2C07A

Oxoacyl-acp reductase of plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
251
structure length
246
Chain Sequence
b'KENYYYCGENKVALVTGAGRGIGREIAKMLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNAIAPGFISSISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-OXOACYL-(ACYL-CARRIER PROTEIN) REDUCTASE
publication title Kinetic, Inhibition and Structural Studies on 3-Oxoacyl-Acp Reductase from Plasmodium Falciparum, a Key Enzyme in Fatty Acid Biosynthesis.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 98
structure length 246
sequence length 251
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c07A00
5BT9A 4FDAA 4FJ0A 3OETA 4YRBA 3TZ6A 1DAPA 4JK3A 4LGVA 3RC1A 1ZMTA 3BMOA 4OOEA 3ROKA 5KKAA 4CLRB 3PZBA 1O5IA 3AFNA 4RVSA 2GF2A 4J9UE 2F1KA 3LC2O 4MIYA 2PV7A 5I7FA 3NDIA 4L8VA 4NZ9A 1O8CA 4DLAA 1SNYA 4PLZA 4X54A 3FHLA 1OMOA 3KRTA 3W6UA 4CV0A 5IF3A 4UUMA 4P4NA 2GRAA 1N92A 4RORA 4LVCA 4OO3A 3C3XA 3QWFA 3CE6A 3E9MA 1E6EA 3DBRB 4FS3A 4BO8A 2PGJA 5BR7A 3O26A 3A1NA 1PR9A 1CQJA 2CFCA 3HHPA 3MEQA 4EBFA 2YQ4A 4GSKA 4GLOA 4DYDA 4DBVO 5JDIC 1BGVA 4KQXA 4PZEA 5G4KB 3WLFA 3FR7A 3IJPA 2WYWA 4J6FA 2GNAA 1SZJG 5BNFA 3RKRA 1DFIA 1YH3A 4JN6B 2GASA 3KM0A 4NH4A 3GGOA 2HDHA 2VOJA 4RF5A 1JAYA 5ICMA 2X0NA 4AJNA 2ZTVA 1NFRA 4QEDA 1R4NB 3EY4A 1DIGA 2BLLA 3L6DA 4CV1A 1LLUA 4EGFA 5L53A 3FNGA 4CM9A 3GEDA 1LSOA 3JQFA 3Q0EA 4E4YA 3JQAD 3COSA 2VYND 3ZHXA 1HWYA 1MG5A 1B8VA 3JQCA 3TZHA 1I2CA 4MIOA 5EJ2A 2A92A 3UH1A 1N8KA 2WE8A 3HUDA 4NBTA 1EDZA 1DO8A 3TN7A 2E4AA 5ENDA 4KTTE 3U4DA 3F6YA 1MA0A 4A73A 1I10A 2ILTA 4A27A 4ZJUA 5JNLA 1E3LA 1Q7GA 2CD9A 4WASA 1G0NA 4MP3A 4XQCA 4B79A 4CPDA 5T67A 3PHGA 3TRIA 2VRCD 1D8AA 1LX6A 3JQ7A 3UXYA 3WIEA 2HMWA 3L6OO 4IDBA 3ZNNA 3D3WB 1PIWA 3Q1LA 2Q2VA 3QIVA 1ISGA 1R12A 3GMSA 1DC5A 2HCTA 2CDCA 1PSDA 4JP3A 4XJSA 1C1XA 3PJFA 1E7YA 4BNJA 3QLJA 1D1SA 2DBRA 3GMDA 5FI3A 4D41A 4GAEA 4Z6KA 3EAGA 4OKIA 4ZQHA 5FYDA 1IZ0A 4YB8A 4L74A 4PLGA 2ZQZA 1LDNA 2EG9A 4EI2A 1WDLA 2FOIA 4W4TA 4PRKA 4BO7A 2BFMA 4CV2A 4S3MA 1EE9A 5A5FA 4CMHA 3JQBC 5GZ6A 3TNLA 3GZ4A 1UUFA 1PTJA 1EEHA 2GUGA 1UZNA 3Q9UA 3GNTA 3WOHA 3F5SA 4B7CA 1BRMA 4JJIA 4NPCA 4YAEA 3ZDFA 1H2BA 2V7PA 2NVUB 5A03A 1YS4A 3I9OA 3ZWCA 1MGOA 2Q1WA 5THKA 5CG1A 3K31A 3R1IA 1C14A 3AFMA 3MJ4A 4CMAA 4CQMB 1Y8QB 1P1IA 4ND1A 3QVSA 2IYPA 1ENPA 1FDTA 4OL9A 4TZKA 3PLNA 1BMDA 2EEZA 1A7AA 5KWEA 2NADA 3VH2A 2DBQA 5CP8A 2I3AA 4MVJP 4ZVVA 4P8RA 5C7IO 4IGEA 4XYGA 3IC5A 3CMCO 2O2SA 3WMWA 3GDFA 1KYQA 1YJQA 3WBFA 3WYEA 3IL2A 4JIGA 5AXDA 1JWBB 2X8LA 3EK2A 3JYPA 3EMKA 5ITVA 4E12A 2Q1UA 3EC7A 3RUFA 3JYOA 4IGFA 3LC7O 1AHIA 2AQ8A 3OA0A 1GADO 3TWOA 1KEPA 3D7LA 3N58A 2X0RA 3D4PA 3I9KA 5EINA 3NGXA 4BO6A 1NR7A 3RBVA 2IE0A 4BNGA 4U8GA 2HAEA 2GD1O 3L4BA 4DGSA 2YQ5A 1Y5MA 3ULKA 3WBBA 5EERA 3RFVA 2FP4A 1NQOA 4XZ3A 2GN6A 3PYLA 3RIHA 3DZIA 1YB1A 5DCYA 1ZW1A 1W0CA 1DOHA 2AEMA 1BHSA 1VSUA 3Q2KA 4E33A 3PDUA 5DP2A 1FDWA 5JC8A 4FFLA 3WGIA 4NBUA 4IIVA 1QRRA 2YHIA 1D7OA 2ZB3A 5ADHA 1E7RA 2DUWA 3RAJA 2DTXA 4QXMA 1VLLA 3QWHA 1U3UA 1M6HA 3EZYA 3K5PA 1PQWA 4RVGA 2UV8A 3OM9A 2CVQA 4YPOA 1OC4A 3O03A 4Z9YA 4B4UA 2HRZA 2JJYA 3V1YA 5CPFA 2BKAA 1H6CA 1TT7A 1B8UA 1EVJA 1RYDA 1XGKA 3WNQA 1U4OA 3ONEA 3PFWO 1LRJA 3U49A 5KJ6A 1Y5RA 2B5VA 2PD3A 3FI9A 1DFHA 2C82A 2O48X 4W7IA 5G4LA 5GMOA 4HFJA 1PGOA 2AG8A 7ADHA 3A14A 3LYLA 2EHDA 1EZ4A 4DQVA 1YQGA 1WDMA 5ILOA 3GZNB 3DHYA 4U6QA 2Q2QA 4DVJA 1HETA 4EITA 3RASA 1GV1A 4LSWA 4WUVA 3UCFA 4O6VA 2HJSA 2OO5A 4IXWA 1H6BA 2OXIA 2YFHA 4Q3AA 4RF4A 3I9NA 4RPJA 3DTYA 4ZGWA 3R3JA 4HKTA 1PJQA 3V2UA 2YV2A 3LF1A 4DL9A 4I8XA 4CR8A 1S7CA 1PZFA 1F17A 1LDEA 1EBFA 3IAHA 4IXTA 2NQ8A 4BL5A 5COBA 2A94A 5EN4A 3BMOB 1HDGO 1HDCA 1VL0A 3DZFA 1BG6A 1PZHA 4TKLA 1B8PA 3BTUA 4HADA 3L6EA 3NRCA 3W1VA 4TQGA 3IOYA 4NU5A 4IMRA 3LT1A 3U3XA 3WYCA 1AN9A 3BIOA 3VHRA 3NJ8A 4KP7A 4GX2A 4BNFA 4IJKA 1UDAA 4PN3A 2O3RA 2B69A 3MOIA 4PGFA 2ZKLA 2G5CA 4KQWA 4NIMA 4CMJA 4CQLA 1F12A 1I3NA 3RUAA 1LI4A 4ZU3A 5CFZA 2ZB4A 1NM5A 5K6AC 3GOHA 4CM4B 3MJTA 1ADCA 4XR9A 1KVRA 2Y68A 4XKJA 2NU6A 1NP3A 5CDTA 4FB5A 5DOVA 4M86A 2WYUA 4GVLA 2NNLD 1HLDA 4OSOA 1HDYA 2O4UX 3HFGA 4YJFB 2YUTA 4XYBA 1G0OA 1H2HA 1I2BA 1P1FA 5F5NA 3KO8A 2VT3A 3AUAA 4R5HA 3ONDA 1IULA 2I9PA 5HBRA 2VOEA 4MVJD 5ICSA 4EYEA 4UREA 4L75A 4BMNA 4D45A 4QQRA 4J49A 3DDNA 4XCVA 1WAMA 4NI5A 5A4DA 3H5AA 4GQAA 1XHLA 2ZK7A 4FJ1A 4CUJA 4GMFA 3S2FA 3X2EA 4BB5A 3H9JA 1KVQA 1LNQA 2IZ0A 4GLLA 1WW8A 4RZIA 3ANNA 5G2OA 4FFMA 1M75A 3DMTC 1XLTA 2Y1CA 4YJGA 3TZCA 3V1TC 1T26A 1U8XX 3ZWBA 7MDHA 5L4NA 4WOKA 4JBGA 2NUAA 1OI7A 5LDGA 2PY6A 5TS3A 1X14A 3UW3A 2EWMA 2O3QA 1X13A 4HP8A 3KXDA 1Y7TA 4CL3A 5ITWA 1MFPA 1P1KA 1Z7BA 1DB3A 3HADA 3UICA 1MXFA 4L0QA 2BMAA 2H63A 4DIFA 1E5LA 3L0DA 4A10A 1E3EA 1VRWA 5U4QA 1XKQA 4EJ0A 5C5IA 4IMPA 1N1GA 3JQ7B 4K6FA 5CEFA 5A9RA 2D8AA 3S2IA 3L77A 3C85A 5KVQA 3V2HA 5KTKA 4R68A 4ILKA 3UF0A 2Q2WA 2XXBA 2DKNA 2X58A 3BMQA 1HDRA 5B4UA 5L4LA 5AOVA 1C1XB 1LDGA 3FNFA 3WJ7A 3VH3A 4BQRA 3IUPA 3RVDA 2AQHA 3I52A 2Q50A 1RM5A 2WMDA 3WGGA 2DU8A 4L4RA 1LQTA 4BNNA 1H6DA 3SBOA 5LDHA 4URFA 5LC1A 4AJ1A 3T4XA 1VKOA 2CVOA 2I66A 2B36A 4NNJA 4DPMA 5B1YA 1CF2O 2QYSA 1ORRA 4PG7A 3VPGA 4B4WA 4DBZA 2PH3A 2JCXA 3WJAA 5JCJD 4E31A 1PQPA 3RUHA 1X0XA 1RJWA 4TRRA 2HMVA 5C7LO 4MVJF 1PS0A 1QXSA 2CMDA 5JCXA 3PYMA 1BWSA 3DO5A 4A5OA 3IIEA 4LMPA 3H6KA 1F8FA 4FFPA 1GAEO 3CKYA 3ON5A 3VPFA 3F47A 4BO4A 1CQIA 1JKIA 2AHRA 2W2KA 5A05A 1XR3A 3DZHA 1RKXA 3QJ5A 1DRVA 4O1MA 2R00C 5JO0A 5DBIA 3H9UA 1KS9A 4B7XA 2DBZA 2VWGA 4B7UA 2DUUA 3DHEA 3G49A 2A4KA 4DWVA 1ZIDA 4OGWA 4W99A 4PVDA 2AXQA 3QWBA 4II3A 4YR9A 3EW7A 3HDYA 1GYQA 4TRMA 1EDOA 1GR0A 4PG4A 4E32A 5IDWA 1LA2A 3LSYA 1Z7EA 2VYVD 9LDBA 3VZQA 2X5KO 1HLPA 2DTDA 1U7HA 4RGBA 1TI7A 3OH8A 1U3TA 3UGKA 2NVBA 1BW9A 3JQEA 4XYEA 1J4AA 5I8ZA 2YW9A 3PIDA 3VTZA 1QYDA 3ETDA 2HMTA 3LLVA 1YGYA 2YHIB 3OIDA 4TMFA 2YV1A 4H7PA 4M8SA 4OYRA 1X7DA 2QX7A 2XOXA 1I24A 2QYTA 3A9WA 4K1LA 4DC1A 1LRKA 2BGKA 2X0IA 1AUPA 2DPHA 2W90A 3L07A 2X86A 4K26A 1DBVO 4BB6A 2OOSA 1XU7A 2BGLA 3QWIA 3GRKA 3H5RA 3Q9NA 4UEKA 4D3DA 3ZN2A 2O2YA 5IN4A 5KNLA 1LXCA 3R6DA 1IPFA 1ZVMA 2AA3A 4YRDA 2I3GA 1PGQA 4WCDA 3DMYA 1YQXA 3I5MA 3TPCA 5KJ1A 5JAQA 3OQ6A 4GGOA 4J4BA 1ZMOA 4PG8A 3RU7A 4Q3DA 2RBEA 4YXFA 1E7MA 1LDMA 2B4QA 5AQ1A 2EP7A 4IDDA 2FR8A 1GY8A 2UUOA 2ZIZA 3H8VA 2PZKA 3BZUA 4CM6A 4BO3A 1PJBA 4QFDA 1WMBA 3LF2A 2P9GA 2GLXA 4J7UA 4ZICA 5JYEA 4BGEA 2C7GA 3QP9A 3RSHA 4YQYA 4CMIA 5JW6A 4PLVA 4ALLA 3HDHA 3AY7A 3NJ4A 5IXYA 4RPGA 4AJHA 3EUWA 5I7SA 1V35A 1D1TA 3GAZA 3ANLA 2EKLA 4U0JA 4XA8A 3PXXA 3U4CA 3FWNA 4FFNA 4KUEA 4B4VA 2NV6A 4DC0A 4JNKA 1GYPA 4YRAA 1ISMA 2G82A 2C0CA 4NHEA 1I3KA 2WM3A 1WZEA 2WYVA 5DT9A 5TJ9A 1R16A 3ZU2A 1NVGA 3GFBA 1DIAA 3JQ9C 4UUNA 1X7HA 4JP2A 5CPBA 3VAZA 5CDYA 4AJEA 3V5NA 3ZWPA 1FDUA 3U09A 3PHIA 4BNVA 3CZRA 4J43A 3C7DB 2Q3EA 1D4FA 3PYXA 3G1UA 4WJZA 4CQLB 1LLCA 3GC6A 1WDKA 3MWDB 1LC3A 1NR1A 2VHYA 1BXGA 1PJTA 3PZRA 1JDJA 4J2OA 3GF4A 1K89A 4OMUA 4GBJA 4A26A 3I9LA 1PR3A 1JWAB 2BRUA 4N5LA 3BMNA 4I1IA 1LBEA 2GR9A 4IIUA 3W4KA 1QG6A 3OJLA 4FOOA 1NAHA 4MVJM 3W8EA 1IE3A 3ZHYA 3CZMA 5IG2A 3ZU4A 4EJMA 2NVWA 1K6IA 2PNFA 2I99A 5DULA 5HA5A 3RC7A 5DOZA 5F5LA 4LSMA 1WWKA 4XDZA 1J49A 2O3UA 4J2HA 3SX2A 4Y6SA 1JLLA 1ISJA 2JAPA 4CQMD 5F21A 1N1EA 4P38A 2JD1A 3O38A 4NFHA 3F46A 1ENOA 1CERA 2BELA 5T64A 2C2XA 4ND5A 3BA1A 5COQA 3IKVA 4PG6A 3KYBA 3OA2A 2GGSA 4YJGB 5JY1A 1GQQA 2O7SA 3PI7A 3Q3CA 3RUCA 1DEHA 1JA9A 1JKFA 1YB5A 3NEPX 1AE1A 3JD0A 1U1IA 1EVIA 4ZRMA 1HYEA 1NHWA 5EQDA 4CLOA 4Y67A 1ISFA 1A27A 1GCUA 3UHAA 4BMVA 5I7EA 3VPXA 3LLSA 1E7SA 2BF7A 5L45A 3O9ZA 4BKOA 2E48A 4QUKA 3ZV3A 3JQAA 1HE5A 1H5QA 4Q3EA 4LRTB 1JKJA 2VYNA 5H81A 4N54A 4NFYA 4RPKA 1TA4A 1Y81A 3ADOA 4C7JA 4Z0TA 4L76A 4PLPA 3BMQB 1ZXLA 4FGSA 2JD2A 2J3IA 2BFAA 2QHXA 4TROA 2VCYA 3OMLA 3CSDA 4KZPA 4CR6A 3BMCA 1W8DA 2W2LD 1WNTA 3CPSA 3INRA 3KYDA 1HE2A 3ZWNA 2BHLA 1KY5A 3N7UA 4BO0A 1SPXA 1QV6A 5B12A 4XJTA 4EUEA 4XGNA 5K6AA 1HZZA 2Y93A 3B20A 3E82A 4RO0A 1EQ2A 1UDCA 3DXFA 5TSDA 3ZWYA 4R4JA 2RAFA 3ROQA 1GDHA 3WS7A 4GMGA 1P77A 1T4DA 1Y1PA 2VRCA 3QWAA 3R0IA 3SXPA 2V6BA 4WKGA 2P5UA 1EK6A 1XDWA 3GHYA 2G17A 3RU9A 3HQ4O 4J0FA 2PWZA 4R5MA 1YQDA 4EW6A 3ZWVA 4R51A 2CNBA 4E3ZA 2VZ9A 4Q3CA 2QIOA 3E8XA 1KETA 4J9VA 4FD3A 3INTA 3RI3A 1J6UA 4N18A 1VL6A 4WNIA 4B3IA 2X9NA 1LLQA 1VC2A 2NM0A 2W2KB 2HRBA 3WQRA 2GO1A 1LQUA 5JPIA 3FPLA 3ITDA 3JYQA 2HQ1A 2PKQP 1NVTA 1F0YA 1DSSG 5U1PA 3GNQA 4NJMA 4EUHA 4J4TA 3VPSA 4UVHA 5JXWA 1S6YA 3KVOA 3DMTA 4YAJA 1K5HA 1U2DA 1NASA 3NT4A 1NPYA 3WR5A 2OP0A 3LU1A 3WGZA 1Z74A 1JAXA 1LU9A 5F3RA 2H6EA 1K6XA 2D4AA 3NX4A 3CH6A 2WD7A 3F3SA 4AG3A 4EDFA 1ZKMA 3ZZNA 3BTSA 1PJ3A 4AJKA 3FTPA 4ZQFA 3AU9A 3K96A 1N9GA 1KY4A 3WG9A 4H15A 1E3IA 1Q7CA 4FW8A 5DF1A 3ZH2A 1ZNQO 4F3YA 2Q99A 3UFXA 1BW9B 4W9NC 1U3WA 2X9GA 3ST7A 5A3VA 2YHUA 2AE2A 1E1MA 3NDJA 3QSGA 4PZCA 2BFPA 5C37A 2FHSA 3ETGA 4IINA 1MV8A 1XSEA 4NMHA 1E7WA 4OKNA 1UJMA 4WOJA 4YVFA 3S2EA 3EZLA 3U9LA 2IEBA 2E49A 4MIEA 4FFOA 3E1KA 4J1TA 4AJOA 2A9FA 2X7HA 1GPJA 4MP8A 1ZCJA 5JY6A 1QP8A 2QRLA 3O8QB 4KDEA 2VN8A 4YWJA 2WTBA 3PWKA 4AVYA 3BYZA 3OJ0A 5IFLA 5IAAA 1YXMA 2RH4A 4YEDA 3LZ6A 1QSGA 1I0ZA 4R41A 4TVOA 5DP1A 4DTIA 1V8BA 1KERA 3C24A 3I4FA 5IZ4A 4BGIA 4ZQEA 3RKUA 1GV0A 4ALJA 5DCUA 5MDHA 1HDZA 2GPTA 3KLPX 4BVAA 2PGDA 1A72A 4I5GA 4MKZA 3TOZA 2DQ4A 2X9VA 1JU9A 4R16A 4IS3A 2RHRA 9LDTA 4BNYA 2D5CA 3KHUA 1YVEI 2UVDA 2JCYA 1UXKA 5DNAA 1W73A 1GUZA 3LDHA 1ONOA 4GX1A 3PK0A 4UULA 3NDRA 5IZCC 1NPTO 1KVTA 2C07A 3R3SA 2C2YA 3ASVA 5IDYA 2B83A 1UXHA 1SB9A 1VJ1A 2R00A 1MB4A 4HNHA 4L73A 2DT5A 2PH5A 2WSBA 3NV9A 2V6FA 4EUFA 3OP4A 2ZTUA 2QW8A 1HDOA 2QQ5A 3DL2A 3DZKA 1B0AA 1IHXA 2Q46A 3H9QA 4W7HA 5DN9A 1KEUA 4DIBA 4HFRA 1XA0A 5JE8A 4JBIA 5KKCA 1LUAA 3MJSA 3MJVA 5FFFA 2Z1NA 1EFKA 4C7KA 4HWKA 3E6AA 2DFDA 3HJAA 1HRDA 4D7AA 4AL4A 4F46A 1BVRA 1O6ZA 1YKFA 4RPHA 1NNUA 1T1RA 4IUYA 4O0LA 1PZGA 3VH4A 1L7DA 1XG5A 1BXGB 1YL6A 4YT8A 2NWQA 4O59O 4YCAA 2P9CA 2Y67A 2IDZA 1M76A 4R1TA 4RQUA 5EQFA 1K6JA 3B70A 3BMNB 1L1FA 1SOWA 3OSUA 2WD8A 4OXYA 1UAGA 2VHZA 4DPLA 2VNAA 3SVTA 2C59A 3MJEA 4BV9A 1NFQA 2H9IA 5L7YA 2IEDA 1GUFA 4RJTA 3ETEA 3K2BA 3PDJA 4ZQBA 4XYLA 4WPGA 1PJCA 1NAIA 3HFSA 3PRJA 1Z82A 3DEYX 3AOGA 5K0ZA 2ZQYA 4WECA 3S1LA 1GEGA 1RM4A 5HWSA 3A4VA 1Y8RA 5EIOA 1XQ1A 1OZAA 2NTNA 5IN5A 1ADFA 1NWCA 2W8ZA 4GI2A 3LT4A 4R1NA 3GHHA 1ONPA 2B35A 1J0XO 1EUCA 4LMRA 3LC1O 2HJRA 3QVTA 4ITUA 1FXSA 3FCOA 2HLPA 2FR0A 5TC4A 2IXBA 3RROA 2WWRA 1PGNA 5ENVA 5JLAA 4LRSB 4JJGA 3NAQA 3PJDA 1R0SA 4XD2A 4LCJA 2XPCA 2ZJ1A 2VRBA 3L9WA 4CLOB 5JBIA 1GTMA 2CDAA 4GKBA 1D3AA 1Q0LA 3E03A 3JYNA 3ORFA 4MVJA 5CHEA 4MVJH 3NT5A 2HU2A 3JD2A 5ES3A 4E21A 1NTOA 4NBRA 3V8BA 3K6JA 4MVJE 2IRWA 3K9QO 3I83A 4NJOA 5AYVA 4CL8A 3JQAB 3H5NA 3G79A 1Q7BA 1E3WA 5KVSA 3I4CA 4FFRA 4BNKA 1E5QA 1YWGO 4ZHSA 4PCVA 1ZEMA 2HUNA 5T5QA 1P1RA 1EUDA 4CUZA 1RYEA 4ND3A 3TFOA 1BDMA 3MJCA 4PG5A 2FZEA 8ADHA 2JFHA 2PTGA 5HS6A 1VSVA 2Y1FA 3JQ9A 5JAIA 3BMCB 3Q2IA 3FSRA 3M2TA 3QQPA 3KYDB 2OFPA 3M6IA 4AICA 3SEFA 2B37A 2AQIA 2X5OA 3JV7A 3AUSA 1BXKA 1R0LA 2O3TA 3MOGA 1YDEA 2FR1A 3PIIA 1MP0A 2D0IA 4HFNA 3AW9A 5TGDA 1V3TA 4XRRA 3WGTA 2GZ1A 4F45A 1NQ5A 1FF9A 1DRUA 1OAAA 3LVFO 1N5DA 1GU7A 2VUSA 2GDZA 1HYGA 2UYYA 1B2LA 2P9EA 4UVDA 5A06A 2UAGA 1NQTA 1VI2A 2AQKA 4FJ2A 3GR6A 4Y98A 4D43A 1YONA 3PGXA 1QYWA 1C0IA 4BNMA 2X1HA 1F14A 3ZHZA 4N5NA 3ITKA 1PS9A 3IJRA 1ADGA 2Q4BA 1SMKA 2VWHA 4JROA 1NBOA 2PLAA 3L4SO 4FR5A 4WEQA 4WLNA 5IJZA 4UUPA 3WXBA 1QYXA 5C3MA 5EPOA 4PLTA 4I5EA 1A4IA 2VWQA 2LDBA 4LVUA 1V3UA 1HT0A 4NJMB 3FN4A 3UVEA 3ZI0A 4BNLA 3FD8A 4DA9A 2VTDA 3GN1A 3GH3A 4NR0A 2I65A 2P4HX 2NU8A 2Z1MA 4WCFC 5A02A 1PWZA 1ZK4A 4MKRA 5JCJA 2EW2A 2W4QA 2IXAA 4CMEA 3K30A 1YJ8A 4JBHA 3FR8A 1MX3A 4DQUA 1HE3A 2J3KA 2DBVO 1E1LA 2EV9A 1JVBA 1PJLA 2EP5A 2X4GA 1BXZA 4UVEA 1N2SA 4TRJA 1I32A 5L3ZA 1G6KA 1PJ4A 3VZPA 4TWRA 3RUIA 1DIBA 1NYTA 4BNHA 4GVXA 1V9LA 4WEOA 3X2FA 3NGLA 2O3SA 2Y0CA 4ALIA 1DHRA 3VZRA 3STHA 1CRWG 3CTMA 1PL8A 1WLYA 3W8FA 3PLRA 2CZCA 4CUKA 1U4SA 4IDGA 4OAQA 1CIVA 2NQTA 3RJ5A 3VKVA 1DRWA 3F4LA 3PP8A 3JQGA 1IL0A 1HDXA 4BGUA 4XB2A 1YOVA 3WTBA 2AEJA 1GYRA 6LDHA 1EE2A 2G1UA 4PVCA 1MUUA 1HTBA 5T8KC 4CMCA 5FWNA 3VOSA 1DAOA 3RBXA 2VNSA 2VYVA 3I9MA 4D46A 4PLYA 5JDIA 4P22A 3MTGA 2GSDA 4BHTA 2Y0EA 1A71A 3KEOA 1UXIA 4XR4A 5KJCA 1YL7A 1KC3A 1CYDA 3V1UA 2EF1A 4BNWA 4LISA 5F1PA 3V2GA 1LDYA 3QY9A 1ZK0A 3PHHA 3RUDA 4CM8A 1HSZA 1QYVA 4BUCA 1VJTA 4CV3A 4ZRNA 2OHXA 4IJUA 2ZTMA 4IJWA 4B8ZA 3QVWA 2QRKA 1AXGA 4WK6A 3RQSA 3ZNQA 4B3JA 4E2YA 4KUHA 2VT2A 4NFSA 5TT1A 4CM7A 1RM3A 4BS9A 3PJGA 1C3VA 2G0TA 4BQPA 1DDOA 3D0OA 3D4NA 1U3VA 2CDBA 2C54A 1NXQA 3INGA 3NTQA 4I5FA 3FWZA 1MC5A 5G0TA 3OIGA 4XQ9A 3WGOA 1DXYA 4R3WA 1P0FA 4H16A 3CUKA 4BO5A 1SBYA 4NBVA 4E2WA 4J91A 3IP1A 4AJPA 4M55A 2EGGA 2D1YA 5L7WA 3T4EA 1BSVA 3VDRA 4I5DA 1MFZA 3DZJA 3GUYA 3OEYA 4GSLA 5TQVA 3TQHA 3N74A 4RVHA 1GD1O 4QTZA 4W9NA 1DPGA 3NKLA 3JQ8A 1R6DA 3ROMA 1GUYA 3GEMA 2DPGA 3P19A 4CJXA 4F6LA 4N7RA 4BNTA 4EEZA 4IQ8A 4ZA2A 4RLSA 2WEKA 3CEAA 3FPCA 3L4BC 1QORA 2JL1A 3I1JA 4PFJA 3RC9A 3G0OA 1BVUA 1QKIA 5GZ3A 2NU9A 4AJ2A 3DTTA 4MVJI 5IDQA 4Y6RA 4QO8A 1Y8RB 3F1LA 5AXAA 1ZSYA 5KJFA 3GVPA 2OZPA 2BI7A 4E6PA 3PQEA 3JQBA 5I9MA 3TJRA 3SLGA 1LC0A 4IDCA 4IM7A 1IPEA 4TRNA 1YBMA 1QV7A 2PFGA 3RJ9A 2ET6A 1NQAO 4E5MA 4R69A 4TZTA 5A9TA 2GCGA 4G81A 4MKXA 3PEFA 5THQA 2NTVA 2FN7A 3B1JA 5A9SA 1ZK1A 3TDKA 4YAKA 2PZMA 2PA3A 4KDFA 1MC4A 4MOWA 3PHLA 3M1AA 3QV1A 1U5CA 3FNEA 3JQDA 1LSUA 3WFJA 1R4MA 2OP1A 2EJWA 5KIAA 1VM6A 1A9YA 2CSUA 3F1KA 2PK3A 1AXEA 4ALNA 5IZCA 2ZYGA 3GK3A 4Q9NA 3IKTA 5TLSA 3C1TA 3GPDG 3QA9A 4Q3NA 2X23A 1E3WB 5A04A 4MO2A 1QLJA 3DR3A 3GDOA 4CQMA 1QMGA 1JTVA 1Y8QA 3VKUA 3KV3O 1GQYA 4ND4A 4BKUA 5H83A 3H9EO 4L9RA 2C7VA 3IMFA 3KUXA 1LSSA 3GLQA 5ER9A 3I23A 3WQQA 4CLEA 4E5YA 8LDHA 2D3TA 3I6QA 2P4QA 5JS6A 4I08A 5BNIA 5ILGA 1GZ6A 4JGBA 2YV3A 3KB6A 6ADHA 3GVIA 2ZCVA 3GQVA 3OICA 4PLCA 3SC4A 3QVXA 1PGJA 2PKQO 1F8GA 1Y9AA 2X0JA 4XYMA 4E13A 4DPKA 2Y1OA 2PD4A 2BH9A 1A7KA 2FSVA 1KEWA 4RL6A 1ZXBA 4WLEA 5KJEA 3BHMA 3S55A 4XGKA 2J3HA 2O7QA 3BXXA 1M67A 4HNGA 4J1SA 5G0UA 3U4HA 2EERA 4Y9DA 4DIOA 3GEGA 3OIFA 1T1SA 1JW9B 4GPD1 1E1KA 1LLDA 1XELA 2VUTA 4A0SA 1PJSA 2RHCA 2FPGA 3IQDB 1G1AA 5BNTA 3TZKA 1IB6A 1U28A 1F06A 3OJEA 3OJFA 2GN4A 2E6UX 3ABIA 2W2LA 2F00A 3JD1A 4PZDA 1B3BA 1O0SA 1PWXA 2C5EA 3EGOA 3JSAA 1C0LA 3P5SA 4YDRA 3HG7A 2RCYA 3OHSX 2YJZA 1KC1A 2PGLA 3KSDO 1MG0A 3RUEA 5FEUA 3E5RA 3I3OA 2P68A 4PIVA 5TRTA 4UVGA 3ZWXA 1GZ4A 1YB4A 3DOCA 4IDEA 3HN2A 4TKMA 3C1AA 1U2GA 1RM0A 3GUCA 1Z6ZA 2HK8A 2O4CA 3PJEA 3QVOA 2V65A 3D4OA 3B1FA 4QSMA 1AGNA 5CDGA 2GZ3A 3WWYA 1C0PA 1PS8A 4B4OA 1ZBQA 1CETA 5FI5A 4DYVA 3K73O 1TEHA 2JAHA 2V6GA 2QG4A 5HM8A 3DBVO 4XDYA 5G0VA 3U5TA 2NLOA 2EGHA 2ZB7A 1WMAA 1UR5A 3JQ6A 4Z9XA 4E5PA 4QFCA 2BGMA 3WNVA 1PX0A 5JO9A 2VHWA 4QO7A 1DIRA 2X5JO 1P0CA 4S1VA 4Y6PA 3AU8A 3DBLA 4R9SA 5HS4A 1P33A 1SAYA 1ZFNA 3DC2A 4ALMA 5JC1A 4I9HA 4RF2A 4ND2A 3ZNOA 1C1DA 3JQGB 2Q49A 1YOVB 5AXBA 4Q39A 1DLIA 5DZSA 4BOYA 1HZJA 3ENNA 4IY1A 2CF6A 4B8WA 2EKQA 4CLXA 4BO2A 1M6WA 1P1JA 1QYCA 2OUIA 3WFIA 4KWHA 1HXHA 3TFQA 4D0RA 5T6BA 1ZH8A 4BKQA 4DLBA 2Y66A 2W98A 5JDCC 3GPIA 2OBNA 1YO6A 3KTDA 3GAFA 4JCOA 3PPIA 5TX7A 1PL6A 3KLMX 4NG5A 4RDIA 3NUGA 3DZBA 1PEDA 3D5TA 2O23A 2H1SA 5DBFA 4CM8B 3PQFA 4ALKA 3BAZA 2VHXA 3RCBA 3B1KA 1E3JA 3EHEA 4KWIA 3AM3A 4FQ8A 4CM4A 1P3DA 4XIJA 4P4LA 4XRGA 4J1NA 4LN1A 5EESA 1YBVA 2EKPA 3JD3A 1MLDA 4ID9A 4Y8VA 3UCXA 2WJPA 1H6AA 4XB1A 3GA0A 2NTJA 4A7PA 4HFMA 4YJFA 2OORA 3AWDA 1Z73A 1LDBA 2B5WA 4D44A 5AVOA 4AJLA 4E2ZA 2JCVA 3EYWA 2DC1A 4EEXA 5CG2A 2VWPA 1R66A 3TZQA 4WCFA 4TVBA 3UCEA 1XQ6A 2ZB8A 3EVTA 5F1OA 3K92A 1ADBA 4BGVA 3G1TA 4Z0PA 3F9IA 2P2SA 3TOXA 3U0BA 4YA6A 3GFGA 4J90A 3ENKA 3EDMA 2HMSA 4YYZA 4GX0A 4RDHA 5L95A 4MINA 4IZIA 4L4XA 2Y1DA 2J8ZA 3MTJA 1I2ZA 1NX6A 4WLOA 2DFVA 3AI3A 4R9RA 2FSSA 3JQ8B 3AUTA 3M2PA 1V0JA 4MPDA 1UP7A 4ONEA 3WGYA 3WDSA 1QLHA 5L9AA 1HSOA 3DFUA 3NT2A 5J23A 2H5LA 3SLKA 3D1LA 4E5NA 2I6TA 2OGUA 4JJFA 4BMSA 2UUPA 5T8KA 1NHGA 3I9JA 3JCZA 2TMDA 1B15A 1K3TA 4E2XA 1FJHA 1I30A 1GCOA 3OBBA 3VVBA 1DFGA 1RWBA 3ZW9A 4BV8A 4YJDA 3GGPA 4INAA 1E6UA 1ZUD1 3WGHA 4CM9D 3IDSA 4G65A 1X0VA 3UN1A 2ZCUA 1Y6JA 1EUZA 2DTEA 4BNXA 3NTRA 2P5YA 4CMBA 4KMSA 1AHHA 3GVCA 1IYZA 1J5PA 2SCUA 3O4RA 5A9SB 3KSZO 1UXGA 2JFGA 2C20A 3WQSB 1SB8A 2Q45A 1PGPA 5L4SA 5BSFA 3TL2A 3H3JA 4FGWA 3QE3A 3ZGYA 2XXJA 1R4MB 4CMIB 5I9NA 2FY8A 1TXGA 1KOLA 4JLWA 1ARZA 2FPPA 5GY7A 4MP6A 1T2AA 4BKPA 3OECA 1E92A 3ZHBA 5I8WA 1Y9EA 2DM6A 1X15A 3K8ZA 1C0KA 1U5AA 3E9NA 1UZLA 3DAPA 4D3FA 3AOEC 1B3RA 4OIMA 1YL5A 2GZ2A 5JMWA 1ZSVA 2NSDA 1ID1A 1VL8A 3C1OA 1LTHR 4YJHA 3DHNA 4GH5A 5U9CA 5H82A 4GKVA 1DJQA 4IZHA 3ZU3A 4M49A 3DOJA 3H2SA 2YZ7A 4XEHA 3PHJA 2XF8A 3D5QA 2Q4EA 4RVDA 3DBHA 2EXXA 4BO9A 5BSGA 3VPHA 4XGIA 4FSHA 1P45A 2J3JA 1OOEA 3GRPA 4BNIA 4DUPA 3RC2A 4HBGA 3SJUA 3UUWA 2ZATA 3BTVA 4Q3BA 4NU6A 4YBZA 3I6IA 1EK5A 3HE3A 4JX8A 3A28A 1SC6A 5JSFA 2AG5A 4UVIA 1U7TA 3QRWA 2Y1GA 3GVXA 3K2EA 4DLLA 4WNCA 2J5QA 1HE4A 1KEVA 2NACA 1NWHA 3FNHA 2ZJ0A 3TL3A 3DB2A 2IZ1A 3OQBA 3ADPA 4IS2A 1WVGA 4WLFA 1E0DA 2CF5A 4FPXA 5C7OO 4XWYA 3H3FA 2OBYA 3OQ1A 4IDAA 3H65A 4DXHA 3GG9A 4E30A 1FMCA 4G5HA 4M87A 4PLHA 1LSJA 4D0SA 3OF2A 4J1QA 4KTVE 1V6AA 3UAGA 4W6ZA 2PZJA 1NVMB 2HSDA 2AW5A 3P2YA 3JD4A 2Y05A 4H3VA 1ZK3A 4FOSA 4E0BA 1DHTA 4XIYA 1WP4A 4IQGA 4Z3KA 3BHIA 4CM3A 4BKRA 4KUGA 4B3HA 3DZGA 3L9XA 2IODA 2CVZA 4M54A 1TVEA 3PTZA 1BTOA 1UH5A 3MCVA 4MDHA 2HKIA 2WDZA 3P7MA 3MZ0A 3AI2A 2FPIA 2RH8A 3LT0A 1HYHA 3T7CA 4NDNE 2CY0A 1TT5A 1XCBA 1H9BA 1ENZA 3KETA 2O50A 3ZWWA 5JMPA 3H9GA 3GT0A 5G0SA 3DBLB 3H2ZA 2RIRA 4UAGA 3FRJA 3MWEB 1C1DB 1O89A 1T2CA 2YY7A 1SEPA 3B6ZA 1KIFA 2ZTLA 4OQYA 1M2WA 3DWFA 1T2EA 4CM5A 4AJJA 1P31A 1U9JA 4EJ6A 3GG2A 1DC6A 3HDQA 4CLHA 2WE7A 4F6CA 3ZWOA 4U6SA 1OFGA 2R6JA 2C29D 3FBGA 3QHAA 5MGBA 1JQBA 4L4SA 4OH1A 3CMMA 3RD5A 3ZNPA 5CEJA 4QX6A 3DQPA 4G2NA 4RF3A 4XX0A 1O9BA 1SOVA 1WZIA 3KOUA 4BIIA 2IZZA 4RZHA 2VUUA 3AY6A 3FF4A 3VC7A 4CM1A 4DMLA 1JN0A 3JYLA 3KYCA 1CJCA 2PR2A 1ZJYA 1PJ2A 5B4VA 2FMUA 4K6CA 5AXCA 4R54A 4OHUA 1U8FO 1X1TA 3H4VA 4LW8A 3VH1A 1T24A 1K0UA 1UXJA 4DQXA 1B26A 4Z3DA 3LT2A 5B4TA 3G17A 4R1SA 1ISHA 2G76A 1ULSA 5COAA 3AI1A 4WLVA 3ZW8A 2AE1A 5JYDA 2YDYA 4R1UA 4BNZA 1VPDA 2D59A 2FRDA 2HK7A 4HX5A 4WE3A 5A3JA 4TSKA 5GZ1A 5K9ZA 2B4RO 5LCXA 5TNXA 4WCFB 2YFQA 3SC6A 2Y99A 3JQFC 2VHVA 2C5AA 3AJRA 3OEWA 1KBZA 2WD7B 3S8MA 4D42A 4J3FA 2BFOA 3TSCA 4ROSA 1E6WA 5BQFA 5CEEA 3T7EA 1JVSA 1SEVA 4D3SA 3UKOA 1ONNA 4O63O 1N9GB 4IDFA 2PD6A 4HY3A 3C7AA 4FIZA 4GWKA 4YAGA 2B4TO 3GNSA 1W4ZA 1I5RA 3DONA 2Z5LA 4A03A 3W8DA 3WB9A 3ZWAA 1I33A 1H0KA 1ZK2A 4YAIA 5DBGA 1R15A 4XQEA 1E3SA 1FDSA 3PVZA 3VDQA 1MXHA 1FK8A 3HSKA 1GQ2A 3WWZA 5HTOA 1ENYA 4A2CA 2EW8A 3AM5A 4NQZA 2P91A 1YDWA 3VZSA 4CLRA 3WMXA 4YT4A 4AFNA 1EQUA 4YTEA 3ZV6A 1T2FA 5BSHA 4I9NA 1T4BA 4OJNA 1PZEA 1K2WA 2CUKA 2XAAA 5JDCA 1FDVA 4FCCA 3RBZA 1SO8A 5TIIA 2AEFA 4MJLA 3HN7A 1IOLA 4J16A 4HUJA 2GN8A 4IPTA 4K28A 3WTCA 3ZWMA 4PRLA 1X1EA 4MVJG 3HDJA 3G3EA 4M89A 3DBRA 4OSPA 1I3LA 4JQCA 2EJVA 1N7GA 2FWMX 5DDIP 1R37A 1EBUA 1ZO8A 4IJVA 5G4KA 5KOIA 1GEEA 3AM4A 1LRLA 5IXSA 3F5QA 4FBGA 2JKVA 1OC2A 2X6TA 3P2OA 4J4HA 1GZ3A 3W6ZA 5A5EA 4UEJA 4OQZA 2VQ3A 1UP6A 2DVMA 1E7QA 3GDGA 1Q0QA 4UUOA 1M66A 3DAFA 1R4NA 1V3VA 3S2GA 4WGGA 3KEQA 4R3NA 2JHGA 3OFSA 3EVNA 4YQZA 3E5MA 2E82A 3M1LA 2YDXA 3WIDA 1IHYA 3KBOA 4OXKA 5TJHA 2DAPA 1P44A 2UDPA 2YYYA 2I67A 1VKNA 4YJHB 3AUUA 4DRYA 5JAMA 3D3EA 1TLTA 2Q1SA 4CODB 1EVYA 4C4OA 5L51A 1UP4A 3C8MA 5KVCA 3RWBA 1IZ9A 3Q11A 5HRUA 5CDSA 3ICPA 2O3JA 4CMGA 3DAGA 2BI8A 4O5OA 4EZBA 3DBHB 3KZVA 5CDUA 4CLDA 2GERA 4RPLA 3U4IA 4OM8A 3DFZA 5TT0A 3WSVA 3VTFA 5JAZA 1P1HA 5T57A 4OOFA 3RFTA 3FBTA 3A06A 3ZCXA 2QRJA 4N5MA 2D5AA 3PQDA 2B0JA 2JFFA 3LQFA 4ZN6A 1HF3A 1T25A 5A1TA 4I9UA 4ZQGA 4XQGA 1Z45A 4CMKA 2J5RA 1E1NA 1W6UA 4RVFA 3IS3A 3D3WA 1Q0HA 5TF4A 3ONFA 1A4UA 2J6IA 3HB4X 4DREA 4YT2A 1XYGA 1I01A 4FN4A 4D79A 1GFSA 1H94A 3WYBA 1EVZA 3W4JA 4FC7A 1OBFO 3ANMA 1P74A 3Q6IA 4RV9A 2J5KA 1XU9A 1H9AA 4AJIA 1Q2XA 2OL4A 1A9ZA 1L7EA 3PGJA 4J0EA 1ZJZA 3O8QA 3PWSA 4KOAA 5FF9A 4U7WA 2JD0A 3KSUA 1Z75A 1X7GA 1DC4A 1SCUA 2HK9A 4J7CA 3E18A 3WICA 2V6MA 3WX0A 1TB4A 1UAYA 2ZYAA 3H7AA 2Q1TA 5DCWA 1O94A 5KCZA 1GPDG 2DLDA 3WGQA 4UEOA 2NVUA 2E37A 2X22A 3F4BA 4U5QA 1I3MA 2Z95A 1TT5B 3ZU5A 3TF5A 3AY3A 1B16A 1UZMA 4II2A 1P9LA 4DMMA 4NBWA 3AOEA 5IDXA 1DJNA 3RFXA 1ULUA 3VVCA 2VTEA 3E48A 5KVVA 3GVHA 5G0WA 3NTOA 4RQTA 1NPDA 4AJ4A 3HZZA 2TMGA 1YE3A 3PWZA 1T2DA 3ASUA 4JXKA 1N7HA 5ER6A 5I9LA 1R0KA 5JFOA 3AK4A 1PL7A 1XEAA 2GYYA 2POQX 2Y1EA 1IY8A 2LDXA 3PFFA 1I8TA 3IP3A 1E77A 2QZ9A 2A35A 4LK3A 3BTOA 4GL4A 4M1QA 1VJ0A 4GGPA 1YBAA 4U0KA 1A5ZA 3IUSA 4RLHA 1IUKA 4BNUA 4RCVA 3WLEA 1DLJA 4PLFA 4BO1A 1WPQA 1ML3A 3HNPA 1ISIA 3HWRA 3CXRA 3ICCA 4E5KA 1YRLA 3HB5X 3KYCB 4YT5A 1PU2A 1ZZEA 2I76A 1I36A 3GN2A 5EMHA 4OXNA 3C7CB 4WLUA 4IBOA 1QR6A 1CDOA 4RVUA 4NK4A 1DIHA 1KVSA 2BD0A 3CINA 1XWFA 4FC6A 4PLWA 4Z0HO 3W4IA 5B37A 4QT0A 4GWGA 2NU7A 3ZV5A 4HV4A 2Y0DA 2PZLA 3DOOA 3UOGA 2JHFA 2FZWA 4NK5A 4Z9FA 2D2IA 4P4GA 1LEHA 1XIVA 2QZZA 2GN9A 4W82A 1CWUA 1H93A 4YACA 3SJ7A 1EMDA 4ZD6A 2HO5A 5BSEA 3GGGA 3BHJA 1PQUA 3ROPA 1ZSNA 4K9DA 2VZ0A 1GL3A 5L40A 3D64A 2EIHA 2VZ8A 4IQ0A 1EFLA 1NFFA 5I7VA 1O95A 3LK7A 3WSWA 5L7TA 1HEUA 1Q1NA 2PKRA 4CR7A 4J7XA 2AMFA 3GZNA 1WXDA 1BDBA 1LJ8A 1RPNA 2OMEA 3E9QA 3QW2A 1B7GO 5F1KA 3ZV4A 1ZEJA 3OJOA 4GX5A 1DC3A 1UDBA 5EL0A 3GY0A 3FTNA 4LCEA 2IYOA 4QECA 4CMEC 3CIFA 3U62A 1HL3A 1HKUA 1KVUA 3NYWA 1B14A 4ESOA 2I5PO 4R01A 3JTMA 1CEQA 5CAEA 2ZYDA 2HMUA 2R2GA 4HXYA 1VE9A
chains in the Genus database with same CATH superfamily
4UXIA 1HNWB 3VHLB 3ZC3A 1YR1A 4WBSA 4JK3A 4QGAA 2H3HA 2P62A 5FOWA 4OOEA 2JGKA 4XIIA 3ROKA 3PZBA 4QYIB 5CDFE 5LZ4A 4ZEVA 1TEXA 5ESXA 1KYZA 3SQWA 3OQHA 1OGYA 2FEAA 3V1NA 4O2BA 1GXSA 4RD3A 2ZYRA 3ROEA 3KRTA 2WWGA 3V8VA 4ZOLF 1CNMA 1YR3A 3QMWA 2F8LA 2BGNA 2H0QA 3AKZA 2XNJA 1OU4A 1N92A 1T8PA 4BZZA 1U2PA 4TTIA 1WF3A 2AEEA 2JLSA 1XRRA 3LYHA 1QNLA 3NETA 3CE6A 4IXDA 3VTAA 4NYIQ 4FS3A 1JHQA 3O26A 3OMWA 4BFYA 3BH7A 1OUMA 4NULA 4CG1A 2CFCA 2H11A 4V0ME 1E61A 1ZIYA 2O7RA 3KUKA 1ZD4A 4YONB 2ZKIA 5B7PA 4DBVO 2V7EA 1XZKA 5G4KB 2RFLA 2REBA 4KH1A 4PHHA 2JFOA 2PSDA 4PSCA 4G2TA 4EARA 2QTWB 2JC3A 3HCAA 5E6UB 2ZAYA 5BNFA 4M9QA 2CJXA 4KGDA 4BQNA 1DFIA 3MBIA 1T5OA 2XZLA 4QJ3A 4DXDA 1XD8A 2I71A 4MGZR 1SU4A 4Q03A 2HO4A 2HDHA 3F8TA 4X85A 2OGSA 5G3YA 2O0HA 1B6RA 4EHJA 1EM8B 5GVRA 1RC1A 1XZMA 1T3GA 1DIGA 2VDUE 4AP9A 3K0SA 1AC5A 4L2IA 4QULA 2Q2OA 5EGNA 2AMYA 2HF7A 1K75A 4L15A 1NVVQ 2IT1A 3JQFA 4KFRA 5FBVB 2XB4A 1F4LA 1N3YA 2FW1A 4I1SA 3LDUA 2I55A 4HEA1 2R87A 3N0RA 2AGVA 1I2CA 2JJQA 3NV7A 3T9CA 4KXUA 5CFLA 2A92A 2HW8A 1QHHB 4BATA 3V42A 4EENA 2ACWA 3KC2A 13PKA 2CFOA 2WE8A 3QQ5A 1E2GA 3EF1A 3EOBI 3RADC 4GQIA 3WL3A 3D6TB 4HWOA 4QOIA 3O7WA 2AWNA 2OVFA 1EUQA 3PEYA 4P3OA 4JB8A 4EKYA 1YDGA 1MA0A 2GK7A 1Q0TA 4GPAA 1MJHA 4S1OA 2GCOB 5EZQA 4ZJUA 1E3LA 1Q7GA 1VFPA 1DX9A 4YHHB 3IUBA 4CPDA 3H2GA 1GNSA 1XLVA 3BWDD 4KXWA 1GJRA 3CUUA 1NP6A 5F4BA 1JEYB 1F6WA 3JQ7A 3KVYA 3ZQUA 2DHEA 3L6OO 3V3KA 3P4YA 3K9LA 3D3WB 3HR4A 1E9AA 5AUPB 4PBSA 2AI1A 3U48A 4A8HA 3WYFA 2D0DA 3USZA 2QXUA 1VP9A 4YP6A 3F4KA 2HCTA 2CDCA 1PSDA 1PEAA 1U2TA 2OZEA 1WX1A 3NHSA 4KB5A 4PO8A 1OE0A 1C1XA 1T8TA 4Q82A 4XJSA 4YMWA 3TGWA 4HAUA 3W0LB 4CIBA 1DCTA 4CU2A 5AKZA 2DBRA 1J97A 1WZUA 1YZNA 3GMDA 1XTVA 5CLQA 4D41A 4Z6KA 5FYDA 4MV3A 1IZ0A 4HF7A 4L74A 4GZMA 1J42A 5FB3A 3UA3A 1G21E 3HFRA 1BC5A 3QPCA 4HN2A 2Q3DA 4IAOA 4M9RA 5HVNA 2VAPA 2BFMA 2VDWB 3FMIA 5IS2A 2GBGA 3K0AB 1C7IA 2R6AA 5GZ6A 3GZ4A 4KREA 2ZXEA 4J7AA 1EEHA 5KAPA 3MWGA 1UZNA 3Q9UA 1FJGB 2JBWA 2IIQA 3F5SA 4KXNA 4BP3A 3ENZA 3K1ZA 3IQFA 3DPSA 2JATA 3TDNA 1J8YF 2DGDA 5CG1A 1MGOA 3AF5A 3R1IA 1ADYA 2AT1A 2YIMA 2XDAA 3BL8A 4CQMB 2W42A 1SRRA 3X1KA 1ENPA 3GJ3A 4OL9A 4TZKA 5EMJA 1VE1A 3VSBA 3LOQA 4ZAGA 4AMUA 1MTZA 1SBCA 2NADA 1RYMA 3IALA 1MO5A 1G38A 3RVMA 4B40A 2W7TA 3ZHCA 3IKMB 5C7IO 3P0EA 3HUUA 1XAGA 4F9EA 3LY9A 4A91A 1CY6A 3CMCO 2QD1A 3AFOA 3GDFA 3GEPA 5IAEA 4HUQB 3T9FA 1P73A 2AJ8A 1JDNA 4BECA 1GTG1 3HZHA 2PZEA 2AJDA 3BXOA 4JB2A 4GKJB 1SCBA 2PZ8A 3IEKA 4LJ9A 5DBHX 3RUFA 3WKCA 3ZWQA 1ZJJA 2I80A 1SBZA 1II0A 4KIUA 1ZAKA 1Z8DA 3BXEA 1Y3AA 4TSFA 1CRZA 2XQIA 2QLTA 5CB4F 2ISCA 5BOSA 3KZCA 3LBFA 3LD9A 4PE5B 3GZTB 2DT8A 3TWOA 3ORQA 3HBLA 1RZ3A 2GHTA 3N58A 4R7GA 1IWOA 4HDSA 5DXAA 2G9RA 1WCXA 1IJBA 3OPVA 3D4PA 2AUMA 1VE3A 3LC0A 5DTEA 5LLDA 3RBVA 2IE0A 5JRZA 2XH8A 2YJNA 3L4BA 1XCOA 3ULKA 5JXGA 4YROA 4I81A 1FSFA 1NQOA 2FSVC 3PYLA 2FFBA 3DZIA 3DMHA 5LMCA 1G9SA 4AAYA 1UZAA 1W0CA 2QTTA 2Y1LA 1JQDA 2X42A 4NMLA 3UFBA 1Q74A 3DT8A 2DFKB 5IYZF 3R8FA 3WGIA 2WC1A 3V80A 3W77A 3AHHA 4NBUA 2C96A 3W5VA 2ZB3A 3R74A 1E2KA 2TMKA 3ACBA 2DTXA 2RHHA 4QXMA 3RAJA 5JCPA 3TQIA 1FYEA 1JR2A 1U3UA 1R0WA 2ZTSA 2P7HA 4URXR 1QC5B 1GUDA 3K5PA 4RADA 5JV5A 2ZYWX 3DE3X 2UV8A 3OM9A 3SZRA 2CVQA 3TAXA 3AIKA 1FRVA 4YPOA 4KR6A 1F2TB 3K1AB 1OC4A 3ZYZA 5CA0B 5E3HA 3RIYA 2EZUA 3V1YA 4HNUA 1MT0A 4RTJA 1X3LA 4XAQA 1B8UA 1EVJA 1PUJA 4TLEA 3THYA 2PGOA 3H0CA 1QH9A 2QPTA 4D02A 1U6JA 4D0NA 3A4YA 3PFWO 2B5VA 3A7EA 1TF7A 3FZEA 2FZ4A 2GEUA 2W4IA 7ADHA 5CNJA 4X60A 2P0YA 2AX3A 3SBDA 3W5HA 2DYKA 3L6RA 1J20A 4RM3A 3UJPA 5J5AA 3SX0A 3MK31 1ZD2P 2P9JA 2WTEA 3HB7A 3LDGA 2H06A 5CJ2A 3RASA 1GV1A 4EITA 3BRCA 4LSWA 1IC6A 5C1BA 4YPFA 3GJZA 1JHPA 1R5BA 2X9QA 4JUAA 3EDYA 4PR3A 4O6VA 4PSUA 4WUVA 5LZ8A 3T8YA 3VI4B 2HJSA 1JE0A 1RZUA 2OO5A 4UMFA 4YRFA 2OXIA 1JG6A 1J8QA 3D7SA 3O4GA 2JZCA 2H92A 3I9NA 1A9QA 1QH8B 1VG8A 4RF4A 3QBVA 4WWHA 4ENUA 4ZGWA 4EPTA 2JZNA 1PJQA 4ZKEA 3V2UA 3RYCA 3O7MA 4I8XA 1T8WA 2NUTA 1ZINA 4XJVA 1T3ZA 4CR8A 1ZOPA 2XZOA 1EBFA 5C0OE 1ZJWA 4FEEA 3VOTA 3OPYB 4HXGA 2BHSA 5CCDA 4D4JA 2G71A 4D9EA 2CEKA 3D8HA 5HFAA 3FX2A 1HDCA 4PF1A 2HZ7A 3GEBA 4JFRA 3FDZB 4X3PA 1MB0A 5KAMA 1UF9A 3BB1A 4LV5B 1B8PA 3BTUA 1U0OC 3AKCA 4O4JA 5B2ZA 4CIVA 4F4UA 3W1VA 3IOYA 2BWJA 4NU5A 4Z2YA 3LT1A 3G0GA 3U3XA 3BIOA 3VHRA 3NJ8A 4H7DA 4TYMA 3IDQA 4GX2A 4KP7A 3VHQA 4BNFA 1E9BA 5AW4A 2FA9A 3ILSA 5K6TA 3VNBA 2XIJA 3FOZA 4JL8A 2MR5A 1FX0A 2OR3A 3JYHA 4CMJA 4EJSB 4CQLA 1F12A 1LI4A 3BK2A 4ZU3A 2ANCA 3ER6A 4FTWA 1GL7A 2DKOA 4JLDA 5K6AC 2V0GA 1BH2A 1FP4B 3MJTA 4XR9A 2PL5A 2R6DA 2Y68A 3IAXA 4X7RA 3B6JA 2G67A 1F51E 4UKDA 3TD6A 1TAGA 2CXOA 2ODNA 1UBRS 5CTJA 3IMEA 3QPUA 4GVLA 1UKEA 4C22A 4UE6A 3HFGA 4YJFB 1MZPA 2YUTA 5DIFA 2QM8A 1N6IA 1XD9A 2JJ2D 1KH1A 4ARVA 4F84A 5F5NA 3HWSA 3ECSA 3H8SA 1VCIA 1GGEA 3AJ8A 4INPA 3V00A 3U6BA 2RHJA 2I6QA 5AI9A 4CI9A 3D5EA 4DLKA 5DX8A 2I9PA 3WGNA 5LIRA 4MVJD 4P80A 2ATCA 5ICSA 1A8SA 4EYEA 3C5WP 2WU3A 4J49A 3DDNA 3PL1A 5IBPA 2PBLA 1DQPA 3C70A 3W2HA 4OGKA 1WRBA 4WESB 5A4DA 2ZK7A 4HGOA 1XMJA 4BMXA 1O4WA 3BREA 3RBXA 2C98A 4ROTA 3ZBQA 3GCGA 4JVLA 1U0EA 3H9JA 3VNRA 4PZAA 2CLMB 1LNQA 2IZ0A 1WW8A 2AOTB 1XXHB 4TWBA 1VDZA 4FFMA 1M75A 1G19A 2YS6A 3DAOA 4KLRA 2W5UA 2GPBA 2MJLA 5ERYA 1U2DC 4GYKA 4GUAA 3IILA 5C8YA 3CHYA 4R2WA 4A8PA 3TZCA 3V1TC 5D1HA 1NVUQ 7MDHA 1DJOA 2V4ZA 3ZUGA 3Q8LA 2PBFA 4YUVA 1N7JA 4L85A 3H99A 3HVJA 1OI7A 4PBRA 1E96A 1WF6A 4WZBB 2I7XA 4N7JA 2QUBA 3ND9A 5HKLA 4G5YA 1A2QA 1X14A 2ORED 2EWMA 1H2AS 1X13A 2O3QA 5JAOA 2XXAB 1ECJA 1Y7TA 4CL3A 2PKCA 5ITWA 4DRXA 1Z7BA 4I4CA 1A1VA 1TQ2A 1RJ9A 3CV3A 3IT2A 2BMAA 4NX2A 4DIFA 1G8GA 2X0FA 2ONCA 4EPRA 1S3FA 4JGGA 1VRWA 2K7ZA 5EI5A 4EJ0A 4KXYA 3A31A 1SKBA 3KR1A 4IMPA 1CY7A 4BASA 4KAJA 4KQGA 3JVVA 1RD4A 3S2IA 3L77A 1T34A 3FVWA 4FHDA 4LF6B 3MT9A 2FEKA 3RBZA 4RA6B 4C0AC 2P9QA 2WHXA 5JJCA 4GLJA 2XXBA 3AKYA 3W3ZB 1NNSA 2FLVA 2Z8YA 4F5ZA 2WW8A 4TXLA 4WK4B 5CFRA 1WB4A 1YE5A 3EODA 3FUCA 4LHSA 5D5HA 5AM1A 2C2KA 4FU0A 4ZV7A 3T0FA 1Z15A 3WJ7A 4M1TA 3WI7A 2NZWA 4DM4A 3D81A 1W0JA 2ECFA 3RVDA 2AQHA 2VJKA 1G21B 2IHBA 3RYIB 2MSEB 1RM5A 1J0BA 2IHVA 4YWHA 4D74A 4ER0A 1LQTA 2FI1A 1U3DA 5DTQA 1LBTA 2WJ6A 3MSCA 5IC5A 1J1ZA 3ZY4A 2FFRA 2IY9A 4ENSA 7REQA 4AS3A 5TQ2A 5HYVA 5A3RA 3T4XA 1VKOA 3DO8A 5TVKA 2I66A 3AVTA 3F0TA 3NP9A 1L1EA 3LHKA 3GLUA 1ORRA 2WJZB 2VLBA 1ODTC 3GJ8A 3O1LA 4PG7A 2MYPA 2H0AA 3MXTA 5GOZA 1QP0A 1OFVA 3LVBA 4GMHA 1XZLA 3AJDA 2BFNA 3DDZX 2JCXA 2C8JA 2QZ4A 1U0JA 3KS9A 2G5PA 3PT9A 4JEUA 2VEDA 2XMQA 2JHPA 3EIEA 1SBHA 2W2OA 3HEBA 3LGAA 4GOOD 2HMVA 3L49A 3PR1A 3CPEA 9MHTA 1DOZA 4F12A 5SY6A 3T3MB 5JCXA 3PYMA 3G88A 4KFUA 2EKBA 3BXZA 1E5XA 3DO5A 2FUCA 4P31A 3DGEC 5IVDA 2QR3A 3WNZA 5JLJA 3ON5A 1A76A 3VPFA 3F47A 5JHGB 1T4MA 1UADA 2FYTA 5JXIA 3THWB 4PZZA 3SY8A 3TEJA 2DX7A 2KBEA 4UMVA 2AN4A 1ETHA 2LVBA 3K2QA 3V4VB 1XR3A 1NUTA 1BKDR 1RKXA 1B4DA 3IA7A 5GJCA 4CKCA 1B1AA 1NUSA 3E22B 3QJ5A 2DWOA 4UOZA 4M37A 2PMDA 2HXYA 5JO0A 2VJMB 5IUNC 2H2HA 2GZHA 1Y3CE 3RS7A 3IXQA 2A4KA 4EF6A 3JWJA 1QX4A 4I4IA 1GITA 1RWQA 3BE5A 1PFVA 3O21A 4PVDA 3X1YA 5IKXA 1VIVA 1Z0SA 3G2LA 1K63A 5IX8A 4X8HA 3RSFA 1Z8NA 4YR9A 1DZIA 1K7EB 5IPFA 1GYQA 2IEAA 1EHCA 3OM1A 1C1HA 4PG4A 2XUGA 4E32A 1O0BA 4LJ6A 1FFGA 2DFNA 3KHTA 4O5AA 2X5KO 4JA0A 1HLPA 5H0IA 5LZ2A 3KHSA 3OP1A 3AWIA 3BD9A 1M3SA 2X4DA 2DLCX 5FV4A 1V48A 2QM7A 5E4FA 5AJZA 3UGKA 3IQHX 5F2NA 6Q21A 1RHMA 2RKOA 4HATA 2XNCA 1J4AA 5I8ZA 4OLFA 2O52A 5B7NA 3VR1A 3P0RA 1WHSA 4M9SA 4D4IA 3A1FA 1YGYA 1ZMXA 5ED4A 3TB4A 4HS9A 4TWZA 1Z5WA 2YV1A 1SVOA 1EGHA 2BBWA 3NBFA 4ZYYA 3IQXA 3RTAA 2QX7A 4TL9A 4OQXA 2WB4A 2OYCA 2BGKA 2X0IA 2Y92A 3G59A 3HK2A 1J2RA 1YKGA 5BYJA 1H4QA 4E4RA 3RRBA 3M5DA 4FDMA 1A9SA 3I04A 4I46A 3CW8X 3AVQA 5ALYA 1N6LA 1O58A 4TKUB 1PLKA 4WT7A 4FSXA 2X2EA 2OOSA 2FQXA 1XU7A 2BGLA 4YJ2B 5EMKA 5FPSA 3UC9A 4BBZA 4UEKA 3Q9NA 4R81A 3WK5A 3M6UA 2BFBB 2O2YA 3O0TA 4KHZA 4RVOA 6CHYA 1QU3A 1XZGA 4LHZA 1LXCA 3R6DA 3AGQA 1AQLA 1SUBA 1ZVMA 4DCJA 1GVNB 1PGQA 1R6BX 2FKAA 3DMYA 3R5XA 3TNFA 3TPCA 2LTAA 3DDSA 3OQ6A 2CV2A 4KQ6A 4B6FA 2G9QA 4J4BA 4BP1A 1MZVA 3KQWA 3R5KA 1UDXA 1V95A 4B9EA 1E8NA 2O0MA 2OFOA 2G8LA 3WMFA 3UK6A 2QX9A 3CX4A 1S2DA 4GYJA 2FR8A 3ZK9A 1Z0AA 2FZKA 1E4YA 1P0MA 2WLSA 3KHKA 3WHKA 3RYTC 2PZKA 3R75A 4CM6A 4C5CA 5HIMA 1NDHA 4NNOA 4BO3A 5BNWA 2O8DB 1E4EA 5JSZB 2P9GA 1J99A 3E5NA 2JGDA 1AVTA 2I7VA 3FSGD 3HDVA 4KPGA 5ALLA 4CMIA 4J2TA 5K7SA 3HDHA 3NJ4A 2PZFA 2Z3ZA 2H16A 4JLKA 5IXYA 4AJHA 4WXMA 1LPMA 4M8KA 3ADKA 2J4FA 4XA8A 3GAZA 2QI9C 3ANLA 3N87A 3AEQB 4QXQA 3K32A 2WAMA 5DPMA 1JQAA 2RH5A 1AURA 2CLLB 4XW2A 5KOYA 3ILHA 2ZW9A 4NHEA 3SCZA 1Z0UA 3JASB 5DT9A 5K51A 3ZU2A 3NYRA 3REOA 3GFBA 1DIAA 2OO7A 1LF0A 3F9CA 4WA8A 3VAZA 1FRNA 3L92A 4EHKA 1C7JA 4HDRA 1CE8A 4IV0A 4OK3A 1BEUB 1QOZA 1L5OA 3ANSA 3V5NA 3VU0A 3WWEA 3ZWPA 2WLTA 2QT1A 4BJ1A 3D6UA 4J43A 1FYXA 1XQWA 3BF8A 3G1UA 4YCDA 4CIAA 4G8BA 3EXG1 3KQVA 3MWDB 1XWIA 2E55A 4IO0A 1Z6PA 4HAWA 1BXGA 3EZ2A 2LWIA 2Z8ZA 1JDJA 3MWYW 3GF4A 1K89A 2PH7A 4J2OA 3IELA 4A26A 6REQA 4P93A 1G60A 4ZYTA 1VBMA 2BRUA 4O4LF 3ZK7A 3URMA 5L3SA 4N5LA 4ZVKA 2PE5A 3BMNA 2EZ8A 3SE0A 1CUHA 1EIZA 5THXA 3AHDA 4N01A 4ZVQA 1WCWA 4IIUA 2OZKA 4HEQA 4FOOA 1M6VA 3V4SA 1SZDA 3MGGA 3SJAA 3Q9SA 3RSHA 3ZU4A 2P2NA 1GAWA 1K6IA 2PNFA 2LXNA 1Y4UA 5DULA 3SZGA 1J0CA 1C1YA 3S7TA 3VR6D 5LU9A 4YDSA 2CMHA 1Q14A 1JIJA 1XWWA 1FQJA 1JS1X 3OJXA 5F5LA 1J70A 5DNDA 5BYAA 2IC5A 2FTKE 3P94A 2RGNC 5EP3A 3SX2A 1ISJA 4DFDA 1AMOA 1SURA 4L95C 4A6XA 4IP0A 2VSFA 3NC1C 1VJRA 2D1SA 2MMGA 3EEIA 1Q20A 2OHFA 1U0TA 4V38A 3T35A 1OBHA 3O3MB 1ODCA 3LUFA 1ENOA 3MCTA 4WK2B 5EQJB 2OM6A 1XDDA 2YY6A 2O14A 3KYBA 2VP4A 2GGSA 3RUCA 2O7SA 3Q98A 4KE7A 4EMUA 4DARA 1DEHA 3NEPX 1YB5A 4ZOQI 3PTAA 1EVIA 4QU8A 3OLWA 4UFPA 1NHWA 4FYIA 1SIWA 3C8HA 4EHLA 1APBA 4CLOA 1P75A 4Y67A 1A27A 1G2OA 2RIPA 5IT5A 3KTOA 3SHWA 4MVWA 5HXAA 3EPJA 2DULA 1C9KA 5TF0A 1M0TA 2FPLA 2G7ZA 2NV2B 3NHAA 4BWFB 3VPXA 4DWWA 4JP5A 1ULHA 4EYQA 3O9ZA 3AVXA 5A4IS 4QUKA 1SY7A 4OHZA 4O4IF 4D96A 3JQAA 4ZMRA 4XUDA 2QA5A 1OX6A 3AHCA 4Q3EA 3S70A 1QHYA 3FUVA 4D56A 2RHDA 4JCCA 1T1GA 3ADOA 3M1YA 4P5DA 2BIFA 4GOLD 1ZXLA 1B8NA 4ME6A 5I7HA 2ZIWB 4QQ8A 3NNSA 1YI1A 3ZZTA 5HJ7A 5K0BA 1A8UA 3ELWA 1Z5NA 3P9SA 3R3HA 4CR6A 4LXXA 3W7AA 3KIPA 3MMNA 5EXXA 1BX0A 1VZ2A 3KYDA 3L8CA 4Q3KA 3ZWNA 1A3CA 4X6XA 3Q2OA 1KY5A 1G5TA 1SPXA 2JW5A 3SSOA 1QV6A 2H1VA 3FSJX 3QY0A 3W1EA 1FDIA 4Q21A 4XJTA 4TWJA 2CDNA 5C31A 2ZAOA 3A1DA 1RYHA 3QLTA 2P9YA 3B20A 2R1UA 3B7WA 3KJFA 4LJRA 1HFWA 5FNVF 5TSDA 4R4JA 4N41A 4UCQA 3ROQA 1WP9A 2FOLA 1JHUA 4GMGA 1P77A 2ZT7A 1EWTA 1LX7A 3PUYA 1NG9A 4D5GA 2YTZA 2IOHA 4J16C 3H4IA 4LC1A 4Q4AA 1RLIA 2P5UA 1D03A 2F3RA 1XDWA 3GHYA 3MAGA 1JXMA 1UT8A 2P4SA 2RGAA 4MQ5A 5LMUB 4XFJA 4OMFG 2HF2A 3PB3A 2OVBA 3ZWVA 5J2UA 2XE8A 4R51A 3ZE7A 1H23A 3S99A 2GJ8A 4LE1A 4Q3CA 2QTVB 5K3DA 3IAUA 5EE3A 1NI4A 4DDTA 5LR6A 3RI3A 4I1OA 3P9PA 2B20A 1KDVA 2VBIA 1CB0A 2MSCB 3V4FA 1Z5ZA 3WISA 1VL6A 4W5TA 2OKGA 3OE7D 1LLQA 3TNJA 5LWHA 3VUFA 2B25A 2HRBA 4C05A 2GO1A 3FYUA 1ZHOA 2HYIC 1L7AA 3ZWKA 1RLMA 1EZ1A 1EG7A 4FONA 4QYSA 3VPSA 2PU5A 1W96A 3FZGA 3G2QA 2BFWA 3S3TA 4G09A 3DMTA 5K0GA 2C1ZA 3NT4A 1NASA 2A2ZA 2XMPA 4MQFB 4N0QA 1NBMA 3HVUA 3PIRA 4FGZA 5DT2A 3S5JA 3GDHA 5LQKA 3WGZA 3GWZA 3BFXA 3B9QA 1K6XA 1UPAA 2RCNA 3GWGA 4WFKA 1J39A 4OQNA 2JLAA 2PRZA 2A5GA 3FLEA 1X87A 3ANYB 4Z0NA 3ZDXB 3S81A 3ZZNA 5F7ZA 2QUAA 3IT1A 3HCFA 3QX7A 4EHAA 1IQRA 2A59A 4X7PA 4KGZA 4OYHA 3WG9A 3R0VA 4OQMA 1C3JA 1YS9A 5DYIA 3UUEA 1E6MA 1E3IA 1Q7CA 5TS2A 2QZSA 4G4IA 2PUAA 4XD7A 3SSAA 3ZKAA 1TVKA 3BSWA 1BW9B 2J67A 1QZZA 1U3WA 2X9GA 1X7WA 4I6EA 4KVGA 3TTWA 5KHOC 5A3VA 3EY9A 2YHUA 2AE2A 1E1MA 1WABA 1XJ0A 3QSGA 2BFPA 4PZCA 2Z0MA 2FHSA 3DLPX 3T1HB 3ML1A 4MWZA 4NMHA 4HLCA 4AMBA 4ZVOA 2JIQA 1R9GA 4YJ3B 2CLCX 3T1QA 5AW6A 2XKJE 4QJIA 2WM9B 4D9JA 1AMNA 2C2WA 2FMHA 1H9CA 3SYKA 2A9FA 3J80A 1GPJA 1YQUA 4MP8A 3TJZA 5JY6A 3K6KA 1DAIA 2CEAA 1DGQA 3GW8A 4DVGA 2BPOA 1KK3A 4YWJA 4L3VA 2F3QA 2WTBA 4FFVA 5IFLA 3OJ0A 2V7TA 2FG5A 3ET4A 5IAAA 5LQAA 1YXMA 2RH4A 3BRSA 3GLHE 4LIPD 4YEDA 3LZ6A 4EELA 3NHJA 3QYFA 4WFJA 3J81A 3LFHA 4B82A 3E3AA 4DMRA 1H22A 5DP1A 2W6QA 3P52A 3T34A 5A4KA 1ZQ9A 5AI6A 2FZLA 1PDVA 1DS6A 2CWWA 2DHCA 1S89A 5JHHB 4I1YA 2XZDA 2OCPA 3FPKA 3RKUA 1ICEA 2Z43A 5DCUA 3K0BA 4N6GA 4OGFA 4V0NA 2GS9A 3F8SA 1V7PC 3FWKA 5AK6A 3QX9A 4I5GA 4FHZA 2DQ4A 3VNSA 3B89A 4PYIA 2X9VA 2FN3A 1YDHA 3SHTA 3TTUA 5L3VA 1BN6A 1JU9A 1A2OA 1L7RA 4K40A 3OFNA 2EFCB 2OGWA 2PIDA 1YVEI 3DFFA 3ZHSA 4DNFA 1KFKB 1D2NA 3BSFA 4GDFA 2VTBB 1W73A 2BGJA 3QITA 3RVLA 1GUZA 4ZCMA 4YMLA 4RTQA 3AKEA 1PBNA 4JS0A 2GEFA 2C5LA 3AX6A 3PK0A 3U7JA 5K3CA 5ABPA 4YMVA 4RNCA 5E7IA 2ZBDA 5EHXA 3LHSA 2CUZA 2W43A 4H6PA 1UXHA 3EFEA 3ZE6A 5B6IA 2R00A 4L73A 4MV7A 3TKAA 1RKBA 1AIPA 1Z0FA 2HHLA 4GPZA 5B55A 1QCDA 4Y1RB 4Z4GA 4EUFA 3OP4A 2V7QD 3KWMA 3UJ9A 3CVYA 1WHTB 5CXUA 2QQ5A 3KB2A 4RD1A 5DN9A 5KU1A 3GFPA 1J0AA 2FN9A 4DIBA 2WFLA 1RT9A 2XMZA 2Q5JA 5LYYA 2O1WA 1FSSA 2YN4A 3CO0S 3LBNA 3EIFA 2H4YA 4KYUA 2NSLA 3BFPA 2BTQA 3J7AC 4KRXA 2XOKD 2DFDA 1SKMA 2FW9A 2CL5A 3E35A 4O2BF 4F46A 1YKFA 4YHBA 4RY2A 1FUUA 1T1RA 4N82A 1N33B 2Z4TA 1SCDA 1KK0A 1PZGA 3FPSA 3LS2A 1L7DA 3QPAA 3L8HA 4O0LA 3QKWA 4Y2HA 2QR5A 1MAWA 2QVXX 3DDCA 3L7IA 4JL5A 3PGLA 2LCFA 1K6JA 2B7BA 2PO7A 1U8AA 4FOTA 4DLZA 4EG6A 4LI3X 1FLNA 2QD3A 1JYSA 1K6EA 1C29B 4NZYA 2WZCA 4EF5A 1SFRA 4DDKA 4ISBA 3SVTA 4EGQA 3F7OA 3BDIA 821PA 2H9IA 2IEDA 2H9AA 2P27A 3RSCA 2GAOA 4Z1MD 1JQLB 3WHPA 4RJTA 3NAMA 3R6LA 2FSHA 2O5CA 1RRCA 3DDWA 3EC1A 3PRJA 5FTJA 3H13A 3D4BA 1NATA 4WECA 4Y9TA 2H85A 5JXWA 1GEGA 4ENVA 5BVGA 3N6XA 3HDTA 3CNEA 1M1YA 1OZAA 2ZDHA 1JDBC 2OV4A 4IKOA 5FQOA 1ADFA 2AJTA 2W8ZA 4GI2A 4AF7A 2D5IA 3OIWA 1UJ2A 1AQ6A 4HGQA 3TLZA 2DH6A 3LC1O 3U9TA 4YCCA 1UBNA 1O6FA 2PWYA 3FCOA 4KSYA 4S04A 1YJCA 2IXBA 4MGYR 1SXJA 1HNNA 3MJDA 5KDOA 4P82A 2EL9A 1K8ZB 4LRSB 3NAQA 2BGUA 2H1RA 3PJDA 1ZVVA 3HA7A 4XD2A 4FI3C 2QRVB 5KZMB 5AVJA 3VR3D 1XZDA 1N1DA 1I3CA 2YVQA 3EG5A 1K4YA 3KEGA 4Q4LA 3NXSA 4KFTA 2CDAA 2I8LA 2OBFA 3ORFA 1U5BB 3DOFA 2Q5HA 3NT5A 3QUCA 4YUWA 4E21A 5J3JA 3V8BA 2LCQA 3WK6A 1XTTA 3IJEB 3K9QO 3AR3A 1P91A 3FM9A 3K9NA 1OB5A 3G79A 2O8EB 4GMXA 3JAWB 1JKJB 2E4XA 3I4CA 3D4IA 3O0DA 4QXPA 4WINA 4YDHB 4BNKA 1CU1A 5TLSA 1ZONA 1YWGO 3QPDA 2XDQB 4PCVA 4ZVLA 1ZEMA 4YLEA 5EYPA 2HUNA 2JVJA 4CUZA 1RYEA 1CUEA 2V5UA 5EKTA 8ADHA 2Q3HA 2JFHA 3B1XA 3QNUA 2IPAB 2HREA 1P5JA 3CEHA 1W5SA 4B2YA 1JG7A 4LBVA 1I1HA 5EXPA 6AT1A 3OZVA 3QVVA 2R1VA 1K7XB 3N8KA 4M2LA 3USCS 3M2TA 4WV3A 3P20A 4Z53A 1QQ6A 4MX8A 1NZFA 3QQPA 3BILA 3NPMA 2OFPA 3P9IA 4F1JA 1WXWA 3UBMA 4UTNA 3GEIA 3TUJC 2B37A 2AQIA 2SNIE 2WJGA 3HI6A 3JV7A 3ZQJA 2HHAA 3AUSA 5KSYA 2O8CA 1CQJB 1R0LA 1RQXA 4YECA 5JVDF 2FR1A 2JIZA 1I6KA 4PNZA 2D0IA 2PMKA 4NWIA 1AKNA 1X80B 4NCAA 5KOJA 2PIAA 3ETLA 4CRWB 5AK3A 1U2RA 3E53A 1V3TA 2FX2A 2BM0A 2NUPA 5EWJB 3ZE9A 4NYJR 1BMFA 3SZ3A 4KXFB 3A04A 4FE3A 2C84A 3ILVA 1DWQA 2UYYA 2ZRAA 1B2LA 1QAMA 5C52B 1G9TA 5JANA 4UVDA 4B74A 2XUIA 5LA6F 3RC3A 4M7RA 4X92A 4DV1B 1Q11A 2ZJ6A 3I8XA 5ECDA 1FNBA 3SAJA 1KZ4A 2DBYA 3PGXA 1G5IA 2X1HA 3N2ZB 4ZK2A 5C5CA 3QX8A 3BT7A 3HBNA 5LB2A 3IP8A 2YYSA 3P1JA 1ADGA 2HWUA 1B1CA 4ID3A 1KU0A 1ZBDA 4G01B 4BUJA 5AI4A 2ZDGA 3UB2A 1L7VC 1XALA 4V3CA 4TL7A 3ZD8A 5IJZA 4M1SA 2WIJA 2CBXA 4O33A 1AS3A 4YPVA 1ZU4A 2V1UA 1WMFA 3W7VA 3U7EB 2LDBA 2ERXA 1HL7A 4B32A 1FRQA 1TAQA 4MS4A 5C1OA 4UUBA 1JP7A 1HT0A 1AZLA 4V39A 1DEAA 1QFSA 1G59A 4PTYA 3UVEA 2R84A 1E2MA 1XRJA 1MNAA 2FMXA 1JG3A 2I2CA 1TKCA 3NQ41 3BXPA 1OBOA 2YYZA 3DHWC 2VPPA 4YQFA 1Z5UA 3VZDA 4JOCA 2VLIA 3ICOA 4O4HF 5JCJA 2IXAA 1P1CA 2Q1YA 2NO9A 4L16A 1MGPA 4CMEA 3FR8A 3EFBA 1M7HA 2X7JA 3INNA 3AIMA 1RHKA 4UW9A 5KX5A 1S9DA 3K0EA 1JVBA 1OTYA 3ZKWB 5J1TB 1BXZA 2R3SA 1WDTA 2Z09A 1QIIA 4TRJA 1U8UA 1FFDA 2C99A 3CKMA 3OG9A 1G6KA 4L0CA 3O4FA 3HABA 3MTIA 1MIHA 4LYEA 5AJTA 3VZPA 4F6RB 4EYSA 4CKEB 3GUHA 3RUIA 1VMKA 4F93B 1NYTA 2WUEA 4EL0A 5EJ7A 1O03A 3X2FA 2JARA 2NXEA 5DNWA 1NU8A 4CTOA 5BMOA 4QXOA 5D3MA 3VZRA 3ZY2A 4F3TA 4OXXA 1EFVA 3CTMA 3EGEA 1FVHA 1OI4A 2DUJA 4DIEA 2O8FA 1YQEA 1U4SA 3OQOA 1KAHA 2CMGA 1CIVA 2NQTA 3QENA 1OAKA 4M22A 3AVOA 1M0EA 4DDWA 3P4UA 2QBYB 3TR0A 1IL0A 3T7SA 1OTHA 3QFHA 2AEJA 3LPCA 1B76A 2R60A 2OWDA 1S2IA 1T9GR 4MRPA 4MK4A 4IWXA 4E70A 5EAIA 4PVCA 3GLHB 4WKNA 4IGKA 4TMZA 4K7JA 3DE0X 2ZJZA 3BIJA 3L8EA 3CH7A 4OB7A 3RK4A 2VYVA 2IPNA 1T9ZA 1OYWA 1W46A 2YWXA 1FSGA 1T8SA 3N8DA 5JDIA 5KS2A 4P22A 4J0CA 3QX3A 3UOWA 1X1DA 3MTGA 2Y0EA 1A71A 4PIPA 1UXIA 1P7VA 4IIHA 4WK0B 3T3IA 1WPGA 3U56A 3AXSA 4H4EA 3AR4A 1WUHS 3S27A 3DEJA 3EPLA 3LOPA 3TZEA 4BNWA 3RUDA 4LS3A 4DANA 3QYJA 1P2SA 2FQWA 1IBMB 4BUCA 1VJTA 3IAEA 4CV3A 2EDAA 4JR1A 3OC0A 5HRCA 1L5RA 2COKA 4HNRA 1MO6A 2JGMA 4P4UA 1OWLA 2OV8A 3AONB 3ECAA 4IJWA 5CRIA 5H68A 3RJMA 4B8ZA 2ECPA 4X24A 4ER6A 5AW5A 5HHTA 2V97A 3T38A 1JAHA 3W90A 1JIKA 3STVA 4G3XA 2QI9F 1U2SA 1Y5LA 4PHGA 5I7WA 2VJOA 2JZOA 3Q40A 4GOJA 5E6UA 1WXEA 1LPNA 3CF4A 1DDOA 4PRZA 4MWEA 5AW8A 2WIDA 3TMYA 2IQ5A 1PHRA 4RTLA 1U3VA 4ZCQA 1F2DA 4I5FA 4W6QA 1QWSA 2QU7A 1MC5A 1OFHA 3AV3A 2VPTA 4KO2S 1KARA 3K15A 4Q34A 3TD9A 3ELYA 1HOTA 3TSZA 3WGOA 4E11A 1P4GA 4FMBB 1R10A 2CKMA 2OHGA 4LNUB 3CUKA 3DMNA 2ORIA 4Y2GA 4CEJB 1CFJA 5ECGC 3HCNA 1H1DA 4IOLA 1TJ3A 1L5GB 2GBLC 4NEGA 2EHJA 4IJQA 1Z25A 1P5FA 2ADMA 2EG5A 3UMRA 3LCUA 4O4JF 3V9PA 2AZDA 1OX5A 1THMA 4H1TA 4POOA 4GSLA 5TQVA 3TQHA 2ZYSA 1Z22A 3D6AA 4XPIB 5DW0A 4RVHA 1RACA 4G1VA 1JTFA 3HWWA 4QTZA 3A6DA 4W9NA 3EQ9A 3UK0A 3JQ8A 4AO7A 5KVAA 1PR2A 3V9AA 4JT8A 2PV0A 1VPEA 2IYFA 3ROMA 3GJ4A 1UCFA 4NENB 1JDUA 3GEMA 5B2FA 2VK2A 1RQPA 4F6LA 4CYMA 3UAYA 5JPDA 2N0SA 3ETHA 5E9WA 1M5TA 1KZHA 2F17A 3L7DA 2JL1A 3OLVA 3RC9A 4PFJA 5KTSA 2QW0X 3DT6A 5AWFC 3G0OA 3UAWA 4F91B 2QK4A 3E4DA 4ZYWA 5GZ3A 5IVKA 1AKYA 2YUIA 2JJMA 4MVJI 2NPFA 5IDQA 2H2AA 3SC3A 2JFNA 2BLNA 2Q5QA 3SQDA 3QUBA 4QASA 1PYGA 4LDNA 1ZSYA 2QTZA 3E0QA 3T94A 1D1QA 2Q3FA 3QI7A 4P54A 3DM9B 3SLGA 3ZDEA 4BNDA 121PA 4M9UA 4WBNB 4W5NA 1E4OA 1GU1A 1LC0A 3EF3A 1MIOB 3CNLA 4IDCA 2YXBA 2AOUB 3EA0A 3M3PA 5EUMA 2C7RA 3CLRD 4ETIA 5KSWB 5JS1A 3RJ9A 5NLLA 1YASA 2DP4E 2EBFX 3NORA 4NQRA 1KSJA 2JBAB 1NSTA 4TZTA 2Z2ZA 4G81A 2YXEA 3KDPA 3LLMA 3PEFA 4KJZA 4ZVNA 3A6EA 3DYBA 4Z7JA 2PZMA 2PA3A 4KDFA 2ROQA 4WNAB 3K0AA 4MOWA 3PHLA 4NOLA 3ZH9B 3OT1B 3IAAA 5LP6A 2ZR0A 2CVFA 3D8TA 4CN8A 3U7FB 4DB2A 4JR0A 2XLBA 1H3NA 1ODIA 3K0CA 5JUWA 1E8DA 2CSUA 2KI5A 2PK3A 1QOPB 2Q7DA 3UKJA 3EQZA 1LVGA 2JHCA 3IKTA 3C1TA 4HR7A 2VXBA 4MO2A 4CQMA 3O73A 1H2RS 5K0FA 1WKBA 4ND4A 1ZXXA 1BFKA 2WMYA 2I34A 2RGRA 2X3FA 1NX9A 5DVZA 3IMFA 5DHPA 3V55A 4HVTA 1WOYA 3AIIA 3CKLA 4E5YA 2NX2A 3CR3C 2D3TA 2ZSKA 3I6QA 2XX3A 5M2QA 4RFSA 3N2KB 1Z0ZA 4I50A 5DXJA 1GZ6A 1Q3KA 1H0SA 1QE3A 2Y1WA 2YV3A 5GVSA 3GVIA 1WXQA 2ZCVA 1IHOA 3LWZA 1BQ3A 3OICA 4PLCA 4YRRA 4YR7A 4K6GA 1NW4A 1F8GA 3JZFA 2X0JA 4TUYF 3TSWA 5C18A 2Z2KA 4UU0A 5AW0A 1II8B 4JAVC 1JR3D 4TLDA 2Y1OA 4MXDA 4DPKA 2GK3A 3BHNA 1KI9A 1UZUA 2V96A 3MLAA 4IJMA 1F60A 2ZU0C 5KJEA 1XLUA 4J3JA 1Y1LA 4QGBA 3WGVA 4OBWA 1PF7E 2HWXA 4JVNA 3BXXA 2ZIXB 5CT6A 3T15A 4QYTA 2V6JA 1VECA 1UBKS 5LVAA 3NH9A 3URKA 3OIFA 5U1PA 4X1YB 2PL9A 3RHSA 4EVIA 4QL3A 3ANXA 1UDWA 4GPD1 2HM7A 3MWKA 5HQ3A 2VUTA 3U9SA 5AKIA 1O94D 1XVAA 2A0YA 5GGYA 4EGAA 1U81A 3TZKA 4KRYA 3RPEA 1U28A 5IT0A 2GN4A 1E89A 1CD5A 2O0JA 2SBTA 2W2LA 2QUHA 3BBLA 2F00A 3JD1A 4G4SO 3CLTD 1G4AE 2FQYA 3OIYA 4J0QA 4N0DA 2C5EA 5DASA 2PJUA 3JSAA 5AMXA 4ZEWA