3FMPB

Crystal structure of the nucleoporin nup214 in complex with the dead-box helicase ddx19
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
229
structure length
229
Chain Sequence
LVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear pore complex protein Nup214
publication title Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncoprotein/hydrolase
total genus 68
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
B PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmpB00
1HQYE 3RS7A 3GEHA 4KITB 2RGBA 4KAXA 3ZLJA 4HAZA 2V7QD 4IHQA 2A2ZA 4HYYA 1L4YA 2ZE6A 3BBPA 3LH5A 4EIWA 1KI1A 2QQ0A 3KKOA 4HDQB 2QPOA 3W90A 5JEDA 2BBTA 4B73A 2PEZA 4WOPA 5F98A 3OAAA 5L3VA 3B9QA 4BFSA 3CF0A 2GCNA 2QORA 2LCFA 4OHYA 4FCWA 2WWFA 2NO6A 1BO6A 1WQ1R 3U61B 4C2TA 1KSGA 5FOTA 4GNKA 5D3MA 4IEEA 2DFLA 4TL8A 2FE4A 4URUR 1S3SA 2QY9A 5SZKB 3U7GA 1AZTA 2NO9A 2I4IA 2Q6TA 1KK0A 1C1YA 1XZPA 2IYTA 5B57C 2OV2A 3HWSA 1JI0A 1SVLA 4G5RA 1OH7A 2CVHA 5C1BA 4V0OA 2QG6A 1JAIA 3AP3A 1M7HA 3CONA 1FFHA 5CIWA 5KDDA 4HDCA 2AX4A 2C9OA 1XJ0A 2FFHA 2CJWB 2P6NA 1OXSC 2F9MA 2BDTA 3SJAA 3TSWA 3U3KA 2GJKA 1IN5A 2ZJZA 1G3RA 5EP1A 4I1UA 2ZYUX 3KL4A 1VG8A 2HT6A 1YR8A 2N42A 1E2MA 1EFCA 2OEPA 3Q5EA 4JBYA 4M53A 4N0DA 2IYRA 3GFPA 1OXVA 2ORVA 2ZS9A 3EAQA 2ZYTX 4UJ3A 4YONB 4V02A 3OIYA 5EUQB 3Q8XB 4KLZA 3PJRA 5FTMA 2XXAB 3PEYA 1M7GA 3CRW1 4HATA 1DS6A 2YYZA 4KV9A 2J41A 2CJWA 2W0MA 3EXAA 2DWOA 2ERYA 4LV5B 1SVOA 2WZQA 2GXQA 3PEVA 4MYCA 5AWFC 4B44A 4QM7A 1TQ6A 1R4AA 3GMTA 3P26A 4MGKR 3AUXA 1AK2A 2FU5C 1TUEA 3CRQA 3WHLA 3UMRA 3TRFA 2RH5A 2PJZA 2IYSA 2PL3A 1FL9A 2IA5A 2Q3HA 4A0GA 4ZCIA 3WY9A 2GVDC 1AGPA 1W0KA 1KDRA 1YRBA 2XXAA 2ZI4A 1CR4A 1NVUQ 4JLNA 5DYGA 1ZNXA 4FI3C 1XX6A 3BC1A 4DLYA 4ASUD 3HDTA 2WWWA 4ARZA 5J4LA 2EYUA 1N6RA 1DAGA 1WRBA 1GG2A 2GCOB 4BFTA 2A5FA 1XJQA 3FFBA 4DC9A 5FOVA 1D2EA 4PX9A 1Q44A 3BOSA 1QHGA 1GRNA 3K53A 1XEXA 2AK2A 2YZ2A 2WICA 3L0OA 1FNNA 1VTKA 3RC3A 3QI2A 4RD4A 2NO0A 3TJZA 4EFLA 2VHJA 1FUKA 1R5OA 1K5GA 1LVGA 1F2UB 1DAMA 1M7BA 2VH5R 3K70B 4OQXA 1WBDA 4WAUA 3CWZA 1AIPA 4OBEA 1ONBA 1W1WA 2JJ8A 5LBIA 1UBEA 4NYMQ 5EE9A 4MKFA 5P21A 2CVFA 4DSUA 3OEHA 4H1VA 4Z8YA 4X8LA 2OBMA 1QVRA 2AXPA 2WVJA 4UNSA 5IF9A 5JMTA 1E2JA 1V5WA 1JECA 1JJVA 3CB4A 3SZRA 1F2UA 3CWQA 3LVRE 4G5OA 5FOXA 4BZQA 4NPHA 3OHMA 1J2JA 1CU1A 4JS0A 2IX3A 1E2FA 1WF3A 1XD2B 3EASA 1SVIA 2GCPA 4DLXA 1VCOA 3ND9A 2RB4A 3HU3A 1O3YA 4A0HA 2RCNA 2LKCA 1G4UR 1CULC 4Q4JB 1RKBA 4NZYA 4JL5A 2G0NA 1KI6B 1S96A 2ZRGA 1VMAA 3ZQJA 4DT1B 1ETUA 3LW8A 1T8UA 2D2EA 2V6JA 3CPHA 4FW9A 2VHTA 3B85A 2J0VA 4A8JA 5CITA 3GEEA 2QM8A 4KJZA 1AQUA 5HZKA 1II8A 4E07A 2MSCB 1GTVA 4WVFA 3ZYCA 2FMXA 1XTJA 4PC2A 1T5IA 3KQNA 1XD2A 5E7JA 1QZXA 3JVVA 3VX4A 2OCBA 2F1HA 3GJ6A 3EZ6A 3NBYC 1OIWA 3KJEA 4GZMA 4BRWA 4Q4JA 4MYTA 1E2IA 1G6HA 1T3HA 2KE5A 3R9IA 2E87A 3CM0A 3THYA 1HA3A 5A4JA 2NOAA 4CIDA 1KI6A 2I1QA 3FTQA 4DT1A 4TSFA 4A8JC 2ANCA 2C78A 4O2LA 4ZDWA 4OI1A 4FINA 2O8FB 1OW3B 1YZGA 1CJKC 1DO2A 2IF2A 1XF9A 3KKNA 3PEUA 3LX8A 3F0TA 5IHPA 4KBFA 1XMSA 4H1UA 4BFYA 1COWA 1NN0A 4G0NA 5EP3A 3FKQA 3KFVA 3BERA 3AVTA 4PO9A 2OFXA 1Z5ZA 3BB1A 2RMKA 2GESA 1KO8A 3VU9B 2A5GA 3WRXC 4M21A 2DFTA 4Q18A 4PQYA 4GBMA 2CNWA 4YXWA 3GLFE 4HB4A 5CJ2A 3SFVA 4JLJA 2J0QA 1Z83A 2P6UA 1MOZA 2VP9A 4G5SA 3IHLA 5KPJA 5L3RA 2A7QA 2DWPA 1YE8A 4URYR 2OESA 1D5CA 1PLKA 3QQ5A 1XU4A 5IDVA 1RRGA 4CEIA 3X1XA 3VNVA 2V1XA 4O0MA 1RC8A 1OYWA 1VYUA 1E9DA 4OL0A 4TL7A 4YMWA 5DI9A 1JPJA 1LB1B 4A0FA 5JECA 3THWB 4IFBA 2PZGA 3R20A 1MR3F 2QM7A 2VYFA 2ZJBA 1IXSB 1R0ZA 2QE7A 3NDPA 3UANA 4DSTA 1O87A 2VIIA 2KI5A 2OHFA 4KO8A 4Y0AA 3DKPA 1ELOA 2XAUA 3Q7PA 2N46A 4CT5A 1Z28A 5JS8A 3KB1A 1RRCA 1OHHD 1T4GA 1E1QD 1D2MA 3PCRB 2DPXA 1AJEA 1GAJA 3DMNA 1IY2A 2QL6A 4JJKA 2I3BA 5EZ6B 3GP8A 3TBKA 1UKZA 2GRJA 1J99A 3THWA 1TX4B 5B30A 1N0UA 4IDNA 4AI6A 4JMPA 3UG6A 1KI7A 2EFHB 2E1RA 1NN3A 4L9SA 4RCYA 4FXPA 3VR3A 4CEJB 1TQ2A 4GP6A 4A92A 4DEYA 3T1TA 3U4QB 2WWGA 3QXXA 1N2CE 4V0NA 1XPOA 1HE8B 4IEIA 3KXIA 4IOKA 3U3OA 4DDWA 4AYXA 4B2PA 2ANBA 2QRNA 3B78A 3C15C 4B3DA 1KMHA 1G8HA 1ZVQA 2EFGA 3MAAC 1I4TD 1IN4A 3EARA 4RY2A 4DVGA 4DDTA 2P3SA 1SULA 4EJSB 3QEOA 4LJ4A 1VG1A 1Z6AA 1G9XA 4PC7A 2BCGY 5KDOA 3V00A 3LXXA 2HEIA 2BMDA 2F6RA 3K9NA 1FP7A 4B32A 5F9HA 1GILA 1W5TA 2IYUA 3U4QA 2BEKA 1U8AA 5HCNA 3HR7A 1IONA 3H84A 4PO1A 4FCTA 2X2FA 1NG9A 4FMDB 2W6JD 2ZTSA 1AKYA 4L5BA 4URXR 1CR1A 4NCJA 2IEYA 4DDUA 4OJQA 3PV0A 4EDHA 4ABYA 4CGZA 2O52A 4QXAA 3D3QA 4EJSA 3EZ9A 1WE2A 1W4RA 4P4UA 1N6HA 4JJZA 3RYTC 2P2LA 2H1LA 4JT2A 2BMJA 4B76A 4YMTA 5G3ZA 2ZI7A 3LW7A 2ZRDA 3I8SA 4U7DA 2F9LA 2J59A 3BAFA 4E09A 3QVVA 1QDEA 1P73A 4JVSB 3CUEF 5E95A 2NO1A 1OF1A 3VFDA 2CLCX 3UATA 4Q19A 3TE6A 5JCZA 3BJIC 2H18A 1E9BA 5JS7A 4HZIA 4JYBA 5FR2A 5JWRA 4LSGA 5J4VA 3MGCA 2W6IA 821PA 4EJSC 3LQRA 1M34E 5L3SB 4TLBA 5JJLA 1E6CA 1Z29A 3SJBA 1KI3A 4XH9B 1MKYA 4HUTA 1OH8A 5F2EA 3RANA 1M8PA 1B0UA 3WNDA 1OFHA 4AKEA 1J90A 4HZUB 1BIFA 3DDCA 4IOMA 1A82A 1DG1G 3D31A 2C95A 4NCKA 1F5NA 3RAPR 3RLFA 3BRWD 3DZ8A 2ZI3A 2O8CB 1E2DA 4ZKDA 4Q4HB 3U6KA 1DAFA 1VKJA 5FTLA 3A4MA 3ZVLA 2ORIA 3EIEA 3TGPA 4LX0A 4OKSA 4BLOA 1N6IA 3BH6A 221PA 5DI3A 2WJJA 2ZRIA 1W49A 5FTNA 2ZRMA 3KQKA 4LJ6A 5L3SA 2CE2X 3EZ2A 1DG3A 1ZRHA 2ASEA 1ZD8A 2H5EA 1OXTA 3BFXA 3IIJA 4URWR 3VKGA 2IUTA 1F6BA 3TK1A 3D6TB 2G0TA 4DUGD 2XJ4A 3WBJA 5TARA 1JNYA 1KNXA 4Q4HA 4TZ0A 2Z5FA 1M74A 5FPKA 1ODFA 1UEIA 3IQWA 3I5YA 3GLFB 2IHBA 3BWDD 1FZQA 3ADCA 1ZM4A 3IPXA 1N3BA 1U8ZA 2VF8A 4K46A 1E9EA 4UNNA 3ZVMA 2XZOA 5BQ5A 2IT1A 1KDPA 1P2TA 2QENA 4KVGA 4Q5IA 2IWHA 2YWFA 3PENA 1II9A 1W47A 2QTFA 3T35A 3EPLA 4NYIR 3ONWA 1DE0A 1X6VA 4NCHA 4M9XA 4DWJA 4RZUA 1KSHA 5LDDC 4TMZA 1T5LA 2HLDD 3LV8A 2H17A 4WA7A 1XXHB 2YOFA 4DCTA 3ETLA 1G6OA 3U3JA 4BLRA 4LOAA 4KFTA 4NKRA 5EUMA 4MA4A 1PVOA 1E0JA 4M9ZA 3B1YA 3I4LA 4Q03A 4U02A 4B3BA 5C2JB 4N3NA 1AM4D 2IXEA 2BBWA 2KBFA 4XOIA 2G3YA 2HT1A 4CZ2A 2EWWA 5C4GB 4M1MA 4V0KA 3UMFA 2QEQA 2ODBA 3SYLA 3OIWA 5FR1A 4LYJA 4B3XA 1XXHA 3GJXC 2AHOA 4QGHA 4A9AA 4C0QC 4ZI2A 1KI8A 1YR7A 4IOJA 5GJCA 2QSYA 4Q66C 1XZQA 3HJNA 1KI2A 1E9CA 2BVNA 4KXFB 2CL0X 4NTZA 3QJYA 3B6EA 3KKPA 3L2OB 2J1LA 1X8JA 4ESVA 1KI4A 4QHSA 2C04A 1N0WA 4RD0A 2QBYB 3MJRA 1ZMXA 3N70A 4HI0E 4LHYA 3T1OA 1ZAKA 3KQLA 2QGZA 3AUYA 4UXHA 1P9WA 3Q9LA 3C4JA 2ZI9A 2GJ9A 3UWOA 2BC9A 4Q9JA 3SQWA 2FX3A 1KAGA 2ZSDA 3C7KA 2GJAA 1VYTA 3CRRA 4RD2A 3RDPA 4DHEA 3K0SA 1G7SA 3FGNA 3IEUA 4HAVA 1II0A 3LBIA 1ZU5A 2XZPA 4HB2A 1W4BA 2CXXA 4NBSA 2PT7A 2Z43A 4F93B 2H57A 3SOPA 1GRQA 2IHYA 3QBTA 3ZD7A 3LNCA 2OCAA 3SDZA 3A1WA 5LD2B 2PMKA 4ACBA 1Z0FA 2QBYA 4E5UA 4OI4A 3CO5A 1K6MA 1AZSC 1Q1QA 1WP9A 3SU8A 2BMFA 3GD7A 2R65A 4CVNA 3PUVA 3E2IA 5M04A 3HP1A 4DKXA 2N1BA 4CDGA 1NMZA 4CT4B 2ZROA 3NKVA 5FOSA 3C5HA 3W9YA 1E9AA 4JLMA 4EAQA 3SBEA 1IY1A 3NC0C 1UBFA 4V0ME 4A4DA 4GI7A 3L82B 2R6AA 3HPRA 3SJZA 1VHTA 2GVZC 3AVUA 2KB0A 1TF7A 2ZREA 3AF2A 1ZNWA 3DOFA 4TZ6A 1VIYA 3AF4A 1AQYA 1IBRA 2QAJA 4LC0A 6Q21A 4I99A 1OHHA 2WKRA 3SYNA 3QXHA 4G5GA 1W36B 2LWIA 2VP2A 4W5HA 121PA 4QBFA 5HE8A 2D06A 1AS3A 2JIZD 3VQTA 3RRZA 4PTLA 3N2IA 4JSYA 4JT4A 3TW8B 1Z0KA 4Q48A 2OAP1 4LBVA 1TQ4A 2DCUA 1CBUA 2WJHA 3LRPA 1EXMA 1OIVA 1E98A 4PPGA 1Q20A 1V43A 2YINC 4JL8A 5AUNB 3TW4A 1GRRA 1GL9B 4ITRC 1S3GA 4B6FA 4BZPA 4MRRA 3ZH9B 1QF9A 4D0GA 1YZUA 2A3RA 3SHWA 2ZXUA 3VR2A 1E2LA 1FQKA 2IS2A 2W58A 4YLGA 5E7IA 5EE3A 5G53C 4D81A 2IYVA 1ZNZA 5BN5A 3QXSA 3TVTA 4DCNA 3QENA 1EFHA 4V03A 1KI9A 1TTTA 3OESA 1AA9A 3GLHA 3NEYA 4QGFA 3SFZA 3C5CA 3LWNA 4QL3A 3EWAA 1N0VC 2O5VA 4HLUA 3UIEA 4AKGA 2QQEA 2WIAA 1U90A 4DJTA 1ANKA 2CL7X 5JWHA 2Q3MA 1OLOA 2W6JA 3CNNA 3AVQA 3QPVA 3ZS9A 5K8TA 2CCJA 3SI7A 1ZUHA 2WOJA 4LHWA 2FOLA 2IYYA 5BYJA 2ZVQX 1H8ED 5FPSA 4ON9A 1QHIA 1HEIA 4ZV4A 4U5XA 1JAHA 4B43A 2VA8A 2ZJYA 3C16C 4HAUA 4PQRA 4L8GA 2JAQA 5FBRB 3O8CA 2B8TA 2BBSA 4EQ6B 3B1XA 5TXGA 3W6OA 1NI3A 2JLQA 5LB2A 4JLVA 5B64A 3P1JA 1QVAA 1D9XA 1E79D 3CX7A 2AKYA 1ZUIA 3NH6A 1KYIA 5CJPA 1YVDA 5AUPB 2IC5A 1RRFA 3A58B 3CZQA 4GDFA 5JJIA 1FOEB 2AK3A 5GJWC 2GJSA 1AGRA 1Y3AA 5D3MB 4JLKA 2ZRNA 4LBZA 4PHGA 4XVRA 2FN4A 4W5JA 4AY2A 5AUQA 3QF7A 3DM5A 4EQ6A 2DFKB 4KCGA 5DHAA 1KHTA 1NLFA 4DCSA 1P3JA 1SXJD 3W8RA 2KSQA 2WSSD 3MG9A 2J9RA 2GEUA 3A1SA 4Q1AA 4RD6A 1Z0DA 3U3RA 1DTSA 3ZS8A 1XPRA 3P27A 3UWKA 3OZXA 1SQ5A 4F4CA 3NWJA 4GMDA 4AD8A 3W3ZB 3KKQA 4GL2A 3MWJA 1PUJA 3EC2A 4HEJA 2QNRA 5SZIA 3VKWA 5H68A 2WTUA 2R62A 4AURA 4HAXA 1IAQA 4C9BA 4D0NA 5K8LA 1GWNA 4B2LA 4FN5A 1UKEA 1ESMA 1G19A 3CZPA 4OI0A 4DLSA 2ATXA 1ZD9A 2HF9A 4OK3A 3BORA 3GJ3A 4LWZA 4MRSA 3UKDA 4RKFA 2D2FA 1P62B 3AH8A 2V6IA 4S2EA 1N25A 2OXCA 1X86B 3FHOA 1U0HC 3L0PA 1UF9A 3K09A 2X19A 2DHRA 3CIOA 3WP0A 2VRWA 4N1AA 2J0UB 3WXMA 2SHKA 2W00A 3A1VA 4EKDA 2ZSFA 3C41J 1CJMA 1LW7A 2WKPA 4PZZA 4RKEA 3AM1A 4MH0R 5GJVC 2ZR9A 4QM6A 1P9NA 1Z22A 4D80A 4JVMA 3O8RA 2C9CA 2AWOA 4PFSA 5J47A 4TYQA 2FG5A 5H70A 3NHBA 4B2IA 2QI9C 1NBMD 4AKHA 4O25A 3C8UA 4MQBA 5JEEA 2HLDA 3K09C 3WYGA 2QRZA 1KOFA 5EJEA 2H16A 3HR8A 3PFIA 1XEWY 4C30A 3TQCA 2IK8A 2J0UA 3GJ0A 2VF7A 5FPTA 2HUPA 3LBHA 3BB3A 3U6BA 4WIAA 4OQLA 1XTQA 4LBWA 4PC6A 1YZQA 2PLFA 1YJ5A 4JYCA 1OE0A 4ARZB 3EPJA 2OLJA 1CF4A 1RZ3A 1VDZA 1DAKA 3VHXA 4UXIA 4LUCA 2BJVA 3DMDA 5GVRA 4OQNA 3TUJC 2H92A 2BM1A 2GILA 3FB4A 4EFNA 3H0KA 3D8BA 4OK5A 4RZ2A 2GXAA 3NIBA 5AJXA 1XEXB 5AJZA 1CP2A 3I8XA 3LX5A 3CR7A 4JL6A 2QT0A 5E3HA 2HF8A 2JA1A 2YC4C 4V0MA 3OEEA 3B7GA 4A2QA 4QJ3A 2ZI6A 2HJVA 4KHZA 1TU4A 1LV7A 2HDNB 1I4DD 3CPJB 1EFRD 2QN6A 4TMTA 2BV3A 2G1KA 2OSBA 3K0AA 4M1TA 1Q22A 1VG0B 4GMXA 4JLDA 4DLZA 4C2UA 2X77A 1ZD1A 4CYMA 1E99A 2PT5A 2JCSA 4OK6A 4XWAA 4BFZA 5TB5A 1E32A 3CPEA 4B3CA 2Q9AA 4OHXA 2ZQ5A 5DE3A 1DEKA 3K9HA 1E0AA 1YQTA 4AYWA 2F7SA 4M1WA 2PBRA 4BASA 2ZS7A 4FMCB 5EE5B 2VSOA 1OH6A 1EFUA 3JZAA 4ERNA 4E22A 4EPYA 3KTAB 3QOFA 5EZ5A 3VHLB 3M6AA 3DKVA 1LF0A 4KFSA 4PO8A 3SHFA 3CX6A 5FPHA 4KODA 1E0KA 4Q01A 1T0HB 2TMKA 2FA9A 4B47A 1P6XA 4MRVA 2YWHA 5HE9A 4UKDA 3CNLA 4A8JB 2GAOA 3NBZC 1UDXA 4Y0VA 5TY0A 1II8B 4V0LA 2J46A 3U7HB 1F2TB 1J7KA 3I92A 1AS2A 3IKJA 1U0LA 5HKKD 2B92A 4P3YA 3K0FA 3KTAA 1HH4A 2PLRA 3VR6A 1PV4A 2BMEA 3L0IB 4PPNA 4DLVA 5D3QA 1OPXA 2YVUA 1GOTA 5B58C 2HXSA 2REOA 3IIKA 4N0EA 4NYIQ 5E7MA 3LQQA 2O0KA 3THYB 4TL6A 4IJMA 2G88A 4MKHA 4EPVA 2OZEA 4DLWA 3KJGA 2NTYC 1GL6A 2ZRKA 2JIZA 4IFEA 5KO2A 4M1OA 2IYZA 3FFAA 3QG5A 2B21A 1DAIA 4MDFA 2KJQA 1F2TA 1KDOA 3WYAA 1UBCA 1G8YA 2BCJQ 3GEIA 2FGKA 2JJ1D 1G18A 3ASZA 3HU1A 3F5FA 3U7FB 3TLXA 4US0R 1N5JA 2RAPA 2PX3A 3R7WB 3VX3A 3RRMA 4M1KA 2J0SA 3PVSA 2WV9A 1JQLB 1LS6A 3QKTA 1OFUX 5EE0A 4JLPA 2VO1A 5BN4A 3MWLA 1CIPA 1KJWA 1JXMA 1Z2AA 2C99A 4M9QA 4HSEA 4MKGA 1Q3TA 1P60A 2C2HA 3KXLA 5CK4A 2QU8A 5EP4A 4OQMA 721PA 1Z06A 1SKQA 2QMUA 4PXAA 5ANRB 2J45A 3WRYC 3FHTA 1ZJ6A 4CEIB 1QHYA 1MO5A 5EXXA 4QGGA 3PG5A 1VG9B 1VIAA 3R7WA 3B13B 4XD7D 3TUIC 1HTWA 1XBTA 3RHFA 1H8EA 1R0XA 1KAOA 1P72A 4PHTA 4QBGB 4YDHB 4JIMA 2ZVPX 1H8HD 2XEXA 4HAYA 3FYHA 2GF0A 2XB2A 4RJLA 2CLDX 4G5QA 2RHMA 4TYPA 1FX0A 4EPWA 2BOVA 3PUWA 4B75A 2Z4RA 1G21E 1S9HA 3P4XA 3TUZC 4B6EA 4LHVA 1E79A 1UEJA 2ZAOA 5JLJA 3U44B 1BKDR 3QF4A 1JQJC 1NSTA 1XXHE 3W6NA 1GVNB 1R5NA 1NIPA 1JEDA 4B35A 1X8LA 2QROA 2P0EA 5IK2D 1G16A 2WAYA 5FFMA 3QKRB 4F4IA 4QC2A 1DO0A 1WB9A 1KY3A 3H4MA 3CBQA 4ZCMA 3JVUA 4NCNA 3BXZA 4P31A 2EU8A 2QMHA 2GXUA 4NYJR 1E9RA 1Q1BA 3IUYA 3EA0A 4IVRA 4M9SA 3IEVA 5F9FA 2L0XA 5DO9A 1DARA 1EX6A 2V7QA 5DH9A 1ZU4A 2ORWA 1KMHB 4GOKA 4MKIA 4MUAA 1Q3HA 4O3MA 4TLAA 2EVWX 3SEAA 4LJ9A 1KK2A 3U44A 4PPQA 2AFHE 2QP4A 2BWJA 1SZPA 2X2EA 1N6OA 2VHQA 3QKRA 3EX7C 4OYHA 2ZETA 1KO7A 1ZYUA 5EXPA 4AKIA 3FKSD 4Q7JB 4GOXA 2FH5B 3B1ZA 3TQFA 2JLVA 2JLYA 2V55B 2FZLA 2WWYA 5JI2E 1BH2A 1SXJC 4OHZA 3AVYA 4IDPA 4WZBE 5KU1A 3EWSA 3I32A 4IVPA 3W34A 3C14C 2Z83A 5FOWA 2CHVA 4XVQA 3GLIA 2O8EB 4DZZA 3AF3A 1JBKA 4BUJA 4QKQA 4R2HA 5G41A 2RHDA 3KDSE 2ZJ5A 4LRWA 2ZRFA 4NCIA 4NH0A 4CW7A 1A4RA 3R8FA 4QHTA 4JVLA 1XTRA 3IBGA 3QPUA 2ODNA 2IS6A 1D9ZA 2GZDA 1NBMA 1UBGA 3HYRA 3IBYA 4WZ6A 3CH5A 4AG6A 1PZNA 1W2HA 1NY5A 2NZ8A 3IIMA 3IQXA 3OF5A 2FJUA 3NH9A 2O8EA 2PZEA 1JR6A 2JLSA 1I2MA 1F60A 4II7A 4OHWA 4R9UC 5AJWA 1S8FA 4NP6A 5BN3A 3PUXA 1NJFA 4QNMA 3EZ7A 1RFLA 4YMUA 3GFTA 1OXXK 3K0CA 4GP7A 2PMDA 3ZQ6A 3KJIA 4MRPA 3CNOA 4Z1MD 4Q9LA 1Z6GA 5FUXA 5DI3B 1EG7A 3TAHA 4PAOA 1VPLA 2ZRJA 4JLBA 1M2OB 4XIGS 4MRNA 1P2SA 4FMDF 2YWGA 1QHXA 5DHFA 3NVAA 1W0JD 1XP8A 1KJYA 1MT0A 4RZ3A 5TV2A 3VR1A 4C7OA 2OLKA 3AP1A 2IYQA 1M1YE 4TYNA 2O0JA 4KFUA 1W44A 1SHKA 1SHZA 4ASUA 5L8VA 4XWKA 3K0CC 1EFRA 3GLHE 4NONA 4A6PA 2PCLA 1VCNA 2MSEB 3D7MA 4W5WA 2D7DA 3G82C 2DFNA 2W0SA 1G3UA 1U2RA 5KSPA 3RWOA 3B8HA 4CEHA 2X1VA 2YJTD 2GKSA 1NLZA 3LDAA 3FPAA 1W4AA 2PEYA 4IDOA 1XB2A 3W8NA 1G5TA 2ZUCA 4KYUA 4A2WA 4D4JA 1ZP6A 2NQ2C 2KBEA 2Z4SA 2B8WA 1JEEA 4ZI3A 2PCJA 3AF0A 1RIFA 4Q4LA 4PSKA 4DDVA 5CM9C 2VTKA 4JVNA 4UQOA 1GL7A 4I1OA 1UADA 1UAAA 4PAMA 3OAAD 1T6NA 2IUSA 1QBKC 1KGDA 1YHNA 1G41A 4M22A 4M4SA 3UK6A 3R9WA 1FMJA 3X1ZA 2CK3D 1IN8A 3IHWA 4JBWA 3SR0A 4HLQB 4Q7LA 5TDHA 3NDBB 2AKAB 3RWMB 3V4FA 3RS2A 5A0FA 1UJ2A 2NGRA 3NG1A 2WKQA 1ZM7A 1N6NA 1TU3A 3TVDA 2IS1A 1ZC3A 3PIRA 3QUSA 3SE0A 5DN6D 3J81k 2W83A 4ZDJA 1G7CA 5HKKA 1KO1A 2A5DA 1Z47A 1Q1EA 3UPUA 2IEZA 5LPNA 1TL7C 3B1WA 2QP9X 2ZJ2A 1OJLA 3T12A 2H7VA 4KU4A 3NEJA 2GXSA 1E9SA 5GJBA 1NRJB 1UFQA 4ESHA 2G1JA 1I4LD 3ZZTA 1R5BA 3QXJA 2UVQA 1E2KA 2J7KA 3FWYA 1S9DA 2UKDA 1J8YF 1MO3A 3CW2A 1CR2A 4PC3A 1XCMA 1Z6XA 1RRPA 4DB2A 1YRAA 2JJ1A 4GSYA 3B5JA 4WBSA 1KZ7B 4C3ZA 2GEDA 5F3WB 2ZRBA 5LB4A 3M4YA 1HUQA 5FL7D 2X8AA 4Q7KA 1KO5A 1TNDA 2FPKA 3EG5A 4G1UC 2GWHA 3KUDA 3A37A 1YZNA 4XSHA 4ZDKA 1QG2A 4LJ5A 3I1FA 1NMYA 4PAQA 4RD1A 4GRAA 3G0HA 1S2MA 4Q9HA 2OXRA 2JDID 5EE1A 3A4LA 2O8DA 1NSFA 2WJGA 4PZLA 2JASA 2OCYC 4LBYA 3TKLA 4B71A 2ZJAA 3QY0A 1BYIA 1GIAA 1CRPA 4ZIRA 3QXCA 3FMPB 2P5SA 4Q00A 2GA8A 2JJ2D 3QPWA 2IW3A 3AGPA 2DY1A 1PLJA 3ECCA 1P2VA 1MV5A 4C4PA 4RVCA 1GNPA 2JLWA 3N2EA 1H8HA 2Q3FA 1GM5A 4WXPA 2R6FA 2BEJA 1YZTA 2FV8A 2GJ8A 1ZCAA 4P0TA 2WM9B 4BQSA 3G5UA 4DLRA 2CBZA 1IHUA 5FTKA 3QNUA 4MYUA 3TIFA 1E94E 1KSJA 3MCAA 5TVKA 2AL7A 3QKUA 5JRZA 5CDFE 4AC9A 1FUUA 1Z6YA 2G6BA 4WZAE 1MRNA 4GPTA 3U5ZB 2QAGA 2WSMA 5IK2A 5FBQB 2P6RA 4BFUA 5JWOA 1IXRC 4KVAA 2NIPA 2ZE7A 4HB0A 2R44A 4F4JA 1OKKD 1WXQA 1E3MA 2ZRLA 3IDQA 4DB4A 3NHAA 1G291 2JLRA 5KYKA 1K5DA 1US8B 4MGZR 1IJEA 1E1QA 1FP6A 1KJZA 1A7JA 1BS1A 1KTVA 1GP2A 4L15A 5CYOA 4IKEA 1CR0A 1E1RD 5JSZB 3PQCA 2QAGC 3KJHA 4LYAA 3GLHB 3K70D 1H65A 2QT1A 5IRCD 3WYFA 2CL6X 4I1VA 4A6XA 5FUWA 3FKSA 2ZEJA 2BHRA 1W46A 3ADKA 3GJ5A 4BLSA 5C4MA 1R6BX 3K9LA 4D82A 2J7PD 1US8A 4LJ8A 2ZE8A 1G8GA 2IS4A 4YC7A 2GK7A 2IXGA 3AV0B 3EIHA 3X2SA 1LS1A 3LLMA 1OB2A 3MWYW 5JSZA 2DWQA 3A6PC 5EXTA 3QIAA 5HTKA 3WMEA 3W6PA 4BZXA 1FPMA 1DADA 1SKYE 3WNCA 2FSIA 3IPYA 3LY5A 2DBYA 1GITA 3KKMA 1HT1E 1JR3D 3Q7QA 4UNRA 4GZLA 5CB6A 5CIQA 3ZVNA 1IOZA 3NTUA 4P4TA 5G40A 1XRJA 4MITA 5J5CA 3S1AB 1XCPA 4XSGA 4M1SA 2FPMA 2WMNB 1XDBA 5FPYA 1N5LA 4Q9KA 1G3MA 3VMFA 1FTNA 3H86A 4LI0A 4YQFA 2GAAA 1MABB 1G4AE 1RJ9B 4NMMA 4UXJA 4HDOB 4TTQA 5HCIA 2RGCA 4D2IA 2FSHA 4YMVA 3OIVA 2OO7A 2GZHA 1COWD 2RGXA 4P4SA 4A0RA 2EWVA 2YC2C 3DO6A 2ERXA 3I3SR 4Z1MA 2R6CA 3LFUA 5JCPA 1D2NA 4POAA 4KSCA 3IGFA 4IVQA 4DXAA 2ONKA 3S1AA 2OM2A 4BRUA 1S0UA 2CNWD 2HJGA 2ZJOA 2ZITA 2REBA 4RSGA 4XVUA 1EESA 1WA5A 4TMWA 3U60B 2ZSEA 1UM8A 1RYHA 4F7WA 2GHIA 2XTNA 3HU2A 1MABA 1KIMA 2D4HA 1RJ9A 1W0JA 3EC1A 2ZRAA 3AQ4A 5E4FA 1E2HA 4KSBA 1OXUA 3R9XA 5FI1B 3Q72A 4Z51A 1Q57A 2YOHA 2ZUBA 5AK0A 1NVVR 3QE0A 1AKEA 3AKEA 1YR9A 3ZD6A 1HQCA 1NMXA 2FWRA 2FEOA 4FWIB 4B34A 1OH5A 4LHXA 1FQJA 2VP0A 4PANA 1F48A 4BLPA 2QA5A 1R0YA 3ADBA 3DVLA 4KLNA 4TLEA 3UG7A 5HZHA 5J4HA 4JZKA 2W2XA 1QHSA 2XSZD 4NYJQ 2PZFA 3B82A 1R8QA 3RNLA 2W2VA 4FWTA 4L16A 1GKUB 3MSXA 3KQHA 1KKMA 2WAXA 4LDJA 2XGJA 2ZSAA 5FOUA 3UMSA 1NL3A 3W5IA 2AFIE 3Q3JB 521PA 2V54A 3CH4B 3DOEA 1EK0A 2XX3A 4DUGA 1VHLA 1HY3A 1F3OA 3AVXA 2WHXA 4FMBB 2D3WA 5EXSA 1LNZA 3I61A 2VEDA 1G3IA 4PR0A 1A1VA 4ZPXA 5KNDA 4WXRA 4C0BA 5C18A 1E2NA 2QZ4A 3E5HA 1NKSA 4TTPA 4EFMA 5G3YA 4ZDIA 2CK3A 1XWIA 1KK3A 4TLCA 4QNRA 2D7CA 1XJCA 1XD8A 2CCGA 1MO4A 1OT3A 1G64A 1ZNYA 2GEVA 4TTRA 5SZJA 4TMKA 2IXFA 1KZGB 2NPIA 2EFDB 3ZVRA 4K81B 4F91B 3FE2A 5JRJA 5DNYB 2CEAA 5DN6A 3DM9B 5DISB 1YZKA 1CLUA 1GUAA 1U94A 3QG1A 2IUUA 3K1JA 4NHOA 3SS8A 1IJFA 1P61B 1SXJE 2ZANA 3EIQA 1ZCBA 3ND8A 1GKYA 4HUQB 1TF5A 4B3GA 3TSZA 3MWKA 3SYKA 4AK9A 1CXZA 2VBCA 3L0SA 3WMGA 1XMJA 2REXB 2CCKA 4Z54A 1BOFA 3GPLA 3K0AB 1PUIA 4PPFA 2GZAA 5KSOA 3B1VA 2B7BA 3BIFA 2XOKD 2VP4A 2JLZA 1XEWX 4FCVA 1LY1A 2HYDA 2A9KA 2NPFA 5CDFA 3U2QA 2AWNA 4GFDA 1E2QA 1KSFX 4US2R 3VR5A 3QSYA 3HYTA 1OYYA 4D6PA 2MMGA 1XTKA 1X8KA 2CMKA 4HAWA 3SJCA 2BIFA 5FL7A 1L8QA 3GLIE 3OIUA 5KUTA 2CDNA 4HUQA 4C0SA 4PHFA 3X1WA 2JLXA 1CKEA 3FMOB 4QHYA 5BXQC 2C5LA 5BWMA 3A4NA 3R8CA 4ACAA 5K8UA 1NKTA 2B6HA 2EYQA 5KDLA 2JDIA 3HPQA 3U3MA 2GDJA 1E4YA 2YNMA 4DSNA 1TEVA 2GTPA 2W6ID 1NNEA 1NN5A 1VCMA 4C0JA 3TMKA 5IT5A 1OFTA 1NBME 4FIDA 1AS0A 1U98A 3P4YA 2JJ2A 1Z0AA 4TT3D 3WNBA 4DSOA 5KHOC 4IOLA 1IXZA 2R6DA 4IXMA 4JLAA 1SKYB 2B7CA 3T1QA 1E2EA 3ZZ0A 4BLTA 5SZHB 1CJTC 2J5XA 3RS3A 2XTMA 4BGDA 4URZR 4D4MA 3VR4A 1MH1A 2PX0A 1G7TA 2ZM5A 3FOZA 1ZBDA 3K0FB 2A78A 2G83A 2C77A 3I5XA 4IXNA 1YKSA 1EFTA 2RKOA 1IQPA 4IW3B 5CK5A 3V4RA 1UKYA 1CJUC 4QBHA 3SN6A 3WHKA 4Q1BA 1TAGA 1J8MF 2VSFA 3L8YA 5GVSA 4IDQA 1G8PA 2DYKA 2HCBA 5B2ZA 4LYFA 4TN1A 1A5TA 3DEFA 1E69A 1NVWQ 4Q1CA 3RS4A 5BYKA 2QSZA 3DPUA 4UNQA 2WJVA 4LK2A 3TNFA 1ZIPA 2XZLA 5UKDA 2GCOA 421PA 1GSIA 2NMVA 1UPTA 3AKCA 3BS4A 1Z0IA 1OKKA 2VPPA 1R10A 4PHHA 2A5YB 1NIJA 3CRVA 5A5GA 5AJYA 2FSFA 2Z0MA 4FMCF 4MGIR 2YV5A 1E9FA 4BFWA 3CKLA 2C98A 2IYLD 4NL4H 4R71A 3KB2A 3REFA 2NO7A 3AVOA 1R7RA 1E1RA 2XNSA 1ZM9A 3LAWA 4DLTA 2GF9A 2V9PA 1SVSA 4LCBA 4BPBA 1ZM3A 2AR7A 3NXSA 3ASYA 4A1FA 3M1IA 4M1YA 4U00A 2QTHA 2O0HA 2XNDD 4US1R 2MSDB 3GFOA 4CF7A 2IBMA 4S35A 3T34A 2QGNA 3AB3A 4TYWA 4ZKEA 2J7PA 2F1RA 2WPDD 3LO5A 3F3YA 2V3CC 1RW4A 5DYIA 3B2EA 4MDEA 3MJHA 3H1TA 1TUIA 4OQFA 1ESNA 1UDWA 4BE7B 3CF2A 3BFVA 4QGAA 1N6LA 1U0JA 2FSGA 2VP6A 3O8BA 4LV8B 4M2LA 3KXKA 1KDTA 3K70C 2ZUDA 2D74A 4P32A 2IL1A 4B74A 1FX0B 1CRQA 2VLIA 3T61A 1X1RA 3BH0A 3GJ4A 1BMFD 4QRHA 2GNOA 2ECKA 2R6GA 3Q85A 1NF3A 1ZM2A 3CF6R 1JR3A 4TL9A 1OSNA 1Z63A 3AKDA 4IRUB 4MUBA 2QP3A 2XJ9A 3QF4B 4KYIB 4C0HA 2YKGA 1R2QA 2NG1A 2OCPA 2BKEA 1T3SA 3P20A 1D8TA 1GNQA 3CR8A 1N5KA 2A30A 2FDCA 3BGWA 3VNUA 3LXRA 2F1IA 2ZS8A 4G3XA 5AR1A 1T9HA 3BFKA 2WWXA 2WJYA 1WCV1 3KX2A 2H8KA 1T8TA 1SXJB 4G01B 3M0EA 4LPKA 2WWIA 3GCGA 1C4OA 4Q4AB 3MUFA 3MRSA 5FUVA 5C46F 1DAEA 1Z07A 2G77B 1BYUA 4W7SA 4TMVA 4TQ9A 3RVBA 1IN7A 4F92B 4M8NE 1Z3IX 3PR1A 4W9MC 2O8FA 2FNAA 3F8TA 1QG4A 1JB1A 3T5DA 4DCUA 4NE2A 2ZR0A 3U7EB 2Q21A 5GADl 1Z08A 1S1MA 3QEJA 4TLDA 1ZUNB 3LBNA 2KWIA 5CYPA 2BBOA 3MLEA 1KKLA 1SXJA 5KSYA 2OFWA 2WSSA 4Q4AA 4Z8XA 3GLIB 1M6NA 1U8YA 3KZ1E 3PUYA 4D4LA 3FDIA 3VU9A 4TWZA 4I4LA 4J0QA 3N5CA 4A82A 5J4YA 3NC1C 4A36A 1IM2A 2AD5A 3RC8A 2XSZA 4ZCLA 3OFND 1G5PA 1KK1A 4XTRA 2ZIAA 2C9YA 2R2AA 2GK6A 1FW6A 1G3QA 2HV8A 4RFSB 4YDSA 1G7RA 4TMXA 4Q9IA 4BECA 4PZYA 2J3EA 3ADDA 1NJGA 2UZ3A 1X3SA 3L8ZA 3WP1B 1XD9A 2EW1A 5DIFA 5KPDA 3FVQA 4DIDA 2OT3B 3SBDA 1KO4A 1RVDA 1CJVC 4CRWB 2BM0A 1N6PA 5CLLA 1YZLA 3THXB 2OAQ1 4C0AC 4BEBA 1SVWA 4MGYR 4RFSA 1UKVY 3LLUA 1CS4C 1EWRA 1NG1A 2E9SA 4I81A 5FBLB 1W36D 1P2UA 2Q9CA 2ZSBA 1XFAA 1KY2A 3JZMA 1PLLA 2FEMA 5DLQC 5J40A 2QTVB 3K8YA 2VHCA 4OJKA 3EPHA 2J87A 3B9PA 1B23P 2W2TA 2P67A 4C7OB 1YR6A 2ZAMA 2HYIC 3AF1A 3KQUA 4DIEA 4DBLC 4CEJA 3BD9A 4D25A 2ZE5A 2OFOA 3A1UA 2VQSA 4LYHA 4A15A 3THXA 2C8VA 1FTSA 3A36A 3ZJYA 4NDZA 2F1JA 1VCIA 2YWEA 1X1SA 2P65A 2XOKA 2YOGA 3QBVA 3W3AA 1P5ZB 2EFCB 4CEHB 2OILA 2PJRA 1MO6A 1Z8FA 2ZYWX 3K9GA 4PSVA 3GLGE 4QBIA 3WBKA 1D6JA 3PITA 1NP6A 3DL0A 2C03A 5DGXA 2OBNA 1ZC4A 2FZ4A 4DCVA 4EUNA 1EGAA 4LZZA 2AN9A 3ZIAD 3CX8A 5FI0B 2BKUA 2O8BB 4YMSA 3MMPA 3RS5A 1L7VC 1I2DA 5HR5A 3TR0A 1U81A 1EWQA 1P4SA 1CEEA 4EPXA 2Q0HA 3I72A 2GBLA 4KBGA 3E70C 4O2RA 1QHHB 4XTCS 4URVR 3PUZA 2XITA 2EFEB 2GETA 3TAUA 1MRSA 1NVVQ 1T91A 2MMCA 3VAAA 4TT3A 1IY0A 3OE7D 1GZSA 1Y63A 3W5JA 2VHUA 4QFMA 4E03A 4RD3A 3X1YA 3KFXA 3LA6A 2NZJA 1OV4A 1RYFA 2O8BA 5H1YA 1TADA 4LY6A 1EX7A 4Q1DA 2GBLC 4LV6A 1XTIA 1HURA 4EPTA 2DB3A 3P32A 1QHHA 1HT2E 2FFAA 4RZXA 2IF0A 1G5RA 3IO5A 1WBBA 1R0WA 4NYMR 5DSZA 4HLCA 2RGDA 4M0LA 3A8TA 2D62A 4HZUA 4C0KA 1XTSA 3MFYA 4H9GA 1U99A 5TMPA 3TH5A 1W48A 5JZVA 4K8OA 4JKIA 1DAHA 5FTJA 3T06B 1LTQA 2O8CA 2IWRA 1L2TA 1W5SA 2XB4A 4DLUA 2CHQA 3BB4A 3AP2A 3ICEA 1ZIOA 4XJXA 3QKSB 4AG5A 3GJ7A 4HB3A 2EQBA 1E2PA 4JSTA 3REGA 4D4KA 3AVVA 4LC1A 4BEJA 1KNQA 4KI0A 1T0JB 3RSOA 2ZYVX 1RPZA 3I73A 1XPUA 5AUOB 5HPYB 2AD1A 2XTZA 3MD0A 5JHGB 2O8DB 5BW8A 3T1VA 1RE0A 1P7CA 3LVQE 2XNDA 3LD9A 1AN0A 1PJRA 3BE4A 4ZIRB 2ODWA 2VSXA 3DZDA 4PQFA 1TQDA 4R98A 4MYHA 3QKSA 3GLFA 2RGAA 2WPDA 1Q0UA 3IILA 4PSAA 2IYXA 5JI3E 3CRMA 1NVXQ 4QG7A 1OFIA 4Q7MB 5FBVB 4Q21A 3ICQB 4Q1EA 3O8DA 3EPKA 5JBQA 4QOSA 1GNRA 2CE7A 2P5TB 2K5UA 1FNMA 1XCGB 1Z6TA 4AIIA 5JJKA 3B60A 1DBSA 4B3FX 2ODEA 4LJ7A 2C96A 2JGNA 3AVWA 2QPTA 1Z2CA 3EA5A 2OBLA 1HV8A 3I62A 1BMFA 2Z6VA 2ZRHA 3A1TA 4NU0A 8OHMA 3PEWA 1QRAA 1W0KD 1HYQA 3CLVA 1SVMA 4BLQA 2ZRCA 5EP2A 1TEXA 4RCZA 4TQUS 4D26A 3OEED 4XD7A 3DHWC 2G9NA 3RS0A 5K8IA 4BFXA 2QAGB 4F38A 3VKHA 3IO3A 4QJ4A 3PXGA 1VYVA 3RRNA 4JBXA 3X1DA 3T5GA 5L3QB 2F55A 1FMLA 3BH7A 3K0EA 2DR3A 1XEFA 2FPLA 4LPSA 1E4VA 4DEXA 3FMIA 1P9RA 3L43A 2YHSA 1N5IA 3EZFA 4AWXA 4EPRA 2OG2A 4FD2A 5ELXA 1OB5A 1E96A 1QHNA 2HCJB 5CM8B 1VECA 3GJ8A 2CLSA 3FHCB 4JLOA 4BFVA 3AGQA 5FH9A 4B48A 5KTYA 3TSOA 1DVRA 1A2KC 1LFDB 1TF2A 4B33A 5FUYA 2ZRPA 5L3QA 2FFQA 1W4CA 2R8RA 4ILEA 3RABA 5FBWB 3NBFA 3OEHD 5EQTA 3GLGB 2RGEA 1OIXA 1WMSA 3AVPA 4Q47A 1XMVA 2ZR7A 2ONJA 1XMIA 1KMQA 4Q02A 2OE2A 3BK7A 3SC3A 4X8HA 2WMOB 4GT1A 2JATA 4JKYA 4OHVA 3O47A 3SNHA 3OFNA 5FL3A 2HXYA 1S1CA 1Q21A 1JPNA 1L4UA 2RGNA 1GFIA 1S4QA 2WJIA 4XWOA 3EW9A 2OUKA 4UJ5A 4KFRA 1R8SA 4LHZA 4HLDA 1XNJA 1IN6A 4QJ5A 2CHGA 5KNBA 2ZI5A 2F3TA 4X8MA 3GLGA 2FFBA 4C0LA 1Q12A 2Q9BA 2F3RA 2QPAA 1U9IA 1DELA 1LF5A 2JEOA 1YU9A 2WWHA 1DPFA 4OI2A 5KSZA 1TPZA 2RGGA 3TR5A 2V1UA 4D0LB 1W7AA 2RGNC 5JFGA 2WOOA 3THOA 3FMFA 5LD2C 3H2YA 1WDTA 4RFVA 4P4SB 4UNPA 1NY6A 1P75A 3AKYA 4X8OA 4ZO4A 5AJVB 1A2BA 2F43B 2ZU0C 2ATVA 3RSLA 5CLQA 3ZGXA 4TSFD 1J70A 5JHHB 1U9IC 2WBLC 4A2PA 3WMFA 1JALA 4LGMA 1SGWA 2LKDA 1Z0JA 1JXOA 2JLUA 2VL7A 1GDDA 2FGJA 5H8WA 2A5JA 3KUCA 2Y8EA 621PA 2FF7A 4BWYA 5KNCA 1E0SA 2V4ZA 2WIBA 1G8FA 2QUZA 1T3LA 2V8OA 3QVUA 5CB8A 2F43A 1W36C 1GKIA 1HE1C 2ZU6A 1G1MA 1E2GA 2I1VB 1DOAA 3T15A 4TQAA 4YXWD 4R7ZA 1W2GA 3UXMA 4PC1A 3SQXA 1K8RA 1JJ7A 5J4KA 4TYYA 2AXNA 4I1SA 4GOJA 3GQBA 2QMEA 4HLUC 4DRZA 2UZIR 4LJAA 3ZIAA 1TMKA 3E1SA 2ZJ8A 4IDHA 1CTQA 1G20E 1NN1A 3RRYA 3ZZUA 2ZPTX 4WW0A 1NLYA 3AEZA 2IYWA 1Q1ZA 1C9KA 1G17A 4L4UA 3ZDQA 4AYTA 2VP5A 3VTKA 1JR3E 4L9WA 5KOYA 2R9VA 4P33A 3V9PA 1SVKA 4Q1FA 2QE7D 1ZINA 3Q5DA 1N6KA 4LJYA 3NBXX 2PH1A 1ZW6A 3OE7A 4R2IA 2QMOA 2BJWA
chains in the Genus database with same CATH superfamily
4AICA 1T5DX 5KTNA 5LLDA 4FNAA 2HU7A 2SECE 8ABPA 2AEMA 1Z2PX 2X9GA 4HAZA 3EMDA 1YXMA 2VXYA 4HYYA 1KFJB 3TLJA 1DXOA 2D0DA 2ARKA 3DXYA 3KKOA 3W90A 4PG7A 2YWDA 1Z56C 4P08A 5F98A 3OAAA 5L3VA 3B9QA 1E66A 5D86A 2GCNA 4MHSA 3TLMA 4FCWA 2NO6A 3N75A 3Q40A 3S70A 3U61B 5K8VA 2Q5QA 1GTSA 4NPCA 1RI4A 3H75A 4ZCQA 3R0IA 2IV2X 1GN8A 2FE4A 2NO4A 4BUCA 3U7GA 1V6CA 3JAKB 1DP4A 1WXGA 1AZTA 4UEQA 2I4IA 2RHWA 3PGVA 2O1WA 5BPFA 5JSUA 2XH8A 4E15A 2VH1A 3C1OA 4IIFA 3WIEA 1SCUA 1X8XA 2OV2A 3F6CA 2Z5LA 4O5AA 1SVLA 4G5RA 5AVVA 2DFVA 2CVHA 2QE6A 4GECA 1F2VA 4WESB 4V0OA 5G1PA 1CVIA 4CMJA 5FAKA 3AP3A 5CIWA 5KDDA 4M0EA 4D6YA 4HDCA 2AX4A 3NAMA 5JZMA 3FA2A 4WV3A 4JELA 2H51A 1OXSC 5AVTA 1CR6A 3RU9A 3TSWA 5BY2A 1XUOA 2NU6A 4J1QA 4JWKA 4EGAA 1P31A 4I3GA 2I8AA 5EP1A 1Y1QA 1NVTA 1SIOA 3TXYA 3OM8A 5CIYA 1QYVA 4IXDA 4EJ2A 2E7ZA 2OV3A 2ZS9A 4JYMA 1CIJA 2ZIVB 3QNMA 1L4FA 5L7WA 3DEYX 4IIXA 2VRNA 1I3CA 5EUQB 3U81A 4MWGA 4ES6A 1DBIA 3PJRA 1IPHA 1MGOA 3KT0A 4TRMA 3WVNA 1WETA 1IH8A 3CRW1 3V8MA 4KV9A 1CDZA 1G8KA 2CJWA 2W0MA 5B1DA 3EXAA 3SXPA 3ZHCA 1IBMB 2FDXA 3JAMA 5I6DA 1PGQA 2YXPX 5BRJA 3MCUA 2P77A 1SVOA 2WZQA 3IXQA 3PEVA 3D6HA 4R8VA 1TZCA 3RVLA 3F7TA 1TQ6A 3GMTA 1XN1A 2HLNA 4MGKR 3RNOA 4DC1A 1MQ9A 1J0EA 4E2ZA 1TUEA 2GO7A 2PS9A 5TPZD 2RH5A 4HEHA 4B79A 1B3BA 3A9VA 1W0KA 5LSAA 1GZ7A 4M0UA 3STXA 2ZI4A 2NZVG 3WYDA 4Z1OA 1ZNXA 1KDYA 1EIWA 1O2DA 4YJ2B 1TCUA 2MT9A 1EVLA 2W71A 4ASUD 4CMKA 2X5KO 3RTEA 4ARZA 1SCIA 1WRBA 4CQMA 2GCOB 3KO8A 1JDVA 3IC5A 2QR2A 5DTEA 2IDJA 3IB6A 4DC9A 5HJ7A 4UW9A 2Q5IA 4H3VA 4L4ZA 4GVPA 1HR0B 1E77A 1D2EA 1Q44A 4LZLA 1XZHA 3BOSA 5ED0A 5K05A 4XZ3A 3RRXA 2AK2A 2NV0A 1A71A 3UXHA 1KWKA 3KCQA 4OGFA 4RTLA 2X5JO 4OGLA 2C7VA 5T5QA 3BHNA 3VDQA 1LVGA 1DX6A 1DAMA 1GNTA 3QUCA 5IN5A 1M7BA 1XMOB 3WLMA 2P35A 2P1DA 3N28A 2DTDA 3T3EA 3E3MA 4WAUA 3CWZA 3ESZA 1DC3A 5C1DA 2EF0A 1Z15A 2IDKA 4CF4A 1W1WA 2JJ8A 5LBIA 1UBEA 5EE9A 1M0SA 2L19A 3JV7A 4IH9A 4N4AA 5HQJA 3RADC 1A9YA 2JHFA 3N0VA 4LZJA 4ZVKA 3EQ9A 4DSUA 1I36A 4H1VA 4X8LA 1BGVA 5EWJA 4CODB 3ZDDA 1QVRA 1TPYA 4FJ0A 1D03A 2VNIA 3S99A 4BVGA 1SU8A 3DO5A 4DNPA 5JMTA 3U1TA 3EW7A 4WJLA 4OV6B 1J8DA 4FIZA 3CB4A 1HE5A 1EGHA 2AKEA 1OBCA 3LVRE 2WWRA 4P38A 2H8GA 4JS0A 3U7JA 4PN7A 1WF3A 1FYEA 1GGJA 2QUJA 1R12A 3CH7A 1O4VA 1VCOA 3D64A 5KOJA 2RB4A 1A9TA 3TZLA 4WCVA 5IVDA 3NWOA 3PWSA 1G4UR 1CULC 4Q4JB 4NZYA 5C4IA 4QDUA 5LQKA 1XLVA 1UL1X 3GRPA 5KKAA 1KI6B 2ZRGA 5LP1A 3HEMA 3MHTA 2JF0A 2NXJA 3FRJA 3LW8A 3DKRA 5L3ZA 2PZJA 3DTVD 4L8VA 2B4AA 2Z8YA 1RWNA 4REQB 1YB4A 2PH7A 2PO7A 3KR9A 5HZKA 1II8A 1IBSA 3N9IA 3RV4A 5BSUA 3MQ2A 4PC2A 1T5IA 5GIPE 3KQNA 4PYMA 1XD2A 1EVJA 4YTEA 1XROA 2PK3A 4OSPA 4EF4A 4TXLA 2OCBA 4OSOA 1GL3A 3GJ6A 1TC2A 4PAGA 1USIA 3EZ6A 3ROFA 3W1EA 4LXHA 3A9UA 4B85A 3H11B 2KE5A 4MYTA 2QZ9A 3BGDA 3CM0A 1R0LA 4YECA 5F9MA 3UJAA 3QU7A 3THYA 1UXIA 3LGXA 2EDAA 1V9CA 4DT1A 3K9QO 1EGMB 1M1NB 3L18A 1OA0A 3DAOA 3MWFA 2ANCA 4GM1A 4A8JC 1K63A 4OI1A 1VC2A 2O8FB 5AHRA 1OW3B 3L1JA 4MIOA 2PX2A 3VJRA 5EIFA 2GBIA 4CFSA 1A88A 1T5OA 3KKNA 1THZA 1ZICA 5FUQA 2JGKA 3F0TA 1U1FA 3H9EO 4CE6A 2HBRA 5IHPA 4X65B 4MDHA 3KKZA 4NOJA 4XPIB 5KIAA 4E70A 1COWA 5LKAA 2H3EA 5J2TB 2OV6A 5FWYB 1NW5A 3BERA 3AVTA 2OFXA 1Z5ZA 5I9IA 5JVDF 2EQAA 4Q3OA 2FI1A 2JFHA 2DFTA 2YTZA 1DUVG 2QTZA 3GFQA 3GL9A 3O21A 4NI5A 2CNWA 1IAVA 2LXNA 1GT6A 1U0EA 4HB4A 3TB6A 5IAEA 1LTKA 2DZDA 2CJFA 2WSYB 4JLJA 4C5BA 2P6UA 4C76A 4EGFA 4F04A 3RGWS 1WEKA 1Z9BA 3OSZA 4A10A 4MNTA 1U0SY 4P92A 2NUTA 4B81A 4E2FA 3CIFA 5CBPA 5JSZA 1V5FA 2YZGA 1HT3A 2HN9A 3QQ5A 1T9GR 3JRWA 5E8JA 5IDVA 1RRGA 4CEIA 2QRQA 1M3SA 3RAEC 4QRDA 4O0MA 1OYWA 2Q07A 4OL0A 4TL7A 4CEJB 2ZBEA 3FWZA 1JPJA 1LB1B 4A0FA 3DQQA 3LQ1A 3TQTA 2YIDA 3B48A 2NN3C 2IXTA 1OLUA 4WFKA 5IARA 2I4RA 1QH0A 1AB6A 2QM7A 1ISPA 2WMDA 2VYFA 1U9CA 3PC8A 2NU7B 1R0ZA 2QE7A 1IMOA 1IB0A 1NMQA 1W8IA 3NDPA 3P9SA 1GQFA 5AHXA 2VIIA 4DSTA 1KF0A 4EB6B 2OHFA 4KO8A 4OREX 3HGMA 3C3EA 4M6WA 4Y0AA 1UPAA 4CT5A 4N0QA 2XUGA 2Z2JA 1Z28A 3CINA 2HHJA 1NKVA 5HDBB 3TZCA 3HN6A 1TD9A 4MV3A 5DNWA 1A96A 3K8ZA 3UO8B 1X2BA 4P0QB 1AJEA 1GAJA 2XUAA 3E7FA 3N0XA 4MQ6A 1REQA 5K3EA 3IXLA 3AR7A 5EZ6B 3CEHA 4UBNA 2JGIA 2GRJA 2H48A 4JUFA 4CUJA 1KETA 3IKTA 3JAWA 3THWA 4Q7EA 4HT3B 3F4LA 1Q14A 1RZVA 4IDNA 4AP9A 3RFUA 1IVNA 1ZOPA 1N8KA 4GR9A 2ZJ0A 1DIRA 5I7VA 1A69A 2E1RA 1NN3A 3DL2A 1WNTA 2ZTLA 4H27A 2A84A 1TQ2A 4GP6A 4MVXA 3E82A 4N7JA 5DLYA 4NNPA 1Q0PA 1QIFA 4U9IS 3ETEA 5TT0A 1JKXA 1DI0A 5FFFA 3REQB 2J9YB 3Q7TA 3TOCA 1EAMA 1HE8B 1M73E 2Z57A 3EGXB 1JDUA 3KXIA 1RYMA 4IDAA 2QRNA 3C15C 1V0JA 2ZATA 5FI5A 1KYQA 3LPDA 4QQRA 4GM4A 1FRVA 1CNFA 3KIPA 4RY2A 4DDTA 3G9XA 1SULA 4JLSA 3COVA 3I9LA 3C24A 3OWHA 3VNQA 1NXPA 3GGOA 3BICA 2P0AA 3LC2O 3OT1B 1TO6A 4Y1EA 3V00A 1QFJA 3LXXA 2WAOA 2HEIA 2YY7A 4CMCA 2BMDA 4JENA 1EM8B 1NW8A 4PLZA 3JZDA 5HCNA 5D87A 1UKBA 1XQVA 2AW5A 4HXGA 4QLOA 3R7AA 2HWWA 5KTOA 2ZTSA 1EX1A 2YJZA 4URXR 2RHTA 3PE6A 4YYZA 2IH2A 2K6GA 1ZD2P 4PX3A 1U2GC 5K99A 4RM3A 2FZWA 2Y4OA 1P80A 4CGZA 2O52A 4QXAA 2Q29A 1G5IA 4Q37A 1NOIA 1W4RA 1N6HA 4NZ9A 4EB3A 1AN9A 1ENPA 4ONEA 4JT2A 2YV2A 4ZZ2A 1PE0A 4H7HA 5G3ZA 1DOHA 4E5VA 3I8SA 5IAOA 2J59A 3BAFA 3QVVA 1P45A 5E95A 1M8GA 1A2QA 2AMFA 4L72A 1UMBA 3JATA 3R2JA 2JJQA 2YUIA 4Q19A 2OKGA 3TE6A 3RHZA 5IFLA 2A35A 1HSOA 2HMYB 2X0DA 1E9BA 1VYHA 1OX6A 4JYBA 1QVZA 3VUFA 1CEXA 4RADA 4C88A 3MGCA 1CQZA 2R96A 2GYWA 3C97A 3FUXA 3IURA 4ND3A 4TLBA 5DCUA 5JJLA 3MVEA 1GFWA 3DYBA 4XH9B 5ALHA 4XB2A 2JH9A 1KJQA 3QYJA 4XAQA 1LPPA 3WK8A 3IBSA 3PKJA 1KEZA 4AULA 5F2EA 2KPOA 2G71A 1C8VB 3TFQA 4CTMA 1OFHA 1O6CA 3RRJA 4HZUB 1O9BA 2FQYA 3DDCA 4PO3X 1YI8A 4HNTA 3V2GA 1FJXA 1M8KA 2X4IA 1QCYA 2VCYA 4O4JB 4C4AA 5IUJC 1T36A 3RLFA 3FBWA 1CUBA 1M8FA 2ZI3A 3BL5A 2J09A 4MXDA 4XCVA 5D8DA 4HDSA 1B6TA 1DAFA 1EP9A 4EITA 4MLDA 1MXFA 5DB4A 5JMPA 4OKSA 1EAYA 5JQWA 1OWPA 5DI3A 2AYXA 2JLAA 2Y9MB 4FDLA 1W49A 2QXUA 4GXQA 1Q19A 5EHXA 5L3SA 1S2LA 3SIPA 2H31A 1WUTA 4J7AA 3DCJA 2G4LA 4TXHA 5FIUA 1ZD8A 2H5EA 2JLCA 1OXTA 3DBHA 3RFTA 2V5UA 1J5EB 5JZ9A 5K6TA 5SYNA 1RQ7A 3RYCA 2IUTA 3EXHA 1DWUA 5AVSA 1F6BA 3D6TB 2G0TA 3ZTWA 4DUGD 2GQ0A 3WBJA 1IUPA 1JJIA 1JNYA 1CNEA 1KNXA 2PTGA 2PSJA 4Q4HA 4PX2A 4ZYZA 3TTXA 5HIJA 1PUXA 1KU6A 2XXBA 4D92A 2AQKA 1N9GB 1UEIA 3I5YA 1UXHA 2DBZA 3TR6A 3ADOA 3BWDD 3S55A 1UJ6A 1YQGA 2I54A 4UNNA 1DBPA 3OKCA 4KTTE 3DTVB 2QENA 3T35A 3GLRA 4AXXA 1PAUA 4YX9A 4OU5A 1HDEA 4GRDA 1DE0A 5SY9A 4BV2A 5K3CA 4DWJA 4RZUA 4YALA 1YNSA 5HFJA 3WV4A 4N5LA 3Q5GA 3JQFC 1T5LA 2HLDD 3CEPB 1PEYA 1MA0A 2QX8A 4NS4A 4LJKA 5ULLA 1DBVO 4PBRA 1QFYA 1ORDA 5KHLB 3GDHA 1GRVA 4LOAA 3R5JA 1ZA1A 1PG2A 2CLHB 3P96A 4FFOA 4BX8A 4N48A 5IVPA 3QJ5A 2VCHA 2G7ZA 3ZWXA 2R6HA 1MVOA 3EDRA 2FKAA 2YWCA 4N3NA 4B3BA 1VRCA 1MW9X 1UZNA 1NHWA 2IXEA 3HCWA 4HN4B 4L4XA 1Y1LA 2G3YA 1QTRA 2XCLA 3ET5A 3PU6A 4HF7A 4Q3AA 1VMDA 4ZARA 5AYVA 3O90A 5C4GB 4PWYA 5KOHA 1RM0A 4MW4A 4Z0PA 3H42B 3EF0A 1W4ZA 3M4JA 3QFCA 1I3NA 1ZMTA 3GJXC 4QGHA 2O07A 4ZI2A 1O54A 4WKOA 4HADA 1P7YA 3QV1A 2G67A 2XOEA 2HI0A 4RGYA 1YR7A 1Y5MA 1Z36A 2G08A 4UU7A 1FW8A 2E18A 4IOJA 5GJCA 5TQ0A 1KZHA 3U7IA 5C7LO 1XZQA 2PR2A 1KI2A 3RYHB 1RI1A 4EUKA 3ETJA 5FBKA 3K05A 3B3FA 1EFKA 1NW6A 2DFDA 3JU3A 3M6MD 1YMVA 4MINA 4X1OA 5E6RA 3S0JA 2J1LA 4ESVA 2Z3WA 4OLBA 1N0WA 4QTTB 5G02A 4B6PA 1SBIA 3N70A 1ZMXA 4HI0E 1AZWA 1SB8A 1JTVA 2RAFA 1THTA 1X74A 2QGZA 1CG6A 3KJZA 1PJ8A 4JC4A 4R54A 5CW2A 4G0VA 1U0RA 3CMMA 4HNVA 3WAGA 3UWOA 4ZN6A 3LUFA 4X85A 1HRKA 2YJNA 1SOUA 3FYDA 4RHYA 4AVYA 4IJKA 1H22A 1Q1GA 2PLAA 3RDPA 1VYTA 4WWHA 1ZKDA 2YMLA 3GZNA 4DHEA 4BCCA 3FGNA 3HR4A 4JBLA 3PGA1 4ML3A 4WNIA 3EDQA 2BE7A 4HB2A 5HA5A 4NBSA 3MGAA 3FCUB 3P9ZA 4EG8A 2QZZA 4HNAA 2V7BA 2ZCVA 3ANMA 2CXOA 3EQ2A 2OCAA 5ADWA 3U1BA 1DC8A 1HYEA 1V3QE 1YDWA 2IQ5A 4ACBA 1Z0FA 3RKSA 5ALSA 2HSWA 4OI4A 3CO5A 2HBQA 3MYRA 4QT0A 2VKQA 1AZSC 3ZY3A 2I4MA 2BMFA 3GD7A 3L40A 3K96A 1BQ4A 1FRFS 4EG0A 1AK1A 1L5VA 1JHZA 3WXBA 3Q15C 3PQ8A 4TS4A 2Z98A 3K1YA 1H4SA 3K5IA 3KR2A 2HWKA 4CT4B 5AW1A 3W9YA 4TMFA 4K6HA 4RA9B 3DBRA 2Z6QA 1FP4A 3GEBA 3LTNC 4GI7A 1KP9A 4GXRA 3HPRA 3SJZA 2GVZC 4CMAA 1WDKA 2KB0A 4P7BA 3QMMA 1ZNWA 5FYDA 1UAYA 4RHFA 3B38A 4ICIA 4ALMA 4QU0A 4G2NA 3QXHA 4MS3A 1VL1A 4W5HA 1WQ3A 3D8UA 2QW0X 2C7RA 3PFWO 2D06A 1AS3A 3P2YA 1V7PC 3MMXA 4PTLA 3IT0A 4JT4A 5LDGA 1Y4AE 1IATA 3P8ZA 3GN1A 2FEXA 3DULA 1Y3DE 3FPEA 1Y3IA 3NAQA 4LBVA 4DPMA 5BVGB 2WJHA 3LRPA 1TYBE 3LUDA 4N03A 2EAUA 1EDZA 4HX5A 4RAQA 4UFPA 1EBBA 2YINC 1H05A 4EATA 2PDAA 3FOCA 4JL8A 4QG3A 1VL2A 1WNFA 3GNTA 4ITRC 1TLLA 2A0UA 4MRRA 4IDDA 4D56A 4DILA 4BQEA 4XVCA 1R4ZA 2QN1A 4ZHQA 1SBNE 4K2AA 2O0LA 1P4GA 1ZUD1 3V42A 1VJGA 4UM8B 3MJTA 3U26A 4ND7A 4JASB 4DA9A 4EI7A 1YNOA 5E7IA 3O8LA 3FFTA 2OSVA 2Q2VA 2AJBA 4F2DA 2IYVA 2V45A 4HDRA 5AH0A 5IXYA 3TVTA 2ZQYA 4CGYA 5EIBD 2Z6AA 5EJ8A 1UQTA 1TTTA 1TJNA 1XCLA 4K5QA 1P7WA 4QGFA 1VSQA 5MGBA 3EA4A 1GV1A 4L6IA 3A6LA 4GX0A 1U3WA 4GKVA 3N2ZB 3M5WA 4MGEA 3AOEC 3Q87B 2CL7X 1JIVA 5JWHA 1RAIA 2Q3MA 2Q1TA 3H5OA 1ZK2A 1RHMA 1SUPA 3DNMA 4HRVA 4PRLA 1ZUHA 1EK2A 1Y5RA 2WU0A 3N0RA 1J24A 1PEKE 4JQOA 4LHWA 3ADPA 1BXKA 1H8ED 1YIDA 1VE3A 3KAJA 2IS6A 3I37X 3NOXA 2M6RA 2FK8A 4ZV4A 1RYNA 4U5XA 2QUKA 2FQQA 5B36A 2FY8A 3JS5A 3IAAA 2ZJYA 3C16C 5DDIP 4HAUA 3VA7A 3V4PB 2JAQA 3JR3A 2B8TA 4Z7QB 2R0QC 4QYIA 1I3KA 3AR6A 4LA4A 3IULA 2C4UA 2IVFA 4B6JA 2V59A 2I67A 3I2JA 3O0TA 1PFYA 4LNUB 2B5VA 3L7CA 3P1JA 5B64A 3V8VA 1E79D 4FLFA 2AKYA 3NH6A 5CJPA 1H4QA 4NAUA 3E4CA 1OQAA 5H9VA 1JAYA 2AN3A 4DDHA 3NTXA 3C3XA 4IG4A 4RVGA 1Q77A 4EW3A 3Q9SA 1A4IA 1UIRA 5GJWC 1MEJA 3ED5A 2GJSA 1AGRA 3H5RA 4GYJA 4JLKA 3ZBPA 5DRTA 4K6CA 4BCDA 4LTDA 1OU4A 2Y76A 2BUAA 4FYXA 3T95A 4AY2A 1VSVA 2E4XA 3QF7A 4CQLB 1VL6A 4IGEA 3W2EA 1JHXA 3WOHA 2J67A 2NXEA 2ZIUB 4KO2S 2QV7A 4RF4A 3FPHA 1UK7A 1P3JA 1SUAA 3GMDA 3BRWA 3H5WA 2IDMA 3MG9A 2J9RA 3U3RA 1Z0DA 3VPHA 1YL6A 3UWKA 3IP9A 4V24A 1GCIA 1KH1A 1CY2A 3JYLA 4U6NA 4AD8A 5G0UA 3N2LA 3KKQA 1IFXA 3D3WA 3IALA 3EC2A 3GJTA 3QE3A 4HEJA 3USZA 3WWEA 4AURA 4G81A 1IAQA 3OZTA 4D0NA 3FI9A 1GWNA 2DHEA 2OHXA 4QOEA 2R8BA 1UKEA 2XMSA 5LC1A 1TMYA 5JYDA 3IP7A 5LFAA 1RJEA 4NOKA 2QNBA 4DLSA 1ZMOA 2P5YA 4NSNA 2VT7A 2DY0A 4LWZA 4MRSA 3UKDA 2FUEA 1UODA 1DFGA 1K8YB 4Y2SA 3NGLA 1IQUA 4HFJA 1L5HA 5J2TF 4XR9A 3ZCVA 1T3GA 2OXCA 1TM1E 5MN6A 3FHOA 4ZVQA 2EKPA 4D5GA 1V8BA 3THRA 1J2RA 2DHRA 1LVHA 4HJRA 2VRWA 2IBTA 1DMRA 5HKOA 2JGMA 3TRKA 1F8XA 2NO5A 4EKDA 3VV3A 2X6TA 5JD5A 2ZK7A 2GYUA 2AF3C 2PBLA 4TKVA 3JWEA 3ZX4A 1Z22A 2CFSA 1PX2A 3DCIA 5FDFA 3GDWA 4EJFA 4C21A 2JIOA 3WJAA 1KQFA 4K6OA 4ZTUB 4Z4FA 3L0BA 1E3IA 2H1IA 2LIPA 3NHBA 1NBMD 2OQRA 3MLBA 4UTPA 3EVAA 4YJ3F 1L0BA 1WCIA 1ZJYA 2J5KA 5EJEA 3L1HA 3A1NA 1LPSA 3HCCA 1DRUA 1SZCA 4WL0A 5DNDA 4JXXA 1GAWA 5DGCA 2X3UA 3RYIA 2C31A 4RK6A 1S8NA 3TQOA 2BLLA 3RJMA 2XECA 3FDJA 2PHZA 3BB3A 3BQ9A 5GGXA 3NBUA 4IUBS 1YZVA 1XTBA 1XTQA 3MJEA 5AHOA 1HNZB 1YZQA 3AIMA 4IUDS 3FGZA 4ARZB 3EPJA 3MCVA 1ZZGA 2OC4A 4BQNA 4CQMB 1CF4A 3JRXA 2HK6A 4ILKA 3ZV4A 2JFXA 3FETA 4FHDA 2HNKA 1AZLA 2BJVA 1A9QA 3DMDA 4E51A 1TE2A 3P0RA 2VJDA 2BM1A 4I6JA 2GILA 3FB4A 5KQMA 3IJPA 4OK5A 1QP8A 2WR8A 3OZVA 3PR3A 4HVLA 3D2BA 1GN9A 2PWZA 4O3FA 4QXOA 1GUFA 2I4OA 2VHZA 3GRFA 4PN3A 3RUFA 1CP2A 3L8HA 3F9RA 2W2PA 4D97A 5E3HA 7AT1A 2HF8A 2YBDA 3UOWA 1KC3A 4TKLA 2ZI6A 4KHZA 4D9GA 1I4DD 5AM0A 1BQ3A 1M6VA 2IKSA 2GFIA 2QN6A 2BV3A 2V7TA 1Q22A 1SXHA 3NYQA 2QPLA 4GMXA 2HWXA 3T1YB 2XQKA 3TG2A 3IRUA 1NBOA 1BE0A 2QU7A 1NBIA 1RBYA 1TJYA 1E99A 3LY9A 4F4HA 3V1YA 1YS9A 2AB0A 2DSTA 2PT5A 2R7MA 2J85A 5DHQA 1PNRA 1V2HE 2FOIA 3EEOA 2Q6OA 4ZI7A 2XDAA 4BFZA 3LK6A 1WW3A 4RACA 3JYHA 3KK0A 3QYFA 4EA8A 4LSZA 3HA3A 3ENWA 1CUAA 5HJEA 1MPXA 2HPHA 4X44A 2FEPA 7MDHA 2PBRA 5AICA 1G5FA 1PJTA 2C9BA 2ZS7A 1GUBA 3TBFA 1PBTA 4BASA 9MHTA 1OH6A 2VJNA 1XVAA 3H1PA 2A1IA 1KJNA 2NTJA 1UMCA 4H1WA 3PLAE 2AOTA 4A0QA 4MWOA 4MQ4A 1AHHA 3PQ5A 1OTHA 1RKQA 1U2TA 3E9YA 4PO8A 4X00A 4GI2A 2WUDA 3CQ9A 3CX6A 4G0MA 1CQIB 1E0KA 3F47A 3FSRA 1WOMA 2YV1A 2G1PA 4YJKA 4MRVA 2YWHA 4Z9XA 3CEJA 3W7AA 2XCRB 4MEBA 1XQXA 2GAOA 3KZMA 3P2EA 5K2MA 4EHBA 3Q12A 1II8B 4JI1B 2J46A 3G5MA 1ZOOA 2HRCA 3JQRA 4B6QA 3GBSA 5BRNA 2EATA 4KN8A 3PSHA 5AKLA 1IBLB 1C3JA 1PJ3A 4YQZA 3PQ6A 2PUTA 1N8TA 3R0XA 1PI3A 3WTCA 2RG7A 3TAXA 3MQFA 4TS1A 2WQ7A 3KTAA 1HH4A 5K4GA 5BUSA 3HJTA 4DLVA 4R9UC 4QTUB 2HXSA 4BQQA 3BQMB 3THYB 2VYND 3LQQA 1EUZA 4CLRB 2PZ8A 4IJMA 2GMWA 1T9ZA 3AY7A 1KZ6A 1TIPA 2NTYC 3CLUD 4TTJA 5L7YA 5HUJA 3K1AA 5I01A 4XDHA 5ICCA 3D0OA 2CV1A 3FFAA 3Q2IA 3QG5A 1LEHA 2B21A 1XCOA 2RK6A 5BN4B 1ZR4A 1DAIA 1JT9A 4B4WA 4OP2A 1F2TA 1KDOA 2L69A 1UBCA 2PT9A 2YL2A 3K35A 5E6UA 2A3NA 5AW0A 4WFIA 3TOZA 3T3GA 3FYCA 4WOKA 4YPFA 1G18A 3KOYA 3V4ZA 2I7XA 3HU1A 3AFIA 1N5JA 5JZBA 3PXDA 4OH1A 2PX3A 4V2UA 4XA8A 4ZAVA 3U39A 4GUAA 2RHCA 3FWNA 3ONFA 3BWMA 1MFPA 4PNHA 2OA0A 2ERCA 1UC4B 1MB2A 2JCXA 2QRJA 4M1KA 3TOVA 2YX1A 4Z49A 5C8XA 5DSXA 3DFZA 3KTOA 3WLQA 1LS6A 5ECWA 1Y1PA 1OFUX 5EE0A 1HM5A 1MG5A 2WM2A 3DF7A 3R5FA 3FFXA 4LDRA 3OUZA 3L8FA 5LQAA 1SA0A 3AM5A 3NANA 2NUTB 1I7QB 1KJWA 1JXMA 1TJ5A 5J58A 4MKGA 3DFUA 3KXLA 3G0OA 4R2JA 4X3PA 1UBTS 4RJIA 5FA6A 3T4PA 4OQMA 4PXAA 3H2KA 3Q3EA 5ANRB 1JFVA 3VISA 2FPWA 2YJ6A 5IAKA 1RXUA 4CEIB 1DUSA 2AUNA 1XAHA 2FN9A 3D2LA 1EJ2A 1MO5A 3GPCA 1F0NA 4QGGA 5IAGA 4I55F 1RI3A 3A6FA 1VIAA 5IDWA 4G24A 3KPVA 4RMJA 3B13B 2VT3A 1EE9A 4GXNA 4AFNA 1U6IA 1OLUB 1XBTA 1HTWA 1ZJZA 1ICEA 2BEWA 3LPMA 3D1LA 1R0XA 1P72A 3BRSA 3O93A 3OA2A 5EVJA 2FXIA 3NYWA 2WM8A 2XEXA 2ZVPX 3FYHA 1JBQA 2RSLA 3PGLA 1B8OA 4HNHA 4RTQA 4KXWA 3QQPA 2GF0A 5CXXA 2CLDX 1YQXA 4YROA 3KL2A 4DF3A 5F12A 2BOVA 2AEFA 2JNWA 1ZPDA 1G21E 4M49A 5DGDA 4JYPA 4YREA 4C08A 2HMAA 3O03A 3PDWA 4YMGA 4HC4A 3QVGB 3CNHA 5JLJA 3U44B 2CMDA 5JCOA 1OLSA 2YJGA 1NSTA 3JAWB 2AI1A 5KWJA 3DONA 2VATA 5CDUA 1RM5A 1KAHA 1R5NA 5E8RA 2QRHA 1JEDA 3I6BA 4B35A 2P0EA 2JFBA 1BDHA 3A6HA 1G38A 3G9ZA 4RW0A 2QN7A 3I1YA 4NCNA 3BXZA 4PPYA 4NXMB 4DQDA 5DMXA 3L4JA 1ND6A 3V32A 4NYJR 4WTOA 1XZLA 2A7XA 3HKCB 4IVRA 4OXQA 1O0BA 5F9FA 3ZLBA 1EX6A 4Y1FA 2ORWA 5I5EA 5K0TA 2PKCA 2PIDA 2FW0A 3R5TA 4O3MA 3G2MA 1O96A 1Y48E 5AM4A 3KPUA 1WUIS 1O6FA 2VK2A 3EVTA 1PWZA 4Z86A 4RAOA 3U4GA 5C5IA 2D1TA 1ZUWA 3N6VA 3NRBA 3QEKA 4XASA 3EX7C 3OWXA 4UAJA 2GOYA 1ZYUA 1HZZC 1U3DA 5EJGA 1X7WA 2C9DA 3SF8A 2FH5B 1TW2A 5EQJB 2CYBA 2Q1YA 2Q50A 3G7NA 3TQFA 2FZLA 2ET6A 3JWPA 3RODA 1BH2A 4QTZA 3RTCA 4BB9A 2W4MA 3WYEA 4WZBE 3L7LA 3W34A 1SUIA 5FOWA 5TSDA 4L2IA 3OFVA 3WWOA 1SUCA 4O6VA 1TZMA 1N1MA 3ZHOA 2O8EB 3ZXUB 4KWHA 4QKQA 2AG1A 1FYWA 3UB2A 4F9TA 3E2PA 4LOJA 5SY6A 5EI5A 3E6AA 3E9ZA 4U7HA 5BN3B 5LLTA 4CW7A 1A4RA 4L73A 3NALA 1OZFA 4MB0A 3LO8A 1QQ6A 1CRWG 2YMMA 3IBFA 4XYGA 2XQJA 1FEZA 3GXOA 3VYRB 3MINA 1W5EA 3PIDA 1XTRA 5JH7F 2ODNA 5JD4A 1D2HA 1M0WA 5F64A 4MKXA 1NRWA 1UBGA 3QU2A 1XCBA 5T4BA 4H16A 3OZWA 1NV9A 4RELA 5JRDS 1PQPA 4Q3CA 1PZNA 4ODIA 1W2HA 1NY5A 3OZBA 3SKVA 3C3WA 3OF5A 5ALNA 2FJUA 3AXTA 1AHNA 3MILA 3NH9A 1HRDA 3SP1A 1E6UA 2JLSA 4FR2A 3OJOA 1I2MA 1F60A 4DLBA 3KZNA 3DSRA 3W5AA 4OHWA 4QVGA 1MIOA 1TJ4A 3DEKA 4JQZA 2HDOA 2HK7A 4OHMA 2FTKE 3ILSA 4HVAA 4NP6A 4DRXA 2PUBA 2VYCA 2C59A 3IODA 4RIIA 3LDFA 4DM3A 1NJFA 1RNLA 1T36B 4YMUA 4BV3A 1EUDA 1PZGA 3GFTA 5DYYA 5FB3A 5K3FB 4V1CI 3CCBA 4GP7A 1U4SA 4J6FA 3ZQ6A 2ROQA 5J5AA 1DJOA 3KJIA 5CHYA 2PPVA 1Z4QA 1YBHA 4BJ1A 4BLUA 4PQEA 2IOHA 5FUXA 5DI3B 5HZMA 2IIBA 2UXBB 2ZRJA 1HK7A 1WMDA 5DBHX 1VZ2A 3ZK7A 5B3KA 1VB5A 3LE8A 3QYAA 1ZI6A 1K2WA 1ZMRA 4FMDF 4JI7B 1JKMA 1NRIA 1PYOA 1NUHA 4UD6A 2JKVA 2HUNA 3IR7A 3ZDEA 1KEEB 1YQWA 2OLKA 2W8BB 4XM0A 1QJCA 5DT2A 1XNHA 3AP1A 3ANYB 1N2BA 2G6TA 2JHPA 5I5GA 1W44A 3EXHB 4AP5A 4TYNA 4ASUA 1C9NA 3TWOA 1BXGB 3EXEA 4UTRA 3LHSA 3MCTA 1EFRA 8LDHA 3VSCA 3OVMA 4GO1A 3ZGVA 4EL5A 1RZRD 1UBHS 2MSEB 3D7MA 2D7DA 2EJWA 1TK9A 4IIEA 3H83A 4FFVA 2DFNA 2P2NA 1MN6A 1NBAA 2HPVA 1G3UA 2KLHA 2W0SA 4HMPA 5HS6A 5A03A 1YCDA 3T9EA 4IHKA 4UVDA 3X1KA 4YAOA 2RIPA 4EF6A 4IDOA 1BKYA 4OMCA 4PCLA 3WZLA 1RS0A 3T7AA 2C88A 1G5TA 2ZUCA 4LK3A 5FT9A 2Y0DA 4BC0A 4BV9A 2GRUA 2DWUA 4KWIA 5EUCA 4MIYA 3TMAA 4EAAA 5LM3A 2KBEA 2Z4SA 3CNBA 4AMVA 1WQ4A 3FHJA 1R66A 2ECQA 2I6GA 2ATIA 3L46A 4K0KB 4GEKA 4QOJA 3EMBA 2D1YA 4E5MA 1QIGA 4L6AA 4IF4A 3OQBA 3QX9A 3OO1A 1W2WB 4I1OA 1N2GA 2ABWA 3L7NA 3FUUA 4XM2A 1T6NA 1U2ZA 4Q9DA 2IUSA 2Q6VA 3VVBA 4C4SA 4F11A 5LQDA 1NT2A 3JALA 1G41A 2PX8A 2ZT5A 5L4SA 2WFMA 1SC4A 2JZNA 1AMUA 3R9WA 2VYVA 1IN8A 5I4BA 4JBWA 2GFQA 1RJDA 4HQFA 3SR0A 1ES9A 3RSZA 3V8EA 4WDRA 4ND4A 1YMUA 3PZBA 4KGDA 2VTEA 5H80A 4UATA 4KR9A 4KO1S 2BSQA 1G21B 2O3QA 3D4PA 4BHTA 1ZM7A 3S6JA 2IS1A 4KL8S 3PIRA 5KOHB 3J81k 3HSYA 3TOXA 1KO1A 1QK3A 1CS0B 4WGGA 2IEZA 5LPNA 1GZDA 2WWTA 2W37A 4WCFB 4XGNA 3FTEA 5GOTA 1OJLA 3QPDA 1HDZA 3RYFB 4DVJA 1YD7A 3E9QA 4KU4A 5TS3A 1R15A 3LPLA 4FBLA 4MV6A 3GJSA 4HEA6 4BU0A 1NRJB 1UFQA 2WYUA 3PFBA 3ZZTA 4AUMA 3TX6A 1GGEA 2GVNA 1TA0A 3FG9A 1ZK0A 2C2KA 2H1WA 4JH0A 1MO3A 2W6PA 3CW2A 2P4QA 3O4IA 1XCMA 5K09A 5T7BA 1RRPA 2JJ1A 2NU8B 5CP8A 1K3FA 4D9FA 1KPHA 3AV3A 3PPXA 5DTQA 2Z09A 2GD0A 4HCJA 5EY5B 5AXAA 3M4YA 2C82A 4O2AF 4YJFB 3GUVA 3WWZA 4G1UC 4JB3A 3KUDA 4TKZA 5BW4A 1DEXA 1YZNA 2F3UA 4WGFA 3AIOA 3O82A 1UT6A 2ZXFA 4YRGA 2Q8NA 2B5WA 2PYDA 3T0IA 1QG2A 3ZR4B 5KQGA 3I1FA 1NZDA 3QKWA 2BE9A 1DC7A 4J94A 4R6WA 5TQ2B 4AB1A 3GYBA 4DG9A 4F2WA 5KX5F 2PXXA 3QJGA 1DINA 1SPBS 1N8SA 2JDID 4C6HA 2O8DA 4WZBB 1MBZA 1EWKA 1NSFA 1URPA 2WJGA 3CUSA 3QLJA 4PZLA 5J63A 2ZJAA 4PU0A 3NIWA 2VDPB 3NRJA 4YP0A 2AFHA 5ALEA 3FDXA 1Y8ZA 1Z2OX 4F96A 4ZIRA 3STVA 4ER0A 1DQZA 3DE6X 1Q74A 3UAYA 3NUQA 1NE7A 1ZCFA 2FSVC 2HNAA 1YV9A 1SWVA 2WYVA 4MQMA 4RZQA 3U62A 4QDXA 1UJMA 3QX8A 2Y99A 3RC2A 3SZUA 3W6ZA 4C4PA 2H4XA 4AZ3A 5LP6C 3DBRB 4P7KA 4DMGA 3RF7A 4WXPA 2FN8A 1UXGA 2PQMA 2R6FA 3OF3A 4R7TA 4YCAA 2BEJA 1O4WA 7GPBA 1YZTA 3N76A 3VGPA 4G5XA 2GJ8A 1E9VA 1ZCAA 1UCFA 3FPKA 3KM0A 1C7JA 4H3SA 2WM9B 4QO7A 4F2GA 3THSA 1OR8A 4DLRA 2XUFA 3I9JA 1IHUA 4MS3B 4Y6GB 1CQJA 3ECSA 3HL4A 4BNWA 2JKYA 1HC7A 1XMQB 1E94E 1P81A 1X87A