2C07A

Oxoacyl-acp reductase of plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
246
Chain Sequence
KENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
publication title Kinetic, Inhibition and Structural Studies on 3-Oxoacyl-Acp Reductase from Plasmodium Falciparum, a Key Enzyme in Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 98
structure length 246
sequence length 251
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c07A00
4XRGA 2IEBA 3CZRA 4J90A 4JX8A 5CDTA 5ICMA 1UXGA 1LBEA 3RC7A 5DF1A 4URFA 5KIAA 1FDUA 1N1EA 2CZCA 4WLVA 3IOYA 3WTBA 1V0JA 4JJGA 2BRUA 2A35A 1GR0A 3ENKA 3VTFA 1BXGB 3GZ4A 5MGBA 3EDMA 3JQCA 3RBZA 3GHYA 2PZLA 5F3RA 2WE8A 2JFHA 2VT3A 4IJUA 3TOXA 2PTGA 4E12A 4WJZA 4WUVA 4FC6A 2VOEA 1CYDA 3GFBA 4D41A 1VKOA 3I9MA 1KY5A 3VTZA 1JAYA 3L6EA 5FWNA 5CG1A 3BMOB 3OIFA 3U4DA 3ADOA 5BSEA 2VYND 1HF3A 1PJCA 2Q2QA 4E6PA 3K92A 5IDWA 7ADHA 1JVBA 5CDGA 4DL9A 5IDQA 1H6AA 4IJVA 3QV1A 1U28A 2PY6A 4W7HA 1PZFA 4O5OA 4OOFA 2YV3A 1KY4A 2DTXA 5T64A 4EI2A 1V3VA 3EHEA 3RC1A 2X22A 5EESA 4EJ0A 3ZWXA 5TT1A 2GCGA 2A92A 4BO4A 5GZ3A 4WPGA 5L4NA 4PRLA 1PS8A 1U4SA 3GRPA 3WLFA 3E5MA 1BVRA 3BTSA 5EPOA 1GV1A 3M2PA 2YUTA 3E9MA 1WPQA 4DIOA 4U6QA 1X7GA 5HWSA 2NUAA 4Q3AA 1LRJA 5COAA 1U4OA 3L07A 3A4VA 3ZWWA 3AOEC 3ASUA 3LZ6A 2I67A 4L8VA 3GK3A 1EK5A 2HMWA 2ZKLA 3G1UA 4R1TA 1MX3A 3VPHA 4FJ1A 3L6OO 3VH1A 4BS9A 1LNQA 2PZJA 3GDGA 1XWFA 2P9CA 3RC9A 4FR5A 1D7OA 2EGGA 5CP8A 2GLXA 3GLQA 5I8WA 1UAYA 1IZ0A 3FCOA 3ZWPA 1OC4A 4L75A 2BF7A 4JIGA 4JLWA 1W73A 5BT9A 5IAAA 4CV0A 3A14A 3LLVA 3NT4A 3PHGA 4OMUA 1U3WA 1Z6ZA 1E5QA 4OQZA 5IG2A 2Y68A 4MP6A 1GEGA 4BGUA 2R6JA 3FNEA 3JYLA 4IZIA 2QRJA 3NT5A 1QSGA 3KSDO 1G1AA 2B4QA 1CWUA 3OJFA 4L4SA 1MG5A 2CY0A 3ITKA 2EWMA 4IGFA 3UF0A 1PGQA 1TEHA 3E18A 3M1LA 3WWYA 1CF2O 2WDZA 3I9LA 4RVUA 1Y7TA 5KJFA 1YB5A 1DDOA 4BNZA 1SOVA 3ZW8A 4EUHA 1R4MA 2VYVA 3E9QA 4F3YA 4LN1A 1Y5MA 4AJNA 4GX5A 3NEPX 3D5QA 2HO5A 4FGWA 4W82A 2AHRA 2VRCA 4MP3A 4CM8B 1ZEMA 2FPGA 5HTOA 1YBAA 3HJAA 5I7EA 4ND5A 3Q9NA 1FXSA 3QE3A 4BNLA 4BHTA 2X0NA 1UDBA 1GUYA 3OICA 4I9NA 5TNXA 4BO1A 5CEEA 5G4KB 1ZEJA 2HAEA 1SB9A 1U9JA 1ISMA 2J6IA 1PZEA 1JKFA 2P9EA 4NR0A 1RM3A 3OF2A 1PX0A 3A06A 3IMFA 4J3FA 2GN6A 4FBGA 1JLLA 3D0OA 5CDYA 3AOEA 3UHAA 3PK0A 3OP4A 5CDSA 4J9VA 3UCXA 5L95A 1HRDA 5GMOA 4RF2A 1HTBA 4ZICA 3T4EA 3ZWMA 5JC8A 2RIRA 1E3JA 3LT1A 4DGSA 1X13A 1C1DA 1SO8A 4BNVA 1ZSYA 1A9ZA 4S3MA 4E5YA 3AW9A 2H63A 4J6FA 4BO5A 3GN1A 2BD0A 3SXPA 4TKLA 5TSDA 3PHLA 1PJQA 3PFFA 3FI9A 3IUPA 4L76A 2XAAA 1PJ4A 5L51A 4RF3A 1W0CA 2W90A 5ES3A 3GEGA 2O7SA 2ZTUA 3PP8A 3SLKA 4H15A 3QWFA 3S2EA 1QYVA 4NJMA 1BDMA 1XLTA 2DLDA 4WLOA 3LF1A 4AJPA 4I9UA 3ZCXA 1QG6A 4DUPA 1CDOA 5BSHA 2OGUA 4O63O 2X5KO 5KKAA 4ILKA 1ZVMA 2OZPA 4CODB 3X2EA 1NR1A 1K89A 1DC5A 5ILGA 1AN9A 2NU9A 4XRRA 2HJRA 4UUMA 3MJ4A 5KJCA 1Q0LA 3UW3A 1UP7A 4ALIA 2C2YA 4INAA 3SC6A 5JO9A 3R1IA 1AXEA 1N7HA 3JQ8B 2EP7A 1K6IA 3D64A 4PZEA 3VAZA 4WLUA 3TWOA 4YQYA 3FBGA 5TJ9A 2X8LA 1U3UA 2LDBA 3PEFA 5L53A 3Q11A 2P4QA 3KB6A 4CLRA 3DOCA 3I9OA 3RASA 4HY3A 1Z75A 2C54A 2I66A 4NK5A 3HB4X 3AY6A 4J9UE 3DBHA 2VRBA 3GOHA 3CKYA 4YXFA 5KVSA 1Y9AA 1NASA 1PSDA 1BXKA 2BHLA 2QRLA 4CLOA 1VRWA 2C0CA 3O26A 3I23A 2PLAA 3H65A 1GL3A 4WOJA 4J1SA 1MLDA 1Q7CA 2B83A 3ROKA 4BOYA 4ALMA 4KWIA 5JE8A 1IL0A 1NHGA 3H5NA 2O4UX 4CMJA 1KVQA 3MTGA 3WIEA 3AWDA 3K6JA 3D7LA 3JSAA 2I5PO 2D5CA 1DRUA 1ZJYA 3RAJA 2V6FA 4PLZA 5C7LO 1XIVA 1ZMOA 1H93A 1ISJA 4HX5A 4GGOA 3N7UA 1NQTA 1QR6A 3EZLA 3G1TA 5CG2A 4IJKA 1E6UA 3PJDA 1LU9A 1NVTA 4ZD6A 5HM8A 3H2ZA 4FFOA 1ZMTA 4XDZA 5G0UA 4YJHA 1H9AA 3NTQA 3GVCA 2X5OA 2AXQA 3T7CA 3BTOA 3Q2IA 4YBZA 1NAHA 1YH3A 3KSZO 1XQ1A 4DPLA 5A4DA 2HMTA 4XQ9A 5F1KA 5JDCC 4DC1A 1E1LA 4FIZA 2Q4BA 3L4SO 3WYEA 3DZBA 4DQUA 4CUJA 5KJ1A 4CM9D 5FI3A 4RZIA 1ZO8A 3ORFA 4PLHA 2R2GA 4OM8A 4CUZA 3JYOA 4CMEC 2WMDA 4RPJA 4JQCA 1ZXBA 4B4WA 4PLGA 1MG0A 4WLEA 1LTHR 2J3KA 4ALJA 4XDYA 3JQ7A 3MWEB 3PYXA 2DUWA 4PVCA 5C7OO 4BKPA 1JTVA 2A9FA 3G3EA 3VPSA 1A7AA 1O8CA 1U2DA 3GFGA 3PPIA 4NBWA 4QO7A 4EYEA 2C59A 1AHIA 4EUFA 2O3SA 2G5CA 3DZGA 3W8FA 1I8TA 2VHYA 4FSHA 1UP6A 2BFAA 2PZKA 3CIFA 2NV6A 3GH3A 4O59O 4DC0A 2CUKA 2JL1A 2V7PA 3VPGA 1UXKA 1HL3A 1L7DA 2VHXA 4GWKA 4DA9A 4DQXA 4YT2A 4GMGA 1EDZA 1N1GA 2V6GA 3ROPA 4A73A 4GBJA 3PXXA 4G81A 2HUNA 3Q3CA 1SPXA 3HG7A 5H82A 3GHHA 4TZTA 3I9JA 4JCOA 1GYRA 1WMBA 2GUGA 1B14A 4WLFA 4BIIA 5I9LA 1ULUA 2UAGA 2VTEA 4RDHA 4XGIA 1GPDG 2VHVA 5THKA 5K9ZA 2DBVO 4WCDA 1P33A 1SCUA 1S7CA 4A26A 2PV7A 2P5YA 3ON5A 2WE7A 4NNJA 5CEJA 3KSUA 1PQUA 2HMUA 4GAEA 2OO5A 4UEJA 1BXGA 2Q50A 2JFGA 4GL4A 4Z3DA 4CM3A 1GEEA 1YVEI 4OIMA 5THQA 2FWMX 4W7IA 1QRRA 1Q0QA 5ITWA 5TS3A 2Z1NA 3COSA 5FF9A 2E48A 3DHNA 1DIAA 3VKVA 3VH4A 3OA0A 4NU6A 2OP0A 1GQQA 2E4AA 1F14A 3V2HA 2D59A 3IAHA 4RL6A 3W4IA 1ENZA 3U3XA 3F3SA 4HFMA 3U0BA 2VHWA 4UEKA 1T2CA 3OH8A 3L4BC 4J16A 2NTJA 3MTJA 2Q2VA 4OKNA 5BSFA 2DFDA 2PGJA 3ZWBA 2D8AA 4B7UA 4QT0A 1O94A 5DOVA 1UZNA 1IYZA 1M66A 5B4UA 4CMEA 5JYEA 4LVCA 3PDUA 4D3DA 3HB5X 4UVGA 3S2FA 4XYLA 5CDUA 1R4MB 3NT2A 1EZ4A 4E2YA 1KEPA 2AEMA 3S55A 3ULKA 4NIMA 3LQFA 4FGSA 3MOIA 2JHGA 3KBOA 1WZEA 4Y67A 2PNFA 4B7CA 4XGNA 1GAEO 3H5RA 2OFPA 3DOOA 4Y6RA 2GZ2A 1IE3A 2EIHA 2NQ8A 1LRKA 3PIDA 5G0SA 3ZWOA 3AM5A 3ZH2A 5JW6A 2F00A 5IZ4A 3DBVO 4B8ZA 4ALKA 4KUHA 2GN8A 1U3TA 4BV9A 1OOEA 2C2XA 4R5HA 4YPOA 4MVJM 4RVSA 3FTPA 3WJ7A 2YHIB 4L4RA 2X6TA 5F5NA 4EJ6A 3ZN2A 2I6TA 1HZZA 3JD1A 4R4JA 1M6WA 1XG5A 3CXRA 3L0DA 3DO5A 4R9RA 4I5EA 3U09A 4IZHA 1DC4A 1DAOA 2Q1WA 4H3VA 4I9HA 3WDSA 1LSSA 4OYRA 4CQMD 3RBXA 4TVOA 3VH3A 1GADO 5ICSA 3SC4A 3KEOA 1SB8A 1Q7GA 3PWZA 1OFGA 2OBYA 3EK2A 3PGXA 4E2XA 1SAYA 4BKOA 5A02A 2PKRA 2Y1DA 2CDBA 3DDNA 5JAQA 3NKLA 4IGEA 1NR7A 5DNAA 2IYPA 1XDWA 4NJMB 4XQEA 3ZWAA 1PL8A 3ZHXA 5DP2A 2WD8A 3GY0A 4IS3A 1N2SA 2CNBA 2FY8A 3L4BA 3I4FA 4U6SA 4AJLA 3JCZA 3JQ9C 3LYLA 2IRWA 4BNIA 1ENYA 1LLUA 3QWHA 4DXHA 5FI5A 4ZQHA 1JN0A 4U0JA 2I3AA 3Q1LA 1YO6A 3IS3A 4UVDA 5JAMA 3OJOA 2EJWA 3KYBA 4TROA 3GEMA 3I6QA 4FS3A 2PD3A 3GAZA 4CM8A 3C3XA 4HKTA 1XR3A 1P0CA 2ZK7A 1ZK2A 4CLEA 1BSVA 3NGLA 5HBRA 4BO2A 5U1PA 2NVUA 1B16A 3GZNB 4BNWA 3KYCA 5I9NA 8ADHA 4U5QA 5G4KA 1RYDA 2X0IA 4LMPA 3QY9A 4QX6A 2YQ5A 1DRWA 3LC1O 5F21A 4E33A 2FP4A 4P38A 2NVBA 1T2DA 3TN7A 4F46A 3DFZA 1DJQA 2UUPA 2Q99A 4OXKA 2VUUA 1OAAA 4DLBA 5BSGA 2D1YA 5KVQA 2QX7A 4FFNA 5L45A 2G0TA 2NWQA 4P22A 3WFJA 3I1JA 3IJPA 4PLCA 5F5LA 5A03A 4YR9A 3KV3O 1CJCA 4MIYA 4RJTA 5DBGA 2D3TA 1VL0A 1UP4A 1YB1A 3ZU2A 3HFGA 3RKRA 1O9BA 4JN6B 1ONPA 2DBZA 3QWIA 4YJHB 1DEHA 1DFIA 3H4VA 1E77A 3S8MA 5BNTA 1NFQA 4WEOA 4FFRA 1N5DA 3CMMA 1G0OA 4MO2A 2D4AA 1B15A 2HK9A 4II2A 4CV3A 3WFIA 1J0XO 5CPBA 1LJ8A 1AHHA 4XIJA 4RF4A 2CFCA 4AICA 1W8DA 1E6WA 4WCFC 1T1SA 3PQDA 4LMRA 2QW8A 1YJ8A 3WQSB 1KS9A 4ID9A 3IDSA 3JQ7B 1ID1A 4PCVA 1H6CA 4UUNA 1VL6A 3K9QO 3UICA 3V5NA 1DHTA 3JD0A 2YDYA 4L9RA 3JQ8A 4AJHA 5F1PA 1EK6A 1GCOA 4Y8VA 5DZSA 4BNKA 4AJIA 4TRJA 3GVPA 1L1FA 4CL3A 2O2YA 3IL2A 3GVIA 1A7KA 5L7YA 3FTNA 3WGQA 5JNLA 1HZJA 1P1RA 3OHSX 5BR7A 1H5QA 3BTVA 3RC2A 3AI2A 4HP8A 3H8VA 2AQIA 3LU1A 3LLSA 3D3WB 3KYDA 2EP5A 1XSEA 3NYWA 3DZKA 5CFZA 1WXDA 5EN4A 3HSKA 1M2WA 4ITUA 1J49A 4NH4A 1X1EA 4MINA 3HUDA 3NTRA 4DVJA 1A27A 4YVFA 1DJNA 1JAXA 2C82A 1DIBA 4OQYA 3QQPA 2PKQP 5IN5A 4AG3A 1EUZA 1E7YA 1NPTO 3EVNA 3EVTA 3QW2A 3PHHA 1EBUA 5GZ6A 1PWZA 1ZSVA 5C5IA 4JJIA 3B6ZA 3VDRA 3KVOA 2VWHA 3IUSA 4A2CA 1OI7A 4KWHA 4XB1A 2YY7A 2Q49A 1C0PA 4OL9A 4DMLA 3AY7A 1ZBQA 3FSRA 3Q0EA 4J4BA 4NZ9A 5HRUA 1C1XB 1R37A 1NP3A 2O3RA 1PGPA 4PG6A 3WNQA 2NU7A 1LRLA 3RUCA 3K5PA 1O89A 4TRMA 4IPTA 3SEFA 5F1OA 1NAIA 4BGVA 4R3WA 2PA3A 3FWNA 4KDEA 1ZKMA 4GVLA 1C0KA 3FF4A 5JLAA 4DWVA 2E6UX 5IXYA 1KYQA 5JS6A 5TRTA 1I3MA 2VNSA 4QFDA 2GSDA 4EBFA 4LCEA 1E3IA 3R3SA 4WCFA 1DSSG 1LC0A 1PTJA 2YHUA 3PWSA 5T8KC 4BL5A 4BKUA 2WTBA 4D43A 5A1TA 4XYGA 5I7VA 3GGOA 3P2OA 3SX2A 4BNMA 4YJDA 2ET6A 1I32A 2AEJA 4QUKA 4MVJH 4CJXA 3TNLA 4DLLA 1JKIA 4KZPA 2DM6A 1DIRA 5EERA 3AI1A 3BIOA 2JAHA 4EITA 3KHUA 5TGDA 2RH4A 4BV8A 1W4ZA 5AVOA 1VLLA 1P1KA 1JWAB 1T1RA 1P77A 3FR7A 2GD1O 2NU8A 4NK4A 2CF6A 1HSOA 2O48X 3BAZA 5G0WA 1N8KA 4MVJE 2CMDA 3Q9UA 1EVIA 5JPIA 5JDIC 1I3LA 4IINA 1RPNA 1P44A 2UDPA 4NJOA 2Y05A 1X7HA 1BMDA 1WMAA 3ETEA 3DEYX 3EZYA 2IEDA 4D44A 2OL4A 4B7XA 2FR8A 4PRKA 4EW6A 2CF5A 2GZ3A 3D3EA 3H3FA 4OAQA 3TZQA 1U7HA 1WLYA 2PH5A 1R0KA 1RYEA 1B3RA 4OXYA 5IZCC 2ZYDA 3E8XA 1BDBA 1Q1NA 2X1HA 4LRTB 3MJSA 4P8RA 3F4BA 2YYYA 3FNHA 2B4RO 1P45A 1QMGA 2AQHA 4CR8A 2H9IA 3C7CB 5KJEA 3ZU5A 1I2BA 5JMPA 1J5PA 3BZUA 3CZMA 3FPLA 3M6IA 1EQUA 4WE3A 5MDHA 5KNLA 1LI4A 1MC5A 2UUOA 3JD3A 1ONOA 1M67A 5IJZA 1RM5A 3ZHYA 2X9GA 3WGZA 3OEYA 5DBIA 3O8QB 4CM4A 4RF5A 1MUUA 2J5RA 2JD0A 5JCXA 5T67A 1O6ZA 5A9TA 3GDOA 5T8KA 1Z7BA 1QKIA 4IDAA 4CLDA 1Y1PA 2IDZA 4R3NA 3RU7A 3ZV4A 2WD7B 2VZ9A 4L74A 2GNAA 4A0SA 3DL2A 1ZCJA 2G82A 2NVWA 1IULA 3IIEA 2Q1SA 1J6UA 4FN4A 1WW8A 3OEWA 2YDXA 3VH2A 3QVXA 3TJRA 4BNTA 4PG7A 3PQEA 5C37A 2ZQYA 4ND1A 2NVUB 4FW8A 3KYCB 3ZWCA 1GQYA 1A4UA 1NYTA 2UVDA 3ZV5A 2GZ1A 3OECA 3H2SA 1LLCA 3WSVA 3MEQA 3CINA 3JQGB 2H6EA 4NQZA 4RGBA 1PJ2A 4KUGA 1A72A 3IQDB 3UAGA 3E5RA 1NVMB 4MIOA 3HNPA 4BNUA 1GY8A 5JDIA 1E92A 4M54A 1YL7A 3AM4A 5TLSA 3UVEA 1UZMA 1E3SA 1ENPA 3WBBA 2CSUA 2PFGA 2Y0EA 1EFLA 1Z82A 3IP3A 2O3QA 1DBVO 3TQHA 3DB2A 4F6LA 4ZN6A 2BGMA 3QRWA 1M75A 1LXCA 2YHIA 5AXBA 3W4KA 1KC3A 4WECA 2I3GA 1HE5A 3UCFA 2ZIZA 3JQEA 3SJUA 2POQX 5IZCA 1RJWA 1UXHA 4J2HA 4MVJF 1E1MA 1R0LA 1KVTA 1HDXA 2C29D 3QWBA 2IE0A 2Q2WA 4LRSB 2IZ1A 3ABIA 3NX4A 1O0SA 1ZK4A 4OGWA 3ZNOA 3DTYA 1S6YA 1QV7A 4OH1A 4AJ2A 4D42A 2GO1A 4RLHA 4AJ1A 3ZWNA 2DPGA 4W99A 1Y8RB 1UDAA 2QQ5A 4RVDA 2DTEA 5A3JA 3CH6A 8LDHA 1LDGA 1ML3A 2QHXA 1HEUA 2HQ1A 4GGPA 3BHJA 3G0OA 3VDQA 2EJVA 1DC3A 3B1KA 4CMKA 4YAEA 1Q0HA 3PYLA 4LISA 1PEDA 1ZFNA 4A27A 1DRVA 2OXIA 2O3TA 5I7FA 3AU8A 1G6KA 4TZKA 3I9NA 3MJTA 1B7GO 3ZV6A 2BGKA 4E5KA 1D3AA 2P68A 2Y66A 3PFWO 1R0SA 3PZRA 1KETA 4YAJA 3ZZNA 1XEAA 2EKPA 3JQAD 3JV7A 4B4UA 4XQGA 2RHRA 4DIFA 3T4XA 4XD2A 3NDRA 5EQDA 3PHIA 4NFYA 4CLXA 1Y9EA 4YAGA 4NHEA 2B0JA 3P19A 3P5SA 4P4GA 5CAEA 3RFTA 4JP3A 4OJNA 3JD4A 3NUGA 4PN3A 2CD9A 4Q3CA 3GZNA 3PHJA 4HBGA 3WIDA 3GQVA 1PQPA 4CMAA 2JCVA 3KYDB 9LDBA 2B35A 5G4LA 1HYEA 2NQTA 3LT2A 2ZTVA 2BI7A 2VWGA 3ZDFA 2YZ7A 1NQ5A 5AXCA 3F6YA 3DMYA 3RUFA 1Y8QB 4BB6A 4BQPA 1FF9A 2OUIA 4CQLA 1OZAA 4MVJD 3RUHA 1GUZA 5KVCA 4J49A 1GU7A 1HE3A 5A3VA 1UXJA 3WWZA 3PRJA 4YJGB 5TJHA 1TA4A 2B69A 1K0UA 3GAFA 1V6AA 3WYBA 5KWEA 4ESOA 3LSYA 3GMSA 4EEXA 1M6HA 4HFNA 4AL4A 3JQ6A 3P7MA 1KOLA 4N5MA 1BRMA 4YJFB 2FPPA 2Q4EA 4LSMA 4FPXA 4O6VA 5KKCA 1VE9A 2DAPA 2DTDA 4GMFA 4N7RA 4RQTA 3GVHA 2Q45A 1CRWG 3HDJA 2VWPA 1FMCA 1KEVA 2C5EA 1C0IA 3C1TA 4Q3BA 3X2FA 4GKBA 1AXGA 2X58A 5B4TA 5COQA 1SC6A 2X9NA 1NVGA 5KVVA 3QVSA 3R3JA 4PLTA 1IPFA 4Q39A 1SNYA 4WCFB 1ZUD1 3RIHA 4DPKA 1D1SA 3GF4A 1LDYA 2ZB4A 3DFUA 4IUYA 3RWBA 2HK8A 1OC2A 5DT9A 4WKGA 4FQ8A 1PGNA 1YGYA 1MFZA 1OBFO 2Y67A 4QO8A 2VYNA 2PGDA 4HADA 5COBA 1KERA 3ZU3A 4X54A 4N54A 4KTTE 2DC1A 2OHXA 2GR9A 5KOIA 4NPCA 3P2YA 3W8EA 1DIGA 5EJ2A 1NTOA 3W8DA 4GKVA 3VVCA 5EIOA 4Q3EA 4RPHA 2EF1A 1O5IA 3OJEA 1D8AA 4P4NA 1NWHA 3TZHA 4II3A 1RKXA 2X5JO 3AUTA 1LDBA 3F1LA 2VQ3A 4TMFA 4RORA 1PS0A 3D3WA 1KVRA 3GT0A 2A4KA 2ZJ0A 3TDKA 4YT4A 1XHLA 4ZHSA 1YKFA 3INTA 1YQDA 3JQFC 4CMCA 3H9QA 3U4HA 2D0IA 4BB5A 5JC1A 1H9BA 2PGLA 2F1KA 4ZQFA 4RLSA 1AE1A 3EY4A 1GYQA 2YW9A 3C8MA 5T6BA 2PR2A 2R00C 4UREA 4MJLA 5GY7A 4XX0A 4YACA 1I3NA 4BNJA 5ITVA 3BTUA 3HADA 3K2BA 4HXYA 5KCZA 4NG5A 2O7QA 3F5QA 2C7GA 3HQ4O 3OJ0A 1EVJA 4YCAA 4I5DA 3BMCB 1PR3A 3O03A 1E6EA 3C7AA 4ND2A 2HK7A 3AUSA 3AU9A 1NWCA 1JW9B 3CTMA 4Q3DA 1MV8A 3PWKA 3DZFA 3E03A 2ZB7A 1MGOA 2A94A 3PDJA 1C1XA 4JBIA 3ENNA 3DONA 5L3ZA 1UAGA 4CQMB 3BMNB 5AXDA 4W6ZA 4CPDA 2J5KA 5JDCA 2ZCVA 1XYGA 1HDGO 2AQ8A 4WOKA 1XKQA 4XYMA 4CM4B 3RU9A 4U7WA 4YT5A 4RCVA 4YAIA 1LSJA 1U5AA 4HNGA 3GUCA 1Y81A 1GTMA 1I33A 1VJ1A 3TF5A 3ROQA 1Z73A 3ASVA 4ZQBA 1R66A 4E5PA 1GZ6A 4XQCA 1ADGA 3RQSA 4E31A 3B70A 3H7AA 3JYNA 3D5TA 4QFCA 3TOZA 5A9SA 1U3VA 2NLOA 5LDGA 3O9ZA 5T57A 4KUEA 4GVXA 2EW8A 3DWFA 2H5LA 3ONEA 5TF4A 2PKQO 4JK3A 1PJ3A 1H2BA 4I5FA 3E82A 4XIYA 3WS7A 2EGHA 4UUOA 1YQGA 1ORRA 5I9MA 4FD3A 1YDWA 1FJHA 4A5OA 3UGKA 4J4TA 3EW7A 2VTDA 3H3JA 3LT0A 3DBRA 3AY3A 2EEZA 5B37A 3JQFA 4LVUA 5TX7A 5I7SA 1I24A 5BNFA 1HDOA 3ZNQA 1FDSA 1Z45A 1WDMA 3ZHBA 4AJEA 1EBFA 4MVJG 1ZJZA 3I4CA 2R00A 4KQXA 1E3WB 1ZIDA 4B3IA 1E7MA 1LC3A 3JTMA 2DKNA 4KP7A 4GLLA 1M76A 2FZEA 1R6DA 4GH5A 7MDHA 4XKJA 5EQFA 1RM0A 4OKIA 2I9PA 3GNQA 2AE2A 3L77A 3CPSA 4JROA 3U4CA 3OMLA 4D46A 4I1IA 4YWJA 4EEZA 4GSKA 1DAPA 1E7WA 1EUDA 3VOSA 2CVQA 4E2ZA 1WNTA 4UVEA 2P9GA 4ZVVA 5JO0A 1LSUA 2VHZA 2FHSA 2PK3A 4IQGA 2VNAA 3O8QA 3OQ6A 3RVDA 4H7PA 3JD2A 2JJYA 2NTNA 4DYVA 3VHRA 1JQBA 5JY1A 3W6ZA 1P74A 4R16A 3LK7A 1PGJA 3WQQA 3A1NA 2JFFA 3ONDA 4XEHA 4AJJA 3ETDA 4O1MA 1MXHA 2WD7A 5TC4A 4CMBA 5AXAA 4JBGA 4CR6A 2FSSA 3IKTA 1N9GB 3HFSA 4NBVA 2TMGA 4BNHA 2VYVD 3H6KA 3PTZA 4MP8A 4JNKA 3A9WA 1EE2A 3V8BA 5L9AA 2PH3A 4IXTA 3L9XA 2ZATA 5GZ1A 2RCYA 2J5QA 2VRCD 3RI3A 3DTTA 3K73O 5DOZA 1WAMA 3Q2KA 4RPGA 3U4IA 3UXYA 1EVYA 1I01A 2WWRA 1E1KA 3PVZA 5FFFA 1B3BA 3RFXA 3JQGA 3DZIA 1NHWA 4Y98A 2ZYGA 1LDNA 2BELA 1DO8A 3ADPA 4CQLB 3JQDA 4FCCA 3V2UA 2WEKA 1IPEA 1LSOA 2PWZA 2IYOA 1T4DA 5ILOA 1DC6A 1X14A 2X4GA 3GR6A 4HV4A 2NTVA 4IBOA 4YRDA 1I2ZA 1C14A 3D1LA 3ANLA 3ST7A 3W1VA 3UCEA 1WVGA 3LC7O 3GNTA 2AMFA 3GVXA 2B5VA 3S1LA 3VPFA 4PLWA 3TZ6A 4XYBA 3IJRA 1GDHA 1IHYA 2ZTMA 4LK3A 1HDYA 2FR0A 3VPXA 3UOGA 3VZSA 4M1QA 4PG5A 3WGGA 4Z9FA 4B8WA 3AUUA 1T25A 2O3UA 3H9UA 3NJ8A 3I3OA 1YL5A 1IB6A 4XGKA 1HE4A 1U1IA 5DP1A 4G5HA 3WGTA 5TIIA 4OSOA 3AFMA 1Y8RA 1KVSA 5G0VA 1V3UA 2J3HA 2RAFA 5DULA 5CEFA 2EG9A 1PL6A 3AFNA 3FNFA 3JQ9A 4AJOA 3WYCA 5HS6A 4R68A 1H6DA 2ZCUA 1T2FA 4DREA 1TT5A 5JY6A 4BNGA 2VZ0A 3PIIA 1UDCA 1PJSA 4RZHA 2H1SA 1T24A 5H83A 4HWKA 4CL8A 3GG9A 4Y9DA 1Y6JA 4DTIA 1ADCA 3FHLA 1MB4A 4BNFA 3K2EA 3U62A 3WGOA 4CM9A 5DCWA 4PIVA 3ANMA 1XU9A 1JA9A 2NADA 4YA6A 4XWYA 5TQVA 2GYYA 3FR8A 4DPMA 3KM0A 4PZDA 3MOGA 1H2HA 1D4FA 1N7GA 3LT4A 1NFFA 5K0ZA 1JVSA 4NBTA 1B8UA 2FN7A 1EVZA 3PJGA 1MFPA 1A9YA 1T4BA 4J1TA 1QP8A 3F4LA 4M87A 5IF3A 4N18A 5JAZA 2PD4A 4PLYA 3RUDA 1V3TA 1E7RA 1Y8QA 3V1UA 4M86A 3JYPA 3FPCA 3BHIA 3GRKA 3WICA 3QA9A 3DR3A 1BGVA 5JAIA 1LLQA 2BFOA 5KTKA 4DBZA 4ZGWA 4YJGA 3V1TC 3ZU4A 1Z7EA 4ZRNA 5JBIA 4CM1A 4WNCA 3MWDB 2O2SA 1T2EA 4KDFA 1CEQA 2JCYA 3B1FA 3R6DA 4K1LA 3CMCO 1A5ZA 3TZKA 1TB4A 3K31A 4NU5A 4BMNA 3FNGA 4RVGA 3SLGA 4YJFA 4OOEA 4WASA 3T7EA 2Q46A 4DRYA 4BO0A 2GGSA 4NBUA 1DLIA 2CDCA 3FBTA 3LDHA 4DQVA 1QYXA 1BWSA 1P31A 1P1HA 2ZJ1A 1EFKA 2Q3EA 1GCUA 1PQWA 2OP1A 4QTZA 4XR4A 1HLPA 3H9GA 1R12A 1T26A 2JD2A 5A06A 2GN9A 3GGGA 2QZ9A 3MJCA 1YB4A 1YBVA 2AEFA 1J4AA 5BNIA 4CLHA 1L7EA 1PJBA 4OXNA 4TRNA 1WDKA 2YJZA 4M49A 3WR5A 1TXGA 1LEHA 3E9NA 4Z3KA 4NMHA 1K2WA 3VZPA 3WGHA 5A9SB 4JGBA 2W2LD 5A05A 2UV8A 3KOUA 4DYDA 1XCBA 4R1NA 1U8FO 4IIVA 4ZQEA 2BI8A 3VZQA 2FMUA 3DZHA 4QSMA 5H81A 2HMVA 2VN8A 4J91A 1HETA 3I9KA 4MOWA 2OORA 1P1JA 1UJMA 2JD1A 2J3IA 4XR9A 4TVBA 3OBBA 4PVDA 2FSVA 2WSBA 2WYWA 4U0KA 1ZZEA 3DBRB 3ZV3A 4J0FA 3CE6A 4YRAA 4AJ4A 4K28A 1PJTA 1BHSA 4XJTA 4P4LA 3IC5A 4RQUA 3KXDA 3ZHZA 3B1JA 1HWYA 4NI5A 1MC4A 1NQOA 3PLRA 4BO6A 3WGYA 4NFSA 1YONA 4DIBA 2ZYAA 3OETA 4QXMA 1I5RA 1K3TA 4R01A 3C1OA 3AK4A 2Y99A 5JSFA 1KEWA 4FOOA 1ISGA 4CM6A 5ER9A 3WMWA 3BMCA 4H16A 2NNLD 2Q1UA 1BW9B 2B5WA 4J7XA 2G76A 1LA2A 3BHMA 5DCUA 1HDZA 2VT2A 3KLMX 4M89A 1NPDA 3MCVA 4IM7A 3VZRA 4Y6SA 2Y1EA 4J4HA 4BMVA 2J8ZA 2JHFA 1YL6A 2EV9A 3BMQB 4CQMA 4YQZA 3BMNA 1U5CA 1LLDA 2D2IA 4FJ0A 1B8VA 1HXHA 3WMXA 2HKIA 2O4CA 2HU2A 4R69A 3DAGA 5IN4A 3GEDA 2XXJA 4ZA2A 3ZNPA 5IXSA 2LDXA 3JQBC 1FK8A 4CM5A 1JWBB 1SMKA 4B3JA 1H0KA 4JXKA 2XXBA 1KIFA 1B0AA 4FFLA 4D3FA 1R4NB 1K6XA 2QRKA 3VC7A 1PZHA 5DN9A 4FB5A 3RJ9A 4KQWA 1EEHA 1E0DA 1W6UA 2WM3A 1QYWA 3K96A 5DBFA 3GPDG 4CR7A 2EKQA 4MKXA 1I2CA 1VC2A 4Z9YA 1I0ZA 5FYDA 5HA5A 4HUJA 5C7IO 5BQFA 3KTDA 3TZCA 4ND4A 4ND3A 4D45A 4PLFA 1I3KA 4TWRA 4F45A 1PL7A 4MIEA 1YJQA 3OJLA 4D3SA 2O23A 2X0RA 4HFJA 4R1SA 4ALNA 5ADHA 1EE9A 5U9CA 1GV0A 4RVFA 3JQAB 2B37A 3RUAA 4K6CA 3UN1A 1EDOA 4D79A 3EYWA 2O3JA 3ZW9A 2VZ8A 1VI2A 4UULA 3OSUA 3VKUA 3ICCA 1IOLA 5JFOA 3M2TA 3NAQA 3HWRA 3LF2A 4ROSA 4N5NA 3PJFA 3QVOA 4ALLA 1PJLA 2SCUA 4J2OA 3OQ1A 1Q2XA 3E48A 5J23A 1I30A 5HS4A 4Q3NA 5L4SA 5A04A 1DOHA 3UUWA 4UUPA 1E3WA 1P1FA 1YRLA 2D5AA 3F46A 4Z9XA 1YDEA 4ZU3A 2DPHA 2V6BA 3WX0A 1NFRA 2Y1OA 3IP1A 4HFRA 5T5QA 3RUEA 2VUSA 1YXMA 1P3DA 1F12A 1ZSNA 3F1KA 3I5MA 2P2SA 3ZWVA 4YEDA 2AW5A 3GA0A 4YRBA 4KOAA 1DPGA 4OSPA 5ER6A 4BQRA 2ZB3A 3WLEA 4GI2A 3U5TA 4FJ2A 3TSCA 3EUWA 2YFHA 3ZNNA 4IQ8A 4DBVO 1TT7A 2NM0A 1ADFA 3TL2A 4S1VA 2GF2A 4PZCA 2HSDA 2BGLA 2VCYA 1E3LA 4RPKA 3KO8A 3JQBA 1PZGA 5CHEA 3DC2A 2IZZA 4FOSA 1VJ0A 1TT5B 2CVZA 1Z74A 4GLOA 1NX6A 4EGFA 3C1AA 2PD6A 4W4TA 2JCXA 1YWGO 2W2KA 2P91A 3O38A 3FWZA 2E82A 3WG9A 2QYTA 1F8GA 1QV6A 5JCJD 1PWXA 3WXBA 3CEAA 4RDIA 4CMGA 4D7AA 5B1YA 2BMAA 3OQBA 2BH9A 3E1KA 4CMIA 1N9GA 4RO0A 4I5GA 4QECA 3DXFA 4UAGA 3AM3A 1XQ6A 1LDMA 4JP2A 3H5AA 1MXFA 4MDHA 4RPLA 2Y93A 3QJ5A 4YTEA 1HYGA 2CDAA 1ZK0A 3D4NA 1JKJA 3KZVA 1IUKA 3G79A 4I08A 3QWAA 4E2WA 3ETGA 4ZJUA 9LDTA 3PJEA 2NSDA 1UH5A 2DFVA 4M8SA 2VUTA 3CUKA 4G2NA 3UFXA 3U49A 2DBQA 4YYZA 3MZ0A 1GUFA 4IY1A 4BO3A 1ZK3A 4UEOA 3UKOA 1C0LA 5L4LA 4IXWA 2YV2A 5A5EA 3O4RA 4CV1A 3GMDA 3DHEA 1FDTA 3DBLB 4Y6PA 2DQ4A 3RCBA 4EUEA 3HZZA 1XGKA 1N92A 2WYUA 4MPDA 3U9LA 4FC7A 4R5MA 1YE3A 5AYVA 1H6BA 3KLPX 3TL3A 1SBYA 4J1NA 3I83A 4IIUA 3WSWA 5AQ1A 4Z0TA 4FFMA 1YOVB 1XA0A 3H9EO 4J7CA 1E7QA 4Z6KA 1A71A 4BNXA 2HJSA 5L7TA 3KUXA 1ISFA 1DFHA 2Y1CA 1I36A 3HHPA 1V9LA 4YB8A 3KETA 4YDRA 1IZ9A 2UYYA 3AI3A 3PZBA 2WJPA 3HDYA 3WOHA 3S2GA 4XA8A 3TFOA 5AOVA 1GFSA 4OHUA 1I10A 3NRCA 2BFMA 4WGGA 1MA0A 3AJRA 2QIOA 1P1IA 1F06A 1QLJA 4BNNA 2JKVA 4IDBA 1WWKA 4A10A 4E4YA 1AGNA 4LW8A 1Q7BA 1E3EA 1PR9A 1Y5RA 2DVMA 2EHDA 3L6DA 2BFPA 3OA2A 3TRIA 4C7KA 2AG5A 3CSDA 4G65A 4E0BA 1LQTA 3HE3A 4M55A 4TQGA 4R51A 2FZWA 2DUUA 2I99A 1ULSA 2B36A 1C3VA 4R1UA 2E49A 2OOSA 4B3HA 2XOXA 2X7HA 1IY8A 4IMRA 1VSVA 4R41A 3NTOA 2HRBA 2QG4A 1YS4A 5DDIP 2W2LA 1XELA 3D4OA 3ICPA 4I8XA 5FEUA 1VSUA 1HKUA 1T2AA 3BA1A 2W98A 1GZ4A 1F8FA 5KJ6A 2ZTLA 1U2GA 2FRDA 4BUCA 1DFGA 4IQ0A 4A03A 1TLTA 4W9NC 2HRZA 5ENVA 5IDXA 4R54A 2I76A 5LDHA 3C24A 3NJ4A 1TI7A 4OO3A 1PU2A 1XU7A 2O50A 4D0RA 3WB9A 4C7JA 4PLPA 3AOGA 4TKMA 1UUFA 1YQXA 4E5NA 3OIGA 5I8ZA 4BGIA 4C4OA 1HT0A 1NPYA 3F47A 2Y0DA 5G0TA 3N74A 4AFNA 2IZ0A 2QZZA 4B79A 3PI7A 4LGVA 4IS2A 2GERA 5L40A 2V6MA 3L9WA 1ONNA 4QEDA 1AUPA 3HN7A 3TPCA 1H94A 5JYDA 1UZLA 1WZIA 1E7SA 2RBEA 4AJKA 3D4PA 1LUAA 1VM6A 3W4JA 1QORA 1R16A 4WEQA 4MKZA 3FRJA 4RV9A 1E5LA 3TFQA 4B4OA 3MJVA 2BLLA 4AVYA 2GPTA 5U4QA 1K5HA 2I65A 2Y0CA 4E13A 3DZJA 5EMHA 2IXAA 2G17A 1ZXLA 3ANNA 5A5FA 5K6AC 4TSKA 4IDCA 2X9VA 2GRAA 1KBZA 4CM7A 2GASA 1HSZA 1VPDA 2ILTA 3F9IA 1YOVA 3OM9A 3WJAA 2EERA 2IXBA 1NXQA 2DU8A 4E21A 1QXSA 3BMOA 4Z0HO 4ZQGA 4Z0PA 3STHA 3NDJA 1X15A 1ZK1A 4EZBA 2Z5LA 4GPD1 4PGFA 4BKQA 2XF8A 5CPFA 1KEUA 3DAFA 2VWQA 4BO9A 1X1TA 1CIVA 4WLNA 4BO8A 3RUIA 5JMWA 3GNSA 2BKAA 1VJTA 3FN4A 3GDFA 4RVHA 3B20A 2YFQA 3E6AA 2AE1A 1B26A 2E37A 4ONEA 4D0SA 5G2OA 5B12A 2NU6A 3BYZA 4QQRA 1VKNA 3INGA 5ENDA 1GQ2A 3VVBA 1GZ3A 1E1NA 3PYMA 4W9NA 2FPIA 3DQPA 4DLAA 3EAGA 4FDAA 3C7DB 3PQFA 1HDRA 4L73A 4PFJA 4GWGA 1RWBA 4EDFA 5TT0A 1DB3A 3NDIA 5C3MA 1BTOA 1D1TA 3Q6IA 5DCYA 4YT8A 3R0IA 3GG2A 1EMDA 3SVTA 3OIDA 1ADBA 1FDVA 3WQRA 1BW9A 1ZW1A 4WK6A 4B4VA 4E5MA 4WNIA 4IJWA 3RFVA 1SEPA 3DMTC 4E32A 2X0JA 1QLHA 1P0FA 1C1DB 1CQJA 3BMQA 1OMOA 3S2IA 4GX1A 4IMPA 4BO7A 5IDYA 5A9RA 3SJ7A 2EW2A 1CQIA 1ZNQO 1ZH8A 2TMDA 2VOJA 1B8PA 4L4XA 4MVJP 3INRA 3QSGA 3WNVA 2X23A 3N58A 3GC6A 1DXYA 1LDEA 1BG6A 1X0VA 3PGJA 1WDLA 4JJFA 1CERA 1BXZA 5K6AA 2DT5A 3JYQA 4J1QA 4YAKA 3LC2O 1YBMA 2W2KB 1DIHA 4GQAA 3IKVA 2C5AA 1IHXA 2JAPA 1R4NA 2QYSA 4XYEA 1P9LA 1X0XA 4K6FA 4KMSA 5JXWA 2Y1GA 3RSHA 1QYCA 1V8BA 4CMIB 3H9JA 4IDDA 3BXXA 2OBNA 1ENOA 4PG4A 5LCXA 3ITDA 4XCVA 2C7VA 3QHAA 4XB2A 1F0YA 4K9DA 3I52A 3ROMA 3ZI0A 1QYDA 3GN2A 4E30A 2EXXA 1EQ2A 5JCJA 1PS9A 3LVFO 1U8XX 1VL8A 4UVHA 1SOWA 3JQAA 3DOJA 3OFSA 3HDHA 3W6UA 4LSWA 3EGOA 5L7WA 4CUKA 5EL0A 3NV9A 1HE2A 4DMMA 2W4QA 4IDEA 1LQUA 2CVOA 2ZQZA 1GPJA 1JDJA 4CLRB 4MKRA 4L0QA 4PLVA 1CETA 1NBOA 3QP9A 2WYVA 2Z1MA 3DBHB 3KRTA 4GX0A 3WBFA 2GN4A 3GGPA 1HYHA 4CLOB 3K8ZA 1PIWA 1G0NA 4N5LA 1DHRA 4MVJA 3F5SA 4O0LA 4FFPA 4TRRA 2AA3A 4KTVE 1NQAO 3RBVA 1A4IA 4GX2A 2W8ZA 1GYPA 3DMTA 2AQKA 4ZRMA 2J3JA 5EINA 4MVJI 4XJSA 3QLJA 4JBHA 3AUAA 1LX6A 3HN2A 4HNHA 4CV2A 1GD1O 3ZWYA 4E3ZA 2FR1A 1R15A 5B4VA 1O95A 2RHCA 4GSLA 1KVUA 1HDCA 3EMKA 3GPIA 4R9SA 1EUCA 2NACA 3RROA 1SZJG 2XPCA 2RH8A 1FDWA 1NM5A 3UH1A 3RJ5A 3QIVA 5LC1A 1BVUA 2V65A 1U7TA 4U8GA 3RKUA 3WTCA 2FOIA 1HLDA 3G49A 1KC1A 2PZMA 3ZGYA 3QVWA 4LCJA 3V2GA 6ADHA 1B2LA 4PG8A 1ISHA 2B4TO 2EKLA 2YQ4A 4UVIA 1JU9A 4J0EA 3I6IA 3KEQA 3SBOA 1UXIA 4F6CA 2IODA 2DBRA 2YV1A 3WGIA 4IDGA 3DAPA 6LDHA 2X86A 4EJMA 4XZ3A 3NGXA 1PGOA 2HLPA 3V1YA 1ARZA 2C07A 3DHYA 1NNUA 5IFLA 2Y1FA 3ONFA 2HDHA 4NFHA 2G1UA 3G17A 4K26A 4BNYA 3MJEA 1X7DA 1TVEA 4A7PA 3M1AA 4BGEA 3RD5A 2HCTA 3K30A 1MP0A 4Q9NA 1UR5A 2AG8A 3QVTA 3GUYA 1DLJA 1WP4A 2Q1TA 2HMSA 3FD8A 4NDNE 1SEVA 1F17A 1K6JA 3A28A 4BMSA 4IDFA 3DBLA 4J43A 2P4HX 2ZB8A 2C20A 2GDZA 4BVAA 3PLNA 3EC7A 1V35A 1RM4A 4CMHA 2P5UA 2Z95A 3C85A 3HDQA 4BKRA 1ISIA 4NBRA 4J7UA 2OMEA
chains in the Genus database with same CATH superfamily
5ESWA 4XRGA 5CDTA 1X8JA 4JX8A 1F2UA 4GBED 5JVDF 1UXGA 1A3CA 4AY3A 2D5IA 2GZHA 2W11A 3EIQA 3KR0A 1DELA 2TMKA 2CZCA 1JEOA 1E6MA 2GBLC 1WR8A 3N86A 2LR0A 1UK9A 3R9IA 5E6RB 2A35A 2QL5A 1XTJA 2FPWA 2H4JA 2V5VA 4HDRB 2HPVA 3I32A 3VTFA 1CIJA 1NSTA 3IB6A 4WFKA 3FFWA 5MGBA 3K0CC 3VHLB 2N3ZA 3D7RA 4N01A 3JQCA 4V0LA 2XUKA 3L7IA 3O0TA 2JFHA 4RANA 5JD6A 5B53A 1W47A 2PTGA 3I2KA 1N2IA 3OSZA 1W2GA 4DKXA 1MIOB 1ODSA 5C8DA 2ZYWX 1N2JA 2P0YA 4NLLA 5AKEA 1OYYA 2ZM5A 3T38A 5JATA 2ODTX 4MUFA 4JV5B 1RHRA 1YZ3A 2JAXA 2JFPA 3FNIA 2Z09A 4ESEA 5B6JA 4XEUA 1G41A 4YCLA 3OIFA 1X19A 2X4DA 3ANXA 3IE2A 4MEBA 3JWJA 3U4DA 3V3TA 4M9RA 2VYND 7REQA 4L4ZA 1HF3A 3BFJA 5T4BA 2HO4A 2Y6VA 3GJTA 3WO1A 1PJCA 4PBSA 1AKUA 2XE7A 4D0LB 2VAWA 3FCYA 2H7CA 4HQNA 2ORYA 1P9WA 1Z26A 5BPFA 5CDGA 5IDQA 1H6AA 3ZY3A 2DCUA 2PY6A 4P33A 3OZRA 4O5OA 5F7OA 1R10A 3BCUA 2QRQA 3CR8A 1Z4QA 1N57A 2E5FA 4PICA 2JA1A 1STOA 3EHEA 3C7KA 3VMMA 1FC0A 3GCZA 4EO7A 4KGZA 5LOVA 2O7RA 1K4MA 2XIQA 5IMBA 5A7FA 1QCDA 1O6GA 1C1YA 5L4NA 4ZAVA 5AVXA 1CR2A 3I5YA 2XYHA 5TPWA 1GTG1 4OHKA 3ZDRA 2IBMA 3Q12A 4LXYA 3HV0A 1M6NA 1CK4A 1JHPA 5TARA 3URMA 1UEXC 1BVRA 3O8BA 4MYSA 3PDIB 3C3DA 1WW2A 2WD9A 1GV1A 3E9MA 1O9HA 5BQPA 2JGRA 1DQYA 1GGFA 1JVNA 1YFKA 2NUAA 4Q3AA 5HWSA 3UMMA 5HK9A 2PNJA 3NZEA 3ZWWA 3ASUA 3F78A 2ANBA 2ODPA 16PKA 3X1XA 2BFDA 1MX3A 2D74A 2C3MA 3A27A 3B1WA 1NXWA 3VPHA 1BD4A 5JRJA 5B6IA 1VCIA 2H5EA 5J58A 1CP2A 1KMQA 1LNQA 2VCHA 1SD5A 3GDGA 2JFUA 3KUKA 3PPVA 1Y3HA 1QWSA 4NF2A 4BRUA 3S81A 2G67A 3UWPA 1XOIA 1SQ0A 5DGXA 3FCOA 3ZWPA 2DWCA 5E7IA 2ASEA 3ZJUA 3V34A 3QUAA 1W73A 2VNJA 3ZIAA 1K7YA 3X1KA 2FWAA 3HY3A 3R4CA 5IAAA 1ECPA 1QH8A 2OCIA 4JLSA 3A4NA 1HOTA 1V7QA 1XMJA 2FK8A 3QKSA 1F4VA 2Y68A 3Q8WA 4MP6A 3U40A 3AV3A 3NWEA 5IG2A 1SHJA 2R6JA 4M88A 3VRHA 3FNEA 3JYLA 2R6GA 2D3WA 1GQSA 2C9BA 3DOHA 4LBYA 1Z7YA 2HDNB 4HT3B 3EOBI 4AX4A 1OZFA 3EF1A 3NT5A 1M6VA 1I0IA 1XLTC 2QRHA 3ORYA 4WADA 5I45A 1P1CA 1JA1A 2YJTD 1CWUA 1J9EA 3OJFA 4L4SA 4F3KA 2WF8A 4Q1DA 3GDWA 3ITKA 2X2FA 1CFZA 4IGFA 3UF0A 1U0EA 3BHNA 1F0KA 4B35A 2H8GA 5D8DA 1TEHA 4A6EA 1RPTA 2WDZA 3I9LA 3L49A 3NVAA 2WJIA 2VUIB 1YB5A 4RVUA 4AIRA 4JVLA 2OTCA 1DZ3A 3IXMA 3H0EA 4XGRA 3CX7A 1U3FA 5J63A 1R4MA 2VF8A 4D0GA 1UWLA 4JENA 2RCNA 1TAHA 4RKEA 4GX5A 3NEPX 3OTHA 4RUKA 3G59A 4CM8B 1DAEA 1E94E 2XA2A 3DV0A 3TPFA 2FMIA 4BFTA 3OWXA 1I3CA 4BNLA 4CZ2A 3QE3A 5KTKA 4G0WA 2X0NA 3H42B 1X9GA 2HAEA 4HGYA 2QR2A 2G36A 2CJWB 3H11A 4COOA 5JWRA 4HRAA 1USGA 5BV2P 3AH8A 1L3BA 3L0BA 2FP4B 3O82A 2GD2A 4N47A 3OIVA 1PX0A 5HK8A 3A06A 2GN6A 3D0OA 4MQ4A 4ZVSA 3AOEA 3EISA 5CDYA 4YWHA 1QO0D 1OXMA 5IAOA 3GD7A 1PVOA 1VKRA 3OP4A 5C4GB 4J9VA 3CRNA 3ACBA 3I05A 4L50A 5GMOA 4XFJA 3LS2A 4AU1A 4ZODA 2RIRA 3LT1A 1WQ1R 3DJFA 3F7NA 5HE8A 4DGSA 821PA 4OK6A 3GLIA 2OAGA 2YFYA 1ZSYA 1QE0A 2ZRGA 3E61A 4PYRA 4S3MA 4EHFA 3LMKA 1BXRB 1QH1A 1D9ZA 2GXSA 1QYIA 2I1LA 3MWJA 3CNHA 4NYIQ 1MR3F 3IQGX 3VTAA 4F3NA 4ZVKA 5TSDA 2JBHA 4RACA 1J0EA 1YV9A 2P2YA 1WSAA 3PHLA 1AK2A 2Z83A 4M9ZA 2UKDA 3IUPA 4L76A 2WUVA 3BF8A 5AJYA 1PJ4A 1BMTA 4RF3A 4ZC1A 1W0CA 2W90A 4R31A 4YCCA 4HNUA 1JLKA 1EGQA 4PX5A 3SE0A 1YJ5A 4H15A 3C3BA 1IJEA 3I42A 1QB8A 4HWRA 1YA4A 1S3GA 1P2BA 2RGYA 3KKNA 4NJMA 1T8RA 1BDMA 2BZ0A 1YVPA 4MRAA 2GAOA 4NZMA 3UGQA 4EJSB 4CIAA 1XJ0A 4H59A 4RLFA 1L8XA 1YZYA 1QG6A 4O63O 2XRFA 5FLKA 4UZFA 3HRKA 3RIEA 1V8DA 3HY4A 1YK1A 1ZVMA 2OZPA 3CT6A 2XUDA 1CY2A 2I54A 2VKQA 5CIYA 2M2IA 1QGUA 2R84A 3PQ4A 2WQZA 2AZ4A 3A6GA 1TU3A 1UIRA 3AR2A 1U1DA 4YUAA 5KJCA 3EMVA 4MQMA 5LLSA 4F60A 4ALIA 1D07A 2O8BB 2P9QA 2VJMB 2E4VA 5DTQA 2BCEA 3JQ8B 3D64A 3EGCA 3R0JA 3VAZA 3DLBA 1HUQA 2HNBA 4WLUA 3T3HA 4O2BF 3WMEA 3TWOA 3P2JA 4YQYA 2FGKA 1VG8A 4C0WA 3AJ9A 5HBGA 2J3DA 1U3UA 2OHOA 1NJ2A 1DJMA 3DOEA 3K7EA 3RABA 3Q11A 5IJWA 2P4QA 2XMBA 4ZYLA 3A4IA 1NTRA 1Z75A 1EPUA 1E9VA 3D59A 3VSDA 2Z8YM 2FWPA 2ERCA 1U7OA 4IJ5A 1GTL1 1NASA 2YWGA 4GECA 4C0AC 1M2FA 1IB0A 4H7DA 1XZ8A 2VPZA 4YONB 1TK2A 1YD7A 2WJZB 3BRWD 3H19A 4P08A 2MSWA 3RQIA 2E55A 3QH4A 1GL3A 4DV1B 1H8HD 3QXCA 1ESZA 2WV7A 4PAWA 1MLDA 2K7ZA 2HIAA 2H7YA 4Q4LA 4E6EA 4R2IA 1NHGA 2PZAA 4QREA 5BSRA 4CMJA 4MYHA 3TEJA 3K6JA 2JGDA 2C61A 2I5PO 5BV7A 1DEKA 2D5CA 3KTAA 1DRUA 1ZJYA 2BV3A 4HQLA 5DHSA 5CDFA 1L7AA 2V6FA 4PLZA 4NCAA 3BXPA 5JYBA 3FJ1A 2Z2JA 1K5PA 1BNCA 4GGOA 1X8LA 1QR6A 2OO5C 1QCZA 5HPYB 1E6UA 4JR0A 4MV8A 1WE2A 2FCRA 1CF4A 4GXNA 1LU9A 1NVTA 1FBNA 1RHQA 2AS0A 3ORHA 4DJTA 5HM8A 1QFMA 1OI4A 4FFOA 1ZMTA 1RVDA 4XDZA 2PX0A 5GOTA 1GLGA 4KQHA 5G0UA 4DR3B 3PGLA 2VF7A 5F2EA 2HHJA 1A2KC 5KHLB 3FMIA 3BTOA 1J2TA 1M2VB 1GGNA 1NAHA 1YH3A 3KSZO 5HZMA 2P35A 5I7HA 4JOBA 3IPXA 1RJDA 2BDTA 4PE5B 3HZHA 5F1KA 1E1LA 3MAJA 1M9NA 4FIZA 4QUEA 2Q4BA 1JLRA 3EZGA 1DKOA 2CD7A 3IKMB 4QDOA 4I4TF 1ZM4A 1BEUB 1LLFA 4CUJA 2D13A 3NPAA 2J3EA 4NH0A 3ZY2A 3FOFC 1ZO8A 3ORFA 1BJRE 2HEIA 1NNI1 1DQZA 1O94C 2HA4A 5EJEA 3CVUA 4MQUA 2CXQA 2R2GA 3KSBC 1IQRA 3HR7A 4CUZA 2WM8A 2WMDA 1FEZA 1XD9A 4JQCA 1ZXBA 2JGFA 3N2KB 4HG2A 4L16A 3NKVA 2P41A 4PLGA 3T7DA 1PDOA 2WWVD 4DANA 1YE8A 4RDXA 4FHGA 4AJ9A 4QA9A 4F8YA 3OPYI 4AQDA 4YCNA 1JEQA 1OBOA 2GM9A 7REQB 3W5AA 5C7OO 1Y1TA 1EUYA 1H0HA 2B2CA 2FZ5A 1A7AA 1SKUA 3PPIA 2G9RA 4RJJA 4RY8A 5DMHA 4EYEA 3HZOA 3AR3A 2XOKD 1K88A 3BPSA 1V96A 1GRQA 3HKDB 1T13A 3CBGA 2O3SA 4N39A 5LXTF 2NU8B 3WGNA 4BVJA 4QARA 3DZGA 2JI4A 1UBMS 3QOXA 2XWSA 4M0UA 1J1UA 4EECA 2BFAA 3R41A 4O2RA 4LK2A 1COWD 4DC0A 3GH3A 2FUCA 1Z8FA 2CUKA 2A9JA 3JR7A 4KFRA 1SK8A 5HQTA 1L7DA 1B6SA 1D7AA 2FJUA 4M83A 5DASA 4DQXA 4YT2A 4D4MA 1EFAA 3Q3CA 4LYAA 5H82A 2VLBA 2Z2KA 3CRVA 3GHHA 3QVUA 4M1SA 3I9JA 3HVIA 4BATA 1GYRA 4WLFA 3W5JA 4HWOA 4OFXA 2ZRQA 3CZQA 4BP8A 3GLHE 2WPDD 2H31A 1J8FA 1W5FA 1GPDG 2VDMB 2VTEA 3KYIB 4RDHA 3P4XA 1P7ZA 5AJZA 5THKA 2BZSA 3UM9A 3WYAA 3NTLA 1RJGA 3F90A 1S7CA 2RE8A 4YP9A 5HMLA 2E6KA 3ON5A 4NNJA 3SYKA 5CEJA 4P53A 1PR5A 1OASA 3RSSA 3IDQA 1V9CA 3V8RA 1WVMA 2ZE5A 1Q0QA 3T3EA 3N70A 4LECA 1SVKA 13PKA 3VNUA 2I4LA 4G2TA 4HDSB 3OA0A 4ZVRA 3VH4A 5HKAA 4TN5A 1O77A 3V2HA 1F14A 1NI4B 4QNRA 4V0OA 4RL6A 1D4OA 4E13A 1ENZA 3QPVA 5AVSA 3U3XA 1KYYA 2W6CX 3A1TA 3A7DA 3F3SA 4HFMA 5DLPA 2H7VA 2V7VA 3OCUA 2GXAA 4C7BA 1ORIA 3MUNA 4UEKA 5FUQA 2Y0BA 4OKNA 2DFNA 1O96A 5CH5A 2H48A 5HZHA 4AY5A 2DFDA 3PKIA 2PGJA 1C1HA 1DXQA 3INYA 1RAIA 3D8SA 4QT0A 1UZNA 4J07A 1IYZA 2R79A 4JUFA 3C3YA 5JYEA 3MB8A 2IOYA 4LVCA 1X1SA 2HFJA 3HB5X 1PI3A 4D3DA 4I6GA 4YJKA 3K6SB 1GAQA 3FNRA 1TO6A 3C3PA 3NYRA 4R71A 1P6XA 4AULA 5EMKA 4IIBA 5LYJF 1SIUA 1VMKA 4QU0A 3SR3A 3N28A 1TCCA 2C2GA 4AURA 2D1FA 1U0FA 2IEAA 1I9GA 3N2GB 3CVOA 1NRWA 3LQFA 4RJLA 5EC8A 4K46A 3MOIA 1T3SA 2KYRA 1A8QA 3FOEC 1G59A 2PNFA 1VP3A 4MR9B 3WIVA 4S1OA 1HG0A 2Y3IA 4XGNA 5D5PA 4B7CA 2HNAA 4B75A 2VF4X 1GPH1 1K66A 3P20A 2AFHA 4Y6RA 4N3NA 5JAHA 1IE3A 2EIHA 4JB8A 3T1OA 1AKNA 1PHRA 1DO0A 1IQPA 2EJBA 1T1GA 3C48A 3KAJA 3WL7A 3ETCA 1JLLB 4BVEA 2FNAA 5A4KA 5CDHA 3TTVA 2WHPB 4DJEC 4ALKA 4KUHA 1IY1A 2GN8A 3TNJA 4BV9A 2PBFA 4H1UA 1OOEA 2QMZA 4R5HA 2J5XA 3FLAA 4YPOA 4MVJM 2FW6A 4RVSA 3WAKA 3FTPA 2XMSA 4L4RA 3MERA 2CMKA 2HCFA 1HZZA 4FHZA 3N39C 1XG5A 4K1XA 3CXRA 1YC5A 5F4BA 3U2QA 4CF5A 2V6JA 4BAGA 2REOA 4GVPA 3SZLA 1DAOA 4M6WA 4YMSA 2ISCA 3CH4B 3V7FA 4JH0A 4TVOA 1PT8A 4OD0A 2ZRMA 4G1MB 3B3AA 3SC4A 3KEOA 3O2JA 3PWZA 1FQKA 4L8WB 1DEOA 4E2XA 1SAYA 4IEFB 4TLMB 2WNSA 2ZTSA 5FBZA 3E4DA 3TEMA 1AG9A 2GK4A 2AT1A 1E4VA 1L1EA 4UHBA 4QEKA 2GAJA 3P2MA 4GHWA 1FNMA 4IGEA 5DNAA 1CX9B 3DF9A 3EH1A 1IAVA 2M9MA 3U80A 2AI2A 3OAAD 2Q5IA 2HQSA 4XH9B 5DP2A 4RW0A 3R7WA 4X8LA 1RBMA 1T5TA 4QUGA 2FY8A 1RC1A 3KEFA 2JW5A 1JTFA 3WIBA 3JCZA 4ATNA 3NYQA 4FYPA 3IPAA 1DAKA 5GM2A 1ZL0A 1ENYA 4KKXB 3DO8A 4DXHA 2FF5A 1U8AA 4KVZA 1DJLA 1A9XA 1YS2X 1G5TA 1Y6ZA 2IHNA 1YO6A 4QOSA 1RU3A 3GJ3A 3OT1A 5AICA 1VG1A 2DHRA 2G7MC 2QLLA 3UUFA 3E23A 5KPDA 4TROA 1QVAA 3JVDA 1W96A 3WV4A 1KO1A 4Q9IA 3V48A 2H06A 4FFDA 3WNZA 3HWSA 4C6HA 2PIDA 5LMUB 3QY0A 1JSRA 5KQGA 2G1PA 1XR3A 3KLNA 1P0CA 2ZK7A 4H4EA 4FR0A 3VR2A 4CLEA 1M2JA 2PL3A 3PB3A 4RMIA 1ICIA 4BO2A 2PH1A 2ZT6A 1YK0A 3MGKA 4MWBA 4A4DA 4S0ZA 4CCYA 8ADHA 2GFIA 4RIGA 4G5GA 1JZTA 4DLSA 5JQGF 2ZXEA 5ARBA 3LC1O 2Y27A 1RJ9A 4B6QA 2P9TA 3NASA 4B9EA 5D3MA 1N5LA 4EB0A 4YECA 1KSGA 5F2OA 1FMFA 4Y2HA 4TVKA 1DJQA 1OXSC 4KE9A 4CIVA 4OXKA 4L6IA 2VUUA 5CM9C 4DLBA 5BSGA 2D1YA 2ZRPA 2JVJA 3RDPA 2NWQA 2IHJA 3LHDA 4K2HA 4P22A 3I1JA 6REQA 3L1KA 5A03A 4V1CA 3JAKA 1EE1A 1PT9A 1L4GA 1NOIA 2AFRA 2IWHA 5AW0A 3OE7A 1RABA 2BTEA 3K3PA 3O4GA 4ZOLA 1VL0A 1Z8NA 5AD1A 5HJEA 2C7QA 3C6ZA 4I1OA 1XFAA 2G72A 1BN7A 4QOIA 4MB2A 3DT6A 2XA1A 3GCDA 3IJ5A 1IEWA 3QBTA 3OZIA 4KXLA 1W0JA 4JN6B 4PSKA 5DEOA 3KZXA 1DEHA 5BMVB 3SFTA 1P60A 2A84A 1NFQA 4LHSA 1QG4A 3N9IA 4WEOA 3S8MA 5BNTA 1KEEB 3HM9A 3E05A 5E6UA 2P9BA 2YXDA 1DKLA 1N5DA 3CEHA 1AUQA 4ZT4A 1G7CA 3X44A 1B15A 1Z5WA 1YUMA 4IVPA 4B33A 1QIDA 5ALFA 4Y1EA 1UWKA 4V38A 2YV5A 4KV9A 4JODA 1PKEA 4NS4A 1RDFA 4J0KA 3JVEA 1J8VA 2HWXA 4UOQA 2QA5A 2ZWAA 4JUBA 2IV2X 3RS2A 3TNFA 2P3SA 3R75A 1S4QA 1U4NA 1Q11A 4FINA 5IK2D 3MGBA 1E6WA 3GFSA 2AZDA 4LYHA 1IM5A 2HIGA 1UT6A 2ZBPA 3NBQA 3EPPA 4HUTA 1KQPA 4LMRA 2QW8A 3IHLA 1OV6A 5KHAA 3LZCA 4MW9A 3EDCA 3JQ7B 5J4LA 2XH8A 5TE9A 1VL6A 3ASZA 2RHHA 1NLYA 2YQZA 4IUCS 3EPKA 2OCKA 5DTRA 1Q77A 1SKYB 3EF3A 3G82C 3KJEA 4OL0A 4UBOA 5B64A 4AJHA 4AS2A 3PUWA 3LWNA 4Y8VA 3QUCA 4BNKA 5FWXB 4DS3A 4AJIA 2JCBA 4TRJA 1YS1X 6YASA 2FEAA 3EYAA 3W3AH 5KTYA 1A7KA 3T7IA 5T4HA 3FTNA 3ABOB 3OIWA 5A4JA 4BBAA 1H5QA 2GPNA 5BR7A 4A6DA 3FNQA 5LB4A 4ACBA 1EKXA 2JIMA 3H8VA 4ICIA 4F2DA 5KOHA 3CRRA 5GONF 1RAHA 1SCAA 4RD4A 5D01A 2AFHE 4JXXA 1SU7A 5GJBA 5ARDA 4GZ5A 3DDZX 2EP5A 3EFBA 1WCXA 3DZKA 3ZH9B 1WXDA 5EN4A 3A6PC 1M2WA 4K8RB 5CB6A 5KVAA 1JEJA 1X1EA 2GCOB 2OZEA 2Q29A 3K2QA 3LOUA 4U2GA 5SV2A 3HUDA 3NTRA 4N76A 1D6SA 3L92A 2EFDB 4Y2SA 4DLKA 2ACKA 3N87A 5IN5A 4AG3A 1EUZA 1NW7A 3BE4A 1D6JA 1ZJ6A 4LPSA 3QW2A 1UMCB 3M5PA 1JQLB 1YZTA 4XX0B 3QUQA 5C5IA 5JTUA 3VDRA 3WLPA 4LSGA 2XWJI 3WBJA 4AP9A 2ZJ4A 1OI7A 4KWHA 4RCYA 3CF2A 2PUDA 1E9RA 1XX6A 4ZT2A 4OL9A 4KXYA 4KPYA 3MPOA 4X1IA 4AG5A 4DMLA 1NF3A 1J39A 3FSRA 4NZ9A 1PGPA 2II6A 2IW3A 2NU7A 3M4YA 5IJ9A 3RUCA 3U31A 1DV2A 4PC6A 2EFHB 1ZQ9A 2QN1A 4MVYA 3TD2A 3W5BA 3KKQA 3PFHA 1NAIA 3PSAA 5FPPA 4TKUB 5BV8A 1C9NA 2PM8A 5B3JC 1NX9A 5DTJA 1QU2A 3T5CA 3FWNA 3EEIA 2CHEA 2WHEA 3FF4A 4WTOA 8MHTA 2PHZA 4MQ5A 3ZQ4A 4BP9A 1UMDA 1RRVA 3DE4X 2J0UA 3OLCX 2UU9B 5JS6A 4JP1A 3TSZA 5KOJB 5AHRA 1I13A 1BRTA 1VCNA 1E3IA 1HFKA 3IIKA 1VZ2A 5B58C 1PTJA 4XJXA 3DZ8A 4BL5A 4CXMA 1RWMA 4XYGA 4OUKX 1KE1A 1G9SA 3U26A 1T4CA 3FJYA 1BGWA 2YWEA 1TCAA 1YS9A 3CJTA 4H4DA 3VXKA 4Z3OA 2UXDB 5IT9A 3BIWA 5GONA 3DG9A 5IH7A 1YFZA 1AGRA 1COZA 3TQTA 1W4RA 2GVDC 1USWA 3BIOA 5JXJA 4E07A 3SOPA 4J8PA 2AYYA 1W4ZA 1G21B 3ZTYA 1OXXK 3ZOZA 4D80A 3NCHA 4DKJA 1GA6A 2CFIA 4B2IA 1IVYA 2I1WA 4LWZA 3N59A 3CB2A 1OI3A 5LQAA 4K9OA 4GRAA 4LWPA 3BAZA 5E7MA 1DI0A 2PBRA 1W76A 3BXEA 5IULC 4Y2PA 4R05A 4WZAE 5JPIA 4IINA 3VNRA 4JJ4A 4DIKA 1PUIA 4NJOA 1X1DA 1NVDA 2PUTA 4EUNA 4XAQA 4HGPA 2Y05A 2E4WA 1X7HA 5HVNA 3PT5A 1BMDA 1OYOA 5K3CA 2PXXA 2Q8QA 2XDQB 1FZTA 3S99A 4JKIA 1KP2A 4R8SA 2F48A 4B7XA 1Y5NA 3DKPA 3NBKA 1QHGA 1HFEL 1P5HA 1QTIA 1RAFA 3AJAA 4PRKA 4OAQA 5JD3A 3R7DA 5EIHA 4AX8A 2PH5A 6NULA 4GQBA 1B3RA 3A6KA 2GWRA 3MWGA 2YIDA 3E8XA 1P2DA 1ONSA 3Q10A 4BJHB 1QP0A 4D9FA 3GLSA 1ZOLA 4INOA 4QAQA 3WGJA 4KFUA 3WVNA 1GCGA 4JELA 1U0BB 3TYXA 1QMGA 1ZLYA 1G7SA 2JB9A 1XJCA 2ZS9A 4MCIA 3ZU5A 1I2BA 1CHDA 4BLTA 3ZBTA 1J5PA 2ZIXA 3CZMA 3FPLA 3MTAA 4GC5A 4GMXA 4S1TA 4G0YA 1JT9A 5GGYA 5IPFA 5JJIA 4WE3A 2ZAOA 4JJ8A 5KNLA 2W7TA 5DM4A 1NBMD 4KQMA 1RPJA 4JOSA 2FMFA 4BVLA 2WKRA 5BWBA 2PSEA 3OZWA 1M67A 2ZUCA 1RM5A 3ORQA 2X9GA 4EHJA 2OYSA 4EG7A 5BUQA 1HNZB 3EXFA 1GXSB 3E58A 4G63A 2J9ZB 1QUFA 2QAIA 3QMPA 3EPHA 2QE7A 3IP8A 5DHRA 4EQ6B 3K6KA 4JQYA 1OLOA 3K5IA 4PPQA 1AKEA 3BWVA 5JCXA 1HNNA 3QMVA 4PNZA 1HLGA 2QZSA 3C5WP 1DQRA 4G26A 3IOMA 1QKIA 1KSHA 4CTKA 4TMTA 1VE5A 3E9CA 1PJZA 4PINA 4K6KA 5LB2A 3WL8A 3ZV4A 2VZ9A 4L74A 1RYZA 3DVSX 3B60A 5FOTA 5BVHA 1WXFA 3HCWA 1ZCJA 2P9JA 5CW2A 2KJQA 2R4TA 5HFNA 2CB9A 4FS8A 5HQ3A 2H1FA 3L0PA 5LA6A 5T7BA 2X1LA 2A2ZA 2WINI 3C39A 3OEWA 3O9VA 5IARA 2YUIA 1XTVA 1BQ3A 3ZDBA 2EU8A 4D6XA 2ZCJA 3ICEA 2JFWA 2ZQYA 4MR8A 4HI0E 4ISBA 1R0ZA 4FW8A 5HCNA 3UBMA 3TUIC 2ZJBA 3OUTA 1GQYA 1A4UA 4Z1MD 1KQOA 1VG0B 2OM2A 3O7MA 2JEYA 4IQ0A 4L6CA 3T5BA 3A6JA 4NOJA 2WJJA 5ABPA 1NP7A 5JCOA 1USIA 4RGBA 2GZDA 1PJ2A 3ELYA 4KUGA 5ESDA 2GPBA 3KCQA 2A0KA 2OBMA 3JATA 1NVMB 3RVSA 3RJTA 2OB2A 4BNUA 5JDIA 3HCPA 1YNSA 4ZHQF 3ISTA 2R8XA 2WSSD 3AVOA 4NJEB 1E3SA 1ENPA 2E3JA 3HJNA 3WBBA 4F5YA 3PX2A 3TGLA 1EFLA 2O8DB 1Z82A 3NH9A 2YS6A 3TQHA 2CLFB 1K06A 4ZN6A 2BGMA 2YHIA 1E9SA 3CCCA 3FVVA 4G8CA 4WECA 1UXOA 1GNPA 1YZNA 1DQNA 4HB2A 5IZCA 1RJWA 10MHA 4J2HA 1E1MA 4HOYA 5FRDA 2QVYX 1KVTA 3R3UA 2C29D 1BX0A 4LRSB 5LYYA 4W6QA 3AI7A 3L04A 3ABIA 2XADA 2YNMA 4RMNA 1BCRA 3ZNOA 4OH1A 3D8RA 3TDMA 3TIFA 4DA8A 2JAUA 3WKCA 4LQLA 2XMPA 4GICA 4II7A 5DLYA 1UDAA 3MT7A 2QQ5A 5BV0A 1VB3A 1F2TA 3CH6A 5AO9A 1GM5A 1ML3A 2CK3D 5IVDA 1HEUA 3DCIA 4E88A 5ADWA 2DG2A 2ZVPX 4GGPA 2EJVA 1OA0A 2BM8A 3NM6B 2BFCB 2V3WA 1O87A 3ND9A 3B13B 1E9DA 1RKUA 3EPLA 3R3YA 4YRFA 3O2SB 3BXGA 4HEA1 1U02A 1ZOIA 3MYYA 3MHPA 1G6KA 3BXZA 3R40A 4MWEA 4TZKA 1CZUA 2IWRA 4IJQA 2BFBB 2C9CA 3HVKA 4UNNA 4C3UA 2FEOA 3PFKA 1PG0A 3FWYA 3LA8A 4E5KA 5HJ5A 3VR6H 2YASA 3ESBA 3CONA 5DRTA 4B0PA 1KETA 1QG2A 4NX2A 1QKKA 2MINA 3IHTA 5CH3A 3KTOA 3QJGA 2EKPA 3C4JA 3QITA 3HWWA 5EMJA 4A9AA 4YJ2A 4Q4CA 3OM8A 2BM1A 1RKVA 1U9YA 2QT1A 2C3PA 4NFYA 1JG1A 4XARA 1Y9EA 4CLXA 2PVPA 3LLMA 4DMRA 2B0JA 3O94A 1NA5A 1Z22A 4ZDIA 1KKMA 1SBQA 5LZ8A 4RH3A 4RTOA 3WL6A 2O7VA 2ODEA 2WFLA 3G0HA 3OPXA 3GZNA 3WDKA 3L7YA 3GQVA 1Z2AA 2F17A 3KYDB 2ISSD 2B35A 5G4LA 1W34A 1WV1A 3COVA 2NQTA 3IUEA 1IEXA 3WY9A 1II8A 2GCPA 1MEOA 4G4SP 4RY0A 4XWTA 1DTEA 1NVXQ 2YZ7A 4D97A 2O2JA 2OAQ1 2WJAA 4BKMA 1WSDA 2GM5A 3F6YA 4BB6A 3I64A 3HMKA 4TQ9A 4G5XA 5AFSA 1LK5A 1QIGA 1L4LA 1U81A 1AKRA 3GV0A 1ECGA 1KP3A 1RI4A 3ACCA 2EQ5A 1NXOA 1PW7A 4MVJD 5ALMA 4EY6A 2J1LA 1JKXA 4KBGA 2KBFA 4J49A 3GRYA 2I8AA 4QTUB 4CL2A 3WYGA 4UOZA 3OU2A 3SIXA 2B69A 5FB3A 3IKJA 3HNRA 1N6RA 4YROA 3IRUA 1V6AA 2QRVA 3G9UA 2ADOA 3Q6NA 3WYBA 4XLLA 5C5EA 3DW1X 1U2QA 2O6LA 4HFNA 2FX5A 3IUNA 4UJ5A 3RVNA 1RE1A 3IR6A 1NYQA 3P7MA 1C3OA 4YJFB 2C5HA 4HR7A 2CL7X 3NRJA 1KMNA 2AJ8A 1MO6A 5KKCA 1WCYA 2R4QA 3AHFA 1NP6A 4OMCA 4AZSA 2FSUA 3FOWA 3D6TB 3ELWA 3UMBA 3U7HB 4RM2A 3IP5A 3SG0A 3GLFA 2PYZA 2J33A 3G13A 1WUIS 2HA6A 1N4AA 1XP5A 2VWPA 2PL1A 1KEVA 3CZ5A 3H1PA 4PWZA 5JECA 5CJJA 2GAIA 1O3YA 1C0IA 1VSTA 2RGXA 1G2QA 3PIRA 4GKBA 4QYIA 2XGJA 2JLRA 2ZJZA 3ZE0B 4MI1A 3R3WA 4QUDA 2LWIA 4OQMA 3I28A 3B3JA 3E3NA 1IPFA 1OIVA 3KT8A 4Q39A 3RKSA 3RTAA 2BR5A 1FPMA 1WM1A 3T94A 4MVXA 4CFYA 2ZB4A 3OX2A 1DBPA 4TL9A 1WULS 4KYVA 1PGNA 4KXUA 1YGYA 1MFZA 1FLVA 1Z8DA 2XZLA 3GPCA 4QO8A 5JAOA 1U0OC 2PGDA 3DMRA 1KERA 1VLMA 2LV8A 3H0KA 4X54A 4N54A 2B92A 5COBA 3ZY5A 1TVKB 4AC9A 4OGLA 3U7EB 3B1XA 1ODKA 3BCSA 1X8XA 3QFSA 4OGGA 3TIXB 5KOIA 3HK2A 2A5DA 3LWBA 4IKEA 3P2YA 3W8EA 1DIGA 5EJ2A 2BF4A 4G07A 1J5XA 1LTQA 4I55B 5LBUA 4KIJA 2PXCA 5CLQA 2DY1A 4P4NA 4GOND 3TZHA 3ZCSA 3KL2A 4II3A 2UYOA 3LVQE 5CA0B 1E2EA 2ZUVA 5CGZA 1BU8A 3QQ5A 4LJKA 2F7SA 5F98A 2RHDA 4UNSA 1ZNWA 4MRRA 2VQ3A 1ACMA 4ZI7F 1O4WA 4RORA 2VTBB 1WUJS 3D3WA 4OJYA 2NUPA 3AG6A 2ZJ0A 1ISPA 3AINA 4N5DA 3VR4A 4YT4A 3NB0A 2G1KA 1THZA 2H3HA 2K2WA 5LZ9A 1YKFA 3W2EA 2LIPA 2GPAA 4BX8A 3MCUA 1G1MA 2XMZA 2IEZA 2OR3A 2WT4A 5E4TA 3U4HA 2CJYA 4QOHA 3IBYA 5HR5A 5I5EA 1EJ2A 4K6HA 3BB1A 3QXJA 4NV3A 4RLSA 1AE1A 2RG7A 2ZR8A 1GYQA 3C8MA 5JS8A 1R2QA 2HXSA 2R00C 1CY1A 1WZNA 4TL6A 5AKJA 4YACA 1I3NA 5JVDA 1HQCA 1VRCA 4BU0A 4EG5A 3OHPA 2C1EA 4NG5A 1XALA 1KZ7B 4YCAA 4ARCA 4E3WA 3H6GA 1PR3A 3V6LA 2E4XA 3EDYA 5LLDA 1E6EA 1W49A 5L3QB 3AUSA 1JW9B 1E1RA 3G8YA 3ORSA 1G7RA 4Q3DA 1M54A 2BUBA 1J7KA 4EYOA 1E2PA 1XCOA 2XB8A 1J70A 1C1XA 1AGXA 1X80B 3OX1A 1F1JA 2TRSB 2ZRAA 4ROTA 5L3ZA 2VDKB 3HBFA 4B81A 1PEKE 4W6ZA 4AYWA 5J4KA 1SIBE 3MQ2A 2XUQA 4DCMA 3UMFA 4TT8A 1QK5A 1R00A 4LC1A 1NLFA 2AQ8A 4WOKA 1QUEA 4OQLA 5DXFA 1XKQA 3ZGNA 2Z8XA 3A9SA 2P75A 4ZVMA 2ZI3A 4CM4B 4KITB 1ST2A 4G0ZA 4LFBB 2Y1KA 1IN5A 1LSJA 3K4QA 3G2NA 1SXJA 3L6UA 2V7XA 3GUCA 4S35A 1TZKA 1VJ1A 1INLA 3ROQA 2P62A 1Z13A 1Z5UA 3FAKA 4YMHA 1GAXA 1YVUA 3G2HA 3DCNA 3C8ZA 2R4UA 4H6WA 3AB3A 2GAFA 1ADGA 4BX0A 4E31A 2ZZNA 1FTNA 4UTNA 4OXQA 4UPEA 2BN4A 3FPKA 1XHEA 1FSGA 2IXEA 3H7AA 1G8YA 4IILA 4B85A 4WQMA 2J45A 3M6UA 3NNSA 2FB9A 2NLOA 4JKOA 4K3UA 3O9ZA 1MIHA 3QX7A 4UHEA 4BCBA 1J33A 4HGQA 2I4RA 5DWDA 5H59A 1JQJC 3RVBA 3DP7A 3VGPA 1H2BA 1OYVA 4UTVA 2EGHA 2YFKA 4MX8A 4UUOA 1EP2B 3EHDA 3HH8A 4YHHB 3IYLW 1FVFA 4ER7A 3BE5A 4Y2JA 4MCJA 521PA 4AQYB 3AHIA 2ZAMA 4GI5A 1FJHA 1VGQA 2ZITA 1MHTA 4FQ5A 4WFQA 3UUGA 3FAZA 3LNTA 3AIMA 3DL0A 3ZC3A 3AL2A 1QHHA 5FPYA 3DEKA 2VTDA 2PVSA 5AIBA 1Y3CE 4HAVA 3PD1A 4XCXA 3DBRA 5HCIA 5AW2A 4F3CA 1B6GA 2Q6OA 4L2IB 3NP7A 3JQFA 4XCQA 5E3HA 1WHSA 1XPOA 1CUHA 3VI3B 3Q5DA 5I7SA 3BJEA 4G0NA 3BILA 1RD4A 3PGVA 3PXUA 1T43A 3M49A 3ZNQA 2NPIA 3Q15C 4H08A 1Z45A 1T5BA 1V43A 4M9SA 3Q8MA 1GPWB 1FP2A 1ZJZA 2OAP1 1L7XA 421PA 3ME5A 1W35A 3R76A 1MAWA 2N1MA 1ZNZA 1R88A 3RSFA 1Z4IA 4K9SA 4LPKA 1E3WB 1X70A 1ZIDA 2NT3A 3AY0A 3T0GA 1E7MA 4BX2A 4BGDA 2W83A 1M8FA 2DKNA 3OOWA 4MUKA 4MDFA 1WW3A 3EIOA 2JLUA 4RESA 1M76A 1SUEA 3IUJA 2QBYA 3OTIA 1M2GA 3TW0A 5CIQA 3PPXA 2JFOA 3TS1A 3VZQA 4XFKA 3BN3A 3R9WA 3NJRA 3W5VA 4D25A 4RD2A 2QROA 2W2NA 2JFNA 3ZIAD 2IYEA 3AF2A 4JROA 4GI3A 3VHQA 2X15A 1EYZA 1LNSA 2PWYA 5TDHA 4I1IA 3ESZA 1FFHA 4GLFA 1DAPA 1M6EX 1OX6A 5GINE 3MUOA 3DKKA 1JHVA 3D7KA 4HWGA 2P9GA 4KBFA 4UVEA 2XTAA 5FLEX 5HDBB 5K0NA 4MYTA 5JO0A 3K09A 2R1TB 2FHSA 3OOEA 4ZCRA 1DG1G 3DE1X 3GRCA 3GEBA 4UC0A 5ALEA 1O5OA 3TAHA 2VNAA 2GM3A 2GZAA 2E2WA 3ICWA 1T15A 4MRPA 1X92A 4U7TB 3RT7A 1KOJA 1QV9A 2PMWB 3HUTA 3QHPA 1XEFA 1EI9A 1DBQA 1E4EA 1AQYA 1ECFA 1PGJA 3K2IA 5H0IA 4AN0A 2ZULA 3R6LA 4XEHA 3GNLA 4R1LA 4O1MA 3FKSA 3WQHA 1V1RB 2CKDA 2JHAA 1M5RA 5CXUA 4BFXA 1VHLA 2JKZA 1E5VA 3B89A 4CMBA 4DEXA 5B1SA 3WA7A 2ECKA 5EXDA 3UV3A 2B8EA 1VBFA 2FSSA 3UXHA 4I1RA 4DDMA 3H6KA 3PTZA 4JNKA 4L5BA 3ROFA 2AX4A 2QTNA 2WTNA 4F2HA 1FRZA 1GA4A 1H8EA 2RCYA 3QFTA 3RTEA 2JDIA 5T3UA 3DTTA 3ZHTA 4OMDA 3P2KA 1B8OA 4R0NA 4Y2YA 1TJ4A 3UJ3X 3U4IA 1QHYA 2WWRA 1BKYA 4YRRA 1E1KA 1IY9A 1Q3HA 1JKJB 3GJ6A 3KZOA 4JWKA 4IV8A 4UAJA 3JQGA 4J1TC 3DZIA 2IXGA 2Q3HA 3FZYA 1LVGA 4Y98A 1BMQA 3FUCA 5DXAA 2BELA 4LYDA 4BJ6A 4DBLE 3IUBA 3LCVB 3UFXB 4FCCA 3ZUGA 2IS6A 2JIPA 2R60A 2WEKA 3ED5A 4ASUA 1T4DA 1X14A 1OWOA 2X4GA 1ZGHA 2A59A 4PYNA 1CE8B 2NTVA 4YRDA 5K8CA 5AUOB 3R9XB 1CU1A 1KWKA 3ANLA 2OLKA 3CEJA 4LXUA 4CHGA 2XZTA 3MBIA 4ZANA 1DUSA 3PUVA 1NATA 2YIJA 2YBDA 3BJIC 3GVXA 3OHMA 3S1LA 5KWSA 4HAZA 4KH1A 3VPFA 3NW9A 4X65B 4MQEB 1GDHA 1IHYA 2G25A 4JGGA 1HDYA 3VPXA 2ZRDA 5DTIA 1YHZA 2WIJA 1KFJB 4M1QA 4PG5A 4G1UC 4F11A 3I4LA 3HVHA 3TTTA 2JGAA 3C43A 1GNSA 4ON9A 3CF0A 4Z9FA 4V1CI 2JLXA 4AN4A 4B6FA 1AA6A 1WZ2A 1KU0A 4OYYA 3NJ8A 4AKTA 1XYVA 4YP6A 1H4TA 1IB6A 1OVGA 1C7RA 5DP1A 1E2LA 4OSOA 3O6VA 3AFMA 4L27A 4N1AA 3VU1A 2PBZA 1ELOA 1XDGA 4MPJA 1DIOB 1QGAA 3SJAA 1RC8A 3HVJA 1KEZA 4QYXA 2HF8A 4DA7A 3DDUA 5DULA 5CYPA 4ZZ0A 1LFDB 2RHLA 4HTFB 2HSEA 4N5HX 1HEIA 3FNFA 4AJOA 1RQRA 3L79A 1KDPA 5CVTA 4NMLA 1ESCA 4PZ9A 3DEZA 1SXJE 9ATCA 2XGMA 3FYCA 3T9FA 4RKWA 3LZDA 5H7XA 4U2FA 1NJ5A 5HRCA 2DHEA 1J22A 2I7VA 4GR5A 1PJSA 5DT2A