2C07A

Oxoacyl-acp reductase of plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
246
Chain Sequence
KENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
publication title Kinetic, Inhibition and Structural Studies on 3-Oxoacyl-Acp Reductase from Plasmodium Falciparum, a Key Enzyme in Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 98
structure length 246
sequence length 251
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c07A00
2Y1EA 1I3LA 3JQBC 5L7WA 2JD0A 3JQ8B 4A10A 4BVAA 2HMWA 1VJ1A 2EKQA 2WTBA 2NQTA 2C5AA 3WSWA 5A9RA 2BLLA 1BRMA 2LDBA 3IOYA 1NHWA 2J8ZA 2ZTVA 2EW8A 1P1RA 4JXKA 2EGHA 4ND2A 4YACA 2CZCA 2C5EA 4I8XA 1ULSA 1A7AA 3QA9A 2GNAA 1MC4A 3INRA 3I9KA 3LSYA 1PR3A 1KY4A 1WZEA 1L7EA 1GZ3A 4CMEA 1DIRA 3TRIA 2AQIA 5A5EA 3QRWA 2NWQA 3WGHA 2X1HA 1G1AA 3W6UA 1X1TA 2B37A 3GH3A 2EW2A 3O8QB 4UUOA 4YA6A 2DBQA 4LISA 3K9QO 3ZWOA 2FZEA 5ICSA 2HDHA 2JD1A 3OA2A 1H9BA 2X0RA 3ONEA 1UDCA 1UXKA 1ADFA 1KY5A 1RYEA 1VL0A 4JBGA 5JNLA 2C82A 1OAAA 2TMDA 2D8AA 1F06A 4MVJP 4RJTA 4D42A 4ZHSA 2C2XA 1ISJA 1B8VA 3PIDA 4Q3AA 3GNQA 4QSMA 4PLTA 1GPJA 5KIAA 3DTYA 2Q99A 2QHXA 1Z45A 2GZ2A 3VVCA 5G2OA 4E33A 1B16A 4WGGA 1PWZA 2PKQO 2ZTUA 5TJHA 1HE2A 3JQFA 4JROA 5T64A 3ZU4A 2F00A 1PX0A 3I83A 1WW8A 1G0OA 2BH9A 4M55A 2PV7A 1UZNA 1LTHR 2V65A 3RC7A 1FF9A 4MJLA 1ZFNA 4Z3DA 3ETEA 1DDOA 3QJ5A 4D7AA 4E5KA 3GUCA 3SBOA 2ZATA 5JY1A 1XQ6A 1U3WA 1H6AA 1NNUA 3IUSA 4PZEA 3PK0A 4FJ0A 3HSKA 1I3KA 4CMCA 3DONA 8ADHA 4Q3CA 4DTIA 4ZVVA 3E5RA 3ZWBA 3CSDA 3D1LA 3VPGA 3DTTA 2FSVA 2P9CA 4NJOA 1I33A 3GY0A 4B7CA 2GGSA 1BTOA 3HG7A 1MXFA 4DVJA 1EVYA 4IDCA 2ZJ1A 3NGLA 4IQ0A 4R3NA 2Q2WA 4GX2A 4R54A 4E13A 2VUTA 2D2IA 3D3WA 2NU7A 3A14A 2DUWA 5FYDA 1J5PA 3CTMA 3MEQA 5I9NA 5T67A 3I6QA 2PKRA 5TRTA 4BO9A 1IOLA 1C3VA 2YV1A 4IMRA 4RPLA 3JD0A 2FRDA 5DP2A 2X4GA 4J4BA 3RIHA 2Q4EA 3HWRA 4GWGA 1KS9A 1P0FA 4ILKA 4MO2A 5KTKA 4TVBA 3S1LA 2FY8A 4Y67A 3GQVA 3SC6A 5COAA 1DC3A 1CETA 2XXJA 2FPGA 1NPTO 3GG9A 3FNHA 4FJ1A 4BGUA 1R16A 4ESOA 1R0LA 2UUPA 2EERA 3LC2O 1IYZA 1GL3A 3D3WB 2QX7A 2BFOA 2DFVA 1WWKA 3TPCA 4QUKA 4D44A 4GGPA 1KETA 3OH8A 4XQGA 4F46A 2JHGA 3FPLA 4J1QA 1T4DA 5HBRA 2CDBA 4ONEA 3PYLA 3Q2KA 3KHUA 3IJPA 7ADHA 3E18A 3ZWXA 5EESA 4UEJA 2H9IA 4IJVA 5CPFA 3RFTA 3W4KA 5GMOA 3ZHZA 4BNNA 1LSUA 4UUPA 5G4KA 3ZHXA 1KVSA 4OXYA 4W82A 5MDHA 1ZEJA 4XGNA 1NWCA 4R16A 3GEDA 3S2IA 1KVTA 1QV6A 2GN8A 3O9ZA 4DIOA 4BKPA 3FD8A 2HK9A 4RCVA 4GWKA 3CKYA 1GV0A 1FDTA 4J16A 2VRCD 3JV7A 4DGSA 2QIOA 4TRNA 1JLLA 3KM0A 2WM3A 2WYVA 1FDSA 4PVDA 3G1UA 3EYWA 3WS7A 1NX6A 4LVCA 3UKOA 4N54A 4ID9A 3DOOA 4F6LA 4CLXA 5JPIA 1E5LA 1LSSA 1P3DA 1BXZA 3DBHB 4AVYA 3E9NA 3TQHA 5JMPA 2GLXA 1LI4A 5G4KB 3RC2A 2BFAA 1F8GA 5G0VA 3GNTA 1E1KA 5BR7A 3WJ7A 2Y1DA 2ET6A 3ANLA 3TZCA 3FN4A 1P33A 4TZTA 4NBVA 1N9GA 4YAEA 2CVZA 3JYNA 3NEPX 4YJFA 3PPIA 1VSUA 3H9UA 2J6IA 5ES3A 1U4OA 2QRKA 4G5HA 1EBFA 3ULKA 3FNGA 4OHUA 3RU7A 1ZXBA 1U3VA 2QYSA 5L4NA 3KBOA 2IEBA 1BW9A 1C0IA 2B0JA 4PLPA 3H5RA 1E1MA 3JYLA 4ZQEA 1SBYA 4XR9A 1GYPA 4XYEA 3O26A 4UULA 8LDHA 5KCZA 4GX5A 4IDFA 4QQRA 1N9GB 4HFNA 1O6ZA 4UVIA 5AVOA 4CM6A 2BF7A 3KUXA 3RBVA 4NG5A 1LU9A 1OBFO 4OSOA 3LF2A 3NT4A 4YJFB 1NTOA 3WMXA 4ALMA 4YCAA 1P44A 2E49A 4XYBA 2A94A 1YBVA 3D7LA 4HFRA 4Z0PA 1B8PA 4IBOA 2PY6A 1A7KA 5IDQA 5B4TA 2PZMA 4H16A 2IXBA 2V6FA 3GGPA 4J7XA 4AJIA 3CPSA 1Z6ZA 3H5AA 3DQPA 3PLRA 1SNYA 5BNIA 1X13A 3UCFA 1X7GA 3H3FA 2ZIZA 3DDNA 1BW9B 5AXAA 2O2YA 2DTXA 4CM9A 4PN3A 3NDRA 2PTGA 4IJKA 4JLWA 4PG6A 5JLAA 2ZYGA 1B26A 4NK5A 2FP4A 1EDZA 4ZD6A 1LDGA 1X7HA 1EDOA 1Q7BA 4TRJA 2UDPA 2WYUA 3ROQA 5TLSA 4MVJM 1S7CA 3WYBA 1J0XO 4R9SA 3FCOA 3DC2A 4D41A 2DUUA 1V6AA 1RM5A 2AQ8A 3FSRA 4YT2A 1VC2A 2GRAA 3K73O 5DNAA 1IZ0A 1RM0A 5JDIC 4AJKA 3JQ9A 2OFPA 3QVXA 1IL0A 3QE3A 4ZRMA 3S55A 1CIVA 3H9QA 3KV3O 3UW3A 2GF2A 2NVWA 3D3EA 4RPHA 2AEFA 4PZDA 4J4TA 1Z7BA 5JC1A 3UCXA 1YRLA 3UVEA 1R6DA 1EFKA 3I3OA 1BHSA 2YUTA 3FNEA 1LLQA 1L7DA 4HX5A 4I1IA 3FTNA 2C29D 4N5MA 4E5PA 1K6IA 4O59O 1YQXA 3GC6A 3KRTA 5CDTA 5L53A 4YDRA 5T6BA 1ENOA 4D79A 1KC1A 1BDMA 4R9RA 1Y5MA 5F5LA 4DUPA 1YL6A 4JJGA 3KTDA 4YRAA 3OSUA 2BI8A 1N1EA 3ANNA 3AOGA 4YR9A 3S2GA 4EITA 4Q3BA 1QORA 3OBBA 4J91A 1N7HA 3RFXA 3GN2A 2C20A 3AI1A 4XGKA 5C37A 1Z75A 3LU1A 2Q1WA 3K31A 3QV1A 3OF2A 1XU9A 1VM6A 4O63O 3DR3A 5TX7A 1KIFA 4WK6A 1WNTA 4Z9XA 5K6AC 3GMSA 4TMFA 2PNFA 5A9SA 1F14A 1P1KA 4CR8A 4QX6A 3EDMA 1NVTA 1YJ8A 3F1LA 1GYQA 3K5PA 3INTA 1E6UA 5TGDA 1BWSA 3UF0A 3WYEA 2EP7A 2X5OA 1D1TA 4YAIA 2GASA 1ML3A 1NAHA 1P1JA 2NACA 4YT8A 1ZVMA 4BNUA 2G76A 3DAGA 4BUCA 4CQMA 1HE4A 3GFGA 2Q3EA 4FOOA 1OC4A 1QKIA 5ILOA 4DA9A 1R12A 5JAZA 5A9SB 3TL2A 1QV7A 1P77A 4BMNA 4RF2A 4R4JA 5A4DA 1LQUA 4BO1A 5L51A 4XQ9A 4XGIA 4I5EA 1SO8A 3OETA 1C0PA 1PEDA 1XR3A 2VWQA 4FFLA 4NQZA 4F6CA 1ISIA 3UCEA 1ADBA 3W8DA 1P74A 3RKUA 3O4RA 1PGPA 2ZYDA 5L9AA 2OXIA 3AWDA 1PGQA 4NI5A 2JFGA 3PTZA 2UVDA 3C85A 3WMWA 5H82A 5A1TA 3CZRA 3N7UA 5FFFA 1B7GO 4XIJA 4CQMB 1WMAA 3HDHA 5B12A 5JMWA 3Q6IA 1VRWA 5BNFA 1E3JA 3WGYA 4RPJA 5KWEA 2YFHA 2RCYA 3OQ6A 4UEKA 4W4TA 1OI7A 1I5RA 4EJ6A 2CFCA 1BXGA 4XIYA 3GRKA 5T8KA 3JCZA 4RV9A 1YQGA 2HJRA 2V6BA 3GGGA 3EZYA 1B14A 4L73A 3V2GA 1PZEA 1OMOA 1A27A 3EK2A 2OMEA 1G0NA 3PHLA 4Q3EA 3VHRA 4IGEA 4II2A 4MDHA 1IE3A 4HFMA 4A73A 1Y7TA 3AM3A 5DBFA 2OO5A 3I4FA 4DYVA 3GVXA 1PQPA 3NX4A 1Y5RA 5HM8A 4KP7A 5TQVA 4R41A 2R2GA 4ZQHA 1KOLA 3BHMA 4LW8A 1I01A 1K3TA 3BHIA 1IPFA 4CLRA 4A0SA 2D1YA 2UUOA 1QMGA 3D0OA 4JN6B 2FR0A 1BXGB 1EE9A 1UXJA 4WLUA 3M1LA 4XQEA 2CF6A 2WMDA 4BL5A 4NBWA 2JL1A 4ZJUA 4J0EA 1FDVA 1LQTA 1HLDA 5F5NA 3R0IA 4UAGA 1EUCA 5DN9A 3PI7A 3RI3A 1K2WA 4AJHA 2O2SA 4E5YA 4D3DA 2EWMA 3SLKA 3WGQA 3JQ7A 3P2YA 4C7KA 5JDCC 2Q4BA 5L45A 3JD1A 1QRRA 3ZNOA 3W8FA 3RROA 2P2SA 3LT4A 3CZMA 5C7OO 4CLRB 2OBYA 3PIIA 4FFPA 4OQZA 4DREA 3HJAA 1IY8A 2A9FA 2D59A 1FK8A 1VL6A 3I9MA 4WOJA 2Y99A 4D0RA 3F4BA 4MIYA 4AICA 3GDFA 2X7HA 5COBA 1TLTA 2EP5A 4B8WA 1ZZEA 1I30A 1Y8QA 4IZHA 2I9PA 1F8FA 3F5QA 1DRVA 3WG9A 5JYEA 1KVRA 2W4QA 4F45A 1ADCA 4R69A 4CMIA 2W98A 1YE3A 3JQ7B 1PGOA 3Q1LA 2PH3A 5TS3A 1Z7EA 2VYNA 2OUIA 3MTGA 2GZ3A 3OQ1A 3FR8A 3GA0A 5IXSA 4UVHA 4B4OA 3RUAA 4U5QA 3JD2A 2FZWA 3VKUA 4OQYA 4IMPA 4RVSA 3T7EA 3DWFA 2GPTA 1YB1A 3A06A 3DZBA 1P1HA 4MP6A 3JSAA 2QYTA 4PG7A 4Q3DA 4RPKA 4GLLA 2VHYA 2JD2A 2C7VA 1D4FA 3WQRA 3MJ4A 1HDRA 2EHDA 5A9TA 3F1KA 5A04A 3RUDA 3VTZA 1Y8QB 1FDWA 1T1RA 3F3SA 1V3TA 4OOFA 4CM7A 1ZK4A 3L6DA 5DOVA 3S2EA 3AM4A 4TRMA 2O23A 1DSSG 5CHEA 4AJPA 4CMIB 2C54A 3B1JA 5KVVA 1HYGA 3RASA 3U4CA 2R6JA 4I08A 4WLNA 4BB5A 1O94A 3PP8A 4YJGA 4TSKA 4NHEA 1A71A 4JJIA 2VNSA 3HUDA 1DO8A 1PSDA 3C7AA 5DOZA 1HETA 4BQRA 3VH3A 3LVFO 3FR7A 3I9NA 4MKZA 5I7EA 4DPMA 5IDYA 4M54A 4E5NA 3KOUA 4JP2A 1HDXA 3I4CA 4FC6A 4PLHA 4NNJA 3GAZA 1XCBA 3I6IA 1MLDA 5J23A 2DBZA 3FPCA 4O5OA 4KOAA 1WDMA 2GYYA 2P9GA 2V6GA 3IMFA 4R3WA 4WCFA 1K5HA 1T26A 3IP1A 4YJGB 4WPGA 1DFGA 1QLJA 2P4QA 4BO4A 2IYOA 1A72A 4J1SA 1Y1PA 2VRCA 1HEUA 1NQ5A 2P5UA 3AOEA 5JFOA 4GKVA 1N2SA 4B7UA 3JYQA 1A9ZA 3BXXA 1BG6A 1PJSA 5ER6A 2D4AA 2IXAA 2GZ1A 1UP4A 1B3RA 2EIHA 3EY4A 1NAIA 4J1TA 2FOIA 4TROA 4GVXA 3M1AA 4MOWA 5U4QA 2Z95A 1Q0HA 2FPPA 3NJ4A 4L4SA 2CUKA 4UUMA 4EYEA 5JC8A 1EUDA 4LMRA 4E31A 4IY1A 1DIBA 1W6UA 4HBGA 5G0SA 3ZW9A 1IPEA 4WCFB 5GY7A 1U7TA 3TDKA 1PR9A 1ZSNA 2HK8A 2J3HA 1FMCA 3B20A 3WJAA 4I5DA 1PL6A 4YQYA 4B3JA 1NASA 1E6EA 4OMUA 4BNVA 5EERA 5CDGA 4FJ2A 1NQAO 2JCYA 1NFFA 1GUFA 3RU9A 4I9HA 4J9UE 3SXPA 5L4SA 1UXHA 1U2GA 4AJLA 4DLLA 1DHTA 2QW8A 3GN1A 3NTOA 2PLAA 2VUSA 4CMEC 4KTTE 3GEMA 4AJNA 4GVLA 1DHRA 3TJRA 5TIIA 1DJQA 5HA5A 3RJ9A 4NFHA 3MJSA 4Y6SA 2PGDA 2Y1GA 4QFCA 1N8KA 2HUNA 4QTZA 1KEVA 2X9GA 5AOVA 2J5QA 1I3NA 3I23A 1NQOA 3QIVA 3KYCA 1YBAA 4Z0HO 3GVIA 3WIEA 4D45A 1JWBB 4WECA 2CVOA 1WPQA 3RFVA 1C0LA 3KYDA 1D8AA 4E6PA 1MC5A 1GADO 2ZB7A 1PQUA 3COSA 3BMOA 2AQHA 5IFLA 2X0NA 1ARZA 4CLHA 3I9JA 3BMQA 5LDGA 1ZUD1 3JQFC 1DOHA 1I8TA 3HB5X 4XJTA 2FR1A 2OP1A 3GVHA 2E37A 1PJQA 1SMKA 3WGTA 4PGFA 4HNHA 4B4WA 1MFZA 2EJVA 4CODB 4DQUA 4YPOA 1VPDA 2RBEA 4BNFA 3KYCB 5KJ6A 4B8ZA 4Q9NA 1ONOA 3GFBA 1U1IA 2YQ5A 1MB4A 2ZQYA 1LXCA 4R5HA 3SVTA 3MJCA 1PS9A 3RUEA 3Q9NA 4I9NA 5KVSA 5H81A 3KYDB 4TQGA 1DLIA 5FWNA 3ZV6A 4MVJE 1GEGA 3BMOB 4GPD1 3HN2A 1XDWA 3JQBA 3LK7A 2ZB4A 3PWSA 4J43A 3WBFA 5I7FA 3BMQB 4MVJG 1LBEA 3FF4A 3NKLA 4YXFA 3CUKA 4JBHA 2B36A 3Q3CA 3JQDA 5IDWA 1SAYA 4RZIA 3U49A 4IS2A 3TF5A 3F6YA 1B8UA 1PGNA 4BO7A 4DRYA 1DFHA 3LLSA 3U4HA 2BFMA 4RVUA 3B1FA 4RZHA 2YV2A 3VPFA 3MCVA 3K2EA 4Z9FA 4YVFA 1PTJA 5CEJA 3WNQA 4WLVA 1PJCA 1PZFA 2Q2VA 3K96A 1MV8A 4P22A 3V2HA 3OIDA 3I9OA 1ZH8A 1YH3A 2VYND 5BT9A 1JKIA 4MIEA 2G0TA 4A03A 3CMMA 4YTEA 1E77A 4A7PA 3FBTA 4BMSA 1C1DA 1T2EA 3ZWCA 5CG1A 3C1AA 1YQDA 2AE2A 2PZLA 4OKIA 1QYDA 2WWRA 3DZKA 5THQA 3IL2A 4NPCA 1LLUA 2PR2A 2E82A 3JQGA 3HFSA 2E4AA 4EJ0A 3K6JA 3E48A 5EIOA 4L75A 4LMPA 4FW8A 1X1EA 3PHHA 2H63A 4CMJA 4U6QA 3SJ7A 1ZK1A 1FXSA 1D3AA 2AW5A 4IINA 5C3MA 4P4GA 5IAAA 3VC7A 2YDXA 1DJNA 1CEQA 2GERA 3KVOA 2PGLA 3L07A 5B1YA 1GYRA 3E5MA 5COQA 3ZDFA 4BNJA 1QYCA 1UDAA 4ALNA 1C1DB 5A06A 2AXQA 1LDMA 3UH1A 1WP4A 3L4BA 2E6UX 1Y81A 2Y0CA 3GAFA 1NHGA 1LSJA 2X58A 1TI7A 3PRJA 3KETA 1ZO8A 4OIMA 3JQGB 1GQ2A 1MUUA 4ALIA 2W8ZA 3GHHA 4ND3A 4ZU3A 3W8EA 4PLWA 4KZPA 2H1SA 3FHLA 4CV0A 3FWNA 5KKAA 4NJMA 4ND1A 4DLBA 1HL3A 1JU9A 2EG9A 5F1OA 1GCOA 3H2ZA 4M87A 5L7YA 1LDYA 2CDCA 1CDOA 3WDSA 3ZWMA 5JAMA 1ZK2A 3RWBA 5A05A 3OECA 4XYMA 3ENKA 1T2DA 2GDZA 1GQQA 4EDFA 3N58A 1CYDA 4MP8A 4B3HA 2UAGA 4TKLA 4BO2A 1H6BA 4DYDA 1Z74A 2VQ3A 2VOEA 4AJ1A 4BKQA 1U3UA 2GSDA 4BNWA 3ZGYA 4C4OA 4S1VA 2BHLA 3MJTA 4UEOA 4ROSA 2OHXA 4NJMB 4FFOA 5L3ZA 1GY8A 3WX0A 2IZZA 4Q39A 3ZCXA 1OOEA 3MWEB 4JJFA 2O3UA 1DAPA 1DB3A 2Y05A 4GGOA 4C7JA 4FGSA 3L6EA 2XF8A 2I65A 2AMFA 1YJQA 2VWPA 4FCCA 4M1QA 4QXMA 3KZVA 1LJ8A 2P5YA 4JNKA 3DMYA 3ZI0A 2O4UX 4BNZA 4D43A 1NXQA 4N18A 2QQ5A 4FSHA 4PLZA 1W73A 1E0DA 4E5MA 1R0KA 4DPKA 4M89A 2B5WA 2PK3A 4J49A 2J3JA 1KVUA 5ICMA 1UXIA 3I52A 4XRRA 5B4VA 1HDYA 1LC3A 4HKTA 3DMTA 4N5NA 1PS8A 3U4IA 2AHRA 5DBGA 3I5MA 4NFYA 3IUPA 4JIGA 3C1TA 4WOKA 4H7PA 3P7MA 2VUUA 2HMVA 1TB4A 1ORRA 2B4TO 2ZTLA 2NQ8A 4ND4A 2P91A 4CMHA 4FN4A 4YQZA 2VRBA 3RBXA 1VI2A 4WJZA 1DAOA 1ZNQO 4YAGA 3UGKA 3JQ9C 1EQUA 4RVDA 3U5TA 3KLPX 1AE1A 3DOCA 4HV4A 3EZLA 2CD9A 1UZLA 4RLHA 4FD3A 4XQCA 3VDQA 2GR9A 4IDBA 1UR5A 1YOVA 4FDAA 1GAEO 1Y8RA 2G1UA 1Q0LA 1O0SA 4MP3A 3KO8A 1MG0A 1PZHA 4FB5A 2CF5A 2PD4A 1I2BA 1QLHA 2PZJA 1MX3A 1GR0A 2HRBA 2VHWA 4PLGA 2QRJA 5B4UA 5CDSA 2Z1MA 4OYRA 4IS3A 3JQAD 4CV1A 4QT0A 4J1NA 1CERA 3AFMA 3RUCA 1MXHA 1T24A 2QZ9A 3PXXA 4MVJH 1LRJA 2CSUA 4XX0A 2ZYAA 5AXBA 3VZPA 3WQQA 4EBFA 1NVMB 2OGUA 1H5QA 2VT3A 4CUJA 2YDYA 2FWMX 5GZ3A 1YOVB 1Y8RB 3ONFA 1KC3A 2AQKA 3AY3A 1T4BA 4HY3A 4UVDA 3VH4A 3UAGA 2I3GA 3GEGA 4GMFA 3DFZA 1T2CA 3L9XA 4BO5A 3HNPA 3OJLA 4XYLA 1HZZA 2WYWA 3AY7A 1Z82A 2X9NA 3R3SA 3WNVA 3PJFA 3T4XA 1LC0A 3EW7A 3GDOA 3NJ8A 1JW9B 4RDHA 5THKA 1HSOA 1R4NA 3RUHA 4DIBA 1E1LA 3JD3A 4OXKA 1RM3A 2NSDA 1DXYA 1U28A 1BVUA 1Q7GA 3ETGA 1X7DA 2RAFA 1F12A 3R6DA 3TZQA 3CE6A 4K9DA 5HWSA 4KWHA 3WXBA 4PCVA 2X23A 5TF4A 1P31A 1E7WA 4GH5A 4LRSB 3RQSA 3W4JA 2PH5A 4PIVA 3ICCA 3UICA 4CLDA 1BXKA 3DL2A 4JQCA 4LK3A 1DIAA 2VN8A 5T5QA 1E6WA 1LRLA 4EEXA 3CH6A 4DIFA 1R4NB 4IDAA 1GZ4A 2E48A 3E6AA 2B83A 3AY6A 4WE3A 4EZBA 4PG5A 2NU9A 2JCVA 4JP3A 3LT1A 4QO8A 3QVTA 1TA4A 3PDUA 1WZIA 4HNGA 4MVJF 4E32A 2VZ0A 2V6MA 4UVGA 1LLDA 3FI9A 5TJ9A 2ZB3A 4M49A 1ENPA 2NM0A 2O3RA 2OZPA 2JCXA 4CM8A 4RORA 5BSHA 1AN9A 3Q0EA 2IE0A 1O95A 3ZW8A 4URFA 2NTNA 1H6DA 2Y1OA 3WR5A 2EKLA 4OM8A 3C24A 5IF3A 1IHYA 2AG8A 5T8KC 3DO5A 1YVEI 1PL7A 1JVSA 3GUYA 4AJEA 2ZKLA 3OHSX 4IM7A 4IJUA 4WEQA 4YBZA 5EINA 1K6JA 3EVNA 3LQFA 5BSEA 3PFWO 1PJTA 4FQ8A 1PZGA 1SEPA 1SZJG 4IIVA 4KUGA 3U9LA 6ADHA 4J6FA 1PJBA 2D3TA 2HO5A 3DZIA 3EVTA 3AUTA 1IUKA 3TOXA 4CM8B 2DVMA 2Y66A 3PGJA 4L74A 4YAJA 1YWGO 3RC1A 3RKRA 1E3EA 1KBZA 2BMAA 1XQ1A 3QVOA 4UREA 3V1YA 2QZZA 2CNBA 5AXDA 4CLOA 2IEDA 1ZKMA 2DBVO 4ITUA 4BGIA 4WCDA 1HE3A 3U0BA 1GCUA 5TT1A 3OMLA 3RBZA 5K0ZA 4QECA 4XKJA 4ALLA 3OA0A 5AYVA 5HS6A 1TT7A 2DTDA 3JYPA 1NR1A 3HDQA 3MWDB 1E3IA 1Q7CA 2Q46A 4CMKA 1XLTA 2BD0A 1GV1A 1VSVA 5TSDA 3BZUA 1PWXA 4PG8A 2XAAA 1J6UA 1D7OA 3G0OA 3V1TC 2FHSA 1WDLA 2ZB8A 3M2PA 1KEUA 1MP0A 1U3TA 4GAEA 1D1SA 1GFSA 2BELA 4CLOB 4E12A 3PLNA 2WEKA 1M6HA 1EK5A 3UOGA 4WLEA 1GZ6A 1JA9A 1XG5A 4IXWA 2VT2A 3L77A 2XPCA 3ROKA 2IODA 1UJMA 3WFIA 2HMTA 4FFRA 1PL8A 4P4LA 1X0XA 1PU2A 5I7VA 4BKOA 1ZCJA 3PJEA 1H6CA 5KJEA 4P4NA 3U09A 3VH1A 3ZU2A 1LEHA 2XXBA 2YHIA 1T25A 1TXGA 5CDYA 4M8SA 2G5CA 2I6TA 2SCUA 4PLCA 1NP3A 2J3IA 3L6OO 1E7YA 1TEHA 4RVGA 3BTSA 1WXDA 4HP8A 4M86A 3JTMA 3CMCO 4MINA 4LSWA 2YJZA 1U8XX 2A92A 4ALKA 2JHFA 5I7SA 1JAXA 3ETDA 4YAKA 2DT5A 3RUFA 5BNTA 3H9JA 3U62A 4O6VA 2D0IA 4JCOA 4XEHA 2HMSA 3DXFA 2NTJA 3GPDG 1CRWG 4OH1A 3HADA 1QG6A 1SOVA 1NPDA 1V9LA 1YKFA 4FS3A 1G6KA 1XWFA 2NV6A 2YQ4A 3HFGA 4J0FA 1XKQA 2YHIB 2FSSA 2VZ9A 3SX2A 1KVQA 2YFQA 5F1PA 1ENYA 3V5NA 2X5JO 2BGKA 1DC5A 5I8ZA 3ZWYA 2ZTMA 3VZQA 1H93A 5IZCA 1P9LA 3S8MA 2YZ7A 3KSZO 3ON5A 1AXGA 3W6ZA 2Y0EA 5JO9A 2FMUA 1XU7A 5HRUA 2WE8A 4GLOA 3C7CB 5BSFA 2RIRA 5CEFA 1OZAA 2GCGA 1IB6A 3LC1O 5A3JA 5JW6A 2EJWA 1K0UA 1RM4A 5JDCA 1M6WA 5KJ1A 3NYWA 3ZWPA 4AFNA 3PVZA 3KSDO 1U9JA 4NH4A 4X54A 4I5GA 1BSVA 1YB5A 5H83A 1B15A 4RO0A 1ISHA 1ISGA 2OORA 4OO3A 4XA8A 4BNGA 4II3A 1RJWA 1JKJA 4CM5A 1OC2A 4DC0A 3DZJA 4G65A 4WCFC 4D3SA 3V1UA 3WGGA 1DPGA 1EFLA 4KQXA 4LSMA 3MTJA 2EKPA 1HYEA 3H9GA 2CDAA 3UN1A 3TOZA 1NFRA 3AI3A 3WSVA 5DP1A 1HDZA 4K6CA 3TSCA 9LDTA 3PHIA 1RKXA 1XIVA 3WICA 4OSPA 2YV3A 1DBVO 4Y6PA 4LGVA 4NK4A 3Q11A 3BIOA 4WNCA 1O9BA 4CV3A 5HTOA 1WMBA 4DBVO 3WGIA 5IN4A 3NUGA 4U0KA 4GSKA 3DHYA 1RWBA 1YL5A 2HCTA 4W99A 1O8CA 1UP7A 2IDZA 1SC6A 3QY9A 3LT0A 3H4VA 4W9NA 2O7SA 3GLQA 4AJ4A 4FFNA 4R1UA 3W1VA 4BHTA 4XR4A 1C14A 3T7CA 3INGA 3A1NA 4EUFA 1AHIA 2OBNA 1K6XA 4BGVA 2NTVA 3QWIA 4W7IA 2YYYA 1XELA 2AEMA 4PRKA 3VDRA 1MFPA 5TT0A 5JXWA 3QVSA 3HB4X 3NT2A 2Q45A 2I67A 2UV8A 2GN9A 3TFOA 4YT5A 3SLGA 3ZWNA 4IXTA 1V35A 1QR6A 2B5VA 3HQ4O 1XYGA 4Q3NA 3ICPA 5FI5A 1J4AA 3WGZA 4AJOA 1HF3A 2FPIA 3MJVA 3FNFA 3WIDA 1YL7A 3GNSA 4JGBA 2WJPA 4NU5A 2NVUA 2VTEA 2W90A 3ANMA 3HHPA 1O5IA 4IDGA 9LDBA 4PLYA 1ULUA 4E2ZA 2WSBA 3SEFA 3TL3A 1H2HA 2DQ4A 4IQ8A 3RC9A 1MG5A 3IP3A 3ITDA 4BO6A 3DAPA 3ST7A 4Y6RA 3X2EA 3PZRA 4NU6A 3WTBA 4U8GA 1MGOA 3GRPA 3KSUA 1UP6A 4B4UA 1JTVA 1DLJA 1HXHA 5CG2A 5CEEA 1I3MA 3ZNNA 3T4EA 4CL8A 2GN4A 3I1JA 3LLVA 3H65A 5DCYA 4WASA 2DFDA 1XEAA 2NVUB 4QEDA 1M75A 1JVBA 1E7MA 3C3XA 3PHGA 4BNLA 4EUHA 4PLFA 4WKGA 3ZWVA 3JQ6A 4B7XA 4NBUA 3GPIA 4HXYA 2R00A 3ZN2A 2VTDA 2Y0DA 1YXMA 3JQEA 4BNYA 5JCJD 4D46A 4J4HA 4DWVA 1HDCA 3OEWA 2X6TA 5G0TA 4DPLA 1DRWA 2H6EA 3JQAA 4OL9A 1W4ZA 1T2AA 5JYDA 3TWOA 4NBTA 4GSLA 1Q0QA 5T57A 3GZ4A 3PHJA 4R1TA 3ZNPA 1Z73A 4EI2A 1Q2XA 3QQPA 2EF1A 4GX0A 1HDOA 4AJJA 2NU8A 3L9WA 3DBVO 4I9UA 5A5FA 5KOIA 3FBGA 3PEFA 2QG4A 1UUFA 1HRDA 3PQDA 1GPDG 3Q9UA 3DAFA 1NVGA 3D4OA 3OJFA 4BO3A 4Y98A 2PZKA 1QYWA 4CQLA 4ZN6A 1EEHA 1E3LA 1YGYA 5FI3A 3ZV3A 3UUWA 1BMDA 3JQAB 1IULA 3AK4A 3W4IA 4CUKA 2PD6A 3A4VA 3PQEA 3IS3A 3PDJA 1RPNA 3F5SA 3GF4A 5JCXA 2IZ0A 4RVFA 1ISFA 3D4PA 5CPBA 3RD5A 2P68A 3AJRA 1ZK0A 4PZCA 4ND5A 3GDGA 2PGJA 2Q2QA 4P38A 3SJUA 1PS0A 1U8FO 5BSGA 4FR5A 4A26A 3L4BC 3WLFA 4KDFA 4BKRA 3UFXA 4Z9YA 1LSOA 2ZK7A 2W2LD 4J90A 4CQLB 2EV9A 1GU7A 3TNLA 2I5PO 4RF4A 5ILGA 1LUAA 3F9IA 3VZSA 3GK3A 3Q2IA 4XB1A 5IDXA 3ZNQA 3ZV4A 2HKIA 1V0JA 3O38A 5C7IO 1V3VA 3GG2A 1NWHA 1V3UA 3NRCA 1ZEMA 4ZRNA 3HDJA 3PJGA 4E2XA 2PWZA 1Y9AA 2IYPA 3B70A 1E1NA 4EUEA 3TN7A 5JSFA 5KJCA 4J7UA 5DF1A 2A4KA 4OJNA 2Y93A 5C7LO 1U2DA 2JFHA 1BVRA 3G17A 4TZKA 1QXSA 4LCEA 3V2UA 4YRDA 3ZU5A 4K26A 3MOIA 4NIMA 1ZMTA 1OFGA 4XJSA 2O48X 3DOJA 4KQWA 3WLEA 1PJLA 1F17A 1EBUA 4W6ZA 1NFQA 5G4LA 5I8WA 4B4VA 2LDXA 4LRTB 3GT0A 4Y9DA 3IDSA 2FN7A 1AUPA 3V8BA 3OJ0A 4AJ2A 2ILTA 4IDEA 5MGBA 3L0DA 4BMVA 1ZJYA 3M6IA 1VL8A 3BTUA 4O1MA 2DLDA 4BNHA 1EVZA 3ENNA 2C07A 3VAZA 1X0VA 3VOSA 3ADPA 4RL6A 4HADA 1LDBA 3GGOA 4CV2A 1VKNA 4O0LA 2O50A 1M76A 3GZNA 4L8VA 4RF5A 4CR6A 1I2ZA 3ROMA 1E5QA 1CQJA 1RYDA 3OICA 4UUNA 3C1OA 3DBHA 4N7RA 3H7AA 4WEOA 3LC7O 4GL4A 3G1TA 1FJHA 1N7GA 2ZQZA 4BB6A 3D64A 3CXRA 4TVOA 4XWYA 3F46A 4MIOA 2P4HX 3RSHA 4WLOA 4DMLA 4OXNA 4JK3A 2CY0A 3DMTC 4PFJA 5U1PA 3QLJA 2GO1A 2VOJA 3PFFA 3OQBA 3E82A 1KEPA 2O3TA 3G79A 1BDBA 1WAMA 3GZNB 2QRLA 2HMUA 5IG2A 4MVJD 1HKUA 4KTVE 1K89A 2JFFA 1ZXLA 1DRUA 4NBRA 3RVDA 1QYVA 3PGXA 2RHRA 3BHJA 3IKVA 1JWAB 3I9LA 3BTVA 2JKVA 2DC1A 2ZJ0A 1ONNA 4CJXA 1PJ4A 5KVCA 1ZSVA 2J3KA 1HLPA 1DIGA 3HN7A 1LLCA 5IZ4A 4BGEA 4ZGWA 4GMGA 3C7DB 1KYQA 4XB2A 2Q1SA 2AG5A 3U3XA 4ZICA 3A9WA 2YHUA 2VWHA 1I10A 2VHVA 5EMHA 2H5LA 3VPSA 5DCWA 1CWUA 1A9YA 1GTMA 3L4SO 4JX8A 1KERA 1LNQA 2CMDA 2AEJA 3B1KA 1R4MA 1YO6A 3GHYA 3DHEA 4RQUA 3QVWA 4B79A 5DULA 4DMMA 3ZHBA 1U5CA 2VYVD 3F4LA 1WLYA 5I9MA 4EGFA 5JY6A 4K1LA 2ZCUA 3D5TA 2BKAA 1UXGA 2O4CA 3GOHA 1GEEA 3NGXA 3PYMA 3KXDA 4TRRA 3BMCA 4YWJA 4R51A 3H5NA 3TZHA 4KUHA 2DM6A 1L1FA 3OIFA 4BV8A 1HDGO 1H94A 3ORFA 4YJHA 3GR6A 1B2LA 2Q1TA 1JDJA 1HTBA 3R3JA 3LYLA 4GX1A 1N5DA 5AQ1A 3D4NA 1ISMA 2DKNA 1R4MB 4IDDA 4DBZA 2PD3A 1Y6JA 1LX6A 3TFQA 2HRZA 2YY7A 3VVBA 4EEZA 3HZZA 3B6ZA 3AUAA 4E2WA 6LDHA 1HWYA 2J5KA 5DZSA 2DBRA 3STHA 3VPXA 3GMDA 4DL9A 1H0KA 3RAJA 3BMCB 3HDYA 4Y8VA 3G3EA 3PWKA 5JE8A 1E3WA 1C0KA 1KEWA 3DZFA 4L9RA 3EHEA 4BKUA 3E9QA 4KMSA 4RDIA 3ZV5A 4RQTA 4YJHB 1WVGA 3OIGA 4YT4A 3BAZA 5ER9A 4UVEA 3NTQA 4JBIA 4R01A 4YJDA 3JD4A 3EGOA 3IQDB 3QWHA 5CP8A 1EZ4A 1NPYA 3F47A 1R15A 2PA3A 2C0CA 4GQAA 5KNLA 5DT9A 3DBRA 4IZIA 4N5LA 4BO8A 4BNTA 5K9ZA 5EJ2A 2NU6A 4RLSA 3FRJA 4NR0A 3OP4A 3HE3A 3PJDA 1FDUA 3K30A 4R1SA 5DCUA 1CF2O 2BRUA 2HU2A 2Y68A 5F1KA 4E2YA 1VKOA 1E3WB 1JN0A 4U0JA 1AGNA 5F21A 1M67A 4MVJI 2XOXA 3E1KA 1DC4A 4IUYA 4RVHA 5EQFA 5A3VA 5TC4A 1VLLA 5L95A 2Y67A 4DXHA 1HSZA 3NV9A 5JAQA 1P45A 2X86A 5JDIA 3AUSA 1W0CA 4ZQBA 4E0BA 4BNXA 4XD2A 2IZ1A 1LRKA 2X0IA 4CMBA 4DQVA 1S6YA 5EL0A 3H6KA 4RGBA 4BS9A 1YBMA 2NADA 3LZ6A 4XDZA 1XSEA 2I76A 1EE2A 3QWBA 4CR7A 5JBIA 3DBRB 2I66A 1EVIA 2G17A 3UXYA 3DBLA 3IIEA 2AA3A 4IIUA 1Q1NA 1AXEA 2HSDA 1GDHA 3ASVA 1V8BA 4INAA 1N1GA 4AL4A 1HT0A 1TVEA 2X22A 3IJRA 4BOYA 2HQ1A 2Z1NA 1XHLA 2O3JA 4J2OA 4E4YA 5LCXA 1ADGA 4HUJA 1B3BA 4FOSA 4XZ3A 5EN4A 1HYHA 4XYGA 1F0YA 1M2WA 3ZZNA 1DIHA 3OFSA 1A4UA 4MKRA 1EK6A 4W7HA 4QFDA 4BNMA 5CFZA 4QO7A 1ZBQA 4R5MA 3LT2A 3DEYX 5GZ1A 4MPDA 1XGKA 3WB9A 4XCVA 4A2CA 4EJMA 3DBLB 2Z5LA 4OGWA 4E21A 5K6AA 1QP8A 3OEYA 2G82A 1JAYA 4LVUA 1GQYA 1NBOA 2AE1A 2CVQA 2GUGA 2VNAA 1H9AA 4ALJA 2BI7A 2DPGA 4FBGA 4GKBA 2FR8A 4A5OA 1ID1A 2B35A 2Y1CA 3EC7A 2VZ8A 1ZJZA 3C8MA 2BGMA 4PLVA 3CIFA 3KYBA 2X5KO 2X8LA 2NNLD 1P0CA 1LA2A 4FC7A 1Y9EA 5JAIA 3PZBA 3FTPA 1E3SA 5BQFA 4BNKA 2I99A 2JAPA 3QWFA 5CDUA 3AU9A 1GUZA 2W2KA 3GVCA 3X2FA 1P1FA 2HAEA 3M2TA 3ZWWA 4OOEA 1E7RA 2I3AA 3NDIA 1XA0A 4RPGA 1U5AA 2O7QA 5FF9A 4K6FA 5IXYA 1SPXA 4XRGA 3ABIA 5B37A 2RHCA 5KKCA 4BO0A 3QWAA 1X14A 2UYYA 3S2FA 4NDNE 1EVJA 2C59A 3CEAA 4L4XA 2BGLA 1I0ZA 1I32A 3O03A 1R0SA 3RCBA 1W8DA 1E7QA 4S3MA 5JCJA 1MA0A 5HS4A 3KEQA 2DU8A 2YW9A 4NFSA 4TWRA 5LDHA 3MZ0A 4L76A 2W2KB 3DHNA 3WWZA 3PWZA 1DC6A 3R1IA 4IPTA 2WE7A 5G0WA 1VJTA 4A27A 4FPXA 4RF3A 1R66A 3VZRA 3QSGA 2B4QA 1N92A 1PQWA 1SOWA 1YDWA 1SCUA 4YRBA 3BA1A 4DLAA 2C2YA 4ZA2A 1JKFA 1IHXA 2WD7A 5KJFA 4E3ZA 1E92A 5IZCC 3K2BA 3WTCA 3E8XA 1T1SA 2POQX 2JJYA 1GD1O 1PIWA 3LF1A 3N74A 4FIZA 2HK7A 1J49A 4GBJA 3P2OA 4YYZA 1TT5A 1AHHA 3H2SA 5ITVA 2V7PA 3AFNA 4XDYA 2WDZA 4LCJA 3VTFA 1VE9A 2A35A 3OM9A 5AXCA 4BV9A 5FEUA 4WNIA 3E9MA 3H3JA 3WYCA 1IZ9A 3SC4A 2DPHA 4OAQA 2HLPA 1NM5A 3K92A 4KUEA 3TZKA 4Z3KA 5ENVA 2VCYA 1HZJA 2WD7B 4CLEA 2GD1O 3DZGA 1B0AA 3ONDA 3BYZA 2W2LA 4DQXA 1DFIA 2IRWA 2C7GA 3PYXA 1LDEA 1ZW1A 1A4IA 1SB9A 1U4SA 1JQBA 4CM9D 2EGGA 1NR7A 2VHZA 3EUWA 3K8ZA 4K28A 5U9CA 4CMGA 4CPDA 1TT5B 2NUAA 5CAEA 5F3RA 2B69A 4IQGA 4DC1A 4TKMA 1YDEA 3U4DA 4CMAA 4CL3A 3IAHA 3LDHA 1DEHA 4J3FA 4WUVA 3AUUA 1CJCA 1PGJA 3AI2A 2VHXA 3OJOA 2P9EA 3KB6A 3KEOA 3A28A 2HJSA 3NDJA 2WD8A 3QP9A 4U6SA 2Y1FA 3ADOA 1X15A 3IKTA 1EUZA 3CINA 4E30A 1ENZA 3TZ6A 1YB4A 4OKNA 4BQPA 4WLFA 2J5RA 1SEVA 3AOEC 3ZWAA 1HE5A 2JAHA 4CM1A 2EXXA 3WQSB 2Q1UA 1QYXA 3H8VA 3IC5A 4W9NC 3NAQA 4KWIA 1CQIA 3PQFA 3DFUA 2NVBA 4J7CA 1VJ0A 4Z6KA 2F1KA 3H9EO 2OOSA 1NQTA 3JYOA 4IJWA 4MKXA 4L0QA 1PJ3A 1T2FA 1M66A 3JQCA 2ZCVA 1UAGA 2BFPA 5G0UA 4EW6A 2OL4A 5IJZA 1ONPA 1ZSYA 3QHAA 4AG3A 4P8RA 1YONA 5EPOA 2B4RO 3P5SA 3WGOA 1EQ2A 5LC1A 1I2CA 4YB8A 1LDNA 2O3SA 1E7SA 4FFMA 3VKVA 1P1IA 3UHAA 3ZU3A 5L4LA 4BNIA 5L40A 2DTEA 3ITKA 2RH4A 1I36A 2O3QA 3DZHA 4KDEA 4B3IA 2OP0A 3BTOA 3NTRA 2Q49A 3P19A 1NYTA 4G2NA 3KLMX 3VPHA 2X0JA 1O89A 4NMHA 3WFJA 1ZK3A 4U7WA 1UH5A 2Q50A 1UDBA 4I5FA 1ZIDA 1C1XA 1QSGA 5ITWA 3ZHYA 5DBIA 2TMGA 5A02A 3ZH2A 3OJEA 2VWGA 5DDIP 4IGFA 4D0SA 3GVPA 4G81A 3RUIA 2X9VA 1GUYA 3VH2A 5ENDA 2RH8A 1R37A 3DB2A 4MVJA 4R68A 4CM4A 5JS6A 4H3VA 2DAPA 4CUZA 4CQMD 4NZ9A 5ADHA 1UZMA 4BIIA 3NT5A 4J9VA 5EQDA 1BGVA 4Z0TA 3MJEA 5GZ6A 5IN5A 1U7HA 3BMNA 4PRLA 2GN6A 2PKQP 5A03A 3AW9A 3G49A 3ASUA 3QW2A 4L4RA 4ZQFA 3ROPA 4CM3A 4HFJA 1YS4A 3JQ8A 2NLOA 3E03A 7MDHA 1A5ZA 4ZQGA 3AU8A 1UAYA 4D3FA 2D5CA 5KVQA 1PJ2A 1C1XB 3FWZA 3WWYA 3AM5A 1SB8A 3D5QA 5TNXA 4GI2A 4HWKA 1EMDA 3RJ5A 4F3YA 4J2HA 1ZMOA 2R00C 3EMKA 5L7TA 4PG4A 1H2BA 4PVCA 4YEDA 3WBBA 3MOGA 5I9LA 4CM4B 1WDKA 2PFGA 5C5IA 4LN1A 4H15A 5JO0A 3WOHA 2EEZA 2D5AA 2VYVA 3BMNB 3EAGA 4R1NA 3O8QA 4FGWA 1I24A
chains in the Genus database with same CATH superfamily
2XSZA 2HJVA 1IFXA 3BWMA 1JB9A 1RLTA 1C30B 1SCAA 2HMWA 5SZIA 3WYNA 5K4HA 3VU3A 2PMCA 4RY9A 1ORWA 3WSWA 3VNBA 1V8PA 4AF8A 5A9RA 2BLLA 5EE3A 3FSEA 4QD3A 4NS4A 3WV5A 1P1RA 2OCKA 1DWQA 3DE2X 3EGIA 2EGHA 3NJRA 5J5VA 1P7ZA 4ND2A 2C5EA 4LZZA 3CRW1 3QA9A 1U8ZA 1MC4A 3SF8B 5GTDA 3BAFA 3KAPA 3I30X 1PR3A 1RXUA 2HA0A 2ILVA 2X8BA 3C41J 3QLUC 4R40A 5LYYA 5J4YA 2R65A 4CF4A 1OLUB 5HOQA 3I76A 3E2MA 1OD6A 4XVUA 1G1AA 4ZCLA 4FFBB 4TUYA 3DL4A 1X1TA 2Y2UA 2B37A 3QF7A 3GH3A 3QF4A 2EW2A 1U02A 4OI1A 3RBAA 3VI4B 3AVVA 2Q3BA 3NPMA 3EPLA 4TT3A 2FZEA 4HATA 1NDUA 3B3JA 3UV3A 1ZHHA 3A3OA 5CH5A 1O97C 1IXSB 1DJOA 3L4KA 4AZ3B 1KY5A 5B2FA 2GYUA 3U4QA 2IDJA 2C82A 4LV8B 2CL0X 2PT7A 2YH2A 4CCSA 2GVZC 4YIKA 4DEYA 1DG3A 5AW7A 3OC6A 4ZHSA 1B8VA 1GFWA 2C0QA 4N6OA 3WIBA 1GKIA 1AKMA 1JHZA 2R6R1 1RCUA 4XUEA 3V42A 4XPIA 4FLFA 2QUHA 3DTYA 4RJ2A 3VISA 5E0OA 2Q99A 2QHXA 4B6EA 3CLUC 2IYWA 3M49A 1ZCFA 2ZTUA 3B1YA 3WRXC 5K20A 3JQFA 5DVZA 1P19A 1P4JA 3LW8A 5T64A 3ZU4A 1ID8A 2ZULA 1HA3A 2H0AA 1G0OA 4O2LA 3CZAA 3UXEA 3V1LA 2GWHA 3ZZTA 2I62A 1LTHR 2V65A 4UZEA 1FF9A 5AJTA 4YP6A 2NO6A 3RC7A 1M7BA 4JHXA 5I3ZA 1V1RB 5AW2A 5DGHA 2FMFA 1R0CA 2ZVQX 1ZM3A 3BFVA 3ETEA 3QJ5A 4UHDA 1DZ3A 4YJ3A 1KK0A 3DUWA 3H6GA 3K9WA 2I7TA 4UZFA 3PXUA 4MRAA 3ACBA 4RJIA 3MS4A 1MPTA 3FUXA 5AESA 1L7PA 3HP4A 1UQUA 3IUSA 1NRJB 3PK0A 3RTCA 5CA1B 4Q01A 1ZGCA 4N5IX 4MW0A 3WI7A 4CMCA 3E3AA 4MR9B 3A6HA 3DONA 2VLIA 3W3AA 8ADHA 4DTIA 2QVCA 3ZWBA 3D1LA 2R8YA 1A5BB 2JFWA 3I09A 3G2QA 4Q1EA 5FUMA 3CWCA 1K88A 1Z4MA 5F33A 4EG6A 2RARA 1USUA 4Q05A 2BT4A 4ECAA 4IDCA 1RZVA 2PCLA 1N6OA 4FE3A 1C3LA 4IQ0A 1BE6A 2BEUB 4MB6A 4R3NA 1NXVA 1IEVA 1U0FA 2M6LA 2VA8A 4X97A 3ZHTA 1BMFD 4IICA 1FJXA 1SD2A 4U39A 3E1GA 5C8DA 4M0KA 2GHIA 2A9OA 4X20A 2NIPA 3LXMA 3ZK7A 3PNKA 2G80A 2R6ZA 1EM6A 4N6NA 4JB3A 1ADJA 2PKRA 5ESDA 4EX6A 1IOLA 4CKWA 5ALRA 4Z86A 4IMRA 2G63A 2YC2C 1QTRA 1TUIA 3AMVA 4S24A 3N3BC 1G42A 2O8FB 4ZAGA 1JIXA 1JJ7A 4DSZA 4GWGA 1BEZA 4CG0A 3JARA 4WNAB 3PQCA 1YCHA 4TVBA 3S1LA 3SDBA 2ZRBA 4BAUA 1CZNA 1THZA 1N0IA 3GQVA 1OE0A 1XF1A 4RK4A 3PVSA 2IV3A 4FGKA 1E2NA 1WOMA 1FFXB 2HWKA 3HJFA 4BGUA 1NPTO 4NEQA 3FNHA 1JILA 3G2JA 4FJ1A 5CHYA 3H11B 4ESOA 1R0LA 2UUPA 1NMXA 3CX3A 2A88A 4XTCS 4NMXB 5M2QA 1CEYA 2FPKA 4KR9A 4HTFA 4QUKA 4GGPA 2RK6A 2VLBA 2Y76A 4XQGA 5CH8A 1T3SA 1AK9A 3AETB 2F8SA 2XUIA 3DWIA 5HBRA 2CDBA 3C3KA 1PVDA 4PSVA 1OXTA 2P79A 1U11A 3L7AA 3E18A 4ITVA 4OM7A 3FOCA 4YP1A 5EESA 5JBQA 4EHIA 5K03A 1T6NA 4IJVA 4O2BB 3ZHZA 4PO3X 4BX9A 3AFHA 1NRXA 1JSLA 1LSUA 3DZDA 1KVSA 2Q9BA 1WEHA 2WP0A 2VFAA 1Q14A 2OG1A 4IH9A 2GA8A 3NWBA 4IHQA 3RRMA 1XAGA 5MDHA 2FETA 4HDCA 1D7AA 1ZEJA 2AXPA 2FPGB 4XGNA 5DNVA 1IRXA 1JG6A 3SQMA 1M54A 1VBNA 1QV6A 2GN8A 3A1DA 1U1DA 1VYTA 3RYHA 4EMUA 4KX5A 2EZ9A 3SY8A 4ZZ3A 2PMFA 5JAPA 4J16A 1RFGE 4XWGA 2RHTA 2VRCD 3KR0A 4X1IB 4DGSA 4IIJF 5HFAA 4AUMA 4LYAA 1JLLA 1YZHA 2WM3A 4LV5B 1FDSA 3OSZA 2QLTA 1SD5A 3WS7A 3TVDA 2VL7A 3KE9A 1OXXK 3RRJA 5KTOA 1G1MA 2ZJ6A 3TTWA 4EPVA 4AVYA 1BXZA 1QQBA 1PEYA 2IYZA 3DCNA 1WUTA 1S02A 2GLXA 1LI4A 2ZT6A 4HSEA 2C4MA 5G4KB 3OX1A 1X7YB 2LE0A 2GA9A 2P90A 3EQ8A 3KXLA 5FEMA 3HY3A 4YGXB 2LRHA 3NR2A 2PUWA 1G5TA 3FN4A 1YC5A 4QPPA 2QD2A 1KDVA 1SKBA 2FI1A 1N9GA 1OASA 3MTIA 1CY7A 1FQWA 3AERB 4EAAA 2GM5A 4QT4A 2J7PA 1JQAA 3LUFA 1NMYA 3JYNA 3AKEA 3EUEA 3L7OA 4PPFA 3ODGA 1L7VC 4MGEA 3LOUA 3TD2A 5FDFA 5ES3A 4F3NA 4P4SA 3HO6A 4RWZA 5CT5A 3F6PA 4QOHA 2H48A 4YONB 1U3VA 3PBKA 3EXFA 3RIGA 3SKVA 4M46A 3WLPA 5I9SA 4EY6A 1AGXA 2IEBA 1ZMXA 5BNTA 2FUG1 5IASA 4FHGA 2GJ8A 2J5BA 1AD2A 3EVZA 4MS1B 2P9QA 4Q9KA 1YS6A 2VAXA 5KCZA 3BL6A 4RTSA 4QQRA 2BTQA 3OFJA 2P35A 4UVIA 5T4BA 1SUIA 1DKLA 3KUXA 1P0IA 2VEOA 1RAEA 4W7SA 4A4DA 4OSOA 1LU9A 1NTOA 4QOGA 1UMKA 3W77A 3W9BA 5EZ6B 4G09A 4YCAA 5K0TA 1L5OA 1Z62A 2E49A 1YBVA 2IX3A 2MSDB 4K0KB 4I50F 1B43A 1JLHA 2PY6A 4IBOA 5J63A 4QPNA 3D7KA 3WAKA 5B4TA 4DR1B 2V6FA 3F67A 2CVHA 4LSGA 2PV0A 1H4QA 3H5AA 2JIMA 3PR2B 3H13A 5BNIA 1HQYE 1X13A 4LYDA 3EJ6A 4E4TA 1L8LA 3SLRA 5IAGA 1SXPA 3A6PC 5AXAA 2V6IA 1EVLA 4X62B 1U28C 1UKCA 1FXWA 2O2EA 1SHKA 3DE1X 3NETA 4BNDA 3UT5B 5EWJA 2ZYGA 1GRNA 1B26A 1YA8A 3IMKA 1E5DA 3CLVA 4HOYA 4OB6A 4D3ZA 5LWQA 5AJWA 1Y63A 2H4WA 4MKIA 4FDVA 2OMKA 1EDOA 2HA3A 4X93A 4TRJA 2UDPA 3ROQA 2GX6A 3LWBA 2HBZA 4PCUA 4MVJM 1QRSA 2ZSJA 3FCOA 3NEYA 4D41A 1FTSA 2OV4A 3ZVKA 1YI1A 2A9QA 1V6AA 2DUUA 1YU6A 4REOA 5EEGA 1KJJA 5DP2A 1FTYA 3GX1A 3T95A 4C88A 1CUDA 5ICCA 1YB2A 1L4KA 3K73O 4KMOA 1QFXA 1Q19A 4OQ4A 4GLFA 3RS7A 4F4CA 1Q16A 5PNTA 2OFPA 1L5VA 2XMPA 4UPEA 3UW3A 4A8JA 1YVDA 3MB5A 1RLOA 4BDSA 2NVWA 4RPHA 1M34A 2BGWA 3I39X 2WHXA 4QYIA 3UCXA 1ZGZA 4KN9S 3UVEA 4MV1A 3TW4A 3PQ7A 4LTNA 4B5KA 4DV5B 3NVKI 2YUTA 5LXTF 2D5BA 1LLQA 1L7DA 3AF5A 3ZS8A 1IN6A 3FTNA 2A0UA 4MROA 4NQRA 4O02B 3ZX5A 4N5MA 4E5PA 1SVUA 1C4WA 4ZI3A 1R3DA 1U9ZA 1TYBE 3KJNA 2OD9A 3DV2A 1BYUA 1T3GA 4TMKA 5CDTA 1SG6A 5A0VA 5A6VA 3LA8A 1ZU4A 2ZUBA 1VHDA 4JJGA 1GXSB 3F97A 4PFQA 4ER6A 2ZJ2A 4YRAA 3DVRX 4QBIA 3E53A 1N1EA 2EYQA 3AOGA 3Q0TA 3R5XA 4Z2YA 4YR9A 1TNDA 3S2GA 3TX2A 3LIPA 1WPXA 4C20A 1N2EA 1GL6A 4Q3BA 2OQ2A 1JQ3A 4XEUA 3W2FA 3KJFA 2WFLA 4TPKA 4EGCB 1Z2CA 3W6NA 4F3CA 2CUNA 4G36A 4R7ZA 5C37A 1EX6A 1MAVA 1UOQA 1ML4A 3VOAA 2F1JA 3QV1A 2J3MA 3NHAA 1OFTA 4O63O 3CW2A 4LZOA 2H9YA 3ZBUA 1V95A 1ECJA 2W4IA 3BL5A 4A0FA 4WFQA 1BU5A 3GMSA 3NKVA 3P96A 4TMFA 1H23A 1QP4A 1WNFA 3NMUF 3KVNA 1JDZA 1JQKA 4AKSA 3FCEA 2QZSA 1R3UA 1WQ3A 1S4QA 3F1LA 4J0QA 1SURA 2BFEA 2N46A 1PG5A 4LHSA 4P3OA 3EIEA 5BWOA 1RQRA 4EYGA 2NO1A 2H07A 5TGDA 5I7RA 2DGDA 1OAOA 1W59A 4F2GA 1ODFA 3O4VA 4G5SA 4YAIA 3W79A 2P9FA 1NJFA 1VMEA 4FVTA 5JQWA 4QBHA 1AZLA 2AFHB 4H6XA 3KL2A 4BBZA 5A6SA 4YT8A 2C4VA 4BPRA 2SBTA 2G76A 2X0FA 2WJVA 2IEAA 1FRVA 3UAOA 2SICE 3ZHOA 2Z2JA 2YR0A 4G2TA 4EZEA 2HDOA 4FFWA 5CVTA 4DA9A 4DDTA 3T94A 5A9SB 5DM60 3H8SA 3TL2A 3ORSA 5KBYA 2G88A 3Q3IA 2DH5A 4EFMA 1OFUA 1TAGA 4RF2A 4OJQA 4R4JA 5C52B 1MEOA 4DLSA 4QTXA 1F8XA 4G1EB 1HFEL 4XQ9A 2BUBA 3Q3EA 1L1RA 1XR3A 2VWQA 1X1AA 2QX9A 4NQZA 3FKJA 2JIRA 3HEBA 4BLPA 4F6CA 3W8DA 3VSEA 2I6GA 1Z5NA 5FWXA 5C7YA 1PGPA 2CJXA 5ADVA 2Z98A 3DP7A 2H1WA 5KYVA 3FRIA 3RDPA 1QAMA 2VPIA 3PTZA 2UVDA 3C85A 5A1TA 1TVCA 3K0AA 3PT9A 3CZRA 2EOAA 2XLCA 2J9FA 5EIXA 1E98A 1SU8A 3R6TA 4KXYA 3K1AA 5TPZA 4EY5A 3FPAA 3MW8A 4QTUB 4CL0A 1KK3A 4E3WA 1VRWA 3GJQA 2HCFA 1XTIA 3WGYA 2XTNA 2EZTA 2YFHA 1E5VA 3OQ6A 2QM3A 4W4TA 5DTQA 4BCBA 5K6TA 2ISCA 4GUDA 2CFCA 2CJWA 3ZX4A 1BXGA 1FDIA 4XSHA 4XIYA 5MN5A 2PRZA 9GPBA 4LY6A 1RHMA 2G04A 4W5OA 4DUZB 1B14A 2DLNA 4KGDA 4L73A 3ZK9A 4DUYB 3RADC 4DBLE 3VHRA 3WK7A 2VKTA 1K66A 4OXXA 3M5DA 4MDHA 5HG0A 4FCWA 4HFMA 1Y7TA 4A73A 4JS0A 5IH3A 3NX4A 5HM8A 2P30A 2XI4A 3C8HA 4JVOA 1U2EA 2FFQA 1E4EB 2EX0A 3KKNA 4H4CA 4ZQHA 5JJBA 2OR3A 1NZJA 3BHMA 3ZWKA 3BCSA 1RYZA 3IXQA 4I2VA 4X1OA 2W6QA 1MW8X 1K3TA 2QTFA 4CEHA 3BHIA 4YUVA 3T0IA 1IPFA 1XDUA 2DUJA 2WLTA 4RJJA 3K4QA 4C78A 4N40A 1HFWA 3VU9B 2E1RA 3AILA 4PONA 1HE8B 4WLUA 1NLYA 5E6RA 2JLBA 4B2IA 1EFVB 5AOAA 4NBWA 2XZOA 3RF6A 2BEVA 4J0EA 1LQTA 1XT6A 4EA8A 1VMKA 1ZD8A 2PWBA 5F5NA 3TAUA 1DUIA 2AD5A 4M22A 4ZPJA 2GM3A 1T0IA 4ENQA 4AJHA 4QRDA 2NT3A 4XOUA 2QUBA 2RB5A 4D3DA 3V1KA 2OBBA 4G0MA 1SZCA 3MOSA 5L3QA 3FCAA 4PYOA 4RANA 4WY8A 4B3MB 3HUTA 4K8OA 2F48A 1VLJA 1WR8A 3MWYW 4KWTA 2W42A 1N8TA 1RRVA 3LT4A 3CZMA 1DUVG 3DE3X 1TJ3A 1NP6A 4GR5A 2OBYA 4M0DA 1XVUA 4OQZA 2PN1A 3EVBA 4YCDA 4DREA 3FF1A 4YRKA 2CXTA 4OBEA 2D59A 4UJ3A 1VL6A 5FLEX 4D0RA 2Y99A 5FUBA 4RD0A 2XXAB 3GDFA 3MT7A 1Z83A 3TOSA 5GADl 1P0QA 3CPJB 3EIQA 1NRIA 2GCNA 1PFYA 2WWYA 1Q22A 3ZNOA 3GP5A 2IF2A 4MR7B 1GO2A 2BKUA 3G9QA 3KU4A 1N2CA 4DRYA 1N3YA 4EYOA 4W5HA 4D9MA 1URPA 5J5CA 1X3SA 2IJGX 3F5QA 1F8FA 5D87A 1HX7A 1KVRA 1ND5A 3BFPA 2QLJA 1XJCA 2G28A 4CMIA 4BTLA 2W98A 5E9JA 5BMVF 1PK9A 3W5SA 5FWYA 3LCMA 1VE1A 3FDIA 2CJYA 4PTLA 3FR8A 4FFDA 2MSCB 4O2AB 4F4UA 2B8EA 1KFJB 5JG7A 1I5EA 2P27A 1U3FA 4F38A 3JD2A 2JFQA 2V5UA 4IMPA 4HEHA 1XRJA 4AZSA 3F5FA 4A91A 1BMFA 3KK0A 4IIHA 5AHKA 5L3SB 1P39A 1Q21A 4J03A 1KEEB 3N2KA 4MP6A 3JSAA 5ILQA 1T8WA 3DFMA 4PG7A 4OEHA 4RPKA 5TQ2B 2ETVA 1PNRA 1D9ZA 4DGQA 2HJ9A 2VQFB 1DO0A 2A9KA 1CRPA 4HL6A 2WD9A 1NIJA 5A9TA 3H2KA 3IUMA 1SK8A 5A04A 2Z6AA 5T41A 1Y8QB 1P3JA 3WGNA 2IYYA 1K68A 3DTVB 2EVWX 4AX4A 1U99A 4OOFA 5IYZF 4HVAA 1L4NA 5CTAA 3G2HA 1CQWA 2IOYA 4TGLA 4WZBE 5CHEA 5FIUA 3S2EA 3WLHA 3OCYA 5F7ZA 4Q00A 4Y2YA 1OFVA 4N4AA 3C5CA 5FADA 2V55B 4MVXA 2JFBA 4X8MA 1EIZA 1NVWQ 3UAZA 3RO7A 2QVBA 4BB5A 3W9SA 1KHHA 5EP4A 3FCYA 3AZPA 5KQMA 3J80A 3FX2A 5EGNA 2AB0A 1Y6RA 3G13A 3TR5A 2ODQA 2R7NA 2B8JA 3BWEA 2VNSA 1KZGB 4KO3S 3C7AA 3H8JA 3IUQA 1PT9A 3FOEC 2YRWA 4US0R 3QKWA 3SG0A 4WIAA 3LQYA 1W2WB 3EDYA 3MQFA 4FXOA 5D6OA 3I9NA 5ARCA 2A9VA 2H8KA 4MKZA 4RA9A 5IDYA 4E5NA 3KOUA 5E1BA 2REXB 4LMBA 3FIUA 3ROFA 1BMTA 2SKEA 4FC6A 4JHLA 3TXXA 5HSGA 4KR3A 2P3OA 4M60A 3SFZA 3SMVA 5J23A 3HCWA 1EK0A 4O5OA 2RBGA 1Y4DE 1KTVA 1ZOLA 2IHTA 3IUBA 4IH4A 4JP5A 5DLYA 1N2XA 4QBFA 1DKPA 1SUFA 4ARAA 2GYYA 3SHTA 4R3WA 1U65A 4OJKA 4WCFA 8GPBA 3OTWA 1DOZA 1J9ZA 2ZE6A 3QU2A 2GESA 2DWPA 2ICAA 2V96A 3K7EA 2QTCA 3U26A 4JJ8A 4RDXA 5J1SB 3HKBA 2O52A 5CUQA 1XKTA 1KQOA 5I3CA 2JF0A 3OZFA 2VRCA 1QU2A 2XCUA 3T4UA 3NHLA 2M6KA 1ZOPA 5ITSA 4D8VA 4FYKA 4EKDA 4NL4H 1BG6A 4F72A 3EEQA 2DQKA 5SYNA 2J6CA 2M2IA 2I7DA 4HX2A 3M6LA 3PSAA 4AXBA 2CLSA 2Z8YA 1W96A 2EIHA 3ORQA 1BAPA 1NAIA 2FOIA 2JFOA 5TQ0A 1T5TA 3VJLA 3ITNA 4KPUB 4CFZA 1C29B 5LOVB 2FV8A 2I1WA 2L0XA 2Z95A 5F2KA 1Q0HA 3NJ4A 5GONA 2CUKA 1LLFA 4ZZ2A 2OBLA 1P9WA 3IUNA 4HBGA 5FHQA 1RIFA 2J0QA 4PQYA 2W8BB 1U0BB 5BSRA 3C6QA 4C6HA 3ZGOA 2KI5A 4OHBA 3GLIE 1CP2A 1VHTA 1W36C 2CFOA 4ZYXA 1FMCA 1SBNE 4I5DA 4J3JA 2W6OA 4MQBA 3GJTA 1E6EA 3UJNA 2QGZA 2ZYWX 5DWVA 4GIBA 5TVKA 5FB3A 5K8TA 1RXSA 1NQAO 2JCYA 2PX3A 1NFFA 4YRRA 4UOZA 3QYFA 5A3SA 4IVQA 1OWPA 4J9UE 4IOKA 1VHQA 2RGCA 1GTVA 1X80B 3CR7A 4W8GA 3WQHA 2PLAA 2VP3A 2ZYVX 3GP8A 1Z2DA 5TIIA 4HWRA 2MINA 4KK3A 2F7SA 2FPPB 4QHSA 4Y6SA 3TEJA 4CF7A 2Y1GA 5EJMA 1C7ZA 1D6SA 1EUDB 1YT5A 2AN5A 3DXXA 3R9XA 4QTZA 5AOVA 4B84A 3AVTA 4GRIA 1QFZA 4YAFA 1DXQA 1AKNA 1I3NA 2WSSD 4ZAYA 3ZZ1A 3QIVA 1GCAA 1YBAA 3JY6A 1MV5A 1GVHA 4WN9A 2NUTA 3K0CA 5CDFE 5KEIA 4L85A 4UW9A 5I4BA 1WPQA 4HDMA 4I55F 1YULA 3GLVA 2GF9A 3KYDA 3IDFA 1CVLA 1GADO 1CR1A 3R8CA 1T36A 1ICIA 1YMVA 3BMOA 2R66A 5DM2A 4AG6A 3VUFA 1XHFA 1WS6A 3CF0A 4CLHA 2VSNA 1ZUD1 3JQFC 1I8TA 1OHHD 1KJZA 2HWXA 1Z47A 2YFKA 4MB0A 3HDGA 4OB8A 4UBNA 1Z4LA 2FR1A 4JLPA 2VAVA 4URYR 3ZTTA 3WGTA 1I1NA 4NTZA 4PGFA 4TV9F 4XD7D 4KWCA 1V5EA 3C0KA 2EJVA 3I34X 1ZX1A 4M8LA 4DQUA 3QXCA 5FPQA 3K8YA 4ROTA 2HHJA 2YMQA 3DS8A 5KJ6A 2XB2A 3IAEA 2I3BA 1Y8ZA 2W2OA 5ERXA 2BKEA 4I2NA 1NUSA 2WBLC 4ZU6X 5J2UB 4G5OA 4MHTA 4B3BA 2JH9A 4ESVA 1UPUA 2FPLA 2R1VB 3IULA 5H81A 4CDRA 3FZQA 5AOCA 4BVHA 5KYTA 2Q9AA 3DM9B 5EA2A 5FWNA 1KJIA 1VIDA 5FO0A 3RT1A 4GPD1 1YZQA 4F2DA 2D2EA 3HN2A 1WHSA 2YNMD 1RRGA 2R47A 2ZB4A 2AC4A 4N12A 5CIWA 4HUQB 1X39A 2GZAA 3ND5A 2HA2A 3OZDA 5DRYA 3VR2D 1WXXA 2IP2A 3BF8A 2VAWA 1LBEA 4MQMA 4EY7A 1Y89A 2REQB 4U9HS 3TECE 5BXYA 1N2ZA 3Q3CA 3JQDA 2C3UA 3NXSA 1B6TA 5U4XA 1SUWA 4RZIA 4P5PA 3ENQA 3H5IA 1E0AA 2GS9A 3HMKA 3JALA 1PZNA 2EJBA 3V7YA 1QFJA 3DNPA 3U4HA 2BFMA 3ROZA 1Q11A 4BVEA 2HA4A 1VA4A 2F4NA 5EUCA 4RZHA 4CT5A 2YV2A 4GI7A 1KQGA 3U19A 1DKMA 1H3FA 1SHZA 3G7NA 4BFYA 1D2HA 1RKVA 2J85A 4BLWA 4Z9FA 4LNHA 3NNSA 4QBTA 1WHTB 3WNQA 4DR2B 3EGCA 1PZFA 4A23A 1T4CB 2C8JA 3AVQA 4P22A 5D3KA 3OD5A 4ZJPA 5C2JB 3CYFA 1K5GA 1X7XA 5BT9A 4HMOA 5KZMB 4BQQA 1BE0A 1GNLA 2GILA 3N2LA 4MIEA 1Z28A 3V9PA 3WK4A 5HJ5A 5HQ3A 4YTEA 4C0JA 1U3CA 3C2QA 3FBTA 1VA5A 5ALSA 3RSFA 4FI3F 1T2EA 4IL5A 4U7HA 3ZWCA 2G83A 5CG1A 2VPPA 3K72B 2Z4TA 1VLVA 1OIXA 2CYCA 3UH0A 3H2BA 3TTTA 1M8GA 1H2EA 5THQA 3VYVA 2OBFA 3A3NA 4OFBA 5HF5A 3P0IA 1N8SA 3A1UA 5AHXA 3D3JA 2O1WA 1P7VA 2WVHA 1DI0A 4GUAA 2BP7B 2AK2A 2GPAA 4ZAXA 1E32A 2RG1A 3VVMA 3PE6A 2O8BB 3PHHA 5ARDA 3AH8A 1QU3A 1R6VA 1KGDA 4OY3A 1VPEA 4LJLA 4LF4B 3ENZA 3GLUA 4LG1A 2G9NA 4DV7B 3VC7A 2V4MA 2YDXA 2QXYA 3BB1A 5LBUA 4G0UA 2FFHA 2FWBA 4M0CA 1SXIA 2GZSA 1W4LA 2QPAA 3KVOA 2QW0X 3K1JA 3L07A 2AI1A 1GYRA 3E3LA 3TDNA 4BNJA 3UGJA 2E4WA 4GR9A 1UDAA 4ALNA 1C1DB 4LZNA 2POCA 1FSGA 2E6UX 2Y0CA 4X24A 5LP6F 2D1FA 3KJZA 3F6SA 1P60A 3IT3A 1NHGA 2ASEA 1UMBA 2BCJQ 1KPIA 1PO7A 4J16C 1FY2A 1JE0A 4WGFA 3ZLJA 4JYBA 1YRHA 4R1QA 4DG5A 5H9WA 4A2QA 1GQ2A 1RRCA 3CRNA 2W8ZA 2A86A 1NQWA 4ND3A 4ZU3A 4EY8A 1RMYA 1HEYA 4CV0A 4P34A 1KI4A 3MUEA 1ZNZA 5TEWA 1K9SA 1VKJA 4DLBA 3ODPA 2OM6A 4ZOLA 1OIWA 3WC4A 3IP8A 1QO0D 5L7YA 3L0OA 4PSCA 1DC7A 2CDCA 1C4XA 1DTWA 3MWEA 3ZWMA 3C3JA 1XFAA 2NO9A 4XYMA 5HR5A 1T2DA 3EZGA 2NV2B 1WLSA 5G02A 4O4LA 2GDZA 1GQQA 3X2SA 4HN2A 1Z16A 3N58A 3RJTA 4EDFA 1CYDA 1IHDA 1OBHA 3ZI4A 1W4BA 1I9CA 3PUJA 1YGPA 3R44A 5BV2P 2WAOA 3ZVMA 1NVUQ 3WLRA 3W78A 4DYDA 4BKQA 2AXEA 2JI7A 4WJKB 2BBWA 4BNWA 2K7ZA 4JEIA 5DLPA 4RMGA 3GJ5A 4IOMA 4Q4HB 3W2GA 3MJTA 2OHXA 3OIWA 2FQ1A 3ZD9A 4Z53A 3VKWA 1L5MA 2XUFA 4EFNA 3GLGE 1L9KA 2JI6A 3L7MA 3MGCA 4ZHQF 4KE6A 4DV1B 5EXTA 2VCHA 2Y05A 1QPGA 4ZVPA 3T52A 1ORVA 1P2TA 2C5GA 4C7JA 4RDCA 5ETJA 2WQ6A 3D5EA 3L0ZA 4P08A 5HZGA 1BS9A 2XE8A 4PYIA 3BX1A 2VWPA 1BCSB 1K4MA 4RKRA 3BD6A 2FWPA 5D5HA 4MVYA 4ND8B 5CURA 3RVJA 1QBGA 1SY7A 1V26A 4LJSA 1DEOA 3GPBA 5AW4A 1SCQA 1NVEA 4MS4B 1UMCA 3O1LA 2YWRA 2ZZKA 4D26A 1RD4A 5EPEA 1SOAA 4TS3A 1A82A 1F7UA 2X9QA 1W73A 2JJ8A 1TCVA 5GJVC 4A8TA 5JJLA 3CB4A 4H7DA 1PZMA 2NYUA 3OQIA 4YH1A 3U6KA 3L8ZA 3HMQA 3JATA 2HFJA 2XT0A 2B5WA 4J49A 5ICMA 2J3JA 1KVUA 1UXIA 2CYBA 3I52A 3KWFA 4XRRA 2EJCA 2KB0A 2HU7A 4D02A 3NHBA 1TZJA 1G8PA 2I3ZA 3ABQB 4P35A 3P2MA 2OCAA 2IVZA 1EFDN 3AFIA 4OF4A 3LA6A 3I5MA 3L7DA 2P7HA 1V39A 3Q88A 2XCTB 3T61A 4FYJA 1E9AA 5ECGC 5E6UB 4MWSA 4XYBA 3CT4A 2ZJ7A 3V9AA 1RAGA 3P7MA 3ME5A 2F3TA 3GW8A 2IITA 4EY3A 1XYVA 5GJCA 1ZXXA 2XDQB 4IHKA 4ND4A 2P91A 1G5PA 1C5KA 1H05A 1YJCA 2FW0A 4ZOBA 2A5GA 4CCYA 1KZ4A 4H6WA 4YCBA 3F7MA 4RVDA 1U8AA 3D0RA 2D7DA 3OLWA 3GRVA 1AE1A 3DPIA 4A8JC 4EGAA 1FUUA 1ETUA 3LLUA 4JJ7A 3T9BA 2CD9A 3CNEA 1MEJA 4XQCA 2OFFA 4IDBA 3WADA 5K3DA 4IF4A 4TLBA 2ZDGA 3M4YA 1MIHA 1O0SA 1RLMA 1MG0A 4EAQA 1P29A 2VUHB 3EF0A 3ER6A 2CF5A 4LC9A 1TD1A 5ECYA 1DKRA 1QLHA 4M7PA 2OZLA 4DB2A 3E4CA 1GR0A 2HRBA 2VHWA 2BI4A 1BHJA 4WHMA 3QG1A 4DJJA 4QPDA 1H2FA 5L3VA 1AUOA 1GQFA 3ISJA 3LUKA 1O2DA 1CERA 4MI9A 3IVCA 3ZLVA 2FZCA 2VQDA 4HN4B 5F3WB 1ZNYA 4HBZA 2XV1A 5EWLB 2PNJA 3TS1A 5KVAA 3MGKA 3ZG6A 1MXHA 2QZ9A 3LIIA 2WUGA 3PXXA 3UPDA 2UXCB 3GT4A 1US8A 2ZYAA 2XJ4A 4EBFA 4ZVLA 1DG9A 1NSTA 1NVMB 4KAXA 4RLQA 2VT3A 1DQNA 1X74A 1E18A 5D2CA 4RULA 1YJXA 4YJ2B 2VQSA 5EE9A 1U3GA 3H9BA 5D5PA 5CR9A 3U3KA 1I9GA 1YOVB 4LJ7A 1OLXA 4RD6A 2F6RA 2AQKA 4HY3A 5JVDF 3AR2A 1DQYA 1M2OA 3L04A 5B30A 2Y6VA 2Y6UA 2GEJA 4U6NA 3DFZA 3PE3A 4B48A 1T2CA 1ZP6A 3L9XA 4HD8A 2JVIA 4GG1A 1ST2A 1GRRA 3R3SA 3BEOA 4V38A 1R6AA 2QNRA 3NIBA 4XVCA 1K7YA 5B55A 3GDOA 3RVNA 1JW9B 3EC1A 1MJGM 1HSOA 4QNNA 1R4NA 4XIFA 5FOUA 4W5NA 1Q77A 4DIBA 3JD3A 4RCYA 3MCUA 3ZCVA 1PQYA 8MHTA 2BFDA 3IE1A 1BKSB 1OAOC 3JWIA 4M9SA 1Q7GA 4PIPA 4TXMA 5DYWA 1F12A 4ZEWA 5EIBC 1E9VA 1QHHA 1LX7A 2DQZA 3OT4A 4JDUA 3WZMA 1JG4A 3TI7A 1KZ9A 1Y37A 3PUYA 3TIFA 2EX1A 5BW5A 5EOVA 1I6LA 1D2CA 3TPZA 3UOWA 1XZIA 3CR3C 4LBYA 2LIPA 1VCOA 2MR6A 1P9RA 3KZ1E 3KPWA 4LRSB 4QDUA 3U3RA 4DR5B 4LFAB 1IUPA 3C6YA 1QHGA 2FSFA 2Z5GA 5FTMA 1EDDA 4EA7A 1JI3A 3UICA 4GMKA 4GWLA 2PT6A 4KE8A 5CVUA 4A8PA 3NTUA 3V6MA 4CLDA 1JEEA 4LK3A 2X3UA 3CVXA 4DIDA 1L5LA 1GZ4A 5BV8A 1UJCA 1RLUA 2B78A 2B83A 3DAOA 3FA2A 2QT1A 4PG5A 2L2QA 2G1KA 2NU9A 1JQDA 3OQHA 2RGWA 2JDID 4J3NA 4QOIA 3QVTA 1XLUA 4ZOQI 3EA5A 4ANFA 2NZYA 3SDZA 4LJ4A 4DJEC 1W9MA 3P0JA 3C8UA 2QA5A 3N05A 1Y1SA 3JXEA 3P26A 5JNUA 2O3RA 4F7WA 2BBSA 6YASA 5JEDA 4IDPA 2AXNA 3R7DA 1IVNA 1U8YA 1TYZA 3WHIA 4Q7EA 1H69A 4KHZA 3H1TA 3ONVA 3R40A 4CETA 2Y1OA 3QUAA 1Q0UA 2GHTA 1MNAA 3N3AC 4OM8A 3T3EA 5HZMA 4AKHA 1M2FA 2B8NA 1NVVQ 3KWMA 2FN9A 1L4YA 3U31A 1YVEI 2DPYA 3LNCA 1EM8A 1HDIA 4AJEA 1V4VA 2NXEA 4OQEA 1CIPA 2J48A 3CRZA 1Y9DA 4ZT2A 4OI2A 4IFEA 5JSHA 4R3UC 1VL2A 1SEPA 3LY8A 2Q5JA 2D3TA 2GMWA 2ORYA 2P8JA 2HA7A 2QVZX 3DZIA 4Q7JB 2GK7A 5GM1A 1QIJA 1OXBB 1WO8A 2XD9A 2P5SA 2UYQA 3OZSA 1J9GA 2Y66A 1SXJD 3PGJA 1MQ8B 1YWGO 4INPA 4YAJA 4QNMA 4BLUA 1U8CB 2I4RA 2QZZA 5EZYF 4QPZA 5J4KA 5JNVA 1MAAA 2WSSA 3VUEA 1HE3A 1KSJA 2BM1A 1SUCA 3ET4A 1YBHA 3GEPA 3M8KA 3U0BA 4UTZA 3KXKA 3N59A 3RFUA 3OTOB 3RPEA 3OMLA 4EHLA 5C8XA 2XYVA 1XZJA 3QIAA 3AKDA 2WT9A 3K53A 3ZDRA 4CKCA 2F4VB 4XKJA 2APJA 2CLHB 2NQ2C 4MA5A 2XQJA 4ALLA 3KQQA 2WIDA 5IBQA 5HS6A 1QHEA 1ZOOA 4Q1FA 3JYPA 1XZLA 4RCZA 3HDQA 4A8HA 3OZWA 1Q7CA 4CMKA 2V7BA 2QN9A 1T5HX 2BUCA 3BZWA 3HCRA 5TSDA 4EFLA 1USWA 1OHHA 4G4SO 4ZTBA 3JVDA 3GD5A 3UV6A 4IDHA 1Z2AA 1D7OA 3G0OA 2F67A 2ZB8A 4UE2A 1MJHA 1OA0A 1D1SA 1U3TA 1I4TD 1EYZA 3NKFA 2IYVA 4CLOB 1J2YA 1IWOA 1EK5A 1TGVA 1SQ5A 4WLEA 3RAGA 1XG5A 2C4HA 4YC7A 1M0TA 4O1IA 3K6SB 4RKEA 3ROKA 2RHHA 5CA1F 4CV2A 1MQ9A 4ZAZA 2HMTA 5FI0B 4BZWA 1EI9A 2CUTA 4WA7A 1EFCA 1X0XA 2VP2A 4P4LA 3CF4A 4B80A 4KFCA 5ECWA 5I7VA 2ALJA 3M6AA 5GINE 3N5CA 4YBRA 4BKOA 1MW9X 3QXGA 3CW8X 5D1NA 2YNMA 2BUAA 3HFJA 1YR2A 1E1QD 3ELBA 2YXPX 3R7LA 3REOA 3LD9A 4YI3A 3VR2A 4DCCA 4MB2A 1LEHA 2EZ4A 4R1MA 4EECA 4PZ0A 5EFZA 5B7QA 4Z9BA 2YHIA 2F8MA 4L8YA 1TXGA 1KE1A 2J41A 1ABEA 5DYNA 2I6TA 1RJFA 2SCUA 3FLAA 4JOQA 4RWEA 2NVOA 5JXIA 1P5FA 4AB1A 4MKGA 5FPTA 4HDRB 5J4HA 3ED5A 2QM0A 2CVPA 2IXEA 2JW5A 3EQ6A 5K45A 4ARVA 2WJYA 2JHFA 4IQFA 2ORWA 1AA6A 1VPLA 3Q7PA 3T35A 4HLQB 1I4LD 3B5EA 4BQSA 4N3AA 3GRZA 1H1LB 3PFBA 2H92A 3DAYA 3BWDD 4MVCA 3RUFA 3OPYA 4X7PA 2Y71A 2RD2A 1R7RA 1BOFA 2HMSA 3KFVA 3GPDG 3KQHA 5B3LA 1IONA 2AX4A 2LBPA 2R0QC 1EZZA 4D4MA 5FV7A 1CUGA 3KTFA 5CJ2A 1M7HA 4NMLA 1G6KA 3SJZA 3TRKA 1QIIA 1EP2B 1RHKA 1XKQA 2FSSA 2OGWA 5EUQB 2YFQA 2BGRA 2PKXA 2AMVA 4I4LA 5F5XA 2X3YA 4G4IA 4UHHA 1H93A 1V96A 2I8CA 3VZQA 5IZCA 1FTGA 2CXUA 2W71A 5KHLB 3ECAA 1AXGA 4RUKA 4BE7B 4YRLA 4DJ5X 2L17A 5JOQA 4P7JA 2E2WA 4AP5A 3V7NA 4GLOA 5BSFA 3L4JA 4JP8A 1E1CA 1OZAA 5A3JA 1UT5A 2SHKA 1NW9B 3P5BA 2X5XA 1IUOA 1C7EA 4LEIA 3FLEA 5FP0A 5AI8A 5CRIA 1N5IA 1U9JA 2WTMA 4KIJA 1NJ8A 3G9UA 4FNGA 4NH4A 2B3DA 1DDIA 1K8YB 1YB5A 4X54A 3EPHA 3UMYA 4POOA 4RO0A 1F2TB 3TYXA 1ISHA 3RARA 1ISGA 2OORA 3PF9A 4XA8A 3RWMB 2BISA 1RJWA 1JJAA 5DCLA 3A3PA 3KL4A 1BFDA 1TPYA 4GGMX 2VPZA 3U4GA 5K6RA 5JS1A 4WCFC 4MK4A 4EG7A 2WFMA 4NYMQ 3RTEA 1W88B 4EB8A 5DHFA 4ZYYA 5KS2A 4A0GA 2YZKA 4HQOA 2CN1A 4IXDA 4D92A 2K87A 3VJKA 1DPGA 3AR7A 3KSAC 1OX6A 1RYYA 4LSMA 4UBIA 1M2JA 5T4FA 1ICEA 1XD8A 3VKHA 2YW2A 2GARA 4MTCA 1DINA 5TQJA 3TOZA 3WSVA 1JHVA 3NBMA 2C31A 1CUFA 4HDKB 2XUDA 2YWBA 1E8DA 2PRJA 5FPHA 1CQZA 3PHIA 1NJ1A 1XIVA 2QLLA 1QO0A 4ZMBA 3AESB 2O2DA 1NBHA 4OSPA 5BWMA 3GOQA 4TLMB 2YV3A 4BJ1A 4Y6PA 1G16A 1RWPA 1XXHE 5MGNA 3BIOA 2PQ6A 4WNCA 2R8XA 4D9NA 1LWNA 2EBFX 1JKJB 4L4UA 1RMTA 3N28A 5AKHA 5LQSA 1QANA 4B2YA 1RP1A 4K1XA 4RVNA 5AICA 5IN4A 3NUGA 1I7SB 2FSGA 1RQLA 4PPQA 3DHYA 2ZG6A 1RWBA 5AHWA 5KSYA 3LDUA 2PH7A 1Y3FE 2HCTA 3C3PA 3NU1A 5K0NA 4CU2A 3GLFE 1SZPA 1P2FA 4FDLA 3USES 3L7CA 2IDZA 1E2UA 1EUQA 2IHYA 2HB6A 5KYYB 2ZZMA 1TTPB 3ZLUA 3Q4GA 4Y1RA 3Q41A 4KZKA 3GIDA 2JI4A 3S1SA 4XR4A 2B7BA 3UC5A 1C14A 4QODA 3BWVA 5BUSA 2MIIA 3INGA 5FNVA 4Q4JB 3T7CA 4EUFA 1UM8A 2OBNA 1K6XA 2QOEA 1VKZA 2JJ1D 2FKNA 2OSVA 3CR8A 4C14A 4QYMA 1K2VN 1HFKA 4PRKA 5KUTA 4GPZA 2GCOB 4ZIRA 4HDOB 3PDCA 4EP1A 4YCJA 3BRCA 2CYAA 2ZWPA 3FJ1A 5IVIA 4I6GA 5H80A 5GWXA 5TGTA