2C07A

Oxoacyl-acp reductase of plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
246
Chain Sequence
KENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
publication title Kinetic, Inhibition and Structural Studies on 3-Oxoacyl-Acp Reductase from Plasmodium Falciparum, a Key Enzyme in Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 98
structure length 246
sequence length 251
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c07A00
4YAIA 1PSDA 5DOVA 2ZJ0A 3GUCA 1KVTA 1XKQA 4LMPA 4FGSA 4BNIA 2AE1A 2B35A 2B4RO 2NWQA 4XZ3A 1IL0A 4I9HA 3B20A 4Q39A 3CMCO 3KSDO 1S7CA 2Y67A 3UICA 1LC3A 1UP4A 2OO5A 4E32A 3ROQA 3BA1A 1LSUA 3FR8A 3M2TA 2DTEA 2NVUB 3R0IA 3RBVA 1N92A 2X7HA 2FPPA 1ZEMA 1LBEA 1T1RA 1WDLA 3GGOA 4OIMA 1GCOA 1U7TA 4LVUA 4TZTA 4ZRNA 1QORA 2WMDA 3JQ8B 3GEGA 4R54A 5LCXA 1RJWA 4FFNA 5B4UA 3IC5A 3QWAA 4KQXA 1PJLA 2WM3A 5ER6A 4XB1A 4F46A 2PZLA 4IUYA 3W8FA 4J49A 4NH4A 1PWXA 1WLYA 3FRJA 1I2BA 4J90A 4YVFA 4CM7A 1BW9B 4MDHA 1ONOA 1LDEA 2D1YA 3ZNOA 3I9JA 4GSLA 2P9GA 4YACA 1UJMA 4CLHA 2DTDA 2YJZA 3AJRA 3A28A 5KJEA 4EBFA 1DIGA 3PHLA 4BNXA 3ONEA 4NFHA 5DBIA 4FIZA 2EJWA 2GCGA 1V0JA 3ZHBA 4P38A 1EFLA 2I3GA 3RUFA 2EV9A 2ZQYA 2J3HA 2POQX 5T5QA 4NR0A 3ZNNA 4GX1A 4R1UA 1LJ8A 4Q3BA 3ANMA 4LCJA 5COQA 1QYDA 4BQRA 1GTMA 1SEVA 5EERA 2YY7A 3N7UA 1M66A 2TMDA 1I3MA 5ILGA 4CR7A 1F8FA 1KOLA 4AJ2A 3MJCA 4FD3A 3WGGA 1HKUA 3GVIA 4IQ0A 1UAYA 1NNUA 4LN1A 3WYBA 3PJDA 1P77A 4B4UA 3JQ7A 4R1SA 1TVEA 2AG5A 1EK5A 4WPGA 1PL6A 5DCYA 1L1FA 3WIDA 1DFIA 4CMAA 1FF9A 2IYPA 3P7MA 4S3MA 4UVGA 1SNYA 3AM3A 1WP4A 1R12A 3ROPA 1EFKA 2Y99A 2PKQO 1QYXA 2GRAA 3HDYA 5A02A 1U4SA 2CVQA 2Q99A 5A5EA 4AG3A 2A35A 5CDGA 3NX4A 3B70A 3RVDA 4J9UE 4IZIA 2JFHA 3ZGYA 4ZJUA 1Z75A 2P91A 4IJVA 4IGFA 4YTEA 3V1YA 3ZDFA 4DXHA 4ILKA 3OJFA 4RJTA 5U9CA 3NEPX 1E7MA 4BGEA 1GQ2A 1QV6A 3RUIA 1DSSG 4GH5A 1IUKA 1TXGA 1HYGA 2EHDA 4CR8A 1C0KA 5EPOA 2HCTA 4IDEA 4NBVA 1C14A 4HFMA 1FK8A 2C07A 4CLXA 2FOIA 4GVLA 3TOXA 2OUIA 4Z9YA 5JXWA 3T7EA 2CDBA 4D0RA 4BKRA 2QRKA 1XHLA 3ZU2A 5IZCA 4OHUA 4CM4A 3IL2A 3OJ0A 3WJAA 4NZ9A 1Y81A 5EL0A 1XU7A 3T4XA 5EQDA 2W2LA 3H3FA 1PJTA 4RL6A 3PP8A 4RF4A 1O8CA 1KERA 1O94A 4GQAA 2JFFA 2YW9A 1EVIA 3ROMA 3RASA 3H9GA 2GPTA 3M2PA 4CMIA 4KUGA 4NFYA 5T67A 2HMVA 5CDYA 4PLTA 4IJKA 5L3ZA 4E3ZA 4MKRA 3QVTA 3CMMA 3LQFA 4BO1A 3AI1A 3RBZA 2PZKA 3ZNPA 1B0AA 2X6TA 3ICCA 4II2A 2OHXA 1UUFA 1ZJYA 3GOHA 3K2EA 3SJ7A 1ZCJA 2DPHA 4KUEA 3UAGA 4EUFA 2W98A 5HRUA 4M55A 2Y0CA 4WGGA 4B7XA 3O26A 1A4IA 1U5CA 3INGA 3C7CB 5L7YA 4FQ8A 1RM5A 4NK5A 4O1MA 5CG2A 4I8XA 1V35A 1E3WA 1T26A 1EBUA 1OOEA 3PVZA 4FCCA 5L4SA 3QA9A 1SPXA 3ETGA 4NI5A 3C1OA 4D42A 2HO5A 1WW8A 3A4VA 1O89A 2XXJA 4AJHA 1D1TA 4J2HA 5K6AA 1LSSA 3DWFA 3I6IA 3KZVA 3TWOA 1M75A 4C7JA 1I2ZA 1YB1A 1XEAA 2AEJA 3T7CA 1T2EA 3CPSA 4YEDA 1Q7CA 2AG8A 1KEUA 3EK2A 4YT5A 1F8GA 3IQDB 5BT9A 2OZPA 3AFMA 3ETDA 2C82A 3WGTA 1VI2A 3EVNA 1NVGA 2ZTUA 1GEEA 2P5UA 2C5EA 4AJKA 2G82A 3OQ1A 4ZQHA 4FJ1A 2WE8A 1ISIA 2FHSA 2Y1OA 3V8BA 3JD4A 3KHUA 4CL8A 3Q2IA 4YQZA 3AUAA 1MFPA 2YQ5A 1I0ZA 4Y6SA 3F1LA 4CV2A 1MB4A 2A92A 2O3UA 4DBVO 4Y8VA 2WYVA 5JYEA 1R16A 4IGEA 4PLCA 1DAOA 1ZFNA 4A27A 1D4FA 5TIIA 3MJSA 1JVBA 3NTRA 1NFRA 1IZ9A 1IYZA 1Z73A 3CTMA 1NTOA 3H5AA 4NJMA 3DXFA 3I5MA 1DRWA 2B5WA 3FBGA 5G4KA 4UAGA 4ALNA 3EGOA 4CMJA 1P1JA 3BHIA 3HWRA 3WTCA 3JD2A 4IDFA 4YXFA 2IE0A 4RPJA 1ENOA 2HMWA 5TRTA 2A94A 5CP8A 1HDYA 5JAZA 1ML3A 2VUTA 4FR5A 1ZZEA 2QX7A 1GDHA 3PYLA 1R4NA 3OJEA 1GEGA 4KMSA 4LGVA 3QVSA 4XKJA 3TZKA 4CLEA 4WOJA 1AE1A 5L9AA 2FSVA 3C8MA 3TPCA 4BO4A 4ZRMA 4YYZA 4EZBA 4UVHA 4J9VA 3JYNA 2NADA 1Y5RA 2RAFA 3SXPA 5GZ1A 2C2YA 1U9JA 5B4VA 5F3RA 1CJCA 3NT2A 4RF2A 2I3AA 2Q1WA 4RVGA 2X0RA 4OQZA 3WJ7A 1NHGA 4W4TA 4RVSA 3UF0A 4M49A 1DB3A 1RPNA 4NPCA 3W8EA 1GU7A 4PFJA 4KZPA 2Y68A 5TQVA 3ZH2A 2C2XA 4ESOA 1LDYA 3DHNA 1NPDA 3B1KA 3CSDA 5IF3A 3UHAA 3GG9A 4OOFA 2X23A 3AOGA 3JQFA 3PJGA 2RCYA 3IOYA 1KETA 1W8DA 3S1LA 3WLEA 3AI3A 5L4LA 4LK3A 2Q4EA 1ADFA 3O8QA 5DF1A 5JPIA 4HNHA 4WUVA 5DP2A 4XYMA 1VRWA 4G2NA 3WSWA 2PZMA 3OIFA 4PIVA 3VHRA 5BNIA 2PR2A 2VT3A 2NTNA 1E7RA 4XWYA 4EEZA 1UZLA 4BB6A 1CQIA 4PN3A 3HQ4O 1KS9A 4FJ2A 4J91A 3GK3A 4Z3KA 1ZMTA 5DBGA 4WCFC 1WXDA 4P22A 1BMDA 5TLSA 2EWMA 1UP7A 3W4KA 3IKVA 1ISHA 3L77A 1M2WA 3P2OA 4Z9FA 2CFCA 3MWDB 3KEOA 1NFQA 3R3JA 1NQ5A 1UAGA 4K6FA 1X7GA 5BQFA 3AU8A 3LC1O 2VZ0A 1JQBA 1P3DA 4HXYA 5JC8A 1R4MB 4U6SA 2AHRA 3E6AA 2AA3A 1HE2A 1XSEA 4HFRA 4CM8A 3H2SA 4OMUA 4E5NA 4OKIA 1DXYA 3ZN2A 2VWHA 3TN7A 3MWEB 2HQ1A 1M6WA 1LQTA 3GC6A 3L4BA 3NJ4A 2VTDA 1KC3A 1UDCA 5EJ2A 3S2EA 4XRGA 4KTTE 3OIGA 1BVUA 3C7DB 2VT2A 2VNAA 4EITA 2X0NA 2XPCA 2H9IA 3A9WA 1DHTA 5JDIC 5JYDA 3W6ZA 4ZVVA 5THKA 4E33A 2V6BA 3AOEA 1XCBA 1QV7A 2HLPA 1UZNA 2VYNA 3DOCA 4ZQGA 2JD2A 3DBRB 4NFSA 1H9BA 3K31A 4FBGA 4GKBA 2GO1A 3PGJA 5HS4A 1WPQA 4CUZA 1IULA 3HB4X 2W2KB 3RCBA 2X0IA 4DREA 3OFSA 4I5FA 1X15A 3OJLA 3WB9A 5B12A 1H6DA 3JQ8A 1LRKA 1V8BA 3QP9A 5A1TA 2I6TA 4J1QA 5FF9A 1PU2A 5CDSA 4TQGA 3GNQA 1QYVA 2NM0A 2E82A 1IY8A 1U1IA 1BW9A 3OF2A 5IDQA 3AFNA 2ZK7A 2GN4A 2ZB7A 4KWIA 3V1UA 3WMXA 2BGLA 1NHWA 4JK3A 3ZW8A 3BMQB 3FSRA 3D3WB 2J5QA 5MDHA 1NM5A 1ZK3A 3GHYA 1QYCA 2NTJA 1E92A 1YB5A 3NDRA 2P2SA 4XR9A 1JTVA 2FZEA 4FFOA 2J3IA 2DVMA 1UXGA 1GYPA 1T1SA 4K9DA 1UP6A 2YZ7A 5TSDA 2Y66A 3R1IA 4OXNA 1LDMA 1D3AA 3IAHA 4L4SA 4QEDA 2JAPA 2HDHA 5CPFA 1UH5A 2E48A 1EDZA 2DUUA 2G5CA 3U4HA 4MVJP 4XA8A 3O4RA 4RVFA 3NTQA 4BNWA 4BMVA 5FI3A 4NG5A 3L6DA 1X7HA 1N5DA 3RI3A 3DR3A 2EJVA 2C5AA 4DVJA 3WBFA 2Z95A 4D46A 2PZJA 5JFOA 1CRWG 1XQ1A 3ZHXA 3JYOA 3DBLA 4CQMB 1YB4A 3TSCA 1E3SA 4BNZA 3ANLA 4IMRA 4J7UA 4CLRB 4HUJA 1Z7EA 4RPHA 2W2LD 3ZHYA 1Y9AA 3HHPA 4R9RA 2NLOA 4E2YA 4WLUA 2GLXA 3PIDA 4E21A 8ADHA 4H7PA 3ZW9A 5ILOA 3O38A 4BO5A 2EERA 3C1AA 2VNSA 1MFZA 3BIOA 4WCDA 1YOVA 3AY7A 2VHXA 1AUPA 4D0SA 1M6HA 2ILTA 1QP8A 1VSVA 3DL2A 3WICA 3JQGB 1DRUA 3PWZA 4E5MA 2Z1NA 4DRYA 5CFZA 4H3VA 3AY6A 1PJ2A 4IXWA 2VWQA 1X0VA 2QYTA 1I5RA 1LU9A 3K92A 2C0CA 2DLDA 1DIBA 1DLIA 1PGPA 4R3NA 2DBQA 2W90A 1V3TA 4XIYA 4IINA 2GR9A 1GL3A 1VL0A 3GFBA 2YYYA 1Q0HA 1BVRA 3F47A 1P9LA 2EIHA 3SBOA 2CNBA 3LT4A 4DLLA 1ADBA 1PJBA 5ENVA 1H6CA 1NPTO 5H82A 2EGGA 4L73A 4QUKA 4U6QA 5T8KC 2DPGA 3GN2A 1DPGA 4UUNA 2Q3EA 3MJEA 3S55A 1UR5A 4E2ZA 2ZB3A 1TT5A 1DJNA 3D4PA 3PTZA 4R51A 5JBIA 1DLJA 4GMGA 1HDZA 1UXIA 5FFFA 4K6CA 2EW2A 3AUUA 1Y7TA 4L4XA 1ISGA 4QO8A 3I23A 2X5OA 3LT2A 3WLFA 2OMEA 3EMKA 4R1TA 4BO9A 3CH6A 3ZU4A 2GN6A 2PKRA 1T4DA 1SC6A 1ULSA 1ADCA 3FTPA 4CLOB 1VL8A 1Y6JA 2DM6A 4AJPA 1V3VA 2C7VA 1MX3A 2DUWA 2IEBA 2Z5LA 2BFAA 3V2UA 1IHYA 2EP5A 3LVFO 4O59O 4W82A 3AWDA 2G17A 3JYPA 5IFLA 4UVIA 3W6UA 3U5TA 2FWMX 4J4BA 1XU9A 4XIJA 2CMDA 2CVOA 3LLVA 1XGKA 5CDTA 1I36A 2H6EA 1U3WA 5L7WA 2B69A 1B2LA 3DMTA 4DMLA 4AJOA 3JTMA 1Q1NA 4BMNA 4OAQA 1PJQA 4EJ6A 4ZQFA 3KYCB 5KKCA 3RC9A 1FDUA 3GLQA 1OC4A 3F4LA 4L4RA 1QR6A 1N7GA 5AXAA 4ZHSA 3PZRA 5EESA 2PH5A 1DIRA 2W8ZA 3KRTA 4JJFA 3I9LA 1A27A 1B8PA 3JV7A 3KUXA 1OMOA 4MVJA 3E1KA 1I33A 1H6AA 4KOAA 1HLDA 1K5HA 3BMCB 4WEOA 1B3BA 2HRZA 5JY1A 4ZICA 2GUGA 2B4TO 3KETA 1LDBA 4QO7A 3Q11A 4RVUA 4C4OA 1LRLA 3GGGA 2BELA 3KYDB 5DCWA 5T57A 3GQVA 4YAEA 5ICSA 3WR5A 3QWBA 2HU2A 4HADA 1AGNA 4BHTA 3C85A 1GPDG 3P2YA 3Q9NA 2WE7A 1PR9A 4JXKA 1YS4A 4BNTA 4WLOA 4DUPA 3GZ4A 4CV3A 1A5ZA 1PJCA 3PYXA 3DFZA 5ICMA 1EMDA 3GRKA 4YPOA 4J3FA 1A7KA 3FCOA 3G17A 1SBYA 4RPKA 3NKLA 1WWKA 1WDMA 2BF7A 1KVSA 4UEKA 3I83A 2NSDA 2O23A 4NK4A 3DZFA 1C3VA 2EW8A 1I32A 1E3IA 4CM1A 1PZHA 1R66A 4ONEA 1NWHA 5CG1A 5JAQA 4D3DA 3BHMA 2Q50A 3WNVA 4E12A 1DDOA 2E4AA 3L6EA 2EG9A 4PG7A 4R69A 2Q1TA 3FTNA 3VH1A 1RKXA 1YONA 3ASVA 3ASUA 1NXQA 5JDCA 2DC1A 5HM8A 2JJYA 3C3XA 2X9GA 3MJ4A 1HTBA 3KSZO 3MCVA 1LLUA 4BVAA 4UUMA 1O5IA 5HWSA 1J4AA 2PFGA 3U4CA 4AJNA 2PD3A 5KVQA 3ZV4A 3MTJA 4F6CA 9LDTA 3BMNB 4DIBA 2VCYA 4G5HA 4JP3A 5LDHA 3WBBA 3D4OA 2HKIA 2QW8A 4YAGA 5L4NA 1HT0A 5I8WA 1JN0A 1TA4A 3L07A 1LUAA 2O3TA 3TF5A 2CF5A 3B6ZA 3GN1A 1LLQA 2I5PO 3L6OO 4CR6A 2Y1EA 1PQPA 1SOVA 4YT8A 1BHSA 3PHIA 4J1TA 3TQHA 1VKNA 4FJ0A 4Q3CA 5IJZA 4UUOA 4QFCA 3RWBA 1ZVMA 5KJCA 1M67A 3FPLA 1YL5A 3WG9A 3IMFA 1E7YA 1JVSA 1Q7GA 3EZYA 3PJEA 2BFMA 3PYMA 4TRRA 5JCXA 2OORA 2IZZA 3GRPA 4IJUA 1C1XB 4IXTA 3NDIA 4GI2A 3WS7A 1C1DB 3INRA 3IJRA 1RM4A 3W4IA 3GF4A 2GERA 3KM0A 4E4YA 2VYND 3ZV3A 3N58A 7MDHA 3PK0A 4II3A 2PLAA 2PGDA 3ONDA 3GY0A 3GVXA 3VKVA 5TT0A 4PVCA 1MG0A 2ZTVA 3KOUA 1LX6A 2PD4A 4DQVA 2XF8A 1YBVA 1R4MA 4YQYA 2Q49A 2ZCUA 3JQ9A 4BNKA 3F1KA 1GQYA 5DCUA 4IDGA 3K5PA 2IZ1A 3IDSA 4K28A 2PTGA 2R2GA 1YH3A 1XDWA 2BMAA 3KSUA 1I3NA 1MV8A 2QYSA 2GZ2A 2QZ9A 3LC7O 1VJ1A 4O63O 2UYYA 1K6JA 1QXSA 3E82A 1YBAA 2GN9A 2V7PA 2WDZA 4JP2A 2DBVO 1PL7A 5EINA 2B5VA 1I24A 2SCUA 1U8XX 3GPIA 1WMBA 3SLKA 4BO0A 4ZQBA 1YE3A 5IDYA 3WDSA 2OBNA 1DFGA 3KVOA 3I9MA 1ZSNA 4BO8A 4EUEA 1PJ4A 3DBRA 4XDZA 2O3QA 4BL5A 4XGIA 3H9EO 4GPD1 5JO0A 1NVTA 1G0OA 4K26A 3TL2A 2W2KA 1MG5A 4FPXA 2UVDA 2ZB4A 1GAEO 3ZHZA 4ALMA 1R0SA 3KTDA 5KVCA 3IJPA 5AXDA 4PVDA 2GASA 2WD7B 2JD0A 4NQZA 4CM6A 5EIOA 5T64A 5JW6A 3DC2A 3S2GA 2C54A 4Q3AA 1HDCA 3JQBC 3AU9A 4E31A 1K6XA 3RIHA 4XYGA 1SCUA 2FPGA 2PK3A 4EDFA 1EVZA 4W9NC 4Z6KA 3DEYX 5G0TA 3LF2A 3FN4A 3JSAA 3H9UA 5AOVA 3K2BA 3BMQA 1CQJA 3EAGA 4MOWA 1HZJA 3VH4A 1P44A 4PLZA 3D3WA 3MTGA 2HMSA 4HWKA 4BKUA 3JQAB 3UUWA 4JBIA 4PLPA 5ER9A 2RBEA 1DIHA 1X1TA 1JDJA 2O7QA 2Y1FA 3HFSA 2R00C 1VJTA 4IZHA 1ID1A 1ZK1A 3RJ9A 1B8UA 1ORRA 2IRWA 3X2FA 1FXSA 4YRAA 2P4QA 5A4DA 2BFOA 2VQ3A 1XWFA 4JGBA 2J5RA 4OO3A 3VVCA 1HL3A 1BTOA 1P1FA 4IIVA 3VTFA 1Y8QB 3UOGA 3U62A 3QRWA 1EUDA 3PHHA 4H15A 4N5NA 4AVYA 3M1LA 5A5FA 3KLPX 5GZ3A 2X4GA 4B4WA 3VH2A 1EE2A 1JWBB 2AW5A 4BQPA 4LISA 4LCEA 1JWAB 2UUPA 4HX5A 3U4DA 4N18A 4BO6A 3TZ6A 3IP1A 3QWIA 4S1VA 2Q46A 4RPGA 4XYEA 4CQMA 1DRVA 2OGUA 2Z1MA 4OSPA 4X54A 1DFHA 3DTYA 3MEQA 4R41A 4CLRA 3M6IA 1K6IA 1IHXA 1XYGA 4D43A 1P0FA 2NU8A 3VPHA 2WTBA 2VYVA 2OOSA 2Q1UA 3A14A 2P5YA 4R9SA 3K73O 4KDEA 4Z0PA 3EVTA 4B8WA 3K8ZA 3DOOA 1G0NA 2Y1CA 4CMEC 3B1FA 1HZZA 2QIOA 3ETEA 3JQGA 4HBGA 3DBVO 4J0FA 4M8SA 1FDTA 3L9WA 4B8ZA 2VUSA 2BH9A 4GWGA 3VPXA 4YR9A 4RF5A 5JC1A 3PRJA 1PGOA 3T4EA 3RFTA 1FDVA 5GZ6A 4B4OA 4BO3A 4BS9A 1GD1O 1E6UA 5TNXA 1C0PA 1P45A 2J5KA 1HDGO 1R6DA 1YQGA 3FI9A 3VC7A 4PRKA 4R1NA 3QW2A 3CEAA 3D5QA 2ZYAA 1P1HA 4RDIA 5G4LA 3UXYA 3ST7A 3VDQA 1C0LA 4TRNA 1QKIA 1NX6A 5U4QA 2WEKA 4UEJA 3FD8A 4EI2A 4OYRA 4D41A 3RUDA 4BNFA 1ZK0A 4J2OA 1HYHA 3TZQA 4EUHA 1T2DA 3RSHA 4DC1A 1EUCA 3HZZA 1U3VA 4Q3DA 3W8DA 3ZWXA 1U28A 2PY6A 4ZD6A 1HDRA 2NU6A 1UXKA 1PQUA 4QFDA 3IIEA 4J1NA 4MINA 3PHGA 1HE5A 3I9NA 3JD1A 4A26A 3ZWBA 1PS8A 3OMLA 3E5RA 2ZIZA 4ND1A 4E30A 3SJUA 3LLSA 5I9MA 1DC4A 2J6IA 5DDIP 2EGHA 1GADO 2PH3A 4GGOA 5KOIA 3DZGA 4CLOA 2X58A 3VAZA 4DPMA 2O3JA 1I2CA 4A10A 4K1LA 3FNFA 3AUTA 4PLVA 3PFWO 4FS3A 1ZJZA 1OAAA 4IMPA 4JLWA 1B14A 4CM3A 5DP1A 1T4BA 3EHEA 1LI4A 4GAEA 6ADHA 4JBGA 1GYRA 5TX7A 5TS3A 3BXXA 2JHFA 4XJSA 3DAFA 4ZU3A 3RKRA 2XXBA 2H63A 1JU9A 3H9QA 4PGFA 3ZV6A 4LMRA 4MVJF 1B7GO 1MA0A 4MIOA 4WCFB 2OP1A 1B26A 2YQ4A 4XCVA 1E6WA 4ALLA 3EZLA 3KYCA 5C7OO 1YBMA 3GEMA 1UXJA 3L4SO 3WOHA 3JYQA 1ENZA 1PEDA 3ZU5A 2GDZA 3NAQA 3RJ5A 4E5YA 3DZKA 2YHIB 1A7AA 4OXYA 3BMCA 1Y8RB 2PA3A 4L8VA 1ZSYA 3D4NA 5I7EA 3PQEA 4TRJA 4CV0A 1N2SA 3LT0A 5I9NA 4B3JA 1KY5A 3KYDA 4B79A 4D44A 5COAA 3ZWCA 3FWZA 1QLJA 3E48A 1P1RA 2E49A 4CMBA 1VJ0A 2FRDA 2O4UX 3GAFA 4TROA 3S8MA 1CETA 1YVEI 4RGBA 4BNVA 1P31A 2IYOA 1GUYA 3QWFA 3NV9A 3VH3A 4D3SA 5L53A 5HS6A 3BMOA 4WNCA 2O4CA 3WGYA 1CWUA 4Y98A 4J7XA 3WGIA 2EKQA 2VWPA 1LRJA 2PGLA 1ZEJA 3PLNA 4KWHA 1K89A 5EQFA 5G0VA 1U3TA 1Y1PA 5F5LA 5AYVA 1H6BA 4E0BA 2AE2A 1IE3A 4CM5A 2X86A 1XG5A 5TT1A 2O7SA 3ZWWA 5AVOA 4ND3A 1V9LA 3X2EA 3WWZA 4CL3A 3HB5X 2PGJA 3HE3A 4EJMA 1HE3A 3DBHB 1NQOA 3OICA 5FWNA 3SVTA 4YJHB 2HMTA 3JQ7B 4PRLA 5IN4A 3NRCA 3ROKA 1ZNQO 2ZATA 4DPLA 1WDKA 3BHJA 1PWZA 1LA2A 1SAYA 4GX0A 1Z7BA 1B3RA 2GN8A 4WOKA 4L9RA 5JY6A 2CD9A 4HNGA 5IAAA 3ZWNA 3ADPA 4CUKA 2NVUA 3ZZNA 1QRRA 2DT5A 1EEHA 1J0XO 3HDJA 2DBZA 2ZYDA 5KNLA 4A73A 1PJSA 1YXMA 4HV4A 2TMGA 3GEDA 1Q0LA 3K96A 1EE9A 2O3RA 4U0KA 4NMHA 4YJFB 3H5RA 4EW6A 4I1IA 4F3YA 1HF3A 1TB4A 4RO0A 2X8LA 4IQ8A 2Y93A 4O5OA 2H5LA 1BG6A 3MJVA 1PTJA 1NP3A 4CJXA 2NU7A 2DU8A 2VHYA 4Z0TA 3TFOA 2JKVA 5LDGA 3U3XA 3W1VA 5HTOA 4AJLA 4TMFA 3RU9A 2NVWA 3ENKA 5BSHA 2CDAA 2F1KA 5DULA 3GHHA 2RH8A 3VDRA 4QSMA 4DBZA 1GR0A 1IZ0A 3WGOA 3UCFA 5A9SB 1WNTA 4PG8A 1C1XA 1C1DA 5G0SA 1PGJA 3GGPA 1B8VA 4NU5A 1BXZA 5I7FA 5K0ZA 1W0CA 3WX0A 1WVGA 4Z3DA 1BWSA 5LC1A 3PQFA 1DEHA 4CODB 4YBZA 1BXGB 2EEZA 2Y0EA 1H0KA 4U7WA 5IZCC 1EBFA 3WFJA 1GQQA 4GGPA 4I08A 1X1EA 1F12A 1LSJA 3VOSA 5FEUA 5TC4A 4KDFA 5HBRA 2VTEA 3ZWOA 1ZBQA 4XJTA 4NU6A 4E2WA 4L74A 1NYTA 2BD0A 3OA2A 3PZBA 3COSA 3DTTA 4J43A 4JN6B 1ISMA 2YV3A 4U5QA 2A9FA 4J7CA 4YRDA 3RAJA 1ISJA 3UCEA 4P8RA 4URFA 2NTVA 4PLHA 3ULKA 1NVMB 2WYUA 3DAGA 1MC4A 1I3KA 4OSOA 1YDEA 4FOSA 4BKQA 1I8TA 2RHRA 2EKLA 2Y1DA 2CY0A 1T2CA 3ZWVA 2GD1O 3U0BA 4F6LA 3U9LA 2YFHA 3DFUA 3LT1A 4B3IA 4JCOA 3RROA 4TRMA 1SO8A 1GFSA 2CUKA 3H4VA 4NBTA 3WGHA 4KTVE 1R37A 4PG5A 1KVRA 3ANNA 4CQLB 5DT9A 1HWYA 1MLDA 4IIUA 3Q0EA 4KQWA 1H93A 2BRUA 1SZJG 3LK7A 1BDMA 1HYEA 3JQCA 3GDGA 4W7HA 3HJAA 4XQGA 3GFGA 1LLCA 2WD7A 4M86A 5DNAA 3EW7A 3RU7A 2BFPA 5K6AC 2NQ8A 4L0QA 1P1IA 5JCJA 4MKZA 5A3VA 2FR1A 1O95A 3DHEA 4XQ9A 1RWBA 4BGIA 4BNMA 1H2HA 1GZ3A 1K3TA 1ZO8A 4BV9A 4OH1A 4Q9NA 3IP3A 1LDGA 1ONPA 3OETA 5CEJA 4FFMA 1I30A 1UDAA 1KVQA 4CQMD 5AXBA 3WQQA 1E77A 3JD0A 1ZK2A 2WSBA 3ZNQA 1Y5MA 4XGKA 4D79A 3WFIA 4ND5A 3JQAA 4LSMA 4OM8A 1VC2A 1QLHA 2D59A 3ZWPA 1O0SA 3OQ6A 5TJHA 3SC6A 5JLAA 1OBFO 1PS0A 1DC3A 4J6FA 4DA9A 3NGLA 1OFGA 3L0DA 4BNLA 5KTKA 4A2CA 1R4NB 4ID9A 5A9RA 1Y8QA 3AUSA 2PV7A 1DIAA 3PPIA 3CKYA 2UV8A 2O2SA 3JD3A 1PGQA 4BV8A 5I7VA 3P19A 3MOGA 3FWNA 5BNFA 3Q6IA 2RH4A 1ENYA 1RYEA 3H2ZA 5L95A 4TSKA 1E1NA 2I66A 4YJGB 4DGSA 3G49A 5FYDA 4IDDA 2Y05A 2JD1A 4CM9A 5F21A 3HDQA 3TRIA 3JQDA 1NQAO 4Z0HO 2IDZA 3I9KA 3WQSB 3WXBA 4DIOA 1UZMA 4FFPA 4E5PA 1E1LA 1D8AA 1U2DA 5EMHA 1U2GA 3AI2A 1V6AA 4GX5A 2FN7A 2OBYA 3GMDA 3HFGA 4WASA 4OKNA 4Y9DA 1PZFA 5GMOA 3A1NA 3DMYA 4B7UA 2E6UX 3OP4A 2GYYA 1VL6A 1ZK4A 3ADOA 3GDFA 1V3UA 2JCXA 3JQEA 3D5TA 1HXHA 1ZSVA 2B4QA 2A4KA 3PJFA 1ULUA 1W4ZA 4RPLA 1LQUA 5G0UA 1KIFA 3GUYA 4R5HA 4WK6A 2AEMA 5BSGA 5G2OA 4NBRA 3D7LA 2I67A 4KP7A 1ZUD1 1YDWA 4HKTA 5B37A 1JW9B 2NACA 5TGDA 1XR3A 2C29D 3AM5A 5DN9A 1ISFA 3OECA 5ITVA 2P9EA 4A0SA 3E8XA 4M89A 4YCAA 3BAZA 3GPDG 1HDXA 4RDHA 1EVYA 1R0LA 2VRCA 3QV1A 4EGFA 3G3EA 4XX0A 3ON5A 4LSWA 4UREA 5CDUA 3INTA 4XDYA 5AQ1A 4FB5A 3KEQA 1LSOA 4ND4A 3TDKA 3FR7A 2BHLA 4BNHA 2GZ1A 3O03A 4INAA 3EC7A 1LNQA 1LLDA 3Q3CA 4A7PA 4BNYA 1AN9A 4YAKA 1WZEA 3SC4A 3OIDA 3I6QA 4EEXA 3F5SA 1W73A 1RM0A 1XA0A 1O9BA 2PWZA 2B37A 4DPKA 3DOJA 2DTXA 4F45A 1BRMA 2JCYA 3QIVA 2B36A 2Q2VA 3SLGA 4P4LA 3LZ6A 2FR8A 1CERA 3QY9A 1SOWA 5F1KA 4FSHA 5A9TA 2Q4BA 4Z9XA 5DOZA 4NBUA 4WJZA 2VWGA 3UKOA 4EJ0A 1N7HA 1PZGA 5JMPA 2PD6A 1GY8A 1HE4A 1Z82A 2D5AA 3L4BC 2G76A 2AQHA 2IXBA 4N5LA 4OOEA 4U8GA 1PX0A 1YJ8A 3F46A 3PXXA 1E3JA 1DBVO 3WNQA 2QG4A 4L76A 3NT5A 5ITWA 4WCFA 2D3TA 3PHJA 4M1QA 5COBA 2CSUA 4XB2A 4AICA 1F17A 3NYWA 5A05A 3GT0A 2D4AA 4HP8A 2HK9A 3LF1A 3NDJA 1XELA 5B4TA 3AOEC 2YDXA 1FDSA 1X7DA 2HAEA 2VRBA 2OFPA 3HN7A 4ITUA 2AQ8A 2P68A 2YHIA 3H9JA 5J23A 1GZ4A 4RORA 1L7DA 2FPIA 1Y8RA 2JFGA 3GA0A 4Y6RA 3DAPA 4U0JA 4BUCA 3TZCA 1N8KA 1I3LA 4DYDA 4P4NA 2WYWA 4DQXA 3LU1A 4UUPA 1YO6A 2LDXA 2UAGA 4E5KA 5THQA 1YQDA 5TF4A 3F4BA 4MP3A 3GDOA 4J4TA 4YDRA 5DZSA 3PFFA 3GH3A 4W6ZA 5JAIA 1N9GB 3E5MA 1CYDA 3ITKA 3C7AA 1Z45A 1KEPA 5JDIA 1HDOA 2V6FA 4JNKA 2WWRA 2GZ3A 1E6EA 2GSDA 3EDMA 1NQTA 4O0LA 1MUUA 1ZXLA 4CMGA 4E13A 1R15A 3Q9UA 4HFJA 1YL7A 1EK6A 1X14A 3DQPA 5CEFA 5CHEA 1FMCA 4I5EA 3STHA 1P0CA 2Y1GA 3TJRA 4XD2A 5U1PA 3SEFA 5KJ1A 4CPDA 1R0KA 3F3SA 2AXQA 1VLLA 2CF6A 4GLLA 9LDBA 1HETA 4B7CA 4DTIA 5C7IO 4CUJA 3DBHA 1DO8A 1CEQA 3QJ5A 2V65A 3UGKA 2LDBA 4YJHA 1SB8A 4DWVA 4ND2A 3ABIA 1LDNA 5JE8A 1PS9A 1VE9A 1IB6A 1K2WA 4BOYA 2VHZA 3DBLB 4DYVA 4ALIA 1PZEA 4MVJE 2X9NA 3DONA 1A9ZA 2C7GA 3GR6A 5IXYA 3LSYA 2BGMA 4B3HA 1NAIA 5IDWA 3U4IA 5GY7A 2C20A 1F06A 5I7SA 4LRTB 2DAPA 2X1HA 1YOVB 1JA9A 1B15A 5JO9A 1S6YA 3AM4A 3GZNB 2GGSA 4WLFA 3AW9A 4E2XA 1PQWA 4CMCA 3CZRA 5C5IA 5A04A 3RC7A 5H81A 4YJFA 3I52A 1MP0A 3R6DA 4IDCA 1BXKA 2X5KO 3IKTA 2QRLA 3QHAA 1H94A 3KXDA 3FF4A 3OJOA 1CDOA 5EN4A 3ICPA 1NAHA 2ZTLA 1N1EA 4YT4A 2DBRA 2PKQP 2HK7A 4BKOA 1XLTA 1E3LA 4P4GA 5CEEA 4R4JA 2GNAA 3D0OA 4OL9A 1U3UA 2V6GA 4CMKA 2FSSA 1Q0QA 4FDAA 1MC5A 4ALJA 4BNNA 4I5GA 4DQUA 3R3SA 5A9SA 3BZUA 3I4FA 1F14A 3U49A 1VM6A 1A4UA 2CVZA 2AQIA 1IOLA 4M87A 2GF2A 1JLLA 1W6UA 3WMWA 3CZMA 3GVPA 1TT5B 4AJEA 5A03A 2ET6A 4O6VA 3I4CA 3W4JA 1BXGA 2WD8A 6LDHA 1H5QA 5MGBA 3Q2KA 1NPYA 1QYWA 4GBJA 5IN5A 1OZAA 3HUDA 3RUCA 4I9UA 4YRBA 4YA6A 4WLNA 3UCXA 1NASA 3PGXA 1J49A 4L75A 5L45A 1A72A 4BNGA 1PL8A 5JSFA 2J8ZA 3OEYA 3RBXA 2HK8A 3BTVA 1SMKA 3MJTA 5JCJD 1KY4A 1RM3A 1YRLA 2ZQZA 1ARZA 2FY8A 3QSGA 1ONNA 3D3EA 3JCZA 5TJ9A 4KUHA 3RFXA 1MXFA 1Z74A 2IEDA 2EXXA 4AJ4A 5KJ6A 4B4VA 3BTSA 4TVOA 4Q3EA 3CIFA 4ZGWA 2EKPA 1FJHA 4D7AA 1QMGA 3FNEA 2FR0A 3PWKA 1TLTA 3ZWYA 3ORFA 1EZ4A 2NVBA 4UEOA 4DC0A 5JS6A 3JQAD 4OQYA 4BKPA 4NIMA 3UW3A 4CQLA 4LW8A 1CIVA 2P9CA 4IDBA 5CAEA 3PWSA 4GL4A 2JAHA 5T8KA 4J1SA 4R5MA 4GLOA 4OXKA 4DL9A 2D5CA 1CF2O 1I10A 2G1UA 1U8FO 3FNHA 4FC6A 1KEWA 1GUFA 3PDUA 5IG2A 4PZCA 1BDBA 3RUHA 3VZSA 1YQXA 3ENNA 3DMTC 1GUZA 2YHUA 2HJSA 2NUAA 3WGZA 3PEFA 4HFNA 1U7HA 5KWEA 2ZJ1A 1K0UA 2DKNA 3I1JA 2ZYGA 1LXCA 5KKAA 4NBWA 5H83A 3WIEA 2OL4A 2I9PA 4JIGA 3UN1A 4CM9D 5L40A 4PLYA 4QT0A 3VZQA 4MVJM 4RV9A 4N5MA 1ZKMA 1OI7A 5IXSA 2X0JA 4UVDA 4MIEA 1QG6A 3GVHA 2I76A 3HSKA 1HRDA 3WTBA 5C37A 2CDCA 5JMWA 1KEVA 4N7RA 4JROA 4LRSB 4MVJD 4RVHA 1KC1A 4NJOA 1A9YA 2RHCA 1IPFA 1C0IA 4R16A 4RQUA 3QVOA 3S2IA 3GNSA 2I65A 2OXIA 3E9NA 1KVUA 2JL1A 2B83A 1U4OA 1YKFA 4PCVA 1I01A 4CMHA 3RKUA 3RUEA 4TWRA 4PZEA 2IXAA 1FDWA 2BI7A 2YV1A 2DFVA 1YL6A 3E03A 4FFRA 2O50A 3MOIA 4NDNE 4YJGA 3VPSA 1L7EA 4MO2A 3D64A 3UVEA 5A06A 1EQUA 1GCUA 2F00A 5L7TA 4D45A 2RIRA 5FI5A 2VRCD 5JNLA 4HY3A 2R6JA 2V6MA 2Q2QA 5KVSA 1O6ZA 5L51A 2X5JO 3E18A 1X0XA 4BGUA 5JDCC 3WGQA 4DLAA 4RF3A 4IBOA 1JAXA 5K9ZA 4RZHA 1AHIA 1UXHA 3KB6A 3PQDA 2O3SA 1IPEA 3DO5A 4J0EA 3CINA 4DIFA 4FW8A 3VPGA 4G81A 1LEHA 4MKXA 4MJLA 3I3OA 1WAMA 3JYLA 4XYBA 5BSEA 4YWJA 4QECA 3K6JA 3OHSX 3V1TC 4A5OA 4FC7A 3OQBA 3NTOA 4R68A 5C7LO 4IS3A 1ZXBA 2YFQA 1E0DA 3S2FA 4IS2A 2H1SA 2XAAA 4BMSA 3LC2O 3QQPA 2QRJA 3VZPA 4BB5A 1PJ3A 2O2YA 1H9AA 1D1SA 4GX2A 2HJRA 4FOOA 5G0WA 2BKAA 3GVCA 3OM9A 3PIIA 2Q1SA 3G1UA 3LYLA 3WQRA 4BO2A 1PR3A 1Q2XA 3CUKA 1HSZA 2C59A 1E5QA 3RUAA 3TL3A 5KVVA 1WMAA 2VUUA 4FGWA 1OC2A 3EUWA 4WE3A 1DHRA 3RQSA 1ENPA 1VPDA 4TKLA 4ZQEA 4JJIA 4PLWA 1HSOA 1YWGO 3LDHA 2NQTA 3OEWA 3DZIA 1ZH8A 2HMUA 4IM7A 3SX2A 1JAYA 1AXEA 1G6KA 1NR7A 4MP8A 5BSFA 3DHYA 1LC0A 3JQ9C 3D1LA 4UULA 4AJ1A 1X13A 3KBOA 4AJIA 2YDYA 3BMNA 1AXGA 2W4QA 4NHEA 3RD5A 5HA5A 5BR7A 2UDPA 3KYBA 2DFDA 1EQ2A 4JJGA 3A06A 1U5AA 3GNTA 3FPCA 3ZI0A 4EYEA 3NUGA 3DZBA 1E1MA 4MVJG 3NT4A 4YT2A 2DQ4A 1GV0A 1LTHR 1MXHA 3CE6A 5KJFA 4WEQA 7ADHA 2B0JA 1NWCA 3ONFA 1P1KA 3ZU3A 1ZIDA 3C24A 5AXCA 2D2IA 1B16A 1XIVA 2OP0A 5T6BA 3DB2A 4CM4B 1E7WA 5F1PA 3BYZA 4XRRA 5ENDA 2ZB8A 2ZTMA 1Z6ZA 2J3JA 3MZ0A 1MGOA 2ZKLA 4PLGA 4RVDA 4YJDA 4DMMA 4E6PA 1GYQA 2P4HX 3CXRA 4WECA 2BI8A 2EF1A 4Q3NA 3M1AA 3U09A 4GSKA 4RQTA 1M76A 3V5NA 1ADGA 3ZWAA 1NR1A 2G0TA 3K9QO 4OJNA 1T25A 1E1KA 4CMIB 1DC6A 3JQ6A 2YV2A 4MVJH 1N9GA 3Q1LA 3IUSA 4NNJA 1Y9EA 1T2AA 4IY1A 3H3JA 3WSVA 3RC2A 2Q2WA 1DJQA 4ROSA 1H2BA 1EVJA 4RCVA 1JKJA 4RLSA 3VZRA 8LDHA 3BTOA 3G79A 4UVEA 2VHVA 5C3MA 2VOJA 4JX8A 3L9XA 2YUTA 2NV6A 3PI7A 3DZJA 5IZ4A 3VKUA 1J5PA 4MP6A 5DBFA 2VOEA 1E3WB 4PG4A 3TOZA 4XQCA 3PDJA 3KLMX 4ZA2A 3C1TA 1DAPA 3O9ZA 1NFFA 1E3EA 3OSUA 3ITDA 4TVBA 4FFLA 1KBZA 2JHGA 1JKFA 4BNJA 4IPTA 3JQBA 4AL4A 2FZWA 3H7AA 1TEHA 3BTUA 1UDBA 2QZZA 3OH8A 4Y67A 2X9VA 1NBOA 2E37A 1E7SA 5I9LA 2ZCVA 4W9NA 1TI7A 1ZMOA 4Y6PA 4WLEA 3IS3A 2QQ5A 5A3JA 2D8AA 2Y0DA 5F1OA 1A71A 4IQGA 1VSUA 3EY4A 2FMUA 3GAZA 4MIYA 5CPBA 2VN8A 3GZNA 1JKIA 3AY3A 4H16A 2UUOA 4GVXA 3UFXA 3HG7A 3RC1A 3DDNA 4QX6A 3RFVA 2R00A 4MVJI 4RZIA 4IJWA 3P5SA 2IODA 5ADHA 1SB9A 3TZHA 3HNPA 2EP7A 4XQEA 3QE3A 3G0OA 4WNIA 4ZN6A 1E7QA 4RLHA 1DOHA 4BO7A 2AEFA 1GPJA 4NJMB 4WLVA 4PG6A 3N74A 2NU9A 4W99A 5G4KB 4WKGA 5IDXA 4TZKA 4CV1A 5BNTA 2QHXA 2VYVD 1PIWA 4OGWA 1E5LA 3WYEA 3IUPA 3QLJA 1WZIA 3HN2A 1T2FA 5JAMA 2HRBA 4QTZA 4N54A 1RYDA 2CZCA 3FNGA 2I99A 4C7KA 4GKVA 3NJ8A 4XEHA 4PLFA 3PLRA 4XGNA 2VZ8A 5I8ZA 4BGVA 3AK4A 2X22A 1XQ6A 3GMSA 1BSVA 4I5DA 4R3WA 4J4HA 4GWKA 3TFQA 4YB8A 5ES3A 1P74A 3OA0A 4AFNA 1BGVA 4ALKA 3F6YA 2O48X 3H5NA 3K30A 3VPFA 4CMEA 3QWHA 2FP4A 3GG2A 3QVWA 1G1AA 3E9MA 4QXMA 5KIAA 2D0IA 1PGNA 3HADA 3ZWMA 3FBTA 4FN4A 1DC5A 2PNFA 2BGKA 3EYWA 1AHHA 3F9IA 1Q7BA 4JBHA 1HLPA 1N1GA 2VHWA 1EUZA 3H65A 3E9QA 2J3KA 2AQKA 3VVBA 1J6UA 4YAJA 3O8QB 3I9OA 1YJQA 4LVCA 3V2HA 4BIIA 1T24A 3HDHA 3B1JA 5F5NA 1KYQA 1F0YA 4J16A 2HSDA 3H6KA 4TKMA 1QSGA 4M54A 3UH1A 3TNLA 1VKOA 3OBBA 3JQFC 4CLDA 1D7OA 5B1YA 4BNUA 2IZ0A 2WJPA 3ZCXA 3F5QA 4XR4A 2XOXA 4I9NA 3G1TA 4D3FA 3NGXA 3H8VA 1ZW1A 2JCVA 4G65A 4MPDA 1SEPA 4JQCA 4AJJA 2VZ9A 3WYCA 1TT7A 3KV3O 3WWYA 3VTZA 4W7IA 4IDAA 3V2GA 3BMOB 2AMFA 2NNLD 4CM8B 3ZV5A 1YGYA 5KCZA 4GMFA 1GZ6A 2Q45A 1EDOA 3DZHA 4XYLA 4DLBA 3FHLA 4R01A 2HUNA 4PZDA 4QQRA 3KO8A 4A03A 1P33A 3QVXA 1GV1A 2BLLA 1HEUA
chains in the Genus database with same CATH superfamily
1BEUB 4YAIA 2JI8A 5FA6A 3IRUA 3GUCA 4OJMX 5T4EA 4GWLA 4X66B 3FOBA 2MOKA 2O54A 2CLFB 2ZEJA 1Q0ZA 3MGCA 4LMPA 4NCBA 4LYEA 2AE1A 2PRYA 2RHLA 4XZ3A 4I9HA 4UU8A 1FVOA 1YS6A 2RGAA 3CMCO 2BP7B 2OM6A 4H17A 2Y67A 5AM5A 5AW3A 1X87A 4E32A 1FP1D 3BA1A 2GARA 2NVUB 4GMKA 1KA9H 3RBVA 2B3DA 2P9TA 3IELA 4PEVA 1LBEA 5AJUA 1WDLA 1SHJA 2YFKA 1U7TA 3MSCA 4KGXA 4LVUA 4ZRNA 3NHAA 2GO7A 1PCXA 3KWLA 1RYZA 3I5AA 3HYSA 4OUDA 2QVCA 5K0EA 3CC8A 3PX7A 1M2VA 4QKQA 3U7GA 4XB1A 3ADDA 4IUYA 4Q4DA 3ENZA 4NH4A 4Q15A 3OLCX 1WLYA 1N2CB 2ZSAA 1SM4A 1YS1X 4J90A 4M83A 4YVFA 5HIIA 4E22A 1BW9B 3G85A 1ZM9A 2YJTD 4HXGA 1LDEA 5TEVA 5IARA 4CTNA 3HKEB 1E32A 3GRVA 4Q4LA 3UMRA 4Z7NB 1FS6A 1UJNA 1G64A 3RB8A 2IUSA 4ZALA 4E1BA 4KRYA 2YJZA 2HH9A 3BRWD 2QN9A 1WKCA 3A28A 3ENWA 4WD3A 4G0PA 5F12A 1NI5A 3DG9A 1N78A 1GKIA 3VKFA 4GXTA 1TD9A 1Q3TA 2E18A 4NFHA 4FMCB 3AXSA 3RLIA 2EJWA 3OOHA 1G7SA 3OC0A 3PC4A 1I4WA 4ON9A 1RRPA 3RUFA 4DT1A 1XZQA 4OFBA 4L85A 1OY1A 5LZ9A 1LJ8A 3GPCA 4B32A 1KJJA 3BRQA 3ADCA 4LZAA 4HDSB 3OZCA 3MMXA 2GCOB 9GPBA 5D3QA 5I7RA 3DLIA 1Q3KA 3FJOA 1SBCA 4QFMA 1XO1A 2YY7A 2CXUA 4LBYA 2PJUA 1I3MA 2JI6A 2TMDA 4A8JB 1YUBA 4LJYA 4B3DA 3MJCA 5F4ZA 2I1VB 4FD3A 3WGGA 3GVIA 3WNCA 4IQ0A 4PCLA 1NNUA 3QF7A 3PJDA 2A1UB 3JZMA 4AMYA 3WKCA 2JLWA 4HDKA 1X6VA 4IQ4A 4B4UA 5E8RA 3CJRA 1KFEB 3E0XA 4LJ7A 3ZYCA 3E2MA 1DKRA 3JQ7A 3X1JA 2BMEA 1KWGA 4RCZA 4LHZA 3SSAA 1KZ9A 5ECWA 1DFIA 1PT7A 2XMQA 1ZESA 1N75A 2YY6A 3EAFA 3IV7A 5LBIA 1FF9A 2CNDA 3O3MB 2V0GA 1SNYA 3PNBA 4ARSA 1KK1A 3ROPA 1QQTA 2Y99A 5HOQA 3S81A 2VCEA 1CZUA 2GRAA 3THYA 1SXJA 3OZVA 3QV2A 2H1FA 2Q99A 3LZCA 5A5EA 3SC2B 3AF6A 5CDGA 2XLBA 2PZEA 3RVDA 3I73A 4EATA 2I22A 2MMCA 5BV8A 4YTEA 4IGFA 4TL9A 1KAGA 1OKKA 4QGGA 3CWQA 5TVGA 5C5CA 1JILA 2MDTA 1JLSA 2ZW9A 4Q6WA 4RIFA 4BAGA 4MW5A 2R7KA 5U9CA 5BYKA 4ARIA 3ED5A 2VQEB 1M1NB 3WZ2A 4EEKA 4YUAA 2EHDA 4CR8A 1U0BB 1C0KA 4WN9B 2OXCA 5EPOA 2EQAA 4P0PB 1J33A 4HFMA 2YINC 1PFWA 4H3SA 5CT4A 3EZ6A 1FK8A 4CLXA 1SVMA 3ZG6A 2OUIA 5HUHA 3L0IB 4MUNA 2DUNA 4ZZ3A 1EJ6A 1QAOA 3ZV7A 4P7KA 4W5JA 5IZCA 2B6NA 1GL7A 3NO4A 5EHIA 3HCDA 3IL2A 3HEMA 2VPIA 1E2FA 3E35A 3BFVA 5LBTA 3TRHA 2G5PA 4GZ6A 2QVYX 3O8OA 4JU9A 1MPXA 1D2RA 1NVWQ 2CNLA 4OQMA 3WJAA 5K03A 2M2IA 4G5XA 3T4XA 4FNOA 4UTPA 3KDPA 3PDHA 3PP8A 4QPCA 4RL6A 5TARA 3ZGZA 1EPUA 2BRUC 2X6RA 3BHNA 1ZWLA 4GQAA 2PX0A 5DX8A 1VE5A 2ATXA 4AMBA 6AT1A 2HMAA 1RFLA 4R9VA 1G20B 1XZCA 1IXRC 3RASA 3GFPA 4KAXA 4AO6A 5ICFA 1DCKA 1DARA 2RBKA 2GPTA 4ZOCA 1DWUA 1WRBA 1IQUA 3R5HA 1FTYA 2WJYA 3PXCX 1HQDA 4CMIA 2VH1A 4NFYA 3AETB 4KE6A 1XZAA 4GOOD 5T67A 4OATA 4IF4A 1XD2B 1KDPA 4ODIA 4E3ZA 1ZRNA 1BVYF 5DNYB 1A8HA 1UMDA 1CRZA 3QVTA 3ZZMA 3ZGLA 2P2YA 1AUQA 5EFZA 5JZOA 2PZKA 2SECE 4HEQA 1B0AA 1IRIA 1O1YA 1U9ZA 3ICCA 3TQOA 3P71T 3K2EA 1ZCJA 2DPHA 3K16A 4KUEA 3UAGA 2W98A 1GRQA 5HRUA 2QL6A 4M55A 2AL7A 3HYCA 1VGRA 3U4GA 2IHTA 2AIRA 4LJ5A 1ND6A 2FX5A 4L22A 1QU3A 3B1WA 3II6X 2WWWA 4KZKA 4QL3A 4FQ8A 3W1EA 2MSNA 3LUJA 5CG2A 1V35A 1AK9A 2WTAA 5AK4A 1T26A 3KOMA 3O83A 3PVZA 4YNBA 2ZSDA 4DR3B 4FCCA 1WF3A 3TRDA 2XNHA 1JR6A 1BHO1 1HY3A 4UUQA 3SN6A 4MW2A 2HO5A 1WW8A 2ZWVA 4RA6A 5J23A 2ZBGA 4N8SA 4AJHA 2RGDA 1D1TA 4A16A 1EA5A 2QNIA 1M34B 1LSSA 1KH2A 1JSZA 2EDAA 3PTLA 2PHZA 4F38A 4M9XA 4GFDA 1PT6A 2FUNB 1FXWF 1UODA 2R86A 3IKLA 4P7FA 4BE9A 1P5ZB 1Q7CA 1U04A 2JIBA 5H59A 1KEUA 3EK2A 5HGJA 1P0QA 2B4AA 1F8GA 1KI6A 1OF1A 1VYUA 3LGAA 5C3UA 3VNUA 3M82A 1GCAA 3MELA 4J0HA 4ZAWA 4U2BA 2C82A 3ZEIA 3B6JA 1K92A 2GEDA 5LYJA 4Z1MD 1BHQ1 5P8WA 3WK4A 4AF8A 3MWGA 4AJKA 2Y71A 2ZU0C 4YJKA 2WE8A 1EP1B 3IPLA 1KI4A 1ZPDA 5CA1B 3HB1A 3OM8A 3B12A 3FAKA 4ESVA 3V6MA 4EHBA 3W5CA 1GU1A 2CXHA 2QPLA 2AHOA 5BQPA 3RS4A 2OC9A 2H2AA 3P97A 3KHUA 1GVNB 4UU7A 4YFVA 4CL8A 1RRCA 3AUAA 1MFPA 3B38A 2G9UA 3F1LA 3KL2A 3PKJA 5JAHA 4Q9LA 4DBVO 2WFAA 2WVHA 2FFAA 4AP6A 1Y1TA 1U2GC 1TTHA 4RD2A 1FYDA 1JVBA 1IZ9A 2WNIA 3K72B 3Q3HA 3W2FA 2IY8A 3F73A 1IYZA 3CTMA 1EZ1A 1NTOA 1DG3A 1IBCA 1U8AA 3LYUA 3I5MA 1DRWA 4IYRA 3T5BA 5G4KA 4QICA 2PKEA 5AKEA 1P1JA 3B3GA 3BHIA 5B3JC 1KI2A 1QIIA 2AKEA 5LQKA 1L2TA 1PQ4A 1JEOA 2IE0A 2WVJA 4RPJA 3BK7A 4LGCA 4MQLA 4OA8A 4UPVA 4ARZA 4C0JA 5TRTA 2A94A 1SHUX 1XRQA 2X0DA 2IX9A 5B3LA 4FR5A 1W44A 1NBIA 1GQOA 1ZZEA 2AC2A 1GNPA 2FGKA 2QX7A 1B1CA 4CETA 5FV4A 4KMSA 4KKXB 3ZTYA 3W5AA 4RWZA 5FPPA 5L9AA 4U2EA 3BWVA 1B0ZA 3C7TA 1VQ1A 3FH0A 4RJ2A 3TPCA 3MVEA 5BURA 3GP5A 4JJ8A 1HT1E 4LJ9A 4D56A 2ZUDA 2OHIA 3G5LA 2NADA 4RA9B 3RHZA 4XH9B 1HL7A 1U9JA 3C2QA 1GPWB 2HV8A 1CJCA 4IKPA 5CTJA 1CUIA 3LQ4A 1YI1A 4JL8A 3Q8KA 1VMIA 5CD1A 2JGDB 4W4TA 4RVSA 2EJTA 2XB6A 4FT4A 1HYBA 1QDUA 2YUIA 4M49A 3VZDA 4ENUA 3FDFA 1KZ6A 4YYEA 1LW7A 2E87A 1CQWA 2Z2JA 1GU7A 2ATEA 3DEIA 1T8RA 1TECE 2NSJA 1VZ2A 3E8SA 3I2JA 5B1DA 3WIVA 2C2XA 2GK4A 3K15A 1LDYA 1OHHD 2YBDA 4PC3A 1NPDA 4HRXA 4U9IS 4AUEA 1WJGA 5CFMA 2GMWA 2XWSA 4E88A 3CYFA 1BU8A 4RTRA 4OXXA 3GG9A 2D06A 1Y98A 2X23A 1N2JA 1RLUA 2WSMA 1SRQA 1DBIA 3PJGA 3R9IA 1FYWA 3UENA 1YZKA 3DZ8A 1Z6AA 3JRWA 3UXMA 3WLEA 1Y6FA 5L4LA 4LK3A 1UBLS 3TLEA 4BMPB 5BPHA 2XV1A 3RT9A 1GTG1 3S44A 1P6UA 3AHJA 821PA 4G2NA 4PHCA 3PQ5A 2Y1XA 3CGWA 1MH1A 4PIVA 3QY0A 4ROTA 4EEZA 4M8LA 3W04A 1EWYA 4Q0MA 4BB6A 2GUWA 1HA3A 4TM7A 3SY8A 4FT2A 3VOAA 2WF5A 4X9XA 5LQDA 1C4OA 3HQ4O 5JJ5A 4J91A 2H08A 4LHXA 4Z3KA 3ZD8A 1SN7A 3W06A 2IP2A 1F2DA 1J0CA 2BMJA 4AYXA 2QG6A 3LRPA 1K97A 3IV9A 2K2WA 5AW6A 1ST3A 2C58A 3N2ZB 5A2GA 1CVIA 1F9EA 2DMRA 1NI4A 4Z9FA 4DYHA 2CFCA 1Y4UA 3QNUA 1KPGA 3R3JA 3IKMB 1NQ5A 4UKDA 4EIWA 1X7GA 1JDZA 1MIOB 1MVNA 1OXMA 1B73A 2OCLA 3AU8A 1JEJA 3LC1O 3MOSA 1P3DA 2WABA 5JC8A 1R4MB 4LUCA 3WE7A 3GCXA 3CUYA 3OUTA 1ZP6A 3REOA 3OZAA 4XVQA 4QOEA 5IAEA 4H4EA 2D1SA 1W5SA 5ERXA 2O8CB 3WKEA 1Z08A 4EKEA 4TLMB 2GAOA 2H1OA 1LQTA 2HA0A 3I9V6 3L4BA 3C6BA 5HILA 1D2AA 1YZQA 3LBHA 4HLNA 1QCZA 5EJ2A 1IN8A 4GBMA 3S2EA 5LA6F 5BUSA 2Z5FA 5I8PA 5HZKA 3T9AA 4NWIA 4EG0A 1JEQA 4IFBA 5C53B 3DE7X 3RVJA 2A8YA 2Z6AA 1QDLB 2SCUB 3W6ZA 4GBGA 2FFJA 1QP4A 4UU1A 1B74A 1XDZA 1LNSA 3G8AA 4MYDA 3E3OA 5BWLA 3HDVA 2V6BA 6ABPA 4HDNB 1UZNA 2VYNA 1F8UA 3BFKA 3SVZA 4AXXA 1ORTA 4ZVSA 2JD2A 4NFSA 5TS2A 1YAJA 5JHHB 3PJRA 1I7DA 2WJJA 2VFAA 1H9BA 4N0QA 1FUIA 1E0KA 1H3NA 1KK2A 1U1CA 3OO1A 3PGJA 4L7VA 4F5EA 5JD4A 1KIAA 2ZJ2A 4OL0A 4AX4A 1ONSA 4Z7OB 1J1IA 3LJKA 3VBEA 5B57C 2NP7A 2PQ6A 4I5FA 5IBQA 3WB9A 4PYIA 1H6DA 2QRGA 3H1FA 1WBDA 5JZMA 3C6YA 5GIPE 6NULA 2ZAMA 3LL7A 1OYWA 1NBWB 1Z2NX 2WF6A 1HLGA 2OGTA 2HDNB 4UXJA 1PU2A 4GI3A 4UOEA 5CDSA 5KTYA 3ELDA 2CV2A 4FGJA 2JCSA 4YJ3A 4O4JA 5H0IA 5FA8A 2Z6QA 3HKBA 1TA9A 3K6KA 4ZTZB 2DUJA 4HYQA 5E1DA 3OZ7A 4L3WA 1IY8A 2ZZKA 2FPGB 3IB6A 3MBKA 4BMZA 1KH1A 3SS8A 3I28A 1SBHA 3R0VA 2BFFB 4HNSA 2PVCA 1DRKA 2YNMA 3EEFA 1XTIA 2WB4A 2J30A 1U2QA 3RT1A 4AYWA 1OX4A 1T4GA 4B6JA 3FWPA 2GJAA 4D8TA 2R4UA 3QOYA 4FEEA 4C0KA 2YOFA 3OTHA 4R2KA 4S1NA 3D3WB 3IXLA 4Z8XA 5K3AA 1TUBA 3EASA 2ORVA 2J5QA 5CT6A 3TNDA 1PW7A 1NM5A 1VG0B 3GHYA 2XDQB 2B21A 3EXHC 2F8LA 4YRNA 2P2SA 2PX4A 4FFOA 3EGVA 1TJ4A 5BRNA 4P3YA 4BWGA 3PQ4A 3ESRA 4RY2A 1KARA 2YZ7A 1OH5A 3IH5A 4WXMA 4OXNA 1XN4A 3DD1A 4QEDA 1D3AA 3IAHA 3PV0A 4AKSA 2E48A 1FTQA 1XLTC 3OI7A 4KR0A 3U4HA 4JQSA 1M2EA 1EUDB 4Q7JB 2VS1A 4RHFA 4L07A 5JEDA 5EIXA 4WXPA 1X3SA 1R3DA 1VBMA 2C4TA 3K1ZA 2FX2A 1Z8DA 2WU3A 4NP6A 5FOWA 4EVRA 4D9FA 1K8QA 4EY6A 2ADMA 4LF7B 2I4IA 2IF2A 5ESWA 5FULA 3UMJA 4MKFA 3FVTA 1X7HA 5F1YA 1KYTA 1UJ4A 5G1PA 3M0EA 4P5DA 9ABPA 1L7NA 5IUNC 2Q0QA 2Z95A 3MFQA 4D46A 5JFOA 1I4EB 1EE1A 1XQ1A 3WIUA 4G0WA 2Z2XA 5B5SA 1AX9A 3PNQA 4OHOA 4YP5A 1CUAA 1TAQA 1YB4A 2XUQA 5GJVC 4YASA 4B6PA 5H8WA 3RDPA 2G28A 4IMRA 4CLRB 4EG3A 2W2LD 3RS8A 2NLOA 4RYDA 1MX5A 1UJCA 4WLUA 3RYHA 4FE3A 4E21A 1JIXA 8ADHA 1UEXC 1QGUA 1NBMD 2VNSA 4WCDA 5BPFA 4DAOA 5KWIA 1AUPA 1FMJA 4D0SA 4BBAA 4R6XA 4XWKA 1VSVA 3ZGYA 4I1RA 4ZVUA 3KSMA 1GVHA 1SHLA 3OT4A 2FUG6 4E5MA 4RMIA 4JJAA 3FNRA 1QO7A 4DRYA 3PRYA 2UYOA 3AY6A 5LP6B 2BDUA 2PR7A 3I72A 5EE9A 5SZJA 2PG3A 2QYTA 1I5RA 3UY4A 1LU9A 5KWVA 3K92A 5L6LB 2DLDA 2WM9B 4IOJA 4J0GA 4I99A 5CM2Z 3I6MA 4KXWA 1BYUA 2VRWA 1SCQA 4LYAA 4N0EA 1DLIA 5E7JA 1V3TA 2A9QA 4F2DA 5CURA 1TVKB 2C9OA 2QUJA 4MH0R 1GL3A 4Q4HB 5E9WA 5FNVA 5SY4A 2EIHA 2XSZD 2GYUA 5C2JB 4X62B 4XAQA 3LWDA 2CNBA 1FNCA 3JAKB 3RS7A 1PJBA 1TMYA 3KQOA 5ENVA 1E9SA 3RPEA 3AVXA 2EGGA 4DR6B 5GVSA 1FYXA 2Q9CA 1P7VA 3HZRA 4QUKA 3JR7A 4U6QA 3BK1A 4CT0A 3K20A 3TW4A 2Q3EA 4D9IA 2Z3ZA 4E2ZA 3CSSA 3WKBA 2XNDA 2QD4A 3ZGVA 5JBIA 3RREA 1HDZA 2AUMA 4LRWA 1ZJ6A 3K09A 5I01A 3K9GA 4D6PA 5JFGA 2VSXA 1DEOA 2H7VA 3ONWA 2W6IA 3KR2A 1W4LA 2VSYA 1Y7TA 1YC2A 2D0PB 5AI8A 1OGIA 4QO8A 3LT2A 2QBYA 2NN3C 3B78A 2OMEA 2CYAA 3DNPA 3FLAA 5C46F 5CCBA 1B8OA 2WF9A 3C4VA 4U39A 3WHLA 1XXHE 2GN6A 3OCUA 1KSJA 2JFVA 3OE7D 5CVCA 4BFWA 5LZ4A 5KNDD 2PWAA 1Z0UA 2XNCA 1YDFA 2VDMB 2ZIGA 3AUXA 3KV1A 5DSZA 3RAPR 3RTCA 4EARA 1XTSA 3FKSA 4Y0AA 1SJ9A 2C7VA 3DWEX 3M6MD 3PCXA 3PC8A 3ER6A 2V4ZA 3AFGA 4KPUA 5EKTA 1N2XA 5EUBA 1IHYA 1WMFA 5I7UA 1I7QB 2CLMB 1GPKA 1A69A 1N1DA 3WVNA 4I1PA 2G17A 1NNSA 2I2CA 4HUQB 4UVIA 3U5TA 3GYGA 5CXXA 5C1DA 4K3UA 1KOJA 1XU9A 1AM4D 3CLKA 1R74A 2CMDA 1PFGA 4I8DA 5E7IA 1JA1A 1QH8A 3O73A 5C81A 2AUNA 4DCNA 2XGGA 5FPTA 4NAVA 2JZNA 2R1TA 5CDTA 2WVAA 4RFSB 2H6EA 2B8WA 5L7WA 1NYLA 1LX7A 4O02B 1B2LA 3DE1X 1MRZA 2F1RA 5F7JA 4DMLA 2ZSEA 5CYGA 2NP6A 3BJMA 2R8BA 1Q1NA 4JAVC 2FZGA 2NPFA 1H1DA 1PEYA 1PJQA 4MGIR 3R7DA 1ATIA 3V42A 3FYUA 4L4RA 1GNRA 1PBNA 2WMNB 5C8YF 5EESA 3CZ5A 2PMBA 1R1DA 4LYYA 4HH0A 4JJFA 3I9LA 3AESA 1B8PA 1K5PA 1U3FA 4FDTA 3LQRA 1TO2E 1H6AA 1K5HA 1R27A 4MW7A 3GLIA 3SQDA 4MS4B 5FAXA 3ZWKA 4DDMA 2GUGA 2B4TO 1Q7EA 2NT4A 4OJQA 3KETA 1VPVA 3N2NA 3OOEA 4QO7A 3Q11A 1VI5A 1E4YA 3ESDA 3HY4A 4R8RA 1HK7A 2NPOA 4NHOA 2XRMA 1KY2A 4Y2PA 1B2RA 2PU7A 3KDSE 4GUAA 3G7NA 4QTXA 2VTBB 4X1YA 4AD8A 2CWWA 3QWBA 4EK9A 4BHTA 4HADA 1AGNA 1WB4A 2PTHA 3I2IA 2IUTA 2C1ZA 1UK9A 3K5HA 1NA5A 2GLTA 3BC1A 4DXAA 4WLOA 1OI3A 2H29A 4DUPA 1YMQA 4CV3A 3MT8A 1PRYA 3PL1A 5GM1A 1UBTS 4JJ4A 2M6KA 1WY7A 4W7SA 2ZR8A 2A9PA 3FPEA 4KAJA 1NNI1 3V2IA 4J3FA 3LIIA 1WPRA 1Z26A 2F64A 5F7ZA 2D1QA 3G17A 4MEAA 2BZGA 3W7BA 1M0SA 2B8TA 3CVVA 1ZIPA 1WDMA 4ZAGA 3QEKA 1KVSA 3UJDA 5LU9A 2CDRA 5JBQA 4G1CA 2NSDA 2O23A 3TB4A 2VPPA 3ZD6A 3DZFA 1C3VA 4PC7A 4BN0A 2YXEA 4CM1A 3LY7A 1FQJA 1PZHA 2A9VA 1R66A 4ONEA 4X3OA 4R1OA 4KIJA 1Y0BA 1R6XA 3BHMA 2QDXA 4AN1A 2PO7A 7AT1A 2ASEA 4PG7A 4R69A 2H11A 1RKXA 1YONA 4AKHA 1IBRA 4LE2A 4YAFA 3HCEA 2DC1A 2ZWOA 3EVCA 1EH5A 2I6GA 1G5IA 1GPNA 2IFTA 4IRMA 5AH0A 3RK0A 2VPYA 3P9YA 3UQYS 4RH1A 3UGTA 2WTEA 3Q5DA 5E3HA 2ATVA 4HGQA 4UDOA 2BWJA 1DCMA 1K6MA 3T3HA 3KSZO 3LHSA 3O82A 1KH3A 2JGNA 3HJFA 1LLUA 2NAPA 3AKZA 4GD3Q 3ZIAD 2PFGA 4RHEA 2PD3A 3HA5A 2DETA 1TGYA 1DWPA 2ONZA 3URKA 4ZGGA 3T61A 3BMNB 5KOHB 3LWBA 4G5HA 1THZA 5FLEX 2BGWA 4DTCA 2WVGA 1E96A 3D4OA 4F4CA 3U1BA 4BBPA 3P9IA 3PNSA 1JN0A 1E2DA 3ETCA 4RX1A 3U4QA 4LHYA 5GIOE 4B40A 4G0OA 2II6A 5ARCA 4FDUA 5AM1A 2Y1EA 1PQPA 4YT8A 3E9EA 2YH2A 2Z6UA 2RI0A 2RB4A 2I6XA 4Q3CA 2G8LA 2M6SA 4DANA 4ITRC 3ZDYB 1E9RA 1XCPA 3IP9A 1GP2A 1NURA 2Q28A 2WU0A 3HXLA 3IX7A 3LZDA 3TXYA 5HPYB 5FBHA 2BV3A 5IPFA 2WUWE 2PSSA 3IMFA 1UQUA 1L9XA 1RQ2A 2C2GA 3IQGX 1DAGA 5EP1A 1JVSA 2FEWB 3R75A 3RYFB 1RVDA 5AHOA 5DNDA 1FDOA 4JR1A 5IJ9A 4U7JA 2IZZA 5ICEA 2XEDA 2LV8A 4IJUA 3G0HA 1CUSA 4IXTA 1NYRA 3RSOA 5JAMA 2I62A 2AOUA 1CVLA 5LWHA 1AJEA 3MIIA 2R5WA 3EFOA 3G0BA 4F92B 5HGXA 1K8ZB 3SCZA 2AMLA 2L42A 1EGQA 5BWOA 1NU8A 3PK0A 3G8CA 3PDCA 2VF2A 2DQYA 4MLZA 1CJVC 2X9QA 2ZJOA 3GVXA 3Q7SA 5BXYA 1QVRA 1MG0A 5IM4A 5CH8A 4WJLA 3KKLA 1R6AA 1LX6A 3AWIA 2G9ZA 3AEUA 2D2EA 3EZFA 4G1EB 3NM4A 4JP8A 2XB2A 3L8FA 2QTVB 2H16A 3MCUA 3QE0A 4IDGA 4UEQA 1FFBA 4C01A 5HSGA 3ADBA 5JU6A 5DXFA 2PTGA 3FOZA 2FMKA 3MWEA 4REQA 1I3NA 2Q0HA 3ACCA 4PPYA 2QYSA 3WMFA 1E9FA 2GZ2A 4F5WA 2G40A 2VZLA 4Y2JA 1VJ5A 4BB0A 4O63O 4CFYA 3WLRA 3U81A 1QXSA 2Q27A 3FMFA 3F7OA 1XN1A 2GN9A 3E82A 1QUFA 2GX6A 3LKDA 2V7PA 5BN4B 2R8OA 3E4CA 1PL7A 5EINA 3TOSA 5ANRB 2ZRGA 1L7BA 2PS1A 2AKYA 3GPIA 4ZEMA 5IS2A 1JDTA 2H1RA 1OR8A 1TK9A 4H1VA 1THMA 3QE9Y 5FHRA 1JAHA 2OBNA 5J4VA 1YCGA 2XB8A 3I9MA 4RZQA 3DBRA 4BL5A 5BV0A 2P9ZA 1E6KA 1NVTA 1QPBA 1IJEA 4KBYA 4G8DA 1N5RA 3P9SA 2OGZA 3KOXA 4O4JF 4YJ3F 1UDWA 1TM1E 4M0KA 4FFBB 721PA 2W2KA 2ZWAA 2J46A 1T0UA 1QBGA 4PZ0A 1Q74A 2ZB4A 4TMXA 4AO8A 2ZWMA 3NHRA 4INZA 2RCNA 1D2CA 3CJTA 3IJPA 1E4EA 1IN4A 4H1UA 2PUFA 1A9XB 2VHUA 4WHMA 4TYNA 2GASA 1KRWA 2JD0A 4RD3A 4GLBA 5D6NA 3LP8A 5JNTA 1MOZA 1KJIA 4TTSA 3IVCA 3VR4A 5DYTA 3W5DA 2AXNA 4E31A 1K6XA 4B0OA 2BMVA 2JJQA 3RIHA 1WIWA 2Q3FA 3KFXA 4JB3A 5J63A 3ORSA 2UZIR 4BCDA 1RI5A 4OI0A 1XTZA 1NONA 4P34A 5D1HA 2PK3A 3LY5A 3W3AD 1EVZA 1U8YA 1E8DA 1ESZA 3EZGA 4G1FA 5LYYA 5JZBA 2VI5A 2JDID 2QSUA 3GJ8A 4W9NC 2JFOA 4OXQA 5KNCD 2L0XA 1OJLA 4JLMA 4OHWA 3LF2A 3FN4A 4XUCA 3RSLA 4BP8A 1P3Y1 1IMJA 2W6CX 3H9UA 3ME5A 3MW8A 4Q05A 4R8SA 3VV2A 4QGBA 3KOWA 4DDHA 3SKYA 5CX4A 2C1EA 2DOKA 1FLNA 4GR5A 5EHXA 5AJHA 1P44A 2QS9A 2DERA 2PYDA 3MTGA 3UUWA 4JBIA 3OD1A 1GKLA 1QRUA 1EFTA 2CWDA 3X1XA 1AV7A 1J2RA 2IEYA 1DIHA 2AK2A 1MJHA 5EKUA 1DBPA 3HFSA 1AQNA 2R8PA 1VJTA 3EXG1 1ZK1A 3W0LB 4YRAA 1AO0A 1IWPB 1FXSA 1VMDA 2DFLA 4HQ6A 3MINA 2P4QA 4CIBA 4QUBA 1C7RA 2JIRA 2VQ3A 1ULBA 4JGBA 4OO3A 3GX1A 5F76A 1HOTA 4ZT4A 4YUVA 1G7RA 2X3UA 1BTOA 3AJ9A 2DFTA 3T0FA 3ER8A 1V16A 3WYFA 4NE7A 3NRJA 3UOGA 1TEXA 5LMUB 1JIUA 5DK4A 5H3CA 3PHHA 2ZSFA 1YR1A 4ZI7B 1CUFA 1NJ5A 2W2NA 2F8TA 2WZQA 3KLPX 3B6IA 3HP7A 2IHNA 3GLHE 1RWNA 3WAGA 4OB8A 5IT4A 4LISA 2XKKA 2JH8A 2E5LB 1KZ4A 3PENA 2I8AA 4XVRA 4N18A 4IRUB 4ZZ2A 3HU5A 3SE0A 4A9AA 4BO6A 5JNWA 4UTZA 3AL0C 4FLFA 4UNPA 2OBFA 3IBYA 2O2XA 3O90A 2FNAA 1PR4A 2QJWA 4XYEA 2C0QA 3A9CA 4OSPA 3LGSA 1KMCA 4KE9A 4URZR 5ULLA 1S0UA 1R8XA 2HTFA 1P0FA 5FHQA 4DW8A 2WTBA 3GIDA 2Q1UA 5CLLA 5DEOA 1DG1G 1BCSB 1UBGA 2P5YA 4YPFA 3HV0A 3WNZA 1X8JA 4FHZA 3NBYC 1L7OA 5AM2A 3PL5A 2YS6A 4Z0PA 5T6MA 2P27A 4YP7A 3CLTC 3K8ZA 1MOQA 1OI4A 5BSTA 3HI4A 5CA0B 3F3YA 4ZOLB 5HRCA 5FNVF 4HWTA 2I34A 5GWXA 3I5YA 3WLMA 3M3DA 3LA8A 4KLRA 1KEEA 2BH9A 5TF0A 4YR9A 3UJ9A 3VPXA 1YULA 3TLKA 1YZ3A 5SYNA 3O1IC 3BJEA 1PGOA 3PKZA 1T2UA 3T4EA 4BS9A 1NKTA 1YQEA 1V8OA 5TNXA 3T1VA 1P45A 4CKYA 1HDGO 1XAGA 3VC7A 4Z51A 4PRKA 4CEJB 5GM2A 3IHWA 3OOSA 1QVAA 4CG3A 4EMUA 5ECGC 4JUFA 3WKAA 4LHVA 5G4LA 2GCNA 5JVDA 3ST7A 4TRNA 1KS2A 3KTAB 4BLRA 1O54A 1Q84A 4LOIA 4OYRA 5CITA 5EIEA 3SEAA 4S04A 3RUDA 5SZHB 1ZK0A 3BSSA 3RSGA 4FNMA 1HYHA 5EWMB 2R4TA 4KQ9A 3JAWB 1UWKA 4Z4FA 2X2EA 3HZZA 3GD5A 1XLUA 2ZIFA 2OEPA 4M7OA 4X61A 5EP4A 3W8DA 3RRXA 1DC7A 5EIBD 2NU6A 3RTGA 1NUUA 2O8DB 3LXRA 4CDRA 1LLFA 2YJNA 3ZE0B 4J1NA 4UM8B 2ILVA 3PHGA 3I9NA 3N2GB 3PNLA 2OCDA 1GIAA 2HSEA 1J8QA 3ZWBA 3OMLA 1JHRA 1FUYB 3JTEA 5IDVA 1LKZA 4MMZB 4E30A 1WQ3A 4ER7A 4QLBA 1DC4A 1T0JB 2CK3D 3KZOA 1LQ2A 1IQRA 3N2KA 1YFKA 5KOIA 1QKJA 4JXZA 1I0LA 5FOUA 2QN1A 1EB9A 3H1BA 1QP0A 2XT9A 4EPTA 3R7NA 1Z13A 2R1VB 3O91A 1OAAA 1RAEA 2EDCA 3I92A 1CB0A 5DIZA 1OVMA 3ILYA 2RK6A 1LI4A 3CBQA 4G86A 5KTTA 6ADHA 3CF4A 2O0HA 4TT8A 3SS7X 4BMDA 4LBWA 5LA6B 1BX0A 1V2HE 5TS3A 3SI7A 3TX2A 1IXZA 4B33A 3RKRA 3S5UA 1XJCA 1JU9A 3U5ZB 2TMYA 1TC1A 1G4UR 1CDZA 2ACVA 1MA0A 4LMRA 2FB9A 4C22A 1YCDA 2XBUA 4URXR 3LC0A 1UEJA 2QXYA 2ZJ3A 3W9BA 2GXUA 3IXMA 4J0DA 1D6SA 3JZFA 5C7OO 3EGDB 1XVAA 3EZ9A 1JG6A 3DZCA 2MCFA 1GGFA 4ZDKA 3JYQA 5FLYA 4C4ZA 1RR6A 2WPNA 1PEDA 3Q0TA 1YQQA 2H4YA 3G13A 3P9PA 4DCVA 1Z6TA 1ABFA 2RONA 5AM3A 2HPAA 3E3MA 2NUBA 1SUIA 1PV2A 4B84A 5LWQA 1NBME 4OXYA 1EDEA 1YT5A 2FPIB 3D7NA 3NOQA 2C4KA 2R6HA 4TN1A 4H0FA 4XM1A 3I5XA 1GG8A 2HQOA 3C6ZA 3WLLA 3PQEA 4IL5A 4TRJA 1Y3BE 3I8OA 5K8VA 4GECA 3OKFA 4LJKA 5I9NA 1NN1A 2J6BA 1KY5A 1ZNZA 3L0PA 1C3LA 1L8QA 2G4LA 3BIXA 3EWSA 5AOCA 1SKUA 4B79A 3NOOA 3FWZA 1QLJA 3N2YA 3R3YA 2CXPA 2FRDA 2O4UX 2QSJA 1MJ5A 1UBNA 2WIDA 4PSUA 1ZD8A 4M46A 5EMKA 4BPRA 5FUWA 5L53A 3FM9A 1JUDA 4L6IA 3NTLA 1XVUA 2OOKA 1N3YA 1EK2A 4KQHA 4S35A 4WKCA 1JQAA 2HNKA 3A10A 2JGLA 3NKVA 5ESXA 5FUVA 3T12A 2SBTA 4BYMA 2M9MA 1GCIA 5AYVA 2F90A 3OZXA 3NWPA 5TPWB 2AE2A 1CTQA 3WRYC 2X86A 5IP5A 5KTSA 4H6PA 5JXHA 2A9RA 4RVNA 3WMGA 1OXKB 3ZWWA 4ND3A 3WIOA 1SK8A 5FV7A 3WWZA 5MN5A 5BN5B 4NX2A 4MB0A 5KEIA 2PGJA 3L82B 1GNTA 3MLAA 4FDLA 4HMQA 2JAXA 3TINA 2XECA 4I50B 4YJHB 2C96A 3JQ7B 7REQB 4QXAA 4BAZA 4PRLA 4EFLA 2C7RA 5IN4A 3IR6A 2ZATA 4DPLA 3MAAC 3BHJA 4GNKA 1IATA 4BJ1A 4GX0A 2OZVA 3FPAA 2YXBA 4WOKA 1EHCA 4F97A 1LK0A 1PDOA 1WXGA 4P9NA 1ILEA 1EEHA 1KIMA 1J0XO 1I6KA 1WW2A 3IT1A 2DBZA 2JIMA 3EQZA 4KCGA 1VE7A 3MWFA 1NW3A 1SQ0A 3L3BA 3I1FA 1Q19A 4N3BA 1QYIA 4E15A 5JANA 4L9AA 7YASA 5KYXA 5LQJA 1JPNA 4GO1A 1POXA 2CT8A 2NOAA 2WF8A 2ASVA 4RV4A 2XVMA 4D4JA 2SHKA 3GEDA 1KMHA 1UT6A 1EE9A 1FSGA 1BAPA 1JG2A 1V26A 4OU4A 3UMSA 4IGAA 1L5ZA 5EPEA 1EFVA 4IH1A 4D80A 4F3YA 1D4ZA 1HF3A 4RO0A 3L8DA 3NFRA 2RHBA 4XSHA 3MJVA 2EFCB 1GCGA 1NP3A 3FI0A 2D7DA 2QSYA 2NU7A 2YJ5A 3VNSA 1G5HA 2VHYA 3GFFA 5CYOA 3TFOA 1U8EA 2D5LA 3EDRA 3F2VA 3U3XA 3W1VA 2QD2A 5HTOA 1M1YA 4WBNA 3RU9A 1Q5PA 1CP2A 3L05A 3VZCA 3F6EX 4FVTA 4FGKA 3T06B 2EJCA 4QUHA 4DBZA 1LBIA 1FVXA 4QSMA 3VDRA 3LUGA 1QIEA 3OIVA 4CQNA 4GBED 5IM4F 1CXZA 1FX0B 3O8OB 3ZX4A 3QVKA 3TTYA 3WLPA 1P2FA 1U9IC 4DG9A 2VEDA 3GGPA 1TUIA 4IVPA 3OX3A 2JC3A 1JLLB 3BZWA 1W0CA 4ZIRA 1I6MA 3LQYA 2WLSA 2YWHA 2ORYA 1U0RA 5CX1B 1T5LA 4RHCA 1OJ7A 1H0KA 4U5XA 2FW1A 4U7WA 1XAIA 5HIAA 2IW1A 1E1QA 2DHQA 3WFJA 1GQQA 3DMHA 1WULS 1V6CA 3G0DA 1T6XA 4H1HA 4I08A 1Z0SA 4ZOBA 5CDFE 1F12A 5CLJA 4ZYXA 2HR1A 1I51A 1W94A 3R20A 5HBRA 5CW1A 4XJTA 4L74A 4B3RB 1NYTA 3OA2A 1JHVA 1Y4SA 3UMVA 4BX2A 2J0QA 1O94C 2C42A 2O2EA 3QA3E 5E6RA 221PA 4MUBA 1QHHB 2X9LA 1M5UA 1Z4NA 2YV3A 4B80A 2EBWA 3I05A 4K8RB 1BQEA 4U4AA 1ISJA 2R66A 2W48A 4R2MA 1R6TA 3KPUA 4QWWA 3DB1A 4FINA 4URFA 3ULKA 4DUGA 4RNDB 4OEHA 1TCBA 1MC4A 3CUWA 3RVLA 5FQOA 2Y1DA 2VKTA 2CY0A 1KJ9A 3L01A 2CKDA 5TVKA 1E2GA 5IEBA 2CV0A 2YFHA 4RUKA 3SBEA 5AO9A 4TYMA 4IVRA 3H4VA 3A36A 2C0PA 1WMDA 2ENUA 2ZE6A 1MR3F 2W6MA 2IBSA 2IYUA 2HLHA 5EAIA 1R37A 3QELB 3NHLA 1V4NA 4PG5A 4LF6B 4KPFC 4TLEA 5EQJB 3LQKA 4CQLB 3L1JA 1HWYA 4UHFA 1MLDA 2IPOA 3RM3A 4IG4A 4UW9A 2BRUA 2ZBEA 4YLYA 3DS8A 1BDMA 1J2EA 3I32A 3UANA 2JAUA 5HXAA 5CUQA 4UFPA 1U8TA 3AV0B 3QTLA 3HJAA 1LLCA 1E59A 1W93A 1BNCA 2XKBA 3EIFA 4KEAA 2DYKA 2XIQA 4GC5A 2BFPA 1XU4A 2O2IA 3TB6A 5K6AC 4EFNA 2NQ8A 1ZN2A 4JVMA 3NFYA 4KAFA 1NXOA 1CZKA 5I5EA 4TV9A 3EDCA 4BGIA 5C8YB 1H2HA 1GZ3A 1P6QA 3L7JA 3R2JA 1IHOA 5BOVA 1CS0B 1NVXQ 2WQZA 1CY1A 1LDGA 2I6SA 2X76A 1BXRB 1NQWA 3ZK9A 4D1YA 3GJQA 3L8YA 4E4RA 2A78A 2FZKA 3CLUC 4HPWA 5TMDA 2PT5A 3GRUA 4MZDA 2OKGA 4FYJA 3VU9B 1JMKC 5SICE 4CQMD 5AKJA 3TDNA 4NZPA 1A97A 2WZCA 1CPYA 1E77A 1U02A 2AJTA 1PFQA 2IHVA 3JD0A 3CEMA 4K3VA 4N3AA 1Y5MA 2SKDA 2W6NA 3ZNQA 2XMSA 1XDDA 4D79A 4D4LA 1TIPA 1A0OA 1XQYA 3BH6A 3PC2A 3VNQA 1AQLA 1CZNA 3KPVA 3W2GA 4EA9A 2XWJI 1O0SA 1XMSA 3ROZA 2P2ZA 5JLAA 3VV3A 3MS7A 2BPOA 4J6FA 1BDHA 4G4IA 1DKPA 5DK6A 5H9VA 3TM4A 2BGRA 1WU7A 1EXWA 2QMQA 2OXTA 2FWPA 2QYOA 1Y8QA 4YMGA 3AUSA 2PV7A 1DIAA 2CLHB 3PPIA 3JD3A 5DM0A 1S8NA 1VPEA 2QTZA 2QQ0A 2CXQA 1UKZA 2JFQA 4U8HA 4EHFA 1B0UA 1RZUA 1PF7E 2ZITA 3K94A 5BNFA 1JDBC 2DY1A 2R8ZA 3OZGA 3Q6IA 1TYCA 4HGZA 2XITA 5L95A 1GFIA 1P29A 3ABOB 2BEUA 4OXRA 4PSVA 1NMXA 2V74B 4UNSA 2Y05A 3QXXA 2ZPAA 1YGPA 5BSRA 1E6LA 4PGGA 4R2IA 3TRIA 3HDQA 4D4HA 4DCCA 4XWAA 1T6NA 3PF9A 4QU5A 3IXQA 2W22A 4LRXA 1Q6ZA 3WXBA 3WQSB 2GEJA 4DIOA 5I3ZA 1QB7A 2I2WA 1APBA 4FFPA 1E9BA 1K98A 2XVZA 3OZUA 3MQ4A 1G7CA 2J67A 3DJYA 2AF4C