PA 3CR7A 1OB5A 2CCJA 4NYJR 4DB2A 4MGZR 2IXFA 3OZXA 4AWXA 3QE0A 4B74A 3PENA 5FTKA 4HB0A 1FMLA 2QAGB 2J45A 1DAEA 4IFBA 4F4JA 3QXJA 3OFNA 4PHHA 4YDSA 2G1JA 2CHVA 1CJKC 3B85A 1A82A 2ZVQX 4PSVA 4TQ9A 1Z0JA 4Z1MD 2PJRA 1G6OA 4E09A 2WV9A 5CK5A 1ZM3A 2MMCA 1AGPA 4JT2A 3RS5A 4AYTA 1KZGB 1EX7A 5KTYA 2WKQA 2KSQA 5CYOA 2KI5A 3I3SR 2XOKA 3IDQA 3TNFA 1NG9A 5L3QA 5K8LA 1XEXB 1P73A 3L8YA 4TLCA 5FPKA 3IHLA 1W0KD 2QPAA 3BH0A 3EZ7A 2JJ1A 5JHHB 1G4UR 3X1XA 4LJ5A 4J0QA 3GLGA 4NL4H 3B2EA 3B6EA 3ZD6A 4CEIB 4RZ2A 4QJ3A 4OI1A 1DAMA 1UDXA 4HAXA 2WHXA 4G5SA 3NEYA 1R0WA 1ZNXA 3NHAA 4LX0A 1TF5A 1D5CA 2BJVA 3UXMA 3U3KA 1JNYA 2P6NA 4OI4A 2IF0A 4JVNA 3P26A 4DDTA 3TRFA 1KY2A 4URWR 1DG1G 2FZ4A 2GK6A 1A7JA 4C7OA 1FL9A 3BWDD 2CHGA 1XD8A 3F0TA 3ZYCA 3WYGA 3CM0A 1N25A 2WWHA 2WIAA 4NKRA 2O5VA 3W6OA 3WNDA 3L8ZA 5J5CA 2P65A 4BFYA 4US1R 5GVRA 3Q7QA 1KDRA 4Q7KA 2A2ZA 1AS2A 2I1QA 2R6DA 5EUQB 4M8NE 2XSZA 2YVUA 4EFNA 2EFGA 1SVLA 3H1TA 4PXAA 4UXIA 4EJSA 2PEZA 4JYBA 3U44B 1GL6A 2OO7A 4Q66C 2P0EA 1ZJ6A 3F5FA 2VSFA 3KX2A 1VG0B 4LPKA 1XDBA 4HI0E 2QTVB 3EIQA 4LV8B 2NO9A 1HQCA 1D2NA 4YC7A 4NPHA 3WXMA 2J7PA 3W90A 2ZRIA 1E2EA 1HE1C 4Q9IA 4HAWA 1FOEB 5C46F 4B3GA 4M1MA 2V1UA 2XB2A 1GM5A 3LBNA 1JXMA 4JJZA 4R7ZA 4WZBE 2YC4C 1D9ZA 4TTPA 5IT5A 1EFUA 2YKGA 2RH5A 2XX3A 4QBFA 1ZNWA 2GBLC 5CDFA 3TSWA 4D6PA 1KDOA 2AL7A 1E9DA 2LWIA 4F4IA 3BBPA 2LKCA 2W2TA 3A1WA 3WYAA 1X1RA 3SHWA 2YZ2A 5TDHA 2PZFA 2Q3HA 1G9XA 2PLRA 2WJVA 2VP9A 4Q19A 2IS6A 1IJEA 1M34E 3HJNA 5B64A 3EIEA 3C7KA 1K6MA 3THWA 2G0TA 4BFXA 1E9FA 3K9LA 4P3YA 3OEEA 5GJWC 5HE8A 2ZRCA 4GRAA 2XEXA 2IT1A 3AM1A 5JJKA 4LJ4A 2NO0A 3HR8A 1M7GA 4U5XA 5EE9A 3LRPA 4B3FX 4Z1MA 3BIFA 4KLZA 2ZYWX 2GWHA 3EC1A 3TBKA 4OQXA 4UJ5A 5HE9A 4LJAA 2XNDA 1KJWA 4GNKA 1JXOA 1BO6A 3AGPA 4B43A 8OHMA 1QHHA 1N6RA 4NZYA 4Q4AB 1G64A 2ATVA 3T5DA 5FUXA 1Q1QA 2Q9BA 1TEVA 1W0KA 1ZW6A 4KODA 2IYQA 3CX8A 4ASUD 5EP4A 1XPOA 3PV0A 2EWVA 1W7AA 4HLUC 3SYLA 4NU0A 721PA 4A8JB 2C99A 1QDEA 1S8FA 4DCSA 4AD8A 4XWKA 2X19A 4NONA 4DLSA 2BM1A 1W0JA 5EQTA 3LA6A 1GNPA 1GDDA 3C5HA 1KKMA 3DVLA 3MCAA 4LYHA 5DNYB 2IC5A 3OEHD 4DEXA 1S3GA 2EWWA 2YC2C 1JALA 2ZAOA 1LB1B 1YZLA 2HUPA 2D4HA 4US0R 3ZH9B 4E22A 4WOPA 2WJYA 3QG5A 4RSGA 1TQ6A 1XTIA 3IIKA 4XD7A 5FPHA 4DLTA 3GPLA 2PMDA 1NSTA 2W58A 2ZANA 4RFSA 4XSHA 3M4YA 4IFEA 3QKSB 1NN1A 2YJTD 1TTTA 2ZITA 2I4IA 3KTAA 3QF4A 3A36A 3X1WA 3AP1A 5EXTA 2VTKA 2GF9A 5DLQC 4NDZA 1ELOA 2P67A 3U3MA 1Z0FA 5FPYA 1XXHE 3KJEA 4RD0A 1AK2A 2ZAMA 3B1ZA 3VX4A 2HCJB 1GRNA 3BD9A 3DDCA 4E5UA 1E6CA 2JLRA 4PQFA 4CVNA 4B44A 3QKUA 2QAGC 1E2DA 3A58B 5H1YA 2GJ9A 3WMFA 1DARA 5AWFC 3CB4A 4TT3D 3L2OB 3B1XA 1P7CA 2CVHA 3PEWA 3CKLA 4OHWA 1NVXQ 1KK2A 2EFDB 2ZR7A 1XEFA 2X1VA 4D0NA 1R4AA 3CF0A 1OKKA 2LCFA 3MSXA 1ZINA 1S4QA 2QMOA 1T8UA 3A1UA 4LJ8A 3RSLA 4EFLA 5J4VA 3CH5A 3QKRB 4ZV4A 1HH4A 4OQLA 4US2R 1I4LD 1ZM7A 3DHWC 1DEKA 1NG1A 2QUZA 1OSNA 3BRWD 4GOKA 1P61B 4HUQB 4A36A 1OIXA 4RD2A 2IYZA 2ZE7A 5DHAA 3T12A 2FFHA 4XOIA 4RZUA 3VU9B 2JASA 5LB4A 2OILA 4LK2A 4QRHA 1M7BA 3R9WA 4K8OA 5KSOA 2FDCA 4CYMA 2JLVA 4JLDA 2XGJA 5A5GA 4ZIRA 3TIFA 1XXHB 5HPYB 1Z47A 1NLYA 4BASA 4Q1FA 3U7HB 2X77A 2EFCB 3C5CA 1N5LA 1RW4A 4MRSA 1HTWA 1L2TA 2O8DB 4YMTA 1XJ0A 3PUWA 4OK6A 4NYIR 3B9QA 3AVVA 5IK2D 2QRZA 3K70C 3PITA 3KFVA 2VP2A 2J3EA 1KI9A 1VG8A 1NMXA 3K0FB 5DHFA 1ZAKA 1TEXA 4FWTA 1KDPA 4KYUA 5TXGA 2QM8A 1TQ4A 2H17A 1NVVR 4B73A 3U4QB 1N6KA 2YWEA 3IIMA 2W6ID 1Z22A 2IHBA 5AJXA 4HAZA 1WB9A 4MGIR 3RYTC 2DPXA 4LHXA 4KSBA 4DXAA 1AIPA 3Q72A 5K8IA 1X8LA 1KTVA 2VHQA 5GADl 2RGGA 5EZ6B 5LBIA 4A0RA 5EP1A 1LY1A 3LBIA 2A7QA 2NTYC 2OXRA 2GTPA 2ZREA 3L0SA 2WWWA 3ZVMA 4M9SA 5JFGA 3D6TB 2ZETA 5FR2A 3MLEA 3GLHB 4M22A 2QE7A 2WPDA 4II7A 5LDDC 2C04A 3Q5DA 1W2HA 3FKSD 5AJWA 2ZRJA 2O8FA 2CNWD 2B21A 4MH0R 1CF4A 4TSFA 2VSOA 4LBYA 2RGNA 3THXB 3AP3A 4M2LA 4CDGA 2FPMA 3ZS9A 4C30A 3OEHA 3W9YA 5H70A 1COWD 3NBFA 4ZDIA 4B3BA 1W4CA 5JSZB 3FFAA 3Q8XB 5FTNA 3TSOA 5P21A 4RZXA 3CLVA 2IF2A 4D0LB 4JLOA 1EXMA 1A2BA 4MKGA 3F3YA 2XB4A 4BFWA 3IIJA 3UANA 3C41J 4DT1B 5KNCA 1KZ7B 2ZROA 4LCBA 2C95A 3MWYW 3FOZA 1VCMA 4DDVA 2CL7X 3KXIA 4GT1A 2QU8A 1WRBA 3QVVA 5KPJA 4G5GA 4AIIA 1RZ3A 2HF9A 3IQWA 5JWRA 1JI0A 3LY5A 1WA5A 1XEWX 1OIWA 3CF2A 2QG6A 2ZRLA 1JQJC 3ADDA 4K81B 1OW3B 4A1FA 4TT3A 2BMEA 3KZ1E 1ZUIA 3O47A 2O0JA 3PG5A 4AG5A 1FUUA 1M8PA 3FKQA 3KL4A 4IOMA 2J59A 5GVSA 1OFTA 2B8WA 2DFTA 2QPTA 3QIAA 4BFUA 4LYJA 5CDFE 2JEOA 1XTRA 3JVUA 3P32A 5F2EA 4Q7MB 1TF2A 3QQ5A 5H68A 4CW7A 3SI7A 4X8HA 2O52A 2VRWA 4Z8YA 3IEUA 2RGAA 3ECCA 2E1RA 4JT4A 3BB3A 2YWGA 2G0NA 3K53A 1XBTA 4LJ9A 3K1JA 3KFXA 3TUIC 2KB0A 4TLDA 5FL3A 3GLFE 1UAAA 5JJIA 2DYKA 1KMHA 4CRWB 3IILA 4IEEA 2Z4RA 4PC7A 2BHRA 1Q12A 2TMKA 1Q57A 2ZM5A 1H65A 3ZJYA 4AURA 4CEJB 3ZQJA 4A2PA 3LQQA 1U8YA 3D7MA 3SE0A 4CT4B 4RJLA 2C9OA 3UMSA 4V0OA 4Q18A 1WQ1R 2FFBA 5IK2A 4DLXA 2BBWA 1E2NA 3I8SA 4TN1A 1UEJA 1E0KA 1Q20A 4MA4A 5IRCD 2ZJOA 4TMKA 5JMTA 2R8RA 4TMWA 2CE7A 2VSXA 4MKHA 2XXAB 2QA5A 3NVAA 4URXR 4DBLC 2QY9A 2IYLD 4Z8XA 3AKEA 3UMRA 1BYIA 3VHXA 1Z63A 3VKWA 2DFLA 4F38A 2W6IA 1P62B 4IOJA 1LF5A 2IBMA 4R98A 1E2IA 1E2KA 3R20A 4KO8A 4PX9A 1MR3F 3DPUA 1L4UA 1OV4A 1DAGA 1GKYA 4A2QA 1IN4A 3GLFB 1KI8A 2Q0HA 4XWAA 2FEMA 4JKIA 4KBFA 5CIWA 3K0CC 4KAXA 3JZAA 4TMZA 4OHXA 4I1VA 4MRNA 1CLUA 1XX6A 4HLQB 4E03A 4CEHB 2NO1A 4FXPA 1E2QA 1Z28A 1DELA 3FKSA 4IW3B 5IHPA 2OZEA 2IYUA 1WF3A 1YR7A 2PEYA 1RPZA 4R9UC 2QBYA 1KYIA 3CIOA 4KFSA 3TK1A 2ZJ2A 4AK9A 3QENA 1K5GA 2BIFA 3QOFA 2IYVA 1XU4A 4C0BA 1R10A 4XSGA 2FNAA 2YOHA 2AX4A 2MSDB 1KO7A 4P4SA 3M6AA 5FBLB 1FZQA 4MITA 2ZSAA 2OHFA 5SZIA 2BBOA 4DHEA 3BH6A 3I92A 2AFHE 3ZIAA 1OF1A 2OCBA 3FYHA 4RKFA 4DSTA 4KITB 4UNSA 2ZJZA 1Q1ZA 3J81k 1H8EA 2CVFA 2F43A 5DI3A 5G3YA 4Q5IA 3R8CA 1E0AA 3BAFA 4ACBA 4BUJA 1TQ2A 3TW4A 2XZLA 4KI0A 4TYYA 5B30A 4A0HA 2QEQA 3V4FA 1J2JA 3K09C 4MKIA 4QM7A 1SHKA 2CLDX 4MUBA 4NYMQ 4ARZB 5TVKA 3N2EA 4B3CA 1LFDB 4W7SA 2REXB 1OIVA 3THYA 2Q9CA 3X1YA 1KHTA 3AF3A 1VHTA 2QZ4A 2QT0A 3AEZA 5B57C 1E2JA 2VO1A 5HZKA 4HDCA 1JJVA 1EK0A 4S35A 1IN5A 4FINA 1E0JA 2YYZA 4QKQA 1NBMA 4V0LA 3AVWA 2D7DA 4Q47A 2B6HA 3BOSA 1E99A 1E69A 3MWKA 4OBEA 4OQNA 1KK0A 2OE2A 4IVPA 2V55B 3FE2A 2AHOA 2ZS7A 4L5BA 5FOTA 3GJ4A 3I5XA 5BN3A 3NDBB 4ILEA 1ZRHA 3THOA 1UBFA 3FMIA 4YXWD 1J8YF 1QG2A 3A6PC 4NCJA 1RVDA 1GFIA 5C4GB 1G21E 2Z83A 3N5CA 4QFMA 1XF9A 3SN6A 4OI0A 1N5KA 3AP2A 3NWJA 2WWIA 4WIAA 3GCGA 4JVSB 1FNMA 4KVAA 4MYHA 4FMDF 4DCUA 2HV8A 2QMEA 1ZD8A 3PUVA 4LY6A 4KSCA 4TWZA 1P4SA 1XJCA 1MT0A 1G5PA 4Q9KA 3SS8A 3T15A 1D9XA 2H16A 4GI7A 1CXZA 2CL0X 1NMZA 5FOXA 2JLZA 2R6GA 3IKJA 4BEBA 4PHTA 1W36B 5BN4A 4XJXA 5JBQA 2IYSA 2OESA 4Y0VA 1ZIPA 1BIFA 2QORA 4IJMA 3C16C 1BKDR 4Z54A 2RMKA 2GEDA 4POAA 2CHQA 3LFUA 4BZXA 4ZIRB 1AJEA 5GJBA 5HR5A 3PJRA 1GL7A 1CR2A 1VCIA 3OIVA 2NPFA 4TZ6A 4DZZA 4TL6A 2PCJA 5DISB 4BLPA 3RS4A 3SJAA 5TB5A 3DEFA 2GF0A 1UKEA 5TARA 3OHMA 2VPPA 2ZSFA 1CP2A 4DLRA 1E3MA 1OPXA 4QXAA 1ONBA 2N1BA 3VHLB 5JWOA 3D8BA 3NH6A 1E9SA 1NVUQ 2OBNA 4IVQA 4DSNA 1OH7A 3QUSA 3P27A 4JBYA 2NZ8A 3W3AA 4NH0A 1U0HC 5AR1A 1AGRA 4QGAA 3F8TA 3DKPA 4ZCIA 2ORVA 1K8RA 1PZNA 1YZGA 2IX3A 3H84A 1AN0A 3FDIA 1QHYA 2OXCA 1SVWA 1P9NA 1JPJA 1RFLA 3AF4A 2QAJA 2BKUA 2DWPA 5FOWA 3PUZA 5JJLA 5JHGB 1BMFD 1W4AA 1XRJA 1ESNA 2C77A 1G291 2ZR9A 3UMFA 3W8RA 4IDOA 3A8TA 4JLMA 2GJ8A 2PZGA 3OIYA 4P33A 5J4LA 1ANKA 3NDPA 4PC2A 2J9RA 4Q9JA 3TAUA 5F9HA 1SXJD 3AB3A 3QBVA 4Q4JA 4ABYA 3B7GA 4WXPA 2ZU0C 2ZXUA 1HA3A 2G3YA 2HYDA 4TZ0A 1KAOA 2RHDA 2QENA 4KBGA 5DGXA 5FFMA 4Q21A 3S1AA 2IK8A 1SKQA 3AKDA 3RSOA 4HSEA 5FBVB 1CEEA 2VLIA 5EE5B 1XEWY 4OHZA 4R2HA 2A5JA 2C96A 3TMKA 3AKYA 1TX4B 4F91B 3I32A 1QG4A 1ZM4A 2P6UA 3PEVA 4AY2A 4ZDJA 5JECA 3I1FA 2G1KA 4V0KA 4QGHA 2XITA 5E7JA 3UKDA 4HLDA 3EWAA 4Q00A 1F5NA 2GVZC 1NF3A 1QHNA 3RC3A 2P3SA 3GFOA 4I81A 1ZUHA 1OH5A 4LSGA 1OXSC 5C18A 3GJ7A 4C9BA 4Q4HA 5H8WA 5FTLA 3ZS8A 5KHOC 1RRCA 1PUJA 1VMAA 1YRBA 4DCVA 1E2FA 1KIMA 2OCPA 2JLYA 2V4ZA 3FHOA 3WMGA 2VP4A 5DH9A 2R6CA 3RWOA 4GMDA 1E2HA 4B47A 2VP5A 4B75A 2C98A 2CK3A 2ZYVX 1R7RA 4UXHA 3DOFA 4LHVA 5HKKA 3B8HA 4M1KA 3ND8A 5G40A 4Q7LA 3WP0A 1ZCAA 5BW8A 3GLIA 1B23P 3MFYA 2GCPA 3MMPA 1E94E 1NLZA 4QJ5A 1XD2B 5LB2A 3FPAA 4A0FA 3CO5A 2PL3A 1GRQA 5JCPA 3M0EA 1MRNA 1HURA 4JLNA 2CXXA 4KU4A 4LPSA 4DDUA 4D82A 1OFIA 1TMKA 4PAQA 3W6NA 1DO2A 4I1UA 4PFSA 1J7KA 1RJ9A 3EASA 4HZIA 2KBEA 4JSYA 4KLNA 4FWIB 3LVQE 1ESMA 1U0JA 1ZUNB 4O25A 4QGFA 1X8KA 3QG1A 1ZNYA 3K70B 2ZE8A 4ZDKA 4BFTA 2F1IA 1NJGA 2GZAA 2WJHA 1JAHA 2B8TA 2WKPA 4MYUA 5BYJA 3NC1C 1F2UB 1NN0A 1S96A 2O8CB 3HR7A 1Q3HA 2GNOA 1XCPA 4PO8A 3ND9A 3U60B 3MAAC 4C0LA 1F2TB 3A4MA 4LJ6A 5KYKA 1GSIA 3M1IA 4ZPXA 4IOKA 4D0GA 1J8MF 1MH1A 1N3BA 1RRPA 2IYXA 2RCNA 4PPQA 1P60A 4PANA 4YONB 3OAAA 2IYRA 2OCAA 2O8DA 1N6LA 3H86A 3KQNA 2QMUA 1VYTA 1KSHA 1BH2A 5JEEA 4M1YA 2RKOA 1G19A 4Q1CA 2H5EA 1DAKA 1GKIA 2V54A 1II9A 1U98A 3QXSA 4JJKA 5AJZA 1XMIA 2WWFA 5EXXA 3L82B 1D2MA 1N0UA 5KOYA 1JR6A 1EFRD 3RRNA 3IBYA 4TYQA 3QY0A 5HCIA 1OHHA 4LUCA 1G3IA 2Y8EA 2GXAA 3EIHA 2OFOA 2EW1A 4B2LA 4A15A 3PIRA 4PZLA 1KNXA 2IS1A 5CK4A 2D06A 1P9RA 1E4YA 3FHCB 4IEIA 2GAOA 2P5SA 4ESVA 2ZI3A 4LYAA 5FBQB 4PC1A 4M1OA 2AXPA 1KO4A 3WBKA 4GP7A 3KQLA 2ZRPA 3FHTA 4L15A 1SXJA 5SZJA 5L3SA 4Q1BA 1YJ5A 2ZTSA 4BPBA 3BGWA 4EPXA 1A4RA 1NBME 4RY2A 1OB2A 3GD7A 4K46A 3CBQA 2G6BA 4NCHA 3QKTA 1ZM9A 4FCVA 5JCZA 1V43A 2PT5A 2ZVPX 1R6BX 1W36C 4A4DA 3K8YA 5J47A 3K0AB 4QGGA 2AK2A 3EG5A 3VAAA 4XTCS 2BMDA 2VL7A 5KDOA 1CU1A 3AVUA 1OJLA 1YR8A 3UWKA 1MABB 2QP4A 1Z6GA 1LW7A 4Q03A 2HLDD 5DI3B 5L3RA 3Q3JB 1RC8A 2FPLA 4LBWA 3AVPA 3ZDQA 2FG5A 3KDSE 5FTMA 4PAMA 3SU8A 2KJQA 2ZJBA 3U7FB 1VHLA 4WVFA 3R7WA 1KJYA 3ZZ0A 1YQTA 3LAWA 3L0PA 1KOFA 2VP0A 1PLJA 2YWHA 4X8MA 5EE1A 1P2UA 1UDWA 1XTSA 2QI9C 3FFBA 2QM7A 5JZVA 2OT3B 1NY6A 3PCRB 4XH9B 2PH1A 4Q9HA 2ZSDA 1TF7A 1JECA 1GOTA 1JR3D 2YOGA 1E98A 2H1LA 3I72A 4HZUB 2W6JD 4KFRA 3SBDA 2BKEA 2XZOA 4GPTA 4DJTA 1W4RA 4WZAE 5D3MA 3ZD7A 4OYHA 2ORWA 2UZIR 1HT1E 1W49A 2VA8A 4D80A 1DBSA 2ZR0A 1ZVQA 4LRWA 1UKZA 2XAUA 2OAQ1 1I4TD 3VFDA 2X2EA 1O87A 4KCGA 1W44A 2AD1A 3ZLJA 4RD1A 5KO2A 3W34A 4N0EA 1E9AA 2LKDA 2J0UA 4G5OA 5CYPA 5AUPB 2C8VA 4JLKA 4OQMA 3A37A 3SEAA 1KGDA 2GESA 4DEYA 5HTKA 2OBMA 4NTZA 5KUTA 3KKQA 3DM9B 4B3DA 5CJPA 3FGNA 2W0SA 4YMWA 1R8SA 4GSYA 3X1DA 3AV0B 1Q22A 4IVRA 4RD6A 4R71A 2J0QA 1NIJA 4JLVA 4U00A 4TLAA 4DB4A 3KJIA 4OHVA 1IBRA 2ERXA 4BFSA 2ATXA 5JI3E 3AVQA 1SHZA 2CJWB 1HEIA 3CRMA 4O3MA 2J0VA 2AK3A 2BCJQ 1G41A 2CDNA 1LF0A 2FV8A 2IS4A 1DADA 2D7CA 4EQ6B 2EVWX 5KSPA 2YV5A 4RCYA 1EFRA 1ZYUA 1Y3AA 2H8KA 1US8B 5FL7D 3DL0A 4A82A 4JL6A 2FEOA 4DIDA 4DWJA 2IS2A 1K5DA 1TADA 3LH5A 2HT1A 2F1HA 3MRSA 1MV5A 3GJ8A 3I5YA 4NYMR 1B0UA 4C0AC 1VKJA 2QPOA 4URYR 5BYKA 3HYTA 1FX0A 1VG9B 2ODNA 5E7MA 2ZRHA 3SQXA 3T1QA 2IHYA 2ZSEA 2ZRBA 2GBLA 2O8BA 4NP6A 3ZVNA 2B7BA 3I61A 3VR5A 2X2FA 3B13B 1RE0A 3HWSA 3O8CA 5CLQA 3TJZA 3P4XA 2ZUDA 4A6PA 2IUSA 3SNHA 2V6IA 2I1VB 3CX7A 1WCV1 2BEJA 4JLPA 4XVUA 1XZQA 1CRQA 1UF9A 2JLWA 3CRVA 1XJQA 3Q7PA 3KJHA 4V02A 5EP2A 1NVWQ 1FNNA 2R44A 2F1RA 2C03A 1SVIA 4QHYA 1ODFA 4D2IA 5FH9A 4Q02A 3K70D 5JI2E 1T5IA 3SR0A 3AVYA 5G41A 3ZVRA 1QRAA 2FJUA 3FMOB 3ASYA 1UBEA 3E70C 2CCGA 1T3SA 1KI6B 3GLGE 3U7GA 1II8B 3GLIE 2WMNB 3RAPR 4D26A 1FFHA 4M9XA 1EFHA 1VYUA 2ZI9A 2YOFA 4KFTA 4PO1A 2H18A 5JRZA 5TMPA 4ASUA 3P20A 2ZRAA 3V9PA 1IAQA 1JPNA 3ONWA 4JSTA 3UG7A 3QPWA 3A1TA 5DN6D 5IDVA 4QC2A 2W6JA 2ZU6A 2WIBA 4URVR 3VQTA 1IHUA 1N0WA 3MUFA 1N0VC 1YZTA 3JZMA 1BOFA 4V03A 3WNBA 5EUMA 3SBEA 4IDHA 3SQWA 2ECKA 3GFPA 1KK1A 5L3QB 3VNUA 1HQYE 4V0MA 1QHGA 1E0SA 4NMMA 4YMSA 4ZKDA
chains in the Genus database with same CATH superfamily
1W85B 4MUYA 2BRUC 4PQEA 4DVGA 4PG8A 4WJLA 1N2BA 4WOBA 2J4CA 2WSSD 2LTAA 2IWRA 4XUCA 3Q6NA 5D3KA 4HC4A 5AKZA 4JQSA 3TXYA 4A91A 2QR2A 4AZ0B 2WIJA 4YP5A 3TL2A 2G4LA 3WE7A 1BN7A 3ZGOA 2AD5A 4QVKA 1NFFA 4MQEB 4CCYB 4CMEA 3U7RA 1RQGA 1KTIA 1VCHA 2Z43A 5CDTA 2BDEA 2YN0A 1QB8A 2EARA 3PRKE 3OLXA 1SUWA 2VQFB 3BSWA 3UA3A 3O2SB 2A57A 1CYDA 3AUUA 4WASA 2PJUA 2W6PA 2OG1A 3T0GA 3EPJA 1GIAA 1U0GA 5TPZD 2F6RA 1JHAA 1MGPA 3WQRA 1XPUA 4DRZA 4C7OB 2QAGA 2QD5A 3K73O 2WU3A 4E70A 2X9VA 5BUZA 4MV1A 3K9NA 4Y0AA 4MR9A 2XY4A 4C3OB 3LWNA 4DN6A 2QX7A 3R3SA 3P9RA 1E61A 5JSHA 3ZJTA 2IEIA 2RHTA 2WUWE 3A31A 3EISA 1EBUA 4N5DA 3KSUA 4RQUA 3BGSA 1G17A 1QLHA 4Q4LA 1MO6A 4TMTA 1PNVA 4YMUA 5EJEA 3GARA 3LQYA 1FXSA 1E3QA 2QUBA 3N75A 5FL7A 3WDMA 1U7PA 2FEKA 2FZEA 4NCNA 3T5MA 4B80A 2JGNA 1XOIA 1I2ZA 1YJQA 5AJYA 3CJRA 4WPGA 2J87A 2OSVA 3TDNA 3S2YA 4PIVA 1ZJJA 1PV2A 4EELA 3LLMA 1Y7PA 4D44A 2F9FA 1VMKA 3GCWA 1E1MA 3WHKA 1W94A 3PYMA 2WM9B 4OREX 1UM9A 1PQWA 3PGA1 5G0TA 4BX8A 4ZRDA 2HLHA 2JFFA 1LCIA 3LXUX 5K0NA 4YIHA 3EGEA 5L4SA 2AQKA 4HS9A 3JQPA 3VMFA 2Y1KA 1PI3A 1J70A 1FDSA 4AAYA 4FMBB 5ENDA 1OPRA 2ZZKA 1Z82A 2EIXA 4CM8A 2BAGA 1R66A 2XTAA 4QNMA 1PW7A 1G4HA 2WIKA 4RA6B 5KTKA 3P1JA 3LPAA 2BTQB 3B78A 2XJ4A 1KAQA 2JANA 5L4LA 3TEJA 3TDKA 2GVDC 3UA4A 2PO7A 1FYFA 4DIOA 2J9GA 4RKRA 4C7KA 3OTHA 4UHJA 5A71A 1LPSA 3F5MA 3QMWA 1VC2A 2EJWA 2PZEA 1EGAA 4HS4A 2PX8A 2AG0A 2EJCA 1T91A 2UAGA 3KEGA 3MWJA 2JK0A 2VJCA 3ZCXA 1E9CA 2O8CB 3DBHB 4B3RB 3AF5A 4KQCA 2ZUVA 1IM5A 1UBJS 2YYYA 1AA9A 2BEKA 2JLSA 2VZ8A 1OASA 4OPMA 2Q41A 2PUVA 1E3DA 4GDMA 4E31A 3TLXA 2V5VA 1EWKA 4N1AA 2H2HA 1PJ3A 3I4CA 3OCJA 4I50F 4TLEA 4IAOA 4EMBA 2VAWA 3E7WA 4RF5A 3GUZA 5DGIA 2ZRKA 3H8VA 1MVOA 3LXMA 4CGZA 4LXXA 3ZE6A 2R7MA 4LOAA 1F14A 2O05A 1QO0D 4JQOA 4HR7A 2DCUA 5AUOB 1Q92A 3RVBA 5HQ3A 1P80A 2R7LA 1NM5A 3VU8A 1J1ZA 1T9HA 1Z6XA 3UN1A 4BLRA 2OWDA 3ZG6A 2H1RA 2WZQA 1KFBB 3VPDA 2CVPA 3EPRA 4MYDA 5IABA 1VRWA 4GL2A 2JI9A 2PT6A 3ZKWB 4G0WA 2HLPA 3LSYA 3M70A 3YASA 2G76A 4JHXA 1UMCA 2GARA 5K05A 3SJZA 2CNKA 4BQPA 2RHHA 2WUFA 5FR1A 3HWWA 3C85A 1QO7A 2CCKA 4K9NA 1NXVA 4F3RA 3TBHA 1QLJA 5I7VA 5LLTA 1CFJA 2WSSA 3DYVA 4TTVA 4CIAA 3AZPA 4G9EA 4F7WA 2EZTA 1L7VC 3MTAA 4IKEA 3VPBA 1WMEA 3P4YA 1TRKA 5JVDF 5BSTA 1T4BA 4QDTA 1R37A 3B3GA 4IMJB 3WY9A 4EYGA 3QNUA 1PR4A 5CA1A 6GPBA 1YC2A 2VPTA 2NAFA 2HCBA 2J6BA 1N6HA 2PQ0A 4MWBA 2PU7A 2HMVA 3A0UA 3CONA 2M6LA 2EC5A 1Z45A 2DPMA 3L07A 2C61A 2G70A 1IIRA 3LCUA 3ZU3A 4ZT4A 2WG1A 1JS1X 1MKYA 2YZGA 5J58A 5JPDA 1ZICA 2FSGA 2OVFA 1RJDA 3GH3A 4BO6A 4G9BA 4LJYA 4UHHA 1A1VA 2ACWA 3EPKA 2XMSA 4RFSB 2DB3A 3SXJA 1OE0A 2D5CA 3A1SA 3IOCA 1FSPA 4M4SA 2Q0QA 3HZRA 3S55A 3OC6A 2X6TA 4O2BA 1SB9A 4KUEA 3WMEA 3WKEA 4GG1A 4BVFA 4PZ9A 3KVOA 1FSFA 4M0DA 4RHFA 1R0BA 1NF2A 3A28A 3OE7D 3BMNB 2CFRA 4P4UA 2IOQA 4GZMA 4OU5A 4XVRA 5D1NA 4DMUB 3S2FA 3NTOA 5LM3A 1KAMA 4RADA 1CUZA 3A70A 5DNEA 5FP0A 2C00A 4I9NA 4Z3OA 4J9UE 4DHWA 4TLLB 4XYMA 4CV1A 5JS8A 5L3VA 2YHSA 5EJMA 5DX0A 2HNBA 2J6IA 2QJTA 5CJ2A 5ENZA 4HN9A 2W7TA 5CM9C 4ZOLF 1EZZA 2BP7B 3RC8A 1ZR2A 2EJVA 2VPZA 3V5NA 2FHPA 2R65A 4GAEA 4HZGA 3DOUA 4Q48A 4C1BA 5LQRA 1DJQA 5DXJA 3SYNA 5I6DA 5LYJF 5LD2B 2AW5A 2YWDA 3G13A 3FSEA 3KOXA 3PFIA 1LBEA 4FHFA 1UKVY 3WYFA 2H85A 3NPAA 3O2JA 3LUFA 3OE4A 3TKYA 4E5DA 1G8GA 1DPFA 5HSGA 2FSUA 5HFNA 3RSQA 4KE8A 5KNDD 2IXEA 1P7VA 2BMAA 1A7UA 2OCDA 3ED1A 4UMDA 2B61A 1FX1A 3HGQA 1C0IA 1R9GA 4N76A 1BFUA 3P9PA 4K9KA 2HK7A 4KTVE 4JI4B 2OEPA 1RQ2A 3KDPA 1JGTA 2R6AA 2WWVD 2Q6LA 1NVBA 1XCJA 3K94A 3MOIA 4KIJA 2O0MA 1NFRA 4WZ6A 3ZDFA 3ZDXB 1UC5B 1HY3A 3QYPA 4LRTB 3HBJA 4N3GA 1RWVA 1USWA 3T9BA 1CF9A 3OFKA 1V26A 4PSCA 1Z17A 3OJWA 1NW3A 1TAGA 2WWTA 4NATA 5A4DA 5THKA 4A7PA 1CCWA 3LJKA 3EOBI 3K9HA 4UCWA 4GOXA 4B6RA 2K7FA 4F72A 1E5VA 2R1VB 5JYDA 5AM4A 5JDCA 4F04A 4CKWB 4Q1AA 2D2EA 1UT5A 3GJ3A 1IJKA 2BJHA 2QL6A 4JJEA 5H9VA 5MGNA 1Y8AA 2KBFA 3HVHA 1KO5A 2BCEA 3TZEA 3TLAA 5F4ZA 4V0ME 4B2YA 2ZDGA 5EUCA 3RVDA 4RA9A 4HP8A 2DUUA 1NJ5A 1Z6YA 2R1TA 4N7BA 5C8YA 2W2XA 1IUKA 3EF3A 3R23A 3K0EA 1Y8RA 4PC3A 3FNHA 1BAPA 1I10A 3N0WA 3E9CA 3I6ZA 3SXUB 3W8NA 2ZYGA 3ZWPA 2O2JA 2ODBA 2SKCA 2WD7A 2VIIA 3LWDA 4DV4B 1OB2A 1QGYA 1FP4B 1E59A 2BEWA 5JWHA 3RT9A 2A94A 3KYCB 1G98A 3MN1A 3E2IA 4AJOA 1NHGA 5D01A 1FQJA 2R1UA 1Y7IA 4BO8A 2VDLB 1N2CB 1PGQA 5HBRA 5TS2A 3L49A 3K4HA 3I5MA 5JTTA 3LF2A 2ZSBA 4F8JA 4UW9A 1PR5A 3U9SA 1WU7A 3EA4A 5SZKB 2BGTA 4GPD1 3B12A 3TR0A 1B2LA 1FDOA 2VHCA 1VE5A 3V8PA 2O48X 4X62B 2IPOA 3FNGA 2I7CA 3DFMA 4PYJA 1YTUA 1DTSA 1QYIA 4BDTA 3D1LA 3RWBA 3BILA 4YR9A 5LXTB 3EODA 1DKOA 4EGAA 4RVFA 2XCIA 3WB2A 5HWSA 4DJEC 5KMGA 1ESEA 1M8FA 5CT4A 3DVSX 1M6EX 3GT7A 2PGIA 3B6KA 2CUKA 2I8AA 3QWFA 1PEAA 2GBFA 4E1BA 2CB9A 3TPFA 3T4EA 3SYRA 2INGX 1GVHA 1I2DA 5KVAA 1D1TA 1PBTA 1Z4JA 2ZG6A 1AKUA 2Z3WA 1QR6A 3ENKA 3ZXYA 1IXRC 1UBKS 3NORA 1YDHA 2FGKA 4HWKA 5KVCA 1CQPA 2J4DA 3PRYA 4B8ZA 4B71A 4BGDA 3D3KA 1ULAA 1BCRA 3B6JA 4B2PA 1T1IA 1OAAA 1B93A 3BIWA 3HXMA 2PTHA 3WXBA 1S5PA 1TM3E 4BNHA 2XWPA 3UNXA 2G82A 4JY7A 4XAQA 2YJ6A 1OH6A 1C3OA 1HE5A 3TLBA 1AS0A 1V4NA 4RVNA 2FHSA 3OZAA 4J16A 2WTUA 2C5LA 5K45A 1FS5A 3HZHA 4QM6A 4WKNA 2QVBA 2XE8A 3QFCA 2OO5C 2WG0A 3R0VA 1E9BA 1NZFA 2D7JA 2QVGA 4ND8A 4GPEA 2LIVA 4KHPB 3W6PA 3GI1A 4S1PA 4CTMA 5BVHA 2G5TA 1N34B 5LQDA 5REQA 1IXZA 1PT8A 2HFKA 2YY5A 4JXXA 2E7ZA 3L1JA 4KQ2A 6Q21A 4R6WA 1ZM2A 2IYWA 3E8SA 4P54A 2ENUA 4MRMA 5TF0A 3UATA 1A8QA 2VTEA 3K7EA 3S2SA 4DDKA 3ILXA 2GM4A 2WSIA 1R1DA 4GOND 4OQ4A 4QPCA 1G8HA 3JARA 3PQ8A 4FDVA 2IEAA 3THXA 2FUG1 3V1KA 1RXVA 3WMXA 5KNDA 3W2FA 4B6OA 1KU6A 2QP9X 1LS1A 1O94D 2CLFB 4CM1A 4O4LB 4MUGA 2YV4A 1PW5A 3KTOA 3LPMA 1S2NA 2HX1A 1I3MA 4BQOA 3IBCA 2QVZX 1T8PA 3CH4B 4LVNA 2ZYSA 4IHQA 5FWYB 3EXAA 1H2AS 1B1AA 4JI5B 1OYWA 2GEUA 1IEWA 4OJNA 2PH7A 4R41A 3C7DB 4MLZA 3WGTA 3PPVA 2C0CA 2AYXA 1XTKA 5K8IA 5KX5F 1JHVA 3LYLA 1O89A 3QWBA 3G3EA 1T3HA 3JQ7A 4D9NA 1E3JA 3DHNA 1PWYE 2LRHA 3IIIA 3KQKA 1J5XA 3MQFA 2ZIVB 4LHSA 2E4WA 4N0MA 3ZPXA 1HDEA 4XCQA 3A2KA 1ETUA 4DY6A 5KAMA 2YUTA 4BO3A 4AZWA 2XNJA 3NT5A 1WPQA 4O33A 5K3BA 3TJMA 4F2WA 4PX2A 1H4SA 1XYGA 1KKLA 4I1PA 5E7IA 1DOZA 3WLFA 4X95A 3S8MA 4BMNA 5AHWA 2NO7A 1C7ZA 2ZAIA 3A6HA 4ARBA 4E14A 5AKYA 3AGQA 4ZQGA 3AUXA 5BSWA 2W37A 2IVFA 1V5FA 3F6BX 3E5HA 3BPSA 1BCSB 3OU2A 5HQTA 4CGYA 3Q7SA 3ADKA 4CWAA 1TM2A 1MJFA 4EARA 3O4GA 1SAYA 1R00A 3K1AB 2QHXA 4TRJA 3KQMA 2V1XA 5ALQA 3WLQA 4RXUA 3USZA 1R0CA 3TOCA 2V59A 1F12A 2FX3A 3M1YA 2HF7A 4ENRA 2O2XA 3BE4A 3FSJX 5IF9A 1T9BA 3GP5A 2WJGA 3EGCA 3L5KA 1B3BA 3VSEA 1X7WB 2B20A 4GOOD 3ZDRA 5HQ3B 5MFPA 4YGXB 4Z7NB 4F4DA 3NC0C 3FI0A 4EW3A 4IO0A 3KC2A 3BDIA 4NAHA 4QA9A 3K20A 2GD0A 2VHEA 1V95A 2ZRFA 1PG2A 2LVBA 5HQJA 5LBUA 3RTDA 3ZCTA 4KPUB 4YP6A 3TD2A 2Q6TA 3CVVA 1GU1A 1OKKD 3RVLA 1KEUA 4W7IA 4BNDB 4M7OA 5J4KA 5JYBA 4CEJA 1Z6PA 3WNCA 4DF3A 5CB0A 1KWGA 1E96A 1HDYA 4MQFB 4UNPA 3A4NA 3IHWA 2FXIA 3JQBA 4OXYA 2Q1WA 1T6NA 4QATA 1BZYA 1VSTA 4FKZA 4XWTA 1RAGA 2WVGA 2P8SA 2VHVA 2QD4A 3CISA 3UOAB 5L6MB 3VJLA 1AE1A 5BNFA 3CZ9A 3DAFA 1WMSA 2VHXA 4H0CA 5TV2A 3WI7A 1RYFA 1B8OA 3SNKA 3ETDA 5SZHB 3CW2A 3MGGA 2NSDA 1QH1A 1W96A 5AICA 4HNUA 3UFXB 5CDYA 3BCRA 2J9XB 2XYGA 3FVRA 5ETJA 4C0HA 1GQQA 2C7VA 2HJVA 2P6PA 3QV2A 1U28A 1Z62A 1SBHA 4BNMA 4H7HA 4JK3A 1BX3A 1PGPA 5F7OA 1JVNA 1KARA 2GJKA 3LCJA 2XCLA 2E2WA 1XKQA 1H4VB 1NI4A 4D8WA 7ABPA 3GLFA 2NZXA 2R9VA 3LRTA 2AMJA 3HYNA 4TOIA 1NJFA 4NU8X 2QXTA 3RHFA 2MINA 5TGTA 3VNAA 4G1CA 1WXGA 1G8FA 1QZTA 2YIJA 4BQSA 5FUYA 4LAFA 3LKZA 3G82C 4U2GA 1PYGA 1P0PA 1KYZA 4CEHA 2COKA 2WFMA 4YRTA 4GC9A 3KNZA 4PNZA 4YJFB 2QGNA 4XIFA 1T9AA 3OWHA 4AMZA 3JVVA 4FCCA 5JH7B 3EWSA 1DAIA 1T9KA 2LUOA 4DUGD 1DEAA 2VLBA 1NYLA 2G4CA 3L7IA 3OM0A 1AXGA 4YQFA 1KZ4A 2CFTA 3C3CA 3WHPA 5DTMA 2G6TA 3NV9A 4OA5A 3WIVA 2Q5CA 1IY0A 2EU8A 5L53A 2Z2JA 4ARIA 1I32A 2JNWA 4LJRA 1THTA 1LJ8A 1V5EA 4D6YA 4E5KA 5H5JA 3RJMA 1PJRA 4DV5B 2B4KA 2ZLBA 4DILA 5HNKA 1TKAA 5A2QA 3T7RA 4WBNA 3C8UA 3RC7A 1JEQB 3NBXX 2CXRA 4Q4DA 3HJUA 4J90A 1MRSA 2PMCA 3NP9A 3CNBA 5BMVA 1IY1A 2RGNC 1CR4A 4J2HA 4QDOA 6NULA 1FW6A 3OQIA 3GGSA 1D0IA 4UQLA 4MW9A 1HEYA 2QK4A 4K05A 3BT7A 2HRZA 1CJMA 1IHYA 2PX2A 3BIOA 5KCMA 2IUUA 4C78A 1UPTA 6LDHA 1W2GA 3PXBA 3NANA 4W9NC 2QL5A 2SHKA 5FBHA 2W6MA 3FYUB 4DC9A 4BN0A 4WBXC 1TUIA 1V8BA 3RJTA 4HGYA 5AK5A 5DASA 1V37A 3IHKA 4G1MB 4NQRA 5GM1A 3WRXC 1JEOA 2HFJA 3TNYA 4KGXA 3MGBA 1E1RD 1RDFA 4YWHA 5TQJA 3AO0B 2ZWIA 2RGCA 4HB2A 2VBFA 1XDUA 2R85A 3OO0A 3L3BA 4WDQA 4C5CA 5DGCA 2CL5A 1F38A 2BGLA 1GKLA 4Y1RA 4FIDA 3R4CA 4Z4HA 3GH1A 1ZNQO 3PUHA 1I4OA 1YRYE 2JGDB 4JGGA 1M5RA 4R2MA 2C9ZA 3B1FA 5DCWA 1JLKA 1W5BA 4BKPA 4OQEA 3RRYA 4EG1A 3CW9A 2AKYA 2G5GX 4DSZA 4GKAA 4I1SA 3CN7A 5I9SA 3TSYA 1IXKA 1EUCA 1F5SA 3N8KA 3V7NA 2HMUA 2QT1A 1N3YA 2D2FA 4RA9B 4CLRB 1Z15A 1QTQA 2Q2VA 1XCGB 1FPMA 5E9JA 1VYHA 3SX0A 4QBIA 1QWSA 2K5UA 4NOLA 2ISQA 2W83A 1CRLA 1N5RA 1NPTO 4JUIA 1OFUA 2VHJA 3L41A 1Y7TA 1I6MA 5FJIA 1IONA 4GC5A 4BHTA 2C7QA 4FYIA 3Q9NA 4GPBA 5EY5B 4HQNA 3B60A 2YWCA 4I9HA 4BNIA 1WZIA 4Z0PA 2E5LB 3FKJA 1UKCA 3EZFA 5CPFA 1E4VA 1Q0PA 2AI1A 3QU2A 4EHBA 1BFDA 1O9BA 3H7IA 3KQWA 5EXPA 4CZ2A 4RTOA 3UK7A 1QGED 2OLKA 3BXEA 2XTMA 2JAHA 3KE8A 3PC8A 3N2KB 4JJ6A 3MXTA 2OLJA 5DYGA 1G3MA 2C2HA 4MDEA 1GQYA 4XXHA 3IAEA 7YASA 1UIMA 1CS0A 2EQ5A 1CRPA 1V9SA 4B09A 5AKKA 2BGMA 3D4NA 1P39A 1PKEA 3AHCA 5AKGA 1L5GB 1XAIA 4CIXA 2IZ7A 4B32A 3D4OA 1RQPA 4JP3A 1N8NA 2R8OA 1SIBE 4R9NA 3ELBA 1P2SA 4BJ6A 4EFDA 2F4NA 2ZUSA 5EHNA 4FI3C 3NBMA 4LSMA 4W5NA 1PR0A 4F3YA 5C81A 1WDTA 3DE0X 4IGAA 4AJHA 1OD6A 3Q8MA 2Y9MB 5JALA 4AJLA 1G7SA 2QVLA 3T1OA 4JI7B 3S1AB 5BOSA 1PCXA 4DABA 3GNSA 1CF2O 4EABA 1JHDA 4QQFA 5KWSA 1YRLA 3UWOA 3B3FA 1L7QA 1M2KA 1ODIA 3HCPA 4HLUA 5ES3A 2DWQA 3TZ6A 4DLPA 5HJ2A 1FZTA 4JJKA 4N82A 5CXSA 5ERYA 3WIOA 2OBLA 5GAJA 4IR7A 2VTBB 2PH5A 1RYEA 2R7AA 2RKBA 3C6QA 4OB6A 5EIBC 16PKA 1DG3A 1K9SA 3HU3A 1Z2OX 1T2NA 1T5HX 2Q2NA 4HDQB 3GNQA 5TRTA 4DUGA 2H4JA 4KAAA 4KQWA 2Q5HA 3U7QA 1V16A 2EYUA 1J6UA 3DNPA 5SV2A 4PS0A 4Q6WA 2FW9A 4PYRA 3HV0A 5IJ0B 3MD0A 4UMEA 1LZLA 2GZ2A 3DB1A 3E48A 1MAUA 1VDZA 2BTOA 4L8WB 1D5WA 4D9HA 2MSWA 3H6KA 3IUMA 5B1IA 4LXTA 4BLSA 4I08A 3EDQA 1NV9A 1IU9A 2Y0BA 1ZJYA 3BFXA 3U3ZA 3O8QB 5HF5A 4REQB 3OJXA 5FNZA 1F2DA 2QVYX 3AQ4A 4M1TA 4NEGA 2P0AA 2GTIA 1NIPA 4JUBA 3TVDA 1BROA 3C24A 3QEJA 3GP8A 3RRBA 1PUIA 1EKXA 4OHCA 3GRPA 2I65A 5JAMA 2IIBA 4MYRA 1E1DA 4BTLA 4I4TB 2PUGA 2YIMA 1X42A 3IIEA 2C2ZA 3Q1KA 3A3YA 4LFCB 3GF4A 1ENYA 4U2KA 2AJTA 2RBGA 5ALKA 1RJ9B 2PXHA 4KN6A 1PVDA 1TFUA 2H06A 3EMDA 4JC8A 1E1RA 2YX1A 3ZIAD 1YRAA 3IPAA 2Q1UA 3EZXA 3GRKA 5CX1A 2C57A 2QMQA 3NHKA 5K6AA 4GRIA 4N8SA 3FMPB 8LDHA 4LSWA 4W1QA 3PEYA 4RBNA 3M9XA 2A8YA 2VHWA 3AH8A 3GJXC 4TZKA 2FPGA 2IZ1A 2BWJA 2X9NA 1UBUS 2FN4A 2FFRA 3T5CA 4CHGA 3PHIA 4KV9A 4W8OA 5J40A 3ONFA 1BVYF 621PA 1XVTA 1E0DA 2WD9A 3LUKA 3NEPX 2WWXA 4GWGA 1TU0A 4O2LA 4JHLA 2RAUA 3IAS6 2C78A 3SZMA 1KI4A 3ICQB 4JJFA 2FQWA 2J3JA 3G2JA 2C07A 5FEMA 4F9TA 2YRFA 1G5RA 1FVOA 3SZ3A 5IDXA 1JYFA 5ECWA 1ZGGA 3CX3A 4OIFA 4QX6A 5AUNB 5DIFA 5BV7A 1WW8A 4URZR 2WRZA 5DYNA 5B4TA 1U7OA 1M2OB 4NHOA 4DKXA 3M81A 1XKXA 2GN0A 4BY9E 1BH6A 1CR6A 1H23A 2VQEB 1H2FA 5GINE 2QLFA 4CTKA 3G89A 5E1MA 3ZV7A 3HXOA 1GZSA 4TMXA 1DWPA 4PZ0A 4HDSB 2RIRA 2AF4C 4JQYA 1W19A 5CLLA 3UCXA 3X1ZA 4LCEA 4B6EA 2HF8A 4QARA 4RV4A 4AMUA 2V4UA 4R1UA 2NUTA 1ZMXA 2NU7B 2X3YA 3DOOA 4E88A 1GITA 1RXWA 5HCUA 2B69A 1KE1A 4BJ1A 1RMQA 1DE0A 2B8JA 3EQ8A 1Y3IA 3EVZA 1FTSA 3FYDA 2UZ1B 4FHZA 1Z8FA 1Z68A 3QVUA 1Y89A 3CT4A 4PLVA 3MILA 3PIIA 4F0JA 3JTEA 3KJNA 4FIZA 3FPSA 1D2EA 3QXXA 4OKSA 4PV7A 2BFPA 1FYXA 1YDMA 1I80A 3L0ZA 5F76A 1C3VA 3FRJA 5IXSA 4OUDB 2OHXA 1XKTA 1OZHA 1E2GA 2EFYA 4Q24A 4UEQA 1R2QA 4NMHA 5C7YA 4W6QA 1L8QA 1X2BA 2XUDA 3AESA 3D4PA 4JYCA 4OX9B 5F23A 3ILYA 3GDGA 1H9BA 4G4JA 1AQYA 4MV9A 4RS3A 1H0RA 4U02A 1LV8A 4ZI7A 2W2KA 2GJSA 4PZZA 2BFFB 4C29A 2EG5A 3IRUA 1KMNA 2NT3A 3PE4A 3PXCX 1PT7A 2X86A 4P4GA 1XELA 4JX8A 1RMTA 5E8JA 1MEOA 3DDHA 1JDBC 2FEWB 2KE5A 2VT7A 3AQIA 3EEYA 3OA2A 3CCCA 1PFKA 4GP9A 4I5FA 1H66A 4J2OA 3KB6A 4D9KA 1KEEA 4MTCA 4QXRA 221PA 3BWVA 4RSHA 3QELB 3NHJA 4GRDA 2PMWB 3EYWA 1EWYA 2R8BA 2XLCA 4GECA 4MGKR 5F5LA 3EZYA 4QYWA 4WADA 1PS0A 3MWEA 4MWEA 3G8YA 1H9CA 3BTVA 4UZEA 5J2UA 5AKXA 5EL0A 3EOAI 1JJFA 4AM8A 3WSTA 1J0BA 5FEUA 1V48A 2J5QA 4C03A 3I8OA 1VHJA 1YBMA 2UVQA 4JXKA 5CU7A 1IZ9A 1IB6A 1HDXA 3LCCA 4Q1DA 4DRXA 1EFPB 3OZUA 3CX6A 4LQDA 2J0SA 2PMBA 2JGAA 4WK2B 2ZTHA 3DO6A 2Q3FA 2XQFA 3E4CA 2OK8A 2C5HA 4NFYA 1L9KA 3ITKA 4N47A 1R9NA 1QSGA 3QPVA 5K3OA 2K87A 1TQDA 1EXDA 1YZFA 3TX6A 1H8HD 4BQIA 5KTRA 2WU8A 1V11B 2ZI6A 3U9TA 1NULA 4Z51A 4DCMA 3L0CA 3LWBA 3N8IA 4UU0A 1QX3A 1RWKA 4M9RA 5DPMA 1CUAA 1B8UA 1B0PA 2GMWA 2WINI 2FSHA 2IUTA 2RKWA 1HDCA 3HA7A 3ETLA 2J0UB 4IRUB 3A7DA 1MABA 4RVCA 3LE8A 1PJQA 2AXNA 2HMTA 3PUIA 3QWHA 5KC9A 4XW2A 4DSOA 2BMVA 1YR2A 2VHTA 3A6LA 4IYJA 3X1KA 3HZOA 4CR8A 5IEJA 1E2PA 1STOA 1XNHA 5IM4A 1DV1A 1ZKMA 3CEPB 3EQZA 3KWMA 1KI1A 4CMAA 4CM9A 5BUSA 1Z5OA 3G2NA 3LA8A 4ZDWA 1WCIA 5B57C 1LWOA 4XVQA 2HEGA 3GEEA 1QK3A 2AN5A 1M2VB 4XWWA 2IW3A 2R8PA 2CMKA 2V6MA 2XWQA 3HM9A 1LU9A 1M6VB 3TYXA 1F0PA 3H9UA 3U3DA 3ROEA 3QSYA 3NDIA 3GQVA 3SM3A 4AG6A 3G0HA 2DEUA 4H1UA 3WA6A 4EKGA 4ZVUA 2GS9A 4YLGA 5GZ3A 2WU0A 3NHUA 2ILTA 2I8LA 4Y1RB 3A6GA 4YP0A 2ANBA 1NBWB 2XQVA 3U9LA 2GLXA 1XRNA 2R84A 4TWIA 4DCPA 5K3FB 3M1AA 2NO6A 3CUTA 1DTWA 2A67A 2CDAA 1DCMA 3LCMA 3CPEA 3DM5A 3UGQA 3WK9A 3TQSA 4EJ0A 1H0KA 2Q46A 3KJZA 1UXHA 2VYVA 4Z6KA 5BWNA 3DXZA 3BIJA 2Q3CA 3CEMA 3G2PA 4QDZA 3DCYA 1GCAA 1EA7A 2XCQA 5IG2A 4QQKA 3RRJA 5K0EA 1RLJA 1WULS 3GDHA 2FP4B 1M5TA 5EIAA 1SRRA 2CK3D 5DI9A 1P2GA 4KHZA 1TUGA 3AU9A 4PQGA 4B3JA 5FPPA 2N46A 2EYQA 3WZLA 1LK7A 2YWFA 1ND6A 1E6MA 2QN3A 1IXYA 4LF8B 2ZSKA 3DQZA 4ETMA 1PNQA 4OFBA 3NLLA 1ZI8A 2A1UB 1RU3A 2FZLA 3LECA 1YRWA 2C4UA 4QPDA 4QQ8A 4EKDA 1EIZA 5FOVA 1S2IA 1T8WA 2V6JA 3P0EA 4O02B 2BMFA 2Y1GA 3FZGA 1E6WA 1YZVA 3EAFA 1RQ7A 3IKVA 4QFBA 3JWEA 1FRNA 1OXTA 4IDCA 3ZC3A 4N5MA 1X1SA 2JA1A 1YS7A 3JZFA 3IYLW 4ZOBA 4Y2GA 5EXDA 3Q9SA 3OD1A 1US8A 2GHIA 4FMDB 4RZIA 3SLGA 5CNKA 3IEVA 2B2XA 5AVXA 1TIBA 1O95C 4KXUA 1T4CA 2JFXA 3SYMA 4A6XA 4R7TA 4XLLA 1GQOA 3CGWA 4I55A 3ZQ6A 3ZK8A 5CB4A 1YNSA 2VHUA 2FRXA 4M6WA 4R84A 1M74A 1JHYA 1Y1QA 4JYMA 1VFNA 3S3TA 5AM0A 4DLAA 5JNTA 3PCTA 1DXHA 1QX4A 4OL0A 4V0QA 2VZEA 4QDUA 1PU2A 3ZHRA 5K3DA 5JXWA 4IPTA 1WS6A 4V3BA 2NQ2C 5KNBH 3TAXA 3PGJA 2WICA 4QTZA 1EUDB 5FOQA 4LMAA 3DMNA 2Z2XA 3M2PA 4OHPA 3TECE 3L06A 3QEOA 1E7QA 1NYRA 1LPOA 1CUVA 2O06A 2PSDA 3B20A 4X3CA 1NGSA 1E2MA 5DV9A 3REFA 3P0IA 4EJ6A 3BWYA 1H8HA 2OCLA 3ZCPA 2J7PD 4BVBA 1VB5A 2R62A 1EWVA 3V7WA 4F92B 5HOEA 2QX4A 2V5AA 3MINA 1N2ZA 1UBCA 2ZDQA 1RBMA 1P7WA 3G49A 4IH4A 4JNKA 3O2NA 4ON9A 3V34A 2Q21A 1L5OA 1OYYA 4ZODA 3ZZTA 1NAIA 2PKQO 1WJGA 4B79A 4WFQA 1P5HA 2P9YA 1OT3A 1JKFA 1MO3A 1URPA 5E95A 1EFKA 4LEIA 4FD2A 5ALGA 2V7VA 2QG4A 1JHXA 2AG5A 4N0DA 1CIPA 3WYBA 1NKSA 1JJAA 3MJRA 1B6SA 5B7NA 3DC7A 3NC4A 1EP2B 4HL6A 5IN4A 4NYJR 2I4TA 1P7ZA 2PVCA 4G2TA 4B74A 3QE0A 3OPYB 3GZNB 1LBHA 3JZIA 4S12A 3CG4A 2HSZA 4U7FA 3WGUA 3DBVO 4CM3A 4CMGA 1TJYA 1XZDA 2BUBA 1PJ4A 2I2WA 2VPYA 4MWOA 1Z4MA 1SOVA 3PYLA 4Q9DA 2V0CA 4IFBA 1UODA 4F4JA 3QXJA 4DJJA 2EF1A 4PHHA 2A1TS 4WMLA 3QPDA 4YDSA 5EJ8A 2ZSHA 3IB6A 4PSVA 3FDFA 2VYCA 1DFIA 2O1WA 4IIGA 2JD2A 2MMCA 3FOWA 1NYQA 1XZBA 5DWQA 1E3WB 3H3XA 1Z5WA 4D79A 1SUEA 2WKWA 4XDZA 5CTAA 4BE9A 1AHPA 1A0OA 4YRRA 2WKQA 1GYRA 3GR6A 2ZM6B 3Q8LA 1JKJA 3LHFA 1P1CA 3QFHA 1U0BB 1E1CA 3N39C 4DLBA 1BRMA 5EXEA 1P73A 2QX6A 3L8YA 3RVQA 1NVKA 4UUPA 3IHLA 4B4WA 3FPFA 4I8XA 2QPAA 3AR5A 1V39A 1EE1A 1GU0A 3X1XA 4RZHA 4LJ5A 3SDSA 2C92A 2FOXA 1U3VA 4J03A 2ESRA 4J0QA 5IN5A 4MI6A 1NBEA 1U9CA 2PA0A 4JASB 1DAMA 2DHEA 2WHXA 4G5SA 1E9VA 3KSDO 2AX3A 1ZNXA 4AF7A 2P0YA 3ET5A 3OZCA 1TF5A 3B8EA 4D3FA 4MEBA 5GZ6A 4C3UA 4RTPA 3IERA 4OI4A 2P9QA 2IF0A 2GX6A 2XVMA 2G7ZA 2CYCA 2QKYA 1V5IA 2DUJA 2R00A 2YFYA 3B9RA 3TRFA 4URWR 3E9EA 1ICEA 1C30B 2FZ4A 3OTWA 2NYRA 4LISA 1Q50A 2QR5A 4RXTA 5JROA 1OYVA 1R4ZA 3QSGA 4QYSA 3PL1A 3EGDA 4NKRA 1WL8A 2O5VA 4HHEA 4D0SA 2ZFUA 1E1YA 3WNDA 3WK5A 4AJKA 4CKCB 4G41A 4GD3Q 2AUTA 1Z18A 3V42A 2P2DA 5F12A 1C1DB 1QR2A 4C21A 3UJHA 2R6DA 3CNHA 4IG4A 4WFKA 3UW1A 2PUAA 1IYZA 1V1JA 1XA3A 2EFGA 1QUFA 3L92A 1SXQA 3O8LA 1T36A 3FGZA 1HE4A 3HJGA 4IWYA 4Q16A 1Y6JA 3K0KA 2WKSA 1F9AA 1M1YB 4N03A 3U44B 1GL6A 3ZHZA 1A4XA 3MTDA 4Q66C 1ZJ6A 3F5FA 3Q11A 3D1JA 3NJ8A 1VG0B 2Y1CA 1CY0A 2FR0A 4P82A 4B8YA 2J3IA 3ZW9A 4EKNB 4HQFA 5CA1F 3EIQA 2N75A 2NO9A 3SEFA 2AUMA 4MW0A 3ZE1B 1D2NA 1JDTA 3WXMA 5DEIA 2J7PA 4LNUA 1G55A 5EIOA 3W90A 3K4QA 3QTTA 1NBAA 3N8NA 4CMIA 3W5SA 1CY4A 2NV6A 2Q8PA 3HUUA 3A4IA 2HA7A 3LBNA 3RVRA 1GM5A 2XB2A 1QH9A 2ADFA 1AKRA 2PTGA 1JE1A 1Y4DE 3H5TA 4D41A 4KJXA 1M2FA 1DU4A 5IT5A 4KV7A 4WRRA 3GXBA 1T0BA 2RH5A 2V0NA 2XX3A 2VZLA 3OKFA 4RJJA 2K4MA 3T4UA 5AOAA 3W7BA 2B4YA 4AROA 2LWIA 2WI8A 1X13A 2QVXX 1P8AA 4UQPA 4WGFA 1LX7A 2FSVA 2W2TA 2DR2A 1AKVA 3TQIA 3A1WA 1SEPA 3ICCA 5JH7F 4O2BF 5CAEA 1RM5A 1XGKA 2YZ2A 2PZFA 3CV3A 1G9XA 2PLRA 2WJVA 4WKGA 3HJNA 6REQB 2ZT5A 1PBNA 3N05A 3EIEA 4ER3A 5T4HA 1JSLA 5BR8B 3H5NA 5LJLA 2G0TA 5EGSA 1E9FA 3K9LA 3UUWA 1F4VA 2YXBA 5HE8A 2XEXA 4YCJA 4MVJD 3PQDA 3DR5A 1V1RA 2SKDA 4GOLD 3G2MA 1M7GA 2EP7A 2GN8A 4U5XA 5EE9A 4CQMB 4BX2A 4HH1A 4F11A 4FOPA 5JSYA 2C3YA 4KLZA 3ROGA 3EC1A 5BN5B 3STUA 2WC1A 4OQXA 3ZWAA 4J76A 4Z9XA 2JGKA 5KYUA 4EW6A 2AE1A 1Z38A 1QV6A 3GWZA 4KMRA 2QJWA 4GYKA 3DL7A 2GAJA 3HJBA 2IX9A 2I1LA 3I0NA 3I6BA 1VJ5A 3RE1A 3H11A 4Q4AB 1N6RA 4NZYA 5E9WA 5F35A 4EB8A 5EHZA 3T5DA 4MW6A 4UBOA 2F67A 4ENVA 3I01A 4WZBB 1Q1QA 5CDHA 2BI8A 4D92A 4GLBA 2IYQA 3KR1A 4FR2A 2HRBA 2JIPA 1QV7A 1TJ3A 3DMGA 1D09A 2EWVA 1WU8A 5AW8A 1W34A 2XHEA 2AZXA 5K3EA 2VDMB 4NU0A 1FPQA 5EJ2A 1OTXA 1N0HA 4L8YA 1QDEA 1G0NA 3KT0A 3HDQA 4QTUB 3DLHA 3IOEA 4XWKA 1U0TA 4NONA 2BM1A 3UWMA 4UCXA 4YT4A 3LA6A 1HWYA 5THQA 5JDIC 1NA5A 1C1XB 1TRHA