1BCSA

Complex of the wheat serine carboxypeptidase, cpdw-ii, with the microbial peptide aldehyde inhibitor, chymostatin, and arginine at 100 degrees kelvin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
255
structure length
255
Chain Sequence
HAADRIARLPGQPAVDFDMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLVHRSKNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMYSLYTPVCNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE II
publication title Peptide aldehyde complexes with wheat serine carboxypeptidase II: implications for the catalytic mechanism and substrate specificity.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 255
sequence length 255
ec nomenclature ec 3.4.16.6: Carboxypeptidase D.
pdb deposition date 1995-11-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bcsA00
5EHNA 4AMZA 2JEYA 3R3WA 4W1SA 2OLEA 3C6BA 3DYVA 3I1IA 3GELA 1CRLA 2OAGA 4F5ZA 4Q3KA 3X3HA 3EQ7A 5K3FB 4CCWA 4J0IA 4B0PA 2Y1KA 5FV4A 4U2GA 1GQSA 3AINA 4G5XA 4H7HA 5ALIA 3WIOA 1QIFA 1UXOA 5ESRA 2ONCA 4HVTA 2XMCA 5ALFA 1IZ7A 4JH0A 5DYYA 1B41A 3IA2A 3D4LA 4EY7A 2E3JA 4H7JA 2XMGA 4G4IA 2WTMA 5AKYA 5FP0A 2HDWA 1Q0ZA 4UFOA 2RGUA 4CIBA 1MTZA 4AB1A 2CBGA 4BP8A 5H3HA 2QTBA 5HZGA 1R9MA 3C8HA 1MPXA 3I2HA 2QKYA 5JD6A 3FSGD 1A88A 2WILA 5AK4A 7YASA 1XROA 1DT3A 2B4KA 3I6ZA 2I78A 4BCCA 1H23A 5ALSA 2OCIA 3IUMA 5ALDA 3T52A 1C7IA 4AN0A 5ALEA 4GBGA 4I4CA 1CV2A 5LKAA 4HRYA 2OQVA 4CI9A 2OGSA 3H2GA 5DYWA 2RIPA 5FKJA 2JGLA 2BUBA 1QIDA 4Y2JA 3A2LA 4QDZA 4UBOA 4XX1A 3I1YA 1Y7HA 2PBLA 4C01A 5AOCA 3FCYA 4E14A 5KWJA 1EVQA 1EH5A 4J0HA 1XZBA 4FWBA 3HSSA 3WL8A 3G8YA 4UHBA 5ALMA 2BAGA 5HKAA 2WHRA 4WFKA 2WIKA 5I9IA 4BDSA 3LCRA 3GUUA 3YASA 4FLEA 4OYYA 3WK5A 4Y2TA 3I2IA 1T2NA 4L0CA 3WKBA 5FRDA 5E4JA 2IIVA 4D9JA 4X93A 3HLKA 3T4UA 3I2FA 4YPVA 3AIOA 4J3JA 5BWBA 2H9YA 2ACKA 3EQ9A 1LPMA 3I6MA 1I6WA 4JYPA 5JANA 4B85A 1BCSA 3NUZA 1MX1A 1TIBA 3KSRA 1L7RA 5C7YA 4OB6A 2Y2UA 3WQHA 3VKFA 5JASA 1F0PA 2FUKA 1SFRA 4LXHA 4IHAA 4LXIA 3FOBA 5AKHA 1ZI8A 2OQIA 2WIDA 5A2GA 3OM8A 3PUHA 2XUAA 1XQWA 1WOMA 1AZWA 1XZFA 2HA6A 1K8QA 2VF2A 5I8PA 1XZHA 2FJ0A 4H7IA 4MQMA 4FFVA 3FAKA 4WY5A 2XUHA 2ORYA 3ED1A 2XUFA 1E8NA 3F8SA 3R3VA 1JFRA 1JJFA 5JYCA 1UK9A 3A70A 4E11A 1FFEA 1CUGA 6YASA 1XZJA 5FLKA 2XT0A 4TGLA 2WG2A 1CVLA 2V96A 4UFNA 4X00A 1UK7A 1G66A 3DOHA 4PW0A 3F9CA 1H2ZA 2VAVA 1ORVA 1ZIYA 2WUEA 2VSQA 4C89A 5AOAA 4UHDA 5LP1A 1GPNA 4J0JA 4OB7A 3DQZA 3WYNA 5IVIA 1CUJA 3O4GA 4TVKA 1BE0A 3F96A 4AX4A 1IUNA 3FYTA 2H1IA 4QWMA 2OXEA 4X3CA 5AM2A 1XZLA 5CH8A 2VJBA 2J4FA 1QE3A 1XKTA 5LZ5A 4BAUA 4DLNA 3BXPA 1MAAA 2VTVA 3L1IA 1A8QA 2AJLI 2BGNA 4PQEA 1QJ4A 4N8DA 1DINA 2ECFA 3RK4A 2W22A 5KWIA 2D5LA 5BV7A 4H18A 1ZICA 4FFWA 4ETWA 3STWA 3WJ1A 3V9AA 1MU0A 3BDIA 3WK4A 1QGED 4UBMA 3BIXA 3VVLA 1QTIA 1Y7IA 1N1MA 3NWOA 2P8SA 4B81A 4J0DA 5AI6A 2AXEA 2RAUA 2HA5A 1XKLA 2VA9A 2WUDA 3W05A 1LNSA 2XLBA 3PDCA 1R50A 3E1GA 3GA7A 3HEAA 4UHHA 5EHZA 2CUTA 4G9GA 3UMJA 5SYNA 2DSNA 3AZPA 2XUKA 4Y2RA 1CUYA 4DNFA 3FLBA 2PSHA 4MWTA 4WDQA 4EUSA 3ESDA 3K2IA 4WCVA 4Y7DA 4GEGA 1GZ7A 3PICA 4B9EA 1CIJA 3BJMA 4QEKA 4AXBA 4P9NA 3IULA 2Z3ZA 2CMFA 4DNPA 2QJRA 2ZSHA 5AP9A 1T4MA 3OTQA 5SYMA 3KD2A 1S8OA 1HLGA 1CUCA 1HKHA 4PF1A 4N8EA 5CBKA 1QO7A 3LS2A 5DYTA 3R41A 5AICA 4TPKA 1ZI9A 2XUDA 4LKOA 3D2AA 4NVRA 4KE7A 5AIAA 4UHEA 4X6UA 4X7BA 5E4YA 2XMSA 2ZYIA 4QLAA 1YS1X 3K9BA 3HXKA 1H2XA 1VOTA 2VAXA 2WFMA 1UK8A 4FBMA 2GYUA 1QIKA 1OCEA 1C7JA 3PUIA 1TQHA 2OGZA 1QLWA 5CT8A 1XRQA 2QM0A 3I28A 4DIUA 4KEAA 4B82A 4RPCA 3ILSA 4YX9A 4H7EA 2XLCA 2FX5A 1DQYA 5ALKA 2WHPA 3FCXA 2VT6A 2QZPA 2QT9A 4C87A 3OURA 3AIKA 3TJMA 3LIIA 4W63A 3M83A 3WZMA 3QPCA 1YR2A 2FJPA 4BZZA 4KRXA 1VE7A 2ZJFA 1CUEA 1AGYA 4G8CA 1XLUA 4LIPD 4IO0A 5A6VA 1CUUA 4MEAA 4DTCA 4MJ3A 4MXDA 2WG0A 4DYHA 5LZ2A 4I19A 4BDTA 2IITA 2O7VA 1IZ8A 1L7AA 5HF9A 1YS2X 1U4NA 2V9ZA 4Y2UA 3DOIA 5AI0A 5JAHA 4CG2A 5CH5A 5AK6A 3W04A 3WIBA 3FVRA 3WZLA 5ALQA 1LPPA 3HJUA 3TEJA 2X8BA 2VJAA 4Q34A 2ACEA 1DX6A 4ZXFA 5AI9A 3WK8A 1QIHA 1THGA 4XJVA 1RYYA 2H7XA 5AKIA 4K2AA 4DMHA 1G42A 2WSLA 1R1DA 4B84A 2WLSA 2CZQA 2XI4A 5CXXA 2O2IA 2JBWA 3F98A 5AO9A 5ALXA 3DYIA 4N8SA 4W1RA 1WB4A 1GPKA 4MYSA 1QIIA 2VQ6A 4F0JA 1QOZA 5JIBA 1UZAA 4GWLA 4PO3X 1DWQA 1TCAA 5ALLA 2ZVDA 4BVKA 4QE3A 4H7KA 1XZEA 1GQRA 3D2BA 5DTJA 1A7UA 4AQDA 3H1AA 4RE5A 2X76A 1DWOA 2HIHA 2PU7A 5JZSA 1ETHA 4J03A 5HFNA 2H7YA 5ALVA 1LPAB 2JGKA 3QITA 1M33A 5C8ZA 4G4GA 5T4FA 3H0CA 1EI9A 2C4HA 4Y2SA 3W9BA 3BE8A 1VXOA 4GECA 5AI8A 3WYDA 4DMKA 3BDVA 5AKXA 5CH3A 2PSJA 5LZ4A 4X94A 2H7CA 5CMLA 1QONA 1QZ3A 1JJIA 4P08A 3PI6A 4X85A 1R3DA 3EBLA 3OC0A 1YB7A 2RONA 3QH4A 2OAEA 5ALJA 1SCQA 2WHPB 4X6YA 1WPRA 1P0QA 4U2FA 3PF9A 1UKAA 1A8UA 4MWSA 5FUMA 4PNZA 5ALWA 2GBCA 4RGYA 5IKXA 4KRYA 2HU7A 2WKWA 3BWXA 1YSCA 2DHDA 1VZ2A 5DWDA 5DNUA 4H7DA 3WKDA 3STUA 3M82A 3F67A 4BTVA 3FYUC 1ZD3A 4BRSA 4X71A 3H17A 3JYHA 2HRQA 3TRDA 1QIGA 3S8YA 4PSCA 5DJ5A 3V1NA 5HKBA 3O4HA 4ZI5A 4BE9A 1QIEA 5AJHA 1J1IA 3WKEA 3VJLA 2OCKA 5LZ8A 4DMCA 5DNVA 1Z68A 1GXSA 3IB3A 2GBFA 4P93A 3GFFA 1SOMA 1BRTA 3O4IA 5K3CA 4LHEA 1ZGCA 2WIGA 2Z8XA 3D0KA 1HDEA 3BJRA 2JGFA 1JT2A 2PUJA 3VJKA 3S2ZA 3I2KA 3HACA 5J3JA 2XQIA 1AKNA 3D59A 1EK1A 2EEPA 2VT7A 4K6HA 4KAJA 3AZOA 2JGEA 1KU6A 1G4HA 5IVKA 4XVCA 3CXUA 2I3DA 1CFJA 2BUCA 2ZYRA 1WHSA 3KWJA 3BF8A 1H2YA 4AMYA 2PSFA 4FLMA 2QRUA 4CG3A 4U2DA 3VXKA 3CN7A 5HQ3A 1EDDA 5AH0A 2RHTA 2ES4A 5JADA 4H0CA 4FOLA 1AMNA 1CUZA 1WPXA 1W52X 2GZSA 4GW3A 4X95A 3BIWA 3DNMA 1DQZA 3G0GA 4Q3LA 2XQJA 4X91A 4EA6A 5CT9A 3FSGA 4MQLA 5FOQA 3E4DA 3G7NA 4G8DA 4AO6A 4HS9A 5EI5A 4YK7A 2JEZA 1K6EA 3MUOA 3K6KA 1WB5A 1ZGBA 5DLPA 3PE6A 2JGMA 1EDEA 3QMMA 4E15A 1JI3A 2BGRA 2WHQA 4KE8A 2C5GA 3OPMA 3CCBA 3C6XA 3H2HA 2AJ8A 4HXGA 1R9NA 4DM7A 4IH9A 1IMJA 3VJMA 1HQDA 2DFPA 5DNWA 3ZPXA 2WTNA 1YB6A 3HZOA 3QVMA 3DD5A 4Q1VA 4M0FA 2DHEA 5LYYA 1BCRA 1EX9A 2I3ZA 4RNCA 1TCCA 2CB9A 2WJ3A 4L72A 3DL4A 5JAUA 4YASA 1NX9A 4K5QA 4DSZA 4BRZA 1WB6A 3I2JA 4X97A 1JMKC 4PSDA 1MX9A 4DNQA 4X6XA 5I7UA 1YAJA 4QWWA 5C8VA 1XZCA 2XDWA 1CUVA 2QXUA 2ZSIA 1FFBA 3G0CA 1CEXA 4M0EA 1E66A 4Q3OA 3WL6A 1VE6A 4FHZA 1XRMA 4UBLA 5EHXA 1LZKA 4B9AA 4DGQA 1JU3A 3JWEA 1E8DA 3ICWA 3IDAA 5CT6A 2C0PA 3I6YA 5A62A 3ICVA 5A7HA 3NGMA 2QMQA 3C5WP 2R8BA 5JAPA 3QPDA 1SCIA 4BP9A 4OB8A 2YXPX 4BYMA 4HRXA 1CQWA 2HA7A 1JMYA 4BAZA 4B0OA 5ISMA 2PKYX 2O7RA 3E3AA 1ODSA 3QYJA 4HTAA 4WFJA 1CQZA 2YYSA 5ALZA 5DTIA 4UFPA 2XUPA 3B12A 3KOOA 1F0NA 2GYVA 1DX4A 5K3BA 2Z3WA 4WY8A 3WA7A 1LPOA 4N5HX 1FFCA 3EQ8A 5HFAA 1G5FA 3GZJA 5F4ZA 2PX6A 4Y2YA 4NS4A 5JD5A 5LIPA 3FLAA 1DTEA 5CTAA 2D0DA 1EXWA 1WHTA 2OPHA 1CPYA 5HQ3B 4XIIA 1QFSA 2QUAA 4CG1A 5AOBA 5ALUA 1C4XA 1BN7A 4QDUA 2ROQA 4H7FA 4HZGA 4WJLA 3IUNA 3KWFA 1EA5A 4W1PA 4CCYA 3HI4A 3STVA 1ZJ5A 3MUNA 3G0IA 3JW8A 1H2WA 5JARA 1Y37A 1XRLA 4WDRA 3WWEA 3OG9A 2WFZA 2CEKA 3FLEA 1JKMA 1UOQA 2XB6A 4A5SA 1XZDA 2V97A 1FFDA 1TAHA 1ISPA 1NU8A 1CUIA 4AN1A 2XE4A 1R88A 1CUDA 4ZWNA 3C8DA 1W75A 2BJHA 3CCCA 3H04A 4G4JA 4UHCA 1ZI6A 1MJ5A 1UKBA 2XUIA 4W9RA 3A2MA 1VXRA 1IUOA 1RP1A 4DNOA 2C58A 1ORWA 5IVHA 2LIPA 1THTA 3IVMA 1AURA 2XQFA 4B80A 2UZ0A 4K6GA 1VA5A 3W2TA 1A8SA 4C4XA 3KXPA 3LIPA 4LXGA 3AUKA 2PU5A 3V1LA 5K3AA 4Y2PA 4OD0A 1KEZA 3G0BA 3MGAA 3G0DA 5EHQA 4GHWA 3WA6A 3ESBA 2QVBA 4M0MA 3W9UA 4B6GA 4QZVA 5ALTA 1K5PA 4QLOA 3ANTA 1MNQA 4HXFB 1GT6A 3ANSA 3G02A 4BVLA 2HADA 5JALA 1PFQA 1BROA 2WG1A 3B3QA 2G63A 4UPDA 2DQYA 4BVJA 2XQKA 4BB0A 3SWWA 5AKKA 3DJYA 5KREA 1ZD5A 4QDOA 1MX5A 3C70A 1N8SA 3A6ZA 4KYVA 5AM1A 5AM5A 5ALOA 3IUQA 1BS9A 1TRHA 4BE4A 2HM7A 1W76A 3HABA 5HK8A 3C6YA 3D5EA 4ZV7A 1TKRA 4OYLA 1MNAA 1QO9A 1CR6A 5JAOA 1CUHA 2XUQA 5FXMA 1XLVA 3WK9A 1CUXA 1YA8A 1P0MA 3AIMA 4CIAA 5ALRA 1IUPA 2BKLA 1JJBA 3IBTA 1YASA 4NMWA 2WIJA 2GBGA 2YH2A 5AK5A 1MO2A 2HU5A 2XMRA 4JEIA 4U2CA 1LZLA 1EB9A 2HL6A 5ALHA 4Y2VA 5CW2A 1O6FA 3C45A 5IH7A 1F6WA 4IH4A 4QNNA 3WJ2A 5A7GA 1O6GA 4ZRDA 3DEAA 3Q8WA 3R0VA 4CCYB 1AC5A 2EDAA 2Y2VA 1Q84A 4EZIA 5JZBA 3L1HA 1EHYA 4K6KA 3WL7A 4FBLA 1EVEA 1QTRA 2NW6A 4O08A 2HFKA 1VJ5A 1HL7A 3LLCA 1YCDA 1BN6A 1DT5A 3ESCA 5CT4A 3U0VA 2J3DA 3O9VA 5HK9A 3WI7A 1CUAA 1X2BA 1YA4A 4HXEB 4U2EA 1GGVA 4ZREA 5EGNA 1OILA 1XRRA 3QZUA 3H1BA 4ROTA 1LGYA 5CRIA 3C6ZA 1P0PA 2OG1A 1J06A 3DKRA 2R11A 1ODTC 2XUJA 3ESAA 3H18A 3V1MA 5LLSA 4EY8A 1XRNA 1ZOIA 2GZRA 4Z49A 1ACLA 1K4YA 3D2CA 5YASA 1DU4A 2ZJ7A 4Q05A 1TCBA 5T4EA 4MEBA 2Z8ZA 2CKMA 5HF8A 1Q0RA 1XFDA 4GXNA 1RWQA 2B61A 5AIBA 4FTWA 1P0IA 1W6RA 4BZWA 1MT3A 1MN6A 3RKSA 2WU3A 4KE9A 1XQXA 1R4ZA 5LZ7A 5ALNA 2G5PA 3SX4A 4J0GA 4N5IX 1Q83A 1OXMA 5LKRA 1LPSA 1VZ3A 3QBJA 5ALGA 5D3KA 3WK6A 3B5EA 1XZKA 3DKKA 1ODCA 4LYEA 2BFNA 1J07A 4UBIA 1XZMA 3EIOA 5HF5A 1XZGA 2QUBA 1FSSA 4KR0A 3G9ZA 5ALPA 5ALYA 1U2EA 2HHAA 2VATA 3BF7A 4FDMA 5A7FA 5IVDA 1PV1A 2JGJA 2J3QA 4HAIA 3WWOA 4FNMA 5JZ9A 1DWPA 3AILA 4KE6A 2WU4A 2WM2A 5K3DA 4OUKX 1QFMA 2QOEA 1EDBA 4P92A 3IIIA 2BCEA 1CLEA 5A71A 4BCBA 3A2NA 4CFSA 4KAAA 4BC0A 3RARA 3PFCA 2XQGA 2C7BA 3SC2A 3C87A 4PSUA 2VJCA 4NZZA 3R3XA 4EBBA 3G9UA 2XMDA 3MVEA 4QA9A 4UUQA 3O95A 3CN9A 3WK7A 3OOSA 4INZA 5C8XA 5AM0A 1VA4A 1U8EA 1UOPA 2WFLA 5FDFA 1UFOA 3VISA 1UKCA 3I2GA 3FYUB 1CUSA 1SC9A 2OCGA 3V1KA 1F8UA 3WKAA 2XUGA 4JYMA 1ZIXA 3ZLUA 3C5VA 3O0DA 4J0CA 2W6CX 4Q82A 4G1FA 1PJAA 5HCUA 3N0TA 1AQLA 3AZQA 1U65A 5EIHA 2GYWA 4B83A 4C6HA 3ZLVA 4ZV9A 1EB8A 1XQYA 2HA3A 3E0XA 4RE6A 4BAGA 3GBSA 5EFZA 3HRHA 2K2QB 5D3ZA 4L9AA 4B7ZA 5CURA 1QIMA 3RM3A 2IX9A 2PSDA 1UWCA 1SCKA 1NU6A 2RHWA 1LBSA 1EINA 2Y6VA 5BWCA 3Q0TA 3LP5A 5AHXA 3RLIA 4G8BA 2PSEA 2WQZA 4A16A 2GBIA 1USWA 5CT5A 3QPAA 4FNGA 3STYA 3WWCA 1ZJ4A 5LZ9A 1IVYA 4XWGA 2ZYHA 3DLTA 3IUJA 5HF6A 3D7RA 5AKZA 2QJWA 4PV7A 4BC1A 3ZWQA 1W4LA 5AM3A 3C43A 5E4TA 1WCYA 2XMBA 5FPQA 3ZI7A 5C81A 4QDTA 1GPLA 1WM1A 2ZJ6A 1JU4A 4I3FA 1HPLA 2C0QA 5D7BA 5JATA 3QMVA 4KACA 1H22A 3WWPA 2PVSA 3G9XA 1ZD2P 3L1JA 1BU8A 4OCZA 1D07A 5EIAA 1AUOA 2EDCA 1W1IA 1VKHA 3R40A 1E8MA 3UUEA 2AJBA 1XZIA 3DDUA 3DS8A 2XMZA 3R3YA 4IH1A 4AO7A 4U2BA 4F60A 3AJAA 2QS9A 1J2EA 3F97A 3EF3A 3VDXA 1CUFA 2XUOA 4AZ3A 4AO8A 5K3EA 2DR0A 2WFLB 4GLBA 2Q0XA 4JUIA 4S0XA 1YAHA 1AX9A 3AFIA 4OU5A 4KJXA 2O2GA 3R3ZA 4A23A 4ZGBA 5AKGA 2VJDA 4C4YA 3TGLA 4BCDA 4C4ZA 1ZD4A 4FKBA 4L3WA 3PFBA 3W06A 1QIJA 4QDXA 5AKLA 5AKJA 1GKKA 3VVMA 1VLQA 4UBNA 5D6OA 2O2HA 5K3FA 4ARAA 2C5FA 2VEOA 4H77A 3SK0A 2WJ6A 4EHBA 3FBWA 2AJCA 4EB0A 2G4LA 3BL8A 1FFAA 3ZLTA 4LYDA 2DQZA 2WUGA 3R3UA 5FPPA 3WKCA 3STXA 1K63A 1UOOA 3H2JA 3HC7A 2OCLA 3HYSA 2B20A 3QM1A 1X2EA 3P2MA 4DMFA 1L7QA 4F21A 4GDMA 3G9TA 2QR5A 4Y2XA 2Z5GA 3H19A 2PM8A 2JIDA 2G5TA 3WWDA 1X70A 3FNBA 1E3QA 4FLFA 2HRRA 4IQ4A 3WL5A 4Y2QA 4V2IA 2HA2A 4G9EA 2I03A 1KU0A 1GKLA 4BATA 1E89A 3NOXA 5BOVA 4BTLA 2WIFA 1XQVA 2HFJA 4ARBA 3N2ZB 4EY4A 1TK3A 3DL7A 5AI4A 2JGIA 4FMPA 3STTA 4J7AA 4GI1A 3V48A 2JF0A 2WUFA 2RI6A 5EIEA 3DCNA 1ACJA 4OSEA 2PUHA 4KAFA 3H2IA 4X90A 2QXTA 3WMRA 5AKEA 2DHCA 4JNCA 3ZV7A 1CUBA 4BBZA 3M3DA 4UBKA 2DCMA 4E46A 5AI5A 2B9VA 2HA4A 5K5EA 1MAHA 1FJ2A 2YASA 1LPNA 5AM4A 5T4HA 3FVTA 1BEZA 4X92A 4MYDA 1B6GA 1LPBB 5AK3A 2BUAA 4W1QA 3D3NA 2PL5A 1XZAA 1CUWA 4UHFA 5T4BA 3QMWA 2OGTA 1XLWA 4EY5A 3IURA 4OPMA 4C88A 2PPLA 2WJ4A 2HA0A 1XRPA 4AZ0A 3GROA 4OU4A 5E2IA 3PF8A 3FWHA 4WFIA 1UK6A 4EY6A 3M81A 4H35A 1LBTA 1LLFA 4UBJA 1UT6A 3KDAA 3O4JA 1BEEA 2HU8A 3UUFA 5CXUA 4J0KA 5JD4A 2CJPA 3H2KA 1N5RA 2AJDA 2XMQA 4ITVA 3U1TA 5KBYA 4Y9SA 3WLAA 2ZYSA 1HBJA 3O9MA 2V98A 1E5TA 2Y6UA 3FYUA 4DSAA 1N5MA 1EK2A 2X5XA 2J4CA
chains in the Genus database with same CATH superfamily
5EHNA 1E9SA 4BNFA 2FOLA 4AMZA 3I3OA 5DI3B 3R76A 2QE6A 2YYAA 4JB0A 4RMIA 1N2HA 3CF4G 4R2XA 2YV4A 4WA8A 3IQFA 5A9TA 3EAFA 5PGMA 2CNNA 2KYRA 3R3WA 5J1TB 4PICA 1OFUX 5E2BA 4CM6A 5BYAA 2VUSA 2VN8A 1CRLA 3CH7A 3GELA 1QV6A 4BQRA 4LK3A 2FMHA 4OATA 1KMIY 4CCWA 1W88B 4M9ZA 5DASA 5HZHA 1UKEA 1K1EA 3ESXA 2Y1KA 5CLGA 4B0PA 3I0ZA 3ZDDA 3KKMA 5H83A 3KAKA 3UJ3X 4H7HA 4WX2B 1G18A 2HCJB 4L7VA 2P67A 3CUEF 5E7JA 5ESRA 3SJCA 5AVTA 3U6BA 4GKAA 3HY6A 2XMCA 5ALFA 2I2CA 2IXAA 2Q5LA 2VSFA 5ICGA 3ABSB 3A4NA 4EGCB 4TMTA 4P36A 3D8RA 2IUUA 1ZP6A 5GVRA 2IS6A 2CMKA 3DE1X 3WIUA 4IG4A 1RJGA 1PWEA 3OHPA 4KXWA 3K0HA 3SOZA 2F8TA 4YQEA 1W5FA 5GJVC 2YBEA 3JQ9A 4XA8A 1E0AA 2A84A 2R8ZA 1JQEA 2IZOA 4GL4A 2CLEB 2H2HA 4CVNA 2PR2A 4DUPA 3Q5EA 5EKSA 1IN5A 3WHPA 1NF2A 2BFAA 5FUBA 1C9NA 4GMGA 4NK5A 1T8YA 5DNDA 2JIMA 4R71A 3RAFC 1G3UA 3Q3GE 4R1MA 2YHIB 2QRMA 1NUSA 5IXYA 3R20A 1C7ZA 1N0IA 2GF0A 2HDWA 3IDFA 3H65A 1Q0ZA 2HIGA 4L6CA 1HYQA 2DHQA 2ODBA 2J9RA 2JCXA 1OJ7A 3OZIA 1GL9B 2BY4A 4LZPA 3NWEA 4RPIA 3TEFA 1EP2B 2NADA 3WLSA 3LWNA 2RC5A 1IH8A 3H3FA 5HZGA 1TM2A 2CDRA 4J4TA 1NJFA 5K05A 5AFSA 3ZS9A 2JC3A 1MPXA 4PZZA 1OSNA 2R4UA 1VGVA 3CLRD 5AK4A 1KAHA 2WVJA 3M4XA 3I6ZA 2E89A 3OOWA 3F6RA 2XHEA 1MH1A 1DFGA 2TMGA 2XNKA 5JJIA 5ALSA 3QVSA 5H5JA 2OCIA 1K06A 3IUMA 5ALDA 1C7IA 3VO1A 3WLRA 4YUYA 4AN0A 3JZIA 2C4UA 1B0PA 3DT9A 1JXAA 1VLLA 5GAJA 3B60A 3UNXA 2QA5A 4I5EA 4IXTA 3EMKA 4FX5A 4QVKA 4U8GA 4IQ0A 3UW1A 3SQNA 4MW6A 5I9SA 3RTAA 3H5VA 4L3VA 5K2MA 1G19A 1Z29A 4RZSA 1QRSA 1D9ZA 1REQA 3LOQA 1U5AA 4KQ1A 3ZE2B 1F3LA 4HLCA 4TTTS 3PITA 3ZIAD 1WMEA 4CPDA 2OGSA 3H2GA 3OPNA 4OXXA 4R83A 4GVXA 3EXHC 4PC6A 5FKJA 2J85A 2TMYA 2JGLA 2VF5X 3QVLA 2BUBA 1RYMA 4LY3A 1EA7A 3FFXA 4RF2A 2QM3A 3TQIA 2ODTX 5DYIA 2ATEA 1NBHA 3KHTA 4XI9A 3VKVA 4R8KA 3VMFA 1N6OA 2IUSA 4J1TA 3R5TA 1PNVA 3EWNA 1XO1A 3CT6A 4UBOA 5K8IA 3A0RB 1W8DA 2VQDA 4FDVA 4LYHA 2NUTA 3VR4D 1XR3A 1RMTA 3A9TA 3I1YA 1OX5A 3ZWOA 3RVRA 4D5EA 1JXQA 5GY7A 4YTEA 4AW9A 1T15A 3IEMA 1DTWA 1BD3A 4PLWA 3FN4A 3T6KA 3B89A 1HWYA 1XVTA 3V2UA 3RD5A 4EG6A 2AOTA 2I6TA 2P9YA 5KB3A 1ZIOA 3A9WA 4KODA 1D9XA 3RRYA 3M6IA 3TCKA 1LI7A 1W36B 2WUVA 1YZLA 3GLIA 3MT7A 1V8DA 1WJGA 1WZEA 1E4OA 5E8RA 4XDHA 4PBRA 3OZRA 3RUIA 4YMHA 5IULC 3NP9A 4HPXB 4P4UA 1EGMB 3GRCA 5DGIA 2OQRA 3YASA 2CLKB 3JASA 4G2TA 4OYYA 1X87A 1T0UA 3RPEA 4FYXA 4E21A 1ZEMA 2IZ6A 1HETA 2GD6A 2B3DA 2D3TA 3F5FA 1T2NA 3KSZO 4Y2TA 1AJEA 4L0CA 3BWBA 4HXYA 4YN3A 1EM8A 3EW9A 3PXAA 2ID8A 4EW1A 4LGYA 1MQ8B 4ID9A 3VI3B 4E7PA 3HCEA 4X93A 3WGLA 4OQLA 1JDNA 1YZFA 3DVAA 3ZJVA 4JAVC 1DMRA 1T2EA 3VSAA 1A4XA 2ZYDA 1IHXA 1TRKA 3AIOA 4QVGA 5BWBA 3QJGA 5L51A 1Z4QA 3TNLA 1PJRA 3NOQA 4O4HA 3UGTA 4G56A 2ZSDA 4QC2A 1TVMA 3I5MA 4CL2A 3KWLA 2YV5A 4M98A 1I4OA 4MRMB 3UWPA 4MO9A 1CEYA 4U7DA 2AQHA 2NP7A 2O59A 2QRPA 4HRAA 3TN7A 3FF4A 1ZJWA 3R74A 2H2FA 1I2BA 4BJ5A 4JYPA 3GFVA 5FO1A 4BMDA 2NTVA 1UFRA 4N3AA 1NN0A 2D1FA 3QW4B 2BF4A 4CYMA 2IW3A 2WNIA 2OFXA 1RYHA 3BD6A 3F0TA 3V4PB 2OB2A 4YWJA 2VP9A 4A8TA 2VP4A 1UDBA 3I4CA 3K1AA 2XH8A 4URVR 2O8DA 3GLGB 3BXZA 4GKJB 3VKFA 4N9WA 3GA0A 1WUHS 2BHRA 4L02A 4Z6KA 4V0KA 5JASA 1G3MA 1QHYA 3ZUPA 1SIBE 1YBMA 2OG2A 2PRKA 3G0OA 1T1EA 2ZRIA 1QO0A 2FDXA 3QXSA 3AESB 3QPVA 5C0OE 1DO0A 3TR6A 4BMSA 4EVRA 2F4VB 1JFSA 1U2GA 4RH1A 3EEBA 3SBXA 1TQ4A 1KF0A 2W2MA 5E7QA 1A4IA 4P31A 5JC1A 4KMSA 2P4EA 3CVWA 1VJ1A 1QHEA 2WIDA 2YYZA 3DTVA 3I61A 4JIMA 1T9HA 1GQQA 2A1UA 3DPUA 4Z0NA 1AD2A 2QN8A 2ZUUA 4KGZA 4F4FA 5LMCA 1RYEA 1SH7A 4US0R 1CWUA 1WOMA 3M1IA 3O4FA 121PA 2V8BA 2QTMA 4K9RA 1HE4A 2HA6A 1K8QA 4M1WA 4OFBA 4R5MA 1DG3A 1GTMA 3C3CA 4CUKA 3RIYA 5KQRA 4QSHA 1XZHA 3U31A 3ZBTA 4NCXA 2ONKA 2YIVX 3HEBA 4OHOA 4LYYA 3DHEA 4RGBA 4JI5B 4FFVA 1JA1A 2DFKB 2R47A 1XTKA 3U4QA 3V2HA 2FHPA 1JHOA 3AR4A 2B8JA 2XWPA 3R3SA 4TWBA 2OBXA 4OLHA 2O3UA 4OKSA 1B16A 5DXFA 4E5YA 3AFHA 1ISFA 3JR7A 3R3VA 3LOPA 3B85A 4TVSA 1CRWG 2C5EA 2QRLA 2YUIA 4Q24A 4KFCA 1KVTA 4LV8B 3NTRA 2DG2A 4M99A 1UK9A 1VG0B 2G82A 5A0FA 5IZCA 4YFVA 2R6CA 2OM6A 4ZI7F 2EQBA 2YWEA 1IIBA 2FMUA 3A70A 4M3NA 1F7VA 2WMOB 1L0BA 1UDRA 1GITA 4H3SA 1HEUA 2GZAA 3ZI0A 1JYSA 3KJQA 3A1VA 4F9FA 5I51A 3JQ7B 1X0XA 1TU0A 1DFIA 1Y1SA 3OFKA 1E5DA 4RFSA 5EZQA 5FLKA 1QMGA 4AJEA 3U5ZB 4C2TA 4FYVA 2WG2A 3NBAA 1YVEI 2W42A 5IWAB 4V0ME 5IK2A 1M3SA 2HR1A 5FTMA 3JYPA 3GP3A 4FYMA 1XVVA 4FGUA 5THQA 3ZWPA 3RRMA 1UK7A 5EXTA 2B4YA 4IVNA 3DOHA 4PW0A 3OZAA 3MCTA 3F9CA 2CVHA 1E6UA 1VB5A 3CW9A 5C7IO 1D2HA 1WEHA 5DX1A 1Q0HA 2VHQA 4AYWA 2WUEA 2NX2A 1KDOA 5G3YA 2DJ5A 5EMKA 5JQGA 4KH1A 3EZ7A 1XHFA 4RNDB 1SBCA 2B5VA 4TT3A 5AOAA 3T9CA 2E6KA 3EAQA 4P54A 3FDJA 1ZONA 2ZETA 2N75A 4XASA 3PRJA 3B1WA 1AQ6A 4Y0AA 2VR1A 3WL4A 1YJXA 1OYWA 2B21A 2YHSA 3UWDA 3S1SA 2ZAGA 4PYJA 1EAMA 5EJGA 1EE9A 1K7SN 3VSCA 4A91A 4FXPA 8AT1A 4QUGA 2XZTA 4TVKA 1HE3A 5DWQA 5U1PA 3ZV5A 1IUNA 1KEPA 4FNOA 4JP8A 1G8JA 2E4YA 3UJAA 3P1JA 4KZPA 4EAQA 4OGLA 1AZTA 4CKEA 3FYTA 4IIJB 2VPZA 4NV3A 1JYFA 4Q0MA 1AG9A 1RM5A 3N07A 1HDCA 4K9SA 4D6XA 5FTWA 4REQB 5AM2A 2AQ8A 3FKJA 4G0XA 5CH8A 2PG3A 1M7BA 1R5OA 2VJBA 3CSDA 4LHYA 4YVFA 3IJEB 3O75A 3BH6A 5T41A 2XY4A 3OZEA 4BX0A 4E4RA 4BJHB 1CT9A 3BD9A 3RVBA 3ZWAA 5BWNA 4KXLA 1TA4A 4HLUC 5K0CA 1HXHA 1KC3A 2QLJA 3TAXA 5TLSA 2QX7A 3SXJA 2PEZA 1M6WA 1P1BA 3H1PA 1A8QA 2X3UA 3B48A 5H16A 1ZSVA 4XRGA 1HNXB 4O29A 3OQOA 3IEVA 1FLAA 2X0RA 4N8DA 2NYRA 3CISA 1DINA 1ZOPA 3CRZA 4Q4HB 3SS8A 2ECFA 2PH5A 1YE8A 1RHMA 3WNVA 4DUZB 2OAQ1 2QF7A 3RK4A 3CIOA 4NV0A 1DLIA 2W2VA 4M8SA 4V0QA 5BV7A 1YZUA 3RHSA 1BQ4A 1ZICA 5CK4A 4DUYB 5ESDA 1GSAA 1NYQA 2AC7A 2EFDB 2F9LA 2WP0A 2ZSBA 3KTAB 2VDPB 1KDPA 2VJOA 4WECA 1X74A 4UAVA 1U9CA 4WZBB 3VZPA 1QQ6A 3P4YA 3WK4A 4BQNA 1AGNA 2J09A 4TVBA 3W2FA 3FD8A 4EL5A 2VJNA 4LHSA 5C8YF 4G23A 2L2QA 4PQYA 2B98A 4UBMA 3BIXA 1IN8A 3VVLA 4MUMA 5JZOA 1Z2AA 1QTIA 1BWSA 2OYSA 3HU1A 1M2OB 2C92A 4BUJA 1RZ3A 1Y7IA 1N1MA 3NWOA 4CFYA 3E1KA 2F8SA 3LH5A 3V7UA 4OV6B 4F8YA 1IBLB 2FZCA 3AB3A 3JQQA 4J0DA 2X42A 4YLEA 4MNTA 2NVUA 1SURA 2HPAA 2AXEA 2EW1A 1WXFA 3VO9A 3K2EA 2RAUA 2YV2A 1NJ6A 2HA5A 1LA2A 4O2LA 3OTWA 2ABWA 3CF4A 3HJBA 1V8PA 2OAP1 4JENA 3ZHOA 2VEDA 4XZ3A 1B23P 2O0LA 3VYTB 3FFTA 4HMOA 4H15A 2I9KA 3LLSA 5B1EA 4V03A 2OCDA 1R50A 3G6KA 2CUTA 4G9GA 3TUZC 4HFMA 1B26A 1C3LA 2AI3A 3TRFA 3HXOA 1RLTA 4R2HA 3SHFA 3WC4A 4X63A 3C3KA 4LOLA 1ECPA 2GO1A 5SYNA 1YIDA 3L02A 1DE0A 1QHSA 1WPGA 4MKHA 4U1RA 4LGCA 1PT5A 2XUKA 5HMLA 1QQTA 1EGQA 2HJVA 2WA2A 3N2IA 3KQYA 3ND5A 4IFTA 4NBSA 3CX7A 1AKVA 4L07A 1BCSB 1SXHA 1E9EA 4ZT6A 1NAHA 5KS2A 4WDQA 2QRJA 1U0EA 1U99A 4TQAA 3K2IA 4QICA 2BJWA 5IW8A 5KYWA 1UMKA 2FWIA 4WCVA 2VRCD 1YKFA 4S1VA 4TYWA 3AVPA 4GEGA 3T3DA 4WOCA 3G2QA 5LQKA 2OT3B 2OO3A 2HBQA 4UAGA 1TYEB 4P7FA 4PE5B 3UT5A 4LFAB 2J33A 3THXA 4LY0A 3PICA 2COUA 2H1LA 4IPTA 1CIJA 4GR5A 2BR4A 4KWCA 4ABYA 3KT3A 4AXBA 1G5HA 1NR1A 2CFCA 2JFZA 4F3YA 2HSWA 2DH5A 4DJEC 3U44B 4N5NA 4EO9A 1E2UA 4LBYA 1OPXA 2AG8A 2ZTSA 3X1JA 4O3FA 4Z4IA 2GSDA 3AVVA 2AG5A 3CNHA 2VPXA 2ZUSA 1E2GA 1UANA 5B12A 2O2JA 1A8PA 5AP9A 4HX9A 3QSYA 3OTQA 4WXPA 1ISIA 1PJ2A 3D4OA 4D44A 3WV4A 5A02A 1NF8A 2C31A 1CUCA 2ZI5A 3K96A 1E59A 2FGKA 3LK7A 2A5LA 4IUBS 4M9QA 4N8EA 4PF1A 2HK9A 4BGIA 1LJ8A 1NMZA 2HMWA 4EKDA 1QVRA 3CLUC 5G1OA 3ANXA 5DYTA 5FI0B 5AICA 4DHWA 2O23A 4OKNA 4BFSA 3U7HB 5B7QA 2HX1A 3LDUA 2OK7A 1GCIA 3KR2A 5BYBA 2JBAB 1PR3A 1TD9A 1ZH0A 2BRUC 2P4SA 3GXOA 2I33A 1S2MA 4NZMA 3TVTA 4E4TA 5IDQA 3ENQA 5K8CA 4OHYA 4X6UA 3TQRA 2C78A 1R8XA 3BS4A 4I1VA 3TIIA 5IYZB 3G0HA 2IYYA 3IAUA 1XTPA 1IN4A 2DC1A 1U8FO 2CD7A 2Q9BA 1NTRA 3HRKA 3I53A 3ITEA 1JQ3A 2H4FA 4FX2A 4K6CA 5DPMA 5HS4A 5LU9A 1E69A 1G8HA 4IJMA 2EL9A 1ZG3A 2ZYIA 4ZHSA 1WRBA 1DJOA 1DQPA 1KI7A 1SVIA 1WW2A 4HD8A 1YS1X 3NBKA 1SZJG 2FAXA 3UO8B 4LDJA 3BT7A 5BNIA 1A9TA 4RSHA 4Z0TA 1P4JA 4S1OA 4XGKA 3JZAA 2J5BA 1VPTA 3BRSA 4CT0A 1ML3A 3B1ZA 4L1KA 1Y6FA 4FBMA 4F4HA 1DG1G 1HI9A 2AFIE 4BKRA 3TQCA 1QIKA 4WL0A 3BHNA 1OCEA 4E2WA 8OHMA 2J0EA 3IKTA 2AF3C 1FMTA 3NTXA 2OGZA 1HG1A 2DBRA 3OWHA 4PIMA 3K9LA 1BYUA 4U7FA 3DO8A 1Z45A 3V4LA 1X7WB 1XRQA 2PEYA 2YHIA 5HX7A 3CONA 3EUFA 3TLBA 2IH2A 3TDMA 3D31A 2WJHA 4DYVA 4EL0A 2RK6A 5EZSA 3ZJ5A 3M6UA 4E31A 1MC1A 1QZXA 4D42A 3FOZA 1Z4PX 3FPSA 2DBQA 3F3SA 3QLJA 1KJJA 4N5LA 4TWZA 4ACBA 4LA4A 3DBOB 3PKIA 4NPCA 3IKMB 1KYWA 4GI7A 4EJSB 3FOFC 1EKXA 2H1CA 4KXYA 1IXZA 3B51X 1U7WA 1JWBB 3KZCA 3PRKE 4Z1MD 2VHVA 2VRNA 3FMPB 2QZPA 4QYMA 4GQIA 5LCXA 3QKIA 1R15A 2QT9A 5C1DA 1RRCA 1DELA 3GPIA 4KMMA 3UGKA 1AA6A 4R0NA 3IAAA 4PAGA 1WULS 4QFBA 3TD6A 4LN1A 5H7XA 2XNDA 1S01A 1S2LA 4I5GA 4WK6A 1OZ0A 5EIBD 4R01A 2EKPA 4FN5A 1UDXA 4J1NA 1WDKA 3QKUA 1AKTA 1G20A 1YR2A 3KELA 4B3BA 1TEVA 1IRXA 2R66A 4BZZA 3QFRA 3TLZA 4O8CA 1YZVA 2J9GA 3G1WA 2V7QA 3EYAA 4OQEA 4OHPA 3KYJB 5CPBA 5EFOA 2DPMA 4P35A 4QM6A 5K0NA 1Y0BA 3DL2A 1WAMA 2IQ5A 2WOOA 2ZRKA 2RI1A 3BZUA 3OU7A 1TAGA 2QX4A 3HCAA 1VYUA 4URUR 2BMFA 1MXFA 4G65A 4IKOA 2XOKA 4WXMA 5DBGA 1Q5PA 2YL2A 1MZVA 1IOLA 4LIPD 4IO0A 1UJ6A 1CUUA 3F6EX 3D4IA 1F1BA 1TYAE 3B20A 2I1QA 1S6YA 1HRDA 1VMEA 5COQA 4YAUA 3NB0A 2V54A 4MI3A 3WISA 4C2BA 2WG0A 1ULSA 2G17A 3RBZA 3TL6A 3I72A 4Q7EA 4Y1RA 3UCXA 4DYHA 2EWVA 2Q41A 4EFLA 3Q10A 2V7XA 3A6HA 3MTAA 4I19A 2VZLA 3RF6A 4DMGA 5ELMA 3VR5H 1Z4JA 2B34A 3BGSA 2RI0A 3I23A 2P2GA 1L5HB 2NVBA 3PEFA 4B7AA 3G9QA 2A58A 4J3NA 1HNZB 3EPPA 5E1BA 2HB6A 1V45E 4NYMR 1U4SA 2IXEA 2Q5HA 4FGLA 4B43A 4OF4A 2UYCA 3CZQA 1F20A 2FVYA 1RFLA 5JVDA 2EU8A 2V9ZA 4M86A 4OYRA 1Y3DE 4P84A 4WBNA 5AI0A 3E7XA 3MUEA 2EVWX 3D3KA 3CUTA 4A8JB 4OVKA 4QOJA 3KALA 3WSTA 1TQDA 3N70A 4FP9A 4MUKA 4Q9JA 3ZDYB 1B76A 1N33B 3IODA 3PR3A 3B5IA 1Y3IA 1P62B 2JFYA 3DP7A 2F8MA 2VSYA 3JAKA 1DKPA 2ZQZA 4UTOA 1XN1A 4WCFC 3AHIA 3J7AC 3ZYCA 4KR6A 1E7RA 2YIJA 3AEQA 3U3MA 3WZLA 2A14A 2GA9A 4H17A 1JXOA 3IAHA 4WKGA 3KLBA 6REQB 3E84A 1X14A 1LQTA 1UBMS 3FROA 4HDCA 4A8PA 2JCVA 3WDKA 3EASA 4FJ0A 2ACEA 2FX3A 3D5QA 3GUCA 4RS4A 2FPGB 3LKBA 1LF0A 4FSXA 1NR7A 1GRNA 1ZUD1 1TUBB 3EZ6A 1V5WA 1NOIA 1HA3A 2E4UA 2QTHA 2Z08A 4MVJP 4R54A 4RL4A 1EXVA 2JG3A 3LDGA 1ZU5A 4MW7A 3ND7A 2VC2B 1G9XA 2VS1A 2IYWA 3O47A 4PLFA 3SLGA 3JZDA 3QX9A 2AEJA 4K2AA 1ZVKA 2AD1A 4Z2YA 1U0GA 3D6FA 4R9VA 4B84A 4F12A 5AUNB 1C9EA 1QZTA 2WLSA 5EWLB 3RAEC 2QIPA 1OX6A 1VMKA 4IWNA 4PFKA 3ZGYA 4FB4A 5LNK6 9ATCA 4CN9A 1C9DB 2JBWA 1Y82A 1YTLA 2Y27A 1EM6A 2H0QA 3BMXA 3GLGA 1KY3A 5ALXA 5JPIA 4N8SA 3NBXX 1TF7A 2OC4A 1WB4A 3BILA 1HE2A 4MYSA 5JAQA 2VQ6A 3M6FA 4FONA 1E9VA 5K0LA 2C1ZA 2GHIA 3LCJA 1KYQA 5K8VA 3AW9A 3KOYA 4PC7A 1XRSB 4MDEA 1ZM2A 2QE7A 1WUKS 2Q1UA 3IBFA 4GWLA 4MV8A 4MVJH 4DYDA 1P60A 1YZGA 3HO8A 521PA 2ZZKA 4PZ9A 4BVKA 4MWZA 2DQSA 3KJHA 3FNFA 1BMFA 4GSKA 1UODA 1LBQA 1NVFA 4H7KA 3D2BA 1E1NA 1J20A 3P2EA 1KH1A 1M7GA 2VNAA 4FS3A 5KTYA 1LEHA 2FN9A 4ANFA 4RE5A 3VU8A 4YRTA 2XRMA 2BGGA 2JVJA 1G5PA 1G1MA 3RBAA 1E1QA 5FBZA 4F04A 2RH9B 3QLEA 4XR9A 1C30B 4ZAYA 5CYPA 2BBWA 4J03A 2A0UA 4FMBB 5TJHA 5HFNA 1FVXA 5AW5A 1LPAB 3G5TA 1T2UA 1PG5A 2RH4A 3ISJA 4NYIR 5IKPA 1G20E 2DR3A 3H0CA 1EI9A 2BM1A 3Q3HA 4YJHA 3VC7A 1BA3A 3DFUA 3BE8A 2IPXA 4RVHA 1KE2A 4GECA 3TM4A 3TSOA 3EGVA 1Q17A 1MGPA 2AHRA 2R7MA 4BY9E 3ODPA 1X8LA 2R5NA 3HB7A 5CH3A 2H08A 3Q5GA 1K2WA 4QBKA 3PPXA 4BX9A 4CJXA 2I4NA 1EE1A 3DMDA 4HHEA 2VZ9A 4MMYB 1DZ3A 1WUYA 1XMPA 1UBRS 1V5GA 2DM6A 2NN3C 4NMMA 1Z83A 1DC3A 3H05A 5EUBA 1KI2A 5KQSA 4DIBA 1K8ZB 5BR8B 1ZM3A 3RRJA 3W4KA 3CUSA 1R3DA 2C3OA 3GMDA 1RTTA 4R6XA 3UJHA 3GQVA 3TUIC 4A0HA 3TGPA 2AKYA 1G16A 3VC1A 1FW8A 1H9AA 4DA0A 3BGWA 1OFIA 3CVVA 1WPRA 1GA1A 5FJIA 2ZTVA 4FYKA 4KVFA 4MO2A 3OZDA 1OXKB 4JEHA 4U2FA 2X3FA 3MJFA 4NR0A 4AKEA 4BASA 3H83A 4HSEA 5CFMA 1D0SA 2GBCA 1R8QA 3T9AA 1BDMA 1YK0A 4HUQB 1T34A 4PBSA 1GPH1 5B53A 4ZZ1A 1GPJA 2WKWA 3B78A 1R0LA 3QA3E 2J3JA 5JMWA 2AG6A 1ACMA 2GXUA 3WHIA 4ZJYA 3LO5A 1AN9A 3VSDA 3OIYA 1VZ2A 2DOKA 1Y8RA 4O1IA 4KPUB 3L84A 4IOKA 4IIJA 4QXQA 3T54A 2JH9A 2QL5A 4G07A 1T0HB 3M82A 2XZOA 2UYOA 3O8RA 4REQA 3HKBB 3W2IA 4I81A 3FYUC 1ZNWA 3DT6A 3AQ4A 4G1CA 4X71A 4ZZ3A 1QIGA 1KP3A 1XL0A 5IKEA 4G26A 1E2NA 1KYVA 4NENA 3G17A 4YDHB 1N7JA 3H42B 4NL4H 1QU3A 4QOFA 2NT4A 5FPKA 3S8YA 3K32A 3OJEA 3LP6A 3GX1A 3PSHA 4EYQA 4RPGA 5L40A 3O4HA 4RSMA 1YJQA 4BE9A 3H8SA 5IAAA 3K09C 2FEAA 4U0KA 2R9VA 3KB6A 2FK7A 3PBKA 1RKUA 4MI1A 4D9HA 5A03A 1EEHA 5TS3A 4ZFNA 2O8EB 3UMYA 3B6JA 3SKYA 4F4DA 3T7IA 1M2EA 2D5BA 1SD1A 3PENA 2JGDB 3GLGE 1H2HA 3FI0A 3ZWBA 2J87A 3KR1A 3F3MA 5LZ8A 1XTZA 1Z68A 3PD0A 4XPIB 1RZUA 5H9VA 3IEIA 4A2QA 3FI9A 4YJ3F 2MMCA 2GBFA 4I99A 3SBOA 1GTRA 1UBHS 3A26A 3HFRA 2ZRPA 4XLLA 4CODB 3DGFC 5AXAA 2ACWA 3WB2A 3BXEA 4RPKA 3RW9A 1UBCA 3IT1A 4YMSA 4BO7A 5DNCA 5K6RA 1NQAO 2GD1O 1AUXA 4QARA 3K0KA 1RPJA 5K3CA 4LHEA 4EAAA 2WIGA 2UV8A 3MJDA 1QAOA 1KQNA 3ENNA 2KX7A 1AUVA 2OY0A 3ABOB 3KB1A 4Q1EA 9LDTA 2O2DA 3LRXA 1PV2A 1DAHA 3EIFA 4KIUA 3N2KA 1VCMA 4AG5A 2RGCA 4S24A 4GPAA 1LH0A 3VH3A 1GU7A 2QAJA 2J6CA 3QKSA 4HWSA 3ZDZB 5EMHA 1C1HA 1PJ4A 3HACA 3PLNA 3WY9A 4ED9A 5IHPA 2PUBA 1A72A 2CXNA 3TQFA 1X39A 1GSOA 5AXCA 2Q9UA 4ZJZA 1HNNA 2P9CA 2AHOA 2CKDA 2WM9B 3RU3A 2IP4A 3FUTA 3E9MA 3RFCA 3CEPB 2BGTA 1RZVA 4QTUB 2VT7A 4K6HA 1OFVA 2HWYA 1CYEA 1FYWA 3VKHA 4AS1A 1IDN1 5ED4A 1KU6A 4DJFC 2HXSA 3D8SA 4B74A 2KE5A 4C08A 5IVKA 1ZOOA 2WJGA 3VOSA 3E9RA 5HKOA 1EVKA 1OZHA 3ET5A 4U3JB 5EPEA 3JCZA 2I3DA 1CFJA 2C57A 4HH0A 4Y0NA 2BUCA 1ILWA 4MV1A 2X4LA 1U7OA 3LQRA 5EJ5A 4URWR 5COBA 2ZYRA 1RHKA 5DRTA 2Y1LA 4JBWA 4ENPA 3GAAA 4V1CI 1GO2A 3HP7A 3OOJA 2JGNA 5F5XA 3T5CA 3U61B 1IM2A 3BF8A 5BMOA 2Z2IA 5T8KA 3EBOA 1ZUWA 5LN1A 4ALIA 4BNVA 4KIFA 4A26A 2QB5A 1QH8B 5TPZD 1SHJA 4H3HB 3ZNQA 3N2EA 3N6VA 3OFSA 2D8AA 4Q16A 3DUFB 3ZQKA 1ML4A 1PEYA 1PZNA 1EDDA 3OUUA 4J3FA 4N49A 2O1SA 5CIYA 3PX2A 1Z17A 2OOSA 1L5NA 2HCBA 2P68A 4F9TA 1YQ9A 1YHYA 2RHGB 3T3NA 1AQUA 4QXPA 3V6LA 1EGHA 4LZAA 4UCQA 4MVCA 4FOLA 3FFWA 4UJ3A 1CUZA 2G25A 3H11B 3U48A 5JFOA 1E77A 3W8NA 1Y8QB 1J4AA 1NSFA 3FNEA 4IZ6A 4ZEOA 4HDSB 1QRUA 1WPXA 1EQAA 1WVGA 2B2NA 2Q3MA 2VYNA 3BQMB 3OLZA 4RIGA 3RNLA 3G2PA 4JJ6A 3USZA 2H4ZA 2YJ5A 3BIWA 2CY0A 1IAQA 1YMUA 2O0MA 3DNMA 3IP6A 3KYBA 5HILA 4C07A 4LFBB 4B4DA 3H8JA 5I7HA 2I7DA 4EA6A 3LBHA 1HF3A 4BFVA 3CVYA 3B8HA 5CIQA 2IUYA 3RSFA 2ODNA 3HB9A 4LE0A 3X1WA 2FE1A 1RYZA 1ODFA 4FK8A 2PAAA 2O1EA 3A58B 4RESA 3V7YA 3Q11A 1ZZEA 1WDTA 2HJSA 2CF6A 3BJEA 3KHUA 4DL9A 2JEZA 4I3GA 1SXJB 2VJMA 3GJ6A 2D2EA 3AR3A 1KEEA 4O1HA 3ETNA 1TADA 3NM4A 3B1XA 5CA1F 3EISA 4YJ3A 4IGKA 1ZGBA 1Z5OA 3BSSA 2JGMA 4JELA 1KARA 5BSFA 5CAEA 2O1WA 1Z0KA 1ZU4A 3HLYA 4KH0A 3BXHA 2LCIA 3RO7A 2X2PA 1QQ7A 2GXSA 2OC9A 3PVSA 1A7JA 3QMMA 4UM9B 4MS1B 4RJTA 4XIJA 1KDRA 3PC2A 5KVAA 1NRWA 2ZULA 2BGRA 2WHQA 1W0JD 4POAA 3VO8A 3VR6A 3MRTA 4US1R 4YCNA 3CCBA 4M7RA 1U2RA 4MW9A 1UMDA 3EG5A 3PIIA 3W8EA 4EZEA 5C1OA 2AJ8A 3USCS 1KYXA 3T7EA 5B4TA 1R9NA 4LGVA 1FFXB 1KXZA 3AH8A 2PTHA 4IH9A 1YWGO 2P0AA 4LJLA 2VHTA 5JBNA 3H6GA 2H31A 4JCCA 2ZB3A 3MSXA 1FUYB 2JJ2A 3GVPA 3DEHA 4XIYA 2DFPA 5DCWA 4MGYR 1RQNA 5NULA 1HT1E 4ZARA 3TVDA 4E5VA 4JT4A 4R69A 1J9ZA 1YB6A 1CF9A 2H9AA 2ZJAA 3OZSA 1E1CB 2EW8A 3HZOA 2H48A 4IIFA 3JWHA 3QFSA 2DFNA 1M54A 1B7GO 4Q1VA 4ZVNA 2I87A 3BKXA 3EVGA 3MS4A 4FZRA 4N5DA 2HDHA 1COWD 4ENRA 4P5PA 4JSRA 2I8CA 4FNAA 4IJKA 4RNCA 1CP2A 1TCCA 4IYRA 2PANA 1CCWA 4XE5A 4A82A 1X1EA 1Y6QA 3D6HA 4E32A 3RADC 4COKA 1YIAA 4MKFA 2CB9A 4B7UA 5TX7A 1RKBA 1YJ8A 3ZC3A 1E92A 4PTZA 5ES3A 721PA 3U16A 2PRYA 3COYA 4X7RA 2N1BA 3KUCA 2JKYA 3H5RA 4K5QA 4YRQA 3T5MA 3WGOA 4M4SA 1BTOA 5JMTA 1JHVA 4YEDA 1WB6A 4CL0A 3PLRA 5B6JA 4L22A 4PSDA 2WF6A 4LC9A 2BHSA 4Y98A 3RIGA 1ZLYA 3JQBC 1BHQ1 4PHGA 4D8WA 3K6SB 1JLLB 3PQ6A 1R0WA 3O8NA 4XDZA 2A0FA 2R25B 5F76A 4ZEMA 1C8BA 3SMQA 3P5BA 4R1QA 2XDWA 3P32A 4PNPA 3WJAA 3HVHA 3L7OA 4M9UA 1W581 4UNNA 1FPQA 5JRJA 1AT1A 4GE0A 1E9BA 2NO5A 4EGQA 2WP8J 3KQLA 1JH9A 1SJ9A 1BXZA 3UC9A 5HUJA 3AVXA 2QGFA 3HVRA 4TKUB 5H70A 3UK2A 4FN4A 2OHFA 3SQLA 1KOGA 3DQQA 1I32A 2J07A 3FPEA 1CZUA 3WL6A 3S55A 1ST2A 2VO1A 3FPFA 5EHXA 3DUWA 4B9AA 2ONYA 3ZOZA 4RL6A 4NBTA 3SHTA 1XU9A 3MMZA 3OZUA 4M8KA 4ALKA 3U5TA 1EWYA 4KX3A 3DD1A 1L5HA 1OGJA 4L8VA 3C1OA 1KZHA 2R1TA 1CERA 2HUPA 3RG8A 1ULAA 3I6YA 3CRNA 5A7HA 4AQYB 4B4KA 2NUPA 2ON6A 3C5WP 1WXIA 1JSRA 4LJKA 1E1DA 3FTCA 5F3DA 2CJWB 1WSAA 5CA1A 3RFUA 5H68A 1HFEL 3KP1A 2ZRMA 1TEZA 4BP9A 1BMDA 3EPKA 1TYZA 1IVSA 1VSTA 2CHGA 4B5LA 5CM2Z 4MTLA 4B4UA 4N0PA 1R2QA 1RJ9B 2MDTA 2C2KA 3A4YA 2CVOA 1KYTA 3L77A 4GXRA 4HRXA 4LRTB 1CQWA 4OK5A 4TL9A 3V8BA 3MRXA 3R6GA 3RS3A 4KIGA 6REQA 2NSDA 3L4KA 2E5LB 1TJ4A 4E70A 1V4VA 3E3AA 1ODSA 3L43A 3DNPA 3TOCA 4YPOA 3ZJUA 3FCEA 1CQZA 2YYSA 2E55A 3MB5A 4ZU6X 3KOOA 1F0NA 2ZXFA 3G5AA 3MWFA 3JARB 4OOFA 2EJTA 4DTIA 2G09A 2BH2A 2H1OA 3WA7A 5AXBA 4PM4A 1ORTA 2VDLB 3I9V6 4BB5A 5I4KA 4US2R 4IGAA 1UC4B 4B2LA 4B8YA 5EUMA 2QTCA 5HFAA 3GZJA 1OUMA 3H5WA 4PXAA 4YGYA 2XVYA 2BKXA 1W4ZA 3FMOB 4RPHA 3SOPA 3A1SA 4H1TA 4ENVA 4NS4A 2JVKA 1RPZA 3WGIA 1E6CA 3HNPA 5CTAA 1DTEA 1XP8A 3RYIB 2WYUA 2ZWVA 3KFVA 2O7QA 3FOAA 3S2YA 4RTOA 1WHTA 2O4UX 3PNPA 1C9YA 1GPMA 2Y66A 4IIYA 4U5XA 5HCIA 1KQ3A 1Q6YA 3PC8A 4XWYA 5H4HA 1CPYA 1NWCA 2ZBFA 2OPHA 4YRGA 2AV6A 4RVSA 3HR7A 3KJZA 1MIHA 1BXKA 1PE0A 1SXIA 4GE3A 2NO6A 2OMKA 3TOSA 4YR9A 1RWMA 1C4XA 1CTQA 1J70A 1RJDA 1BN7A 3B82A 3OHSX 2BEUA 4HYEA 4QDUA 4H7FA 3CWCA 2H5JA 3VMMA 4M9RA 2QMZA 4DDVA 5ARDA 4XQ9A 2B6HA 6ADHA 3OAAA 3KWFA 5CVTA 3OKPA 3L8FA 3ZE8A 1X86B 1X38A 5F33A 1GG9A 2OMEA 3QUSA 4R0MA 4RZ2A 2ZBVA 4YXWA 2PBFA 2WWTA 3BK2A 2GZ3A 3C7AA 3W2EA 4P7BA 3UOGA 1T5BA 2ZB7A 1VKZA 1NRJB 1YBVA 4TLLB 3ZHQA 3RVOA 4GZ6A 1DRKA 4KO3S 4LZLA 3CRW1 4CKBB 4IWXA 1SY7A 4CV2A 4WNAB 2OE2A 3UV6A 5C35A 2PKWA 2XB6A 1LFAA 1NI4B 3FKSD 4G5RA 4HAWA 3ZNNA 2PKRA 4LRXA 2IPNA 1PVOA 4MWCA 3GY0A 2V97A 3ZHSA 3NWBA 4R51A 5TVGA 1RVV1 3M4ZA 2D5IA 4O4IF 5ENVA 5HA5A 1Z0ZA 3E70C 2GPTA 3IS3A 4N7JA 3TKYA 1J99A 3K4PA 5FPSA 1ISPA 1MAVA 4JU9A 1CUIA 4GPD1 4OUDA 2QNBA 2G9RA 1ZD8A 1ZRHA 1OTHA 2C1EA 1X80B 2GH1A 1T5IA 5KSPA 1BC5A 3UXYA 1NBEA 5JUWA 1ABBA 4W5TA 4YR7A 1KI6B 1QP4A 3SZGA 4E13A 1ISGA 1I24A 5AVQA 2P8JA 2EJCA 1DC8A 2PFGA 3HS3A 4OQNA 1TZKA 1WLYA 3CCCA 4D3YA 4JUBA 3K6RA 2OCAA 3NG1A 4TXLA 4UHCA 4EGSA 1PV4A 3ABZA 5L4NA 2XF8A 3D54D 1CVIA 4DCVA 5C4MA 2JJ1A 2SCUB 1QHGA 2CVPA 4IDAA 3NVKI 2H17A 3W6UA 3S2EA 1K75A 1H2RS 3N2GB 1B2LA 2SNIE 2R5WA 3HMQA 4KQWA 5FEUA 2H5IA 2PQ2A 5KHAA 4OHMA 2IX3A 4RJJA 4DNOA 1K4MA 2FY8A 4BUCA 1F51E 4MYHA 4QUJA 1WD5A 3OZVA 4O4JB 3O38A 4RDHA 2GEKA 4DADA 2LIPA 1XT6A 3IVMA 2GLXA 3CGWA 4EHDA 3CEMA 4ZICA 1IDOA 2XQFA 3WIEA 1LV7A 2FR8C 4I8DA 3S1AA 2H5LA 4JKYA 1UZUA 1TQ6A 3RG2A 2UZ0A 2J08A 3ND9A 1EFHA 5E0OA 4C7KA 1PGQA 1DIAA 2QRHA 1W5AA 1N5IA 5EIOA 3GLFA 4DV6B 4C4XA 2VAWA 1SZPA 2APJA 4I1SA 5KJ6A 2VBGA 3JPYA 5D8DA 4NEHB 5EXSA 5TS2A 1Z13A 2OCXA 3QXGA 1ZRNA 1TD1A 4YRPA 3L40A 3MIZA 3V1LA 4AZTA 1E3EA 4KTTE 1D2CA 1HQYE 1N6HA 1JH8A 2G1KA 2C4NA 1KEZA 2C9OA 3AFNA 3MERA 1VL2A 3G0DA 4TSRA 4YV1A 4CM7A 3JALA 3RK1A 1N5DA 5KYTA 3AF6A 1PR1A 4K8OA 4MVXA 4BUZA 4ZYYA 1ND5A 5BSKA 2WPNA 2PJDA 1E2LA 3MEQA 5CU7A 4RUKA 3PNBA 3T1VA 1P5FA 2QVBA 1A82A 3LV8A 2AKEA 5ITVA 5ALTA 2PGLA 4X54A 1IXRC 4AJLA 1EJ0A 1O94A 2J3EA 2V5AA 2HC9A 3H7AA 3GPBA 1TC2A 1U28A 2M6LA 4KITB 1QC5B 2G80A 5AW6A 1PFQA 2DTDA 3A6EA 3NHWA 3OE4A 4I4NA 1L5WA 4UPDA 5CW1A 2DQYA 1PZEA 3LT5A 4JKIA 2XQKA 3RC1A 4BB0A 1AOXA 2HSJA 3TTSA 3DJYA 1O96A 4L0QA 4QPNA 3S27A 1NYLA 1GGNA 2QLNA 3CJRA 3IV7A 5FBWB 3TNFA 621PA 1MX5A 3AEUB 4Z9XA 3C70A 5IASA 1SC4A 2JGDA 2P11A 2Y92A 5AM1A 3IX7A 4XPIA 4M60A 3HVUA 3Q9UA 1T1JA 2AWNA 1Z6ZA 1Z5VA 3AR7A 3I37X 3S81A 3A4IA 1RWKA 4UCFA 4RY8A 1Z15A 1NDQA 4ZI7B 1VRCA 3C3PA 3HABA 1O6ZA 2REXB 5HK8A 3GLHA 2D06A 4WLVA 2WWYA 5HJ2A 5JU6A 1NLZA 4OYLA 2RJ3A 3QOXA 4U39A 2AZXA 4M0UA 3GARA 3GRVA 1KQGA 4YP6A 1Y4SA 2OO7A 2Z9BA 4RC9A 3RS2A 2QV7A 3I12A 1QV7A 2PQ0A 2DMRA 4DMRA 3G6WA 2EIHA 4JL5A 3GEGA 1XTSA 2O7NA 2G71A 3ADOA 3GMSA 3KYDA 2R86A 4G41A 2PFSA 3AJRA 5KJ1A 1XLVA 1YRBA 4DDMA 2H3HA 3EDYA 4LPKA 3ILVA 2O3SA 1E0JA 2HCTA 5I7WA 1KEKA 5F7ZA 5E1OA 5KDLA 3AIMA 4F11A 3Q6IA 4A6PA 1EUDB 1ZCFA 2HMTA 3NU1A 3QE4A 5FYDA 3ZDQA 5ALRA 4I9UA 2IDKA 1IUPA 2WWWA 1ITZA 2IYPA 1CQXA 1MIOA 4NH4A 2WC1A 4P4SA 3PDIB 2ZPAA 3ZEAA 4F4IA 1YZNA 1H0SA 1MO2A 2VK8A 2W6IA 4NECA 4Z8XA 5BN5A 2WQ7A 4I1PA 4UD6A 5D1HA 1YDWA 3U37A 2YN2A 4OAQA 4BLPA 1NI3A 2BM0A 1PS9A 4U3JA 4FR2A 1PVDA 3KEGA 5CVCA 1MDBA 1V2HE 2C0CA 2D74A 1EB9A 1O97C 1KS2A 1FBTA 1JDZA 1RLIA 1I8TA 4NBWA 2ZTLA 2P6OA 1EVJA 4GM4A 4LBWA 4DJAA 5BW4A 4WWHA 2Q3EA 4ZVOA 3R5FA 2CXQA 2BSAA 3Q7PA 1I4WA 1NDUA 3QTBA 4IH4A 2EBUA 3DAYA 1Q3KA 1VHTA 3IR7A 3P97A 4GWGA 3SFZA 3WJ2A 4ZRDA 2ZSAA 3OFNA 3Q8WA 1FL9A 1GTZA 2VG8A 1C4OA 4RHFA 1AC5A 4YJKA 1BGVA 1Z4NA 4BO9A 3NXKA 1JR3A 4IRXA 4JQZA 4RZQA 1MENA 3HJHA 1EHYA 1N6PA 2DWPA 4ILKA 4FBLA 2CLCX 2JRLA 4WLNA 1EVEA 1P5ZB 2DPLA 3H5TA 3WO1A 4Z9FA 3HJTA 2FA9A 3KR0A 2IQIA 3DF7A 4J1SA 1EYZA 1JIIA 1CZLA 1L8QA 1K08A 2M6RA 3KQQA 3P4UA 2Z2JA 4GC9A 3GLFE 3EXHA 4D96A 3RVKA 4MIEA 1T9KA 3TTYA 3W0LB 4AJHA 4EEZA 1VSBA 1DT5A 3B2QA 3ESCA 2J3DA 4CMAA 4E1AA 1L7BA 5AR1A 5J2UB 3ZE0B 4M0PA 1QG4A 1JVSA 4ZOAA 2NU8B 4BNYA 1CUAA 1ZM7A 4GBED 4X65B 1T5LA 2ID7A 4U2EA 2W4IA 2XBMA 5C8YB 5KWSA 2D2IA 3BFXA 4LBZA 2EGGA 1NVVQ 3QZUA 4H1VA 2QG9A 4OHXA 3PP8A 4ROTA 4XOIA 4BU1A 5IZ4A 4DUGD 5SICE 3LUCA 2RGWA 5EP1A 5DCUA 2X8JB 2O3RA 2Z57A 2OG1A 3O3MB 4JUCA 4PLHA 5IXSA 1SIWA 1BS2A 5CEFA 1ZRMA 4DF3A 2X7JA 5KVQA 3DKRA 5JWOA 1NN5A 2WYVA 4MPRA 3ODGA 2CNWA 2IEAA 4DCPA 3C3BA 3DDCA 2GZDA 3ESAA 5CVEA 3V1MA 1S0UA 1JEAA 3TSZA 4F5ZA 3BL6A 4ZYUA 5KTMA 3E27A 3ASUA 4EHHA 1YVUA 4ZPJA 1XRNA 4JNKA 1FSPA 2X0IA 3PLAE 1RXCA 1ZOIA 4BYGA 5HOQA 1JWAB 2JI7A 3IJPA 5CLHA 1TA0A 2AG0A 3QE0A 1MAWA 1E79A 1YB5A 2P91A 5NLLA 4OMUA 4LXQA 2QTLA 1Z8DA 3CT4A 3VPGA 4WZZA 5U4XA 1MBZA 3TQQA 3HZZA 1J2TA 2D62A 4Q05A 3V3TA 3TMAA 4Q4DA 3GJ4A 4XWKA 4BNDA 1FFXA 4YT8A 4NEQA 3ML1A 3M49A 3UATA 2R6HA 4N9QA 3GLHE 1JILA 1VRVA 2CKMA 1DIBA 4RJ2A 5I8ZA 2OFFA 2FWPA 3DZJA 3SLKA 4AMVA 1PFGA 3DOOA 2KLHA 4HQLA 2QYHA 4QRHA 4GXNA 4MKGA 2NSLA 3ZW8A 2HT6A 4H1WA 4NWIA 1Z0UA 5AIBA 1E1RA 3IUSA 5K0FA 2WT4A 3C1AA 5FYQA 4RLHA 2PVCA 1NASA 3K9WA 2AZMA 3PC3A 4CMIA 3RRNA 1ZR4A 2BTEA 4X1OA 2PUAA 2WU3A 2IIPA 2PH7A 5EHIA 1ZINA 1XQXA 1TX4B 1R4ZA 3AT1A 3G89A 1NP7A 1PX0A 3KTFA 4N6OA 1V9SA 3H8VA 4J0GA 1XZNA 2B0CA 3PC7A 2IEYA 4M1EA 2QTZA 4XYBA 1M2JA 3FH0A 5DKFA 5IJWA 2C7GA 1JDBC 2WT8A 1L4NA 4D81A 1LPSA 2QP4A 3WGHA 1U0SY 4HFRA 5BSHA 4DRZA 4FZ5A 4DLAA 2QVLA 1NW6A 1WL8A 3CPHA 4X41A 3B7PA 5KHOC 2DETA 1QG2A 4JLJA 4XLTA 1KY5A 2DPGA 3B5EA 3HBLA 4YAJA 3ST7A 3WP0A 5K20A 3QYFA 4N6NA 1E61A 2B1JA 4XX0B 5KTSA 1KKUA 5IWCA 1ODCA 1SUEA 1D8TA 5D2CA 1L5MA 3UWSA 4BMOB 821PA 4DIMA 3F5SA 1YT5A 3KRTA 1N6RA 4PR3A 1W34A 2BFNA 3R7WA 5HF5A 4UBIA 3WLEA 5BSVA 3NJ4A 1XZGA 3LDFA 4P6VF 4KNVA 4DLUA 4DV1B 4K28A 3BK1A 1FSSA 5TGTA 3K1ZA 1IPFA 3SZRA 3WLNA 4CQMD 5F2OA 3BRCA 4D41A 2V7TA 4RMJA 4FYWA 1S2DA 3F46A 3GDFA 2PQMA 5JAMA 2P9ZA 4R9RA 5LMNB 1JQDA 2D5CA 1JR3E 4IX9A 4QT0A 2FUG1 5JYBA 2ZYVX 1CRPA 3R3HA 1KRHA 1N2CA 1W2HA 2HSGA 3TSCA 5HKKA 4QM7A 3N8NA 2P7HA 3ET4A 2GK6A 2UUBB 2CFIA 3L1UA 5HUQA 2JZCA 1QP8A 4RD2A 4QLBA 3COZA 5A7FA 3W7VA 1YB2A 2EX4A 1TU4A 3E3MA 3LC0A 5LBTA 4EJMA 1XUOA 2JAOA 2ZJ8A 3U7JA 3DLAA 3LT2A 4CF6A 3AFMA 5AVRA 1GIAA 1ADYA 4G5GA 4XEHA 4CM9D 2AOUB 3H3JA 1M8JA 1T9DA 1KSGA 4Y6PA 1H66A 2HTFA 1DWPA 1YONA 2YXEA 3OU6A 3WRWA 5JZ9A 2HMAA 4GP7A 1D6NA 1JDPA 3A04A 4KQXA 4KE6A 3L0DA 4HQ0A 5C8DA 2WM2A 5K3DA 5JT1A 2W2LA 3EXG2 4OI1A 3QKWA 1QPZA 4QOHA 4YC7A 4LJ8A 2FVXA 3EH1A 1RJ9A 1GCUA 3PD7A 3R6TA 4CFZA 5JAIA 3LZDA 4LWOA 4J7CA 5A71A 1PFVA 2Y8EA 1Y80A 1KDZA 4KMRA 3UAVA 1D4FA 2Y9PB 2GN9A 3VTZA 1C1DB 1MTOA 1T5HX 3G2LA 4LWZA 4AI6A 4PPFA 4LXYA 1SXJE 1QH1A 2CNOA 1ZAKA 3QG1A 2CMHA 3GZNA 1DQNA 3NPAA 4C6TA 2VJCA 4PGMA 1YD7A 4NZZA 4OI4A 3X1XA 4PZPA 4HEA6 1EP9A 1N1DA 1QPGA 2YMQA 3LVBA 3R3XA 4S1NA 3G9UA 1M6EX 2YMLA 5AW7A 3L0CA 4D0NA 1SK8A 1OAKA 2YUTA 1ORRA 3UTCA 4D9EA 4GP6A 5KZMB 2JHAA 1O6CA 3FXAA 4UUQA 2LCFA 3JWJA 4TV9F 4P7GA 4CR8A 1NUQA 2FEXA 4ZYWA 3WK7A 4LDRA 2LV8A 3LVFO 1KJ9A 4CLRB 1F9AA 3ER6A 1I1OA 3U7RA 3LJKA 3ZHUA 1L4HA 1HEYA 4RELA 4UQOA 5EP3A 3A0UA 1UOPA 4GBMA 2HSDA 3HG7A 2EARA 2BLNA 5AW2A 2P90A 3IA7A 3P9XA 5JNLA 2P9TA 3WX0A 2E48A 1UFOA 3VISA 2JCGA 5JS2A 1RBMA 3CNNA 1DAGA 3JWGA 1MOZA 1Q1BA 2IYOA 3DG9A 1FU4A 1TEXA 1UKCA 3SM3A 3L4JA 1A9PA 4IY1A 4D4GA 1RM0A 3ANLA 3FYUB 1DHTA 5EE9A 4E2ZA 4E2YA 4DSOA 4NMLA 4MUBA 4GI3A 5GGYA 5HOEA 2CLDX 2G88A 4OJTA 2JB9A 2XUGA 2Y1XA 5KAPA 4HLUA 3FETA 2WSIA 4D99A 1XXLA 3IAM6 4UUBA 4PG6A 2VP6A 2FW7A 3FCCA 1CS0B 4FFSA 4KO2S 4ER3A 3U3JA 5JTTA 5K99A 3C5VA 5CIWA 1U7TA 2Q1YA 4QEZA 2YY6A 1GPBA 1WCV1 2AN4A 2ZIWB 3CJQA 1FTWA 3O0DA 1NE7A 3QKRA 4HWPA 4JUDX 4LX0A 4NP6A 4MQFB 3L1KA 2OFOA 1TDJA 4B6EA 4Q82A 3CO5A 3OIGA 3VHRA 3RIMA 5HCUA 1HEIA 3D6TB 1GGFA 2I1VB 1EX6A 1O77A 4Q7QA 2QN1A 1EBBA 3D9QX 3GN2A 2IHBA 4TV8F 3HJNA 1EFUA 1E63A 1TC1A 1SHKA 1SKUA 1YJAA 5KTPA 3MOSA 1CG6A 2ATXA 3ROFA 3OTOB 1TJ3A 4UEQA 3TSAA 1KI6A 3EOZA 3MLAA 4C6HA 1AKEA 3ZNOA 4BIIA 1KZYC 2UAGA 1KMMA 2UVDA 1GNLA 1RACA 2ICAA 4ITRC 2VPTA 1XQYA 2QQ0A 1GDDA 2GUGA 3E0XA 1E18A 1XVLA 4HY3A 1MG0A 3GBSA 2CL5A 3NOOA 5EFZA 3HRHA 5G1NA 1OBOA 4DZRA 4F2PA 1JKXA 2J0VA 3AR2A 5IFLA 3B1VA 3ETGA 3SQOA 4DWWA 3PHIA 5D3ZA 2F9MA 1JLMA 4X8LA 3J81A 1FU8A 4H3VA 1Q92A 3C3WA 3ZHCA 1D1QA 2H3EA 1K7FB 1V1MA 3DR5A 3P9KA 5DI9A 2UZ1B 2I2FA 3ENVA 1I0IA 2P30A 2WD7A 4U6SA 1SVMA 3NO4A 1QMPA 3R0JA 2QJTA 3PTLA 1HFKA 4M1QA 5AMXA 4IUYA 5IEBA 1I7LA 1NU6A 2BFFA 3O2JA 2OO5C 1LBSA 2QPOA 1EINA 4JHLA 5D3MB 5DYGA 7MDHA 2ZSUA 4F93B 4RK6A 1CJTC 5JCJA 5GGXA 3UJ7A 4HT3B 4DMUB 3BD8A 4YRZA 4PZCA 1L7EA 4HYTA 4PX5A 2X3YA 1GT91 5AHXA 3FDZB 4X61A 1DO2A 3R8XA 2F6RA 2CLLB 4NC9A 1P9NA 2CK3A 5AESA 3RBXA 5CT5A 4J0FA 4JB8A 3QPAA 4EVIA 1IK6A 2OL4A 2ZBDA 4M1TA 4AY4A 2P2DA 7ADHA 1E0DA 5JXHA 3RVMA 1I7DA 3PXCX 1I13A 1RHJA 1AZSC 5EKUA 4TV9A 1PFYA 1FDVA 2GCIA 2I71A 1PEKE 1QX4A 2J0UB 4XWGA 2FE4A 3RSQA 3THOA 4C0KA 2RD2A 4DLWA 4F38A 4FOOA 3FDFA 5ULLA 2XITA 4D7AA 2NGRA 2W4MA 4N7RA 5L3RA 1NT2A 2QJWA 3G2JA 5T6MA 2M6KA 1IATA 1BE8A 2EYQA 4PRLA 1J5EB 1U1GA 1WCIA 1H69A 2A9PA 2P6PA 1QC5A 3W8RA 3ONEA 1HQCA 4HDMA 4V0LA 4CDNA 4CKCA 4Z3OA 1AS3A 2C4TA 2QSYA 2H85A 3U3DA 3UJBA 2AUNA 3EVNA 2CYBA 4NOLA 3EF1A 5BPHA 4YUVA 1BX3A 4QDTA 3UGQA 2H1FA 1A95A 3W78A 2BRUA 1GPLA 1WCWA 1X0VA 4RJKA 5AVSA 1NBMD 4UQPA 1OIWA 4PLVA 3ESYA 1YFKA 1CZHA 1JNYA 3TO5A 4I1OA 2DQ4A 3H6KA 1JU4A 4YUAA 4LDPA 1IC6A 3U4AA 5D7BA 3SHQA 4FFPA 4TV8A 4N3GA 1I2ZA 4GYYA 4DQLA 1IY9A 1J2RA 2QL9A 5LQNA 2EF1A 5K7SA 3WWPA 1CY1A 3ICQB 1L8AA 1FF9A 3OQNA 3BTUA 8LDHA 1GSHA 3G9XA 2RGGA 1S2NA 5TSDA 2JIOA 3EVBA 5I7FA 3OZ7A 4Y0VA 2EFCB 3W6OA 1P5HA 2HSEA 3KKPA 2QZSA 1VSUA 1TTTA 2DVMA 2QX8A 1UWKA 2BISA 4TMZA 1FZTA 4YAEA 3RT7A 4PIVA 3V34A 2PV7A 4FFNA 5AJZA 3T15A 1EFVB 3UUEA 1IHOA 4Q3NA 2DFLA 3LCUA 2OR3A 2P2SA 4O2BF 3PDIA 5EE1A 3OECA 3RUPA 3DS8A 1ECFA 1V1RA 3IXMA 3UZUA 1Q74A 4WKOA 2C9YA 2BMEA 1SM4A 1WBJB 3QEKA 4Q4LA 1PKXA 3AJAA 4AECA 2ERXA 1AA9A 2QS9A 1J2EA 4HVCA 2XMPA 1MT0A 3AF4A 4YFYA 1KHHA 3TR5A 3TG2A 3Q7SA 3U60B 2MINB 3DWEX 4L8WB 3PJGA 1S8FA 1EX7A 1IFXA 3NHYA 3GIDA 4EHFA 1Q21A 1VHLA 4Z9YA 3A36A 2IP2A 5ITWA 1U0OC 4GLBA 4IS3A 1ONOA 1NW7A 2R7AA 3KEOA 4EA8A 5CB4B 1RKVA 4CEJA 1JBQA 2HNKA 2ZZNA 3EULA 1JEDA 1B1AA 4TOIA 5A4DA 1OJLA 2PZJA 1TW2A 3KQNA 2A5GA 2Z0MA 5HQJA 3VV3A 4H4CA 2HLDA 4EHKA 2P4QA 3O8DA 4UNIA 3CXRA 1ZRSA 2FZGA 3D7MA 4FIZA 4OU5A 4PFSA 3ADPA 4QUBA 4UVEA 5AUQA 1ABFA 3UMVA 3K1YA 3LQKA 2HREA 4A23A 4DW8A 2CNLA 4C4YA 4W6QA 2IIQA 1H2EA 3W2GA 4R68A 3MTJA 1LRKA 3LZ6A 2Z83A 4LRUA 2GN4A 4OFXA 2FDCA 5HVNA 4RY9A 2IYTA 2FW8A 2BKUA 4EUHA 2VF4X 5B58C 5JSUA 1PFKA 3AK4A 3OPXA 3PL1A 4FS8A 2I3BA 1I4LD 1SCAA 2LGJA 3W06A 4QDXA 1SQ5A 5BN4A 5ES4B 1W1UA 3EK2A 5JJCA 3EEOA 4OQMA 3D6JA 3IKJA 2NZJA 4XOUA 4QU8A 5JFGA 3QRWA 3WRVA 2AOVA 1VHQA 3U1BA 2FN7A 4Q21A 1M1YA 3BCRA 3N0WA 1AHIA 2VYVD 2I4MA 3TD9A 1DEKA 4WZAA 3FSEA 1XMQB 4IFBA 1V41E 2O8FA 4JI8B 3MG9A 1WCXA 4FPXA 3O82A 5BUZA 1UBLS 3FR7A 4ARAA 2QTWB 4QPPA 1JJAA 2VUUA 1IBCA 4Z7QB 3DE4X 2H54A 2RIRA 4F3NA 1SWWA 1ZGJA 2VHYA 3QW2A 5TF4A 5KX5A 2C1XA 1TVKA 4HZIA 3NAZA 4NFSA 4BMYA 4L4SA 4P4LA 3MCVA 3UVEA 3PYLA 3T95A 4DQKA 2BVNA 1M8GA 3BL8A 2CFTA 3DZ8A 3ZLTA 1G3RA 1NOKA 2RKWA 1SA0B 1H0RA 1STOA 2WUGA 2QR3A 3JVDA 3R3UA 5FPPA 4DA4A 4WTOA 2J7PD 3STXA 2H59A 3I9FA 1QHHB 3H2JA 4F3CA 4M9CA 3NBYC 4QKQA 3U3RA 2OCLA 3M70A 3P2KA 1G8FA 2QROA 3ITDA 3P2IA 4WCFA 1TTHA 1M2WA 1A2BA 5BXYA 2ZGVA 4CV0A 4QJ3A 2VDMB 1B6SA 4IUDS 2BCGY 2EL7A 2UVPA 2W83A 4KAXA 3G9TA 5EKTA 3LGAA 4F91B 3U7FB 4ZU3A 4NOJA 4DG5A 4LXTA 1XA0A 1IWOA 4HQRA 3HXLA 3QU4A 4GZLA 2G5TA 3VZQA 1X92A 1ZWKA 4AZSA 1SCUB 2ZR9A 3JQEA 4FLFA 4GWKA 4JP2A 3OA0A 2PWYA 1QHNA 4IQ4A 4KOAA 3WL5A 3ERCA 2VKTA 1L4KA 2BFOA 3AR8A 4P7KA 1KWGA 3D4BA 4N5MA 4M1ZA 2C54A 5JHHB 1L5SA 4ZK6A 3ZVMA 1V16A 1ZMRA 3GRAA 1MJFA 2O3QA 5JOQA 3SF8B 2KHZA 1GKLA 3PUXA 4BATA 3MTGA 2A5DA 1TXGA 4IFIA 4TLDA 1PWYE 1XXHB 3OPQA 2R2GA 1O95D 1NF9A 4CMGA 2G0AA 3AI1A 3N2ZB 1W87A 1Z0DA 3QFFA 1CNEA 4EY4A 3AL2A 1YNOA 3G3EA 1CJBA 1T24A 2CDAA 3B7WA 4PAWA 1T0PA 3BMQB 5E6SA 4BLWA 1QGUB 5T3UA 3MBKA 3PRHA 3PQFA 3FGZA 3STTA 2ET6A 4CR7A 1GN9A 3DTYA 4MUYA 4YHBA 3R1IA 5AOVA 1Q3TA 4AY3A 3S2SA 4P3XA 2ID9A 1XDBA 4NZYA 1RADA 3RT1A 3CR8A 1VG9B 4RA6A 5EIEA 1TO2E 3A6LA 4UE6A 5BQ5A 3DCNA 5BR7A 2RC6A 2H63A 2GJSA 4OSEA 2G1AA 4KAFA 2GF9A 4MRPA 4AZWA 2R85A 4DB2A 3FWKA 2WTBA 2PUEA 1RP7A 4RANA 3N7UA 5TXGA 4DCUA 2DHCA 1JDJA 4JNCA 3UFXB 5DOZA 3ZV7A 5C1PA 1UJCA 3V2GA 2CHFA 3MAAC 4QU0A 3GOQA 5DLQC 3AEKA 3OLCX 3LC7O 2WM3A 4E46A 3G5UA 4BQIA 1DBSA 2B9VA 2HA4A 5IAGA 4CKXA 2MHCA 4DLRA 5F9FA 5J1SB 2NTNA 4BFTA 5A6SA 2PUTA 3QLUC 4RIIA 1T4CB 1P5JA 2YASA 1LPNA 4YB8A 5T4HA 5JW6A 4NAVA 2O2XA 2RJOA 1NRIA 1BEZA 2FMTA 4Y1GA 1B6GA 3TLEA 4AKHA 2QN7A 3T94A 1BQEA 4BFCA 2FP3A 2VDNB 3FWPA 3D3NA 2DWUA 3O2QB 3T0GA 4F3TA 3THWA 1UJ5A 3ZZMA 1MX3A 1Z25A 3ZZTA 2OGTA 2IV7A 2R3SA 3DOCA 4U7PB 3RREA 4YYZA 5FADA 1YC2A 4A92A 1EDOA 5IDVA 3KD3A 4JB2A 5DTMA 4WHMA 1M1YE 1N6NA 3PFGA