3FMPB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
LVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmpB00
4MRRA 4U7DA 2GZAA 1AS0A 2J87A 4JJZA 1JBKA 2ZR0A 3NWJA 5HKKD 2O0JA 1RRPA 1F3OA 3O47A 5HE9A 3N2IA 2ZSDA 1FUKA 3IIKA 1G21E 1NN3A 4MKHA 4C0BA 3QVUA 2DWPA 5JS8A 2OXRA 1AKEA 1FPMA 3CF0A 3LVRE 2W00A 3EPLA 2GXSA 2D74A 1RZ3A 2NTYC 2CVHA 3CPEA 3L8YA 5FOUA 3C5CA 1A1VA 2AWNA 3TH5A 1KI6B 2Z0MA 1GAJA 3LBIA 4Q9JA 5BQ5A 3TLXA 4B3DA 3CX7A 2CL7X 2P5TB 1OH8A 3AVTA 4PSVA 1B0UA 3QKRB 5AR1A 2ZE7A 1LV7A 4MKFA 5CJPA 3FVQA 4RD3A 4YXWA 5SZIA 3I73A 4EKDA 2H7VA 1VCOA 4AKIA 4PR0A 4EPXA 4LWZA 4DT1B 1S1MA 1E9BA 4QGFA 1GOTA 4ZIRB 3LX5A 4FMDF 4NCJA 4DCSA 2V3CC 3UK6A 4HAUA 1S9HA 4JYCA 2ZITA 5EXSA 1PJRA 2ZYTX 3MWLA 4FCTA 3OIWA 3Q3JB 3JVUA 1XJ0A 2WMNB 5JBQA 2JLYA 4UNPA 4J0QA 3LW8A 5IK2D 4B3FX 4PHTA 4AG5A 1VDZA 4QC2A 4NYJQ 1R6BX 1E9SA 3HP1A 2QGZA 4C3ZA 4JSYA 1Z0JA 2IUTA 3C16C 1SULA 5JSZB 2UZ3A 2BM1A 3CR7A 3WNCA 4B75A 5JI3E 3UXMA 5JECA 1OPXA 5A4JA 3QKSB 1YZKA 2IYVA 2NGRA 2WIAA 2WMOB 3KKOA 1FW6A 2QN6A 1WXQA 2GVZC 1AZSC 3QVVA 1F5NA 2QM7A 1ESNA 1OW3B 2GEVA 1EFRD 4CW7A 5KDOA 3CO5A 2ZU6A 1I2DA 5DI3B 3NIBA 2PCLA 4PTLA 3EZ9A 1ZNXA 2E9SA 2N1BA 2YZ2A 8OHMA 3BB4A 3OIVA 3ICQB 2FPLA 4TMWA 1GTVA 4PQFA 1M2OB 2ERYA 4M1YA 2IX3A 3THXB 1NLFA 4QM7A 4TLAA 4Q9LA 1W2GA 5BYJA 1XDBA 2ZRJA 2WOOA 1Z63A 1E4YA 4IRUB 1WCV1 3CONA 2D62A 1KI9A 1MR3F 3A58B 5G53C 1CR2A 3T5GA 4CF7A 1Z0DA 4A9AA 3CNOA 2WJIA 1PV4A 1KI3A 4B2PA 2W2VA 2ZJ5A 3AGPA 2B7BA 3PR1A 5CM8B 3AVVA 3K0CA 4QBIA 3A6PC 3AVXA 3EG5A 4LK2A 4R9UC 3ICEA 1OXVA 4HAVA 4GP7A 4MKGA 4M1TA 3U3KA 3O8BA 2WSSD 1G291 3IBGA 4TQ9A 2CBZA 2D06A 2XITA 3W5JA 2L0XA 3WP1B 3R20A 2BMJA 4GOXA 2FFBA 1CJUC 2VHJA 2WKPA 3CPJB 1E2NA 5TARA 4C2TA 4HUTA 2QENA 5FR1A 3IEUA 1XTIA 4YXWD 1ZNWA 2YOHA 4LV5B 2P6UA 1CR4A 3EIHA 2IS6A 1UFQA 3X1WA 1X86B 2ORIA 4OQFA 1XD2B 4UKDA 2PZEA 3PUVA 5CB8A 2BBSA 2XZLA 4M1MA 3NHAA 1PUJA 2IHBA 1WRBA 3GJ7A 3QPVA 4F4CA 2ZYVX 1SHZA 2O8BB 4US0R 5HZKA 1VCMA 5DI9A 1A4RA 4LHWA 1N5JA 4R7ZA 5JEEA 1QHHA 3HYRA 2O8CB 4TYQA 4XSGA 4M53A 2IWHA 1IXRC 4Q4AA 3K1JA 3FMPB 1W0KA 2NPFA 1CRPA 1Z6TA 2CDNA 2YC4C 3TSZA 3MCAA 1W4BA 3CRVA 3HU2A 4URZR 2PEZA 1Z6XA 1JPNA 1M7BA 1ZM4A 4G5SA 4TQUS 2NO7A 1Z0AA 1ZC3A 3BBPA 4M9QA 5B30A 4GI7A 2O8FA 3LH5A 1S3GA 1VYUA 1CJMA 3RRZA 3CNLA 4QFMA 4JJKA 4DCTA 4LDJA 5JHHB 4AYTA 3FFBA 1DG1G 4PQRA 2FDCA 1TPZA 2EFEB 5D3MB 2IUSA 4DDWA 3CF6R 2J0QA 5LD2B 4LJ6A 2F9MA 5FOTA 2Q9AA 4PZYA 5AUNB 2X8AA 4HEJA 1N0UA 4JKYA 2Q3MA 2AXPA 2WWXA 1ZNZA 2NO9A 3DPUA 3GJXC 4Q03A 3RLFA 1JXMA 4NONA 4RD6A 5DN6A 4D0LB 4QJ4A 3RSLA 1E9FA 1RYHA 1GKYA 2AR7A 3ZD6A 3BXZA 4QHTA 2IUUA 2PLFA 1H8HD 5SZKB 1IXSB 2ONKA 2J0SA 721PA 1KGDA 2GTPA 2ZRIA 3QPUA 4GSYA 1NMXA 4MKIA 2ZJZA 3SJZA 3GD7A 1N6RA 3AF4A 1ZJ6A 3RS0A 5LB2A 1ZIOA 3U6KA 2C99A 2KBEA 1NP6A 1Z28A 2IEZA 1Z6GA 2ZI4A 3SNHA 2DFTA 5CLLA 1AS2A 1KI2A 2AHOA 4POAA 4V03A 3WHLA 4GT1A 2CCJA 5DGXA 2HYIC 1NVVR 4Q7JB 3I61A 1PLJA 2X77A 3VQTA 3W6PA 4Q9IA 1GM5A 4PAMA 2IEYA 5DH9A 2Q9CA 2GCNA 2NQ2C 2RHMA 1OH6A 2QM8A 821PA 4IDPA 1II8A 1W5TA 1ZP6A 2WWGA 2XJ4A 1IJFA 1RJ9B 3VU9A 4TSFA 4EJSB 3WP0A 4MYCA 2ZQ5A 2V8OA 2H18A 4DB4A 4C0KA 4UXHA 2XSZA 3ND9A 4JYBA 3P20A 1W36B 3P26A 1IQPA 3AF0A 4US1R 1XPOA 4BE7B 2D2FA 2FFQA 1NBMA 3K09C 2Q9BA 1EK0A 1EXMA 1XMVA 3KB2A 2B21A 3V00A 2WTUA 4QKQA 2ZRGA 1V5WA 3NVAA 2QL6A 1O3YA 3TSWA 3F0TA 4BGDA 2WJYA 1T91A 3L0PA 4WW0A 3U7HB 5LPNA 2RGGA 1HTWA 4NCHA 1J8MF 1KTVA 4HLDA 4P3YA 4K8OA 4AYWA 1KK0A 2YKGA 4EFMA 2NPIA 1Z07A 1DO0A 1IN4A 1F2TA 3SYNA 1T6NA 4C0SA 1NVWQ 1XWIA 4KSBA 4A0GA 2V55B 4Q4HB 4S35A 1Q3HA 3H1TA 4PAOA 1OFHA 2MSCB 1ZM3A 1CS4C 1AKYA 2V54A 2ZSEA 1CF4A 2CJWB 4OK6A 4DZZA 2P65A 4LJ9A 5FUVA 3ZS8A 3A8TA 1SVLA 3LA6A 3CB4A 1Q57A 2VHCA 3N5CA 1NBME 1W46A 4JKIA 3M1IA 4KVGA 3SZRA 1T0HB 3GP8A 2YINC 2NZJA 1GNQA 3QEJA 3ZDQA 1RRGA 4B71A 2V6JA 3R8CA 3DZ8A 4TMVA 1G8FA 1S96A 3LRPA 3ZZUA 5E3HA 2LCFA 1XJQA 2KI5A 1E2LA 3GLHB 3RC8A 4DB2A 3ONWA 4CT5A 4U02A 1Z08A 2VP4A 3LWNA 4Z51A 3OESA 1X1RA 3GLHE 5JWHA 2P2LA 4ZDIA 2OEPA 1JXOA 3E70C 1UKZA 3K0FA 4LBVA 2WJGA 2W6JD 3NHBA 1R5BA 1XMJA 1COWD 3TUIC 3O8RA 4UNSA 3IHLA 3KUDA 4LRWA 1KI8A 3QY0A 4MRPA 4DDVA 1E96A 4Q5IA 1W36D 2GJAA 5M04A 3RANA 2CK3D 4A0HA 3ZGXA 5HCIA 3U6BA 1ZBDA 3AVOA 3B78A 4TMZA 2V7QA 2OESA 1HA3A 1FX0B 3TKLA 4A0FA 1BYUA 2IYZA 3CRRA 1HE8B 4LYAA 2R62A 3OF5A 3ZVRA 1NSFA 4XSHA 4HAYA 4LZZA 4XD7D 1PZNA 1N2CE 2J0UB 2GF9A 2B92A 1SVIA 1JR6A 3RS3A 1JQLB 1U0LA 4M1WA 4NU0A 4TMKA 2F1RA 3K0EA 1E99A 1P5ZB 3ZQJA 3DOEA 4GOKA 3VKWA 2RMKA 2HXYA 1F2UA 2A2ZA 4B3CA 4DLZA 4XWOA 3EC2A 1PLKA 1Z0KA 1GZSA 3L82B 2VLIA 3ASZA 1MH1A 1N5KA 3K0AB 1US8A 4FINA 2RGNA 1NI3A 1NBMD 3MLEA 5FPSA 5FUXA 1U99A 1DE0A 1JAHA 1P73A 1VHTA 3DO6A 4KYUA 4HLCA 5JHGB 4XIGS 1MO4A 2IYRA 1OB2A 4PXAA 3IQWA 1U8AA 2FE4A 4HLUA 4KFTA 1NVUQ 2ORVA 2ZANA 3PFIA 5KPDA 3ADDA 4Q19A 1E2HA 2WBLC 3U60B 4TLEA 4URUR 3UWKA 2QBYB 4V0MA 3TBKA 2GESA 3GMTA 1GL6A 3X1DA 2GXQA 2ZUDA 2ZI7A 4OQMA 2PJRA 2EFCB 1CJKC 4C0JA 3BFXA 2FSHA 2HJGA 2REXB 1XF9A 4KFRA 1EFUA 4ARZB 4DIDA 3KTAA 5JJKA 2BKUA 1NG9A 2JATA 1IN8A 3NBYC 4QGHA 5FOVA 1ZM2A 3K0SA 2LKCA 1XEWY 3DHWC 5G3ZA 1GILA 3FTQA 3U4QB 4Q4JB 4Z1MA 1G1MA 3VTKA 2J1LA 1P75A 3CM0A 2IYLD 3RYTC 4WAUA 1K8RA 5B2ZA 4A8JA 3W3AA 5B58C 5KU1A 4W5JA 3LW7A 4RD2A 4FMBB 1TU4A 3OHMA 2JLZA 4JLPA 2VYFA 3I32A 3L43A 4YDSA 1KO1A 3ECCA 5FOXA 3NDPA 1G3RA 4WA7A 5DO9A 1FNNA 3HWSA 3KQLA 2BHRA 2IS2A 5IDVA 2MSDB 2ZUBA 4II7A 1Z8FA 3CRMA 4YMVA 1HY3A 3KJIA 4JLMA 3AVYA 3K9LA 3SS8A 1JR3E 4PSKA 1BMFD 3TSOA 2V7QD 3IDQA 5EXTA 2Q3HA 3FGNA 5SZHB 1M74A 3A37A 2EFDB 2VF8A 4TWZA 4A4DA 5EE5B 1R5NA 4HI0E 4RD0A 1AIPA 1W4CA 2FA9A 1DAHA 1VPLA 3KUCA 2C9OA 3QEOA 4V0LA 1L7VC 5F2EA 3T35A 1VHLA 3VR5A 4P4SB 4NL4H 4F38A 2ZAMA 3CR8A 2VTKA 1NJFA 5KSZA 4RD1A 1U98A 4FCWA 1OFUX 1MKYA 1XEXB 3WYAA 4ON9A 2XXAB 2FFAA 4ZDJA 2R6DA 3QG5A 2FX3A 2BV3A 121PA 1IY0A 1NY5A 3ADKA 5CYOA 4FWTA 2AWOA 421PA 1ZUNB 1H65A 4ZCLA 4OI1A 3AVWA 1KYIA 5F9FA 1U90A 3GLFB 3M6AA 1GG2A 2ZJOA 5UKDA 4YC7A 3ZZ0A 1IM2A 1NKSA 4E03A 1BIFA 2GCPA 4IOKA 1XCGB 2ZRFA 1CULC 4L8GA 4LJ5A 3ZJYA 4BRWA 5FTMA 3GLFE 5EXPA 4GNKA 1WBBA 4TQAA 3RNLA 5LD2C 5KNDA 2VF7A 2XNSA 4M4SA 4KBGA 3QIAA 1YVDA 2XOKD 2NG1A 1KSFX 3IILA 2W2TA 3H86A 4AD8A 4Q1DA 2IYWA 4BZQA 4W5HA 4KCGA 1IOZA 1Z2AA 4BLTA 1D6JA 4D80A 5JMTA 2YOFA 4MGZR 1KZ7B 4DJTA 4G3XA 3X1XA 3PUZA 3QBTA 3NDBB 3QENA 1R2QA 3SBEA 1JR3D 1RKBA 2ZRAA 1MABB 4X8MA 1D2MA 3T1VA 2GDJA 2GILA 4RZXA 3SR0A 3LVQE 4HLQB 4B76A 1QG4A 3W34A 4B6FA 2G6BA 4FW9A 3N70A 4P31A 1SXJA 3U44B 1FQJA 2Z6VA 3A4MA 2G0TA 4NCKA 3W8NA 4LY6A 1W4RA 4JMPA 3LDAA 3FFAA 5C4GB 3EZFA 1YE8A 2Z4SA 5GADl 1TTTA 1VKJA 2F1JA 4BEJA 1XFAA 3SHFA 2A7QA 4DSUA 1R0YA 3EIQA 1CIPA 3PITA 4URYR 3P4XA 5AUQA 3W90A 2W58A 2EWWA 4KSCA 3WBKA 2H8KA 5LDDC 1OYWA 3MJRA 2XAUA 1II0A 2QEQA 2UZIR 1LF0A 4F92B 5F9HA 4B6EA 1XZPA 1T3LA 1G7RA 1S4QA 4AKEA 2IYXA 4EJSC 3REFA 2PBRA 3ZIAD 2RGAA 4MQBA 3SJBA 3B1XA 2JIZA 1W36C 2RAPA 3OZXA 1N6HA 1OV4A 2J7KA 2OLJA 1AQYA 2QTHA 1G41A 3KXLA 2ZRDA 5J4VA 4X8HA 3E1SA 4LHVA 1CJVC 1W0JD 3IBYA 4JL5A 2GWHA 5DE3A 1KKMA 1OH7A 3VMFA 4JVNA 1K5GA 5FFMA 1CR1A 2GZDA 2VPPA 2HJVA 4WZBE 2EYQA 2YWHA 3AUYA 3R7WA 1NY6A 1R10A 2JJ2D 3Q9LA 2BDTA 5H68A 2GRJA 1I4DD 3GLIB 3QUSA 2VHUA 1G3MA 1N5LA 2BEKA 3GPLA 1JJ7A 1LTQA 1T5IA 1YJ5A 1KJZA 3LX8A 2ZI9A 3CX8A 2JJ1A 4OJQA 3S1AB 2ZM5A 2G0NA 2QTVB 4Q66C 4FWIB 1W4AA 2ZJBA 1U0JA 4NPHA 4BFUA 2ATXA 3SEAA 4IKEA 5FH9A 1T4GA 4N0EA 3SE0A 2G88A 3LV8A 2OSBA 2A5FA 4UJ3A 2WICA 5AUOB 4TZ0A 4LBZA 1A7JA 1GKUB 1KK3A 4R71A 2ZIAA 4N0DA 1KMHA 1BYIA 1XD8A 3L0OA 2ASEA 1KK1A 3RSOA 3KZ1E 4A6XA 2WKRA 1U2RA 1G4AE 1G8HA 5HR5A 1CP2A 1DBSA 2ORWA 2OCBA 2XX3A 2Z83A 1SZPA 1ZU4A 1SVOA 1BO6A 5B64A 2GAOA 1W2HA 3VX3A 3T5DA 5K8LA 4ZIRA 4D25A 2GVDC 2JLUA 3GJ5A 2BBWA 4MGYR 4S2EA 4UXJA 3MWYW 4RCZA 3T1QA 2KWIA 1E94E 4I81A 3VFDA 1KSJA 2MMCA 3EZ7A 1XNJA 221PA 3L8ZA 1QHIA 5H8WA 1P60A 1E9EA 3A1VA 3WHKA 4HAXA 3FOZA 3OEHA 3R9WA 4Q9KA 2J59A 1DAFA 3RVBA 3VKGA 1Q22A 3F5FA 3RRMA 1P62B 3D7MA 2OAQ1 4U00A 3THYA 1VMAA 4OK3A 4DCNA 4L9WA 1DARA 4AG6A 1GP2A 1OXXK 1TF7A 3NEYA 4P4TA 2BM0A 1OXSC 4DWJA 4M8NE 1W48A 1F48A 3EWAA 5TMPA 4QHSA 3OE7A 1Q44A 2CE7A 1GWNA 3KKPA 4D4MA 1GRNA 2GJKA 2JDIA 3LXXA 4JLAA 2O0HA 2AD1A 1UF9A 3G0HA 4B2LA 1V43A 1YZTA 1DAGA 2CLCX 1JJVA 1Q1BA 3SFZA 4KVAA 2JASA 2JEOA 3CNNA 1N0WA 1SHKA 3NBZC 1D8TA 2IS4A 2F7SA 3ZLJA 1E9RA 1N3BA 4RZ2A 4MITA 1Z3IX 3KQKA 1TF5A 2V9PA 1AZTA 1VCNA 1E0JA 1GFIA 2QP4A 2RGBA 4RFSA 1UDWA 1XTQA 3CKLA 3TQFA 4E09A 3WYGA 3BS4A 4PX9A 3SFVA 2VRWA 4F4IA 3CF2A 5D3QA 1TF2A 3K70B 2BJWA 4DLVA 5E4FA 3CUEF 1S3SA 3I8SA 3V9PA 4EPRA 4Q21A 1D9XA 4Q00A 3VR6A 5IHPA 3ND8A 3AGQA 4PO8A 1GRQA 1MRSA 3QSYA 1N6IA 4UQOA 3SN6A 1X8KA 2Z43A 4CRWB 3B13B 1UBFA 3MSXA 2N42A 1U9IA 2TMKA 4NYMQ 2PMDA 2QGNA 4CGZA 2QG6A 2C2HA 2VO1A 3F3YA 3AEZA 4JLNA 5TV2A 1JALA 4MA4A 3B6EA 4ZCMA 3C4JA 1XBTA 4B32A 5KDDA 1QVAA 5FPKA 3PCRB 1HUQA 1E2QA 2DWOA 4M9XA 1NKTA 1Q1ZA 2BMFA 4DRZA 4Q9HA 4DCVA 2C9YA 5KNBA 4OI2A 4OQNA 1ZINA 4IW3B 3KDSE 1E1QA 4JLOA 4PZLA 4QNMA 2ZI5A 3PIRA 3W3ZB 1P9WA 1UBEA 3OFNA 4JBXA 3P27A 3NG1A 2E87A 2FU5C 1XXHA 4M22A 1TQ2A 1OJLA 1G9XA 2PZGA 1XTRA 3I1FA 1R0ZA 5JZVA 3QE0A 1Z06A 4QL3A 2JLSA 1J90A 4XOIA 2C96A 1IY1A 3GEHA 5EQTA 2WHXA 2ZXUA 2QT1A 3K53A 5KSPA 1T3SA 2G1KA 1WQ1R 2GK6A 4OHZA 4A92A 4PC7A 1EX6A 2PMKA 4QRHA 3EARA 1ZUIA 3FKSA 5AK0A 4A0RA 3WMEA 4AIIA 2C8VA 5EZ6B 4EPVA 1CTQA 4R98A 4TLDA 2FN4A 5SZJA 3PEYA 5HTKA 2C77A 5E7MA 3BFKA 1NVVQ 2HEIA 1B23P 1OFIA 2DR3A 1XU4A 3AF3A 4V02A 1KI1A 4CEIA 1XD9A 2CL6X 4D26A 3SQXA 1GL9B 1WE2A 3K70D 2JA1A 5FL7A 2EW1A 2FH5B 1G17A 4MRVA 3CH4B 2QRNA 1QHHB 2FGJA 3DL0A 3SC3A 5C1BA 1XP8A 1P3JA 5L3RA 1YHNA 1G3QA 1N6LA 2XZPA 1XPRA 4Q4AB 4BFZA 2QQ0A 4M1KA 1CEEA 3PVSA 1IN5A 3ZS9A 4U5XA 1CR0A 1KY3A 3KQUA 1OHHA 2HYDA 4E07A 2VQSA 1Q21A 5J40A 1ZW6A 2FPKA 1RIFA 1JAIA 3BE4A 4QGGA 3MJHA 2O8FB 3VR2A 4G01B 1OYYA 1P7CA 2GA8A 1EG7A 3GLGA 1KI4A 4EQ6A 2QAGA 4ZO4A 1BOFA 4LJ8A 2A3RA 5TB5A 2IK8A 1LS1A 4BFVA 2R2AA 3KQNA 3IEVA 1GDDA 2QRZA 3EPJA 3CZQA 1N25A 3CX6A 3SU8A 2QY9A 2IF0A 4FMCB 4TL9A 3A1TA 3AH8A 1MO3A 2BWJA 4IFEA 3OEEA 4TMXA 2GBLC 4RFVA 2QROA 4JS0A 2VP0A 2IA5A 4G0NA 1XTJA 1KO4A 1Z2CA 2YWGA 2R6AA 4O2LA 5B57C 4NCNA 2QPTA 3QF4A 2BMEA 5JLJA 2O8DA 2C9CA 4HUQA 4OJKA 3VHLB 3AVUA 1IN6A 3CIOA 4YMWA 3KXKA 3AP1A 3JZMA 2J46A 4URVR 3THOA 1G18A 2ZS9A 2AK3A 2JJ8A 2WWIA 3TAHA 3AKEA 1G6OA 2FOLA 3SI7A 3KKNA 4AI6A 1CXZA 3B7GA 3GLGE 4EPWA 4WXPA 4I1VA 1KJWA 3GJ8A 2OBLA 4M21A 4M9SA 4JLKA 3SYLA 3R9XA 4URXR 1NVXQ 3L2OB 2ZE5A 2DFNA 3KL4A 2P5SA 2JLWA 3HJNA 4MRNA 1XEWX 1P2VA 2RGEA 2REOA 5DSZA 5JS7A 3GCGA 3OAAA 3CLVA 2R9VA 2XTMA 4L5BA 4XTCS 5J4HA 5FOWA 1OIWA 3EA5A 2A5GA 3BB3A 1QHXA 2WWHA 3BERA 3UG7A 1Z83A 3REGA 4C30A 1TX4B 1W0KD 5JFGA 3UMRA 1LW7A 1T9HA 3B1VA 1E9AA 5TXGA 2O8EA 2CHVA 3LAWA 1G6HA 1II8B 2QMOA 3MMPA 4C0AC 1NNEA 4AKHA 3VU9B 2O5VA 4PPGA 3RC3A 3GQBA 2ZPTX 3FMFA 2OM2A 2YJTD 3MFYA 5HZHA 4B3GA 3GFPA 4NYIR 1GVNB 4D2IA 4FMDB 4OKSA 4PZZA 4F93B 1DELA 1KK2A 5H70A 4ZI2A 3I3SR 1NIPA 5P21A 5E95A 2D4HA 3THWA 1R0WA 4OQLA 2R6GA 1P61B 4IXNA 4ERNA 5E7IA 1FQKA 1OHHD 2ZSFA 4D4LA 2GCOA 3HPQA 2H1LA 3LO5A 4YMSA 1OIXA 2JLQA 1R8SA 1CU1A 3KJHA 2WWFA 5CIQA 4PC3A 2ZAOA 3RWOA 2CNWA 4I1OA 5DN6D 1WB9A 2Q6TA 3IGFA 4ESHA 1KAOA 3P4YA 2AX4A 1NRJB 2G9NA 1R4AA 1F2TB 5FTLA 1TU3A 1E0SA 2EQBA 2R65A 2YOGA 2KB0A 4NKRA 1KO5A 1M1YE 1Q20A 5GJWC 3UMSA 4ZCIA 5HCNA 3RS2A 5IT5A 4G5RA 4FN5A 1IBRA 2VEDA 4H9GA 4PPFA 5FOSA 3UMFA 1AA9A 1VTKA 1SVWA 2I3BA 3TIFA 2OO7A 2ERXA 2QT0A 3DMNA 3K8YA 3Q72A 2C78A 1UPTA 2HT1A 2IYTA 4QOSA 1A5TA 1QHGA 1G64A 4MUBA 5BWMA 2NMVA 1OIVA 2F3RA 1XTKA 1S9DA 4DC9A 4RY2A 1LNZA 2QSZA 3WXMA 2CHGA 1WDTA 5FUWA 4B73A 4BFYA 3A4NA 1P9RA 2DFKB 1R0XA 3B60A 4KU4A 5ANRB 3WYFA 4GL2A 2VSFA 3K0FB 2I1QA 1G16A 2B8TA 4NBSA 1S1CA 4TSFD 4BZPA 1C4OA 1Q1QA 2OCYC 1XMSA 3K0AA 5EP2A 5CJ2A 621PA 4CEHA 4Q1AA 1AGPA 4MYUA 4B47A 2XSZD 2ZVPX 1MOZA 3OAAD 3G82C 3B82A 4G5QA 1Y63A 4HB4A 2IWRA 5DNYB 3KJEA 4C7OA 1LB1B 4LC1A 5FBLB 4D81A 4G5GA 2CXXA 1OKKA 3NKVA 4B44A 1OFTA 2VL7A 3QF7A 4YONB 5EZ5A 2QUZA 4LSGA 1BH2A 2IT1A 2RGCA 1HQCA 1XMIA 4GOJA 2GEDA 2UKDA 5KNCA 4PPQA 2OZEA 1NMYA 3UKDA 3T34A 1IHUA 3TUZC 5KTYA 4O25A 4DCUA 1SVSA 3QNUA 3PJRA 3EZ6A 4DIEA 3NC1C 5FBQB 1US8B 4LHZA 2WSMA 1TQDA 3UPUA 3GJ6A 2D7CA 2G1JA 4Y0VA 1E79A 3BOSA 1KDTA 1E0AA 4LPKA 3AKYA 1N0VC 5KUTA 3BGWA 1WP9A 1KHTA 1X6VA 2AL7A 4JVMA 3MRSA 4MGKR 5IF9A 3K70C 3C8UA 2EU8A 5KHOC 3MD0A 2YWFA 4JT2A 4GPTA 2ZJYA 3D31A 1E1RA 4DUGA 3U7GA 2ZJ8A 3AKCA 4XJXA 4AKGA 2R6CA 4DLRA 4ZKDA 4KJZA 1HE1C 4PO1A 4OQXA 5DYGA 4A1FA 5FTNA 4JLBA 5DYIA 1T8UA 1M34E 3EAQA 4TYYA 5G3YA 2VHQA 3QKTA 4B74A 1UKEA 1QF9A 1DTSA 1N6KA 3BC1A 4V0ME 3QXCA 2X1VA 3X1ZA 2B6HA 3TE6A 5JRZA 4ITRC 4QNRA 5KYKA 4D0NA 2GETA 4AC9A 1L4YA 4IHQA 5FPYA 4B3XA 1UKYA 2JAQA 3KTAB 2QTFA 4GMXA 2QU8A 5CK5A 4TYWA 2FSFA 1TUEA 1HYQA 1WF3A 4HZUA 3R9IA 2FG5A 1UADA 4TT3A 3LLUA 5BXQC 4V0OA 3DEFA 2A78A 5FTKA 3K0CC 4IEIA 4ZPXA 4A8JB 2AN9A 2VIIA 3KXIA 3DDCA 1U94A 1EESA 5FBRB 2XTZA 1W49A 2DBYA 1LVGA 5GVSA 1PVOA 1W7AA 1MT0A 4OHVA 3AM1A 4LHYA 2C98A 2QMEA 3HYTA 2WJJA 4KLNA 3BWDD 4AURA 3VR1A 2XNDA 2H17A 2HUPA 2ODNA 2EVWX 4CYMA 4MH0R 3RS4A 4FD2A 4MUAA 2O52A 1FMLA 3PUXA 1TQ6A 5K8IA 4NP6A 2ZRCA 1N6NA 1IAQA 3EW9A 1ETUA 3HU1A 2KJQA 2V1XA 1OH5A 1T0JB 3NTUA 4B35A 3K9HA 1KNQA 2W6IA 4HDOB 1E69A 2FSIA 3QI2A 4DKXA 1YZNA 2ONJA 3T1TA 3RRNA 2J7PA 3C14C 4E22A 1ZCAA 2G77B 3BRWD 4KI0A 2YV5A 3AQ4A 2GF0A 4P0TA 4NHOA 1UBCA 2IS1A 2CLSA 2XZOA 1P4SA 5KDLA 1DEKA 5FPTA 1P6XA 2VBCA 3RWMB 3ADCA 2OUKA 1E79D 2GJ8A 1YR9A 2EFGA 2RGXA 4Q4LA 1R8QA 4TYPA 4EPTA 2ODWA 1QRAA 4TMTA 2XB2A 3H0KA 4W5WA 5HKKA 1TEVA 2FMXA 1MRNA 1G20E 2IF2A 1G7CA 2ODEA 1E2JA 1RE0A 2F43A 4HZIA 2F6RA 5FL3A 2WJVA 3IUYA 4AY2A 1R7RA 2J41A 1EWQA 3Q85A 2FEMA 4LYJA 4Z1MD 2BIFA 3NBXX 4TTQA 4A2QA 1OSNA 3A36A 4M1SA 4I99A 4R2HA 2XTNA 3QXJA 3A1UA 1JEEA 3EX7C 1GKIA 4BFXA 1XJCA 4Q47A 5EE1A 2V6IA 2WWWA 2OV2A 4IOJA 5HE8A 5DHFA 1SQ5A 2HT6A 3LLMA 2MSEB 2F3TA 2DWQA 4KODA 4OHWA 4Z8YA 4LV8B 1E2IA 4NE2A 2B8WA 3MG9A 2OCAA 3ZD7A 4CEJA 3P32A 2WWYA 5EP3A 1CJTC 4XVQA 5DHAA 4HB2A 3WNBA 5C4MA 1Q0UA 1II9A 1EX7A 2QMHA 2I4IA 1SXJB 4BEBA 3K09A 5C18A 4TL6A 1L2TA 3PUWA 3UATA 4DLTA 4FCVA 2WPDA 2HCJB 4QHYA 2HF9A 4B34A 3UWOA 1DAMA 1SXJE 1Z0FA 2ZREA 1UBGA 5ELXA 4NMMA 3PENA 5H1YA 3NC0C 2WV9A 1TNDA 2R6FA 5IK2A 3ZQ6A 1ZYUA 3B9QA 5F98A 1T8TA 1I4LD 3P1JA 4DEYA 5BN4A 3RS5A 1WBDA 2XNDD 1XRJA 4ESVA 2PCJA 2FZLA 4MGIR 3CWQA 2WJHA 3I8XA 4PHGA 2KBFA 5BN5A 5L3QA 3ZZTA 3FHTA 1SKYE 5J4LA 2IHYA 2ZRBA 4PANA 2F9LA 4XVRA 5L3SB 1UJ2A 3I5YA 3H84A 3LXRA 1G5RA 2GXAA 2RKOA 1EFRA 1E6CA 1P2SA 3I62A 1OXTA 3IIMA 1NL3A 2OBNA 4Z54A 3UANA 1GNPA 4IVPA 1YZGA 1QG2A 2D3WA 2ZRNA 4H1VA 2LWIA 2CLDX 4KLZA 2AFIE 3W8RA 2BMDA 1VIYA 1IONA 2J5XA 4EAQA 2QPAA 2Q3FA 2A9KA 4QG7A 3WMGA 1ZNYA 1CKEA 3GFTA 3R7WB 5JJIA 1UEJA 3HDTA 2DHRA 2VP5A 1R5OA 2A5DA 3RDPA 4QJ5A 1KI6A 4TN1A 1Q12A 5AJXA 3QKRA 4K46A 2CMKA 3CH5A 3TAUA 3DM9B 2IYUA 2V4ZA 4JLVA 1S0UA 4N1AA 4DT1A 4LJ4A 4LOAA 1TQ4A 5EE3A 1SGWA 4Q1BA 1P9NA 4H1UA 1X8JA 1KDPA 3B9PA 1SXJD 3VR3A 4ZV4A 2QMUA 2X19A 4IDOA 3RRYA 5AJVB 3IHWA 1NG1A 1KMHB 2WSSA 3HR7A 1DG3A 2WAXA 1ZUHA 3ZYCA 2CHQA 5EUQB 2JCSA 5LB4A 2I1VB 1RVDA 2C5LA 2MMGA 3EASA 1L4UA 3U3MA 4LBYA 1DAEA 2K5UA 3LBNA 5AJYA 5EE9A 3RAPR 1QHYA 4DXAA 5FPHA 4G5OA 1LF5A 1KMQA 1SVKA 3PEVA 3U3OA 1D2EA 1HH4A 2DFLA 4C9BA 3MWKA 4G1UC 5JWRA 1SVMA 3KFXA 5JSZA 1FTSA 3DOFA 3I4LA 1U8YA 3BJIC 3QKSA 3BH6A 1GNRA 1S2MA 4IOLA 2GAAA 4RKFA 2CEAA 4CZ2A 2C03A 4LUCA 2WPDD 5IRCD 3EXAA 3TVTA 3ASYA 4TL7A 4Q18A 1E2DA 2JIZD 1DS6A 5DI3A 3TR5A 1YRAA 3R8FA 4EIWA 4P32A 3SHWA 4A36A 3CPHA 1H8EA 5CM9C 3LBHA 1IN7A 1KO8A 4WIAA 5GJBA 3ZVMA 5JCZA 1VECA 4EFLA 4LCBA 3THYB 4HDQB 2ZROA 3LNCA 1X8LA 3AP3A 4GZLA 2FWRA 3TMKA 1UDXA 2PX3A 1I4TD 3D6TB 3THXA 3QXHA 1Q1EA 1HT2E 5FTJA 5A0FA 4EPYA 2ZI6A 2OAP1 4D4KA 3GJ0A 4KXFB 3Q8XB 5G40A 3U3RA 2KE5A 4BWYA 1DVRA 2ZYUX 2NO0A 1QDEA 2JJ1D 2R8RA 1GL7A 4ACAA 5AJWA 2GJSA 1FOEB 3L0IB 4D6PA 3LD9A 1YKSA 2GK7A 2HCBA 3SBDA 2RGNC 4AWXA 2E1RA 2D7DA 4DSTA 3KJGA 4ABYA 1LY1A 2DYKA 1FZQA 4WVFA 4DEXA 1G7TA 1JPJA 1SKQA 2HXSA 3PG5A 3QXSA 1QZXA 2NOAA 2DB3A 3K9GA 4JLDA 3KFVA 4HLUC 4I1SA 1OE0A 1Z47A 4EDHA 3X2SA 4RFSB 4NTZA 2BJVA 3LFUA 1Z6YA 1Z0IA 1FMJA 1T5LA 1VYTA 2PL3A 1KNXA 2ZRKA 4P4UA 2IC5A 1E2FA 2YC2C 4JVLA 2RCNA 4UXIA 3WRYC 4LJYA 1H8HA 2AXNA 5FBVB 2EWVA 3TGPA 4JT4A 1XX6A 1EFCA 1XD2A 2AKYA 2BKEA 3BAFA 1TL7C 4PO9A 3B1WA 4CVNA 4UNRA 521PA 2C95A 2IYSA 3ETLA 5KO2A 4HDCA 3A1WA 3B2EA 3RS7A 3FYHA 4ASUA 3Q5DA 3IO3A 2AK2A 2W2XA 3C41J 4HAWA 4IDHA 2O8BA 3AV0B 4DSNA 3BB1A 4LHXA 2VP6A 2IYYA 4QBFA 2VP9A 4NYJR 1ELOA 4ACBA 3NH6A 4OI0A 5F3WB 4PAQA 2VH5R 1XCMA 3DM5A 3H4MA 3OEHD 5CDFA 2O8CA 1G8PA 1YRBA 3TW8B 3FMOB 3U2QA 4B2IA 3VNUA 4A8JC 1GIAA 4TTRA 5E7JA 1JECA 1KIMA 2PLRA 1DADA 1E2KA 3IO5A 4HAZA 4HB3A 3TK1A 5FBWB 2D2EA 4RVCA 1HT1E 5GJCA 2DCUA 2CE2X 1YQTA 1G8GA 1RW4A 1Z5ZA 2ZJ2A 2VP2A 3OE7D 1XXHB 2VHTA 3OIUA 1E2EA 4Q01A 4C4PA 2JDID 4YMUA 2OT3B 2ZI3A 3QOFA 4KFSA 6Q21A 5DISB 4BQSA 2ZU0C 5FR2A 4NCIA 1GSIA 1O87A 1WA5A 1XXHE 5D3MA 2OLKA 4QJ3A 1H8ED 2HLDA 4YMTA 5J4KA 1QHNA 2GZHA 4F4JA 4FXPA 3NH9A 1OB5A 2G3YA 4BFTA 4OHXA 2IYQA 2JGNA 3GEEA 4LI0A 5GVRA 1KOFA 3F8TA 4WZ6A 2ZYWX 1IJEA 3KKQA 4URWR 5FI1B 5LBIA 5CDFE 3NEJA 2YHSA 4B33A 3FKQA 2PZFA 3SYKA 1PLLA 2PT5A 3FHOA 1CLUA 4M0LA 1W1WA 1YZQA 2DPXA 2XJ9A 3BORA 3NBFA 3EPHA 3LQRA 4BFSA 4IVQA 4UNQA 4CEIB 1G3UA 1AK2A 2BEJA 2QI9C 5KSYA 1VG8A 1HV8A 5JWOA 3TQCA 4V0NA 1DO2A 1UM8A 1UKVY 4TL8A 4NYMR 2WZQA 1WMSA 2P6NA 1DAKA 1AS3A 3SJCA 3KQHA 5CITA 1E2GA 3KX2A 3U7FB 1IXZA 2H92A 5JI2E 3AF1A 2QZ4A 1LS6A 1X1SA 4NYIQ 1S8FA 4XVUA 3EIEA 3Q7PA 4Q7KA 3TJZA 1ODFA 4IDQA 3T61A 1QVRA 4JZKA 2V1UA 1E2MA 2FJUA 3B85A 3HPRA 4TZ6A 4OYHA 1KZGB 2P3SA 2RH5A 2NIPA 4M2LA 4O0MA 3V4FA 4IJMA 1EWRA 3AKDA 4Q7LA 4UNNA 5AJZA 1KKLA 2CCGA 3B1ZA 3BD9A 5FI0B 4B48A 5AUPB 4V0KA 5K8TA 5KSOA 4W9MC 3GLGB 4EQ6B 3TW4A 2OFWA 2QAGB 3NXSA 2IXGA 1YZUA 4F7WA 1FP7A 4JSTA 4L4UA 4L15A 2O0KA 2OE2A 1E1QD 1RJ9A 2CCKA 4IOMA 1NSTA 3UG6A 2W6JA 3O8CA 2X2EA 4EJSA 2XGJA 3KB1A 1COWA 4GZMA 3OFND 1E9CA 1AQUA 3CRW1 4ASUD 5EJEA 2JLVA 4DBLC 5JJLA 4AYXA 5CLQA 1ZM7A 2CK3A 1ESMA 2B7CA 4DSOA 1E4VA 3QF4B 5KOYA 2O8DB 4HUQB 4CIDA 3U5ZB 1SXJC 1Y3AA 3BK7A 5A5GA 3M0EA 1M7GA 2QQEA 2LKDA 3A1SA 2F1IA 2H16A 3FB4A 3W9YA 2WIBA 3FKSD 4XD7A 4OK5A 2ZETA 4TYNA 1KDOA 3VAAA 1JQJC 1FL9A 4L9SA 4ZDWA 1FFHA 3W5IA 4GFDA 4BASA 2ATVA 2J9RA 1BKDR 3AB3A 2FGKA 1MO5A 1FNMA 4O2RA 1W44A 2W83A 2GNOA 1XB2A 3AP2A 5KPJA 5EUMA 5EP4A 5CB6A 3EPKA 3W6OA 3QG1A 1QBKC 1UEIA 4Q48A 2H57A 1K6MA 1RYFA 2OFXA 4LX0A 4Q4HA 2RGDA 4A15A 5FL7D 3TRFA 5K8UA 2PT7A 2HDNB 2XEXA 1ZD1A 4RZUA 2AD5A 2FNAA 4BLQA 4O3MA 2HLDD 1NLYA 2CJWA 2ZSBA 3DMDA 3VKHA 2OHFA 5L3VA 1P2UA 4X8LA 3FDIA 2W0MA 5BW8A 1A82A 4QBGB 1J70A 5L8VA 2QPOA 2R44A 1E3MA 2ANCA 1RPZA 2O8EB 3SOPA 1KO7A 1RFLA 4D4JA 4Q1FA 3MAAC 2YYZA 4RD4A 4RCYA 2N46A 1JEDA 2ZR9A 2FSGA 1Q3TA 3GLHA 3KKMA 4LJAA 4EFNA 4EUNA 2QP3A 1NMZA 2FV8A 4JL6A 1T3HA 2P67A 3MWJA 3WNDA 4C0LA 1TADA 1E0KA 2FZ4A 2PJZA 4IEEA 4LJ7A 2A5JA 3TR0A 3FE2A 2J45A 4GBMA 4KBFA 1AJEA 4OHYA 1G19A 1J99A 2OG2A 3THWB 1QHSA 2HV8A 4HYYA 4JL8A 3IPXA 3OEED 2FEOA 4KYIB 1ZRHA 1NLZA 1VYVA 2WKQA 4QXAA 2GCOB 1D2NA 1JB1A 1YU9A 1RC8A 1FX0A 3QKUA 4BFWA 3E5HA 1NIJA 3BFVA 3UIEA 2ZRMA 4DLWA 2ZS8A 1XPUA 1OLOA 2A5YB 1EFHA 2GXUA 1C1YA 4DVGA 3LY5A 5TVKA 2JLXA 3BIFA 3RABA 1YZLA 3DVLA 1NN5A 2J0UA 3BH7A 4ZKEA 3W6NA 4LGMA 1YR8A 2RB4A 1J7KA 4BUJA 3MGCA 3C5HA 4NH0A 4ILEA 5CIWA 1I2MA 1N6PA 4B43A 4BLOA 4GRAA 5J47A 1ZM9A 2FF7A 1KJYA 2OILA 4Q1CA 4MDEA 4OI4A 3H2YA 2ZE8A 3BH0A 4F91B 2ZR7A 1BMFA 5DIFA 4DDUA 3K9NA 1KSHA 4IVRA 4IDNA 2FPMA 2ZJAA 5C2JB 3HR8A 5TY0A 5CYPA 1PUIA 4B3BA 3QQ5A 1LFDB 1NN1A 3RHFA 2Q21A 1NF3A 3DKPA 3QBVA 4XH9B 1K5DA 3B5JA 3U3JA 1XZQA 2ZRLA 3EC1A 2ZUCA 1G3IA 1OXUA 2NO1A 2IXEA 1XEFA 4Q7MB 2BBTA 4XTRA 2QBYA 4A82A 4RSGA 3T12A 3VX4A 1J2JA 1F2UB 4I1UA 5AWFC 4CEHB 1DAIA 3FWYA 3EZ2A 3I92A 1ZD8A 2WM9B 1D5CA 3GEIA 2JLRA 2C04A 2Q0HA 3PQCA 4IFBA 1NN0A 1P2TA 4JIMA 5TDHA 3VR4A 1TEXA 2ECKA 4A6PA 4C7OB 4Q02A 1HURA 4ARZA 3D3QA 1BS1A 1ZMXA 4TLBA 3CWZA 2F1HA 4X8OA 3PXGA 3QJYA 2AKAB 5BN3A 3U4QA 2GHIA 4Q4JA 2CL0X 2RHDA 4TTPA 2YWEA 2XOKA 4N3NA 2CNWD 4KO8A 3PV0A 4PQYA 1KSGA 3U61B 3QPWA 4NDZA 4A2WA 2IXFA 3WMFA 3C15C 3IPYA 5J5CA 4HSEA 1Z29A 3A4LA 3TVDA 2OXCA 4PHHA 1JR3A 4PHFA 5J4YA 3IQXA 4DLUA 3AVPA 4CDGA 1Z22A 1TMKA 2OCPA 4I4LA 1ZIPA 2X2FA 4HB0A 4IXMA 3DKVA 4KAXA 3X1YA 4YQFA 2GKSA 4XWKA 2DY1A 1G4UR 3FMIA 3Q5EA 3AVQA 3IKJA 1C9KA 4LC0A 3FHCB 4MYHA 4BRUA 2BBOA 4KITB 1E32A 2BCGY 2J3EA 3E2IA 2EFHB 1U9IC 3Q7QA 2QORA 1GITA 4DLSA 2G83A 3GJ4A 2WVJA 4GMDA 4P4SA 4PPNA 4BLSA 1L8QA 3TNFA 4D82A 4DHEA 1N5IA 2J0VA 4R2IA 1M8PA 1HQYE 2VSXA 1XEXA 4ZDKA 4PC1A 3I5XA 1AGRA 2XXAA 5EP1A 1JI0A 3T1OA 4CT4B 4AK9A 1IY2A 1EFTA 2WOJA 2QSYA 2BC9A 3JZAA 4JBYA 4Q1EA 2OFOA 4HZUB 3GLFA 4MRSA 4BLRA 2ZS7A 3B1YA 3ZIAA 4DLXA 3MUFA 3L0SA 2YVUA 2YNMA 3M4YA 4Z8XA 3VNVA 2BVNA 1M6NA 1E2PA 2GJ9A 2ZRPA 1OKKD 1RRFA 2WAYA 2Z4RA 1JNYA 4LYHA 1CBUA 4OL0A 1UAAA 3JVVA 1W0JA 3PEUA 4D0GA 1ZVQA 4A2PA 2ZE6A 4KHZA 4JBWA 1FUUA 1RRCA 4PC6A 4C2UA 3HU3A 3WRXC 4DLYA 4LBWA 2JJ2A 1ZU5A 1ZAKA 4RJLA 1TUIA 3ZH9B 1ZCBA 1KI7A 5EE0A 4FIDA 2QNRA 4ZI3A 4C0QC 4C0HA 2QE7A 4JVSB 2ZVQX 4MYTA 2GBLA 1VG1A 1MABA 1FTNA 1TAGA 2SHKA 3WY9A 2ODBA 2PX0A 3DZDA 2HF8A 1GRRA 1A2KC 4BZXA 1U8ZA 1J8YF 2VSOA 3ADBA 1D9ZA 4WXRA 3U7EB 3U44A 1KAGA 1E1RD 1MV5A 2ZSAA 4DUGD 2GEUA 3LQQA 3V4RA 2A30A 2P0EA 1G7SA 4Y0AA 3PEWA 3ZVLA 4GDFA 1FP6A 1N6OA 5CK4A 2PEYA 4QGAA 4W7SA 4MDFA 1F60A 1XCPA 1ZC4A 3C7KA 2KSQA 4GP6A 4BECA 2Y8EA 1VG9B 1E98A 2EYUA 2IL1A 1X3SA 2OBMA 2AFHE 3QXXA 2QAJA 3GFOA 1Z6AA 1CRQA 1OT3A 2QAGC 1W47A 2VA8A 5GJVC 3G5UA 5JEDA 3SJAA 1A2BA 2F43B 1G5PA 4PSAA 4RZ3A 4YLGA 1U81A 4TT3D 3CW2A 4DDTA 4HATA 3GJ3A 1KDRA 1VIAA 3O8DA 1F6BA 1HEIA 3D8BA 4L16A 5G41A 5JRJA 1VG0B 2F55A 3WBJA 1YR6A 1AN0A 3CZPA 5HPYB 1EGAA 1M7HA 1G5TA 4TLCA 3VHXA 4WBSA 2Z5FA 1KY2A 3AUXA 5FUYA 2ANBA 3EA0A 1YR7A 4QM6A 4LPSA 4XWAA 3EWSA 2ZTSA 1SKYB 1W5SA 3TUJC 2FFHA 4CEJB 1NJGA 2IW3A 3T06B 3ZVNA 3IIJA 1MO6A 3GLIA 4OBEA 2W0SA 4PFSA 4RKEA 4BPBA 4KV9A 3J81k 5L3SA 3CBQA 1ONBA 3OIYA 1G8YA 4PC2A 4KFUA 3FPAA 4M1OA 5C46F 1E9DA 5DLQC 3B8HA 3S1AA 4FMCF 4YDHB 1VCIA 2ZEJA 2REBA 4P33A 2BCJQ 2W6ID 2XB4A 2IBMA 2ZRHA 4E5UA 5BYKA 2PH1A 2QA5A 3SDZA 3T15A 1DPFA 2BOVA 1GUAA 2J7PD 3N2EA 1P72A 1DOAA 5JCPA 3AF2A 4LYFA 4LV6A 1ANKA 2QP9X 4US2R 3I72A 2CVFA 3SQWA 4JLJA 1XTSA 4WOPA 1OF1A 1ZD9A 2NZ8A 5L3QB 1AM4D 2NO6A 4UJ5A 4WZAE 4FI3C 4NZYA 2H5EA 2QE7D 1U0HC 3CRQA 4K81B 4M9ZA 4QBHA 2UVQA 5EXXA 3GLIE 2P6RA 3PUYA 4BLPA
chains in the Genus database with same CATH superfamily
1E7SA 2VDNB 4ZOEA 2P9CA 4EEKA 4BKRA 4RF3A 1SKUA 1AS0A 1CHDA 3WGNA 3JAMA 3NWJA 3OE4A 1U31A 5BUCA 1PK8A 2D5BA 1NUQA 2ZPAA 3UH0A 1UKBA 5LU9A 1C8BA 1F3OA 1U0NA 4ZZ2A 3N2IA 5CRIA 1FUKA 1QIIA 1WZCA 1U7TA 2H1RA 3IIKA 2IUEA 2VUUA 3KJQA 2BKAA 4MKHA 4C0BA 4F6LA 2BI4A 1Y42X 3AIIA 2Y1OA 1AKEA 3KT6A 1AXEA 1GV0A 4UATA 5GM2A 1X8XA 4REQA 2Z09A 3LL7A 3HZHA 2CVHA 3L8YA 2XDQB 1GG8A 1WV1A 4BO6A 1O95A 1A1VA 1DU4A 3G0GA 4D45A 1FMFA 3COJA 2ZJ1A 1TUGA 1WO8A 2MYPA 4ITVA 3O8NA 4ID3A 3QHQA 1BROA 1FUEA 4Q9JA 1KP3A 1IG3A 1TLTA 3M70A 1KOLA 4K9SA 1L8AA 2NQ8A 4PSVA 4R1SA 3M6VA 1B15A 4UDOA 4FCCA 3MCTA 4YXWA 4EKDA 4AKIA 1Q19A 3I04M 3F6PA 4MUNA 2XMBA 5B2EA 4PQEA 3LX5A 4S1TA 4YV2A 5TS3A 4KN9S 2GO1A 2P4UA 4RMGA 4X66B 1I3CA 3RGGA 3W6UA 3HYNA 2BGKA 1HDCA 1U3WA 4A6DA 3D0QA 4WQMA 3CPSA 2BCEA 3PPIA 4K88A 4LZNA 3HO1A 4DQ0A 2E82A 3FUUA 2YV1A 3KYDB 4NVRA 1RVV1 2C0PA 3OIWA 3WA6A 2JGAA 5F73A 3G79A 5LP1A 1VA5A 4KWTA 4QYMA 4BMPB 1MAAA 3ASVA 3I01M 3ZJ4A 4B7CA 2AXQA 4N49A 3AHEA 3O0DA 4J0QA 4BNUA 3C97A 3DBHB 4FSXA 2WD9A 3KC2A 1T9GS 4BO7A 3GDFA 4RK6A 1R6BX 2FPPB 3TSCA 3P2YA 4BJ6A 3HP1A 2QGZA 4JSYA 3VPAA 2R6JA 3A10A 3C16C 4R1TA 5DULA 5JSZB 2BZGA 2X6QA 4RL6A 1GAEO 4Q24A 1B0PA 3W9BA 5BOSA 2VFAA 2P0AA 2KQUA 1RMYA 4Z5XA 5EWMA 1HZZC 2IYVA 3QIVA 2W6MA 2WMOB 4JOQA 1T6YA 4EGFA 4LAFA 1NR5A 1O6CA 4GICA 2IPOA 2VHZA 5FB3A 3AEUA 5D7BA 3V8RA 1JW9B 3PNVA 4DLPA 5SYNA 5JYBA 4G0XA 3KUXA 3PKZA 4FBGA 3EZ9A 1JILA 4F60A 1F8UA 3H5LA 1HYBA 1C29B 5K8JB 3ICQB 3DTVA 2FPLA 1EB8A 3BMOB 2BFEB 3PJFA 4MUHA 4TMWA 4PZAA 1QYRA 1RNLA 2HLHA 4EHAA 1O2DA 1QFMA 1R1DA 1SC9A 3QWIA 3GBPA 4ZI5A 4TLAA 4Q9LA 2HQRA 3W9UA 3OX2A 1T3ZA 4HWKA 5U4QA 4B4KA 3F73A 4N01A 4UEJA 1M6EX 2ZRJA 2WOOA 2FKAA 2F2TA 2H1SA 2GPAA 3D6UA 1E4YA 5JAHA 3DL7A 3MYRA 3OX1A 3EVTA 1V96A 1P77A 3CONA 2Y1KA 3EDRA 3AEYA 3RYFA 3TNDA 3U4DA 4F96A 3KHTA 4YAEA 5G53C 2IOHA 1F9EA 5CLIA 1J42A 1Z0DA 4A9AA 2O1EA 2VK1A 3SXPA 1OLUB 3G8DA 3GEPA 1PV4A 1Y33E 4KN5A 2W2VA 3NIWA 1WW2A 3AGPA 5CM8B 1SZJG 2O3SA 4MI9A 4QBIA 4Y2TA 3AVXA 2PXXA 4LK2A 2I76A 1ZN9A 3N7TA 4J91A 2C7VA 4JITA 3CLRD 1HTTA 3QM1A 4I50B 4MKGA 5CA1A 3U3KA 2X5JO 5BYBA 1O95D 5KCMA 4DNFA 3D6NB 4AKTA 2D06A 3BT7A 3W5JA 2BUBA 2XNCA 2VHJA 1E2NA 1X7XA 2XWSA 3EFOA 2ID4A 4HUTA 3JAWB 3F5DA 3IEUA 3IUPA 1FDRA 1TT5A 4E4TA 2GB4A 4YXWD 4LV5B 1UFRA 4N8EA 4RUKA 4TXJA 1OOEA 1TA4A 4BIIA 4AZ3B 1J22A 4NV3A 3UFXA 2B82A 5KJ6A 1UFQA 3UBTA 1EE2A 2ORIA 2HU8A 3H9QA 2HNAA 4FR2A 1SB9A 3D4LA 4PZCA 2PZLA 3OA0A 5J43A 2FFJA 2OB2A 2R79A 1K68A 5K3FA 1PUJA 2IHBA 1WRBA 5ALNA 1SHZA 2JI9A 3QU5A 2GAJA 2BI7A 4PE5B 1Q6YA 3D5EA 4I55F 1OCEA 1XLTC 1SQSA 4GM1A 1VCMA 2Q6IA 3EFHA 5KYVA 3IV6A 5JJCA 1EQ2A 4LHWA 2RIPA 3HYRA 4K6HA 2WINI 3SQMA 4M36A 1EWTA 2B61A 2RJNA 3BA6A 4ND4A 4RDXA 3MRVA 3G9UA 5JSKA 1C7ZA 4Q4AA 1W0KA 1E60A 1NC3A 3ONDA 5L40A 1IC6A 5F4BA 3UYLA 4OX9Y 2CDNA 4RKWA 4KR0A 2JRLA 4S24A 4AW9A 1P1RA 2DLCX 1JDBC 1NNSA 3CH7A 3TXAA 3CRVA 1V26A 2ODTX 1XIVA 1E59A 1Z2DA 1IZYA 1ZM4A 2LR0A 3C7TA 4G5SA 4IQGA 4RHFA 1DUIA 3MGAA 3RFXA 4EMSA 4AM8A 5B30A 4M3NA 1FE8A 3C7DB 3PQDA 3ZXSA 1BCSA 1ZS9A 1CJMA 4CUZA 1V8DA 5BQ3A 3U09A 5JAIA 1P18A 3AOEC 4JJKA 4M1QA 4QFMA 4DCTA 2W2KB 2Y3IA 5AKGA 4ZVOA 4AROA 3GNTA 4BKQA 4PQRA 5EXDA 4BNYA 4KO1S 1O96B 1XKXA 2CHFA 1AC5A 3CF6R 3IDOA 1FQOA 2EF1A 5AK6A 2R8EA 5A7HA 3DTVD 2VAWA 3JASA 3DMYA 4I1YA 1O5IA 4HVCA 2CLOB 3T5MA 1RCFA 5AUNB 1X1DA 5DV9A 5JJBA 2BFDA 3LPAA 4AB1A 4MS3A 4YRSA 4UBMA 5E9AA 4D96A 1SM4A 5LZ7A 1ZQ1A 3RS9A 1G66A 1RKVA 4H60A 4CLRB 4GI1A 3I64A 2GT1A 1WEHA 2VQ3A 4MP3A 1NE2A 5LA6F 1IUPA 3ZGVA 4LQ4A 4ZHSA 2B3TA 1DQYA 2QVYX 2OPBA 2HF7A 5JH7F 3DFZA 1TB4A 2W5UA 1VLVA 4PHCA 4MUEA 3UV7A 3PP8A 3FUXA 3J7TA 3WLEA 4E2WA 3EUFA 5EWLB 5AHKA 1L5OA 4ZZIA 5LQKA 2QPLA 3TOXA 3ZD6A 1Y5NA 3FH0A 3P0JA 2PLFA 1MGPA 3L06A 1DXHA 1GQRA 3GRUA 4H2DA 4G0WA 1N5OX 1VLJA 2GTPA 3QPUA 4IMRA 3AHDA 4JNCA 2WKWA 4QATA 3SJZA 3AF4A 1ZJ6A 4EJ6A 4EB6A 2HMTA 2X5KO 1AGYA 1SPBS 1TECE 2WF8A 4N41A 1PGNA 2ENWA 3FFTA 4JLUA 1ZA2A 1XPJA 4KLCA 4Q7QA 1QRRA 4ZHQB 4HTFB 1IB6A 2IEZA 3R74A 4MJLA 4EG1A 4YAGA 2RARA 3LHKA 2DFTA 1LWOA 1TUBB 2UYGA 2YXNA 3DDNA 3HBLA 4QLOA 5HBGA 3WHLA 1EUYA 2YUTA 3DL2A 3DZFA 2HYIC 1B8OA 3L6CA 2AG0A 2HRRA 1NLUA 4IAOA 3NALA 2GO7A 4Q7JB 3VQTA 5I4CA 4WCFB 4HDMA 4Q9IA 5I7VA 1U0OC 4NK5A 5DH9A 1NZDA 3PIIA 3G49A 1NFQA 2K7FA 2XCIA 4F5EA 1JTEA 4CM8A 2GH1A 2AG8A 5KI6A 4E2FA 1VB3A 4J6EA 2NUBA 1WAMA 1QYIA 4GH5A 5JO9A 5HMMA 5KNCA 1SU4A 4LY9A 4MYCA 2ZQ5A 3V46A 3ZWMA 2V8OA 2H18A 1GPAA 1R8YA 3ZY6A 5MGNA 1AA6A 3ND9A 4I5EA 2F17A 2ZQZA 4ZYVA 1LLUA 1YXMA 5DYNA 2UV8A 3A25A 1UFVA 2YRXA 3KLPX 3VZQA 1EUQA 3AR5A 1UWCA 3DBOB 3V4VB 4E11A 2FFQA 5K0JA 4JC8A 3CZMA 5AKJA 1K1EA 4JLSA 1SG0A 1V1MB 5I7SA 2EFYA 2HQBA 1PQ4A 2JF0A 4Y2HA 4ZAXA 3BEOA 1EJ0A 2WTUA 1Y5MA 4XD2A 3ABZA 1DRUA 2QL6A 2B9EA 1CQWA 1ZIXA 3SCZA 4U9HS 1V9LA 3WLSA 3F0TA 4XPIB 2IBSA 4YT2A 1T91A 1CNEA 2XEDA 1LSUA 4FYHA 4GKKB 3CKKA 1SKAA 3KJXA 3PQ5A 2K7ZA 3R8XA 4FXOA 4KRGA 1CJBA 1DIHA 1KK0A 3IMGA 2E89A 3CLTD 3FJ1A 4NPAA 4BNMA 5K45A 4OXKA 1WNFA 3B1KA 5M34A 5BT9A 2C88A 1BU8A 4R2WA 4A0GA 1XWIA 4EI9A 4QJBA 5J2UB 3MJTA 1RWPA 4DA9A 1KQ3A 4YRMA 5AJUA 2A57A 1H0HA 5JJ5A 1TVKA 1DAOA 2F64A 2VPTA 5E0KB 1CS4C 1TD9A 3BWVA 3FJOA 4B7ZA 2CJWB 1T8PA 5IVKA 1VDMA 4LJ9A 3QA9A 3ZS8A 1VMEA 2VJKA 4P98A 5CB0A 1J9EA 2PRZA 4NJEB 3N5CA 3IYLW 4JV5B 1G1AA 3KZOA 4JKIA 3M1IA 4Y9SA 3LDFA 4MLPA 5J23A 2GKOA 3JQCA 3QHAA 4HN2A 4CIBA 3CISA 2XRMA 4FFLA 3ZDQA 2G7MC 2H5IA 2WU4A 3R8CA 5KWIA 1W19A 2XZDA 3UAVA 2PQ0A 3A3PA 1KJIA 5A5FA 2FJPA 3DMTC 3GPDG 4NU6A 4IDFA 2EKLA 2IUFA 4KH1A 1GQSA 5T4FA 1RHKA 3AB7A 2KI5A 3EIXA 3GLHB 1OMOA 1YNOA 4DB2A 5A62A 4DREA 4BQIA 3AJEA 3K20A 3OEYA 1X13A 2CVOA 2LDXA 2XWPA 2IVFA 3RKSA 3HWX1 3C7AA 4CLOA 3R7LA 1NTOA 3CS3A 1J00A 4O8ZA 5JWHA 3PDUA 3VTFA 4ZDIA 5FEUA 2PUVA 3E70C 2PYIA 3D6JA 3NHBA 3AZOA 3TUIC 3HRIA 5P8WA 5K3SA 1FRVA 2R7LA 3HXLA 2MR5A 1E96A 5K0EA 3TDNA 2BFCA 1JLMA 3UGQA 3RANA 3KQOA 1CX9B 1REQA 2BKLA 2EZUA 3B78A 3IE0A 4FU0A 3V4OA 4G8BA 1HA3A 1FX0B 1OI2A 5EJ5A 3OPMA 3I3OA 2HCRA 2UZ1A 2ZQYA 4JQZA 4EUEA 3K32A 1NSFA 3O4JA 4XSHA 3ZTTA 3ZVRA 1PZNA 1N2CE 4QYIB 2Q3LA 4OHMA 4CMBA 3QPBA 1GCOA 5T3UA 4M1WA 2DJ5A 1TLFA 2F1RA 2ZAIA 1TOAA 3K0EA 3WTCA 2CC2A 2IH4A 4NMLA 2CFIA 1YASA 2ZB4A 3QK7A 4PYQA 1NWCA 4RANA 3UUGA 4KR2A 1SA0A 2VWQA 3G8CA 4GGOA 1F2UA 3U7QB 2H9AA 3GQVA 4CHGA 1V3UA 4X3PA 3ZZ1A 1TRHA 4FDLA 4O6VA 2JW5A 3ZZMA 1EIZA 2I67A 4DAOA 1PJ4A 4WXMA 4EHKA 2RGNA 4ENTA 2C4NA 3DBIA 3GH3A 5FUXA 3H1EA 4X85A 1QCZA 3D2LA 5BRNA 1JAHA 1K7XB 3DO6A 4KYUA 4DLBA 4Q16A 1KZ4A 4OXIA 4RTPA 4Z4QA 4JXZA 1UDRA 1MO4A 2PH5A 1OB2A 4ZQCB 4PXAA 3IQWA 4JELA 1NXVA 3I9NA 1BHO1 3O1HB 4L6AA 1G38A 2FMIA 3TXXA 3G5LA 3K05A 2FE4A 2BONA 3NXKA 4LZAA 3RJ9A 2XGOA 3KTDA 5IFKA 3WYBA 4HDNA 1U5AA 4KUHA 1NVUQ 4FMPA 3U62A 5BWLA 5K6RA 1QTNA 5JZSA 2QDXA 3MUNA 5KPDA 4UBKA 4DV1B 4TLEA 3P96A 4NCXA 4RA9A 1YU6A 4KRYA 3TBKA 1GL6A 4MO9A 2GXQA 5IWAB 1NXPA 2ZI7A 4OQMA 2ZDGA 5C8VA 1GZ5A 2PJRA 1NRXA 2E48A 1C0IA 2JK1A 1Y8QA 1VP9A 3BFXA 5GMOA 1G9SA 1KP2A 2I4OA 2FSHA 1Y8AA 3EXHC 3GP5A 3JATA 4NV0A 1BVHA 1SFRA 4JU9A 3LYAA 1GSOA 2AYZA 2QXUA 2NT3A 4FQ8A 1EFUA 3UQZA 1TFUA 2VSNA 4A23A 3T7TA 3PC4A 2GD0A 4DIDA 1CZNA 2QUIA 3KTAA 1U4SA 3OHSX 4JR0A 1HRKA 4L73A 2JATA 4PM4A 4Y67A 5JDCC 5E4YA 3GY0A 4G8DA 1IN8A 5FOVA 3EN0A 1LDBA 1I7LA 1GPKA 2D8MA 2HSWA 3LC2O 3B6ZA 3V1YA 1Q1NA 2I0FA 4Z1MA 1CFZA 3HA5A 4J1TC 3CM0A 5FHRA 2IYLD 2VTEA 2AG1A 5SY9A 3ST7A 3TBFA 3W3AA 4IGEA 5B58C 2YZNA 4DCOA 5C80A 3LW7A 2ZPUA 2CJYA 3H2JA 4FMBB 4J0GA 4KQCA 4B9AA 5EPUA 1XFDA 2JLZA 3SP1A 5A4AA 5AVRA 4X60A 1T4MA 2CXNA 3FMGA 3I32A 4YDSA 2Q3CA 5D2CA 4Y2YA 3NP9A 3V8BA 2IPXA 2R1VB 2CDCA 1G3RA 2PDAA 5FNVA 4G5HA 2XD9A 4M9CA 5IDVA 2MSDB 5LLDA 2BL4A 1ZKDA 1SY7A 2ECOA 2O4CA 1FP4B 3ZPXA 3KLNA 2IODA 1J9GA 4BNFA 1XRLA 2VP3A 3AVYA 2H1CA 2VQDA 1R50A 3VNQA 4LNUB 4KPUB 1EA5A 5TMDA 4J3NA 2Y76A 4EZIA 5A03A 2BN4A 3PFKA 5EXTA 4OA8A 5SZHB 5EYPA 2AEFA 2EFDB 2VF8A 2X8JA 1YONA 4A4DA 4RD0A 4V0LA 1H2FA 3T35A 2I29A 5CVEA 1BX3A 3IEVA 2PLWA 1DINA 1IVYA 4X41A 1NQOA 1OI7A 5ALZA 5JMPA 2C57A 2VTKA 3JVIA 3VR0A 4FCWA 4URHA 3G1UA 4DQXA 1MKYA 1YQ9A 1Y3DE 2ZXEA 4JBHA 3WYAA 3HN6A 3WL6A 3CHYA 1W2WB 3B6MA 4P3XA 4ZDJA 2YWDA 5ICGA 5BVHB 2ECPA 2FX3A 2YICA 3ADKA 121PA 1IY0A 1NY5A 2APJA 2KW5A 5AHWA 5CYOA 2AWOA 1WDLA 2N47A 2XMQA 3GDOA 421PA 1QP0A 2MYUA 3I42A 1RD4A 1TQ8A 2GPTA 5F7XA 4ZCLA 2HRDA 1PD0A 4OI1A 2JFOA 1M73E 4IXWA 3AVWA 1G20A 1E2UA 1UBSB 3GLFB 4MVXA 2C29D 5IMBA 4E03A 4LS3A 4U7GA 2ETXA 1XCGB 1L5NA 2NYUA 4Z4EA 2QLJA 4L9RA 4INJA 3ADPA 1JLLB 5AHRA 4PSCA 4EW3A 2DR2A 2A9QA 1O97D 2ZCJA 1EEXB 5E9WA 5KNDA 3LOUA 2H7YA 2XNSA 1JJIA 2Q7XA 2R4UA 4R68A 4V1CB 5EG5A 1EUCB 1OUMA 3D02A 3LBYA 3NPMA 4QTUB 4UTZA 4WBNA 4ZK6A 2XA1A 5I5GA 5EJFA 4Q1DA 2IYWA 3I5MA 2SECE 1FYVA 1Z2AA 2AE2A 3FY4A 2HPAA 1N3IA 3PHIA 3VC1A 4CTKA 3HCWA 4B83A 4G3XA 1O7JA 4CGYA 3SBEA 2UXCB 1RWBA 2XBMA 5HGJA 4NV1A 4K9KA 5BSUA 2GDJA 3LVQE 2G7ZA 5CAEB 4YP5A 3ROGA 1SQ0A 4B76A 4DRXA 4U8GA 5CBKA 4KUGA 4ITUA 2IITA 1JVBA 4GYKA 1CERA 1QO9A 1FQJA 4G0OA 4X64B 4N7JA 1WSBA 2G5GX 3ETCA 1YBFA 4LY6A 1W4RA 4CCYA 3OO1A 4HH1A 3HJCA 3HADA 1KFBB 5C4GB 1NXWA 5CFLA 3IL2A 1PWEA 1YE8A 2Z4SA 2EKZA 2V0GA 4BMYA 2FMKA 2PRYA 1WUIS 3K4PA 4EF5A 2F1JA 4M46A 3MMXA 3SHFA 2A7QA 3EGEA 1R0YA 3EIQA 3LZDA 4H35A 2BFPA 4QGSA 5AUQA 3A9TA 3TW6A 3MBIA 2W58A 1QHEA 4CQNA 3WBKA 1PAUA 4YN3A 4ZI7A 3QPAA 3RVNA 4ES6A 1OYWA 2VNSA 5ECDA 3WLNA 3R3SA 3B2QA 1AUVA 1V37A 1MZVA 1TZMA 2QLTA 3BQ9A 2NUAB 1MUUA 4B6EA 1E8NA 4KQMA 4GMHA 4PO3X 4ZT6A 4EG6A 5JNLA 3KSRA 5FT9A 3KZXA 4C3OB 3FGOA 4C4OA 4EJSC 3VZBA 2PBRA 2VCEA 4P4NA 2P0YA 2IV3A 1CNMA 1GPDG 1K6IA 5AW0A 1NAIA 3ZIAD 3KSAC 3BAZA 3SJBA 3B1XA 1W36C 1R88A 2N3ZA 1OV4A 4TV9F 1Q91A 2QTHA 1G41A 2QZPA 1QB8A 1N4DA 2ZRDA 5HILA 2HA4A 4CEJB 4FT2A 5JLAA 4JL5A 2IPNA 2F62A 3ENVA 3VMFA 4JVNA 3F97A 4GBGA 4M1ZA 4RAQA 1DBPA 4FS3A 5U1PA 4F7DA 2JJMA 1CR1A 5FFMA 5KVAA 2VQFB 1Z15A 2Z98A 2CLHB 1P5HA 3ZS9A 3AUYA 2YTZA 4X1OA 3V8VA 4P5EA 2K87A 4DIOA 2EBFX 3VYRB 2PS1A 4MK4A 4RKQA 2JFZA 4TRRA 1BE1A 2Y67A 3Q9LA 2GRJA 5B1DA 2IIPA 4KREA 1CQJA 2DQZA 3MT7A 3GPLA 1JJ7A 1U3CA 2V96A 1LTQA 4P08A 4J76A 3KD2A 1YJ5A 5ELLA 1Q1GA 1YOVA 2ZI9A 4OJQA 4S2UA 5F7ZA 1ZMBA 2G0NA 2R4TA 4CM7A 3U7IA 4ZT7A 3FLEA 4RIGA 4K2AA 5ESRA 4AJPA 4ETMA 1AQJA 2QTVB 1WMEA 4NPHA 3R77A 1GTRA 1CZKA 3O8LA 2JHPA 4PSDA 3VU3A 2ATXA 4CMIB 3OEWA 4L50A 5DN9A 3SE0A 3THRA 3VOSA 2G88A 4KDFA 2OA0A 5FV4A 3TECE 5AI6A 2WICA 4ZAVA 2IDJA 3PXDA 4NEHB 2CV2A 4X65B 5DHUA 4GD3Q 4R71A 2ZIAA 4UC0A 4CI9A 1JT9A 4NEQA 1XD8A 4PGFA 4BGUA 1PRYA 5DHTA 3P45A 1T8RA 1Y5IA 3ZGOA 4H7DA 4ARAA 2BSXA 4BNLA 1U2RA 1G4AE 3NWOA 5HR5A 4CKBB 1ETHA 2I2FA 1LZLA 2PKXA 2OCBA 3Q88A 1A9RA 2PMEA 4C4TA 4ZMBA 4KN8A 2O8VA 1T2DA 4KQIA 4Y9TA 5D01A 1T0IA 5HMLA 3UT5A 1U6JA 3VX3A 3BRCA 2A9VA 3T5DA 2WHPA 3GJSA 4IFIA 2X4LA 1W29A 4BBAA 4CM9D 3Q0TA 2GVDC 1IMOA 4MPRA 3TM5A 2BBWA 4I1IA 4CM6A 5CFNA 4UXJA 4HHEA 1EFDN 1GPYA 2KWIA 3KM0A 3VFDA 3C8MA 4R2LA 1JUDA 1KSJA 3I05A 5LP6A 3EXFA 4D0RA 5C52B 1FVHA 2IZ1A 4CIYA 4PAWA 3ITEA 4WKOA 4CDRA 4EYGA 2O23A 4REQB 4RTQA 5HOEA 4QDXA 2JKYA 4EH1A 1P60A 1UPCA 4MPDA 1E9EA 2GWRA 3KYBA 4HAXA 2J59A 3DEJA 4BYGA 2Z04A 4ND6A 2H65A 2OHXA 3D7MA 4OG2A 4U00A 1H0KA 3TQOA 4OK3A 2B4YA 3TX6A 3T9CA 3VR5H 1TF7A 2RHTA 3KVYA 4H0FA 2VG8A 5JAUA 1BU5A 4JJ8A 2DJIA 2D2XA 2QYTA 1OXSC 1NJ8A 2KLHA 2LIVA 5I47A 3F8SA 5IAEA 1TM1E 4E3ZA 1DZ3A 5D5PA 2A1TS 2I6SA 1RPJA 2CE7A 1E5DA 1FPQA 3FZYA 3GFGA 1GRNA 1VE6A 3PD0A 2C7GA 3VC7A 5E9QA 1IUOA 2R4QA 2PUBA 1OLXA 3RC2A 2AD1A 4XEHA 1P0QA 1UF9A 2FUCA 3LC7O 4B2LA 2W43A 4JP1A 5IAOA 1CY1A 4Q34A 4J2OA 5AVXA 5AMXA 1YBAA 3SVLA 1LI4A 1S02A 1SHKA 2R7AA 3NBZC 3VU0A 1OU0A 5LWHA 1JL3A 3OT5A 3OC6A 4MXDA 1MPXA 3CLSC 3ILYA 1KRHA 2QRHA 1H5UA 3G7SA 3IESA 3CG4A 3IXLA 4J0CA 2V9PA 5DW3A 5B37A 3RJZA 4D5EA 4UHCA 5TPZA 4B5LA 1SHJA 5CFZA 5DK4A 3ZDEA 1AKMA 1SELA 4JFRA 3RKUA 5HYVA 4EP1A 1VL2A 1F06A 5BOSB 1HF3A 1KFJB 2WZCA 5EWMB 4E09A 5F2NA 2WM3A 1FS5A 1L4HA 3UHFA 1Z26A 2P41A 5D3QA 1TF2A 3BXXA 1NBOA 3CR3C 4BO5A 3K70B 4X7MA 3KPUA 3IQFA 4OQ4A 5DEIA 3NKFA 5E4FA 4TKVA 3AEUB 4Q21A 4KW7A 1D9XA 3ND8A 3RJTA 3U4IA 4PO8A 4O5OA 1U1EA 1GQYA 4N65A 2HIGA 1M5RA 1XMOB 1YI8A 1DBVO 4EB3A 3QSYA 2E5FA 1N6IA 3DTVB 4UQOA 1OWPA 3NRCA 4UQPA 1I5RA 4WY5A 5CTAA 2ZATA 5FHQA 5A3VA 3KAKA 1C7IA 4UAUA 1K0UA 3DGFC 5DYWA 2N42A 2QN3A 4Q1VA 3BGSA 3G89A 3F74A 2VO1A 4P80A 2B25A 3RTBA 4DMGA 1JG6A 2Y0BA 3N2KA 4JLNA 1S2IA 2JH3A 1LVHA 1N9ZA 4NBRA 3AM3A 4OUDA 5KDDA 4AWAA 1YE5A 3KV1A 4IJVA 3PCRB 1OTYA 3E3NA 1E2QA 1HUQA 4W5TA 3IEMA 5KWSA 2FQYA 2J08A 1NKTA 2JGDA 3A3KA 3GRYA 5GONF 3COVA 3G6WA 4EYQA 4Q9HA 2C9YA 4BVKA 2V7BA 3RYFB 4OQNA 4UTPA 2P6MA 4IIHA 3T7SA 1E1QA 4FQ5A 2JFNA 4I66A 4JLOA 3JQGA 4PZLA 4MKRA 4B6RA 3W3ZB 1P9WA 3L8DA 3UWMA 1RYEA 2RGWA 3OFNA 3V80A 5K01A 1P4GA 4W5OA 4KFCA 1XXHA 1DBRA 3LT4A 1LLCA 4QUGA 1YZYA 4J16C 4IHKA 5BR8B 2JLSA 3VVMA 1BFUA 1YVRA 3CZRA 1IY1A 2PVCA 3ECSA 5C1OA 3DE4X 3FCEA 1O6FA 4QQKA 2XWQA 2OHHA 1TZCA 1LZKA 3C5EA 3EARA 3F46A 3OF3A 1VLQA 1Y1SA 3QVGA 4QPDA 4WERA 3P2IA 4P6VF 4G24A 1WP4A 3OZEA 3IUSA 1TT5B 4B3SB 3FCAA 4NNOA 5EJ7A 1CTQA 3E3AA 4R98A 3RSZA 1FDIA 3AI1A 1CUCA 5DASA 2FN4A 3T7IA 3TNJA 2CT8A 3OMWA 5D3KA 3W7BA 2W8ZA 3A4TA 4FJ2A 2C77A 1UANA 1IZZA 2JD2A 1NVVQ 3B20A 4LJSA 3UFXB 1I7QB 4IV0A 1KTIA 4JOBA 4B80A 4DUPA 2DR3A 3GLKA 3AF3A 4V02A 4CEIA 1JZQA 4BJHB 2HHJA 2YYAA 3BFPA 4Z86A 1NI5A 1PI3A 4MHOA 4ZVUA 4D26A 5K3FB 3LQ2A 5K7SA 1LH0A 2JA1A 3FB1A 5FL7A 2ZCVA 5SV2A 1PYGA 3WOHA 1X80A 1G17A 2P9JA 4QUIA 4EG4A 5LYYA 2QRNA 1BCRA 3JYLA 2XCRB 3DCYA 5C1BA 1AY0A 2VZ8A 1P3JA 2CDRA 4GBED 4UOQA 1Z7GA 2UXBB 4TYMA 1HLFA 4Q4AB 2YNMC 2F90A 3PNYA 1RQ2A 3FSGA 4F84A 1DTEA 2ZYRA 1CR0A 1IDN1 1KY3A 4RSHA 1FYEA 2OKCA 2HYDA 4U5XA 1DFHA 4ARCA 3LUFA 3I2JA 2WIFA 5J40A 3MSCA 3UOGA 3EZYA 3RRXA 2R47A 1JAIA 2QRGA 1ZK3A 3BXFA 1I3OA 3LF2A 4EFKA 2CVQA 5BV2P 3KHSA 3UJNA 2XF8A 1F4PA 4QUDA 1OQAA 3IR6A 4ZA2A 1OYYA 1J8DA 3PS9A 2PQ6A 1BCSB 1JSZA 1LI5A 1X38A 2NADA 3R76A 4BV2A 3ZLUA 1JAYA 2Q8QA 5LDGA 2IK8A 1LS1A 3ON5A 5YASA 4EOGA 3GG9A 3O2SB 5IC5A 3UOWA 2QR2A 2E4AA 2B1IA 2J6CA 4J9UE 2IF0A 1Q2XA 3A1TA 4NMWA 1MMFB 2PVSA 1MO3A 1FSSA 4UCWA 1LBQA 4D99A 4LFAB 4BVEA 3ABRB 4TMXA 3AL0C 2GBLC 3JASB 3PEFA 2YX1A 3A1NA 1R4ZA 4JS0A 2XVZA 2IA5A 4G0NA 1XTJA 1KO4A 2YWGA 3ZV7A 1X87A 2B0CA 2B3DA 2BFDB 4LJRA 4I9UA 4RHUA 1N32B 2BMEA 4OD0A 2O8DA 2C9CA 3K30A 4GC9A 3H3FA 4UVDA 3W9SA 2IYPA 4MROA 2O9JA 2NXJA 3JAKA 4II3A 1EI9A 3OM8A 3UJAA 1M0EA 3JZMA 3VPFA 1LSSA 1NQWA 2VJMA 2C4HA 1KYWA 2BFBA 2WR8A 1DKQA 3M9XA 4LOHA 2X3YA 4MWBA 5DNEA 2YN4A 4AO6A 5CFRA 4GLLA 1N34B 3F5SA 2H9IA 1W52X 4AQ7A 1ORDA 2DU8A 2PUTA 3KKNA 4AI6A 3DUWA 1IHPA 5CP8A 2VHEA 5F51A 1U2DA 2VF2A 4WXPA 3W1WA 4EPWA 2WTMA 3D7RA 3EK2A 3RI3A 3GJ8A 3GIDA 4M9SA 3E81A 4MPPA 4D5GA 1H4TA 1QR2A 5JS2A 3KL4A 4EB6B 1IG0A 1JEJA 1JDZA 3HJNA 4CXMA 3PE6A 1J2RA 1XEWX 1P9LA 4DMCA 2AOWA 1U0BB 3WGUA 1WHTA 3ABOB 2QS9A 1WCWA 1ZXBA 4IGFA 5JS7A 1J1IA 4BKPA 3RU9A 1SQ6A 2XTMA 4L5BA 3WKDA 3ZY4A 2A5GA 3FVRA 3BB3A 4IL5A 4P5DA 3W5CA 2WWHA 3H1AA 2FQXA 1DO8A 4GYJA 4HDMB 1TX4B 1L7PA 4RF5A 1LW7A 2ES4A 3DVQX 2P4EA 4BN4A 1ZXLA 2CHVA 3WZLA 3DTYA 4PG8A 3LAWA 1DKNA 1U3TA 3D3EA 4C0AC 3IR7A 4OOFA 4RPCA 4H27A 3RRJA 5L4NA 1OGIA 2XGMA 3P2KA 4PPGA 3RC3A 5CPBA 3GQBA 2C8LA 1J24A 9GPBA 5HZHA 2D1SA 3GFPA 2VAXA 3KQPA 2BAGA 3ZNOA 4D2IA 2P9QA 4EGQA 4FUTA 6CHYA 3IUNA 4PZZA 3VYUB 3ZLVA 4RNCA 2O2GA 4MDHA 4PGMA 5H70A 4ZI2A 4FVTA 4EA6A 4RTJA 4HMOA 2C83A 1JKFA 3PICA 3THWA 1K3UB 2R68A 2FE1A 4OQLA 2C5EA 4PG7A 3VR6H 4CV0A 4JUFA 2HWKA 4ERNA 1EX1A 1K7SN 1FQKA 2B4RO 2FB9A 4YRPA 1XDGA 3HPQA 3LO5A 4IV5A 1XZIA 2GM3A 1JSRA 3QLVC 4PYIA 5CIQA 5HQTA 2GJ4A 1JR4A 4MLZA 2VSYA 3TQRA 4BQOA 4BB0A 1DPGA 4KH0A 1YDHA 1Y1RA 3NYQA 3ZYZA 5DN6D 3E9MA 2Z8YM 4OLHA 5AVOA 2XRZA 2QY6A 3V4SA 1L3BA 5PGMA 4FM9A 1NRJB 3IP1A 1UAYA 4EJ0A 5FTLA 2EQBA 3GEGA 2HA6A 1D03A 2HQ1A 3DYVA 4NENA 1DKMA 1Q20A 3PXXA 4JEHA 1W35A 4IRMA 4MAFA 3RS2A 1TVKB 3L7LA 4G5RA 2IP1A 4YJKA 2P27A 1EG2A 2DWCA 1NVKA 5KNBH 1N8KA 4X94A 1VTKA 4R9VA 2RI0A 2OO7A 2ERXA 3W5SA 3IH5A 4MJXA 5FO0A 1WMFA 3S27A 1FJXA 1I6KA 2HT1A 1ZRNA 1YULA 3EEBA 1G64A 2BGLA 1LW6E 1HPLA 4HX5A 2DH6A 2ZXFA 3KQMA 4HDKA 4OGLA 1L5GB 2I2WA 2X42A 3IKLA 3FWHA 2X8LA 4F3CA 4LNHA 2ZM6B 3B48A 1XTKA 3NDJA 3FPGA 5LWQA 4UCXA 3Q7IA 2H07A 4RY2A 4L02A 2QSZA 4DC9A 1ARZA 1JYSA 1ULTA 4RADA 5FUWA 2DRIA 4XAQA 4CLOB 1P9RA 1DLJA 1KFEB 1R0XA 1ZD3A 2I55A 4G37A 5ANRB 4Z9YA 1JG3A 1YB5A 2EATA 1YO6A 4NAHA 4WACA 3ZWNA 4CTNA 1QIKA 4WMLA 4BZPA 2Z56A 3DZHA 1XLWA 4QPNA 1XMSA 2PBFA 3A0UA 3MTEA 5EI5A 2I03A 5ALIA 2Q5IA 5FKJA 3AFGA 4B47A 2XSZD 3C3PA 2BFCB 1MOZA 1IAVA 4A73A 1N8SA 1KFKB 1REQB 3B82A 1G8KA 5T4EA 5LQUA 4MJ3A 1SRQA 1WB5A 3I76A 4LC1A 1FDVA 4LK3A 4QXOA 4OHBA 5AM3A 4G5GA 2QK4A 2UZ1B 3RB8A 3WK7A 1EXVA 2CXXA 4B44A 3UEOA 4CLHA 5MHTA 1OFTA 5HIKA 3A11A 1SC4A 3KQYA 5ALTA 5G4LA 3STWA 5HWSA 4GLOA 4KGDA 2QTMA 5IULC 4PLPA 1PT8A 2M1XA 4LSGA 4EG7A 3NKLA 1Y5RA 2Q8NA 3UJ3X 3INNA 4M49A 1AB5A 1HQCA 2ADFA 2FSPA 2GEDA 3P0IA 4UREA 4EF4A 1FS6A 1JJFA 4MVJP 5ALLA 1SCKA 3UKDA 1SA0B 2LZ0A 3T3MB 5I4IA 4O25A 3UHPA 5K3AA 3C8DA 3DMGA 4AN4A 4D02A 1SVSA 4U9UA 2GPBA 3O2NA 3VZPA 2JAUA 4DIEA 3E03A 4DPLA 2ZTVA 2VNIA 4D9IA 1TQDA 3OTIA 2YWRA 4JCOA 1W25A 2D7CA 3BOSA 4KP7A 1KDTA 4IH9A 2PV0A 4F1JA 3PJGA 2QRMA 2C7QA 4I8XA 5KUTA 1E5VA 4LDAA 5EJ2A 2VJOA 4Y30A 1YTLA 3MRSA 2UVPA 3R0JA 3C8UA 1YIOA 3D7KA 4R6WA 4U1RA 2EU8A 3TOVA 3WFJA 5LN1A 2JCVA 3TJRA 3LIIA 2BGJA 2GLTA 2LCIA 2ZT6A 3K15A 4KXXA 4ZRMA 1VRWA 2ZJYA 2PNFA 2ZWMA 4HDNB 3K1YA 1IVNA 1E1RA 4MP6A 2ZJ8A 2JVIA 3RSHA 1Y1PA 3U31A 1VIDA 2GFQA 3SY8A 3MOSA 1BN7A 5DOVA 4HNHA 4PO1A 4DLRA 4E08A 2CNKA 4ZKDA 3MT0A 2VPXA 4RA9B 5FTNA 4WFJA 1V11B 1WETA 3WWOA 3HCCA 4WOCA 1XWWA 1E7WA 5JD6A 4RIEA 4E46A 2Z3ZA 2AN3A 2ODPA 1Y8QB 3CH6A 2IVZA 2PUHA 2W70A 4PGAA 1TTHA 4Z99A 1KZ1A 5F77A 4D3YA 2VDLB 4ITRC 4UULA 1Y3BE 4AC9A 1L4YA 2XKJE 4YMHA 2XB9A 1DT3A 5FPYA 1VRVA 3EW7A 2GHQA