3FMPB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
LVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
molecule keywords Nuclear pore complex protein Nup214
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmpB00
5F9HA 4ZI2A 4URYR 5EUMA 5KTYA 4OJQA 1KZGB 1T0HB 2ZRPA 4V0KA 2IXFA 4HDCA 2FSIA 2PZGA 2ZI4A 4NCKA 2ZRKA 4HUTA 5LDDC 1WCV1 2PT7A 3B8HA 4RFSA 3VR2A 5C46F 3NHBA 1HV8A 2FPMA 5G53C 4PXAA 4TMKA 1VTKA 3IEUA 3NEJA 4FINA 2DWQA 2FGKA 4NCJA 4XTCS 4ZV4A 2XX3A 3CZQA 4PAMA 2R65A 3I3SR 4DCNA 2FG5A 1NF3A 2F43A 4G5QA 1IN8A 4IFEA 5EP3A 4NP6A 2FWRA 1Z2CA 3NWJA 5FPHA 1HEIA 2NO0A 3R7WA 4PPQA 2QM8A 3C7KA 5KDDA 4EPWA 3MG9A 2IYXA 1FMLA 3BC1A 1U8AA 4PPGA 4U00A 4IVPA 4JSYA 4OQXA 4B43A 5JRJA 1W36D 5DN6A 4R98A 1XTIA 1E9DA 1VG1A 1XEFA 2GK6A 3X1XA 3GLIE 3PITA 3JVVA 2EVWX 3FMOB 3LDAA 1TQ4A 3BFXA 1EFRD 3B7GA 4GPTA 4NBSA 2JJ1D 1P62B 3GLHE 5DISB 4CDGA 1QG4A 2H17A 1KK0A 5LD2C 1O87A 3KJIA 4F38A 2EW1A 1SKQA 5A0FA 3A1VA 2JLVA 1JR3E 2LKCA 1ZU4A 1G7TA 1XCPA 3K70C 4XSHA 3RSLA 4FWTA 1WQ1R 2G0TA 2WWHA 5JEDA 2BMFA 1BMFD 1PLJA 1A4RA 1RJ9B 4N0DA 3EASA 3FVQA 4TQAA 3TSWA 4EPTA 3NC1C 3EWAA 1CBUA 4JLAA 1XTKA 4P3YA 2R62A 5JSZA 4KYUA 2Z4SA 4CIDA 5IT5A 2D3WA 1KI3A 2VRWA 1KIMA 2P5TB 2EYUA 4NYMQ 2A9KA 2QQEA 2V7QA 2XTNA 3IUYA 1E79D 3U60B 1L8QA 1G16A 2OV2A 2Q9CA 5KHOC 3PEWA 3Q7QA 1GUAA 5TV2A 2GJKA 1FNNA 1SVWA 3LBNA 1US8A 1JR3D 2ZYVX 1VMAA 3OE7A 4M8NE 1GWNA 2WPDD 3W3ZB 1OYYA 1RKBA 1E2EA 3Q8XB 4HAVA 4JL6A 4QHSA 3RVBA 3T5DA 1R0XA 4KBGA 4URWR 4MRNA 4HSEA 1CJUC 3BB3A 3LXRA 1IAQA 1QHHA 2AKYA 2GEDA 4JL8A 1DEKA 2LWIA 2VP0A 1TF2A 2AL7A 2G77B 2YINC 4WOPA 5EE0A 3TK1A 1KSJA 1D9ZA 1G6HA 1GITA 2WIAA 2B21A 2P65A 4OL0A 1ZNYA 2PBRA 4I1UA 1GOTA 1OF1A 1P6XA 1GRRA 2QTHA 2ZU0C 3DZDA 3LWNA 4D2IA 4JJZA 3UG6A 1JR3A 4A2PA 1IXSB 2IYYA 4IVQA 5CJ2A 2V9PA 2XTMA 4JLDA 5K8UA 4LYHA 3A6PC 2HCJB 3PXGA 2BIFA 4YXWD 3QF4B 2CE2X 4C7OA 4A36A 2F1IA 1G8GA 1N6NA 3HWSA 4PZZA 2CHQA 1H8EA 5H1YA 5JWOA 2NOAA 5EXSA 3F0TA 4G3XA 3FFBA 2HF9A 1N25A 4G01B 2D7DA 2IUTA 4RZ2A 1V43A 3THWB 3RS7A 1W1WA 1KGDA 3AP1A 5CYOA 2ZAMA 1PJRA 1R5NA 1UJ2A 2G0NA 3KTAB 4DJTA 1DAKA 2Q9AA 2JJ1A 3VR6A 4HAZA 1AQYA 4P4UA 2CE7A 3LO5A 4Q7MB 3K70B 1HQYE 4HDQB 4TZ6A 5F3WB 2EYQA 3MRSA 5AUPB 3CNLA 1FOEB 4IEIA 4DLRA 5KNBA 1BYUA 3GLGB 3CF2A 2XNDA 2IYSA 3TR0A 1EG7A 4JLNA 1S9HA 3T35A 3DM9B 1E3MA 2G1JA 3LH5A 4NU0A 3NC0C 1XXHE 2GCNA 4HYYA 3EG5A 4OHWA 2RHMA 2NPFA 1DAMA 1KDPA 1R7RA 4Q66C 1XFAA 3EPLA 3GLHB 1G18A 1G64A 1W47A 3OAAA 3WHKA 5HKKA 1G19A 1JEDA 4V0OA 1E2IA 1CJTC 4W5JA 3UWOA 2V3CC 1BO6A 1JJ7A 2ATVA 3GFTA 1HT1E 1LNZA 2VF7A 5AJXA 4LGMA 4HB0A 2B8WA 1HY3A 4URUR 621PA 3GLGA 2OUKA 4FD2A 3TW4A 1M34E 2ZAOA 4NYIR 3TW8B 4A9AA 1ODFA 1G4UR 4A0RA 5BW8A 2RHDA 2H16A 2ZSAA 2F3TA 1UBEA 1FP7A 1N6OA 4RFSB 5TARA 3OHMA 2XOKD 2JJ2D 2V1XA 4LBWA 1R2QA 4PANA 4TL9A 1ZNXA 3GLFB 3I72A 2N46A 3NTUA 3RS2A 4BQSA 2BHRA 4BFWA 2ODWA 2WWWA 3FMPB 3QG5A 4HZUA 4KFTA 2ONJA 1OIVA 1S4QA 4URZR 4LHVA 1OHHD 2PCJA 2WOJA 3L0SA 1U98A 3MD0A 3UWKA 1XTSA 3QXSA 1ZCAA 5KSYA 1YZUA 4M1OA 1F2TA 1N6RA 4WA7A 4DIEA 2ZSEA 2DFNA 4M4SA 5EQTA 3MUFA 1KMQA 4HB3A 2KBFA 5FR2A 3L8ZA 4C0KA 3WNDA 2P6RA 1YRAA 2R8RA 2GESA 4TLBA 3AEZA 2GNOA 3ZS8A 3B1WA 3QEJA 1Q1ZA 2GEVA 1I4DD 4QNMA 3QIAA 3BE4A 3AF0A 2WIBA 5CM9C 2H92A 1OHHA 1E2JA 1R5BA 2ZETA 4TTRA 1IJEA 1QHGA 4B33A 4KSBA 5FR1A 1RZ3A 4HLDA 5B64A 1M6NA 3GEHA 4PC7A 1ZC3A 3K9LA 3QKSA 2IX3A 1W7AA 1E32A 3QOFA 1Q1EA 4O25A 1GAJA 3MWLA 1LFDB 3LX8A 3QUSA 4BLTA 4AKIA 1S9DA 2QT1A 4A15A 5P21A 1XNJA 4B47A 3R9IA 4JYCA 3L2OB 1N6KA 1TADA 1D6JA 4V03A 4F4IA 6Q21A 3K0CC 3EWSA 2NO9A 1KDOA 3B9PA 3WRYC 4OKSA 1YKSA 4QGGA 2ZI6A 3RABA 3ZVLA 1S1MA 4C4PA 2ZRCA 4DCSA 3HYRA 1R8QA 5CIQA 1EK0A 2ZRHA 3C8UA 4HAXA 4NL4H 3H1TA 4PHTA 3OEED 3W6NA 5JECA 1F60A 1IOZA 2DFLA 3FMFA 1SKYB 3VR1A 4IEEA 4QHTA 2J46A 3DHWC 4D4KA 4BWYA 2O0JA 2F3RA 2JDID 1WB9A 2CNWD 4DT1B 2ASEA 4WXRA 4FIDA 2GJAA 2DPXA 2OBNA 2A5YB 3ICQB 4GNKA 2IYVA 2RGCA 1FQKA 4EFMA 1EWQA 2C77A 1E9SA 4C0AC 3QJYA 2GILA 1G291 2CVHA 4Q18A 3RS5A 2V55B 4KITB 1KJZA 5AJZA 4UNPA 1GZSA 1KY3A 3W3AA 3U3MA 1GL9B 2QRZA 1KO5A 1HH4A 3LLMA 1RE0A 2OCPA 4PHGA 4M9QA 2WPDA 5H68A 4KU4A 3TH5A 1Q22A 2JLZA 1IBRA 4KAXA 1B0UA 2P6NA 3CX8A 4P31A 3REGA 4YMTA 4F93B 2GXAA 3AVUA 3QKTA 2ZRGA 5GJBA 2IYUA 3LQQA 1H8HA 1JB1A 2CCKA 3SQXA 1MABB 1E4VA 5DE3A 1JBKA 4NCHA 3AH8A 1UPTA 2OCAA 3FPAA 4QJ3A 2PX3A 1E1RD 4D4MA 3THOA 1XPUA 4PO8A 3QNUA 4B48A 2QMOA 4QFMA 5BYKA 3AVXA 1EFTA 2CLDX 3MGCA 1U0LA 1Q1QA 5JJIA 3QXHA 3W9YA 5KU1A 3IO3A 4QL3A 4KXFB 1SVKA 4UNRA 4CT4B 2X2EA 1CS4C 3ADBA 2AHOA 4GZLA 2ZJ8A 3HPRA 3L0PA 1OIXA 2JAQA 2BWJA 3PENA 3EIEA 2GBLC 3PUZA 2CNWA 1N6LA 4LBYA 4RZ3A 3G82C 2O5VA 1KAGA 3BS4A 4HATA 1UBCA 2GEUA 4RY2A 2RCNA 1TUIA 5J4VA 2VHJA 2UVQA 2GXUA 1GSIA 2YC4C 1F2TB 1G4AE 3EA5A 5GJCA 1NVXQ 4DEXA 3MJRA 3LBHA 2JIZD 1TNDA 1VCOA 3U6BA 3DPUA 2QROA 4LBVA 4Q1FA 2GCOA 1I2DA 4DLYA 3CPJB 4GMDA 5JBQA 4XD7A 1L4YA 3KFVA 4JS0A 1J99A 1CR2A 4R2IA 1J8MF 1SXJC 1CIPA 1NKSA 1YZKA 5FBWB 1NLFA 1L2TA 2C5LA 2ZI5A 4JVNA 2WSMA 3T1VA 4LJ9A 2O8EA 3IBGA 1E2PA 5GJWC 2ZUCA 2JLWA 2EWWA 2BBTA 3T5GA 2AXPA 1GDDA 2ONKA 2NTYC 2V4ZA 5K8TA 4LC1A 3ZQJA 1AGRA 4JLKA 4BLRA 3S1AB 2ZJYA 1RYHA 2ZJAA 2OM2A 3LW8A 1DE0A 2GF9A 2XB4A 4Q9IA 2O8FB 3NH9A 5EP4A 4Q4JB 4LDJA 4OHZA 3CLVA 2JLQA 2AK2A 5TDHA 2NZ8A 2A2ZA 2F1RA 4DDTA 5L3QB 4OI0A 3B60A 3KKOA 3RS3A 3SBEA 1X86B 1KO8A 2OLJA 2W0MA 4BECA 2OE2A 2ZVQX 1E99A 4XH9B 1NSFA 1LVGA 1TQ6A 4H9GA 2IF2A 2J9RA 1JPNA 3EZFA 3A36A 1NIJA 1YU9A 2BDTA 2KSQA 3FHCB 4YMWA 5DIFA 4C0LA 1DG1G 4BFUA 1P9RA 4DCUA 1LTQA 4Q9HA 1EFHA 2QMHA 5HTKA 4IOLA 3RC3A 3FKSD 2DWPA 4US2R 4BZPA 1YZQA 4NDZA 3TRFA 4YONB 2W58A 3D7MA 1UKYA 2OAQ1 1BKDR 3SJZA 3T61A 3VNUA 3CNOA 4HLUA 1E0SA 1D8TA 2ZR0A 3K09A 3B2EA 4JKIA 5EE9A 5HZHA 2REBA 3ZVMA 4A4DA 2G88A 2EFDB 1KKMA 2WJHA 3CZPA 3V00A 4AD8A 3C4JA 1P72A 1CLUA 2IS2A 1NVVR 3MCAA 2JEOA 3VKGA 3Q3JB 1S1CA 2CL6X 3THWA 4OK5A 5G40A 2C78A 3PEVA 1UAAA 3WNBA 1MRNA 1ZU5A 5FPSA 4PQFA 2D7CA 1EGAA 1CRPA 2BMEA 2NG1A 3F8TA 4JMPA 1AA9A 3U7EB 1RRPA 2MMGA 4NMMA 2FSFA 1R4AA 4EUNA 3P26A 5C2JB 2AWOA 2KWIA 3T12A 2DCUA 3AF1A 1YR7A 4LWZA 4DWJA 5L3QA 3EW9A 4O0MA 3ZLJA 1J8YF 2ZR9A 2J0SA 2K5UA 1JECA 2HF8A 3Q7PA 2OHFA 3RANA 1F2UB 1UKEA 2W0SA 1EFUA 1N0WA 2N1BA 4DLVA 4RD4A 4AKGA 1YZTA 4EDHA 2ZJBA 1LF0A 2GVZC 2FA9A 4BLSA 1S0UA 2ZJ2A 3H2YA 4CT5A 4L16A 3FOZA 2CL0X 4R2HA 3P20A 4PSKA 3RSOA 4D81A 1IQPA 3B1YA 4CRWB 2OFXA 3FYHA 1YZGA 4UXIA 1D9XA 3ZZ0A 1A1VA 4G1UC 2OXCA 1G8YA 2R9VA 4ZO4A 3UMSA 5JI3E 1SVOA 3WRXC 4DDUA 1XPRA 2J0UB 2P67A 2NQ2C 3WY9A 3K0AB 1E98A 1Y3AA 1Q3TA 3NH6A 3DZ8A 4DLUA 4MKFA 1QG2A 1E2FA 4MDFA 3O47A 4E09A 3ASYA 4RCYA 1XZPA 5JI2E 2H1LA 4H1UA 4JZKA 2HT1A 5ELXA 3GMTA 4LPKA 2CXXA 3DMNA 4JBYA 3SYNA 5AR1A 5JZVA 3CO5A 4RFVA 5G41A 5F98A 2KBEA 4MA4A 3U7HB 4U5XA 1G20E 4GMXA 4NCNA 2GZDA 2GHIA 3PUYA 2W2XA 1E9EA 3NDBB 4ARZB 2VYFA 1U0JA 3EZ6A 5E3HA 1P9WA 1N6IA 2Z4RA 4JLJA 4OI1A 1CRQA 5F9FA 4DLZA 1JNYA 1YZNA 4QKQA 3PUVA 2ODNA 2W83A 1P2TA 2A30A 3VQTA 1G9XA 2UZ3A 1P61B 1RIFA 2VLIA 3QQ5A 4UXHA 4NYJR 3SYKA 5C4GB 1A82A 3RNLA 2QY9A 4TWZA 1Z0KA 3HR8A 3HPQA 3TBKA 5IF9A 1KNXA 4TT3D 4QC2A 3GLFA 2H5EA 2FX3A 1CXZA 3R8FA 2ZRDA 3LVRE 3BJIC 1VIAA 1LF5A 1SXJA 2G9NA 3OIWA 2FF7A 1W5TA 3VNVA 2QI9C 5AUQA 5HE9A 2JDIA 5DSZA 4B71A 4V0NA 1GRQA 3U44A 4ZDWA 2GJ8A 3QBVA 4FMCB 1RC8A 3NDPA 1U9IA 2WHXA 3NHAA 4LOAA 3TSZA 3TQCA 4Q4AA 2QAGA 5JWRA 5HPYB 4A82A 4DXAA 2GRJA 2XZPA 1A7JA 2BM1A 3LFUA 1TQDA 4D80A 2QGNA 1VECA 3VAAA 2ZR7A 4TZ0A 3N2IA 1Z0IA 4LHXA 1SVIA 2BCJQ 4FMCF 5L3RA 3X2SA 4US0R 2J7PD 2IYRA 1EX7A 2YWHA 2FEOA 3T34A 1GL6A 3BFKA 3WYAA 5J4HA 1JALA 1ZIPA 3OEHD 3CH5A 3RYTC 4M1WA 5JS7A 1Z22A 1II9A 2GBLA 5FTLA 3U7GA 3U7FB 1DADA 4OK3A 1XTQA 3GJ4A 2XZOA 1LS6A 5FOUA 3EZ9A 4B75A 1Z47A 2O8BB 2QM7A 3J81k 2ZUBA 3GJ3A 5DYGA 4M1SA 2WBLC 2JLXA 1PLKA 2CHGA 4AG6A 5DI9A 1SULA 3Q5EA 2L0XA 4PPFA 5G3ZA 3ZIAA 4DCTA 3KJGA 5TVKA 5FFMA 1XJCA 1P60A 1KNQA 4MDEA 2IBMA 4P0TA 4OK6A 4MKGA 2PLFA 5KDLA 3LRPA 4E5UA 3KXIA 2VH5R 4ACBA 2WKQA 3CB4A 5CLLA 3CIOA 1NLZA 3PUXA 4TL8A 3TVTA 2E1RA 1FUKA 4ZIRA 4HUQA 3I4LA 2VQSA 4D0LB 1NIPA 4GZMA 4RZUA 4B32A 1Z0FA 4B3BA 4Q7KA 1V5WA 3U4QB 3CPEA 3N5CA 5KYKA 2VPPA 1PZNA 4A0FA 2WTUA 2D2EA 5BWMA 1G6OA 5CB8A 5KOYA 1E1QD 4G5GA 3SYLA 1Q3HA 2HCBA 2BEJA 3HDTA 2XOKA 3MFYA 5FOTA 1E69A 1KI8A 1ESNA 4JJKA 4KYIB 4Q9KA 3IIKA 4HAUA 1P4SA 4JLOA 1Z6AA 2ORIA 3UXMA 3I62A 2QSYA 3M0EA 1JXMA 4IDNA 1ZD9A 3AUXA 1PV4A 2IW3A 3MWYW 4B34A 4A92A 4HUQB 2QA5A 1G3RA 1GILA 2XNSA 2IXGA 4TLDA 4MYTA 1JXOA 4D0GA 1XRJA 2R6AA 1W2HA 2WM9B 3KJHA 3NXSA 4JSTA 2RAPA 1OFUX 4LZZA 2IUUA 3KXLA 3UANA 1J2JA 1ZM4A 4RD1A 4K8OA 4Y0VA 3W8NA 2DFKB 3CX7A 4LYAA 2VF8A 2G6BA 3TJZA 2X1VA 1R8SA 4BGDA 4J0QA 2W00A 3BWDD 3L43A 3ZVRA 2B7CA 2ZXUA 2OEPA 3E1SA 2WSSA 4EKDA 3BXZA 4Q1EA 2QL6A 2PZFA 1G5PA 3SI7A 3R20A 2RH5A 4JBWA 3LNCA 1IHUA 1MRSA 2ZVPX 5FPKA 1FX0B 3IIMA 3ZIAD 2ZE6A 1D2EA 1ZUIA 1OLOA 2PCLA 3CONA 4HB2A 4N1AA 1X8LA 5H8WA 1O3YA 2F55A 2Q0HA 1ZM9A 4E03A 1RRCA 3P1JA 4GBMA 4DKXA 5AWFC 1TAGA 2CBZA 2J41A 3DM5A 4PX9A 3MWKA 4GOJA 3W34A 2LKDA 2QAGC 4LPSA 1E2GA 3K0EA 2HLDA 2WKPA 3O8CA 4B3FX 5C4MA 3GJ5A 3DEFA 2XAUA 1N5JA 2A5GA 3MLEA 3UG7A 4IDQA 3B78A 3ZGXA 1KDRA 4P4TA 3GLIB 2FZ4A 1DAHA 1JI0A 3NBYC 5CYPA 3OIYA 2ZE5A 1JAHA 4JVMA 2XXAB 2YZ2A 4FW9A 5KNDA 3H4MA 4PO9A 1H8ED 2W2VA 1UDXA 4KVGA 4ZI3A 1XP8A 1P5ZB 4Q1AA 5EE1A 1NBMD 1VKJA 4TLEA 3B5JA 2NIPA 5EXXA 4FXPA 4Q03A 2OLKA 4YXWA 2ZRMA 2G83A 1C4OA 2FFQA 1Z63A 4ZDJA 3Q5DA 3IILA 5E7IA 5J5CA 4NH0A 4B35A 4L9WA 1J90A 2QT0A 4LSGA 4Q4JA 2VP9A 4HDOB 1PVOA 4EAQA 5J4KA 1RRGA 3THXA 4A2WA 2XXAA 5JJLA 2C95A 2XSZA 3THXB 4AG5A 3IPXA 3V4RA 3KKPA 2X8AA 2WWXA 3VTKA 4Z51A 3IHWA 4KVAA 4ACAA 2WOOA 2Z43A 3QXJA 2PLRA 4QGAA 4DSNA 4E07A 1WDTA 2KI5A 5J40A 4UKDA 1U81A 3H86A 4KI0A 5KNCA 4LJ6A 4ABYA 3GD7A 4X8LA 1ZD1A 4WW0A 4ZDKA 1OFHA 1KMHA 1E9BA 1Z06A 1AIPA 4BFZA 3GLGE 3NVAA 4DSOA 3OF5A 3HU2A 2C9YA 2O8CB 3A4NA 4F92B 1QHHB 1E2MA 5EE3A 5FUYA 1Z83A 4I4LA 4NYIQ 1IONA 1KJYA 5B58C 4Q9JA 1G7CA 4EFLA 2PEYA 3OIUA 2IYTA 3A1UA 3RWOA 4RD0A 4C0SA 4DLWA 3ZJYA 4DVGA 3CRW1 3MAAC 4Z8YA 3DOFA 4G0NA 3NG1A 4M1YA 4KO8A 4Q7JB 4YMVA 4DB4A 3OZXA 4LY6A 1FFHA 4C9BA 4DIDA 1N3BA 4WZBE 1GNQA 2IT1A 5BYJA 4AKHA 4IVRA 1N5LA 1ANKA 2XSZD 3N2EA 1FTSA 4LYJA 4UJ5A 3U61B 4AY2A 2J0VA 3QEOA 2ZRLA 3K8YA 3FWYA 4QG7A 1UKVY 2OFOA 4MQBA 2J87A 2WJIA 4TQUS 4XOIA 4XJXA 2QNRA 3F3YA 4FMDF 4YDHB 1OB5A 3IEVA 2NMVA 2YWFA 1W46A 3MWJA 5A4JA 4QM7A 1FTNA 1FMJA 1K5DA 1SZPA 2ZUDA 1SXJD 1N6PA 1VYUA 3QKRA 421PA 1MKYA 4MRSA 1ZNWA 4LX0A 2Q21A 3R9XA 2HT6A 2BCGY 1G1MA 3TMKA 5FPYA 4Q5IA 1R0YA 1D2NA 4U7DA 2YHSA 4CZ2A 2I1VB 1BOFA 2PEZA 4DUGD 2GF0A 2OT3B 2BC9A 2IXEA 4I99A 1XWIA 4QJ5A 5EZ6B 2QPAA 4TSFA 3UIEA 2JLUA 3HP1A 3EIHA 1OKKA 1QHSA 2ZE7A 3L0IB 5FH9A 1GKIA 1XMIA 2IHBA 2VP2A 1U99A 3E5HA 1XD2A 2R6FA 3LAWA 4AKEA 1CR1A 1XBTA 4POAA 1QHXA 4GP7A 4P32A 1M2OB 1Q0UA 3BK7A 1L4UA 2XEXA 1ETUA 4B6EA 1UEJA 3LD9A 5EE5B 2FE4A 2QE7A 2QAJA 3DO6A 3FHOA 1YJ5A 1TQ2A 1ZYUA 2CCGA 1Z0JA 2ZRJA 4L8GA 4ZKEA 1Z28A 5JCZA 1U8ZA 2P3SA 5L8VA 3AKDA 1NMYA 3A1WA 5AJVB 5SZJA 3UMRA 4BLPA 3U44B 4V02A 3R9WA 2HV8A 5HCIA 2CJWB 3VR3A 3K9NA 3GEIA 4NONA 3IIJA 1R0WA 3DDCA 4I1OA 2HDNB 8OHMA 2IL1A 3QI2A 4D4JA 1JJVA 2NPIA 2UKDA 1ELOA 5HZKA 4GDFA 4Z1MA 5KPDA 1LB1B 3KZ1E 1QHNA 2Z0MA 3QVVA 1UEIA 1COWD 4EFNA 5DN6D 2YV5A 2MSCB 3KL4A 1ZM7A 3BH7A 3BRWD 3PFIA 3QPVA 2RMKA 3W5IA 3CWQA 4F4JA 2GTPA 4U02A 1ZAKA 4Y0AA 3EAQA 4OHVA 4I1SA 2RGEA 3VFDA 3FE2A 1XMSA 1VCNA 4IDHA 4ASUA 4Q1BA 2OILA 4YMUA 1TU4A 4LJ4A 5CITA 3T1QA 3ECCA 1G21E 3REFA 2RGNC 3IKJA 2A5DA 3MMPA 4HI0E 3QXXA 3CUEF 4WZAE 3P32A 4JLBA 3AUYA 1XZQA 3JZAA 1QBKC 3W6OA 2GJ9A 1IN7A 2WWIA 2YKGA 2ERXA 3SFZA 2JLRA 4W7SA 5IK2A 5KSPA 1GKUB 1DAFA 4V0LA 5DLQC 5FBLB 2XJ9A 1JPJA 3VKWA 2JLSA 1JQLB 1K6MA 4HZUB 2CDNA 4MUAA 4EQ6A 4XWAA 3PVSA 3WP0A 3KB2A 2KJQA 2WKRA 1WXQA 4MGKR 5JEEA 1TX4B 3ZZTA 4K46A 4D0NA 4R71A 1VPLA 3KTAA 4P4SA 221PA 3KX2A 2XZLA 2Q9BA 2X19A 2V1UA 2ZYWX 3U3JA 1G5RA 2W6ID 2A7QA 1U90A 1ZCBA 5JHHB 4B2IA 1P3JA 1TMKA 1TPZA 1Q1BA 1ZMXA 3SEAA 2QEQA 2Y8EA 4UNQA 3EIQA 2VHCA 2VL7A 2A78A 4LV8B 5LB4A 4BLOA 1XEXA 2IHYA 4C3ZA 1WF3A 1E2QA 2YWEA 3CM0A 3I92A 5EP2A 3FTQA 3W5JA 3WBKA 1NJFA 4TMVA 4IDOA 3UMFA 3FKQA 3RS4A 4DT1A 4N3NA 3IHLA 3EXAA 2H18A 4FI3C 5CB6A 5CDFA 1D5CA 3ONWA 2F1HA 3ZYCA 2KE5A 4YQFA 2MSDB 1T4GA 4XVQA 1NVUQ 2J59A 2JLYA 2FFAA 5FI1B 821PA 5FI0B 3ND8A 4ESVA 5LD2B 3RHFA 4XWKA 4TYNA 4OI2A 2V6IA 4PAQA 1ZW6A 4LJ5A 1VIYA 2CMKA 1NL3A 2F9LA 1G3MA 1Q12A 1KYIA 1K8RA 4DSTA 4TLCA 3DKPA 4PZLA 1OKKD 2Z6VA 2QP4A 2PMDA 4A6XA 4IW3B 2QMUA 1E0AA 1F6BA 3BAFA 2PJRA 5JFGA 4DLSA 4ITRC 3QPUA 1W0JA 1KI7A 3KKMA 4RD6A 3U3OA 1CJVC 5TY0A 3SQWA 1TTTA 5TB5A 1OFIA 3UATA 3EPHA 4JVSB 2V8OA 2YOHA 1I2MA 4MKHA 4QNRA 1AQUA 3AKCA 2GZAA 1M74A 2BOVA 3KDSE 3FHTA 3FB4A 1NN1A 2NO6A 4RCZA 3ZH9B 1XJ0A 1YR6A 4LI0A 5CM8B 3W90A 2FPKA 2PJZA 1TF7A 1LS1A 1VG9B 2OAP1 2IEYA 5D3QA 2B7BA 4RKFA 1W36C 4A2QA 2IUSA 5BXQC 2J0UA 1GVNB 1W49A 1NJGA 2O8DB 4FCVA 4GP6A 4KFUA 4PSAA 4BLQA 2F9MA 4BFYA 3VHLB 1W2GA 1X1SA 3WP1B 4B44A 5E7MA 4N0EA 4EPXA 2A3RA 3AF2A 3NEYA 4AIIA 3ADKA 5KPJA 3ND9A 1IN5A 3I61A 2YOGA 1WRBA 2GA8A 2O8EB 4EJSC 2VSXA 4PSVA 5KUTA 1YQTA 4Q4HB 4BRUA 1SVLA 4IFBA 3PV0A 3AVVA 2VP4A 3KQUA 4QM6A 2VSFA 5DI3B 4KHZA 1P2SA 1CP2A 2RGAA 1VYVA 2B6HA 3KB1A 3TIFA 3V9PA 1Z07A 3QG1A 3ASZA 3CNNA 4KBFA 1W4CA 1M1YE 1P75A 1E2KA 5HE8A 3BIFA 2GK7A 2BMDA 2DYKA 5FUWA 4DRZA 3CF6R 2HYDA 3K0FB 4F91B 3WYFA 1N6HA 1UBGA 3PR1A 2FN4A 4GFDA 2HEIA 1PUJA 4UQOA 4HAWA 1Z08A 5FOSA 5DHAA 4AWXA 4BUJA 3AKEA 4JT4A 3THYB 1UBFA 2REXB 3LQRA 1QHIA 4P4SB 2XB2A 1OIWA 4NKRA 1DVRA 1DTSA 1SXJE 3QSYA 1FX0A 1CULC 4V0ME 4B2PA 4LK2A 2C98A 3AVQA 1WP9A 4MGZR 2OXRA 3AP3A 2ZIAA 3M4YA 4A0HA 4A1FA 4LHWA 2IYQA 3I1FA 2WJYA 3CRVA 3U3KA 4Q21A 5AUNB 3PUWA 2V54A 4C0HA 4ASUD 2H7VA 3JVUA 3U6KA 1QRAA 3C41J 4TL6A 5FTJA 2GETA 4CW7A 4LHZA 2XITA 1XD9A 4IJMA 4RD3A 2ATXA 1T91A 2PZEA 3ETLA 1P2UA 3R8CA 4D6PA 2ZS8A 5M04A 4L15A 3I73A 4Z1MD 1T8UA 4B76A 4YMSA 4EQ6B 2FOLA 1BYIA 2X2FA 1UKZA 3OFND 1OXXK 3CW2A 2IWHA 4F7WA 3SDZA 4B73A 2AWNA 1YRBA 3KUCA 4CGZA 5L3SA 1UDWA 2J7KA 2FNAA 4Q4LA 4ZPXA 4M1MA 3MJHA 1GG2A 4HZIA 2ZM5A 4JLMA 1HTWA 5G3YA 5SZHB 4DBLC 4CEJA 4PQRA 3NBXX 3L0OA 2CCJA 5BN3A 3ZD6A 2GXQA 4H1VA 5DI3A 3SFVA 3TR5A 2CLSA 2EQBA 1EESA 4RVCA 2YYZA 1KO4A 1OT3A 5FPTA 5D3MB 1XXHB 2DFTA 2ZS9A 3TKLA 4PHHA 1NKTA 2CEAA 2H8KA 4DSUA 5CK4A 2R6CA 4JT2A 1VG8A 2N42A 2I3BA 3WMGA 1OJLA 2MMCA 1W4RA 4D82A 1HE8B 1GRNA 3WMFA 3BBPA 1W36B 2I4IA 4URXR 3ADCA 2PT5A 2D2FA 1XTRA 2CK3A 1FZQA 4FCWA 1TEVA 2ZYUX 3B85A 4MRVA 4BEBA 1T6NA 1KK1A 3QBTA 3QENA 4M1TA 4TQ9A 3SJBA 1G7RA 1L7VC 3RS0A 1UM8A 3VX4A 2XGJA 3GJ8A 2RKOA 3DKVA 1EX6A 4OHXA 1ZUHA 1VHTA 2ZEJA 1W4BA 1N2CE 1ZIOA 2WAXA 4Q48A 1CKEA 3O8RA 1P7CA 4D4LA 3AM1A 1NSTA 2P0EA 1VYTA 2BBOA 1WA5A 3GFOA 4AI6A 1R5OA 1X8KA 3BERA 4NHOA 3SBDA 2VP5A 1F5NA 4KCGA 1F48A 2FZLA 2EWVA 2QN6A 3VMFA 2WAYA 2DB3A 2GVDC 3H0KA 4PPNA 1OSNA 1II0A 3BOSA 1E0JA 2QU8A 3LV8A 3IQXA 5C18A 4DDVA 3KQKA 3NBZC 1W48A 1IJFA 2GDJA 3T1TA 1E9CA 1NBMA 2BEKA 3QY0A 2FGJA 3M6AA 1KDTA 4TMXA 4L9SA 2AD5A 2BBSA 3RAPR 2LCFA 3D6TB 2FMXA 1NN5A 4PHFA 1Z29A 2XNDD 4GRAA 1E96A 1QDEA 1MH1A 2GKSA 2PMKA 3SJCA 5BN5A 4DB2A 1DARA 3GFPA 2GAAA 5JS8A 5IRCD 3I5XA 3SHWA 4QGFA 3AB3A 4W5HA 2IS4A 2F1JA 1KKLA 4QOSA 5KO2A 3AGPA 2RGDA 121PA 1VG0B 4XVUA 1FW6A 1M7BA 3SE0A 1OXVA 2VEDA 1KO7A 3CRQA 2DHRA 3AVWA 2JATA 1U94A 2FPLA 4CYMA 1NI3A 4ESHA 2F43B 4ILEA 1SVSA 4TMTA 2E87A 2VSOA 1F3OA 1US8B 3BORA 2ORWA 3RWMB 1SHKA 2O8BA 1G8HA 1N5KA 2VHTA 4EJSB 3K53A 3SR0A 5E95A 1Z3IX 3X1ZA 2BMJA 2RGXA 3GLHA 4QHYA 2W6JD 5SZKB 3UKDA 1Z6XA 4AK9A 2QENA 3GJ6A 3THYA 3VU9A 1XU4A 2IWRA 3EARA 3P4XA 1KSHA 2J0QA 1DELA 1UF9A 2EU8A 3LVQE 4OQNA 3OFNA 2QRNA 5GJVC 4EPYA 5JCPA 2AXNA 1AN0A 1R0ZA 4IXNA 2FDCA 2IEZA 2D06A 3T06B 3DMDA 1NY6A 3E2IA 4IOMA 5J4YA 4Q00A 3K0FA 4QBIA 2EFEB 2O0KA 3WMEA 3DL0A 3W6PA 2WMOB 3CH4B 1X6VA 2BJWA 4FCTA 3B1ZA 4AURA 4RZXA 2W2TA 5EXPA 1S3GA 4IHQA 5AJWA 5K8IA 3PG5A 2EFGA 2DBYA 721PA 1NRJB 5JJKA 3BB4A 2R6DA 1RVDA 3VU9B 2ZRIA 5GADl 1RYFA 2YOFA 2A5JA 4UJ3A 4US1R 1ZNZA 3A58B 3IBYA 1E94E 4WAUA 2VHQA 2F6RA 3SC3A 4UNNA 4ZDIA 3RC8A 3PIRA 2AFHE 2R2AA 4IOKA 4BEJA 1ZBDA 3AVYA 2QUZA 1OYWA 4A6PA 5L3SB 3DOEA 4DC9A 4D26A 3LY5A 5JMTA 3K0CA 2NO7A 3CKLA 2JJ8A 5UKDA 3HJNA 5CLQA 1IY1A 4JLVA 2C03A 3ZD7A 2GZHA 1KI2A 4A8JC 4MYHA 1JAIA 3W8RA 1SQ5A 3FDIA 3AQ4A 1DAIA 1FQJA 4O2RA 3RRMA 2QZ4A 4KJZA 3RRNA 3O8BA 4TTPA 4OQMA 3C14C 4ERNA 1II8B 1Q57A 1E9FA 3TUZC 4Q1CA 1DPFA 3RLFA 5KSOA 4TYWA 1TEXA 2UZIR 4BZXA 4TYPA 2JA1A 3I32A 3EA0A 1AGPA 2OG2A 4Z8XA 4AYWA 2E9SA 1EFRA 2HXSA 1OB2A 1NVWQ 1W4AA 1XEWX 3TAHA 3KJEA 2W6IA 3A37A 2FFHA 1IM2A 3A1TA 3NKVA 3T15A 4M9SA 4BPBA 4C7OB 5JWHA 1ZM2A 3FGNA 4DDWA 3OESA 3FFAA 4DHEA 1BS1A 4Q1DA 1HYQA 1AZSC 1OE0A 2B92A 1VHLA 1AZTA 2H57A 3IPYA 2DY1A 1XPOA 2QE7D 4ZCMA 1HURA 2CJWA 1OFTA 4TYYA 4W5WA 3WHLA 3C5CA 2AK3A 4MGYR 1DOAA 1T5LA 1R6BX 4G5RA 3KFXA 4CEIA 1E2HA 4ZIRB 5IK2D 3B9QA 4CEIB 1KI6B 4IOJA 2GCPA 4PO1A 3VKHA 2IF0A 3A4LA 4L5BA 1KAOA 1W5SA 4M1KA 2WJGA 1NG9A 5CJPA 5DHFA 5L3VA 5JSZB 3QF4A 3TGPA 4TTQA 4UNSA 2YC2C 1G41A 3B1VA 3BGWA 4I1VA 2REOA 1FPMA 2Q6TA 4QBFA 4HEJA 3JZMA 4TSFD 5EP1A 1TUEA 2QBYB 3CF0A 2ZI3A 4TT3A 3E70C 1EXMA 2OCYC 1NLYA 2OCBA 1R10A 1DS6A 3HYTA 3K0SA 3BB1A 4JYBA 1NN0A 3ZDQA 2HJGA 4Q9LA 3SZRA 3TE6A 2IA5A 1OXUA 4OQLA 2OFWA 2WICA 5FL7D 3UK6A 1XDBA 4XTRA 4FMBB 4DLTA 5ANRB 1WBBA 3KQNA 4JLPA 4XVRA 1GIAA 3K70D 4OQFA 4K81B 4QXAA 2ZU6A 4NTZA 1GFIA 1Q21A 2FU5C 1E2DA 5A5GA 1UADA 4EIWA 1XCGB 2SHKA 4XIGS 4B3XA 1KTVA 1Z6GA 2J5XA 5KSZA 3QPWA 3B82A 1AKEA 1XB2A 2X77A 4MITA 4X8MA 1ZVQA 1E79A 2IS1A 5B57C 4TLAA 2P6UA 3QE0A 3QKSB 4E22A 5DNYB 2C9OA 2QPOA 1ZJ6A 3AVPA 2ZROA 3SU8A 1D2MA 1U9IC 4ZCIA 3P4YA 2J45A 4YC7A 3S1AA 2NZJA 3IQWA 2QG6A 1P73A 2ORVA 2RGNA 3LA6A 3V4FA 2VTKA 1J70A 3PEUA 5FOWA 1TU3A 3CRRA 1LW7A 1YHNA 2QQ0A 3TUIC 1CF4A 3TLXA 2WWGA 1CR0A 2ZE8A 2QGZA 2QSZA 4S35A 2IK8A 2CL7X 3K09C 2MSEB 5BQ5A 3VHXA 3B13B 3EPJA 3QVUA 1DO0A 4A8JA 2BM0A 4CEHB 2TMKA 1Z5ZA 4BFXA 1KI1A 2ANCA 2FFBA 4LYFA 1XMVA 4JIMA 1M7HA 1N0VC 3AVTA 3LW7A 5LB2A 1LY1A 5DO9A 3L8YA 4GT1A 4L4UA 1FUUA 4URVR 2BKEA 1T9HA 5FL7A 4DUGA 1MOZA 1HQCA 3Q72A 4HLQB 4HLCA 1W0JD 3TQFA 1KMHB 2QMEA 4WVFA 5FOXA 4NYJQ 1MABA 1G17A 4MRRA 3SNHA 1T8TA 3QXCA 3SJAA 4ARZA 1DO2A 1IY2A 3KUDA 2NGRA 4KLNA 1GL7A 4D25A 2HXYA 3H84A 1Q44A 1MO4A 2EFHB 3OE7D 1UFQA 3VR5A 4KLZA 3LLUA 1N5IA 1S2MA 4WXPA 3TUJC 2ZJZA 3HR7A 1XEXB 2C96A 2A5FA 3C16C 2ZRAA 5HR5A 3AGQA 3MSXA 1E2NA 4Q4AB 1KHTA 3OEEA 1MO3A 1E9RA 2HUPA 3BH0A 2WJJA 3LXXA 3TAUA 4IRUB 2W6JA 3U2QA 4DCVA 2V7QD 4TMZA 4BASA 2FV8A 3CRMA 2Z5FA 5IDVA 5DGXA 1MT0A 1XJQA 1I4LD 1E2LA 2EFCB 4B2LA 3K0AA 2DWOA 4LBZA 1P9NA 3SHFA 4YLGA 3D31A 1AS0A 1BMFA 1PLLA 1JEEA 2WWFA 1GTVA 4ON9A 3KXKA 2JASA 3C15C 3HU1A 2R44A 4X8OA 3ZS9A 1H8HD 2YVUA 1T3SA 1XEWY 5J47A 4NZYA 5EJEA 1OV4A 2RGGA 3SOPA 2VIIA 4M21A 3CPHA 1KSFX 2JCSA 3NIBA 4NPHA 4GSYA 1AKYA 2Q3FA 1DAEA 1SHZA 1HUQA 3CR8A 4I81A 4XSGA 2D62A 1TF5A 3KKNA 3RRZA 4MKIA 4OHYA 1M7GA 1RPZA 1Z0DA 4ZKDA 4IKEA 3KQLA 2IS6A 1HE1C 2GAOA 4PTLA 2FEMA 3X1YA 2AFIE 4LJ7A 3BFVA 4PC6A 1G3QA 2BKUA 5CIWA 3CX6A 3GQBA 2ZQ5A 1FP6A 2ZJ5A 4B3GA 1ZUNB 4PC1A 1XD2B 4C0JA 4Q4HA 2ZSDA 1W0KD 4JL5A 4RJLA 2WVJA 3I8SA 2OSBA 2Q3MA 1IN4A 1S96A 5EUQB 5HCNA 4M2LA 2BJVA 4G5SA 3Q9LA 1U8YA 3D8BA 2YNMA 2PH1A 3GJ0A 4KFRA 1OW3B 4LJYA 2QTVB 5EZ5A 2ERYA 2CLCX 4Z54A 5JRZA 3VR4A 3GLFE 4PFSA 4R7ZA 1OH7A 1S8FA 5FTMA 1AM4D 5JHGB 3AF3A 4QGHA 2JJ2A 2O0HA 2QTFA 4CF7A 3K1JA 1SKYE 2AN9A 1Q20A 1U0HC 1ZP6A 3HU3A 2G1KA 4CVNA 2IYLD 5FBQB 1SGWA 4B3DA 3G0HA 3UPUA 3KQHA 1VDZA 1WMSA 1GKYA 4KSCA 1KOFA 3LX5A 5FBVB 3K9GA 3DVLA 4II7A 5B30A 2CK3D 4B3CA 1COWA 1XF9A 2HLDD 4OJKA 4QRHA 4M53A 4JBXA 5D3MA 5TXGA 2B8TA 2BVNA 4WBSA 1SVMA 2QP3A 4YDSA 3FKSA 3NBFA 1M8PA 2AKAB 4O3MA 1AS3A 2WV9A 1ONBA 2ECKA 3A4MA 2ZANA 5C1BA 2PL3A 2O8FA 4R9UC 4M22A 2FJUA 4TL7A 4C30A 4LV5B 4OBEA 2CHVA 2HYIC 1KI6A 1KZ7B 4MRPA 4FMDB 2BV3A 1QZXA 4RSGA 1LV7A 1T0JB 3RDPA 3T1OA 2WSSD 1G3IA 4Q01A 1IY0A 4FWIB 3EPKA 3PJRA 1B23P 1E1RA 3CR7A 4V0MA 1A5TA 3GJXC 1QVRA 1NMZA 2ZRFA 4M9XA 3P27A 3D3QA 4W9MC 2RGBA 4OYHA 5GVRA 4NCIA 3BD9A 4PC2A 1JQJC 2ZI7A 4LV6A 3X1DA 4FN5A 1E6CA 4LJAA 1XMJA 3EC2A 3WBJA 2WWYA 1RJ9A 3QKRB 2O52A 4QJ4A 1Z0AA 1KI4A 2KB0A 2PX0A 4BFSA 1E9AA 5GVSA 3GJ7A 3AP2A 3AKYA 4WZ6A 4B74A 2QAGB 2ODEA 1DBSA 1KO1A 1T5IA 3TVDA 3OIVA 5SZIA 3GLIA 5B2ZA 4XD7D 4LC0A 4MYUA 3IDQA 4LJ8A 1WBDA 2P2LA 2DR3A 1A2KC 4MH0R 2J7PA 5JLJA 4A0GA 4BFTA 2IYZA 1A2BA 1MO5A 5FUXA 2ZI9A 1ZINA 2G3YA 3ZVNA 1SXJB 2VP6A 5AK0A 5F2EA 2JIZA 4KODA 2I1QA 2ZPTX 1E1QA 5E4FA 4Q19A 1OXSC 2OESA 2R6GA 4LRWA 1KI9A 3A1SA 4Q47A 5FBRB 4JKYA 1Z6YA 2IYWA 1GM5A 1I4TD 3OAAD 4G5OA 1DAGA 2FSGA 4M9ZA 5H70A 5HKKD 3WNCA 2GCOB 3B6EA 3PEYA 1NP6A 4F4CA 1EWRA 1MR3F 1Y63A 1KK2A 3QF7A 3WXMA 2O8DA 1CU1A 1Z6TA 4PC3A 1E0KA 2WZQA 1ESMA 4HB4A 3AF4A 4RD2A 3C5HA 2OZEA 1IXZA 2C04A 1K5GA 3LBIA 4PR0A 1VCMA 2F7SA 5J4LA 1G3UA 4LUCA 1HT2E 4EPRA 4S2EA 1CJKC 5TMPA 3ICEA 3G5UA 3RRYA 3PCRB 4IDPA 1ZD8A 1CEEA 4X8HA 2OO7A 2Q3HA 5DH9A 3M1IA 4Q02A 2FSHA 1CJMA 1CR4A 5FTNA 1DG3A 2C8VA 1HA3A 3GP8A 3FMIA 2OBLA 4AC9A 2AX4A 2QP9X 3OEHA 2QBYA 1IN6A 1T3HA 4A8JB 4CEHA 3U5ZB 1XTJA 3Q85A 2ZSFA 2CVFA 4PAOA 3X1WA 1G8FA 2ZITA 1U2RA 1NY5A 2VBCA 4PZYA 2JGNA 1JR6A 4MUBA 2BBWA 2ZRNA 5FTKA 5E7JA 2GJSA 4EJSA 4EPVA 1P2VA 4MGIR 2D74A 3I5YA 3AV0B 3CBQA 2WMNB 4MYCA 5DYIA 3BH6A 2ODBA 5LPNA 1ZC4A 4DLXA 4GI7A 4B6FA 1AK2A 521PA 2ZREA 3GCGA 2Z83A 1BH2A 1NBME 4UXJA 3SN6A 1XCMA 2GWHA 3AVOA 1NNEA 2IC5A 1QVAA 3QKUA 4QBHA 3VX3A 2XTZA 1XX6A 1F2UA 4BRWA 1G7SA 5CDFE 5FUVA 1Z2AA 4WIAA 3ZZUA 1AJEA 1ZRHA 1FNMA 3I8XA 2C2HA 4OI4A 2YWGA 2J3EA 5EXTA 1X3SA 2D4HA 3U3RA 1YR9A 5KDOA 1KJWA 4GL2A 2ZS7A 5LBIA 5AJYA 4Q7LA 4KV9A 4KFSA 2C99A 4C2UA 2C9CA 5CK5A 1AS2A 1C9KA 2VO1A 4P33A 1IXRC 1PUIA 3EC1A 3GPLA 4M0LA 1YE8A 4BE7B 1C1YA 3KKQA 4BFVA 1GNRA 1OH8A 1E4YA 1VCIA 2AR7A 4HAYA 3ZQ6A 1CTQA 2YJTD 4NYMR 3IO5A 1YR8A 4LCBA 4AYTA 3A8TA 1MO6A 1H65A 4C0BA 3F5FA 3EZ2A 3R7WB 2ZJOA 1KY2A 2P5SA 1TL7C 2WJVA 1OH6A 1X8JA 1KSGA 1RRFA 3TSOA 1ZM3A 1W0KA 2NO1A 4C0QC 5IHPA 3SS8A 4PQYA 4TYQA 1GNPA 1NMXA 4O2LA 3O8DA 2V6JA 3GEEA 3K9HA 1G8PA 1OXTA 1FL9A 1RW4A 2QPTA 2QORA 1GP2A 3EZ7A 3B1XA 4XWOA 2OBMA 1J7KA 1NN3A 2ZYTX 4QBGB 3EX7C 1X1RA 1II8A 2HJVA 2FH5B 3ADDA 3L82B 5AUOB 4IXMA 4LHYA 1YZLA 1KK3A 1XD8A 2ZTSA 1G5TA 2GXSA 1EFCA 4RKEA 1Z8FA 1W44A 2XJ4A 3PQCA 2ZRBA 4DZZA 1MV5A 1S3SA 2ZSBA 2RB4A 2VA8A 5FOVA 4C2TA 4CEJB 5K8LA 4BZQA 5BN4A 5FL3A 2J1LA 4HLUC 1QF9A 1YVDA 4TN1A 1NG1A 1WE2A 4ZCLA 1OPXA 4GOXA 2AD1A 3U4QA 1NVVQ 2O8CA 3TNFA 4AYXA 1OH5A 1T3LA 4NE2A 4DEYA 2ANBA 4TMWA 3WYGA 3IGFA 3CWZA 4GOKA 1XXHA 3N70A 1N0UA 4JVLA 2VHUA 1RFLA 1QHYA 1BIFA
chains in the Genus database with same CATH superfamily
4Q3BA 3T7AA 5AI6A 2BH9A 3PQ4A 4C08A 1KZGB 2ZRPA 4H08A 4V0KA 4HDCA 3LC7O 2MYNA 2VTVA 5LDDC 2W4IA 4GXNA 1K3FA 3AFNA 1NUQA 4J7UA 2FN3A 1OR8A 1L5WA 5T64A 2FPMA 3T4UA 1A2OA 4BTEA 1H4TA 4UUBA 4GAEA 1JVSA 4TMKA 5ABPA 4D8YA 4G84A 4O4HA 3NEJA 4XTCS 2B37A 4JJ8A 5BR4A 1H0HA 3G2QA 1MC1A 1NVKA 3AERB 4ZV4A 3WKEA 2DPYA 2XX3A 2LE0A 3G7UA 3I3SR 2FG5A 1DL5A 1BE6A 4X7PA 1IN8A 2W2OA 2Z9BA 5LUBA 3G79A 3JQFC 5EP3A 1FUEA 4O8ZA 2FWRA 3GLRA 3NWJA 5FPHA 2VUHB 1LW6E 2NO0A 3I9MA 2ZUWA 4L8YA 3RU3A 4IDEA 1XAJA 2UXDB 1TM1E 1Z37A 3D59A 2EDAA 1HSOA 3LU1A 4XX0A 4RM2A 2H4YA 5E9JA 4DIFA 5KDDA 4O2AF 3BC1A 2VTBA 4PPGA 2CMHA 2DH6A 3M1LA 4R98A 1XTIA 1F1BA 1FMCA 4QDJA 1CRLA 1Y1PA 1L7BA 1MJGM 2OC4A 3IV9A 3JVVA 4JKOA 3BFXA 3CUYA 3D0RA 3DOUA 3ELYA 2H17A 5BVHA 2F8MA 2GLTA 5LD2C 1A50B 1O87A 1SVNA 1VMEA 3E9RA 3M6MD 4GX2A 1AD2A 2O2ZA 3QPBA 4F38A 5A4AA 2ZSHA 2WHEA 5CLFA 3LI2A 1CSEE 4IIEA 4E13A 2UVDA 5KKNB 1G7TA 4NPAA 2VDPB 4NK5A 2H3EA 4ESOA 2G0TA 3SOZA 1E6UA 2BMFA 4JA2A 3TSWA 1A4RA 5JEDA 4N0DA 4FHCA 1U6IA 2IEBA 4EPTA 3VVCA 2Y9PB 2JCVA 4IUDS 1V9SA 4JLAA 1XTKA 4P3YA 3TMYA 3A0UA 1PR0A 3RYCB 4CIDA 3EXIB 2D3WA 1YIAA 3KB8A 4ZQCB 3TIVA 4NYMQ 3EVTA 5A4DA 2VBFA 3DP7A 1D1QA 2XTNA 1LDNA 1WUJS 1L8QA 2FZEA 3T7KA 1XGKA 2WR8A 4CXMA 2OV2A 3I6YA 5KHOC 1YL7A 3PEWA 1AGYA 2H4ZA 2WSBA 2IH2A 5C8YB 3C98A 2GJKA 4KXVA 2OV8A 2Q5CA 4OLHA 1A96A 1WMFA 3WGVA 3GGDA 5DYWA 3B6ZA 4ZYZA 5DX1A 2QVBA 5LQKA 1EWTA 4X65B 5FTWA 2N0SA 3EXFB 1JQBA 3PB3A 5BWOA 2BONA 9LDBA 4F96A 1UMDB 2Z6AA 2B20A 3W3ZB 1GWNA 3ROMA 1BKSB 2ERCA 3NV7A 4HAVA 3Q8XB 4KMRA 3HEAA 4QHSA 1LRJA 3VC3A 2V58A 1EU1A 5FULA 2Y1FA 1YZ3A 1N9KA 3QVOA 1JMVA 4MS4A 3G2MA 4RSRA 4URWR 2Z58A 2JIOA 3LXRA 1LWNA 3W9SA 4ZK2A 3ZHQA 5CH8A 1QHHA 3CURA 1RTTA 1CUEA 1CT9A 1JFRA 2XB9A 2A35A 2Z98A 3PNKA 4G5XA 3PLAE 5EHXA 3TW0A 5HSGA 1FRNA 3SF8A 5EE0A 4RGBA 3TK1A 4BAGA 1DXQA 1D9ZA 1ZVVA 2R6ZA 2DWUA 3B9RA 4ZVNA 3N2KB 2BDUA 3QTBA 1UWKA 2A86A 3KEGA 1OF1A 3IUBA 4I1UA 2ZU0C 1UANA 2G09A 1SZJG 4FGLA 4DQ0A 5ERGB 4A2PA 2IYYA 2H8GA 4IVQA 4CCSA 5K8UA 4JLDA 4KL8S 1ISHA 1LUAA 3ZDFA 3EUEA 5EJAA 2YHBA 3CNBA 4F5ZA 5KVSA 1V7PC 1MC5A 1ZWKA 1YQGA 4HNQA 3AR4A 3R24A 2CE2X 1P19A 2GAFA 5HG0A 4C4YA 5A9SA 4C7OA 5B1IA 2SCUA 1IWBB 1ORIA 1QK4A 5KX5F 1H8EA 1CY4A 2NOAA 3COZA 1Z4KA 2CFOA 2R1UA 4Z0NA 3ER9A 2ZBVA 3GRCA 2UU9B 4LZOA 1PFUA 3I6IA 4FU0A 4BAUA 2QT9A 2IUTA 4RZ2A 3E0XA 1XQYA 3DE0X 4Z7QB 3RS7A 5EWMA 5TQ0B 3THWB 2XUIA 5FI3A 4C6RA 3INYA 3CVOA 5CYOA 4RZSA 3R3SA 2PRSA 1R5NA 2H4HA 2NVUB 3N8IA 1D7OA 1CY2A 1V7QA 2JJ1A 1TM2A 2SBTA 3AHDA 4GIBA 5ALOA 2EQAA 5K0JA 2Z5VA 3R5SA 4K9NA 4YP6A 3LO5A 4FGWA 3JTEA 3COPA 3OKCA 3OSUA 4UBJA 4NMXB 3R7SA 5C7LO 1E2UA 3Q6IA 5IKMA 1M1NA 4IJVA 4UU8A 1SCAA 3GRRA 2OSVA 3GLGB 1D4AA 2M1ZA 1C29B 1CDDA 2XNDA 2IYSA 3CF2A 2R6R1 3LQ1A 4LQDA 4DR3B 4EFMA 3JQ8A 1OBOA 2HQ1A 2QLTA 3KKLA 3TQQA 4QTTB 3UJ8A 5HRCA 7MDHA 3CVWA 3Q3IA 1CW2B 5DM2A 1UFKA 4OLAA 1WABA 1KR2A 4I36A 2GCNA 3VVBA 1P2GA 4GZ3A 4TLMB 4UVDA 4ZAWA 3OZIA 5LP1A 4R84A 1R7RA 1CUJA 3NT4A 1T4DA 1XFAA 3QQPA 4GR5A 3RFVA 1ZUWA 2VKTA 2PUEA 1DU4A 2G0AA 1DQYA 4ARIA 1AQLA 5DASA 3CHYA 1JEDA 1CJTC 1KBQA 1GPH1 2PX8A 3AHFA 2ATVA 3UA3A 3WSTA 1LNZA 1LLCA 3ABRB 5F78A 4XCXA 4DCOA 3QVLA 2GBGA 2GR9A 1RLIA 4OPMA 5DTMA 4FTWA 1S2OA 2NU9A 3PPWA 3DZJA 1Q11A 3B52X 3I76A 5ILOA 5CH3A 4HLNA 3WOVA 3GLGA 4LGCA 4FD2A 1IZ8A 4BN0A 5BW8A 5E9QA 2RHDA 2RONA 2H16A 4Z49A 2ZSAA 3LT5A 4E94A 3P71T 5IVHA 3PEFA 3WJ1A 1QFMA 2PWAA 4L07A 1KZ6A 4KREA 3IR7A 5TARA 4IINA 4UD2A 3S7ZA 3ZGNA 4B3HA 4D6XA 3I3OA 4PANA 2OGUA 2V97A 2VNIA 1V9CA 1EM6A 3CKYA 3I72A 4JR1A 4R2XA 4J29A 3E3AA 3WQHA 3ZCRA 3BMCA 4G4JA 4O4HF 3RS2A 2PSHA 4MQFB 1DQPA 3D6MA 1JE0A 3DTYA 4LS3A 2WWWA 3QG5A 4MR9B 4MGHA 5E7QA 2ONJA 3HJAA 4CTNA 2XNJA 2C61A 3S44A 2I54A 3WRYA 2WOJA 4LXIA 3L0SA 1MJFA 1TCAA 1NUAA 3QXSA 3OC6A 1YZUA 4ZVQA 3HLYA 3HCOA 1F2TA 5FX2A 2NUAB 2VAMA 3E6AA 3H1GA 1FJ2A 2A0YA 3FLEA 1X7WA 2QMQA 4TVOA 1KMQA 1Y1LA 1O0BA 1XTTA 5BQXA 3QU5A 2UUBB 5L4SA 4GOLD 1MJGA 1YRAA 2R8RA 4YIKA 3BF7A 3RUPA 3BCSA 2JKVA 1LFAA 4A6DA 4EY3A 5LQDA 4KQKA 3SZ3A 1FFEA 1FYVA 2EXXA 3I9LA 4OYRA 1SUDA 5DSXA 2GFHA 4RDCA 1QF7A 4EATA 1SIOA 3SSOA 5IKPA 3JQCA 1XDZA 5AOCA 1EWVA 1SQFA 3I5MA 2BLLA 1J0EA 4H31A 3WIEA 3IV6A 4DM7A 4E5VA 1ZL2A 1VPWA 3JQ8B 3CTPA 3O5AA 4PX3A 1L0BA 5C8YF 3VR4H 1IJEA 5EEGA 1VHJA 4QFCA 3G2OA 1RZ3A 3O7MA 1GA4A 3E3NA 2FXIA 3ES9A 4R7TA 4Y9TA 4RF4A 2YN2A 3QKSA 3WGJA 1E32A 2Z95A 3QOFA 2YWJA 3F6RA 3O82A 4J9UE 3MWLA 5HBRA 5BSEA 5JC1A 3E4DA 2WYIA 3WNQA 1U8UA 5FO1A 1PQYA 1T6XA 4DBVO 1GGHA 4A15A 2CDAA 1DWOA 4V03A 3IPLA 5IDYA 1V1JA 1E8MA 2XMRA 1UM9A 2UDPA 3I52A 4J2HA 3ZWKA 1RU3A 4HPWA 4QGGA 2ZI6A 2JK1A 4ZO7A 3R6LA 2AI2A 2DQ4A 1M72A 2X13A 3MJ4A 3PRKE 4DCSA 2ZRCA 1R6XA 5ALWA 1FNBA 4XR4A 4O02B 3AUSA 4GX1A 4O2BF 2HK7A 3PC7A 2YTZA 3H9QA 4XWTA 1EVJA 2AGVA 4PHTA 4Y2YA 4BVGA 2QVCA 2NZYA 4JNCA 1EDZA 2B1QA 2PUTA 2WUVA 3FPJA 5BMVB 1I32A 3NVDA 3R3YA 4MAAA 3INNA 4RX1A 4LF7B 4TKLA 5I3CA 1Y8QB 2RAVA 3UT6A 3OQHA 1HDZA 3JAKB 1OILA 4IEEA 1H3FA 1SBQA 3PQ2A 4D4KA 4S2UA 3WICA 4BWYA 1PG0A 3ENKA 3NALA 3LO8A 4MS4B 4Q3CA 3U7QA 2GYWA 3DCJA 4CMIA 5C37A 3H19A 4DT1B 2FVXA 2FWBA 5TQVA 1GA1A 4WXRA 3FDZA 2GJAA 1XVVA 3D6NB 2CLMB 3E18A 1ECLA 1IAVA 1VPDA 2A5YB 1ZUD1 3EQ9A 3C8HA 1ARZA 3CMMA 5MN6A 3E7DA 1Z5UA 2H31A 2NVBA 2Q1YA 2RGCA 2JCBA 1MAUA 1UXOA 2PX2A 1H1LB 1VIDA 3DPSA 3KK0A 1F8XA 4FFMA 4WI1A 1E9SA 2VWPA 2C9DA 2EHDA 4C0AC 3FNHA 5LZ9A 5FI5A 1ST2A 3KJZA 5T5QA 3VTFA 3L1KA 4QYIB 1PK8A 1V4BA 2HD4A 4PLZA 1GTRA 1SEPA 5CB4F 1E1CB 1CLEA 3A3PA 1GL9B 1Z5VA 2C7OA 3KJNA 1A1SA 1KO5A 2XMZA 4QJBA 2ETXA 3LLMA 2OCPA 4PHGA 1YB7A 4M9QA 4AO6A 3TH5A 3VC1A 4DNQA 5AVRA 2Y1EA 1U02A 4R3UC 1EX1A 2XNKA 1Q22A 2AX3A 3O84A 1IBRA 4G1BA 1B0UA 5AW3A 2IP4A 2GPYA 3LTEA 3DF7A 3QKTA 5GJBA 3WIDA 2IYUA 3R23A 2UZ1A 5DNCA 2Q5EA 4L85A 4NHEA 5DE3A 1JBKA 2CD7A 3WGMA 3ZE2B 2WI8A 2ZM6B 1D6NA 1MCZA 3QYAA 3IOBA 1EZZA 2WTBA 1C7JA 4PSUA 3VKGA 4PLGA 2WV7A 1E1RD 4D4MA 1RYNA 1QPBA 1Y7HA 3QNUA 2YXNA 1X94A 4P86A 1C3JA 1B14A 5BYKA 2HMVA 1Q7TA 2JVIA 4O3FA 4KQEA 2P2GA 3D81A 3P2OA 5JJIA 3CGGA 4KGVA 3IO3A 4L0QA 3USES 5KJFA 2R7LA 1DXYA 1SVKA 1WCWA 2X6QA 3TXAA 3ZWAA 3MHTA 3L7NA 1ZI8A 1KDVA 4CQMD 3ADBA 3UH1A 3GROA 1N8SA 3GEMA 1HOXA 4HWOA 4EKNB 2IX9A 2I7VA 2VSYA 4KQGA 3BULA 4JJ6A 4EO7A 2ZZMA 4RZ3A 3ONFA 2P9BA 5E1BA 2H52A 3GI1A 3BS4A 3KEOA 2GEUA 1NQVA 4JB0A 4RY2A 2RCNA 3E61A 4EFDA 3OM9A 2X8BA 1MDBA 3I4FA 4IKPA 4GLLA 4XIFA 3A27A 1G4AE 2WVAA 5TX7A 1NVXQ 3L4SO 4B4KA 3LBHA 4G67A 2JIZD 1D8AA 1TNDA 3DULA 3ROQA 1C3OA 1V3TA 4BKPA 5FBZA 2QROA 3ONNA 2V8BA 1JT2A 4KYTA 3VH4A 1GGFA 5KOJB 4E32A 3FCEA 2H08A 4L8LA 3JQPA 4DLYA 3CPJB 4COOA 4E12A 4PTZA 2BFFA 3KFVA 4O5AA 4WL0A 1J99A 4DIMA 4KEAA 1QFYA 4OBWA 2Q5IA 4R2IA 4P08A 1J8MF 1SXJC 2W2PA 2JIQA 2WIKA 5FBWB 4YUXA 5LP6B 5HK8A 1N5DA 1L2TA 4OLFA 4K9QA 2WSMA 2B36A 4L76A 1GQFA 3IBGA 4XGQA 3UGTA 1GJRA 1A77A 1JYSA 5IVPA 1T24A 1E6LA 5ALPA 1G21A 1FJXA 5L95A 2ONKA 4KK3A 4QDXA 1F6WA 5EIFA 3AUJB 4LC1A 4MQUA 4BJ1A 3ZQJA 1AGRA 4JLKA 4MQLA 4NBLA 2ZJYA 2XMQA 2ZJAA 2C7VA 2WVHA 1KQOA 3ZXIA 4F9FA 1DE0A 1V6AA 2GF9A 2XB4A 1X1TA 3DDUA 3DW1X 5BSVA 3I5UA 5EP4A 4G24A 3ELBA 1DBRA 3RW9A 2FF5A 2JLQA 2PGLA 4I50B 3I9JA 4K88A 4BV9A 5L3QB 4FUTA 4YYEA 3B60A 3RS3A 4DGSA 1XZCA 1LC3A 1T8RA 3G8CA 4WXHA 5EERA 5K3AA 3SS7X 4DRXB 1YMVA 1AO0A 2OE2A 3TKYA 1P2FA 3I9KA 3M6XA 3P7MA 4Y2GA 2PWBA 5KHAA 5IDWA 1TQ6A 2CN1A 4J7AA 3N9IA 2IODA 4LEIA 1V7CA 1A8QA 5JW6A 2VJNA 2BDTA 1JWBB 3H7IA 4IGAA 4C0LA 4RYLA 3N8NA 4BFUA 2B82A 3OFKA 3RC7A 1LTQA 1P0CA 5LKAA 2GN8A 3T9BA 1P74A 2FFJA 3FKSD 3ZDXB 2O57A 3H5NA 4BZPA 3H1BA 3TRFA 1ZY2A 4YONB 2W58A 3WFJA 5K20A 2J5KA 4S1WA 1EK2A 1KU0A 3EC7A 3S8YA 2RHWA 1QTNA 1XDSA 1Z9BA 1WO8A 1KEVA 2WTAA 3S29A 1D8TA 3H1AA 2I8AA 2HMUA 2QRLA 3K09A 1R8XA 4JKIA 2FWAA 3BJRA 2AFRA 4DQVA 4O08A 1U2EA 5AXBA 2YS6A 1NVVR 3IP6A 2JEOA 3M9LA 3EA4A 3MCAA 1QK5A 3OKAA 4PYNA 4ZYTA 3P2YA 5KNBH 2Q45A 3K9BA 1V25A 3G5AA 3ICVA 2CB9A 4KTVE 3AO0B 1EHIA 1LXCA 4EGSA 1IDOA 1UAAA 2I65A 3D0OA 4KIFA 3HBAA 1ABEA 1ZU5A 2P62A 4HGQA 4J0GA 3RCBA 5KYGA 4RDXA 1CRPA 3F8TA 2NXWA 3U1BA 4Z99A 1AA9A 2D2IA 3U7EB 1E3JA 4EUNA 4MA5A 2YNMD 4B8YA 4EKEA 6GPBA 1F4LA 1GAQA 2CXNA 2KWIA 3U4GA 4A91A 4NECA 3OIDA 1A9XB 1DJOA 2FMFA 1CUCA 4D1YA 1JAYA 2V45A 5HILA 4UAJA 4X7RA 1SQ0A 3UOWA 1L7MA 4TTIA 1WSDA 3Q7PA 2XD9A 2HF8A 1BCRB 2AOTB 1M1UA 2CKMA 2QX4A 3RANA 2Q4EA 3H1EA 2QD3A 4A16A 1UKEA 1EUDB 1MRZA 1EFUA 2W0SA 2YRWA 4RQUA 1TJ5A 1WQ3A 1QP4A 4AKGA 1YZTA 4CL3A 4D9KA 2OHOA 4TX1A 4EDHA 2JLCA 4H3KB 1S0UA 2HH9A 4D9EA 1SU4A 4KOEC 4CT5A 3W5VA 3FOZA 4D81A 3P20A 3VR5H 5F3DA 4BQEA 2VNKA 3FYHA 2DKFA 3GOHA 5JIBA 1EFAA 2Y9MB 4G1UC 3DR3A 2W4MA 4MA0A 5HZGA 2VWQA 3UMSA 4ZO4A 5IJ9B 3OI7A 1N75A 3WRXC 4BNIA 4DDUA 2B9VA 4DV7B 3G0OA 4JC8A 3O4FA 2NQ2C 2VXBA 1EE9A 1RRVA 4HFNA 1Y3AA 3NH6A 4ZT4A 4WPGA 4XGKA 2PU5A 5A5EA 4JFRA 5BW6B 4F9GA 2AZTA 2OV4A 2EF1A 2C58A 4CQMB 3DTVA 3O47A 1N9GB 1YJQA 4CLXA 1U9JA 4DV5B 3QWAA 4KIWA 2ZUSA 2H1LA 1DDOA 1XAHA 4F1JA 4IG4A 2C57A 2Q2QA 2WP0A 3C3CA 2HK8A 5E6UA 1NI5A 1T9GR 4QYWA 4ZTZB 3WJ7A 4LPKA 4G1VA 2CXXA 1P6QA 1GFZA 1JLLB 3JQBC 1ID1A 4O59O 4OHUA 5KINB 1E77A 2QUBA 2OOKA 2WKSA 5ITWA 4JVOA 4RFVA 1E6KA 3DBOB 1TA4A 5F98A 4AUMA 4U5XA 5IT0A 4NCNA 1U0RA 1MENA 3HR4A 2WMDA 3NC4A 2GHIA 2W2XA 3T5MA 1K92A 1E9EA 1VHQA 2P1DA 3BM5A 3MSCA 3H5OA 1U0JA 4IH1A 3UF0A 3EZ6A 5DULA 3AHJA 3WFZA 4MV7A 1V2GA 1CQIB 2Z8YM 4JLJA 4TSRA 4OI1A 4PGMA 3DMRA 1ZXLA 4HVAA 3DXYA 2Y27A 1I36A 5BN1A 1WSWA 1NF9A 3PUVA 5EJ6A 1WEKA 2IHUA 1SKMA 2QSUA 3K5HA 1P2TA 2PJUA 4QG3A 3L18A 1RCFA 1WTAA 2FB9A 2UZ3A 4JOBA 1P61B 2FPWA 1RIIA 2VLIA 3OP4A 3QQ5A 4LQLA 4UXHA 1NURA 3MTIA 4E5MA 3DBRB 1ODSA 5K0TA 1VBKA 2BFDA 5KOIA 3M81A 4KKXB 4LGYA 3TSAA 3D3EA 4PXSA 4TWZA 5HMMA 5AD1A 3O8LA 1KFKB 1RXIA 5AKHA 2AR9A 1C0EA 2XKJE 1KNXA 4KG7A 2SKCA 2JRLA 3GLFA 3FYDA 2FX3A 5B4VA 1FNDA 2ZRDA 3LVRE 3QI7A 1ZESA 1KOLA 5F52A 1SXJA 4LOJA 4O63O 3OIWA 3VNVA 1GZ3A 3JWPA 4UAVA 3DDHA 2EX1A 3ZY4A 5HE9A 1SWWA 1K2WA 1YAJA 3KWLA 1P39A 4RQBA 5GZ1A 3P9XA 4ZDWA 2GJ8A 1I1HA 1J25A 3C3EA 1KERA 2FWNA 1HNZB 1RC8A 1NOJA 1C3OB 3TSZA 3H2SA 2BISA 3ZZ1A 4Q4AA 5JWRA 1XU7A 4G36A 4P82A 2VH2A 2EZ8A 5G1PA 5HPYB 1A7JA 1OWMA 3TG8A 1TQDA 3M83A 3VAAA 4HP8A 2ZR7A 2I7DA 1IZ7A 1L5VA 2EL7A 3QVGB 4MJXA 4TZ0A 2DRIA 1Z0SA 4EHAA 4FMCF 3G1UA 3UGJA 3CB2A 4BCBA 1EX7A 2NTVA 1KP3A 3QA3E 3RODA 3WYAA 1KF0A 1MQ8B 3AX6A 1JALA 1ZQ9A 2GZ2A 1QMPA 1Z22A 1II9A 3DNFA 2VQEB 3HE3A 3K9QO 5FTLA 1KS2A 3HCWA 3U7GA 2DAPA 3U7FB 3QU4A 4WOJA 1FJGB 2LIVA 4OK3A 1XTQA 4RV4A 1ULTA 3WIOA 3K1TA 4EOGA 4UHCA 1LS6A 3DEIA 3HYNA 1Z47A 1H2HA 4Y6GB 3E22B 4PINA 3VJRA 2A58A 3B6IA 2OGZA 4BO8A 1NVEA 3PHGA 4KNVA 4R2KA 2LDXA 3SDBA 3IODA 3H5VA 3FUCA 1GLVA 4KBYA 1Y98A 3RIXA 3LPNA 2L0XA 5G3ZA 4DCTA 1LVHA 4YBRA 1XJCA 3BK1A 5DM60 2BMWA 4D0RA 5A2GA 4FS8A 5KJCA 3MJVA 3H18A 1VDMA 3PL5A 5EMLA 1OFUA 1T36A 3AWIA 1IUPA 1XLTA 2V6FA 3ESCA 3L8HA 2W42A 3WL5A 2X23A 3KUUA 2CJYA 1QH1A 4B8WA 4N49A 1YZFA 3VNBA 2FMIA 1LPAB 3LOUA 3IAUA 4HUQA 3RG2A 1SU7A 4Z6KA 2C7RA 2VQSA 1O97D 3F9RA 4B32A 3GPIA 5T57A 3O0DA 1SU8A 2QIOA 3L40A 4GWKA 2F3UA 1XZFA 2GK3A 3CPEA 5D85A 1K27A 4BU0A 3AR3A 3RC2A 4A0FA 1A9PA 2QQGA 4J90A 1T0PA 4BNXA 3D0QA 2O3JA 4B6SA 3MMXA 4NCAA 4G5GA 2W7TA 3EEFA 1BFDA 3URMA 3DFIA 5CM2Z 1OWLA 3MFYA 3IR6A 1ML3A 3NT5A 1UMDA 3N05A 4JBHA 1PGPA 1ESNA 4KYIB 3INRA 3JAKA 2V98A 4Q9KA 2VJOA 1NXTA 1PSZA 4W1SA 3RUEA 1P4SA 2WPNA 1Z6AA 2JGJA 1JMKC 1Y9ZA 2WF5A 3I62A 1ACJA 3FY4A 3L84A 1TVCA 5LCXA 1BHSA 1JXMA 4ZHQB 3HB7A 3AUXA 4B34A 1TMOA 2JHCA 5I01A 3RUAA 4HUQB 2QA5A 3DCYA 4TLDA 3EQ2A 1VKZA 4D0GA 3FUXA 1FMFA 1HL7A 1W2HA 2UVPB 2WM9B 3BL8A 3KJHA 3Q3VA 1JH9A 3ZLBA 2XCLA 3GU3A 1YIDA 4DCCA 3PX7A 2WB2A 3DGEC 3FIUA 3LCCA 2IUUA 1SR8A 1Y37A 3UANA 3WK8A 1HRKA 2DHCA 4RD1A 5KI6A 3DXXA 4Y0VA 4RK0A 1WZCA 2DFKB 3CX7A 2XA2A 5T8KA 2VF8A 1ABBA 1JYEA 3TJZA 3T7JA 4JJAA 3CEMA 3OEWA 3L43A 4MV1A 5HFJA 5IKOA 1H6BA 1EI9A 1M1YB 2G6TA 4GECA 3ZVRA 4D6YA 3OUTA 3GT0A 5EA2A 2ZXUA 5IULC 3E1SA 2WSSA 4Q1EA 4MWGA 2I6FA 4B7ZA 2JGMA 3K1AB 1G5PA 3DA8A 3KQVA 4OJTA 5FPKA 4OAPA 1R0SA 2A1UA 3IIMA 3QYFA 2FPPB 2IZOA 3ZIAD 1D2EA 3ETEA 2ETVA 2PCLA 4OA5A 3U37A 4E7OA 5CDGA 3KYCA 4JP1A 2FW8A 1XHLA 4AJIA 3TZLA 2F55A 2QTTA 3MYYA 1XXLA 3DMTA 3L07A 1ZM9A 4FEEA 3UJHA 3ZTYA 4YY3B 3P1JA 2GCIA 4L78A 2JHPA 2J5BA 1RRMA 2VSNA 4W7HA 5AWFC 5AW0A 2J41A 4WHMA 2ZUUA 4KGXA 1X0XA 1YHYA 4ZOEA 3TZBA 4B3FX 1J06A 3GJ5A 3L7BA 2G8NA 3PQEA 3WISA 2Z1NA 1M1ZA 2IVZA 2GX6A 3UG7A 2FPGB 1TM4E 3OHSX 1DAHA 2FZ4A 4LWPA 4BQFA 4DVJA 3NBYC 2XADA 3OIYA 3W2IA 1MAHA 4PRZA 2YZ2A 2I1LA 5KNDA 4PO9A 1M6EX 2XE7A 3ETDA 4B6QA 1H8ED 1VLLA 3HJHA 2R1TA 3E9NA 5F1YA 1R18A 4ZI7B 1R00A 2Z2ZA 4TKUA 2X9GA 2JIRA 5E2IA 3L0CA 5EE1A 3HXMA 1CUBA 3B5JA 2NIPA 9MHTA 1RI1A 1BX1A 5EPEA 2PZLA 4C7MA 3NAQA 1E8DA 1IVSA 3LDUA 1N5RA 3WKBA 1RCUA 3IAHA 3V8QA 5JCJA 2OXFA 5GINE 4L9WA 1J90A 2JNWA 1RHUA 2XYRA 4UUMA 4Q4JA 4JI6B 4AJOA 1WVGA 2GK4A 2VP9A 3MXTA 4AECA 7MHTA 1X7WB 3C5WP 4HDOB 5J59A 5JANA 3DBRA 2N1MA 1SPXA 3BSFA 1RYDA 4A2WA 2XXAA 3UY4A 2Z2XA 3THXB 4P7JA 1Q0HA 1Z6QA 4RDHA 3K0HA 1MEJA 3ITKA 3PLNA 2GAIA 4G0YA 5J63A 5LXTA 2VJKA 3QLUC 3RS8A 4TV9F 1SUSA 2WOOA 1K4YA 2Z43A 3QXJA 1ZGZA 4HVTA 3OM0A 4QGAA 3G89A 4HNHA 3B51X 4JI7B 5J40A 4LE2A 4CN8A 5EJGA 1U81A 3H86A 4KI0A 4FHFA 1TMGE 1JRLA 4IFIA 3LCJA 4FYIA 4F3CA 2GGSA 2YICA 1QJ4A 5K99A 2X2OA 4WW0A 5LQUA 5DOZA 2I8LA 1DHRA 2AJTA 3ZXUB 1NW4A 1JEYB 1FFCA 1KMHA 4WOBA 1Z06A 1N36B 1JJAA 4QEZA 3RJTA 4YWHA 1IM8A 4G0VA 3NETA 3O75A 4PG4A 3R4CA 2O8CB 3V7FA 3VSEA 3A4NA 4ZYUA 4GGPA 2AYXA 4KI7A 4MP8A 4ZT2A 1E2MA 1HYBA 1Z83A 2TSYB 4DJFC 2A9PA 1BW9A 4P1ZA 1ZI6A 1GGKA 1KJYA 1L5SA 2G17A 1PO7A 3GUYA 2PEYA 2GS9A 3OIUA 4NZZA 5K0CA 2VPYA 4B84A 3ZJYA 2WQ7A 3IP1A 3J81A 1JT9A 3AT1A 3DOFA 4G0NA 4M1YA 4DJEC 4KO8A 3KUXA 3DBLB 4DB4A 3U48A 4D79A 4C9BA 1FFHA 4C7VA 4BLVA 1ONOA 5A4IS 4DIDA 3LCRA 1N3BA 1XVIA 2WG0A 2P9ZA 1XL0A 3R44A 1QO7A 2EKDA 2P9HA 1YB1A 5JSUA 2XSZD 2MIIA 3N28A 1FTSA 4U2KA 4HL6A 4AY2A 1DEHA 2PS0A 1K0FA 4KTTE 5CVUA 4JXKA 4AZ0B 1UKVY 4MUMA 2B99A 1ZK2A 3ZY2A 2QLFA 2ZWOA 3OOSA 1OB5A 2VAVA 3CC8A 1T8YA 1H1LA 1VHDA 1W46A 3HCRA 4QM7A 4J49A 3H0EA 3N0WA 1KYXA 1SXJD 2JEZA 3KQMA 4DQDA 1GUYA 4EJ6A 4BX0A 5DW0A 1FBTA 1ZNWA 4NR0A 1ENOA 3JX9A 3HRIA 3R5TA 3RYHB 4BWFB 5TIIA 1H23A 4BFCA 3V1NA 5HRAA 5CDUA 4M46A 1HT0A 4M0FA 3UJ3X 1RXYA 4U7DA 1FP2A 3H13A 4CZ2A 4BNWA 4EA6A 1BOFA 1HDEA 4D97A 2M6RA 4AKHA 5EZ6B 2BC9A 1NDHA 2E48A 1TCBA 2JLUA 4WKGA 5I7EA 3A1FA 3HP1A 2HEGA 3R77A 4AY3A 4BNNA 1UKCA 1IQ0A 3GEDA 4Y98A 3W5HA 3L0IB 3PX2A 2PS3A 4URHA 3G0DA 3HVIA 3JAWB 2UXBB 1JDPA 1U99A 3ITEA 3E5HA 3ETJA 2I71A 4H17A 4PFQA 3PQDA 1TVKA 1A8SA 3VOTA 2X42A 3CMCO 3FBTA 3ZDZB 1QC5B 1LLQA 1QHXA 5THQA 4HQNA 3GMIA 4HAOA 3N87A 5BN3B 4XWYA 1M2OB 2ZTMA 4U2BA 1L4UA 3PI6A 2XEXA 2I2DA 4BRSA 3C7DB 1UEJA 1FK8A 4RENA 3LD9A 5ENZA 1G38A 5EJIA 2QTVA 2QX9A 5EHNA 3EGDA 1CRZA 1R6AA 4D7AA 5CG2A 2QE7A 4DADA 2XUHA 3DO6A 3E03A 1SHUX 3EGVA 3P9PA 4XYBA 5EEHA 5U1PA 2CCGA 4IRXA 4CCWA 1A5AB 5JCZA 2ATCA 1U8ZA 1N78A 2I4NA 2BTQB 3VSDA 3DHYA 5L8VA 1NMYA 4U2FA 1GXSA 5AJVB 2XHEA 1IZYA 3AINA 1UZUA 5SZJA 4V02A 4DIOA 1YR1A 3U40A 3OZWA 2DSTA 4N8EA 3VNQA 1QH8A 2XWSA 4PS1A 5E38A 4NONA 2IY7A 5JCXA 5K7SA 1NMSA 4RHYA 1V39A 4DARA 1R0WA 1YB2A 5JZOA 5JQGB 4UVHA 2WF7A 1XMPA 3QI2A 4C4OA 3MBOA 2UKDA 2PRZA 4K9RA 4GDFA 5JNRA 1L4KA 1W75A 1GTSA 1LB1B 3KZ1E 3N3AC 4YJHB 4EFNA 1NZFA 1HNNA 4RCVA 5SYAA 4D3ZA 1KL7A 4R16A 4BV2A 1KS9A 3ERCA 5IJWA 3F5DA 3HN2A 5GTDA 3BH7A 3NYIA 2BR5A 3PFIA 4K26A 2E6KA 2RMKA 1KXZA 4JUAA 4NMLA 3W5IA 3WGUA 5KWIA 1KETA 1TW2A 4RVHA 2V7GA 4U02A 1F2DA 4E6EA 5K0SA 4OHVA 3PI7A 2YFKA 1Z7BA 5KOHA 4P0QB 2E7ZA 3VFDA 4ASUA 1VCNA 1P3Y1 1JUDA 5JAHA 3BG5A 3LQKA 1KQNA 1TU4A 3FTPA 4U7TB 5CITA 3O4VA 1R8JA 3E8MA 3FOAA 3MMPA 5CVEA 4WZAE 4RXUA 4X6XA 1ISJA 4FSXA 3AUYA 2QYSA 3TJMA 1M34A 1XZQA 1QRSA 4PWYA 2J67A 4HBZA 5HX7A 1QBKC 3R6WA 5CX1A 1M67A 2A9VA 3IUMA 4TVBA 3AUUA 5DNWA 2YWRA 5HIAA 5KSPA 1G5HA 2IXTA 1NYQA 3FOCA 4H0FA 4V0LA 5DLQC 5LQAA 3FCOA 2JLSA 1L5GB 5ITZA 1X9HA 2HUNA 2J5RA 2XMCA 4XJTA 4ZU1X 4HZUB 4WECA 3EVBA 3CVUA 5DK4A 1K06A 3PVSA 2GYYA 1XVUA 3F5MA 1H4SA 5HKLA 4UFNA 3KHTA 3DJYA 1U7DA 2WKRA 1YFKA 1WXQA 3RTEA 3TB4A 3U13A 2O0LA 2VZ0A 4RK7A 3AL2A 1CB0A 1HRDA 3T5AA 1VPLA 3W8FA 2AZMA 4KQJA 3BN3A 221PA 3HKDB 1PR2A 3DL4A 3QE3A 4HWRA 4U3JB 5CNIA 3S55A 3U3JA 2RHOA 2A7QA 3H99A 2BUCA 1BA2A 3WIUA 2E82A 2UUCB 1P5HA 3DQQA 2OGSA 2PRYA 1TMKA 3RVKA 4YJKA 2BTQA 3SXUA 1Q1BA 4OGWA 1KFJB 4U4AA 2AIRA 4MKZA 1A97A 3QW2A 5MF6A 1MLDA 1EUDA 1RNLA 3TWOA 2VL7A 1RI4A 1ACLA 3LC2O 5LB4A 3BK2A 3OU7A 2IHYA 1BFUA 1WF3A 3G68A 5EP2A 1KVTA 5T6MA 3IQGX 2I4RA 3DDOA 1UIMA 1NJFA 1M73E 1LPSA 4MEBA 1MB0A 2CL5A 4FHEA 3LHKA 1Q50A 1Y8AA 3FKQA 2PGNA 3RS4A 4CMAA 1A4XA 4N3NA 4NXNB 5ALQA 4K3VA 1TO1E 4M7OA 1D5CA 3ONWA 4P5DA 4Y30A 3P0JA 4QSMA 3DLIA 4YQFA 3TZ6A 3A2LA 4XVQA 4WLNA 3TECE 3KQPA 3AJDA 2JLYA 3FPLA 2DWCA 5HGJA 3PC4A 821PA 1Q92A 3RHFA 4NVRA 3G2KA 2F9LA 3BTSA 4CI9A 1OROA 1PWXA 4BNDB 1Q12A 1JAXA 2WEKA 4CUKA 4KDFA 4U7FA 1BE1A 1N5MA 1Z16A 3C85A 5BYAA 1KBZA 1CETA 3D9QX 4KZPA 3UAXA 4HGZA 1C2YA 4FGSA 3RSCA 2HA4A 3JD3A 1H2RS 4V0QA 3BAZA 3WIBA 1LBEA 4I4CA 1EBFA 4EMSA 6ADHA 2HWUA 4YROA 3AUKA 1RE1A 3NHWA 5FD8A 4DUPA 4BQNA 2IKSA 3F4KA 3QPUA 1W0JA 1KI7A 3KKMA 5BURA 1QM5A 1UMBB 3RV3A 4JEMA 5TY0A 3GXBA 3QIVA 5A06A 2F17A 1VA5A 1QZZA 5GM2A 3BICA 4JVSB 3UATA 4L02A 4AUEA 1USIA 3CUTA 2YOHA 3DV0A 2O4CA 3ZE0B 3RR2A 2WHRA 2PGOA 4ZO8A 3AKCA 3UT5A 1IPEA 2AG8A 1M74A 1S3FA 2BOVA 5LYJA 2P9FA 3GP3A 4J4HA 3BE5A 1T36B 3FB4A 3I2JA 3OU6A 3VYWA 1Q1GA 4BNJA 3LKVA 5DM70 4RCZA 3K0BA 4JIGA 2P3OA 2G9VA 4BVLA 1XJ0A 5DM0A 5D3QA 4C6SA 4TS4A 5FBKA 5KTOA 4FLMA 5DBEX 1J9GA 5KJEA 1W36C 2QX7A 3TZQA 1JIIA 1GVNB 1W49A 4JJEA 4F46A 2XCIA 3M6FA 3HA2A 3E35A 1W2GA 4FZ5A 1VJ1A 2AG1A 2BL4A 2YY6A 5E7MA 2D8AA 3NEYA 2QR3A 4RK5A 2GFQA 3JYLA 1A9OA 4KQ2A 3LWZA 1KP2A 1Y5MA 3NDRA 3S2GA 2D8MA 1XRSB 1CZHA 3LF2A 3CCBA 4IIJA 4WXMA 4ZQEA <