1OFTA

Crystal structure of sula from pseudomonas aeruginosa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
119
Chain Sequence
b'PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLNRERILLLQAKDNAAALALSCEALRLGRSHTVVSWLEPLSRAARKQLSRAAQLGQAQSLNIRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN PA3008
molecule tags Bacterial cell division inhibitor
source organism Pseudomonas aeruginosa
publication title Crystal Structure of the SOS Cell Division Inhibitor Sula and in Complex with Ftsz
pubmed doi rcsb
total genus 35
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03846 SulA Cell division inhibitor SulA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oftA00
3AUYA 2HCJB 4H1VA 3IIMA 4ZI2A 4GDFA 1K5DA 4DLTA 4JLOA 3ND8A 1G41A 1XCPA 2UZIR 1NIJA 4DLSA 1OIXA 821PA 2KB0A 2H7VA 1MABB 4KYUA 4DDVA 4EIWA 4V0ME 3WBKA 3QXJA 4N3NA 2A30A 1HV8A 4AURA 1WBDA 1SXJD 2KI5A 4OBEA 1UF9A 2ZVQX 3P1JA 1G3IA 3EIHA 4MUAA 2Q6TA 4G5QA 2WSMA 2PBRA 5E7MA 3L82B 2O8DB 3SJZA 1XXHB 2J0VA 1UEJA 5AJYA 1Z5ZA 3AVQA 421PA 2IYSA 4K81B 1UDXA 1GAJA 3FYHA 3NG1A 5TDHA 5EXXA 3W8RA 4Q4AB 2FMXA 3BS4A 3A36A 5KSPA 4X8LA 1ZUHA 4RD1A 1I4TD 5KTYA 2FZ4A 1EXMA 2PLFA 4YDHB 5EE5B 1U0JA 3BGWA 3UIEA 1RKBA 2ODNA 2ZYWX 4HLDA 4A6PA 4RFSB 5D3MA 3EA0A 3B1WA 2RAPA 1J70A 4B6EA 5H1YA 5J4YA 3TK1A 1ZD1A 4LK2A 1U0HC 3DDCA 1P60A 4HSEA 4XWAA 3FKSA 2G3YA 4TQAA 1KMHB 4D6PA 1XU4A 4BWYA 5KU1A 4M0LA 1EX7A 1Q20A 4MGYR 2V55B 1AGPA 3T15A 5KPJA 2VSFA 3BAFA 4E5UA 1Z0FA 1X6VA 1BYUA 4KLNA 2O0KA 1R4AA 4Q47A 1S4QA 1SXJB 2W0MA 2HUPA 3B60A 1NBMD 1KO1A 3SN6A 4RZ2A 3K0CC 3QKUA 3A1TA 2ZRHA 2ZVPX 4M1YA 4MGIR 2WOOA 1OB5A 1E2MA 2W0SA 4DCUA 2X2EA 1VECA 3OIUA 4GRAA 1BYIA 1QHGA 1UKEA 2ZAOA 4KCGA 5A5GA 1Q0UA 4EPXA 1PLKA 2AKAB 3I3SR 1NVVQ 2RMKA 3O8BA 5FL3A 3FE2A 1Z6AA 4YMUA 2YWGA 2OE2A 3M0EA 2BC9A 1PV4A 2QMOA 1R5NA 1E0SA 3BB4A 2EWVA 4BFZA 1CF4A 1ZYUA 1D5CA 4IDQA 1W0JD 2YKGA 2QAJA 2QPOA 4QBGB 1SULA 2H92A 3A4LA 3AKEA 1LNZA 2QT1A 3LW8A 3IILA 1AS2A 2V7QD 4URYR 1JR6A 3KKOA 4CEHA 1MT0A 4LYJA 3I61A 4LYFA 2ATVA 3TW4A 2ORWA 3QNUA 5DI9A 1VYVA 1L8QA 5TY0A 1X86B 3SJCA 2C5LA 5LPNA 2WVJA 3EA5A 2W2TA 3DM9B 1C1YA 4YLGA 2IHBA 4EFMA 4K8OA 3FPAA 4Q9IA 2CE2X 2HYIC 5LBIA 1P2UA 1T9HA 2B21A 1VYUA 4CIDA 4CF7A 1U8YA 3BB1A 1US8A 4KHZA 2V8OA 3BFVA 5G53C 3LVQE 3CWZA 1E4VA 4ZO4A 3WHLA 3CH4B 2CE7A 1KI9A 3THYA 2JLYA 1LY1A 1XEWY 1AQYA 5SZJA 1FQJA 2FSIA 1G6HA 2GVDC 3MUFA 3NBFA 1NJFA 3LWNA 1JPNA 2JLQA 2JIZD 4US2R 3FMIA 1AKYA 4UNNA 3PXGA 5EUQB 2MMGA 1FZQA 1R6BX 1Q57A 1OFHA 5SZIA 3UWOA 8OHMA 2RGEA 1W1WA 1ZCAA 2GWHA 5JCZA 4EJSB 4URZR 2BMJA 1T5IA 4Z8YA 1AA9A 1BMFD 1OXVA 1KTVA 3GJ7A 3M6AA 3GLFB 2IS2A 5AJXA 3DKPA 4JL6A 2ZS7A 2ZJ2A 5EZ5A 4NYJR 1OXSC 5JCPA 3SQWA 2FGKA 5LD2C 1W44A 3CPHA 1N2CE 1Z63A 2PL3A 1DBSA 4L16A 4RZ3A 5K8UA 1ZM4A 1JJ7A 4FINA 2A5FA 3UMRA 2H17A 2ZRDA 1G7TA 1ZC4A 4FW9A 1AQUA 2J41A 3BERA 3O8CA 4N0EA 3T1VA 4UXIA 1Z6TA 3IDQA 2GKSA 4GBMA 3AP3A 1HYQA 5FL7A 2CNWA 1PVOA 4YMSA 4F91B 4US0R 1S3SA 3IQWA 3LNCA 1NIPA 3K70B 3AVVA 1SVWA 2J5XA 3CKLA 4JLKA 3AVWA 4I1VA 1E9SA 1M8PA 4EQ6B 1XPOA 1P6XA 2GAOA 4LBWA 4M1MA 3C15C 4TL9A 3U6KA 1XXHE 3P20A 1G5TA 1G5PA 1GUAA 4XVRA 5FR2A 2AL7A 4Q7KA 4DSTA 2O8FA 1HE8B 5HCIA 2QAGB 2QMUA 1U8AA 4FWIB 1F3OA 4DEYA 2JLVA 2IXFA 3CRQA 1TF2A 1VIAA 1NP6A 4AWXA 3A8TA 2FH5B 1GRQA 4QJ5A 4WZAE 2J3EA 2ZREA 4C2UA 2I1VB 1YJ5A 1OXXK 1OXTA 2WMOB 1P3JA 1ZUNB 3K9NA 3RANA 4A36A 4LPSA 2FX3A 2HCBA 1TF7A 1XD8A 3MGCA 1R0YA 3M4YA 2I3BA 4N0DA 3WMFA 1DAHA 4EFLA 3GD7A 1NVUQ 3QEJA 1KI6A 3THOA 2C78A 2C03A 3GFTA 5JEEA 4HLUA 3B6EA 3FHOA 5HR5A 4IKEA 3E2IA 1E1RA 1G64A 4B74A 1Z2CA 1ODFA 1E1QA 4IEEA 1Z07A 4YMWA 5HPYB 2XNDD 2D4HA 4L5BA 2XAUA 4TYWA 2WJGA 3KFXA 4HLCA 4ESHA 1OW3B 4RD0A 1VHLA 4V0LA 2WKQA 2YZ2A 2FPLA 3U44B 3I5XA 1T3SA 1TL7C 4R2IA 2H8KA 4L9WA 2ZRAA 4PSVA 3GEIA 5LD2B 2PJRA 2V4ZA 2OBNA 1W4AA 4HB4A 1FTNA 2Z4SA 1DPFA 1GG2A 4WOPA 4ESVA 2J0UA 1RPZA 3U7EB 3ASYA 5EP3A 1WQ1R 4NCNA 2WZQA 4POAA 1P9RA 1G8PA 3CZQA 5J4KA 3TSWA 3CF0A 2CCJA 4BEJA 2Q3HA 3UWKA 4DDTA 1IXSB 3Q9LA 2J59A 1TNDA 4DLYA 2ZE6A 2FN4A 1TQ6A 2CL0X 3KKPA 1ZIOA 2Z0MA 1IJEA 2EYUA 4DLXA 4TQ9A 5BXQC 1ZIPA 4GSYA 4GOJA 1E94E 1NBME 1E9BA 1X3SA 3S1AA 1NKTA 1F48A 4IVPA 3THXB 2W6JA 2WIBA 3EC2A 1JXOA 1VIYA 1HQYE 5BWMA 221PA 1X8JA 3ZH9B 1E2GA 5J40A 4LC0A 2FFBA 2JLXA 2A9KA 2OCBA 2OAP1 3EARA 1TPZA 4JL5A 4BFWA 4XWOA 5JWOA 2GK6A 1E9CA 3PQCA 1GNPA 3PUVA 4MRRA 4OK6A 4OQFA 4A0RA 1EWQA 3CIOA 1KSHA 3PCRB 3RAPR 4Q9LA 4DB4A 2E9SA 3NDBB 1E9AA 1GKIA 5EJEA 2QI9C 3I8XA 2ERYA 4MA4A 4GMDA 5EP4A 3E1SA 1M2OB 5FBLB 1N25A 1Q3TA 1UBCA 1R0WA 2ZITA 3LX8A 4LJ4A 5F98A 2UVQA 3LV8A 4Q9KA 3NC1C 3L0SA 4OHVA 5P21A 1R2QA 2VSXA 1G1MA 2CVHA 4LBZA 3W8NA 2WJVA 3N2IA 3ZS9A 5IDVA 4DDWA 3QEOA 5FPKA 1EFHA 2P6RA 4AK9A 4G0NA 2F1JA 2O0HA 5IRCD 2OM2A 3SR0A 1DAGA 1IBRA 4KITB 2D7DA 1JJVA 1VTKA 2OFOA 3KB2A 3ASZA 3V4FA 5AJVB 2AXPA 3UK6A 3VQTA 1JAIA 3AEZA 4HDOB 1Z08A 5CK5A 5CIQA 3CH5A 4HUTA 4BLQA 3I5YA 2F1RA 3GJ6A 5IK2D 1D9XA 3HWSA 3U3KA 5HE9A 4CT5A 1COWA 2NO9A 2FWRA 5G3ZA 5FUYA 2VP6A 2GNOA 3CR8A 2OO7A 3U61B 1YZGA 1UKVY 3L2OB 4NYJQ 3SNHA 1CRQA 3CX7A 2G77B 1KK0A 3R9XA 2QT0A 1P5ZB 2QORA 3GFOA 1M1YE 4JSTA 4QHTA 1HT2E 3CLVA 3PVSA 5D3MB 4KI0A 1NMYA 4BECA 2YV5A 2BCJQ 1XFAA 1SKQA 1S9HA 1V43A 3MWJA 2CMKA 3FKQA 2RGNA 4D80A 4DCNA 3QF4B 4LV6A 1GRRA 4IEIA 2CDNA 1L4YA 1WP9A 1G3UA 1WF3A 2D2EA 1Z0IA 4Z8XA 3P4XA 5DN6D 4MGZR 2ZU6A 3EAQA 3VU9B 3PEYA 4QGHA 2ORVA 1KI8A 4HUQB 3NTUA 4NYIQ 4B3FX 3K9HA 2B6HA 2ZS8A 4PHTA 1Q22A 4Q4JA 2EWWA 4A0GA 1ZAKA 2CVFA 3SFZA 2A2ZA 5KHOC 2J46A 3IPYA 4DB2A 3LX5A 2F3TA 1ZMXA 3GLGE 1ZJ6A 1YRBA 3NVAA 1IY1A 3QKSB 1MO3A 1GITA 1ZRHA 2ZYVX 3OE7A 3V9PA 4D0NA 1IOZA 3VNUA 2PX0A 2RGDA 2Z43A 1OHHD 4JLMA 4A2PA 3L0IB 4BLSA 2YOFA 5CIWA 4B33A 5JRJA 1U8ZA 4F4IA 1YKSA 2GZDA 4LYAA 5AUNB 3ICQB 3CW2A 4FMCB 4OK5A 1D6JA 1NLFA 4YMTA 4UXJA 2O8FB 2W83A 1MRSA 1QHSA 2WIAA 1F5NA 3DO6A 4Q1EA 4I81A 4HLUC 4URXR 5JECA 1N6KA 2GEVA 3EIQA 4DJTA 4AKGA 3WP0A 5JSZA 1S1MA 1XMSA 1IN6A 5EQTA 2VSOA 4RY2A 1MO6A 3NH6A 1LTQA 2D2FA 1G5RA 3KJGA 2JATA 3EIEA 3OAAD 3SOPA 4IXMA 5AUOB 2IYXA 3T34A 2W58A 4MH0R 4P4UA 3PJRA 1IM2A 2QM8A 3WMGA 3DZ8A 1FNMA 4JBYA 3PEVA 2OZEA 2O0JA 4B48A 1ZC3A 4LOAA 3R8FA 1TX4B 2ZRMA 3B8HA 3E70C 3QY0A 1SVMA 2NIPA 4TT3A 3RC3A 4DIEA 5KNCA 4JS0A 1P2VA 2DCUA 2MSCB 2GHIA 3E5HA 3WMEA 4C3ZA 4DLZA 1Q44A 2GZAA 4BFYA 1B0UA 4JBWA 4TLAA 2J0QA 1Q1ZA 5EXSA 3AVPA 4KU4A 1E9FA 5BQ5A 4OI4A 4W9MC 1I2DA 5EP1A 1U9IA 3RLFA 2IWRA 1L7VC 3GLIB 2ZUDA 4BFXA 3OESA 4EPYA 2BV3A 1W2GA 2FFHA 3TVDA 3WY9A 2XOKA 4TYPA 4QGAA 5FOTA 2X19A 4Q5IA 1XTSA 3DEFA 5FH9A 1YZUA 1DO0A 2JLRA 1XJ0A 3U3MA 5JSZB 1U94A 1W49A 3OE7D 2Z5FA 4P4SA 4GFDA 3B1XA 4Q03A 3F5FA 1UKZA 3QXSA 4E09A 4PQYA 4M9ZA 2ZANA 4PPGA 4ARZA 3OIVA 2OCYC 1P7CA 1AKEA 1G8HA 2AK2A 2IW3A 1QG2A 2QTFA 5B57C 1IONA 4LRWA 721PA 4HAZA 3MSXA 4DZZA 5DSZA 3ZLJA 3AP1A 3BH7A 1Q1QA 1Z8FA 2X1VA 3SJAA 4LPKA 1XDBA 4MITA 3LO5A 5CM9C 2PH1A 2DFKB 1QDEA 4A6XA 2ZR0A 3MJHA 3QF7A 4BZXA 1EK0A 3CZPA 3GP8A 5F2EA 5G41A 4MRNA 1DADA 4RJLA 3TW8B 3ZIAA 5FUWA 4QG7A 4B44A 4B34A 4KVGA 4MRPA 2CHQA 3FFAA 4TMTA 4R71A 3TJZA 2IXEA 3RS7A 5JS7A 2ZE8A 3BD9A 2A5JA 3KTAA 2OSBA 1CJVC 2AR7A 3H2YA 1Q12A 3A4NA 4PXAA 1J8MF 4CDGA 2AXNA 3QXXA 2OT3B 2R65A 2NO6A 1TAGA 4WXPA 1WRBA 3R9IA 4JLJA 4ZV4A 2WHXA 3C4JA 1LS6A 2AFIE 1BIFA 3QPWA 4ZI3A 1IN5A 2QBYA 5EE0A 3BOSA 4LBVA 5TVKA 1LFDB 1OH8A 2NZJA 4Q4HA 2OG2A 2XGJA 1KAGA 3GJ4A 2EFEB 3WRYC 4RCYA 4DEXA 2QP9X 1XEFA 4Q18A 3NIBA 1T8UA 2CJWA 1ZU4A 2MSDB 1ANKA 4PHGA 3BK7A 2NG1A 4W5WA 4WA7A 4FWTA 1GM5A 4JVNA 4JVLA 1RRCA 2ZR7A 4QNMA 5DLQC 3K0CA 4KV9A 1EWRA 4MUBA 1LV7A 2R2AA 3NHBA 4DCSA 5AUPB 4JVSB 1GWNA 1KKLA 3EZ7A 2ZI6A 4M1SA 1JR3A 4MQBA 3WNCA 2F6RA 1DTSA 4X8OA 1A1VA 2OHFA 1ZM7A 2WWFA 5FL7D 2Z83A 3QJYA 4HZIA 5H68A 3UKDA 3W34A 4EPRA 4KLZA 4TZ0A 4M9SA 3CB4A 1G291 1G16A 4EPTA 3QI2A 3ZDQA 4G5GA 1ETUA 5L8VA 2X2FA 4IDPA 4Q4HB 4DLWA 2G6BA 4PC1A 5JI2E 4MKIA 5FR1A 4RD2A 1OT3A 3G5UA 1JPJA 2LKCA 2RB4A 4BGDA 4O3MA 5HCNA 3QVUA 1SZPA 1PLJA 1N6LA 4R2HA 2QGNA 2FSFA 4LJYA 2VL7A 2WWIA 3BIFA 3LDAA 5BN3A 3ZS8A 2WMNB 1SVLA 2ZETA 1UJ2A 4NBSA 3ND9A 1W4BA 4ZCLA 2W6JD 1YR6A 3LY5A 2JIZA 3VR2A 2EU8A 2YWEA 4FMDF 5CJ2A 2AD1A 2XZLA 2PMDA 2IA5A 3OFNA 4TTRA 2OFXA 1KIMA 4ZIRB 2DWOA 1FNNA 2JJ8A 3W3AA 3P27A 1ZNYA 3AVTA 3LW7A 2QQ0A 4TMKA 5FBVB 4C7OA 1KSJA 3R8CA 1CR2A 1Z2AA 1U90A 4QM6A 4PZYA 1UEIA 2WKRA 1II9A 4NCKA 3PFIA 3KX2A 4F93B 1G18A 1E2NA 1HT1E 2G1KA 2WBLC 1Z6XA 2IBMA 5FBWB 4PHHA 1ELOA 4CEIA 2XTMA 3TUIC 1G4AE 3RVBA 5IHPA 4GL2A 3OHMA 3L0PA 4TLDA 4IOMA 2REOA 4KYIB 5CYPA 2JDID 4P3YA 3K53A 2QAGC 3EZ9A 4BLTA 3UANA 1E98A 1ZU5A 5DN6A 2PCJA 5BN4A 1NN5A 3RS4A 2GESA 4M1KA 3GLIA 2BJVA 4URUR 1IJFA 5FPTA 1T8TA 2QA5A 3REGA 2IYVA 3RRMA 2O8CB 4RVCA 3BFXA 2I1QA 1LW7A 1OYWA 1PZNA 2HJGA 2YHSA 4X8HA 1H8ED 5E7JA 3OFND 1NN1A 3WP1B 4HYYA 1S9DA 2ERXA 4EAQA 2GCPA 4TSFD 4TYYA 3U60B 4FXPA 2WPDD 4XJXA 2GEDA 2ZRNA 1EFUA 4TLBA 3RRYA 2ZRPA 3BXZA 4O0MA 4A4DA 1K5GA 1KKMA 3TAUA 1KNXA 1QF9A 3GFPA 3ZVRA 3KL4A 2O8EA 1OIWA 2IUTA 4IDHA 4NYIR 5FOUA 4DUGA 3CRMA 3X2SA 4HLQB 3LQQA 2RKOA 1E6CA 3VR3A 2O8BA 3AGPA 4UQOA 5C18A 4NTZA 4MRSA 3U7HB 3CNNA 2XOKD 2LKDA 3T06B 1RVDA 3AGQA 1NN0A 3O8RA 2F43A 1ZP6A 3B78A 2ZJ5A 1WDTA 4Q00A 1W36B 5DI3B 1U0LA 3GMTA 4DRZA 3FTQA 2UZ3A 3L0OA 4GNKA 4DXAA 4JIMA 5HZKA 2FEOA 1QHNA 2YYZA 4G3XA 2VLIA 2ZI3A 4LHYA 4IFEA 1A2KC 4C0KA 1N0VC 1UBGA 2SHKA 2WM9B 3T1QA 1QG4A 1NVVR 4URVR 2P65A 2Q3FA 3FDIA 4OQMA 5BW8A 1HEIA 2GDJA 3JZAA 3AVXA 4JLPA 2X8AA 3C8UA 5H8WA 3NBYC 2OXCA 4GOXA 1IN7A 2XITA 2ANCA 2KBFA 4HZUA 2HF8A 3IUYA 1XCMA 4PANA 3CRVA 4Q9HA 3CUEF 4B3BA 3CO5A 4HB0A 1E2FA 3BB3A 5C2JB 4Q21A 4CYMA 1FW6A 2ODBA 2G9NA 4KVAA 4A0HA 3R7WB 1KHTA 2FSHA 3LXRA 4KFUA 1H8HA 2IYYA 3O47A 4V0NA 1MO4A 1CU1A 1CLUA 1CXZA 3QENA 1NY6A 4YXWD 4NHOA 2AWNA 4BLOA 1FQKA 1FUKA 4QBFA 1Z0KA 3GJ8A 1U98A 1UPTA 2PZEA 3Q85A 2OUKA 3NKVA 3KJEA 1D2MA 4QJ4A 3I92A 2ZSFA 3HU2A 2A3RA 3ZGXA 4S35A 4ITRC 5CLLA 2R6FA 1T0JB 1ZVQA 4ZDIA 2EFHB 2QTVB 3AF0A 1R8SA 3CF6R 3R9WA 1XD2A 5L3QA 4MDFA 2Q21A 1GIAA 2XXAA 1JAHA 5HZHA 3VR1A 1EFTA 3KXLA 4S2EA 3MWLA 3RSLA 3SZRA 3THYB 3TLXA 1RYFA 3H4MA 4PZZA 1TTTA 3I4LA 1W2HA 2VF7A 5F9HA 1D2NA 3PG5A 1GOTA 2F7SA 1Q1BA 2REXB 1VG1A 4HAXA 2QBYB 2HYDA 2BOVA 4RD3A 1GP2A 1VCOA 3U7FB 2D7CA 2ZJOA 4FCTA 2QG6A 2AKYA 3DOEA 2DYKA 3UXMA 2H5EA 1G8YA 2BKUA 3EWSA 5ANRB 5FUXA 2OEPA 1WB9A 3WNDA 5FPYA 3QPVA 4L9SA 3C16C 3PITA 3W6PA 5KOYA 5E4FA 3F0TA 1XPRA 3ZD6A 3P32A 2ODEA 3L43A 2G0TA 2ZSDA 3P26A 4O2LA 4TLEA 1KK3A 2ZRJA 3CX8A 4OI2A 3U4QB 3VNVA 3K0FA 1OLOA 1J99A 3B85A 1JEEA 4HZUB 4Q1FA 5KSOA 4CZ2A 1H8HD 2J7PA 2P5TB 2YINC 3B1YA 1W36D 4A8JB 1GFIA 3L8ZA 1XF9A 2WJIA 2Q3MA 2G83A 2B8WA 2KBEA 3X1YA 5GJBA 3EPLA 3DL0A 4IRUB 3IPXA 2GZHA 1OH7A 4B3GA 4JT2A 4P31A 4C0LA 4UNRA 2HV8A 2VQSA 4WW0A 4P33A 1QVAA 2QUZA 2WOJA 3K9GA 1AIPA 2IYWA 3N2EA 1WE2A 1XMJA 3RRNA 4DC9A 2KWIA 3H1TA 2CK3D 3HDTA 2IK8A 4KODA 5TARA 3GLIE 1UFQA 3IIKA 4L4UA 3HPRA 2ZSBA 3W90A 2GCNA 5FI0B 5TXGA 4WZBE 3U3OA 1YRAA 2XJ9A 1A7JA 1KZGB 4L15A 2W2XA 3DMNA 1E79A 1KI2A 1KI3A 1UBEA 2BBWA 2QQEA 4V03A 3TIFA 2V9PA 2FFQA 2V1UA 3OEEA 3ZQJA 1E79D 2GBLC 3P4YA 1JB1A 2A5GA 3A37A 4U7DA 1AN0A 2RGNC 3BC1A 2FG5A 4Y0AA 1SVIA 2WJJA 5D3QA 5KDDA 4Q66C 2R6GA 3W6NA 2J0UB 1VCIA 1FMJA 2N42A 4NYMQ 3SYLA 2QTHA 2VP9A 4B71A 2IF2A 2NO1A 4RKEA 5CJPA 4A2QA 5DH9A 1OKKA 3DVLA 4OHYA 5SZKB 3IBGA 1JBKA 4Q01A 3ECCA 2RHDA 1IY0A 1R8QA 1Z0AA 2D06A 4DUGD 2XB2A 1FUUA 1OF1A 4OYHA 2G1JA 2ZI9A 5J4VA 2QGZA 1KNQA 1W47A 4HAUA 1F2TA 5B58C 3C41J 1KYIA 4G5RA 1NSTA 3BORA 4D0GA 1PUJA 4HB2A 3RS0A 4RD6A 3M1IA 2ZQ5A 1DAMA 5JWHA 4MKGA 4UXHA 5EP2A 621PA 1CJUC 2C9CA 4LY6A 1MABA 1W0KD 1W48A 1NMXA 4XWKA 2QPAA 5AUQA 3KQHA 1E0JA 4JMPA 1QHIA 4MKFA 1W0KA 4KFRA 4Q9JA 2IX3A 2IYQA 4RZXA 1Z28A 4DSOA 2ZXUA 3LAWA 3VR6A 3T1OA 4BFSA 1S96A 2NO0A 121PA 3GJ3A 1UBFA 2F1HA 3GPLA 1BOFA 1S2MA 2R62A 1XEXB 1GNQA 521PA 1JEDA 1PJRA 4PFSA 2ZRLA 3GJXC 2VP0A 5K8LA 1E2LA 1ESMA 4XVUA 3W3ZB 3DKVA 4EKDA 4PAQA 4QKQA 4HDCA 2MSEB 2W6IA 4IVQA 2CL7X 4M4SA 4TTQA 5TMPA 1IQPA 1W0JA 1CP2A 4JYBA 2AFHE 1WCV1 2CLDX 3X1DA 1G7RA 2GCOA 2ZE7A 3A1SA 1YR9A 3Q72A 3K9LA 4GT1A 2GRJA 3AVOA 3ZVNA 5B2ZA 5EE3A 3Q7QA 2ATXA 2RGCA 4LV5B 4PPNA 3TH5A 4HUQA 1J90A 4FMDB 2Q9CA 1VG8A 5AJZA 1NLZA 1D8TA 2CXXA 4M22A 3LLMA 4BRUA 4DCTA 4LDJA 4IVRA 2VHCA 5AR1A 5J4HA 3VX4A 1A82A 3Q5EA 5KDOA 4RCZA 2DPXA 2BWJA 3PUYA 2DR3A 1OH5A 2FEMA 4TMWA 1G3MA 1RRFA 2JCSA 5G40A 2QNRA 4FCWA 3ADBA 1GL6A 3FB4A 5CB6A 3AVUA 2XZOA 1R7RA 4MKHA 2FU5C 3NH9A 2ZJZA 4PAOA 4B2LA 5KNBA 4C7OB 4TT3D 1Z0DA 2GXQA 4BFTA 4QJ3A 4FIDA 1ONBA 3H0KA 1S1CA 3THWA 1UKYA 5JS8A 1SGWA 4D4KA 2L0XA 2CHVA 3H84A 4LZZA 4PQRA 4ZKDA 3F3YA 3VHXA 4F4CA 5FTMA 1OSNA 2FDCA 3HR8A 1R10A 4B43A 3EXAA 4C0BA 2C8VA 3PENA 4JBXA 2QE7D 2CJWB 2YJTD 4F92B 2ZUBA 4LJ5A 1Z06A 2WJHA 5TB5A 5A0FA 4IXNA 1N0WA 3KKMA 4UNQA 1LF5A 3T5GA 5DIFA 1N0UA 3TGPA 2D74A 2QSYA 1K8RA 4ERNA 3FMFA 3HYRA 1W4CA 4OQXA 1KI7A 1P2SA 1HURA 1OXUA 2DWPA 3MMPA 4JLDA 3ZVLA 2P2LA 1TQ2A 1VKJA 3K0AA 5B64A 2JJ1D 1Z0JA 2FV8A 3NBZC 4XTRA 3MLEA 1CTQA 2IF0A 2RGGA 1DE0A 2Z6VA 3W9YA 3PUWA 1G21E 1P61B 2GTPA 4QC2A 3VKGA 3DM5A 1J7KA 1T5LA 4A9AA 3KTAB 1FL9A 1VHTA 2IHYA 1NF3A 4TTPA 3B2EA 5TV2A 3LA6A 5EXTA 3SS8A 1C4OA 1NG9A 1GTVA 2R6AA 4BZQA 3DHWC 1RJ9B 3IHWA 3X1XA 2B92A 3KJIA 1E4YA 3KQNA 5JBQA 3U4QA 2FPKA 1RJ9A 2VHTA 2ZSEA 4HATA 3VMFA 4BFUA 4Z51A 4PC2A 1CR4A 4US1R 1G6OA 3D8BA 4I1UA 5FOXA 2IYLD 1X8LA 4ABYA 1LF0A 4OQLA 2P3SA 5CLQA 5DYIA 1KK1A 4AG6A 4BPBA 3ICEA 1AGRA 1J8YF 1XEWX 3B9PA 4NCIA 5HE8A 2IC5A 1OPXA 1E2EA 2YWHA 3MWYW 4EPWA 2XJ4A 2QENA 2A7QA 4GI7A 4RSGA 4BUJA 5H70A 3IGFA 1M7HA 1XZPA 4UJ5A 4LJ9A 4D4LA 3T35A 1GL9B 4G5SA 1XCGB 2VTKA 3SHFA 1G3RA 1E0KA 5L3VA 1SVKA 3D31A 2VBCA 1F60A 5F9FA 2R44A 3U3JA 3QBVA 4JJZA 4OQNA 2G0NA 1VG0B 2W00A 2PT5A 3LQRA 4P4SB 4V0OA 3NC0C 2ZRIA 4DVGA 1W5SA 4LBYA 2GBLA 4D26A 4QGGA 1SVSA 3SBDA 2DFLA 3AF3A 3B7GA 4UNPA 1XD2B 5L3QB 1HA3A 3KQLA 4XOIA 3WBJA 4M1OA 3ADCA 1XZQA 3AVYA 3QQ5A 4NYMR 1KY2A 1DS6A 3THWB 1RZ3A 2Q0HA 1P2TA 3QBTA 2C98A 2R8RA 1FP7A 3EPHA 4GP7A 1VPLA 2Q9AA 1VMAA 1E0AA 2IT1A 3MFYA 4U5XA 2I4IA 1A4RA 3GCGA 4R9UC 5CM8B 1E32A 1YQTA 2VRWA 4CT4B 4HAVA 4Q4AA 3JVUA 3U44A 3FFBA 4LJ8A 1GKYA 1M7GA 4URWR 4KJZA 2GAAA 2V3CC 4MYUA 4O25A 3LH5A 4Z54A 4LWZA 5HKKD 2FJUA 1KDRA 4C30A 2IS1A 1RRPA 1SKYE 2GXUA 1W5TA 2HT1A 4Q4LA 1NMZA 1TEVA 4TWZA 3BH6A 4QBHA 2JGNA 3SE0A 1NRJB 2ZU0C 2OCAA 2J9RA 2C04A 4D4JA 1HQCA 3VFDA 2AHOA 3ZJYA 1TUIA 2H1LA 1G8GA 2CK3A 4AKHA 1XTKA 1I2MA 4JLBA 4M1WA 4NMMA 1X1SA 2F1IA 1AJEA 2RCNA 2DHRA 2NOAA 2IYZA 4Q1AA 1D9ZA 1OIVA 4HEJA 2GJ8A 3NEYA 4B2IA 4TMXA 3I62A 4B75A 1S3GA 4ZDJA 2F9LA 1XEXA 1KDOA 1Z6GA 3K09C 4CVNA 2NMVA 3K0EA 3QVVA 5E95A 3BJIC 1HTWA 1YVDA 4AYXA 5DYGA 3RYTC 1IY2A 5DI3A 3GLFE 1OFUX 2P67A 2QAGA 1NLYA 3QXHA 5JHHB 3QSYA 3QKSA 2WWXA 3DPUA 5FFMA 3VX3A 4C0HA 4TSFA 4C9BA 2Q9BA 1JXMA 5IT5A 4PTLA 4KSBA 5JJLA 2XX3A 1HY3A 2BKEA 3A1WA 3QG1A 4LJAA 4QFMA 5E7IA 1IAQA 1WA5A 4PO9A 4FN5A 1QHXA 2GILA 3CX6A 1YZQA 4AIIA 3CR7A 5ELXA 2OLJA 3H86A 2PCLA 4JLNA 3LXXA 3TQFA 5CYOA 2JASA 4PO8A 2H18A 1G19A 2IYUA 1W46A 2JLSA 1OJLA 1KSFX 1KAOA 1KO4A 3IKJA 3U7GA 4OK3A 1UAAA 1K6MA 4LYHA 1HUQA 4B3DA 2AD5A 3HJNA 3SYKA 5EXPA 1EFRD 2F3RA 3N70A 3IEVA 4I99A 1F2UB 2J87A 3T5DA 1WXQA 3ZZ0A 3C5CA 2BBTA 5JHGB 1XJQA 2CEAA 3OF5A 3GLHE 1E99A 2HXYA 1R5OA 2P5SA 4PC3A 3AQ4A 2ODWA 2C9YA 1MKYA 4EJSA 1E2DA 3L8YA 5FTNA 2ECKA 1LB1B 4IHQA 3A58B 3EG5A 2VHJA 3NHAA 2HT6A 5GVSA 2VP5A 4W5JA 3ETLA 2ZIAA 1XTIA 1KSGA 2FE4A 4Q1CA 3RDPA 2JJ1A 3W5JA 3WRXC 2JLWA 1ZUIA 1AS0A 2FNAA 3O8DA 1P75A 3QKRB 4YXWA 1N6IA 1TU4A 1QHHA 2CCKA 4QRHA 2ASEA 1Z47A 3LBHA 4AI6A 4IFBA 2F55A 2VO1A 4ZDWA 4AKIA 3A1UA 3AH8A 1KJZA 3FWYA 4Q48A 2KSQA 2XEXA 4HDQB 1JR3E 1E9DA 2OILA 4LSGA 5BYJA 1DEKA 2QPTA 2YOGA 4B47A 1DAEA 2QP4A 4NL4H 5DGXA 4BZPA 4E03A 2BM1A 1DVRA 2DY1A 4JLVA 3IEUA 4AG5A 4JJKA 4PX9A 2XB4A 4RKFA 4A8JC 1R5BA 3QKTA 3K0FB 4JLAA 4ZKEA 2ONJA 4KAXA 4TMZA 2J45A 4NU0A 2EYQA 4YC7A 3C5HA 3PEUA 2NO7A 4HI0E 3RHFA 1N5IA 5SZHB 1N5JA 2GK7A 5FOVA 1NSFA 1ZD8A 3CRRA 3T61A 5FOSA 1JR3D 1QRAA 1CULC 2FA9A 3SDZA 4WZ6A 4QNRA 1D2EA 1ZW6A 4NH0A 2OBMA 1PLLA 4L8GA 1IXZA 3BBPA 3GEHA 4G5OA 3QKRA 1YZNA 2VP4A 3ZZTA 1DARA 1RRGA 4IDOA 1SXJA 3K70D 4DCVA 2FFAA 2XXAB 1A2BA 5KDLA 5JMTA 3MAAC 2ZAMA 1N5KA 4CRWB 4M2LA 3CPEA 3QG5A 3SJBA 2W6ID 2OESA 1KMHA 5L3RA 2HLDA 4FMBB 4JYCA 4PHFA 2BBOA 3CRW1 4OJKA 3LBIA 4B2PA 1C9KA 1HE1C 1XMVA 1E2IA 2EW1A 3MCAA 4JT4A 2QZ4A 4RFSA 2B8TA 4AYTA 1F2UA 3X1WA 2VHUA 4BRWA 4E07A 2C9OA 2VF8A 1OHHA 2OBLA 4DLRA 5CDFA 2FSGA 4II7A 3OIYA 4B32A 5DO9A 4TN1A 3MWKA 1XJCA 3EWAA 3MD0A 3TNFA 3WXMA 4ZDKA 1U81A 4OKSA 2CLSA 5GJWC 4NCHA 4UKDA 1KO8A 1KMQA 1TQDA 4G01B 1EFRA 2ZYUX 4JZKA 1FX0A 1TMKA 5JWRA 4DDUA 4D0LB 1KI6B 1XPUA 5LDDC 5AWFC 2K5UA 3A6PC 2YOHA 5IK2A 3NXSA 3UATA 2GJKA 3JVVA 4Q19A 3OEHD 2QN6A 3K09A 1FTSA 2XTNA 1DAKA 1SXJE 1MO5A 2REBA 1R0ZA 1Q1EA 4A92A 4M8NE 1XD9A 3AP2A 1E1RD 3WYAA 1ZM2A 2EVWX 3HU1A 5FI1B 5FTLA 1N6NA 3U3RA 2WSSA 4TL8A 1EG7A 3RRZA 3RNLA 4B76A 1JALA 2ZI4A 1NVWQ 4A82A 3UG6A 3QIAA 4Q1DA 2JJ2A 3AB3A 2GF9A 1S8FA 1KJWA 5JJKA 4LCBA 4LHWA 3OEED 1V5WA 1SVOA 1YZKA 4IJMA 1JNYA 3U2QA 3A1VA 5A4JA 4EQ6A 1OB2A 5C4GB 3K0SA 2O8BB 1YE8A 4CEJB 1Z22A 4JKIA 2ZS9A 2QE7A 4GP6A 2VA8A 2LWIA 2GF0A 3W6OA 1KGDA 4QL3A 2QU8A 1KO5A 2VPPA 1F2TB 4Q7MB 4GOKA 1VYTA 2IEYA 4N1AA 4PC6A 1XBTA 2IWHA 1N6OA 4YMVA 3QUSA 4X8MA 3GLHB 1AK2A 2E87A 4V0MA 1DO2A 3WHKA 5LB2A 2N1BA 3OAAA 1HH4A 1T3HA 3IO3A 1AZTA 4XSHA 4WAUA 1KO7A 1QVRA 2ZYTX 4PZLA 2O52A 4KO8A 1N3BA 4OHZA 4AD8A 2CNWD 3KZ1E 2GVZC 2J7PD 3OZXA 3IHLA 2O8CA 2WAYA 3EC1A 2AX4A 3RS5A 4PO1A 1JQJC 4H9GA 2ONKA 3GLFA 2JJ2D 1E9RA 1NJGA 4Q1BA 3Q5DA 3NDPA 2AN9A 4KBFA 4KFSA 1KOFA 2B7BA 3AM1A 3EPKA 5JJIA 5FPSA 3KFVA 4NE2A 2ORIA 2WICA 1OH6A 4CEJA 4TZ6A 2CLCX 3CPJB 4C0AC 4AC9A 3KQKA 1RC8A 4ASUD 2VH5R 4DT1A 2NQ2C 1JQLB 2OV2A 3OEHA 3B13B 3EASA 4B3CA 5L3SA 1T4GA 1ZNZA 4TYQA 4PQFA 1N5LA 4Q02A 1FFHA 3D6TB 1KI4A 2HF9A 4NONA 3TAHA 2WKPA 3TR5A 2AK3A 2BMEA 1S0UA 2F9MA 2ZRCA 5FBQB 1O87A 3GQBA 3ZZUA 1P9WA 1P4SA 1EFCA 2ZE5A 2GA8A 3G82C 2JLUA 4Z1MD 1AS3A 4QGFA 1RFLA 4QHSA 4ZIRA 1G7CA 2BMDA 2G88A 2ZJBA 3KDSE 4A15A 2ZM5A 4DWJA 4A8JA 4FD2A 1VDZA 1Y3AA 2DBYA 2GJ9A 3HP1A 1RW4A 1Q3HA 1IXRC 3LVRE 2PEZA 3D3QA 1II8A 1ZM9A 4EFNA 1CJTC 2OCPA 2XSZA 5M04A 2DFNA 3DZDA 2O5VA 2ZEJA 1FX0B 4V0KA 1FOEB 1EGAA 3TSOA 3FHCB 4O2RA 2BBSA 2RGXA 3LFUA 2V54A 2CL6X 3REFA 3BRWD 5DHFA 3R20A 1W7AA 3ZD7A 2A5DA 5BN5A 3VU9A 2JDIA 2C96A 4D4MA 3I1FA 4CGZA 1DELA 1XTRA 2HLDD 4BFVA 2BM0A 4BE7B 4DKXA 1CKEA 3DOFA 5AK0A 4ILEA 4I1SA 5KPDA 2WWYA 4XTCS 2GETA 1ZD9A 2QSZA 3I8SA 4R98A 5E3HA 1Z6YA 2FZLA 2PX3A 3RS2A 1OFIA 1OKKD 2J1LA 2EQBA 2ZI7A 5JLJA 3U5ZB 1M7BA 3EW9A 4DSUA 5DISB 2HDNB 4NZYA 3J81k 1EESA 1ESNA 4OHWA 3BFKA 4HAWA 1CEEA 3Q3JB 2J7KA 4QXAA 1WMSA 4M21A 4ZPXA 4WIAA 4Q7LA 2E1RA 4BQSA 5JRZA 4LV8B 3SC3A 5EUMA 2ZPTX 5GJCA 3KXIA 1L4UA 4F38A 3UPUA 2ZRKA 4H1UA 4HB3A 4WVFA 4PAMA 3DMDA 1SHKA 2QP3A 3VTKA 4NDZA 5K8IA 1NNEA 1OFTA 4LHXA 3I72A 3TMKA 4PSKA 2GEUA 4XD7A 1NBMA 2ZRGA 4KXFB 4F7WA 3EZFA 2GJSA 1CJMA 5CK4A 4LJ6A 3HU3A 3Q8XB 2P0EA 3FVQA 2OFWA 2R6CA 4IW3B 3VAAA 2JLZA 3C14C 3EPJA 1KDPA 1E2PA 3X1ZA 1BH2A 4M53A 5CDFE 1G7SA 3KXKA 1NY5A 1GVNB 4JSYA 3PEWA 1P73A 1IN8A 1GILA 1RE0A 3R7WA 2A78A 4GZLA 1XXHA 3UMSA 1MR3F 1E2QA 3RSOA 3TE6A 3UG7A 1Z3IX 1T91A 1R0XA 1GNRA 4PPQA 4DSNA 5IF9A 4IOJA 2FOLA 4XD7D 5C46F 2OAQ1 2GCOB 2IUUA 4TYNA 3TRFA 2WPDA 4ZCMA 4TQUS 5KSZA 1NKSA 1JI0A 2BVNA 1II0A 2EFDB 1UM8A 4D25A 2B7CA 4MYHA 2MMCA 1EX6A 3FHTA 2YC2C 5FTJA 5C4MA 4YONB 2C77A 2PLRA 2RGAA 4I4LA 1BKDR 1U2RA 3IIJA 1E2HA 4W7SA 2OXRA 2BIFA 4LGMA 4ACBA 3EX7C 3AF2A 4J0QA 3RWOA 1NL3A 2VP2A 6Q21A 2FGJA 1IHUA 1MOZA 3AF1A 4R7ZA 3PUXA 1YR7A 2ZJAA 3AKYA 1XRJA 2PT7A 4AYWA 3THXA 2CCGA 3LD9A 3EZ2A 2F43B 4OI0A 3S1AB 4JKYA 1BMFA 4D81A 1E96A 3IBYA 2PEYA 3IO5A 2RHMA 4Q7JB 4D82A 2IL1A 1UDWA 2VYFA 3OIWA 4UJ3A 1KK2A 3GJ0A 2V6JA 2JAQA 1VG9B 5KYKA 1BO6A 1TF5A 2P6NA 1W36C 1H65A 1FMLA 4NPHA 4M9QA 5KO2A 1YZTA 2O8EB 3KUCA 3RWMB 1N6RA 3GEEA 4LI0A 3N5CA 4PPFA 4NCJA 4A0FA 4DHEA 3Q7PA 1G3QA 3SYNA 4B3XA 5FOWA 2QRZA 1DOAA 2XNDA 4BASA 3AKDA 1E1QD 3B9QA 3T12A 2YNMA 5JZVA 3CBQA 3ADKA 3CM0A 3RC8A 4MDEA 2UKDA 2BCGY 5JI3E 2WV9A 3FOZA 2IS6A 4JL8A 5DNYB 3ZQ6A 4Z1MA 3BH0A 3KKNA 2ANBA 1FPMA 3UMFA 3KKQA 2QMHA 2BEJA 4BLRA 5KNDA 3EZ6A 2J0SA 1MH1A 3TSZA 4QM7A 1G4UR 1DAIA 3AKCA 4DBLC 2RGBA 2QMEA 1GZSA 1OV4A 4TL6A 4C0QC 1Y63A 5EZ6B 2CHGA 1B23P 3CNOA 1ZNXA 2DWQA 1TQ4A 4XIGS 5JEDA 2C2HA 4JVMA 2ZR9A 4LJ7A 4MRVA 1TUEA 2DFTA 2H16A 1P62B 4QBIA 3GJ5A 3B5JA 2CBZA 5GVRA 1N6PA 3VR5A 4C2TA 5AJWA 2QROA 5KSYA 4NP6A 4MGKR 1IN4A 2PZGA 3QPUA 4UNSA 3RABA 5DHAA 3FGNA 3ADDA 2D3WA 5K8TA 4AY2A 3QOFA 1KI1A 4IDNA 5FTKA 2QRNA 1T3LA 1RIFA 1BS1A 1AM4D 2BJWA 1P72A 2LCFA 2HEIA 2IXGA 4RD4A 3VHLB 4E22A 3FMOB 3PIRA 1Z29A 1F6BA 3SEAA 2IEZA 3F8TA 3I32A 2NPFA 3CNLA 4YQFA 1VCMA 2ZJYA 4NKRA 4M9XA 3FKSD 1AZSC 3TUJC 1MV5A 3SFVA 4Q4JB 3AUXA 5F3WB 1NN3A 1SKYB 2NPIA 3VR4A 3K70C 4ACAA 4XSGA 2FPMA 4AKEA 1DG3A 4IOKA 4LC1A 5FBRB 4B35A 3GLGA 1I4LD 4EDHA 2ZI5A 4B6FA 1YR8A 3B1ZA 1KZ7B 4PR0A 3KB1A 3QF4A 5CITA 3B1VA 2AWOA 3CWQA 3HR7A 4EJSC 3FMPB 4W5HA 1RYHA 2KE5A 5J47A 1M6NA 2XNSA 2BEKA 4A1FA 3A4MA 2WSSD 1KY3A 2WWWA 3PV0A 1LVGA 5LB4A 1XTJA 2IUSA 4EPVA 2QY9A 2C99A 4XVQA 3HPQA 2NGRA 3QXCA 3KJHA 2XSZD 4B73A 4LHVA 3PUZA 1X8KA 3TVTA 1E3MA 3ZIAD 2ZROA 1X1RA 3KQUA 2EFGA 1T6NA 5J5CA 2R9VA 2D62A 2TMKA 1UADA 4F4JA 4M1TA 1SQ5A 2FF7A 5GADl 1ZBDA 2GXAA 4YDSA 1YU9A 1KJYA 2DB3A 4FCVA 3NEJA 3WNBA 1ZCBA 2V7QA 2ZRBA 4G1UC 4MYCA 1E9EA 1E2KA 1U99A 1G9XA 2YWFA 1US8B 1DAFA 1JECA 3AF4A 4C4PA 1GRNA 4DIDA 4FMCF 2ZTSA 1TU3A 1XMIA 4GMXA 3BWDD 3W5IA 4RFVA 4P0TA 3WYFA 1CJKC 3V4RA 1MRNA 1ZNWA 5KUTA 3GLGB 3VKHA 4ASUA 4ZCIA 2R6DA 4WBSA 2HJVA 4Y0VA 4QOSA 2VIIA 3I73A 2JA1A 4I1OA 4U00A 4CEHB 3TBKA 1Q21A 4KFTA 3K1JA 1CIPA 1GSIA 2X77A 4TMVA 3LBNA 3SI7A 3MRSA 2NTYC 2BHRA 3B82A 1GKUB 4TL7A 1T0HB 1II8B 3ZVMA 3NBXX 2A5YB 2PZFA 5EE9A 1XWIA 3T1TA 5EE1A 1G8FA 4D2IA 1COWD 4WXRA 2IYTA 1XTQA 5HTKA 3TUZC 1NG1A 2ZRFA 4K46A 4BEBA 1SXJC 1VCNA 2WJYA 3NWJA 4OJQA 3K0AB 4PC7A 3V00A 3QE0A 3BE4A 4CW7A 2IYRA 3SHWA 2ZUCA 1CS4C 2KJQA 1XX6A 1KDTA 2PJZA 4ARZB 3ZYCA 5GJVC 5FPHA 2P6UA 1SHZA 1M34E 1CBUA 1W4RA 1QHHB 1CRPA 1O3YA 1L2TA 2YVUA 2XTZA 4IOLA 3SBEA 3TQCA 5L3SB 4OL0A 3LLUA 3MJRA 3TKLA 1TADA 4DT1B 5B30A 2Z4RA 1QHYA 1FP6A 2V1XA 3D7MA 2Y8EA 4RZUA 1N6HA 4P4TA 1I4DD 2XZPA 1E2JA 5DE3A 3CONA 3U6BA 5HKKA 1DG1G 1XNJA 1GL7A 1CR1A 1NVXQ 3LRPA 2V6IA 4V02A 4QHYA 1G20E 4FI3C 2RH5A 4GZMA 1Z83A 3WYGA 3PR1A 3G0HA 4C0SA 3AV0B 2EFCB 1J2JA 4C0JA 4LUCA 5JFGA 1TEXA 2QM7A 2W2VA 3GLHA 3VKWA 1ZM3A 2OLKA 4HAYA 2JEOA 2QL6A 3CF2A 5FUVA 4OI1A 1P9NA 1QZXA 4OHXA 4KBGA 1WBBA 2O8DA 5UKDA 4DLVA 5C1BA 3KUDA 2C95A 4GPTA 1OE0A 4PSAA 4LHZA 4P32A 2VHQA 1XB2A 2HXSA 3C7KA 5BYKA 1GDDA 1LS1A 1XP8A 4EUNA 1H8EA 2ZJ8A 3IQXA 2WTUA 5G3YA 1OYYA 4U02A 5CB8A 1NI3A 4LX0A 4TLCA 1M74A 2ZSAA 4CEIB 3TR0A 3JZMA 2WWHA 1U9IC 2WAXA 4MYTA 2GJAA 4ON9A 3SQXA 1G17A 4XH9B 4KSCA 3RS3A 1E69A 1CR0A 2IS4A 2WWGA 1A5TA 2YC4C 2H57A 2N46A 3HYTA 4BLPA 1PUIA 2VEDA 4DLUA 3MG9A 1ZINA 2NZ8A 2PMKA 2BMFA 3SU8A 2GXSA 1YZLA 1YHNA 3K8YA 2BDTA 3ONWA 5J4LA 2QEQA 4A2WA 1QBKC
chains in the Genus database with same CATH superfamily
1HT3A 1JIVA 4H1VA 3FB1A 2M2IA 4FYWA 2LE0A 1DWOA 1GRVA 4NBNA 1C81A 1SCNE 4B79A 1XCPA 1P74A 2BGLA 1NIJA 5BSUA 3JQGB 4DLSA 5BWLA 5GIOE 3HXMA 3NDRA 1HDXA 2JB9A 821PA 1SHJA 2KB0A 2H7VA 4KYUA 4ZRNA 3BILA 1DEAA 4OXNA 4V0ME 2Z8YM 1KFJB 5B7NA 4XPIA 4X44A 4YEDA 4AURA 1B93A 2E37A 1SXJD 3OY7A 4MRMA 3RKUA 1W25A 5JAHA 1UF9A 5SICE 1T2NA 4CLDA 3VDRA 1G3IA 5FX2A 3EIHA 4QYWA 4DEVA 4LFCB 5ILQA 1IPHA 3TTSA 5BSGA 1QFXA 4P2GA 2ONYA 3U3ZA 2OB2A 3AHIA 5EVJA 1A4UA 4ZOAA 1L5WA 4RLHA 2TSYB 5E7MA 3DEKA 3L82B 5BV2P 5IBPA 1ML4A 1G2QA 2WFZA 1UDXA 1WL8A 4K81B 5LOVB 4LGCA 3AJDA 4KTVE 4RHUA 2V8BA 2OAGA 1L5SA 2LUOA 5TDHA 3LHSA 1I3LA 3RROA 1QVZA 1XNHA 2BKAA 4MQUA 4X8LA 5KSPA 1AMNA 1ZUHA 2NLOA 4RD1A 1I4TD 2ZIGA 2FP4B 2H2DA 2G4CA 4KI7A 4FGSA 1DG9A 1NVDA 2ZYWX 4HLDA 5SV2A 1Z45A 2PJDA 4EFDA 2GKGA 2GN6A 1O8BA 3IBFA 1CCWA 3AG6A 1WG8A 1EMDA 2ZGVA 2XCRB 1SUEA 3A1DA 1U0HC 2NYUA 1P60A 3BQ9A 3FKSA 4XWOA 3I37X 4INJA 1S01A 1RWOA 2VPTA 1QORA 1JN0A 3OX1A 1Q20A 3PC4A 4QRIA 4HHEA 2R00A 3NHSA 3GNQA 2HWXA 1A72A 3HI6A 2WT4A 4E5UA 1VMIA 1Z0FA 1XN1A 3H9CA 1QPGA 1BYUA 4Q47A 1R4AA 4TKUB 3W04A 3R1IA 1J24A 3D4IA 3K7EA 3CHYA 2W4MA 4ENVA 1O4WA 1PAUA 5BQXA 1FDSA 3ZTWA 2CLOB 1C5KA 4OJTA 4BIIA 1ONOA 4NFYA 4UZEA 4BB6A 4UVHA 4ND4A 3FN4A 4M1YA 1JZQA 1IZ9A 1PQ4A 3VRHA 2BONA 3OIUA 1QE0A 2VCYA 5JC1A 4BQPA 2FFRA 3SEZA 4EPXA 2QS9A 3IAXA 3QEMB 5FL3A 4GX2A 1NVVQ 3QE4A 2I87A 1A8UA 3FE2A 3VPBA 3TO5A 4Z0TA 5HOEA 2YWGA 2OE2A 1A5ZA 1J2EA 2Q6KA 4LKRA 4YJFB 3EXEA 5BSMA 5LJIA 4LJRA 2BC9A 2QMOA 1AF7A 3LYHA 4HRYA 2JBAB 2OBXA 1E0SA 4X71A 4F9FA 4P7BA 3IA7A 2EWVA 3ZKWA 2Z98A 4DG9A 2AFRA 1K7EB 1ZYUA 1D5CA 3B6IA 3PI7A 4IDQA 2GK4A 4CWAA 6ABPA 5EIXA 2YKGA 3KVYA 4PIMA 4QBGB 1V3UA 5C8YF 1SULA 4ARVA 5K5EA 1CK4A 1LNZA 3Q2OA 3L7CA 5CVDA 2I66A 2UZ0A 1AS2A 4HX2A 3HUEA 4DJJA 4M98A 3VZBA 1EXDA 1JEQA 4RK4A 5EQDA 4ZJYA 5J23A 2BEUA 4ECAA 3A3KA 4KUEA 3TW4A 2YJ5A 4IZ6A 1E7MA 3IDFA 4F5YA 3M83A 3K73O 2QQ5A 1C1YA 1SVNA 4EFMA 4IJ6A 3FPAA 2HYIC 4FE7A 2PXAA 4I9GA 5LBIA 3WWZA 1CZOA 2B21A 1XVTA 4CF7A 3WGGA 1US8A 1VSVA 2Z04A 5CFLA 3BFVA 2SKDA 1XQ9A 1J1ZA 2WTMA 1LK5A 3H87A 3ISJA 3LVQE 4I8IA 1VGRA 3UUEA 3IUSA 1CIVA 2GBGA 3DL4A 1F0NA 4G8JA 4H7IA 4AP5A 3OICA 2CE7A 2WP8J 4MGEA 5C1IA 3THYA 1JDPA 1FSZA 3TRJA 1TQ8A 1FQJA 2F9FA 4L6AA 3EF1A 4EKGA 3IELA 1QIMA 4DRYA 2QW8A 3CQ9A 3LWNA 4PICA 3FMIA 5NULA 5AQ1A 4YUYA 2MMGA 1FZQA 3PX3A 4CV1A 2AOTA 3T5BA 1W1WA 4ZJUA 2BGJA 3T7CA 3VA7A 1N36B 5LU9A 1OWLA 1BMFD 3GJ7A 5HKBA 3PWSA 4Z4FA 4JJ6A 1QP8A 1G59A 4KACA 4MWSA 1R1DA 5GONF 1L4GA 4YCSA 5BSVA 1B73A 2X15A 1HX7A 1VJTA 2PWYA 3P2OA 4GLLA 4NYJR 2FGKA 3RFTA 2GHRA 2HGSA 3GVXA 1W44A 4RH1A 1JWLA 4K9RA 4EVSA 1E3QA 1CY0A 3GVHA 4L1KA 5GZ3A 2PZJA 5A3QA 3GGDA 3W7BA 1XMOB 4LGYA 3L7OA 4Y1RB 2PUCA 2OHXA 4AY5A 1DIHA 3D0RA 2ZDHA 3UA3A 3G0OA 5CFOA 4ENSA 3L84A 3CT6A 4UXIA 3G85A 1BE6A 1HFEL 2Z8ZA 4ZAVA 1ORIA 3OZGA 2B6NA 1W59A 2BLNA 3O93A 4OATA 2NUAB 3SBOA 1YR3A 3AP3A 1ZXBA 4HQ6A 1ISGA 1Y3IA 5FL7A 4MQEA 2XWSA 2HJRA 3I9V1 4QXRA 5YASA 4KMSA 1NIPA 4NJEA 1I8TA 4GWGA 4YMIA 1SVWA 4HNVA 5DM0A 2ZJFA 2OZLB 4CPDA 5D5QA 4JLKA 3N86A 3AVWA 4I1VA 2LBPA 2VATA 2GAOA 2QUAA 1FP4B 2BE7A 3C15C 4M1MA 4XWYA 5A04A 2WF6A 4X95A 1ZK3A 1XXHE 4OH1A 3CJRA 4EO9A 1G5PA 2CD7A 3QEBZ 2PZBA 4DBLE 4DSTA 4QXQA 5EHXA 1HE8B 3F2IA 5HCIA 1XDDA 4N5DA 1P0MA 4NATA 5GV7A 1XAIA 1RAEA 2QUIA 4GLBA 4HBZA 3G2MA 2BFCB 3D54D 1YIOA 3WL8A 3HBFA 4C2UA 2I1VB 1TGVA 4U2CA 2GASA 1OXXK 1OXTA 2EFJA 2WMOB 1ZUNB 3DBIA 3UCEA 4A36A 4LPSA 1YULA 5JD5A 5A6VA 2HCBA 1TK9A 1OI3A 2CUZA 3MGCA 2HWKA 3LG2A 3HJHA 4I6GA 4NG5A 5IEJA 3FNFA 1L5YA 3GD7A 2ZUFA 3QTBA 3R76A 3HKEA 3QEJA 1KI6A 1LC0A 3GEGA 2QN7A 3TLGA 3UAYA 2QXTA 5EWMB 2QYHA 2C84A 2C03A 2HBRA 3L0BA 2G0AA 4KOAA 2VJMA 3TPCA 4BMCA 4IKEA 4QUEA 2XLBA 4QPNA 1USIA 3E2IA 4EMTA 1ODFA 1E1QA 4EUFA 3OPVA 1Z07A 4YRPA 2D4HA 4M3NA 1VZ2A 2QN9A 4PM4A 2DKNA 4U63A 3KFXA 3OKFA 2PVCA 1GA4A 4HLCA 4R01A 3U40A 4A27A 1OW3B 4AFNA 4F1JA 1FXSA 1SA0B 1G4HA 2QUHA 4WDRA 2WKQA 4ZVLA 5B6IA 1FDTA 2FPLA 4BV8A 4QEDA 1UMKA 3I5XA 1T3SA 2D1RA 5DM1A 1TVKA 2PJUA 4HVAA 4UCFA 5DVZA 2H8KA 5JZSA 3OTIA 2CLLB 1YQGA 1TCCA 2H65A 1FDIA 2VJCA 4FYHA 1VJRA 2EIXA 4NABA 1ZHHA 1U0RA 2FSPA 3OA2A 4K7JA 4L7VA 4AW9A 1PCXA 1XUOA 2OBNA 3UCXA 3AKZA 2XADA 1JJBA 3CV3A 3TQTA 5HZGA 1FTNA 4ZYTA 2Z4SA 1DPFA 1LRKA 2IZ1A 5K2MA 4L0QA 3TRDA 3ASYA 4ESEA 5IYZA 4P7JA 3K9QO 4DNFA 2YH2A 3RVLA 2NTEA 4C4ZA 1V1RA 2H4HA 1ZD4A 4D6XA 4RK0A 4BEJA 4MQ4A 4YCDA 4EJ6A 1IXSB 3Q9LA 2NVOA 5FWNA 2OD7A 2FN4A 3DLTA 3QX3A 1I4EB 1TQ6A 2CL0X 3C6QA 4WNAA 3UWPA 1L5RA 3D02A 3Q41A 3VZPA 1QFMA 2EYUA 4A91A 4CM9A 1PDOA 3AR8A 1T36B 5AT1A 1VJ0A 4UVEA 2EJVA 4WK6A 1CUGA 3RK0A 4HADA 1NXWA 1HNXB 2P6MA 3E18A 3IC5A 4PTYA 1E9BA 3C3JA 1U1EA 3H7AA 1CG6A 2MSNA 2YIVX 1T0UA 5JD3A 3MTJA 3S1AA 2BMWA 3OZDA 2QTWB 4QOIA 1F48A 4BNYA 2WIBA 3EC2A 4GUDA 3O9VA 1KBOA 1JXOA 1S2DA 2I5PO 4QQ8A 4JU8A 221PA 5T8KC 3FF1A 3UZUA 3WB0A 1U28C 3O2JA 3ZH9B 4LC0A 2JLXA 3I0NA 3IL2A 1KFKB 2OCBA 1Z6ZA 1DFIA 3EARA 1P5HA 1TPZA 3PXCX 4BFWA 5IZ4A 3QLTA 4MRRA 5JWOA 1GNPA 1BWPA 3GMIA 5EWJA 1EWQA 2OZPA 2LCQA 3DZBA 1C9MA 1JU3A 1DNPA 3AI3A 3RSSA 5FT9A 1UDRA 2E9SA 2IUFA 2XUFA 3E22A 1D2AA 2XCUA 2ZUEA 3OE4A 4GMFA 1HGXA 3MB8A 3I8XA 4Z9AA 5FJIA 5ABPA 2VSYA 1M2OB 1RHUA 3LX8A 5CDGA 1V3VA 2WD9A 1Z26A 5DULA 2Y0EA 4RTQA 2NZ2A 2V6FA 2UVQA 4IGAA 1QFYA 2I65A 3NEPX 4CMAA 3F8SA 4HTFB 1JIXA 4Q9KA 4OHVA 2QSUA 3GUZA 3OQNA 1R2QA 3GD5A 4LZLA 1GN9A 1I30A 1BGVA 4YO7A 3W8NA 3N2IA 3ZW9A 4CIXA 4DDWA 3VVLA 5D85A 1MDBA 2JAHA 3CNHA 3SX0A 3DBLB 1U8TA 3P19A 3AY7A 5IRCD 4ZVQA 1V41E 4G0PA 3SR0A 4Z0PA 4E14A 1T6ZA 1IBRA 1WXHA 1N0HA 4MW0A 3CLUC 1JJVA 4E2FA 4X91A 5E1BA 1Z36A 2V45A 1MC5A 4RPJA 5AJVB 1JAIA 1X7YA 1E8DA 2VJPA 4CM8B 1QXSA 4BLQA 5K3OA 1GR0A 3I5YA 2FEPA 3VXKA 3SMVA 3G7NA 3HZZA 4QASA 4QREA 2ID9A 4WESB 4BJHB 2F1RA 3H5OA 2C82A 1D9XA 3HWSA 3U3KA 5IK2D 2KHZA 1RBYA 4EG6A 1JVNA 1EHIA 2CXOA 5ALXA 2IU4A 5T6MA 4WOJA 1A1SA 3TDNA 1B26A 2A0UA 3U9TA 2DUJA 3PD0A 2LW7A 3D64A 4MW7A 3P0FA 5EOVA 4P5PA 3T5CA 3UJ7A 1FQOA 2OO7A 4GYJA 3WKAA 1YZGA 1UKVY 3L2OB 3N2GB 1HDGO 1CRQA 3DFIA 4UDYX 1KK0A 2G77B 4JSTA 5KMGA 3CLVA 3HDYA 1LEHA 5AVWA 1L8AA 5FNVB 1SKQA 3S40A 1U2GA 4UBLA 4MSUA 4RLSA 3B36A 1FIUA 2GN4A 2RGNA 3JY6A 4D80A 1T4CA 5H7XA 2R8OA 1QRRA 3IEIA 4LWOA 5JASA 2EWMA 1GAXA 4LV6A 2G07A 4MLDA 1W88B 4ETNA 1L4YA 2FRDA 3R09A 1Z0IA 2AZMA 4Z8XA 1RYDA 3EXHC 4DQUA 4FKZA 3VU9B 2E5LB 5H80A 4ISBA 1VI2A 2XBLA 4HUQB 1OZGA 3NTUA 4O1IA 4RVOA 3F7MA 5FPQA 4MVJM 1F6WA 1EJBA 1NYQA 1N8NA 1RCFA 2ZS8A 1Q22A 2QL5A 3QFCA 1M8JA 1E5XA 1UDAA 3NX4A 4RF5A 3ZHYA 3OT1A 4RF3A 4DREA 1ZAKA 4NOKA 2PS9A 4DB2A 2J46A 1B6TA 1E0DA 2XE7A 2EERA 4ID3A 4O2AB 4B3JA 1LK0A 2Z1NA 1M75A 1L7RA 4O4IF 1GG8A 1PL7A 4B3TB 3WLQA 2BTEA 2XTJA 1MO3A 1GITA 4HXFB 4EW1A 4NBUA 3T3DA 5IH7A 2IOHA 1V1JA 3EA4A 3T3GA 1U1GA 4HEA1 3T7AA 2PX0A 1I2ZA 2Z43A 1J0CA 5EZYB 4JLMA 4XFDA 4B4DA 1G2PA 1I32A 3WADA 3L0IB 4DBZA 2YOFA 3KWJA 3V5NA 3VNAA 1U8ZA 2F3SA 2WQZA 4QEZA 4LYAA 1JVBA 5T4EA 4ZYLA 1TZBA 3CW2A 3N7UA 1HFJA 1W5BA 2OV8A 2PZ8A 2WM8A 3MIIA 2WIKA 3NPAA 4UMEA 3X43A 1SZCA 1CZNA 3ZI4A 4C6TA 4F46A 4HDMA 4PSCA 5KEIA 1MRSA 2X6TA 1XZNA 2GWRA 1QHSA 2HHJA 2WIAA 5CPBA 3D7SA 3U1BA 2B20A 4I81A 3CWCA 4ZTZB 1N6KA 2C92A 2APJA 3BX1A 1CP3A 3WIDA 3CNBA 3WP0A 4P3KA 4AIRA 1XMSA 6AT1A 1YF3A 5DM2A 2PXHA 4HMOA 3KUXA 2B1GA 3M4XA 1MO6A 3PFNA 4P1ZA 3F73A 3ZVMA 1WVGA 3TLKA 2IYXA 4L3WA 3W4KA 4DHWA 2CF6A 4EX6A 2D5BA 3O8QA 4TYMA 1H1DA 3T34A 3V1NA 3LSTA 4G8BA 4MH0R 3PJRA 1PBNA 3WMGA 4CDNA 3DZ8A 3HWX1 4W6QA 2PUAA 2H0QA 1ZMTA 2O57A 3PEVA 3ZU5A 3HQ4O 5JAOA 4NOLA 2V3VA 2OPBA 3IV9A 3R8FA 4TT3A 3RC3A 5KNCA 3QY0A 1NMQA 2NIPA 3IPCA 4DIEA 1CZLA 5KZMB 2Z8YA 4L07A 2MSCB 1YS7A 1RQGA 2GYUA 3EBLA 3M6FA 1W76A 4NLLA 5KVQA 3UPDA 1BX0A 1DOHA 4CKBA 1X0XA 3F9CA 4FYIA 1ZEMA 4REMA 3ROTA 2I0FA 2HF7A 4TLAA 2J0QA 5EXSA 5D84A 3K4HA 4W9MC 2WVGA 3G3EA 1UAGA 4MWOA 4RZIA 5BSFA 1VL6A 4OHFA 3ZEIA 4H08A 5AICA 3DF7A 5JAMA 1PT6A 4YHBA 3EUFA 1L1QA 4EPYA 1MNQA 3ZQ4A 1M3SA 3DP7A 2BHLA 2DPYA 2VHYA 3WGLA 1VPEA 2X19A 5FI3A 5DHPA 3ZWCA 1F14A 1DCTA 1XJ0A 4KAFA 3W5HA 1X94A 4G25A 1YT5A 3UWDA 1Y8RB 4GKKB 4G41A 1JMVA 2M6RA 1BXZA 2YWBA 3F5SA 3F5FA 4G1BA 4E09A 2FR0A 4PQYA 2DUUA 4G0OA 1XWFA 5IJ0A 2JAPA 1UZAA 3LHKA 1G8HA 3E9YA 4Q05A 1VDMA 1K7CA 1X7ZB 4DZTA 2YWCA 3FIUA 1J0XO 3ZHCA 1M8GA 1JHUA 4LRWA 2L42A 2PMBA 3QTLA 5JR3A 3ZLJA 4ARIA 3AP1A 1GZ3A 1Q1QA 1UDBA 2P30A 2X1VA 1I7DA 1URPA 3CVUA 3E48A 3LK7A 1QDEA 1U0FA 3K6JA 4IJWA 4G84A 4A6XA 4BZXA 3IUEA 4W82A 3GP8A 3BFPA 1L5HB 5K45A 2II6A 5CT5A 3OKPA 4B1FA 3GRKA 3IQGX 3TW8B 3ZIAA 5FUWA 3R0VA 1QJCA 1TLFA 4B34A 1ZZEA 5KIAA 5BSWA 3H5TA 3QLJA 3IUPA 4MRPA 2GLUA 3FFAA 4G2NA 4QT4A 4Y6LA 4TMTA 4BYMA 2B25A 2VAWA 3NBUA 4FNGA 1U1CA 5I7HA 4LHEA 4YPOA 1OROA 1P45A 3RS7A 3TZQA 2A9PA 1GDTA 4ZVSA 1P7VA 1JKJB 3D0KA 3ENVA 3P5SA 4FFSA 2AR7A 4PW0A 3L6DA 1W8DA 1UPAA 1EDDA 6CHYA 3Q8MA 3JQBC 3PXEA 2RHRA 2R65A 3M5CA 2IEIA 2VF2A 1TAGA 5DK4A 3ZE1B 3R9IA 4PYIA 1YOBA 1ZRMA 3BK1A 1T8WA 2WHXA 2Y77A 1J5XA 2R1VB 1LS6A 3QPWA 1BIFA 1XZIA 4F4HA 4WJLA 4YNBA 4ZI3A 1QIGA 2FUG1 4MAFA 1K0FA 3BOSA 4LBVA 2FPXA 5THXA 4Q4HA 4RTJA 3GJ4A 2XGJA 2EFEB 4JUDX 1DC5A 1HQKA 4RSRA 4N48A 2ADFA 4IG4A 4DN6A 2WUDA 2X6QA 4BVEA 1ZU4A 2MSDB 2VWQA 1DWUA 3BK7A 3V2UA 1GM5A 1QGUA 2WE8A 1OC4A 3Q7IA 2BP7B 1OCEA 3WLHA 2C3YA 2YCBA 4KV9A 2G1UA 4AU1A 2XKAA 4LXXA 3NHBA 3OUTA 3RIEA 5ERXA 1GGMA 3EZ7A 2ZI6A 4LMPA 1UJMA 3WGJA 5KSWB 4ZCQA 3S70A 2F6RA 5JS6A 5TEVA 1UKCA 4YROA 1XK7A 1CYDA 5H4HA 5FL7D 2Z83A 4QWWA 1YTLA 2NYRA 3UKDA 4M9SA 4N03A 4A73A 1G291 1O6BA 4INZA 2BEWB 3M4NA 2X2FA 3KQVA 1OT5A 4Q4HB 4OLHA 3JALB 7REQB 1CJSA 3DVSX 3LQ4A 4CG2A 3AHJA 3VO1A 4RBNA 5FR1A 3HN2A 1N1DA 1M33A 1KAMA 3BD8A 1OT3A 4JJGA 4G26A 2OGZA 3IPRA 3MOSA 4EL0A 5DLPA 1ODTC 5BYAA 2JFHA 1VKNA 5CEEA 5HQ3A 4UOQA 3FPSA 1WDKA 5INTA 4FFWA 5HCNA 3K96A 5BMOA 3HCNA 1WZEA 3ZH2A 4BKQA 3PL5A 2RD2A 4BYGA 1JA0A 1B41A 1N8KA 1XKQA 3N39C 1P4AA 2FW1A 3BMXA 3JVIA 2GEFA 2XYPA 2PUTA 3AG5A 5HIMA 1UEXC 1ULSA 3G0GA 3RUPA 1T8RA 2D54A 5BN3A 2I6XA 4QDXA 4JI7B 1GEEA 1HE5A 1UJ2A 1P0FA 3ND9A 4OM7A 3PDHA 4ZCLA 4EK9A 1I6WA 1U65A 4H7FA 5BN1A 4PZUA 4BP9A 3ET4A 3JAMA 4IY1A 3B1KA 2HKIA 1RQPA 3KSMA 1MTZA 2EU8A 2TECE 1Q1NA 4FMDF 3VR2A 2XR1A 5C7IO 3WS7A 2PIAA 2PLWA 2VJAA 4Y98A 1NHWA 4D74A 4RHYA 2X6RA 2JJ8A 3DAPA 3W3AA 1SXHA 3AVTA 2HA2A 5H83A 1JEAA 4ZVPA 4JUAA 4TMKA 5E1MA 1EVQA 1KSJA 1U7HA 5KAMA 2JEZA 1MG5A 4IJ5A 3TVYA 3OE1A 1CR2A 5BP7A 4WKOA 2YJZA 1QV6A 4JCOA 4ZOEA 1KXJA 3VC1A 4PZYA 3AI7A 2WKRA 4NCKA 4P83A 5DTRA 1LGYA 4B4WA 5JSYA 4C4XA 5HYVA 5K0EA 3IVAA 5F7XA 1T3TA 1EZ4A 2JLCA 1WZIA 3R40A 5K2OA 1QH1A 2WBLC 1EBUA 1E6UA 4UMFA 5ALFA 1DTWB 4AMZA 2IBMA 4P3NA 5EKSA 4CKZA 4X62B 2H3HA 1AQ6A 1ELOA 3TR6A 3OHMA 1H0HA 1NR1A 4Q24A 4TLDA 4MHTA 2REOA 4KYIB 4ND8A 4P3YA 3C98A 4ZOBA 3B3QA 4R3UC 5G0VA 4KWTA 4Z99A 1A4IA 1PN3A 2WKWA 1VC2A 3EZ9A 4R1SA 5LBTA 3UANA 3FJ1A 1O6FA 2C5BA 3AEKB 5DN6A 3WGMA 1C0EA 2GCIA 1ZJZA 1PNVA 2Q3JA 4WZZA 5KYXB 3IB3A 1JZTA 4HWOA 4I19A 1CUWA 1V37A 2BJVA 1SCUA 3CUKA 5BQOA 1AK1A 4URUR 4UU8A 4C7KA 4EI7A 2GZRA 3RFFA 1JSRA 1TGYA 4MS1B 2P3OA 1HETA 2VT7A 4HDAA 5FPTA 4G86A 2OXIA 5CFMA 1O95D 3OZVA 3GFBA 1J1IA 1EFPB 3BFXA 3MLAA 5FEUA 1LW7A 1OYWA 1NW6A 2AR9A 2ID4A 2PGJA 4HFJA 5E6RB 1QCZA 1FU7A 4RWEA 4XPZA 5D5HA 5E7JA 1JHYA 4HYYA 3VUFA 3OU6A 5LIPA 5AHXA 2GCPA 3OH8A 3FJYA 3KT8A 2Q0SA 4R1QA 2Q5CA 3U60B 4OJNA 3ESYA 3H18A 1AF4A 2NW6A 3PJEA 3M6IA 4A4DA 1ENYA 2FN8A 3T38A 2BSQA 3X44A 4QQRA 2O8EA 1OIWA 1F9EA 3GAZA 4WADA 5FOUA 1JS1X 5T5QA 4DUGA 1P9OA 1Y1TA 3D59A 3X2SA 2WU0A 4LJLA 4DA7A 1ZKDA 1IHYA 2AG5A 4KN6A 1IHXA 5EJ6A 2NP7A 5AVSA 2ODPA 4AQDA 1F0PA 3FPFA 1YXMA 2OOSA 4M9RA 4OHPA 4UQOA 4CT0A 4DADA 4D99A 4TV8A 4MRSA 4C03A 5CD1A 3IESA 1M66A 4U2FA 1GXSB 3C3AA 3T06B 4YPVA 1FJGB 1ZR4A 4DV5B 2OVFA 3B78A 3PFWO 3JRNA 4CHTA 5IT4A 1W36B 1SNYA 3MJEA 2ODAA 4MINA 4B84A 3PHGA 2UZ3A 3L0OA 3IMCA 4EY6A 1SKBA 1PR1A 3IT1A 1XTPA 4G3XA 2R751 3SG0A 1Z18A 5KTKA 4CQMD 3ABRB 4JJ8A 1XG5A 2YHIA 2AUNA 4R9RA 4KPUA 5D5PA 3E27A 1ZOOA 3T1QA 3WRXA 5I48A 2BYTA 4URVR 2P65A 3DMRA 4DM3A 2FVYA 4J3JA 2WJ3A 3RSQA 3KO8A 3AVXA 4YP6A 5H8WA 2YL2A 3C8UA 4UE3S 1X7HA 3C6BA 1T8PA 2DQKA 3K6RA 1JE0A 1YRHA 2RSLA 4HZUA 1AMOA 2HF8A 4CFZA 2EL9A 1FLAA 2VFAA 4PBRA 1GCUA 2Q0QA 3CRVA 4I66A 1OXMA 4QATA 1CY7A 1D6MA 1I10A 4HAIA 1HDOA 3PR3A 2OQRA 2VYND 3O73A 4MWZA 3VPSA 2VHZA 1RI5A 2QVYX 4WERA 4E3WA 5I7EA 3QE9Y 3TZ6A 2V98A 3BB3A 3QZUA 4MV8A 4BEVA 3GDWA 4CYMA 1FW6A 1Y82A 2OCGA 2ODBA 3HCCA 1MQ9A 1U9JA 3ER6A 2G9NA 2OECA 3DQQA 4EW6A 4RABA 1KHTA 3LXRA 4PSDA 4N6OA 5CNIA 4AJHA 1DSSG 5A1JA 1QANA 3O47A 4KXWA 1SUDA 4V0NA 3S8MA 3WVNA 1NUPA 3H17A 4BKMA 1CU1A 1CLUA 1FYDA 2FJPA 3WRYA 5I7OA 4UHCA 1GYPA 1NM5A 4M8IA 2PX5A 1N7HA 3WB1A 4ZOQI 2DPMA 5AXCA 1YL7A 2IY9A 2XA2A 5JYDA 4FQ7A 2WFAA 4LE2A 3WK6A 3G02A 3KJEA 5JC8A 1D2MA 2AA3A 3I92A 5AHKA 3KSZO 4M0FA 1EIZA 3EMVA 1BU5A 2DC1A 1PJTA 3C43A 2QTVB 1R8SA 5L3QA 2AJCA 3RVJA 3T7EA 4ZI5A 2XXAA 1JAHA 3O4FA 3VR1A 1EFTA 4S2EA 3ZE0B 5HZHA 3MWLA 4FT4A 4D4GA 1SBHA 3RTEA 1UPXA 2OY0A 1EXVA 3PZBA 2QDXA 2C0CA 3PKIA 3QRWA 2VF7A 4M1ZA 4G36A 4EMUA 2XD4A 3LT1A 3PG5A 2ZYAA 4OO3A 4F2PA 6GPBA 5DBFA 3EYWA 4FYPA 2QBYB 2ZWOA 3A10A 1B00A 3CLHA 2N47A 3H1EA 3LC2O 3P45A 3GP3A 4WXEA 2D0IA 1GP2A 1KGSA 2A7XA 2HU5A 3QM1A 4TXHA 4FCTA 5BWCA 1P1JA 4ZD6A 1E1MA 3HCBA 2XD9A 4JAVC 3PE4A 1JLSA 1G8YA 4TT8A 3EWSA 4KR7A 3P0HA 1QFZA 2IYAA 4CUKA 2CWDA 3VMMA 4BBPA 1GGFA 4C88A 5FB3A 5E4FA 2A4MA 2X7XA 5KOYA 3P32A 5FULA 5AI0A 3W5AA 3GJRA 3IE2A 3B70A 5EERA 4JC5A 3L8FA 3UTCA 2Q45A 4O2LA 4TLEA 5CB0A 2YMLA 1H42A 2ZRJA 4OI2A 4N40A 5ALKA 2O5EA 3N5KA 1KP2A 2PUJA 2WJ6A 4DLPA 1JEEA 1K9SA 1IWPB 1W9MA 5KSOA 1J6UA 4M0MA 4MLPA 2P5TB 1C3OB 2YINC 1K27A 2D4AA 2FW6A 2BDEA 3QBEA 3SDSA 3P2YA 3ZLUA 4RH0A 3WTBA 4A8JB 1GFIA 1W36D 1R4MA 3L8ZA 2D1YA 4WKCA 2JD1A 2G83A 2KBEA 1AUVA 1E6WA 2EJBA 1GZ7A 4WZAA 1MU0A 3UV7A 1NT2A 1LPBB 3KD2A 1SKAA 3PVCA 5HBGA 6REQB 3KYCB 1RZUA 4G1VA 4UTPA 1J5PA 4LF4B 1GA6A 2IYWA 2RHCA 1BXGA 3DVQX 4G81A 2RG1A 3TZLA 4ZVRA 3G7SA 3HO6A 5F5NA 2IK8A 5IBCA 4KODA 4HNGA 4L4UA 5ULLA 2WZCA 3FGOA 3TECE 1BJRE 1NW7A 4WZBE 3UT5B 1H2ZA 4I9HA 2R8EA 4HNRA 1KI2A 3ZGYA 5KHLB 1BD3A 1XWWA 1PE0A 3I3OA 1ST2A 1OWNA 2FFQA 3QP9A 3OEEA 2QNIA 4BO8A 3NTOA 3I30X 1E79D 4FHEA 3ANSA 3P4YA 4ND1A 3VC3A 3ZQJA 4BB5A 3AOGA 4AJOA 2PYZA 5A3RA 3BC1A 3LIIA 3QFHA 2FG5A 1J0BA 4Y0AA 3V32A 3B7PA 6ADHA 2WJJA 4TWIA 4LA4A 5IYZB 5KDDA 1SY7A 4HNUA 1RAIA 4MP8A 4L2IA 4WASA 3W6NA 2PUBA 1VCIA 4NYMQ 1KMCA 2RARA 1TRKA 5I9NA 1NYTA 3BN3A 4MYRA 3B2QA 4NBVA 4B71A 1I7NA 5CJPA 1R9NA 4MKZA 3WYCA 1OKKA 2QR5A 3S3TA 3AUUA 4Q01A 1JBKA 5TMBA 1CY2A 2DWCA 5DT9A 2RHDA 3G5MA 3MGBA 2D06A 3RLIA 1TO2E 3Q3EA 3OBBA 1NZFA 5L45A 1YS1X 4WBXC 2ZI9A 1QWOA 1QF7A 3KEQA 3UT6A 4FX5A 4JCCA 3Q7RA 1JHXA 5B58C 2MINB 1R6DA 2A0WA 2BM9A 2GD0A 3JQAD 3S2EA 2A6PA 4JYAB 3IP9A 3BORA 4BQOA 1PUJA 1SELA 4D0GA 1UXIA 3M1IA 3ABOB 4MZDA 2GAIA 1YJ8A 5JWHA 5CD9A 4UXHA 2NZYA 1RJEA 3KSBC 1YE3A 2ZBFA 1W0KD 1MJGA 1Y0BA 2X8JA 4YRCA 3N8IA 1Y7IA 5JIBA 1E0JA 2B37A 3WYNA 3V80A 1SU4A 2Y76A 2ATCA 4Q9JA 1J56A 2IYQA 1N2XA 1YJCA 2FRVA 1Z28A 3BDVA 3KOUA 4X60A 2VDVE 1XA3A 1T2EA 1D7AA 3GJ3A 3ESRA 2GR9A 2R62A 5CCXA 1XEXB 2ZRLA 5K8LA 1ESMA 1ECLA 1PQYA 2C31A 4BP1A 4QKQA 4PAQA 2QYTA 2YJNA 1TUGA 4DZRA 2MSEB 2W6IA 3V7NA 2Z95A 4TTQA 4M4SA 1KDYA 2Q6LA 3UAOA 3VOAA 3H2ZA 3L8EA 1FP4A 1WCV1 2J48A 1QF6A 4DNPA 1YB2A 2O9JA 3KVRA 3EDYA 3LE8A 2ZE7A 1KE2A 2CN1A 1LX6A 4BMPB 2QF7A 2GRJA 4GT1A 1E6MA 4NCXA 1TFRA 1JMKC 2RGCA 2C88A 4GR9A 4MVJH 4PPNA 1YFJA 5C7OO 4IFTA 4XUEA 2IOFK 2P27A 2W9XA 4RJKA 4TMFA 4X3CA 5AJZA 2YZKA 2QXYA 3WBBA 2UAGA 1O6ZA 2G8NA 3DTVA 2ZYDA 3OOHA 4IH4A 2PUWA 4M55A 4LDJA 3VSBA 4B83A 4YCBA 4DCTA 3QELA 3OQVA 1O9GA 3ZHBA 5LMUB 2R4QA 4KW7A 4RCZA 5ILGA 4U4AA 1B6SA 4AKSA 4WY8A 1AN9A 4O2BB 1NNLA 1OGYA 3IQHX 3QU7A 4N76A 2JCSA 1WB5A 2PSEA 2QNRA 3BTUA 2A59A 4HFRA 4O6VA 3ADBA 1GL6A 3FB4A 4Q4DA 4J07A 4U6SA 3AVUA 3FYSA 1Y6ZA 1S2OA 3HE3A 3NH9A 5IUJC 1KEUA 4PAOA 3R9XB 2B4RO 5CW2A 1WLYA 2PUDA 3G6KA 5LIRA 5MFPA 4DA0A 4KXMA 1XDUA 3HRKA 3K3PA 4LYDA 1XLVA 3IAM1 4XEUA 5ENDA 1AKWA 1JYFA 1SGWA 3F4LA 1G0OA 2CHVA 2PH5A 3FXAA 3H84A 4LZZA 4PQRA 2QZPA 4F4CA 3QUBA 3WLKX 2FDCA 1UPBA 4EYSA 3EXAA 1ZWLA 1MGOA 3Q1KA 3WO1A 1B43A 1M5RA 4DS3A 2BR5A 4F92B 3JATB 1B0PA 3KLOA 1Z06A 4DPKA 1HLGA 2GA9A 1GDHA 2O2ZA 4OHBA 5A0FA 4CLEA 4D0SA 1N0WA 3KKMA 3IXLA 4LRUA 2I2BA 3C3WA 4XM1A 2NSDA 3SS7X 1WDWB 5DIFA 3HA2A 2ENWA 3DHYA 3PB3A 1WV1A 2JGIA 3WAKA 5HBRA 3QYPA 1HURA 1OXUA 1QC5A 1WAMA 1B3BA 1L5ZA 2DWPA 4WLUA 1FS4A 1RMTA 2C4VA 1K7SN 2JJ1D 3E03A 1QTNA 2FV8A 4DQDA 2H0AA 2Z9BA 1L3BA 3MLEA 2Z6VA 3FNIA 2RGGA 4JP1A 3W9YA 4IIYA 1UXJA 2WSIA 4EYKA 1G21E 1P61B 2GTPA 2QTBA 2ZTUA 1T5LA 1DAPA 1FL9A 4KIJA 1NF3A 4RQUA 1ADGA 3GJTA 5TV2A 1FLVA 1OVGA 1C4OA 1GTVA 1TOAA 4MUMA 4HVLA 5FV4A 1DJMA 4IMIB 2UYGA 2ICAA 1YQQA 2EC5A 4UBOA 5JO9A 1OPRA 1YB5A 3IHWA 4KIWA 1F5SA 1E4YA 2I4TA 3IULA 4XIJA 4IEFB 4DLKA 4EG0A 3KQNA 4HATA 2X0JA 4Z51A 4FJ0A 4KRGA 3MCZA 3IUNA 4LC9A 2IYLD 3BWXA 1CY8A 3PPWA 1Z5PA 4ABYA 1JQ3A 2P3SA 2CSUA 1Y3DE 5DYIA 1KK1A 4Y2SA 4U7JA 1REQB 3VM6A 3A1FA 1ADYA 1ID1A 3GA0A 2I3DA 1RIIA 2BFBA 4RENA 3B9PA 4CQNA 5AK6A 3W05A 1J00A 2VDKB 4EPWA 3KU4A 4MWDA 4KR9A 4BUJA 2GDZA 3VC7A 1BX1A 1ZCZA 3IGFA 1FNDA 3BXOA 2PUGA 4X85A 4D4LA 2O3RA 1GL9B 4G5SA 4BWVA 1XCGB 1UBTS 2NTVA 3G8CA 3MXTA 1E0KA 4I36A 4OIMA 4R9SA 3D4LA 2VBCA 5F9FA 5KOHA 3QBVA 2FETA 4JJZA 4OQNA 1HM5A 2I3GA 2OG1A 3PQ6A 3ZGLA 1UBUS 1VG0B 1YCDA 2LVBA 2W00A 4UU0A 1L5GB 1T2DA 2XMSA 2XYGA 4JUFA 3U4DA 4IS3A 5KYUA 3WX0A 4Y8VA 1W5SA 2FWJA 4LBYA 2GBLA 4EG7A 1SVSA 3SBDA 2DFLA 5JCXA 1A9OA 1I7SB 3WBJA 1K3FA 3HMQA 4M1OA 5TIIA 2WK1A 3I64A 3DR3A 2O4UX 4PG7A 4ZZ2A 4MPDA 3SKXA 4YCNA 4WOKA 3ABSB 3Q2IA 5IXJA 2R1TB 1IUKA 1NPYA 1KY2A 2LXNA 3THWB 1F7VA 2CY0A 3JSAA 3P2EA 5EEHA 1PG5A 4Z3DA 5CH8A 3ZHQA 2C98A 2R8RA 4ZO6A 3S99A 3NYRA 1CQIB 1UT6A 3BE8A 1PU2A 4Y6RA 3LWDA 1VPLA 3H1PA 4QTZA 1WF6A 1OC2A 4D44A 1E0AA 1Y48E 3MFYA