1BCSA

Complex of the wheat serine carboxypeptidase, cpdw-ii, with the microbial peptide aldehyde inhibitor, chymostatin, and arginine at 100 degrees kelvin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
HAADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SERINE CARBOXYPEPTIDASE II
publication title Peptide aldehyde complexes with wheat serine carboxypeptidase II: implications for the catalytic mechanism and substrate specificity.
pubmed doi rcsb
total genus 83
structure length 255
sequence length 255
ec nomenclature ec 3.4.16.6: Carboxypeptidase D.
pdb deposition date 1995-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bcsA00
4Y2RA 2XLCA 2HU5A 2OCLA 3NGMA 3ZV7A 1DT3A 3V1NA 3HACA 4KAAA 4CCYA 2DSNA 1ACJA 3WKDA 1DX4A 3SWWA 5AKGA 2WLSA 3I2FA 2VJBA 5AK5A 2ZJ7A 4UFNA 4DLNA 3NOXA 5ALEA 3GZJA 2B4KA 4QA9A 2WUGA 2JF0A 3AIKA 3UUFA 4Q1VA 3VJMA 5HK9A 2VJDA 4N8SA 1VKHA 1MJ5A 5ALDA 5ALZA 4CCWA 2WHPA 5SYMA 3EF3A 4Q05A 5ALYA 4EY6A 2ACEA 4J0HA 5D7BA 1XKLA 5HF8A 4G9GA 1BCSA 3DQZA 3O4IA 1F0PA 1XRMA 3B3QA 1CQWA 4JUIA 5K5EA 3FBWA 1ZI6A 1TCCA 2XUQA 1K5PA 5I9IA 3WA7A 4KEAA 4B80A 5AI5A 4OPMA 1GKLA 4UUQA 3IUJA 1DX6A 5AI4A 3MGAA 3HC7A 4OD0A 4DM7A 5CBKA 1MX1A 4BP9A 3M83A 3DNMA 2CB9A 1TK3A 5T4FA 4GDMA 1UFOA 4GLBA 1VOTA 4X6UA 5ALFA 3F97A 4FBMA 1QTIA 4XX1A 5C8VA 3I6YA 1T2NA 4FLFA 4G8CA 4G4JA 2X8BA 1O6GA 1U65A 2JIDA 5JATA 5AM5A 3PFCA 5C81A 3I2JA 3R3UA 3TGLA 3EBLA 4C4XA 3BIWA 1JJBA 4ARAA 1H2YA 1CUAA 3DD5A 1UWCA 3IUMA 4P92A 5EIEA 1EVEA 5AI9A 1R9NA 3FVTA 4FNGA 4G4GA 2GYVA 3TEJA 4H7IA 3N0TA 1LPMA 2QS9A 4UHCA 1QIFA 4CFSA 5ALGA 1AUOA 1R9MA 4U2GA 3WWDA 4X92A 1PJAA 1ZIYA 1N5MA 2OAGA 1DU4A 3MVEA 5CH8A 1CQZA 4GHWA 5AKHA 4BTVA 5JIBA 2Y6VA 3HABA 3D2CA 4BDSA 4HXEB 4AO8A 2O7VA 5E2IA 5K3FA 1UT6A 3WK6A 4LXGA 3I2IA 4X3CA 1HDEA 2XUFA 5EIAA 1MTZA 4BBZA 1THGA 3A2NA 4DIUA 3VJKA 1LPAB 4C89A 5LZ9A 5AOCA 2WIFA 3BL8A 1JKMA 3LP5A 1P0QA 4KAFA 3H1BA 3FOBA 2JBWA 1YCDA 1XQVA 5CXUA 3ESAA 4KRXA 2WJ3A 4HTAA 4Y2XA 5DYWA 1WB5A 3R41A 2RHWA 4K6GA 1JT2A 1YAJA 3T52A 4W63A 1ZD2P 4HS9A 4U2DA 3WMRA 1B41A 3HJUA 1EK2A 3VJLA 1BROA 4MYDA 4OB6A 2HDWA 1XQYA 1FFAA 1UKCA 2YYSA 3LCRA 2XMBA 3QBJA 1ZI8A 2C5FA 4B9AA 1XROA 1UK9A 5A62A 5AKIA 3RLIA 4YASA 5JZSA 2QOEA 4BDTA 1XZKA 5CT8A 3WWOA 2DHEA 4MWTA 3STUA 1ZJ5A 1QZ3A 3BWXA 3PE6A 5E4YA 3TRDA 4KE8A 1W76A 2DHDA 3BXPA 1H2XA 3EQ8A 3W9UA 1ISPA 1MX9A 4FFVA 1EVQA 1BEEA 4MQLA 5JAOA 1QIDA 4BRSA 3FWHA 1CRLA 3IUNA 1A7UA 1BCRA 5LLSA 3HZOA 2XB6A 1JI3A 2JEYA 3IUQA 3NUZA 2WU3A 3RARA 1ORWA 1QIEA 1GQRA 1PV1A 4J0DA 4EA6A 4BZWA 4WCVA 1J1IA 3L1HA 4P08A 4EY8A 2I3DA 5EHZA 3OOSA 1IZ7A 4JNCA 4AXBA 3ANSA 1QJ4A 3C8HA 4XJVA 2ONCA 1RYYA 3U1TA 1QIHA 2QKYA 4F0JA 3CCCA 5KBYA 2D0DA 1CUSA 4ZREA 2XUOA 1X2EA 2H7XA 1LPOA 3C6ZA 4Q3LA 2GYWA 1VA4A 5K3CA 4JEIA 4WY8A 4HXFB 1OILA 4ROTA 1EH5A 2GZRA 1EB8A 1RP1A 3WLAA 3PDCA 4BRZA 3QITA 3ZLUA 5AM4A 3ILSA 4ZGBA 4U2EA 1ODTC 3I6ZA 1B6GA 4PQEA 3OTQA 2Z8ZA 3HYSA 7YASA 1P0MA 4BTLA 4EHBA 3H0CA 1MAAA 4PW0A 1XZDA 1CUEA 1CLEA 4EY5A 2WHPB 1C7JA 3RK4A 3F67A 2ZVDA 4MYSA 3H2IA 5HCUA 4UBJA 3HLKA 1U2EA 2QMQA 4K6KA 3VXKA 2B61A 2PL5A 1HL7A 4DMHA 2GBGA 3ICWA 1JU3A 1EI9A 5AK4A 2AXEA 5AP9A 4WJLA 3OPMA 4CG3A 1GPNA 5BV7A 5SYNA 2YXPX 3IBTA 1E8DA 1XRRA 3DKRA 2D5LA 4M0EA 2VJCA 4BATA 4YX9A 5ALSA 4ZXFA 4Q34A 4ITVA 4G8DA 3KOOA 4QWMA 5A71A 1BS9A 2H7YA 2ZJFA 4S0XA 1MPXA 2PSJA 5CT9A 5K3BA 4C87A 4IH1A 5K3AA 4B6GA 5ALTA 3O9MA 4MEAA 1E89A 1XQWA 2J4FA 1WCYA 4M0FA 4G5XA 4OB7A 1CVLA 5ALKA 4AO6A 4ZV7A 4BYMA 3ANTA 1YA4A 5AKZA 2QT9A 2RONA 3IURA 2RI6A 5IVIA 2PBLA 1AC5A 4FWBA 4E46A 3W2TA 3V48A 2GBIA 3WKAA 3MUNA 2ZSHA 2ES4A 4B0PA 1XLVA 1CUDA 1SFRA 3WKEA 5JZBA 1CUFA 1YASA 5I8PA 5HF5A 4B83A 4KE6A 5ALMA 1WOMA 2BAGA 1F0NA 3IULA 4CIBA 2J4CA 3DKKA 2XI4A 3A6ZA 4Y2UA 1L7QA 3V1MA 3WYNA 4RPCA 5HQ3B 3R3VA 2LIPA 5EFZA 2P8SA 2XMGA 1R1DA 1AKNA 3G9XA 5JALA 1XRLA 5AM3A 5DLPA 3F8SA 3Q8WA 4PNZA 1UXOA 5LZ2A 3AZPA 2VT6A 4DSZA 4H77A 3FVRA 3G8YA 5ALHA 3IIIA 1SOMA 1H2ZA 2B9VA 1ZGCA 4X71A 1O6FA 4HXGA 4J0KA 5AOBA 4LXIA 5AKJA 2XLBA 4QWWA 4LYEA 1FFBA 5AK3A 3SC2A 5D3KA 1GQSA 1CUGA 1LZKA 2VJAA 5AH0A 3I2GA 2Q0XA 5FPQA 3K9BA 4HRYA 1RWQA 3L1JA 1TQHA 3AIMA 2HFKA 2W22A 1QIGA 3KWFA 5CH3A 4X91A 3JYHA 3WK5A 3BJRA 1D07A 1YB7A 1XZBA 5AI8A 1MU0A 4KRYA 2C58A 1QLWA 1UK7A 2X5XA 2WHQA 5ALVA 1W4LA 3R40A 1WPRA 4N8EA 3H2KA 4IQ4A 4BE4A 4QDZA 1VZ2A 1LBTA 3T4UA 5ALPA 4U2FA 4PO3X 4H35A 3M82A 1M33A 5AJHA 5AKKA 2O7RA 3W04A 4AN0A 1C4XA 4INZA 4DGQA 2UZ0A 1JFRA 4MWSA 2Z3WA 3WWCA 2HFJA 5AM1A 4AN1A 4N5HX 1USWA 4X00A 3C8DA 1IUOA 3WIBA 4X95A 1AQLA 2BGNA 4UBMA 4DMKA 2RAUA 1XRNA 4KYVA 4BC0A 4PSDA 1H2WA 1XZHA 4B85A 3EQ9A 1MNQA 2FUKA 1CUJA 2B20A 3QZUA 4OCZA 5DWDA 3STYA 6YASA 3M3DA 4ETWA 4B7ZA 5AKXA 3CN7A 1A8QA 3R3XA 4DNOA 4GW3A 2XMCA 1CUWA 1GT6A 3DOHA 1XQXA 3LLCA 1Y37A 3STTA 4K2AA 4BB0A 3O9VA 2HU8A 2XMQA 5A7FA 2CBGA 4FNMA 1IZ8A 3I1YA 1YAHA 4Y9SA 4C4YA 4JYMA 2QM0A 1DINA 2WU4A 3E4DA 3FLBA 5EHXA 3C87A 1LZLA 3RM3A 1XRPA 1XRQA 2C0QA 5T4BA 5ALRA 3DS8A 2O2GA 2PM8A 1N1MA 2PSEA 1QIMA 5IVKA 3CCBA 2QRUA 2G5PA 3ICVA 3F9CA 1YS1X 4RGYA 1ZD4A 1JU4A 4AMYA 1DQYA 1LLFA 4QE3A 2PPLA 5BOVA 1BN7A 2VSQA 5ESRA 4CG2A 1QOZA 2VT7A 1CUIA 4J03A 4KR0A 2WJ6A 1HKHA 4B0OA 3BF7A 1Z68A 4GECA 4WFJA 4Q3OA 5AK6A 1TCAA 1TRHA 1HPLA 3R3WA 3O4HA 5FOQA 1NU8A 2ORYA 1K8QA 4H18A 3Q0TA 3H18A 1AGYA 4UBKA 5HQ3A 1ORVA 3WK7A 3ZLTA 3O4JA 4UFOA 2XMZA 4BZZA 4EY7A 3UMJA 1EDBA 3P2MA 1E3QA 2XDWA 2VAXA 1TCBA 3F98A 4OUKX 4EB0A 2J3DA 1F6WA 1ZD3A 1VXOA 1DWOA 1FFCA 2QR5A 4F60A 3LIPA 1UK8A 2XUHA 1GGVA 3BJMA 2BCEA 2ZYHA 5AHXA 1HBJA 2QXTA 5CXXA 3DCNA 5T4EA 2WG0A 5JASA 2CMFA 3IDAA 3GROA 3QPAA 2OGTA 4J0JA 3OURA 1EINA 3FCYA 1NX9A 3ZLVA 1YA8A 4W1QA 4CI9A 4Y7DA 2PU5A 2ZJ6A 1UOOA 2IX9A 3FYUC 4AMZA 1QE3A 1QONA 5CT6A 3HI4A 4DNQA 1CPYA 1IVYA 3M81A 5ALIA 1XZIA 3UUEA 2EDCA 4H7HA 3QMWA 4OU5A 2XMSA 2JGKA 2WFMA 1ODSA 3H17A 1EK1A 2V97A 3DEAA 2OGZA 2I78A 3LS2A 1EDEA 3ESDA 3CN9A 2H7CA 1NU6A 3OM8A 1TKRA 4I19A 4UBNA 1AX9A 1W1IA 4JH0A 4L72A 1QIKA 5HF6A 3PICA 4E15A 3C43A 2WKWA 3PF8A 1LBSA 4P9NA 2R11A 2ZYRA 4XVCA 4IHAA 2HA5A 2YASA 4DSAA 3E0XA 4P93A 4X6XA 3N2ZB 4H7FA 2WUDA 1K4YA 5ALQA 1MN6A 1CIJA 3V1KA 2PVSA 1CUCA 4W1PA 4Y2QA 2GZSA 4X97A 4Z49A 2WHRA 4XWGA 1E8MA 1G5FA 4NZZA 1KU0A 2WFLB 3WWEA 1ZJ4A 2QXUA 1JJIA 2QTBA 3C70A 5LZ8A 5FLKA 2HIHA 3E1GA 3ZPXA 5EIHA 3PUIA 3X3HA 2Z5GA 4G4IA 2QJRA 1LPSA 2ZSIA 1TIBA 4BVLA 1JJFA 3O4GA 2I3ZA 3JWEA 4FTWA 4HAIA 3K6KA 1QTRA 5KWIA 2EDAA 2WG2A 4WFIA 1G42A 4L0CA 4H0CA 3KD2A 2OPHA 5K3EA 5BWCA 4FMPA 4OYLA 1J06A 1KEZA 1SCIA 3OG9A 3H04A 5E4TA 4LHEA 2C5GA 2BUCA 2H1IA 2XT0A 3AIOA 4Y2SA 1A8SA 2JGJA 2G63A 2PSHA 3A2MA 4TVKA 4NS4A 5ALXA 4FLMA 1CUYA 4MEBA 5LYYA 2X76A 3C6XA 1CUVA 4GI1A 2XUIA 1CV2A 1OCEA 1AMNA 3WWPA 5AKLA 2HA6A 5LKAA 4V2IA 3A70A 2QUBA 1XZAA 4MQMA 5FP0A 5HF9A 1X2BA 4EUSA 3D2AA 2ROQA 3WA6A 5K3DA 2YH2A 2HADA 1UOPA 4UPDA 2HA7A 1XZJA 2AJLI 3V1LA 5C8ZA 4KE9A 4UHBA 1QGED 1XZLA 2WUEA 1EDDA 5DNUA 1EB9A 1WPXA 2VA9A 3ED1A 2DQZA 3G0DA 4FBLA 4N8DA 4J7AA 1IUNA 3FAKA 1A8UA 4D9JA 3WIOA 4RNCA 1EA5A 2HA2A 2HRRA 3C5VA 5J3JA 3DDUA 2JGEA 2C7BA 5ALUA 2PX6A 5BWBA 2K2QB 3ZI7A 1GXSA 3U0VA 2RIPA 4UHHA 3D5EA 4Y2YA 5T4HA 5CURA 3KWJA 2OCIA 3VVMA 3B12A 4GEGA 3G0BA 4TGLA 2DQYA 4OU4A 4X85A 3STWA 2GYUA 3QYJA 1ZD5A 1LNSA 2CUTA 2XUPA 2HM7A 2Y2UA 5DYTA 1DTEA 2WIJA 5FKJA 5D3ZA 4PSUA 3IA2A 4DNFA 3D59A 2HA4A 2WQZA 1MT3A 5ALJA 1QFMA 4KACA 1U8EA 4WFKA 2Z8XA 3G9ZA 3PF9A 5CT5A 2RGUA 3DYIA 3FSGA 2QVBA 4PSCA 5AM2A 5A2GA 3I28A 3FSGD 5HFNA 4BE9A 4EBBA 2CKMA 1P0IA 2E3JA 4BCDA 1BRTA 4U2BA 4UHFA 4CG1A 1N8SA 1VA5A 4BAZA 2XUJA 1H22A 3LIIA 1PFQA 5FUMA 2ACKA 1ACLA 2WIGA 5E4JA 3WL8A 1A88A 1GZ7A 1FFDA 2BFNA 4X6YA 2VEOA 2BUAA 4H7KA 1R4ZA 1ZOIA 3D0KA 4DMFA 4IH4A 4Y2VA 5LIPA 1YSCA 2O2HA 4ZV9A 3WJ2A 3WK9A 1G66A 1CFJA 2WJ4A 5AKYA 2R8BA 2W6CX 3SX4A 1Y7IA 5A7HA 3C6YA 2WFLA 3H2HA 1YB6A 4LXHA 4ZWNA 4X93A 2HRQA 2VTVA 3PUHA 2OQVA 3AUKA 2XQJA 1L7RA 4UBOA 4HRXA 5ISMA 4C01A 5IVDA 3WZLA 4DTCA 3I1IA 4DNPA 4Y2JA 4PV7A 1R50A 4UFPA 3R0VA 1CEXA 3GFFA 1CUZA 2OAEA 3KXPA 1N5RA 2OGSA 4IH9A 4OB8A 2DCMA 4BVKA 1R88A 1ZI9A 4CIAA 2FJPA 5AKEA 1T4MA 4UBIA 1GPKA 4UHEA 3AZQA 2BGRA 1ZIXA 4FHZA 4DMCA 1ZGBA 1UZAA 2VF2A 3S2ZA 2IIVA 4QLOA 4W1RA 3MUOA 5AICA 4X90A 1XLWA 2WIKA 4OYYA 3O95A 2C0PA 1DQZA 1E5TA 5JANA 3PFBA 4BVJA 1LPNA 2QJWA 2PSFA 1BE0A 5CH5A 1FFEA 3R3YA 3DL7A 2BJHA 4QDOA 5HK8A 1LPPA 5AIAA 5FV4A 2XMDA 3HXKA 1VXRA 1UOQA 1IMJA 3AFIA 3G02A 1W75A 5EHNA 4W9RA 2RHTA 4IO0A 5FDFA 2CEKA 3E3AA 4FOLA 3VDXA 1XZMA 3H19A 5DJ5A 3R3ZA 5AO9A 4BP8A 4J0GA 2HL6A 5C7YA 1HQDA 4EZIA 1MNAA 4C4ZA 1QIJA 2WFZA 5DTJA 3H2GA 1LPBB 2FJ0A 2V9ZA 3QMMA 2OCKA 2OXEA 3AZOA 4QNNA 1HLGA 1FSSA 1G4HA 4OSEA 2O2IA 2PKYX 2XQKA 3QM1A 4B82A 1GPLA 4YK7A 1ETHA 1XZGA 1UK6A 2JGLA 2QZPA 3QVMA 1CUUA 4AZ0A 1S8OA 2HA0A 2I03A 3G0CA 4HZGA 3QPDA 5ALLA 2WUFA 3F96A 1ZICA 5FPPA 1E8NA 3SK0A 5H3HA 3AILA 5DYYA 2JEZA 1VE7A 1GKKA 1WHTA 2FX5A 4B84A 1VE6A 4L9AA 3S8YA 3I2HA 2XQIA 1TAHA 3QPCA 3GA7A 4KE7A 3CXUA 2AJ8A 1FJ2A 3WQHA 1WHSA 5KWJA 4H7DA 1R3DA 3YASA 5F4ZA 4I3FA 1WB6A 5DNVA 4EY4A 5DNWA 4FLEA 3WL6A 1MAHA 1MX5A 3D4LA 1XZEA 2WG1A 5EGNA 3WK4A 3HRHA 2Y6UA 4JYPA 5JAUA 4AX4A 4HVTA 4Y2PA 3C45A 3A2LA 4O08A 5JD6A 1JMKC 4QZVA 5JADA 2PSDA 4QDTA 2JGIA 3QH4A 3D7RA 3C5WP 5KREA 1WM1A 3FYTA 3GBSA 3V9AA 4C6HA 5FXMA 4WDQA 4WY5A 5I7UA 4LYDA 4KAJA 1JMYA 1CUBA 5JAPA 1SC9A 4RE5A 4FDMA 1UKBA 2OG1A 2VAVA 3IVMA 2Y2VA 3C6BA 4UBLA 4QDXA 3W05A 3WKCA 2DFPA 2WTMA 1W52X 3G9UA 1BN6A 3I6MA 1SCQA 1KU6A 4W1SA 1QO9A 3ESBA 3PI6A 4M0MA 2G5TA 2JGMA 4U2CA 1WB4A 4G9EA 1C7IA 5LP1A 2JGFA 5IKXA 3DOIA 4RE6A 2DR0A 1VLQA 2XE4A 5CTAA 1XLUA 5JD4A 4NVRA 2IITA 3KDAA 1U4NA 5IVHA 2HHAA 3BIXA 5HKAA 3ZWQA 2Z3ZA 4G8BA 3K2IA 4NMWA 4QEKA 5JYCA 1DWQA 4ZRDA 4A23A 1QO7A 3FLAA 3GUUA 2Y1KA 3FYUB 3WJ1A 1P0PA 2AJBA 3FNBA 1K6EA 4XIIA 1I6WA 1THTA 1EX9A 1BEZA 3VKFA 1LGYA 2GBCA 4F5ZA 4CCYB 3DL4A 2G4LA 4FKBA 1EHYA 1BU8A 4GWLA 2OCGA 3HEAA 1QIIA 5HZGA 4N5IX 3W06A 2XMRA 2XQFA 1EXWA 2HA3A 1IUPA 4F21A 3H2JA 1XZCA 2WSLA 2PU7A 1CUHA 4BC1A 4QLAA 3FCXA 4AB1A 1VJ5A 4TPKA 5LZ7A 3WI7A 4YPVA 3G9TA 4LKOA 5JD5A 2GBFA 3AJAA 1K63A 5JAHA 3WYDA 3JW8A 3BE8A 3WKBA 5LZ5A 3BF8A 1AZWA 1QFSA 2V98A 4BAGA 3DYVA 5AI0A 5FRDA 5CRIA 5CW2A 5A6VA 2C4HA 4GBGA 4BCCA 3D3NA 3TJMA 1E66A 4UHDA 4K6HA 5C8XA 4C88A 1J07A 3EQ7A 1OXMA 2ZYIA 1ODCA 2J3QA 5HKBA 2QUAA 5HFAA 2WILA 4L3WA 2CZQA 4H7EA 3KSRA 3NWOA 4GXNA 3RKSA 1Q84A 3OC0A 2XUDA 5IH7A 1CR6A 2AJDA 5JARA 5D6OA 1XZFA 4AZ3A 3B5EA 2WTNA 3G0IA 4Q3KA 2OQIA 1VZ3A 3L1IA 5AIBA 2ZYSA 1Q0ZA 4LIPD 4AQDA 5AI6A 2CJPA 3GELA 4Q82A 2XQGA 2H9YA 5ALNA 4Y2TA 1XKTA 4PF1A 3STXA 2DHCA 3W9BA 1X70A 2XUGA 1F8UA 3DJYA 3O0DA 5AM0A 2WIDA 2AJCA 4E11A 4MJ3A 3WK8A 4G1FA 4E14A 2XUAA 3WL5A 2BUBA 3WL7A 5K3FB 3WZMA 3G0GA 5JZ9A 4KJXA 4QDUA 4ZI5A 4J0CA 4J0IA 3DLTA 4FFWA 5CT4A 4H7JA 3FLEA 1Y7HA 2VATA 2EEPA 2WM2A 1YR2A 2HU7A 5AOAA 1W6RA 1XFDA 2NW6A 1H23A 3G7NA 4WDRA 2BKLA 2OLEA 2PUHA 5ALOA 1J2EA 1L7AA 4B81A 2XUKA 5YASA 4MXDA 5LZ4A 5LKRA 4K5QA 4DYHA 4B9EA 3HSSA 3D2BA 3VISA 1Q83A 5EI5A 1CUXA 1DWPA 3AINA 1AURA 4BAUA 2ECFA 4I4CA 3IB3A 4A16A 1DT5A 3H1AA 3BDVA 3EIOA 5A7GA 2V96A 1MO2A 5ALWA 4AO7A 4BCBA 3I2KA 2PUJA 1SCKA 3BDIA 4J3JA 4A5SA 3VVLA 5DTIA 4X94A 1UKAA 1YS2X 4ARBA 1Q0RA 4X7BA 5CMLA 3STVA 3FYUA 3QMVA 2VQ6A 5EHQA 3ESCA
chains in the Genus database with same CATH superfamily
3I9V1 3KO8A 2KJQA 4Y2RA 2GEVA 1CS4C 2P0AA 2B8NA 3ADBA 2EJVA 3SF8B 3FPLA 4X1OA 3I5XA 1E5LA 2EX1A 1U90A 1UP4A 1OI3A 5JXJA 4B31A 4WAUA 1L7VC 2PNJA 1L7OA 1QAOA 3KZOA 1Y9DA 1XL0A 4JC0A 4YLGA 3WKDA 3EPJA 4JOQA 4UVIA 1DX4A 1MORA 2PGXA 4TLBA 3S29A 1TLTA 3NCHA 4D4KA 5BXQC 2QV0A 1EE9A 1N5LA 3EGDB 3SWWA 1SOAA 2V7GA 2IH5A 1HZZA 1TE2A 4MS3B 3RYFB 3HKDB 3I2FA 3KJHA 3RU3A 3PR1A 2IS6A 3FDXA 2JI6A 1NA5A 2HV9A 5H59A 3X1JA 2BISA 5BSEA 5BR1A 3BFXA 4OXIA 5C18A 3TTVA 3SLKA 1KOFA 4CM6A 3WDSA 1QH9A 1VSVA 5TRTA 1HMYA 4AQ7A 1RYMA 2VSXA 1DIOB 3QU4A 1Z33A 2E4ZA 5DXFA 2VJDA 3S8MA 5MGNA 4C04A 2WJWA 4N8SA 1T25A 1MJ5A 3PUZA 3MPUA 2OORA 5ER9A 5LQKA 2Q2VA 1G3IA 4UD6A 3SHFA 3IUEA 3MLEA 3VV3A 1NE2A 2Y1XA 1XSEA 2A5YB 4JUCA 1X3LA 1JR4A 1PWZA 2BBTA 3A6HA 1JHXA 3EF3A 4QU0A 4TV9F 3WL4A 3DXYA 1Q5PA 5BY2A 4XVRA 5CAEA 3Q3IA 4WNYA 1Z37A 2IY7A 1FFXA 1ID1A 3W5SA 3WGGA 4KUEA 1Z62A 3G23A 4TWBA 1HI9A 1P5RA 4LWOA 3HCFA 2CVPA 3LA6A 1WS6A 4IIFA 4KNVA 5EINA 2IBSA 2O54A 3CNEA 4G9GA 2QPLA 3NHYA 3NYWA 2JLQA 3OF2A 4Z3DA 3KQLA 1ENZA 4QU5A 3EZ6A 1BE6A 5E6RA 3EG5A 1U1IA 3CY6A 2YMPA 5IZCA 4RF2A 2XVYA 2QV7A 521PA 1CY1A 1CQWA 3CLKA 5EMKA 2G0AA 4B2LA 2X4GA 1UWLA 4D0LB 1QF7A 3OZAA 6LDHA 2JFNA 2DJ5A 2Y93A 3ICPA 3MMSA 3PGXA 4QQFA 3SIPA 3A1EA 3WA7A 1QS0A 4KEAA 1J25A 4YT2A 4NOKA 2FTKE 4XDYA 4S05A 2Y68A 1QVZA 3EEYA 2IYFA 4GZ3A 3VQTA 1DX6A 1KR5A 3M7IA 3K5HA 2VWQA 3MILA 4J7UA 1X1BA 4JEHA 5HZKA 3KOUA 3HC7A 4WBSA 1O2DA 3B1VA 4D9BA 5LJLA 1QPBA 3LXUX 1QF6A 3DVQX 2J33A 3G88A 3IC5A 5JDCC 2XD4A 3GEEA 1JVSA 4LDRA 3CS3A 2BV3A 4WZAE 4RIHA 4DEXA 4DLAA 4KLAA 2ZBGA 3HUDA 4G0MA 3T7JA 2D5CA 2Q45A 1TK3A 3CPEA 4KPYA 5GY7A 1XTKA 1HL3A 1T6NA 4QGAA 1RLOA 1U2DA 1TZCA 3FMGA 2IU4A 2J3IA 4GLBA 1VOTA 4HEA1 2VUUA 4P4SA 2I2AA 4U7GA 5TXGA 4CIDA 1QP8A 3WADA 1UF9A 5L4LA 1NUPA 3D4BA 4RM2A 5A7HA 1QTIA 2IFTA 1N8KA 4YCDA 4CCSA 1M2OB 2NUTA 5C8VA 2YWJA 4LF8B 4NENA 5J43A 5DCLA 4LJ9A 1G6KA 3UFXA 1IEWA 2AHOA 4BMSA 3N53A 3OEEA 3O1HB 4V0KA 4F4CA 5ERGB 4O63O 4J1NA 1ZLXA 2XTMA 3FXAA 2VT2A 3OEED 3PFCA 3I2JA 3RUEA 5ICGA 3GRRA 4M1KA 3CRZA 2EKZA 3H6HA 1A7JA 3KWMA 3EBLA 3NEYA 3QVXA 5MDHA 3BIWA 2FSSA 1JJBA 2Q28A 2Z8YA 1UAYA 1PT8A 2EIHA 4G9BA 1J2TA 1H2YA 1FU4A 1T0BA 1WKCA 2CHUA 1UWCA 3ITKA 5IDVA 5TMEA 4C3VA 3Q40A 3IUMA 2O0KA 1TYBE 2FPPA 5AI9A 3PQDA 2ECPA 3RV4A 1OX6A 3FVTA 1C8KA 3QLVC 3UPTA 1EBBA 3UJ9A 4LXQA 3CLRC 4ALMA 3WLSA 3G2MA 3T1QA 2ERYA 2I66A 3DKVA 1NRXA 2O50A 3NV7A 3SU8A 4UTPA 2XNJA 1DKQA 4PR0A 2A88A 2YQZA 2YWFA 3M4ZA 3GK3A 5AW9A 3TPFA 621PA 5ALGA 5J40A 1P8JA 1GAQA 3GJ7A 4HNGA 3WWDA 4BEBA 1KARA 1F14A 2QQGA 1ZIYA 3BWVA 2N47A 4IRUB 4II3A 5JAZA 4B4DA 1U8FO 3MVEA 3HXQA 1CQZA 1FL9A 2F64A 3R7WA 3QK7A 1K4MA 2I3BA 4Y1FA 5TMDA 3CUUA 4I46A 3IBCA 5K8JB 1CNEA 1M7GA 4YYEA 4FB5A 4L5CA 3DGFC 3S8EA 3HABA 1WB9A 2PXCA 3TX2A 5KZMB 4GZ5A 2Q4TA 2O7VA 3AVVA 3DP7A 1SC1A 3THXB 1E77A 1O9GA 4DWVA 5G1OA 1XTIA 2HDOA 2PZMA 4EKNB 1WP4A 1C9EA 1HDEA 2W58A 3UKDA 4C9BA 4N01A 2PY6A 3JQFA 2OD2A 2BEVB 2WYVA 2NUPA 5CLQA 3NHZA 3A2NA 2NO0A 2BYTA 1R8XA 5DXAA 3AC0A 5KQGA 2FFRA 4EB6B 4E5YA 2BP7A 3GPCA 4MKHA 4V0SA 3WGMA 1WV1A 2OUKA 4ZVLA 4AMGA 4DZZA 4DMRA 1KEEA 2QQ0A 3LLSA 1JKMA 5HRCA 1O94A 1K08A 3Q9LA 1OY1A 4GYWA 3TMKA 1P0QA 1I5EA 2BEJA 1KKUA 1O94D 1V11B 3NXKA 4PRKA 2VRWA 4PIVA 4B3BA 5C4MA 3ZWDA 5DE3A 1AK2A 2VLBA 3D6JA 3M5PA 4IZIA 4EFKA 2DRIA 1MO3A 3DVAA 1PNVA 1IRXA 1Z5VA 1X8XA 1X9IA 1XQVA 4NG5A 3W6UA 4YUWA 5B64A 3IP3A 1J70A 4KRXA 3TGWA 2E1PA 4N54A 1TKAA 4HTAA 2JFYA 3R41A 1JEAA 1EDZA 2G1UA 2PGDA 2QY6A 1ZJZA 3A1TA 1XIVA 1X9GA 1DOAA 2KLBA 4LZOA 4RY2A 4K6GA 4D56A 5IS2A 2PLNA 3HJGA 2X14A 3F5MA 2QU8A 2PGAA 4NBKA 4Q01A 4LWZA 1EFRD 1WU8A 2IZOA 3T52A 1AUVA 5LUBA 3V33A 4HCJA 4W63A 1CWUA 2FLWA 3FWNA 2W4QA 4HS9A 1EGVB 2JFVA 4P3PA 3RYCB 1B41A 1UXJA 1EK2A 1PZFA 3VJLA 4PWYA 3SXUA 4MW4A 1XDUA 4DBLE 4OB6A 5DHUA 5C35A 4KXUA 5IC4A 4MDFA 1ZH8A 2CYCA 2HPHA 2QYSA 4B44A 1XZPA 2E55A 2WABA 1UKCA 4JGGA 2IYXA 1TEVA 1YB2A 4OQZA 1T8WA 4IJ6A 1VHQA 3OOHA 3RYHB 1BQEA 5GZ3A 1AQNA 1GVNB 5LQNA 3LO8A 3R7NA 2C5FA 1Z0KA 3BGSA 5KYTA 1RHJA 2I34A 2CUKA 3E84A 4M76B 1UK9A 4KR7A 3V7NA 4IS3A 3W2IA 4HAOA 2NWQA 4WIAA 1NBEA 2PYDA 5A62A 1UQTA 1V3VA 2FR8A 3QELA 1QUFA 5I8ZA 3SQMA 1CRQA 2QOEA 4KVFA 3ZDQA 2Q46A 1ZD1A 1EHIA 2UUPA 1XZKA 2WUWE 4S1PA 1CE8A 3U31A 2Z56A 3HS3A 4B73A 3ZR4B 3VHRA 1VMIA 3NVMB 5C32A 4MWDA 3ZBTA 3TOVA 4PC3A 5KYUB 3REQB 1ISFA 1IXKA 4D45A 4DLLA 4DABA 3IE0A 1OZHA 5TPZA 5FEUA 4R3WA 4Z0HO 4MWOA 3THWB 3DDWA 2QTNA 1TVKB 4IMPA 1Q7GA 1NQUA 4MDHA 3L79A 5JNRA 3ZXYA 3OLCX 3ZX4A 3ETLA 4KE8A 2CDAA 1NBMA 3A3OA 1X13A 3EXFB 2RG7A 5DNDA 3UN1A 5KYWA 3FVWA 3BXPA 1UDCA 2P1ZA 3COZA 3OPYA 1NBMD 2J6CA 1L5RA 3W9UA 2YZKA 1W581 5CDYA 3WMFA 4QTUB 2W48A 4FFVA 5IT0A 5B7PA 1BEEA 1M1NA 1OYOA 1XDDA 1XWFA 3EA0A 4J49A 4YAEA 5JI2E 1QIDA 2RJOA 3E2MA 3MXTA 1KIAA 3WGUA 1KWGA 3MJCA 1KJWA 1Q92A 2LV8A 2QJFA 1AO3A 2IW1A 1CRLA 2IP1A 1SPBS 2JCYA 2R66A 4G0ZA 4R8RA 1DHRA 4HOYA 1BCRA 1DUSA 1RBQA 3FTDA 4UM7A 4PWZA 4NBLA 4CM4A 2PUGA 1G5PA 1SELA 2Z1DA 4LS3A 2FLVA 3SC2B 2DLCX 3NNSA 4F8JA 1EAYA 4NESA 1O0SA 3NUZA 1N2HA 3DR5A 2WU3A 2A5DA 3F78A 1PWEA 3H9GA 2MYPA 4HGOA 1DO2A 4OYHA 2CV0A 1QKIA 4NMMA 3OJXA 4H0NA 3LO5A 1V2GA 4X1KA 4V0QA 3ZGNA 3WLNA 1L2TA 3CVYA 1BQ4A 3QE3A 3M1AA 3LVBA 3OU6A 1JSXA 1BW9B 2EGHA 2ID7A 2R9VA 3B36A 2FETA 2JRCA 4N3CA 4Q7JB 2YXDA 3E5HA 4AG6A 4MS4B 3TLJA 1DBQA 2GD6A 4WZBE 1ZOOA 5LFAA 3Q5EA 5EIFA 4EY8A 1MXHA 4D9FA 4GOOD 3P71T 3KVVA 4OI1A 1GCIA 1U9IA 1YZYA 2EJCA 3KR2A 3F5SA 4P2BA 1S01A 1W36D 2L19A 1CY7A 3CSSA 4WKCA 5LM3A 1KL7A 3GQVA 4L4RA 1YZLA 2VG8A 4FOTA 3PNOA 5DWVA 4PR3A 2IYYA 3QU9A 1V2HE 4CEJA 3CVOA 1VHDA 2B7BA 4F3YA 4N0MA 1BGWA 4Q9HA 4F0JA 3RAJA 1BWRA 2QZ9A 2QN9A 1I2CA 5TT0A 2D0DA 1SHJA 2P2SA 3OIDA 4CUZA 4LI0A 3INYA 2HK7A 2V7QA 3GLHA 4C7VA 3FUWA 3KR9A 4DLPA 1Q1QA 1IXRC 2WWXA 4MMZB 3U7RA 3OZXA 3TI9A 2V7QD 1NMQA 4OFWA 5EMMA 2ZYVX 1VA4A 4FFPA 2VJPA 4ZO8A 5TDHA 5F9FA 1MAUA 1SCUB 1V5EA 4GGMX 1YXMA 2EP5A 4JEIA 2Q7DA 4UNSA 1HOXA 3KKQA 3L8YA 4WY8A 5ESXA 4WTOA 1OILA 2H4JA 3CRMA 5J1SB 1AGPA 1RKUA 1EH5A 1LI5A 5BMVA 3CF2A 2OHXA 2LWIA 4FK8A 1EB8A 3H86A 3CLSD 3EQZA 3GRVA 4L07A 1BYIA 1QRAA 2RHGB 4LJLA 1EP1B 2ACVA 3PDCA 3QITA 4P4NA 1FLVA 5P8WA 4BX8A 4N76A 1QGZA 2NTVA 4Y0AA 3T7KA 5KYXA 4YP7A 1HSZA 3FCEA 4U4AA 1EP2B 1G3MA 1Z7BA 3ILSA 3BVPA 4FW8A 1HQCA 3VSAA 1LS1A 3I6ZA 1ZH0A 1N2JA 2AC2A 2I1QA 2OFXA 4M38A 2ZVQX 2ZXUA 1J49A 3R7SA 4JJGA 1VIDA 3GC6A 1J2YA 2C9YA 2QRNA 3HYSA 3HCBA 3TTXA 4BTLA 2XE8A 3GIDA 4BBAA 1O5IA 4EHBA 1SVMA 2O14A 4WK6A 4LCJA 4LOKA 1GNLA 2X3UA 4BE7B 2NVUA 2ZB3A 3V4FA 3CKKA 3Q7IA 2XGSA 3FGNA 3TE6A 1CUEA 2WC1A 4RHFA 4EY5A 3ZDBA 1A27A 3S55A 3EVCA 3RK4A 2O8DB 4L4XA 1US8B 3BCHA 4CLXA 1N34B 4LF4B 4D8XA 4MYSA 5HCUA 4R84A 1NV9A 2C7OA 2CGEA 2HQRA 4UBJA 3P2IA 2VTBB 3L49A 3VJRA 1NJGA 2QMQA 1KXZA 5HS4A 3EHEA 3QUTA 3VMMA 5B1EA 5FOXA 3VHLB 2Z6UA 2PZEA 4Q39A 3PFFA 4HDAA 5HDQA 3W2EA 2D2IA 1EI9A 1HRDA 5AK4A 4ZVKA 4ZVQA 4GEKA 1NVMB 3HJAA 5CJ2A 1SO8A 2AXEA 3JQRA 4DHWA 1DIHA 3C1AA 4I1SA 5F2OA 1JBKA 4WJLA 2K7ZA 2BGLA 1Y1PA 2M1ZA 3OKAA 2GKOA 3OPMA 3LVQE 3DB2A 3AEQA 4LV8B 3HJNA 1V8DA 5D3MB 2A5FA 5ADWA 5KYGA 2FPOA 3HYCA 3ZJTA 1EWVA 5H68A 1Z6ZA 4BN5A 5ITWA 3VH2A 2QLNA 5EJIA 4MJLA 1JG2A 4EKDA 1JDVA 5BV7A 5JSFA 1M2FA 4O1MA 1SWVA 1XRRA 3MM4A 3QKWA 3Q9UA 4WKBA 3RF7A 2E4WA 4EJSA 5CFPA 1N2XA 1PR9A 4KKXB 4LNUB 3RUCA 3Q8LA 3EVZA 3T5CA 1GTG1 2P8JA 2VJCA 3B1FA 3TF5A 2UYOA 2C5SA 2CXQA 3A11A 3ITNA 4G8DA 4ITVA 5CEEA 4MR7A 4RGVA 3ZZ0A 2Q6TA 1SHUX 5A71A 1P2UA 4DMGA 3HV2A 3GFPA 4WGGA 1USKA 4GPZA 1H3EA 2WEKA 1NQWA 4L85A 2D74A 3OIVA 1JA1A 1PGQA 1AV6A 5A0TA 5BQPA 2NU7A 1DP4A 4GSYA 4INPA 4PRZA 3G3EA 4OBBA 3PUKA 2BZ0A 5DISB 2VF4X 1LA2A 1SD2A 2DUMA 2QNRA 3EAQA 3IEUA 2WJJA 5CT9A 5K3BA 2C3UA 4KFTA 2BGIA 4WOKA 3WHKA 4MEAA 1XQWA 4HNAB 3AOGA 3WRVA 5AUOB 1AB6A 1HA3A 3HU2A 2P77A 3OI7A 1WSBA 3LT1A 4EVRA 1G0OA 4PZ9A 4C20A 3D8RA 5LOVF 2W2MA 2BZGA 2V3WA 4FFOA 1T5SA 1VL1A 1YA4A 2E48A 5AKZA 5FUXA 3RC7A 3TZEA 5CLFA 2QT9A 3BB1A 3A4MA 3OIGA 4F97A 2X7JA 2FUG1 1JV2B 5IVIA 3QEJA 2IQ5A 4I4NA 4I50B 1ZA1A 5C1PA 3V48A 4GOLD 1JU9A 2RGCA 2R6GA 2CJXA 1BWQA 4N3BA 2QIPA 2XOKA 3JVEA 4X3OA 5D87A 1VYHA 1NXPA 1XLVA 3SEFA 1JDZA 2XOKD 3JTMA 3NRBA 1QH1A 1YE8A 1AXRA 1V1JA 1P9RA 3EDOA 2QAGA 1P7PA 5LQJA 1ENYA 1RLTA 2DERA 3BA6A 4WKNA 1MT0A 5LQRA 4AWAA 4PCAA 4B83A 4DYDA 2ZB2A 1PWXA 1AUQA 3C2QA 3LY7A 4F5YA 5JC8A 2JFGA 3GPDG 3IULA 2UDPA 3W2FA 1NW5A 1XEXB 2Y9MB 5A4IS 3T3PB 3AOEA 1Z8HA 2YY5A 2XTJA 4O4LB 3SJBA 3LBIA 3P0EA 3KQKA 3UQZA 4Y2UA 1UEXC 4KMRA 3L40A 3M6VA 1GSAA 3UAWA 3OPYI 1XLTA 2CKDA 4IJMA 3GRCA 3WIUA 4DV7B 3HXTA 5IPFA 3AUAA 1XPJA 3B3GA 2A59A 3MLBA 3PFWO 3R3VA 5AHWA 5JH7B 4MV7A 4P8RA 4ZPJA 1NXQA 2NQ2C 1NV8A 2XMGA 1GL3A 2NX2A 1NULA 3O8CA 2TYSB 2L18A 2OK8A 2V9PA 1IQPA 1DX9A 1QG6A 1MG5A 1YQGA 5G0VA 3KAQA 4GLFA 5DLPA 3F8SA 5JQGA 3JVDA 4IG9A 2JDID 3T0GA 3U4DA 1E6EA 4J7CA 3ZHBA 4A8JC 1GZ6A 3FTNA 4ZVVA 1ICIA 2ATXA 5LZ2A 1ECGA 5CX4A 1GG9A 2XQVA 4H77A 2K87A 4CMHA 4XAQA 2VJOA 3K6JA 1EFVB 1TUGA 3LSTA 4CRWB 2XZPA 3FGOA 3BREA 3X1KA 5FWYA 2FI1A 3CO0S 3IIIA 1H2ZA 3FSRA 2B9VA 1DCTA 1E99A 2RGNC 1KOLA 1FLDA 2R6JA 4JX8A 5I7WA 2EL7A 5DBFA 2YXBA 1EFTA 1F06A 1Z5GA 2ZOSA 1EWTA 1JLKA 1ZHFA 1NPYA 5DTEA 4LXIA 2QQEA 3OJFA 2HI0A 3MELA 3OCJA 4QWWA 2JHCA 4BNNA 3C3KA 1MDBA 4LYEA 5EE1A 4I5FA 2Q0QA 4A0RA 5PNTA 1VBMA 1FFBA 3BD7A 1KSJA 1WKBA 4OHUA 3RUDA 2C9BA 2BR3A 3KJGA 1MQ9A 3L6OO 4FU0A 1PJZA 2WU1A 4YRNA 1K92A 3H2SA 1XCOA 3EXIB 3FWYA 4DL9A 2A1UA 1Z5WA 3DBRA 3CNLA 4BFTA 2YX1A 3KEMA 3NKVA 5E95A 3V1YA 5EESA 1FDUA 2LCQA 3S40A 4LHWA 4XM0A 3VUEA 5KUTA 3KE9A 4MV4A 3I2GA 1NFRA 2Q0XA 2VPPA 1GU1A 5DM4A 4R9VA 1HE4A 4L5AA 4EGFA 2FN9A 2IUEA 3WYBA 1IEVA 1JQBA 1RWQA 1RYNA 2CL0X 1OTYA 5DULA 3L1JA 1TQHA 3AIMA 1Z0DA 2BM9A 3PQ4A 2CHVA 4ISCA 4RA9A 1RI1A 2D4HA 3EZFA 4UDXX 2W22A 3E61A 2ONJA 4C4RA 1R74A 1YDFA 2VN8A 1DTWA 4FSDA 2V7BA 1RAGA 1TW2A 2V59A 4MR8A 2IU6A 2Q2QA 4QUDA 5DLYA 5B6IA 4NHEA 3HGTA 2C4TA 3BJRA 4X8LA 3MWJA 1D07A 4TSFA 2J9ZB 1QKKA 4BVAA 4XYLA 3GVPA 4ZXPA 5LXTB 1E2BA 1UBJS 4FGZA 5FPTA 1Z0FA 4TSFD 4MKZA 3NHLA 1D2MA 1QLWA 1UK7A 1VSTA 1FDSA 2ZE6A 4IZ6A 4MA0A 3HN6A 3QE0A 4OFXA 4UVEA 2HXGA 4I5GA 2R6ZA 1XCPA 3R40A 5ALVA 5HKOA 5HEKA 4CKEA 1V16B 1XN1A 3HSKA 4IQ4A 4S12A 4H1UA 3N8GA 5BW8A 3AY3A 5ESWA 3IQXA 1KS9A 5AYVA 2G1AA 3HDGA 3JD2A 4QEDA 1OVMA 3L6BA 5DHFA 3SMQA 3Q12A 1ULAA 2O2DA 2IE0A 1FSFA 4OBWA 4UOQA 1YVEI 3T4UA 3DWFA 3H87A 1Z5ZA 2IY9A 1G41A 3DXZA 4RK6A 4H35A 2XRMA 4EZBA 1MCZA 1PX0A 1UMCB 4AN0A 4UQPA 4INZA 1MO4A 4KYIB 1DMRA 2V7UA 5CX1A 3RSQA 5ANRB 5IHXA 1JFRA 4XQGA 2XV1A 4MWSA 2POCA 1M8PA 4MV8A 4N7BA 4V0OA 3N3AC 2JCSA 2ZI3A 2PN1A 1UBOS 4ZALA 2QTAA 3WWCA 5U4QA 2HFJA 3FCAA 1P9NA 5AUPB 1VJTA 4N5HX 3DBIA 4HWGA 2A4MA 1USWA 3OOJA 1C3LA 3IQWA 4JT4A 1XO1A 3V3KA 4KQFA 4YAIA 3C8DA 5FEMA 3SBXA 4ZZ3A 1QYIA 1I33A 1ZPDA 3KEFA 1ECCA 3W7AA 3KJIA 4J6FA 4X95A 1GNTA 1V9SA 3TW8B 3ES9A 1JHOA 2OYSA 5M7EA 1Q1EA 1P4JA 2IW3A 1UZNA 4F06A 3PXEA 3LQQA 3UMBA 4A8JB 4CQLB 1GV1A 4QJBA 3A31A 4I55F 4X8HA 5H0IA 4L9RA 3VPSA 2DBVO 1OF1A 4TMWA 1P4AA 3EQ9A 1MNQA 2HF7A 2J3KA 3HA5A 4B87A 4NARA 2X41A 1CUJA 3KTAB 4ONEA 3GEDA 4U6SA 1PEAA 1XHEA 4OQFA 3WAKA 3PGKA 4B7ZA 3K16A 1LTHR 3O8BA 4TN1A 2OO5C 1YNSA 4ITUA 4B43A 4IOLA 1WMFA 4FMCF 3NTQA 1ZU5A 2H0AA 3HXPA 3VX4A 1HDZA 2G76A 2G71A 2O8NA 4KQCA 2GD0A 3WMXA 1GT6A 1P8AA 1U2GA 4ZI7A 4BMNA 1IVNA 2DKOA 1Q0SA 3D0OA 3GCXA 3LLCA 3TOCA 1NC3A 3FWZA 5KSYA 1RMQA 2Q50A 3N2KB 2YWCA 5FWAA 5HRUA 1O3YA 1LJLA 1QORA 1SQSA 4G5FA 4BB0A 3VOSA 5KVAA 1Z45A 4KI7A 4YFVA 3ZH2A 3FZQA 2D7CA 1R2QA 3AGQA 4G89A 3HFGA 4ZICA 2JGDB 5A7FA 2PT6A 1CT9A 1N8NA 2CBGA 4YCAA 5PGMA 3UAGA 3UJ7A 3GJXC 5CFNA 3ZIAD 2QNBA 2QUZA 3GD7A 1IZ8A 4PHTA 3I1YA 4PVDA 4WLUA 4Y9SA 5DK6A 3TN7A 4C4YA 4DCPA 2HK9A 2YZMA 3SE0A 3O8QA 1QOQB 1U2SA 3PQEA 4LRUA 1KYQA 1GPWB 2CXNA 2BR4A 1FTWA 3JAKA 2Z83A 3MZ0A 5JAQA 3C87A 3AR3A 4YAKA 2HDNB 2XZLA 2ATIA 5JWRA 2BM8A 3T0FA 2O8CA 3GVHA 2W2KA 4JL5A 2ONYA 3ASYA 4NEHB 3T9EA 2FEXA 2PUEA 1LDBA 4OQXA 4C4SA 3DS8A 1HGXA 2UZ1A 4G36A 4XD2A 3F6SA 4PX5A 4XWKA 1Z82A 1N1MA 1YB4A 4L78A 4CM3A 5KSZA 2BKVA 2GASA 3IUSA 4I8DA 3ZD6A 4H59A 4L0MA 3CCBA 2HMUA 2QRUA 2G5PA 1E9SA 3ICVA 1IN4A 4OHXA 4P53A 2COKA 5IHPA 3FNRA 3OIUA 2GPTA 4KODA 5JSQA 4PZYA 3M33A 2RKOA 4AMYA 1LLFA 2P6UA 4KO4S 1KFCB 1JSZA 4QE3A 3HBFA 1K0FA 3IT3A 2UVDA 4L4YA 3AJEA 1FFGA 5B37A 2JW5A 3DV9A 2VNKA 3A32A 4MA4A 3UJHA 4ESHA 3QE9Y 3T5BA 1I01A 3LHIA 4X45A 1VKJA 1P6QA 3UAYA 1V1RA 1BN7A 2A30A 4V1CB 1THZA 3H2BA 3RBVA 1JEYB 4DADA 4EO7A 3E82A 5D86A 1Z0IA 2AE2A 1ACMA 1IM8A 1HE8B 1LXCA 3L0YA 1T5DX 1UEJA 4UMFA 3RVRA 3T5MA 4YV0A 1ZO8A 3SLRA 1ELOA 3NDJA 2UXDB 3FPKA 5FL3A 5EKSA 3JQAB 1RU3A 3BF7A 4IGKA 4LHZA 4ENSA 1BHSA 1YDEA 2GZAA 3Q3HA 4C6TA 2J31A 4GECA 4PG4A 5DX8A 1VPDA 3T5DA 4ZZ1A 1ISSA 3ZV5A 5F3RA 1EVLA 3W90A 1BXGB 3D31A 4B8WA 1F8FA 2YINC 1U28C 3R3WA 2QRGA 3MCVA 4IXMA 1LQ2A 3SSOA 4GUAA 1VJGA 1K68A 2C95A 1M0TA 3P9QA 2JB9A 2HOQA 2O8FA 1TVMA 3DMGA 5C4GB 1PJBA 2LTAA 2OILA 4KLCA 1TMOA 1XFAA 1K8QA 1U3UA 5BR8B 1AGYA 2O2JA 1VG9B 1QAQA 2W6PA 3C3WA 3RGWS 4N6NA 1CDZA 3I04M 1ORVA 4Z99A 1OA1A 5BQ5A 5FWXB 5L3QB 5J2TA 1NUHA 4BZZA 4Z8YA 5EWLA 4RMJA 1BNCA 1Z34A 2G25A 2FN8A 4IMIB 4LUCA 4EL0A 2HV8A 4MQ5A 1EDBA 2GPNA 1SXHA 4QSMA 2D1RA 4TSRA 1EGQA 1TM3E 3BGIA 5EZYA 4D26A 4LTMA 1C9YA 4PANA 1E3QA 2BLLA 2DWUA 2JLVA 1ST2A 1N9KA 4NH0A 2WVAA 2J3DA 4X41A 1JLRA 4RMIA 4NC9A 2HSWA 4CN8A 5FL7D 3L0SA 1MRSA 1QMGA 3QVKA 1KVTA 2FVYA 1AJEA 4ECEA 4Z7QB 2D2EA 2V6GA 1LTKA 4IXNA 3T54A 1SVNA 1P0FA 4HDNA 3GJTA 4M98A 1OLUA 1ZP6A 3EWSA 4RS3A 4BGEA 4Q9AA 4I0WB 3TIXB 4ZI3A 3LIPA 2W2VA 4I6GA 3SQWA 1U5CA 5CG1A 3TDMA 1U8TA 5T3YA 1GGVA 1U2PA 1GXSB 2EKDA 4I4IA 3IRUA 1SG0A 2PWPA 3INGA 2ZYHA 3SVZA 1RWBA 5BNTA 3Q1KA 1B42A 2QXTA 2YYYA 3AYXB 3S5UA 1LVHA 1WZNA 5P21A 4BBPA 2QYHA 1PO7A 1B8VA 2PIDA 3I5MA 3N05A 5AWFC 3VYUB 2KX7A 1Z63A 2VPQA 4HDMA 2WG0A 4JP3A 4BQQA 4JQZA 3H3FA 3TVDA 1JNYA 1L8AA 4FZVA 2O7NA 1A9ZA 2NV0A 5IP5A 1JALA 4EYEA 5EKTA 1CS0B 5J23A 4U02A 3OURA 1EINA 3GGJA 5IJXA 3ZCTA 4AULA 1NZFA 1T29A 2CW5A 1PK7A 3ENWA 2ZRBA 1NX9A 2W11A 3LVRE 4M0KA 3PHCA 5THXA 3UATA 4LDPA 3IOYA 1YA8A 3BE6A 2I3GA 5DI3A 4FYKA 3CTPA 4G4SO 3GPIA 3NJRA 1QPGA 2EL9A 4MH0R 1U5AA 4OHPA 1I13A 4KN6A 4Y7DA 3MT9A 4C6RA 4C05A 3D81A 2O1SA 2TMYA 1Q7RA 1UQUA 2Q1TA 2IX9A 3VPCA 1H5UA 1U0JA 4G65A 1JFTA 3K31A 2G17A 3BG5A 4PPFA 4HL6A 5CVTA 2ZKIA 1DS6A 3K5WA 1S5PA 1AQUA 3GBPA 2JK1A 2MSKA 4AUNA 2CL7X 1EFPB 1TQ6A 4YJ2F 3BK1A 4DNQA 2V8OA 3E9CA 5B2ZA 2VK2A 3WYGA 2YCLA 4Y1RB 4OG2A 2ZSJA 4TYMA 4UNQA 2EDCA 2XYGA 1Y6ZA 2DB3A 2UZAA 3AVXA 1ULUA 3E5NA 5EEGA 2XMSA 4BO0A 3E53A 2AF3C 1YDHA 4UHKA 3VPBA 3DEJA 1EK1A 3H1PA 1PL8A 2C5BA 3C3BA 3QOYA 4MVXA 1GA4A 4HDRA 5K09A 1UKZA 1HZZC 5AUNB 1HX7A 2H57A 5DP1A 1BH6A 2F8LA 2FSFA 2D1TA 1V7CA 3D1LA 5BQOA 2QRMA 3RVJA 1EDEA 1P2FA 1QZZA 3HJRA 1NU6A 3UK6A 4MEJA 4KREA 3R7AA 1I2ZA 1TKRA 1YGYA 3KLOA 3NWEA 2ZSEA 1RQGA 4OHKA 4QJ4A 4PC6A 4TKMA 1BAPA 5FBWB 5GV7A 4D3YA 3LT5A 1GITA 3AY7A 1J22A 4XB2A 1W1IA 1TD9A 4JH0A 2AUMA 3QGMA 4L72A 4NBUA 4PTYA 4WNAB 4EB8A 1FNDA 1LD3A 1N1EA 2JAQA 2XNCA 2CLIB 3KYCA 2CF6A 3PICA 3GLSA 1YMVA 3OBIA 3C43A 3S6JA 1GV0A 4E15A 2OORC 4JLDA 1CIVA 5LQUA 4NZPA 1NVFA 1LBSA 1T1EA 2QD5A 4C21A 1A9RA 2R11A 2XMPA 1SZPA 2ZYRA 4ZJUA 2Q5FA 1OLSB 1U0NA 4FVTA 3ORSA 5DSXA 5A3QA 4WMLA 1T9AA 3F8TA 2DPLA 3BZWA 2XX3A 5B4TA 2GO1A 1U7UA 3SZ3A 3ZHZA 5HM6A 1NBIA 4ZJZA 1E9DA 4JJIA 5F76A 1RW4A 4HI0E 2GD2A 2WUDA 2ZYUX 3O90A 4D9CA 3E2PA 3P4YA 4DBZA 1O77A 3TXAA 2F8SA 3N5CA 1Z3IX 1I24A 1I7LA 2DM6A 2PXHA 2G08A 2QSUA 1W5EA 5E6SB 1PS0A 5GTDA 1MRZA 1U3VA 5IZCC 3KBOA 1SBZA 3B7PA 4UEKA 3LQFA 3MS4A 4DGSA 4Z49A 1KK3A 2ZYWX 3LF1A 2VI5A 3R9XB 5F4BA 4YRBA 1TOAA 3IDSA 3EMDA 1P1HA 4NZZA 3H97A 1CQXA 1KU0A 1YI0A 3R24A 3LW7A 3EXHA 1REQB 1IAVA 3KK0A 2LE0A 3I01M 1TZKA 2ODAA 3PPYA 3U16A 3R74A 4FSXA 5BRAA 3DO5A 4HAZA 4BNLA 4TV8B 1O6CA 3DZCA 2PX5A 4NH4A 2HF9A 2ZRMA 3HA3A 2FMFA 3WWEA 4Q16A 3NBFA 4ZYWA 2P9QA 1N57A 1PJ2A 4CLRA 1CULC 4QQ8A 1HURA 2XF8A 1E5DA 4A8HA 1YB1A 2IT1A 1HYBA 2AE1A 3R75A 1OI7A 2CLOB 4DA6A 3OO1A 2KE5A 5IW8A 4EHJA 1CF4A 1W25A 3AHJA 4RW0A 1KSGA 1VCNA 5T41A 5GIPE 1BIFA 1JIIA 2B3TA 3OT4A 3A6LA 4WLNA 4KNYA 1P2TA 1JJFA 3O4GA 3E7PA 4HAIA 1A97A 2ID4A 4PZ0A 4XRRA 4ERNA 4OI2A 4AK9A 5L9AA 2R44A 2EDAA 1XJ0A 2WG2A 1N2CA 1T91A 3V8NA 4ZHQA 3HO1A 4U3JB 4MDYA 1KYZA 3K6SB 1J2JA 3LPNA 1G42A 4RTJA 4ZCLA 3PUVA 3UMGA 3BSSA 5DWQA 4K9QA 1W8IA 1RJ9A 5CDSA 1AT1A 2AXQA 5K3EA 2BBSA 1FXUA 4NCIA 3I9KA 2XYVA 4EW2A 2BF4A 2XAUA 3DPSA 2BDUA 3GUHA 1SPXA 3WHLA 5MN6A 3N2EA 1GT91 3WRWA 4TVSA 4GKBA 4R68A 4X8OA 4LHEA 2H1IA 2BUCA 4DJTA 1T35A 1XTSA 1S2DA 1IHOA 1IBCA 2H3EA 1KNQA 3DZ8A 4EG3A 3GZ4A 2CE7A 2I67A 3ZXXA 3OCZA 2IV2X 1OKKA 2OQRA 4MVJM 2F17A 4EBFA 4YR9A 3JATB 3IHTA 2R5NA 4ZCSA 1N36B 3NBAA 3KKPA 4JA2A 4JJEA 4BEVA 3F7TA 3NHFA 5F35A 1CUVA 1JIKA 2XUIA 4RVDA 2Z2ZA 1AMNA 1CCWA 4R83A 1RFLA 5CEJA 5LKAA 1F6BA 2FSPA 2Q62A 3H4VA 3JU3A 2QUBA 3M6AA 3LBFA 3PEUA 4YJFA 1Z74A 1FNCA 1UC9A 4L3VA 5TC4A 4TV9B 3I12A 4QULA 1T4DA 1N7IA 4I14A 1PJTA 2FPIA 1RXEA 4LYAA 5HF9A 4CMAA 5MN5A 1X2BA 1TL7C 2IHUA 1NMZA 1K5GA 2PL9A 3A3NA 3WLFA 2F3QA 3F6EX 3QKIA 3D2AA 4B6QA 1P4GA 4LJ8A 2VQ3A 2UUBB 2YH2A 2HADA 1ENOA 3CR3C 2RFLA 2HO4A 3PIDA 5EJ2A 1W2HA 2HA7A 3P5BA 1XZJA 2QAJA 1XD9A 2ZE8A 3JQFC 4K28A 4KIGA 4TQAA 4YXWA 1KRHA 1LSJA 3N8KA 4TWZA 4Z9YA 3GLFA 5JMPA 3FUTA 1Y8RA 1JDBC 4YXWD 1A5AB 4IV5A 3M8KA 4UHBA 5DT2A 1QGED 1ISIA 2A92A 3QQPA 2WUEA 4LV5B 3I9MA 3X1WA 1RBMA 3O8OA 5H1YA 1WPXA 3N87A 4Z7JA 3UT0A 2ZBPA 5D7NA 5GIOE 3ANNA 4X9XA 1L5ZA 3ZDFA 2F3PA 1VHTA 3BXFA 1E63A 1HYQA 4JC8A 3PKJA 1QRTA 1IUNA 2FZLA 2OK7A 4NE7A 4G0QA 3RIHA 4EHHA 1F9EA 2MR6A 1K8ZB 1G8KA 2HPVA 2X5JO 3DW1X 5BURA 4BV2A 1DEXA 1H2RS 3KQMA 3X1DA 4BLRA 1UMBA 3C5VA 4N0DA 5J3JA 3VAZA 1JNXX 1YZUA 2O0HA 4IG4A 2JGEA 3W78A 3WOVA 2H8GA 2C2KA 1AF4A 2PX6A 1WKVA 3L6DA 3I9FA 4HRAA 4MGEA 3PRYA 1ZK3A 3U0VA 1FP7A 2ZI7A 3TM5A 2PO5A 2RIPA 1DI0A 3AVTA 4NZ9A 1VGQA 4UHHA 1DBSA 1G9TA 2DGDA 3PHIA 1RYZA 5LQMA 1NVBA 4PG6A 3UTDA 2AOTB 2JI4A 3LM8A 5DK4A 2D1SA 3QLUA 1E3TA 4G67A 5CURA 5JEDA 2OCIA 4DA0A 1N2SA 1KY3A 2V55B 1KK2A 2JLWA 1WXDA 3FZEA 5HKKD 5J1TB 1PT6A 1FOEB 1F6DA 2AFIB 2OV1A 3QXXA 4CM9D 1BG6A 1J6UA 1H0KA 4JIGA 4K6OA 4MR9A 3RYIB 2BFFA 8OHMA 4OU4A 3STWA 1BKSB 2GYUA 3QYJA 1ZD5A 1UIMA 4QUKA 5CNKA 4AVYA 3H42B 1AV7A 3PEEA 3MWDB 1HYGA 2CNBA 3HWX1 3CVUA 2HM7A 5EYPA 3OEWA 1BKYA 2ZTSA 2ZUCA 4MGZR 4RIFA 4Y1GA 4QYTA 2XCOA 2WIJA 3DMDA 4RFSB 4AJNA 4RCYA 2AZXA 4E4YA 3LGXA 4KDRA 4ND7A 3OZUA 4GLJA 4ER5A 5JLJA 5JXHA 2PX3A 4R8KA 3D59A 1ULHA 1S0UA 3PIRA 3IBFA 3R3SA 1JSRA 2HA4A 2YJTD 4TKUB 4RC9A 2J67A 2A33A 1K7YA 1MT3A 3BIFA 3PIIA 3M1IA 4EO4A 4R54A 2CXTA 1T3SA 4ENPA 3P0JA 1DKNA 3ELUA 4J1SA 2H16A 4LZNA 3F7NA 1WUHS 2B1GA 2GNPA 5CT5A 3G8AA 5BWOA 2RGUA 1TJ5A 1MKYA 1TRKA 4BGIA 5IX8A 1PJQA 1OLXB 1YRBA 3DMHA 1QX3A 2OVFA 3MWFA 1UC8A 3GBVA 3MCUA 3F9RA 4H3SA 1TM5E 1V1MB 1DAEA 2YS7A 3E1KA 5AQEA 4AFNA 4E5KA 3BEDA 1WEHA 3BSFA 4NOJA 1HT2E 3P5SA 5DHPA 4BO2A 4OL0A 4MULA 1R8SA 4BV9A 2AEFA 5FPHA 3G5MA 5KB3A 1F17A 2GK6A 2QP4A 4ZIRB 4Z4FA 4U2BA 4XLTA 5DCYA 5SZHB 1IY8A 2EX4A 3K0CA 2E6KA 1LW6E 1WHTB 1ZIOA 2GEDA 4JJ4A 2REOA 3CW9A 1BU5A 1MABB 3U1BA 3EDQA 1OT5A 1QRRA 2FY8A 4XCXA 3CGWA 2XUJA 2JJ1A 3F90A 3OTGA 4Z0TA 2WV7A 1TJPB 3NYRA 1TGYA 1QHGA 4DJJA 3IDQA 1N9GA 4GOND 2JJ1D 4TXNA 3NDIA 4AF7A 1X1EA 4ENTA 4M9CA 3FN4A 2YHSA 5JSHA 1MFPA 1RJFA 1JFFA 2ACKA 1NOIA 1ACLA 2AMYA 1NAHA 2BFDB 2H2FA 2ZIUB 5ERYA 3T3EA 1GLNA 1TCUA 3ON5A 1KZ6A 4YREA 2YDXA 2DWPA 3ND9A 4MVJP 3UCEA 3WL8A 1ADYA 1FUEA 1R0LA 1WHSB 3ZGXA 3VO2A 2DE0X 3HN2A 2OGUA 4U9HS 2F1IA 1Y1QA 1ZMRA 5CLLA 4F96A 1MJNA 3OPQA 4BJ3A 1N32B 2YHUA 3B1XA 3NHKA 2AG6A 3KETA 3D8NA 3H8JA 2CXRA 3F74A 3KQWA 3SJZA 3W4KA 3D0KA 3GLGA 1G21A 3NORA 5FADA 3ASUA 4KPGA 2PS0A 4Y2VA 3EEBA 1DAPA 3P7MA 2O2HA 1FTQA 4IXWA 4NCXA 2PTHA 3A4NA 5DGHA 1QG2A 4JI2B 4CVNA 1XPRA 4ZV9A 5EQDA 3KKZA 5JNSA 4W8OA 5EXPA 3WK9A 5JOQA 4WE3A 3UQYS 4LZJA 1Y1KE 2X0JA 4D3FA 3PPIA 1ZUIA 5CJPA 1CHNA 2IKQA 2J4DA 2R8BA 2YVUA 1C1XB 3OO0A 1UADA 3R5KA 1TJYA 4RV4A 3VU9A 5IYZA 2FMHA 3DZHA 1I9CA 5KQRA 5F5LA 5A06A 3GXOA 2WMDA 2C3MA 2F9MA 4G24A 4M37A 1E7MA 3OLWA 4CWAA 2BDTA 2O1EA 4HLUA 3H2HA 1YB6A 1C9KA 2IXAA 3PQ7A 4KQ9A 4LXHA 4Q0MA 2R84A 5F52A 9LDTA 2OWEA 1DIBA 3KG2A 4KXFB 3AFNA 3A04A 5FR1A 3PUHA 3UOAB 2YWHA 4M87A 4M89A 2OQVA 1CZUA 2DUUA 2GVNA 3CEAA 1T4GA 2YFYA 3LE8A 3OZ7A 4ML3A 4E5VA 2BGGA 2B8EA 3LUJA 1QCCA 4WESA 3PRJA 2B92A 1EXNA 2AWNA 4HRXA 3S2FA 1YVPA 1YE5A 3I6IA 1C3VA 3HA7A 4MHOA 4RPJA 4GYYA 2C3YA 4C01A 1JQJC 1NP6A 1UBKS 5K6RA 1QFXA 3WZLA 3OUUA 3O3CA 2B4QA 4Y2JA 2COEA 4BX9A 5H82A 3BMQB 2EV9A 5IAKA 1U63A 1RQLA 1EIZA 1JB9A 1OUMA 1Q0PA 2ASVA 2C4WA 2ZT7A 2WOOA 3IKMB 3KUUA 2EJBA 1C2YA 4QL3A 4QUGA 5HTOA 5B4VA 1XVVA 2IX3A 1Z2PX 3RLFA 3PGVA 2PMKA 1TPZA 3A6KA 4P7BA 3WB0A 1N5RA 2UYYA 3KEQA 2P79A 4HXYA 1QYRA 1U2ZA 3HBLA 4GYJA 4HDSB 5CUQA 1CETA 2K6GA 4PU0A 4UJ5A 4DB2A 4OQEA 1FNMA 3H99A 2X1VA 4DYVA 4NJOA 1NN5A 3IP5A 3B7WA 4JWKA 3SS8A 4JJ7A 3ZZTA 3A36A 5DTRA 3MJVA 5GJVC 4ES6A 4K3UA 1GG2A 1TQ4A 2ACWA 4E4TA 1DUVG 1BE8A 3GEPA 1YRAA 2GCEA 4BN4A 3ORHA 1P1CA 2HUPA 1X8LA 1E7YA 1GPKA 2XYQA 3GG2A 2I2WA 3AZQA 3PZRA 5GQSA 2BGRA 1Z88A 1ZIXA 3C1UA 4NPCA 1PSZA 4AG3A 5E3HA 1M73E 2AUNA 5G4LA 2GH1A 1G291 2P2DA 4PBTA 4EJFA 1WSDA 4EHKA 1H9CA 2PX8A 1W96A 4P4UA 4A6PA 5CB4A 3W5AA 1EGAA 4LQLA 1SCNE 3MB5A 1BX1A 5CDFE 1XQ6A 3MD0A 4Z86A 5IFLA 2SICE 4LXTA 1C0PA 2XTZA 2ZAYA 3DE0X 1JB1A 4JUDX 2I6UA 4X90A 1XLWA 5KC8A 1QHYA 1XL1A 1QKJA 3N39C 2Z09A 1YCHA 2C0PA 1DQZA 2OCBA 1E5TA 1TJ3A 3PFBA 1SU8A 1EUCB 1WVGA 2ZWOA 2QJTA 3KSUA 1C0KA 1ZNWA 2QSZA 5FTNA 4ZVMA 4PO9A 4OQMA 2IBMA 5HW0A 4HGPA 1XP5A 1E1NA 1Y7PA 1A7AA 2QJWA 3CUWA 4JQCA 4ZT3A 4OI0A 1YACA 1BE0A 5HG0A 4LVOA 2FRDC 2OAQ1 2OEPA 4I3GA 4WUVA 1TD1A 4EEKA 3M6IA 4NCJA 3HDJA 4PTLA 4FGLA 1Z56C 3DL7A 4I5EA 3ZD8A 4L4SA 7MHTA 3EZGA 2G9QA 3ZKWB 2WAYA 3DAFA 5A6SA 3NEPX 2AUTA 1O96B 2WJIA 3D6VA 4K46A 4QBKA 5EA2A 5L7TA 4JFAA 3HXKA 1VXRA 1IVSA 3NETA 2VHXA 3Q2OA 1C3OA 4FT2A 1PUXA 2OYRA 5JZMA 5K0SA 1DRJA 1UOQA 1T1RA 3M6MD 3PVCA 3AKZA 4O2AF 3ZJVA 3AFIA 2V5AA 3OCUA 4LXXA 4Z6KA 4JJAA 1N6LA 1W75A 3PJDA 2PWAA 3IVGA 1H66A 3VU9B 1PFWA 2RHTA 5IM4A 2VP5A 4TKVB 3TEFA 4BLUA 1VMKA 2AFHA 4AYWA 5FDFA 1YQ9A 3E27A 4UAGA 5T8KA 2ZVPX 2DLNA 2JPDA 3NUGA 3E3AA 1T9GS 5JVDF 5KPJA 3K15A 1PDVA 3VDXA 3T4XA 1D0VA 3H19A 1DJMA 2ZJ3A 5DJ5A 1Q7CA 4LFBB 2VPYA 2CCKA 1Z06A 2QDKA 3QVWA 3PG5A 3QXJA 1KI2A 4BP8A 1M83A 2YIDA 6GPBA 2CFTA 4KWEA 4X84A 2RBEA 1D9ZA 1NDQA 3RRJA 3KBBA 2HL6A 2XVAA 1W9HA 4MGHA 2GZHA 1JXOA 4LQ4A 4TS4A 3E05A 3DE1X 4JZYA 3NASA 3LBAA 2BIFA 4RTQA 1M67A 1P74A 1XD2A 2CMDA 2V4UA 4JK3A 3UWKA 1MNAA 4EYKA 2FR0A 4C4ZA 1QIJA 1JA0A 1IZ0A 4MW2A 1AHPA 3A4YA 2OG2A 3NI2A 3ZDRA 2M1XA 3AOEC 2CDRA 1CLUA 4IQ0A 4JLAA 5DTJA 3MW8A 3F7OA 2H2HA 3KSDO 3PWTA 4DC0A 3SC3A 3ZQ4A 3QMMA 1H6BA 2RAFA 3DTVB 1XLTC 4BJ6A 3UTCA 1XYYA 5E9WA 5AVRA 2I6SA 4GMFA 1FXWF 4DLSA 3AZOA 4HSGA 1HLGA 3HXOA 1IK4A 1SUCA 3RWBA 2L82A 3BH7A 4TOIA 3CRW1 3MD9A 4FDAA 1CJCA 1U6IA 1FQOA 4GM4A 4HBGA 1U7XA 1B2LA 2RGRA 5DN9A 4QDJA 1EGMB 1TYEB 2NADA 1DO0A 3GT0A 4ZOBA 1UM8A 3DD1A 5G0TA 4B2PA 1IBKB 4JBWA 2IEIA 1GDHA 3QX9A 4CZ2A 1PG5A 2JIQA 1Y1SA 3M4YA 1AXGA 3AUFA 1T15A 1E3WA 3A9VA 1EFCA 3FHJA 3GMDA 3F49S 1TFRA 3TLYA 1CUUA 4LX8A 3IALA 3NC4A 1XXHA 1NGSA 4P98A 1G9SA 1P75A 1L4KA 3N70A 1S8OA 2HA0A 1QP7A 1JR3A 3L84A 2IHVA 4HZGA 4EPXA 3GVCA 4PZZA 3NPAA 1UJ5A 2CC2A 1SBQA 1JR3D 2OSBA 3KHKA 3NC1C 4M9QA 1NN3A 1PVDA 3KFXA 4CTKA 1TO1E 2ENUA 2Z9BA 4BJ1A 1AQIA 5JS7A 1ZICA 4FIDA 3QF4B 4QXOA 5CYGA 1LQTA 4DIOA 1JEDA 3SZOA 5CGQB 3KSAC 4DANA 1K1EA 1QB7A 4JOCA 2J7KA 1KIFA 4YDHB 1AUPA 3U3XA 5AT1A 4DA8A 4GXTA 1VE7A 2FSGA 2FX5A 4PZEA 5COAA 5EP3A 4G25A 5DNCA 2P9ZA 4B84A 1QANA 2CVOA 5C34B 2ZFUA 4DLKA 4OXRA 5NULA 4E2WA 4AUMA 4BX0A 2ZTLA 4KKVA 1JLLB 1CJTC 3HHPA 4KR9A 5CFLA 5JEEA 1N6HA 2E4XA 2PSSA 1HTTA 3GP3A 3S8YA 3I2HA 4LVCA 3DWEX 3UA4A 2XQIA 2V6BA 2ZITA 3P8ZA 3CXUA 3OE1A 3GHYA 3QHAA 4C0KA 4DM4A 1GRRA 1L5KA 3JYLA 4LF7B 1GUDA 1GQYA 4NYJR 4ZO4A 4KGVA 2IS2A 4IIHA 1WZIA 3VKGA 2FSVA 4AZ3B 1GG5A 4FIZA 2HSGA 3NBZC 1G2OA 4KX3A 8LDHA 1FUYB 1GIAA 5JZVA 4ALLA 4I4TF 1WB6A 4GQAA 1L7NA 2QL6A 4EY4A 3GDGA 1Y3CE 4GRDA 4I9UA 2NUAB 5DNWA 1G20E 3ULKA 2QW8A 3DDHA 5AVWA 3DM9B 3I04A 4BVFA 2FH5B 4RA6A 1MAHA 1ZJJA 3D4LA 4INJA 4EL5A 5EUMA 2IUUA 1XTTA 2DP4E 4BVGA 4ZMBA 3WK4A 2RC5A 1T2VA 3HRHA 3BFKA 2FDRA 1H4SA 2NU6A 4M54A 1IXZA 4ZC8A 2IXGA 5JAUA 2LW7A 2QN6A 3FFAA 1P31A 2PR7A 4ZDIA 4O08A 2JFFA 3D6FA 4HRVA 4E6EA 3F46A 4WGFA 1V8FA 3ZHOA 4XYEA 3VR6A 4HGQA 2QLBA 4CMBA 5JADA 5I7OA 4PPQA 5IBCA 4R7TA 3I42A 3VR6D 4Q3NA 3SHQA 1A2KC 1ODKA 4YDSA 4WN3A 3FYTA 3NIDB 3AR9A 1KI1A 3GBSA 3DTYA 3AV3A 2EJTA 1EWKA 5KAPA 5C51B 1L7EA 2BN4A 1M2GA 2WJAA 3GJQA 4MQFB 2HXYA 3LUBA 3R09A 4TX1A 3D3QA 2R4TA 4RXMA 2GS9A 4CTMA 1P2BA 2OXIA 1EE1A 3OEYA 1JMYA 1YJAA 1O8CA 2FFBA 2VF5X 3IOMA 3NIGB 4IDOA 4L8FA 1LWNA 1JKIA 3ZGYA 4BU0A 4PN3A 5JAPA 4ZT4A 3PC8C 1A82A 1K3UB 2GBLC 2QORA 3CPSA 2HMYB 2Q9AA 3NPMA 5A9TA 1P4RA 1Z29A 5HOEA 3K9FC 3RQIA 3DG9A 4ED9A 3NNDA 4Q4AA 3U1VA 3FTFA 4DV5B 2VAVA 4DVGA 5C4IA 3HPRA 2D8MA 2Y2VA 3OX4A 3ND7A 1ECFA 3WVNA 1Z8DA 2QG9A 3MWEA 1CR0A 2A94A 2NVWA 2YRWA 4MZXA 2GRAA 3HDTA 2DFPA 1W2GA 2BGWA 1PTJC 2WTMA 1TFUA 1W52X 1D4OA 3HNOA 4BOYA 1KU6A 4W1SA 1I4LD 2BKUA 2R1TB 4XFJA 4KIWA 2G70A 2PK3A 1E0KA 1FA9A 2JFZA 1HG0A 2XGGA 3ILYA 3ROZA 2JLYA 3I6BA 1YJ5A 1JXAA 3MAJA 1T3LA 4CQMD 5DMHA 3G0OA 4Q19A 2RMKA 1SULA 1F7UA 5LBUA 3PNQA 4AUKA 3V3TA 3SBDA 2QG4A 4LPSA 3GLIA 4QYSA 2X4LA 2OA0A 1SXJA 4BLSA 2JGMA 2LR0A 1F4LA 3UC9A 2R6FA 4ZT2A 3ST7A 4D8WA 4AROA 4IDQA 3WLQA 1SXJD 2I2DA 1PKXA 1KFJB 5BN3A 3CUKA 1O4WA 5FJIA 4U2CA 3NKLA 1WB4A 4ARZB 1H05A 3EXEA 3SEZA 4NJEB 2EP8A 2H54A 2JGFA 4F8YA 5GINE 1RKQA 3TCKA 3WS7A 1EM8B 1KGDA 2EZ4A 2NPOA 3LMKA 2AF4C 1NHWA 2HTEA 4RTMA 3SVTA 1FMCA 1GWNA 1XLUA 1BMFA 3D54D 2V7VA 5SY6A 3ZHRA 2RHCA 3SKVA 3SN6A 2QP9X 1EX1A 2JFOA 3P9KA 4W5RA 2A84A 1UKEA 2WYUA 3PDUA 4C5CA 2IF2A 4RKEA 3T12A 5KMGB 2PAAA 4RQTA 1SXPA 5IVHA 1WUIS 2B3DA 3ZU2A 2OCXA 3ZWQA 5BW5A 1RQ2A 4EX7A 1ZUD1 3ZY5A 3ASZA 1EQAA 4N03A 4NMWA 4QEKA 2VAWA 5JXWA 1D09A 4JR0A 1BWSA 2BKAA 3THSA 1Y8ZA 1R4AA 3OQMA 4K03A 3JQ7B 3R3JA 1PZEA 3P94A 3QVGB 2PR2A 4EPYA 1FVFA 1Z73A 5JLAA 1OH7A 2MMGA 1C41A 1XWWA 1U04A 3BORA 1XTRA 3GUUA 3NZEA 2EJUA 3UJPA 1H5NA 2FGJA 3HB4X 5F12A 1P2VA 2O6HA 5BN5B 5FO0A 5J58A 1K6EA 2EXXA 3N58A 5CD1A 4RK0A 2R8RA 4LCBA 3A6DA 3FE2A 3EUAA 3OQIB 4X1IB 2IWHA 3AEKA 1N8TA 1A5SB 2J6BA 4OAOA 4RF5A 1THTA 3ABQB 2ERXA 4LZAA 1K97A 4DSNA 3BXEA 1NAIA 3VR5D 5TQ0A 2D1FA 1O97C 1WW2A 2PUVA 1EHYA 4FKBA 4EGJA 1KTVA 3OMLA 1YMQA 1CX9B 4HYEA 4FOPA 4LHSA 5KDLA 2Z2YA 2AG8A 5DNEA 2BMJA 2OBYA 3LDUA 5IDQA 3CISA 4JLNA 1SEVA 5CB0A 3L7KA 3PB3A 3HL0A 4QOHA 3WG9A 3LHKA 3ER9A 4R2WA 1L4MA 2XMRA 1T0JB 1DXHA 2CJYA 3O6VA 3OX1A 4Z7OB 1W0KD 5JXIA 1EXWA 1RWXA 2VYVD 3P9XA 1NJ2A 4CIVA 3COJA 1AY0A 1UDWA 1IQRA 4URHA 4F21A 2EWVA 4I55B 1G59A 3CPHA 1X92A 5IAJA 3TIIA 2WSLA 3WNCA 5HTKA 4DV0B 3ANMA 4RJKA 3CNBA 4DRXA 4U7WA 2CLMB 2PMBA 3O2JA 3I01A 3GJZA 4IS2A 3NOQA 1VJ5A 4FC7A 4X20B 3B3JA 4IF4A 5A05A 4Z2YA 2ZUTA 2VP0A 5K0BA 3ZYZA 1PJSA 1PRYA 1E6CA 3L6RA 4UULA 2ZTMA 2JFUA 5LB4A 3WI7A 2VUHB 1WF3A 4CDRA 1PE0A 1U0OC 3DT6A 4FMCB 4L5IA 2LD4A 2O20A 1RRGA 4HADA 2B2NA 4NE9A 1N5JA 2Y1WA 3IGFA 2ATEA 1I7NA 2GBFA 3NNNA 3NP9A 4MIYA 4IQFA 3U4IA 3S7ZA 3UJBA 5BN1A 3BH0A 3QEAZ 3WIDA 3SEAA 4LBWA 4QOEA 5A04A 3TW0A 1I4EB 2XBUA 1I94B 3DAHA 1BFDA 1I3KA 4RM3A 1B15A 5LA6F 2WE7A 2YJZA 3KPYA 1DVRA 1GNVA 1OD6A 3A9CA 3BE8A 3WDLA 3KSBC 1W59A 4BIMA 3Q10A 5TS2A 3OKFA 3V32A 1K7EB 3ZDXB 1BS2A 4TT8A 2VVTA 3D7NA 1X19A 2PD4A 2FAXA 3ED5A 4P6VF 5AI0A 5EVCA 2XITA 4NICA 4NYMR 5FRDA 1C29B 1QR6A 2PZFA 4HAYA 5CW2A 4CF3A 3PENA 2OC4A 4QC2A 5A6VA 5L8VA 2YQ5A 3ZV6A 3CX3A 3BD6A 4OAPA 1PP4A 2QTVB 4KN5A 1TEHA 5EAIA 3D3NA 2XTNA 1V37A 1XVLA 1JP7A 3R5JA 1FZTA 4UHDA 5AVUA 3KC2A 1YU9A 3L41A 4C88A 3ZE9A 1H69A 1E1RA 3OE7D 1OXMA 1VBKA 1NJ6A 2ZRFA 3EZ9A 4CEHB 3B5JA 3G2OA 1E1RD 1Z2AA 3JZAA 3RF6A 4Z4IA 4CN9A 4MVJA 3OA2A 1XI2A 4UTVA 13PKA 4AJ2A 1G1AA 1H1LA 3PFHA 4MVJD 4BMZA 3JQQA 1B3BA 3V8RA 1CU1A 2XBMA 2Y4OA 4RTNA 2FX2A 1J0EA 1JWBB 2QTCA 3LCJA 5D5PA 5ERXA 2RGAA 4L3WA 5HFAA 1BFKA 1JTFA 3T41A 1JYEA 5TARA 1TUBA 2ZJ5A 1Z7GA 1KFBB 2GTHA 2YWXA 2AD5A 2I87A 1SNYA 2P5SA 4H7EA 4ILEA 4TTJA 5GONB 3V4ZA 4EFNA 3ZQ6A 1CZRA 2W6JA 4MP6A 4U0KA 5C1BA 5IH7A 4LJYA 3J81A 4ZKEA 2AJDA 2W6JD 2PL3A 1RFGE 4FXOA 3OMXA 3BRQA 1PK8A 4QOJA 2Q5LA 2QZ4A 1NP7A 5WRFA 3OUTA 4H15A 1B8UA 2WTNA 2XB8A 4MPDA 4DQUA 2VJKA 3K53A 3LZCA 3HB5X 1E2QA 2OQIA 1VZ3A 1X7WB 2AG0A 3NQ41 3U4GA 1D03A 3UAZA 5C8YF 1U0HC 1NNI1 4C4PA 4YP1A 5BN4A 4NTZA 3T15A 5JSZB 3QENA 5AI6A 2CJPA 4LFAB 2XHEA 1CEEA 4Q12A 4WASA 1D8TA 2AB0A 1KQOA 4HLCA 2DVMA 3VKWA 3VNAA 3IJEB 4JEUA 1ZH2A 1V0JA 3GNTA 5ALNA 3URKA 4ND5A 3H9BA 2C98A 3TIFA 4GSKA 3T1NA 1GFZA 3FKJA 3OZVA 2DHCA 4XYBA 3W9BA 1KETA 1RXUA 1NZDA 2XUGA 4NXNB 3NUQA 1USIA 4J0FA 1FE8A 1G8YA 3JPWA 4FUTA 4G5YA 4DCMA 3IIKA 1NBWB 3K5IA 3DE6X 1Y9JA 3CWQA 5JSYA 3ZWKA 5F7XA 1DDIA 2QUKA 3RABA 2DXIA 3PC3A 3F3YA 5JCOC 2OBLA 3WK8A 3IP6A 4AYXA 3B20A 4ZJYA 3OQPA 5F33A 3NIBA 3O83A 4G1FA 4IFIA 4P34A 4V3CA 1VLHA 2V5VA 2GX6A 2DBQA 3K0EA 3DE7X 4QPNA 5FORA 3LC7O 4O4IF 3I62A 1IY2A 2WE8A 5JZ9A 1V7QA 3AIIA 2SKEA 2I6TA 3ZWXA 2OFOA 1DCKA 4L5YA 5FLYA 4KHPB 1YJXA 4YJGA 2XIQA 4HGZA 4DVJA 3AL3A 4P5PA 2ZSFA 1T1JA 3M5CA 4FCVA 1KYYA 2YV1A 4M1OA 4QYIB 3U2QA 5IT9A 4GR5A 2CMKA 2HUNA 2I7CA 2O48X 3FOAA 4Z2AA 1VFPA 2FPGB 2VNHA 1GLVA 1O89A 2IXFA 5CT4A 4ZAZA 1AD2A 3BRSA 3LT4A 5CIWA 3QFSA 1L7PA 4L6IA 2WWHA 1NUSA 2CFIA 1MENA 2VXYA 4HWKA 3T34A 2HQOA 4EENA 4YT5A 4BLQA 3G2NA 1L6RA 2DAPA 4DG9A 5IAAA 1S2NA 2NW6A 2R7MA 3KOMA 5HQJA 5CITA 4AUEA 2PUHA 3ML1A 4OIFA 4U9IS 2D7JA 3AETB 1V9LA 3KCQA 4PX9A 3TKYA 3T9FA 4QIHA 4RVCA 3ZY4A 2M9MA 5DLDA 4XA8A 5JDIA 3EA4A 5FTWA 5YASA 4WV3A 2YJ3A 2OV6A 4GPAA 3BHIA