3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
b'EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyphenylpyruvate reductase
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
molecule tags Oxidoreductase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
2VHVA 2QHXA 3IMFA 3JQCA 4LK3A 3OICA 3RC7A 5ICMA 2VYVA 5IN5A 4FJ0A 2RIRA 5G2OA 4L4SA 3GDOA 3KETA 3O38A 3JQGB 3RIHA 4CPDA 4CV1A 4DC0A 4PLWA 4R54A 2VRCA 2C29D 2X6TA 1GTMA 1NM5A 1FDVA 1HE5A 1GFSA 4DQVA 4NJMA 3BAZA 3R6DA 4I5FA 4HXYA 5K6AC 1XWFA 4BIIA 4L73A 3IUSA 1HDOA 4GPD1 4KMSA 5H83A 2QW8A 1GZ4A 1W0CA 2X1HA 1UDAA 1X0VA 5I9LA 1RJWA 1M6WA 4WEQA 4B4WA 4RPKA 3GEMA 5JXWA 4K1LA 2OHXA 4QECA 4URFA 1O5IA 4ALKA 4PLTA 1I5RA 1G1AA 1JW9B 2OMEA 3FD8A 2AEMA 2QYSA 1P1FA 1A4IA 3WXBA 5COQA 2X86A 4KTVE 4KZPA 3AU8A 2HMUA 3AI1A 2YHIB 4BO2A 3RVDA 2X9GA 3WGYA 1YQXA 1WLYA 3C8MA 1NXQA 3SEFA 2VUUA 3KUXA 1HXHA 3GVXA 3GEDA 1WZIA 1B26A 2FPPA 2W2KB 1DC3A 4NU5A 5CG2A 1LBEA 3DMTC 2AE1A 1O8CA 1JWBB 4DREA 4BV8A 4IBOA 1FK8A 1R0KA 4OKIA 4GH5A 4TMFA 3HZZA 1KYQA 4B7UA 1Z7EA 4IPTA 1Y5MA 5G0VA 5KJ1A 4QEDA 3VZRA 1Q1NA 4R9RA 3E6AA 3UAGA 3RUIA 1Z75A 4AJKA 3PDUA 5KVCA 2AEFA 3CXRA 3N7UA 3P7MA 3C1AA 1LSJA 1KEVA 4GMGA 3R1IA 1BHSA 1P1HA 3EVNA 4O0LA 4BNGA 4MVJG 4CQMD 3K96A 2VT2A 2X5JO 3FNHA 1DC4A 3H7AA 5JAIA 1P1IA 2PLAA 2Y05A 4K6FA 1BXKA 4F45A 4MVJI 2IRWA 1DHTA 1ID1A 4CM4B 2O3RA 4NFYA 3B20A 2O48X 3EC7A 4YAJA 3MJSA 5K0ZA 1WPQA 3I5MA 4JP3A 5DF1A 4DRYA 3AOEA 3ZH2A 5HA5A 1UZLA 2YHUA 3FF4A 1UDBA 1GY8A 2VNAA 4CQLB 3QHAA 2HU2A 4ZVVA 1P1RA 3RCBA 2A94A 5IZ4A 3UVEA 4Q3AA 5F5NA 1PJBA 1VRWA 2FSSA 2D4AA 4BQPA 4CQMA 2BFMA 1Y8QB 3D64A 3SBOA 1Z74A 4ZQFA 3DZGA 3L9XA 2DPHA 3M1AA 3U4CA 3UUWA 1KIFA 1NQOA 1I2ZA 3C7CB 3G0OA 4AJ1A 2E37A 1PJ2A 3LQFA 5BSEA 1BVUA 1DLIA 2PV7A 3MOGA 3PGXA 4CM3A 4W7HA 3WFIA 2V6FA 3RFXA 3NYWA 2VTDA 3VDQA 1K3TA 2BMAA 1CETA 2AE2A 2CSUA 2P5UA 4XQGA 5COAA 4WUVA 1R37A 4KQXA 1PU2A 4YJHA 2IXAA 4Q3EA 2AQKA 2EIHA 4JX8A 2O3UA 1ISMA 1U3VA 4M87A 5TQVA 3FWNA 3HDJA 4I08A 1CJCA 1N2SA 1V3VA 3GC6A 4JLWA 2OFPA 4CV0A 3KOUA 3G1UA 2I67A 4R1NA 5FI5A 3WG9A 3I6IA 1GYPA 2Q4BA 4XIYA 1A5ZA 2Q4EA 3MEQA 1EVZA 3GMDA 1LDYA 3ULKA 3FNGA 1C1XA 4OHUA 4B7XA 1LNQA 1HDZA 5TJHA 1D4FA 2X0JA 3JQ6A 2Z1MA 3FTPA 2DTXA 1PGQA 1P0FA 1DIBA 4BO7A 5JYDA 4GGPA 4FCCA 2QIOA 4IZHA 4LVCA 3SJUA 2OXIA 2CDAA 4UUMA 2LDXA 3DZKA 1RYEA 1XU9A 3OSUA 3TN7A 3WGGA 2O3QA 3S1LA 4AJNA 2NACA 2VRBA 4Q3CA 1IZ0A 1UXHA 3GG2A 3D0OA 1NAHA 1A7KA 5HBRA 3CMMA 4FDAA 3K2BA 3MZ0A 1HYGA 1OI7A 1OC4A 1I24A 1QLHA 3NUGA 3FBTA 3U4DA 2XF8A 3H5RA 2JCYA 1X15A 2FMUA 4CUJA 2HAEA 5JYEA 3QA9A 4WOJA 3IP3A 1OZAA 8ADHA 4E5YA 3ONDA 4E2ZA 2E4AA 3TZKA 1GUYA 3KRTA 1DPGA 2DU8A 2UAGA 3PGJA 4FW8A 5T57A 4HV4A 1DIGA 1HSZA 3ITDA 4MPDA 1NFRA 4B3JA 3HFGA 4OQYA 4QTZA 2JCVA 2YYYA 1HDYA 3ZNQA 1VL8A 4WECA 3H2ZA 1EVYA 3EMKA 3RUAA 3VPFA 5TT1A 2Y1CA 2X7HA 3AY6A 1EDZA 5KVQA 3RBXA 1IUKA 3ZWPA 2YFHA 4RPLA 4NDNE 4EGFA 2IZ0A 3I9KA 3LZ6A 2J8ZA 3B70A 5H81A 4NJOA 3BZUA 1MC5A 3FCOA 3K30A 1DFGA 3DBRA 1J0XO 3GG9A 4Q3DA 4DPMA 1EDOA 5CHEA 4DL9A 1PJQA 1WMBA 2UVDA 2ZB7A 3AFMA 3DBLA 1ENPA 4WCFB 1R4NB 2PD3A 4NG5A 2AQIA 4NFHA 4NZ9A 1QYDA 2E82A 1G6KA 3SX2A 1Y9AA 3S2GA 4JBIA 4YAGA 1J5PA 1U9JA 4I1IA 3JYQA 4E0BA 7MDHA 1VSVA 1RM3A 3E9QA 2ZTUA 1NHWA 4QFDA 2RHRA 3PK0A 1U3TA 3AOEC 3DB2A 5TJ9A 1JAYA 3HADA 5FF9A 5GZ6A 4DIFA 1IHYA 1GUZA 3PWZA 5KVVA 1Q7CA 4CR7A 4FN4A 2OP0A 1QV7A 2CUKA 3NV9A 1B15A 3EK2A 3O4RA 2E49A 1MB4A 3WYCA 1GQYA 3U3XA 5I9NA 1T2EA 3I3OA 3GVCA 4GX0A 1Y6JA 3RKUA 3FNFA 4UVDA 3R3SA 4BB6A 3JQDA 1E6WA 4DYDA 2AEJA 3PVZA 4J1SA 4P4NA 4F3YA 5A5EA 3TZCA 3WGTA 4RLHA 2OO5A 5EQFA 2I65A 3NDIA 4YACA 2OORA 4ZA2A 1KVUA 2VWQA 3GRKA 1R6DA 2CF6A 1T1SA 3UCXA 3EUWA 4DIOA 3EGOA 5I8WA 5JAQA 1DAOA 4A0SA 3FRJA 3VDRA 1KERA 4R41A 3WMWA 3GDGA 1Z73A 2PWZA 4GVLA 1ZK3A 3DMYA 1ZK0A 1CF2O 4Y8VA 3BTVA 3DHNA 2UYYA 5TS3A 1E3WA 4J4HA 2OBYA 4RPJA 2Y67A 1GCUA 3JD1A 4LSMA 5AVOA 2D8AA 2WE8A 1PL8A 1LJ8A 3HDQA 1QXSA 1D8AA 3TSCA 1SBYA 5JCJD 3QY9A 4E31A 1GADO 3TZHA 2VYND 3F4BA 4E5MA 4GSKA 5THQA 2O2SA 3FSRA 1W6UA 4GWGA 4PLVA 3I4FA 3ZW8A 4BNMA 3ENNA 4JK3A 1NPDA 3AK4A 2WD7B 3OA0A 2PK3A 1BW9A 1KVQA 2Q2VA 1YL5A 1TI7A 2WDZA 2O3TA 2HMSA 5TLSA 3ANLA 1LX6A 3WQRA 3BIOA 3LDHA 3S55A 2CVZA 1JQBA 4FOOA 4RZIA 5AXAA 1K2WA 4B8ZA 3SC4A 1F8FA 2FR1A 5KKAA 3B1KA 4RVSA 5JCJA 3ZWOA 4M8SA 1NYTA 4H7PA 2VYNA 1U1IA 3Q3CA 4J2HA 1XLTA 4FIZA 4C7JA 5B4UA 3NT5A 1YJ8A 3PJFA 1FXSA 4M89A 1SB9A 4Z3DA 5JDIA 5K9ZA 5DULA 3ETDA 3M1LA 1SC6A 3TPCA 4J1NA 3MJ4A 4D42A 3M2TA 1FJHA 4LCEA 1DC5A 2UV8A 3OA2A 5KOIA 3SJ7A 4DA9A 4KWIA 1BVRA 3TDKA 4I5GA 3FI9A 2B83A 3JQ8A 4AFNA 1KEUA 3WGOA 1GPDG 2C07A 3Q2KA 1O94A 5CDSA 4HWKA 3BMQB 2Q1UA 2X58A 3FR7A 4HFMA 4IQGA 4CMIB 4ZQBA 1KBZA 2FOIA 1ONOA 3NDRA 5L9AA 4UREA 4ALLA 5CFZA 2PZLA 4ND4A 3PYMA 3OH8A 1E7QA 4IXWA 1B3RA 4OOFA 3CIFA 5JLAA 4BNLA 1T2CA 2A92A 2EV9A 4YQYA 1LSSA 1N7HA 3E9MA 2DC1A 3RUDA 5CDUA 2G17A 1VM6A 3ASVA 5IG2A 4XJTA 2NU9A 4TSKA 1I32A 1D1SA 5TGDA 1MLDA 3KHUA 3CINA 3E03A 1T4DA 4JJIA 1LDNA 1TLTA 1I3NA 3GEGA 4UUNA 2EKQA 4R4JA 5CDGA 1WP4A 3UKOA 4CLRA 4JJGA 2G82A 3ZDFA 1XA0A 1T24A 1ZEJA 1IY8A 5LDHA 3E5RA 4J49A 1DLJA 2YQ5A 1KEPA 5A3JA 3VPGA 3IS3A 3ZHBA 4PVCA 1UXGA 3PIDA 4G5HA 1GV0A 4CMBA 4Q9NA 3EW7A 4XB2A 1H2BA 1IOLA 1B3BA 1DDOA 2XOXA 3GOHA 3QVXA 1GU7A 2DFVA 3WQQA 5IZCA 3HWRA 1KY5A 2VUTA 3RASA 4DC1A 3JYLA 5T64A 4RL6A 4GQAA 3VVCA 5JFOA 1B0AA 1H6AA 1I8TA 2G5CA 3OETA 2Q1WA 3DAPA 3RWBA 3UH1A 4NHEA 1RM5A 1UXJA 1QYXA 1H93A 2ZB3A 4GKVA 3ADPA 4PG7A 2WWRA 4DMMA 4N18A 1M6HA 4DLAA 3G1TA 1EEHA 1I3KA 4ND2A 2ZB4A 3ZN2A 3KYBA 1B7GO 3L4BA 1NP3A 4N5LA 2NVWA 3N58A 4WCDA 2I76A 4JBGA 4Z3KA 1ONNA 3HN2A 1ML3A 1T2FA 1BXGA 4BKRA 2C7GA 2A4KA 3I52A 4Y98A 3WTCA 3IP1A 5G4LA 1XHLA 3ZWXA 4KP7A 4UVHA 4RJTA 1H9AA 3DZJA 3OM9A 3PHJA 1YOVB 3TOZA 2UUPA 2X0RA 2O50A 4BKUA 3UW3A 3WNVA 2FN7A 3FTNA 4JN6B 1MFPA 5MDHA 3OJLA 2DAPA 4L0QA 3AI3A 2VWGA 5KJEA 3T4EA 3W4IA 4Y6PA 2CZCA 3OQ1A 4BO3A 4XA8A 4H16A 2Q46A 4I9NA 4L9RA 4A03A 3GPDG 1TT5B 2J5QA 1UXIA 3HDHA 3R0IA 4EEZA 4NBUA 3WR5A 3DHEA 4R5HA 3VPSA 2HK9A 4WLNA 2X9VA 3FN4A 4BKPA 3AW9A 5EJ2A 3RUEA 5JY6A 4DYVA 4IMPA 4BQRA 1E3SA 1PGJA 5L45A 4I5EA 5JDIC 4EJ6A 2I3GA 2TMGA 4FJ1A 2HCTA 3QWBA 4ID9A 3VAZA 4KTTE 4AVYA 1BG6A 1PEDA 4FPXA 2Q2WA 2PTGA 4U6QA 3SVTA 1VL0A 2ZTVA 3K6JA 2BF7A 1LLUA 1XR3A 4NK4A 4QXMA 4RPGA 3ZWCA 5U9CA 4MKRA 2PKQP 3I9OA 5JO0A 4L74A 5T5QA 4UULA 2BI7A 4BGEA 1K0UA 3DXFA 3IKTA 2YZ7A 3AOGA 2HK7A 5DNAA 4BO8A 3U5TA 5DBFA 3BA1A 1WXDA 4JXKA 4R16A 1DIHA 1E3LA 2PGLA 4IJKA 1XIVA 4YRBA 2IEBA 3H3FA 4NI5A 5BR7A 1VI2A 2A9FA 1ZW1A 2P4HX 2D5CA 3OEYA 3AU9A 5CPFA 3INGA 1NBOA 1PJ3A 1ZZEA 2X22A 3AUUA 1OAAA 5DN9A 1PJLA 3L9WA 3OBBA 2ZCUA 1GR0A 2JJYA 3ASUA 3H5AA 4KWHA 4YEDA 5JO9A 1QKIA 4NPCA 1SMKA 3NTRA 3IOYA 2NU6A 1SOWA 1X7GA 1NVMB 4DMLA 3KYDB 3OF2A 5IN4A 5TIIA 4B4VA 4II3A 4LMRA 2XAAA 4XGIA 3P5SA 4AJ4A 1LEHA 2BGLA 3BMOA 1C0PA 2LDBA 3GR6A 3O26A 1U7TA 4DBVO 3QP9A 3S8MA 3T7CA 4KUGA 2GUGA 4PG5A 3JD2A 4UVIA 1E1KA 4CR8A 3KSZO 1I36A 3IKVA 3NDJA 3Q9NA 1A71A 1P1JA 4E2YA 5ENVA 5IZCC 5BSHA 3PLRA 4UEKA 3HHPA 4P4GA 5A3VA 2ZKLA 1LI4A 2QZZA 3T4XA 2GN6A 3VPXA 1U5AA 2YV3A 5DT9A 1I01A 1DO8A 4JCOA 3ITKA 5EINA 3NTQA 4IM7A 4OMUA 4RVGA 5DP2A 1CEQA 4J1QA 4OM8A 5JNLA 1AE1A 1J6UA 2BELA 3MOIA 4D46A 3JD4A 1HLPA 3UXYA 2NTNA 1B14A 1O9BA 4KUEA 3W6ZA 1DAPA 3L4BC 4R1UA 3V2HA 5BT9A 3MJCA 5I9MA 5L51A 2BGKA 4Y9DA 1MP0A 2EWMA 1HLDA 4AJLA 4GL4A 3PIIA 1ADBA 1V3UA 5F1OA 1I33A 2FY8A 1QYWA 4RF2A 1QRRA 3VTZA 2H9IA 4WLOA 4HUJA 4HADA 1CWUA 4FOSA 3PRJA 3DHYA 1R12A 1RPNA 4BGVA 4BNUA 1OBFO 3C3XA 1HF3A 5C7OO 4LGVA 5ADHA 5ITVA 1WNTA 3KM0A 1GD1O 2G76A 3TRIA 2VHYA 5CP8A 2DVMA 1N8KA 4NIMA 3QWFA 4WK6A 4UVGA 3UCFA 3ZV4A 4A10A 3RSHA 4J2OA 2VZ0A 3QW2A 1AN9A 4Q39A 1ENOA 1OOEA 4MVJP 4U0JA 3GGGA 1F12A 2P4QA 5KCZA 4WJZA 1B16A 2ZYGA 1V9LA 3JQGA 5L4SA 3WFJA 1Q7GA 3WIDA 1BDBA 4BNNA 2JFHA 5BNTA 3TZQA 5ICSA 4FFPA 3AM4A 3DBHA 5G0WA 4YYZA 4NMHA 1JWAB 4Q3NA 4GVXA 3E5MA 3LLVA 4ZN6A 3GGPA 4HBGA 1E92A 3PHHA 1EFKA 2IXBA 3HE3A 3INRA 5ER6A 3TJRA 4RVFA 3RQSA 1M2WA 4CQMB 1Z7BA 1LSUA 4IDEA 1XKQA 4PZDA 1E77A 1IHXA 4MDHA 1LUAA 3TL3A 3F5SA 4CL3A 3NGXA 4RPHA 1XGKA 5HWSA 1EE9A 2HRZA 2ILTA 4U8GA 3WWZA 1JVBA 1CDOA 2X0NA 3DTTA 1EE2A 3GVIA 1Q2XA 1ONPA 1UZMA 4MIYA 4RF4A 3UN1A 5A4DA 4H3VA 1PL7A 4GGOA 1Y8RA 2QX7A 3PLNA 1PJ4A 4XKJA 1ISJA 1LSOA 4YJHB 1NFQA 3I1JA 2W2KA 4YT8A 4S1VA 4J3FA 4IZIA 1DFHA 4XYBA 4A73A 1DBVO 3F1LA 1GUFA 4JBHA 1E0DA 1QP8A 4BNVA 4B3IA 1HDXA 5KVSA 3OEWA 1I2BA 3ORFA 1HKUA 3P19A 4ESOA 1U3UA 4R1SA 1U3WA 2Y0CA 1NX6A 2O3SA 3MTJA 4GWKA 4Y6SA 4CM9D 1C1XB 9LDBA 3ZHXA 5L7WA 4NK5A 3EVTA 3ADOA 3K92A 1X13A 1PWXA 3TFQA 4E30A 4WLUA 2EJVA 4ZQGA 3TQHA 3X2EA 2WYUA 3ANMA 4LSWA 3DFZA 3M6IA 2D0IA 4B4OA 1KEWA 5JAMA 4OSPA 5H82A 1B2LA 4YRAA 3E1KA 2FRDA 4BO1A 1OFGA 1XYGA 3QWIA 1K5HA 1TXGA 1ZIDA 1X1TA 1DSSG 4DPKA 2RH4A 2P2SA 2I9PA 1UR5A 3ROMA 1FDUA 4CM9A 5JDCA 5C5IA 2PFGA 4PCVA 1XQ1A 1A9ZA 4Z0PA 4CM6A 2PY6A 4BNIA 4FC7A 3IJRA 3BTUA 1NWHA 2Q2QA 2GSDA 4R51A 5CEEA 4PZEA 4D0SA 1ENZA 5I7FA 3GN2A 4UVEA 2FP4A 4RVUA 4XQCA 1A7AA 2NUAA 1YGYA 2P5YA 2EG9A 4FGSA 2IDZA 2GO1A 3B1JA 3HNPA 5F21A 1ZSVA 1QORA 4EITA 4G81A 3BMNA 4C4OA 3DEYX 1IE3A 4F6CA 1NTOA 3D4NA 1I3MA 4E6PA 3GLQA 1NAIA 1A27A 1AUPA 2DBQA 1A4UA 1QV6A 1TA4A 2NNLD 3KBOA 3GUCA 3RUCA 3NT2A 3DBRB 1YB5A 1HE3A 5AXBA 3WLEA 4BVAA 3I6QA 3DBLB 4CMKA 1X7DA 4CV3A 2X8LA 3C7DB 1UP7A 3F9IA 2C20A 4IDAA 5I8ZA 4XJSA 1XG5A 4DUPA 3KZVA 2WSBA 2P9CA 2GR9A 2VOJA 3K8ZA 1ZJZA 3PWKA 4ND1A 3ANNA 4BUCA 5AQ1A 2XXJA 3OJEA 2TMDA 1EFLA 2B0JA 1Y81A 2PH3A 4DPLA 5C37A 2H6EA 5I7SA 3WB9A 3GHYA 1NPYA 1GAEO 4FGWA 2NV6A 4YT5A 1LU9A 4R68A 6LDHA 4E5KA 3P2OA 4RGBA 1E7RA 2HDHA 1HWYA 2ZYAA 1Z6ZA 3ONEA 4BO4A 3QVSA 4YAKA 4RO0A 4Z6KA 1DB3A 3WMXA 4XEHA 2IODA 5EN4A 3NGLA 4OO3A 1ZMOA 2DT5A 1LLQA 1Y5RA 5FEUA 3EY4A 2GDZA 3Q1LA 2EF1A 2OOSA 3TZ6A 3LC7O 2FWMX 4IDCA 5TRTA 3H65A 4U5QA 3CMCO 4YAEA 3W8DA 1S6YA 1ZXBA 3I9NA 3GQVA 4AJPA 4IDBA 3INTA 3KEOA 1U5CA 5AXCA 2ZK7A 3GF4A 3RUHA 3S2EA 2NVUA 1YB4A 5CPBA 3VH2A 3G79A 4ZHSA 2NLOA 2D3TA 1LLDA 2BFPA 4RDIA 1UUFA 1ZH8A 4WGGA 1HZZA 5TT0A 3X2FA 5IDYA 3I9MA 3LSYA 4CM5A 1YO6A 2PD6A 4XGNA 2Q99A 3QSGA 5L4NA 1EBUA 1DHRA 1CQIA 1E3WB 2X0IA 1U4SA 3H3JA 1PR3A 1P77A 2BRUA 3LT4A 4FD3A 1LA2A 1VLLA 3WOHA 3F5QA 1LC3A 2B4RO 5HS4A 2Q50A 1VKOA 3GMSA 2V6MA 2YJZA 4R3NA 3AY3A 1T1RA 2YDXA 4MO2A 3O8QA 4RQUA 4BL5A 1OMOA 3ZNPA 4AJ2A 4DBZA 2POQX 1SO8A 4E33A 1ULSA 4J91A 5CEJA 3NKLA 5BNFA 4IQ8A 1NVTA 3COSA 3GNQA 2GERA 1I0ZA 1I30A 4KUHA 1DJQA 2B35A 3NJ4A 5IF3A 4BV9A 5ILOA 1M75A 1X0XA 4JNKA 1NQAO 4ZQHA 3MWDB 2Y1EA 4D41A 1WVGA 1W73A 1K6IA 5B4VA 1A9YA 2JAPA 2O4CA 4TZTA 2J3KA 4ND5A 4TRRA 4BNKA 2X5KO 3KVOA 2GN9A 3FBGA 3T7EA 1PS9A 4ALIA 2VUSA 2ET6A 4J1TA 2WTBA 4EDFA 3Q11A 5U4QA 1JAXA 4R01A 2RHCA 1MFZA 1W4ZA 3L6EA 4HFRA 4QO8A 4CR6A 3LLSA 3Q2IA 3PTZA 4INAA 2EGHA 3OJ0A 3QWHA 4R3WA 3BTSA 1KOLA 1PZFA 3SLKA 1SCUA 4B4UA 3H9UA 4W6ZA 4WLEA 3PWSA 4WNCA 1S7CA 2HRBA 3WWYA 4UUPA 1ENYA 3JQ8B 3PYXA 3UFXA 1XU7A 1L1FA 3DAGA 1SEVA 2EP5A 1UP6A 5FWNA 1EBFA 3FWZA 4XYLA 3W4JA 4OH1A 3PPIA 4N7RA 1WDMA 3DWFA 3DC2A 3PXXA 4IGFA 1C1DA 5EESA 1E7MA 5IXYA 1O89A 3RC9A 1SEPA 4J0FA 1UXKA 4E32A 3K5PA 2VHWA 1PSDA 2B36A 3ONFA 1GYQA 2I3AA 1P44A 2HKIA 4FJ2A 1PGNA 2HO5A 4XR4A 1N9GA 2JKVA 3PQDA 4RCVA 3GN1A 4DIBA 3MJEA 3PFWO 2ZYDA 1EMDA 1BGVA 3SXPA 3LVFO 2WD8A 4TKMA 3TOXA 2B5WA 5CDYA 1F0YA 1AHIA 1DJNA 2IEDA 2ZIZA 3NAQA 1L7EA 3PJDA 4LISA 2E6UX 5ER9A 4F6LA 4GMFA 2R00A 5F3RA 1XEAA 1JTVA 4RV9A 4YTEA 4YR9A 1WDLA 4CLRB 4CM8B 3HDYA 2PA3A 3PP8A 2CF5A 2HJRA 3KLMX 3D4OA 5BSGA 1N7GA 5EMHA 4BHTA 2E48A 2NSDA 3KB6A 4NBWA 3OECA 3GRPA 5DP1A 1WW8A 4ZGWA 1RM4A 3EAGA 2ZTLA 1ISGA 1ZXLA 1YL6A 4CL8A 3E48A 3E8XA 4YT2A 2C5AA 4BMNA 4GBJA 3EDMA 2EP7A 4ILKA 1H9BA 4N5NA 2QRKA 3ZNOA 3K2EA 2PNFA 3LU1A 3JQAD 4QUKA 3D3WB 1VJTA 4CV2A 3S2IA 1JU9A 3ZWWA 2JHGA 4GX2A 1N1EA 2IE0A 3OQBA 3WIEA 3I9JA 1U4OA 2V6GA 4FS3A 3LYLA 3WGQA 3E82A 2EGGA 2PZJA 2Q1SA 5A06A 1BTOA 3OP4A 2JFFA 4J6FA 4DQUA 3KYCA 4XDZA 4CM7A 4WLVA 3C85A 4BB5A 2VNSA 1P9LA 4IY1A 3D1LA 2DUUA 4XR9A 3GZ4A 4TWRA 1DIRA 3VH4A 3ZU4A 3K9QO 2QG4A 3VH1A 4N54A 1PGOA 5BSFA 1YJQA 2ZTMA 1JDJA 4EYEA 3OJFA 4MVJE 1I2CA 3VC7A 4YJFB 3PJGA 3JQAA 5ITWA 3LF1A 1LQTA 2ZCVA 3HN7A 2DBZA 2OBNA 5CDTA 6ADHA 3WBBA 1KVRA 4PG8A 5JS6A 3L0DA 1GQQA 2FSVA 2AA3A 2WE7A 3VZSA 2GPTA 2VT3A 1U7HA 3DZHA 1DRWA 3GZNA 2O3JA 4MKXA 2JD1A 4TZKA 4OGWA 3V1YA 1PX0A 3U62A 3WYEA 3OFSA 3RKRA 3QIVA 1U28A 2O4UX 4WASA 1HEUA 5JMPA 3AWDA 4NQZA 5AOVA 1EZ4A 1E5LA 2QZ9A 5HM8A 4MIEA 1FDSA 4CJXA 5A9SA 5KNLA 2XXBA 2YFQA 1P3DA 4MVJM 4BGIA 2RAFA 1HDCA 1YONA 2J6IA 2W4QA 3U49A 1ZSNA 1N92A 5LCXA 3RAJA 3C1OA 5U1PA 2ZQZA 2NQ8A 1VSUA 2NTJA 2GYYA 1NR1A 3BHIA 3MCVA 2Q45A 5EQDA 1MXHA 4PLZA 3RJ9A 4HNHA 3U0BA 3HQ4O 3CEAA 3KXDA 1R4MA 4E13A 2J5RA 1NR7A 4XD2A 3I23A 4DGSA 2CFCA 3WJAA 5JBIA 3HFSA 2GD1O 4GAEA 1V6AA 1ZK1A 3Q6IA 2BFAA 4GSLA 4D7AA 3I9LA 4HY3A 4X54A 1UP4A 1QMGA 2VWHA 4NU6A 3V8BA 2NQTA 4MVJH 3WGHA 4AJHA 5IAAA 4RZHA 4XRGA 3JQ7A 4EW6A 3RU7A 4JQCA 1IB6A 4GLOA 4XYMA 1V8BA 1PZGA 2GLXA 3JQFA 2VHZA 4TRNA 5C7LO 5JCXA 2QRJA 2Y1GA 3FPCA 3IUPA 5J23A 1P33A 3AM3A 3NRCA 3DQPA 5FYDA 3UHAA 3VHRA 4EEXA 1E7WA 3PHLA 1YB1A 3QVTA 2JD0A 2C59A 2P9EA 4XGKA 3LK7A 2IYPA 4S3MA 4E4YA 5IJZA 2GGSA 3RU9A 2PKRA 4FFNA 4CMEA 2HQ1A 1HL3A 1BWSA 5T67A 2VTEA 1YOVA 2WEKA 5A05A 5A02A 2R00C 1WMAA 3A06A 2FZEA 3H4VA 3A4VA 1JN0A 3BMOB 3DOCA 1K89A 1PJSA 3PQEA 5GY7A 5LC1A 1HE4A 3WS7A 2VZ8A 3RBVA 3N74A 1ZCJA 2JCXA 3MWEB 1AXEA 4K26A 5JPIA 3GPIA 1TT5A 2FR8A 2WYVA 5F5LA 4IIUA 5B37A 4BMVA 1MG5A 1EVJA 2C54A 3ZWMA 3DFUA 4WPGA 1GL3A 3CSDA 1JKIA 3GT0A 4RVHA 4AJEA 3B1FA 3VPHA 3HG7A 1C0LA 1T2DA 3GK3A 2Z1NA 3H9JA 4MINA 4RLSA 1VJ1A 2GZ3A 4FB5A 3ICCA 1P0CA 2Y1DA 5CAEA 4DVJA 4O5OA 4YJGA 3HB4X 3LT1A 3RROA 4BNWA 5AYVA 1U8XX 2W98A 4W4TA 1PS8A 2NM0A 2VQ3A 4ZICA 1ZSYA 1HYHA 4RQTA 4NJMB 3KEQA 4QT0A 1B8UA 3ZZNA 4YWJA 1ZUD1 2EKPA 3ZU2A 1EUZA 2ZJ0A 3DONA 3L6OO 4HKTA 5CEFA 3WQSB 5JC8A 5DBGA 1PR9A 4WLFA 2V7PA 2I5PO 5G0TA 4M49A 5G4KA 4J7UA 4LW8A 2B69A 3KO8A 3PEFA 4CLOA 1YL7A 3WJ7A 3HB5X 1DEHA 5KIAA 2PH5A 1HYEA 3KLPX 1U8FO 1W8DA 3ZGYA 2DLDA 1OC2A 4WKGA 3PHGA 4DTIA 3H8VA 3JTMA 1WDKA 4D0RA 3CZMA 1Y7TA 3TNLA 1YDWA 3TL2A 2G1UA 2YW9A 3OMLA 3L77A 2UUOA 2RBEA 3WDSA 1RKXA 4OIMA 3QQPA 3ROQA 1MV8A 4YB8A 2B4TO 4CUZA 1MC4A 4OOEA 1M67A 3BXXA 1PZHA 2CDCA 1ZJYA 2I66A 1YDEA 1YWGO 3KYDA 3BYZA 2VN8A 1UAYA 2O7QA 4W7IA 4W99A 3HSKA 1F8GA 2ZATA 3WX0A 1E5QA 2CVQA 3QE3A 1GZ6A 5EPOA 3UGKA 4GKBA 1LXCA 1NPTO 3PDJA 2RCYA 1QYVA 1YQGA 2AG8A 3BMCA 3CH6A 3DBHB 3ROPA 3ZWYA 4D44A 4DXHA 1PS0A 4O59O 3OQ6A 2BD0A 2EHDA 4MVJF 1QR6A 3OHSX 1AGNA 4IS2A 1NHGA 1UZNA 4MP8A 3AFNA 3ZHZA 5THKA 2SCUA 5COBA 4L76A 2R2GA 5GZ3A 4P4LA 4MIOA 1KC3A 3GHHA 1HDGO 3NX4A 4AJJA 3WICA 3DBVO 1VJ0A 5TSDA 1K6JA 2F00A 1LLCA 4BKOA 1EQUA 8LDHA 1MG0A 1Y8RB 2CY0A 3GAFA 1J49A 1KETA 3JQFC 3MJTA 1YKFA 4MOWA 5LDGA 3KTDA 4A27A 1R0LA 4OL9A 2EW8A 3HJAA 1VL6A 1BXZA 5TX7A 3G3EA 1ZNQO 4CODB 4BS9A 1GEEA 3L4SO 5B1YA 2YUTA 4HP8A 4OYRA 2X4GA 1U2GA 5I7VA 4KDFA 1B8PA 2B4QA 2HLPA 4YRDA 2AMFA 3ON5A 4MVJD 4D79A 3JYNA 4CMEC 2DBVO 4XYGA 1YBVA 1UDCA 2PZKA 2Y99A 3R3JA 1UJMA 4AL4A 4TROA 2IZ1A 5ENDA 3ZV3A 2YHIA 4B3HA 1YE3A 3GVHA 3ENKA 1EUDA 4E2WA 1CRWG 1SAYA 1X14A 3UF0A 5A03A 2ZQYA 1PL6A 3OIFA 4KQWA 1E7SA 4B79A 2DTDA 1VE9A 3D4PA 1B8VA 3RJ5A 1ISHA 4TVOA 1P1KA 4K9DA 3WBFA 3JD3A 4IDDA 1I10A 4EUFA 4AICA 1NQTA 4L4XA 3GNTA 3GFGA 3C1TA 2O23A 3D3EA 1J4AA 5KKCA 4OAQA 1V0JA 4GLLA 1PTJA 3ZWVA 4MVJA 4HX5A 2UDPA 4IINA 4NFSA 1H6DA 1PQPA 4FSHA 5CG1A 5JMWA 1DIAA 1PQUA 1DRUA 2PZMA 2OGUA 4A5OA 5T8KA 2ZB8A 2H63A 2OZPA 4CMGA 1YQDA 3ZV5A 4RVDA 2JFGA 4ROSA 3H9QA 2BKAA 2Q3EA 1E6EA 2I6TA 4FQ8A 3GVPA 1LDGA 1T4BA 1ADCA 1RM0A 3SC6A 4NBVA 1TT7A 4CM4A 5L95A 1CIVA 1AHHA 5KJFA 3RUFA 2RH8A 3STHA 4DWVA 3C7AA 1FDWA 3GNSA 3DO5A 2FPIA 3H9GA 2GCGA 3TF5A 4M1QA 4HNGA 4DLBA 5ES3A 3ETGA 3BMNB 5L7TA 4CQLA 4MP3A 4E5PA 3ZNNA 4E12A 4J16A 3ZWAA 2D1YA 4ONEA 4R1TA 1NFFA 1LDMA 2BH9A 1WAMA 5DCWA 2VCYA 2AW5A 5T6BA 5B12A 4MJLA 3CPSA 2ZJ1A 4CMCA 4BNYA 4RDHA 1JLLA 3WNQA 2O7SA 5DOVA 1Y8QA 3W8EA 3U9LA 1LRKA 1N1GA 5DBIA 4UUOA 3D5TA 5IDXA 3RD5A 1GZ3A 4U6SA 4WEOA 4IGEA 2QQ5A 5TC4A 3WSWA 1GEGA 1NWCA 1DRVA 3VZPA 2HUNA 3CZRA 3PI7A 4WOKA 1KVTA 2EJWA 3BHJA 5ILGA 4EUHA 2GN4A 4OXKA 4XB1A 4YDRA 2C5EA 1SNYA 1FMCA 4D45A 1JVSA 4YXFA 4XDYA 4U0KA 2CVOA 1EK6A 1HZJA 3W1VA 2AQ8A 3AUSA 2Q49A 2GASA 4G2NA 3RI3A 1NVGA 2DQ4A 3TFOA 3F3SA 4DQXA 3F1KA 4NR0A 4G65A 1LDEA 1EQ2A 1CYDA 1LRJA 3EHEA 3JSAA 4PLPA 3OIDA 2HMVA 4L4RA 4TQGA 2BHLA 4DLLA 3GDFA 1XCBA 4ZJUA 3E9NA 4ZRMA 5A5FA 1ZO8A 2JD2A 4L8VA 1RYDA 4PLHA 4FFOA 4RF3A 1YXMA 3QLJA 2Y0DA 4R5MA 5DDIP 2NVUB 3VVBA 4CM1A 4PGFA 1XQ6A 5MGBA 1VC2A 3GFBA 3JV7A 1VPDA 2IYOA 4RF5A 2NADA 2BI8A 2DBRA 1HE2A 2AG5A 4IJUA 1GDHA 3QWAA 2AXQA 2PKQO 2OL4A 4UEOA 2Y1FA 4EI2A 3B6ZA 3O03A 4W82A 4XQEA 4GX5A 4M86A 4EUEA 5L4LA 4NBRA 1TVEA 5G0UA 2J5KA 2HMWA 2W2LD 4I9HA 3W8FA 4YCAA 5JSFA 2EEZA 1ULUA 2WYWA 2HJSA 4LN1A 4A26A 4BNZA 3GGOA 2R6JA 2DUWA 3JCZA 1IPEA 2PR2A 2FPGA 3O8QB 4A2CA 2PGDA 2YY7A 1PQWA 4YA6A 5BQFA 3NJ8A 4IS3A 4D3DA 1SPXA 3IQDB 3KSUA 1Z82A 1ZEMA 2AHRA 4ZD6A 4R9SA 1G0NA 2NWQA 1QSGA 3GH3A 1E1MA 1LRLA 3JYPA 2NU8A 2O2YA 3LF2A 4FBGA 3JQ9A 1GCOA 5DCUA 2C7VA 3DOOA 3EZYA 2Y1OA 2C0CA 4IUYA 1D1TA 5A9RA 4O6VA 2QYTA 2BLLA 5I7EA 4XIJA 1ISFA 4UEJA 3CE6A 3GA0A 3DR3A 2W2LA 3DDNA 3I4CA 2DTEA 3NEPX 4PG4A 1LC0A 4GI2A 1BSVA 2GZ1A 3JQBA 4K28A 3DZIA 5DOZA 3A9WA 4H15A 5JAZA 4FR5A 4MKZA 1HRDA 2EKLA 3BTOA 4NBTA 1TEHA 5T8KC 2Y68A 3PYLA 4FFMA 2GRAA 1BW9B 4WCFA 3Q0EA 4IXTA 1LTHR 1R4NA 4J9VA 3VZQA 4OSOA 1E1NA 5AXDA 3ZV6A 4Q3BA 2B5VA 4B7CA 1GV1A 3M2PA 3DTYA 2WMDA 3G49A 2FZWA 2AQHA 2J3IA 1FF9A 2P68A 4QQRA 4XRRA 2CDBA 3V1UA 4AG3A 4Z9FA 3F4LA 1SZJG 2DFDA 4XWYA 3MJVA 1N5DA 4LVUA 1C1DB 5JE8A 5JDCC 3GAZA 5FI3A 5IDQA 1LDBA 4TRJA 5FFFA 1ADFA 3O9ZA 1TB4A 1F17A 2NVBA 3UOGA 1XDWA 4YQZA 3Q9UA 2X23A 3HUDA 3PZRA 3RC1A 4BNFA 1H6BA 2GF2A 1E3JA 2XPCA 4O63O 1N9GB 5EL0A 1V3TA 5KJCA 1H2HA 2EXXA 2FR0A 3L6DA 1PGPA 2D5AA 2OUIA 3RFTA 2BFOA 3KSDO 2F1KA 4YT4A 4IDGA 2I99A 2P9GA 2X9NA 4KOAA 1KS9A 1JKJA 3LC2O 4ZQEA 4E2XA 2V65A 5GMOA 3AUAA 1R0SA 2JAHA 4LRTB 4N5MA 4CLHA 4R69A 1NNUA 3OJOA 1KC1A 2FHSA 4QFCA 3EYWA 4OXNA 1O6ZA 4D3FA 3PZBA 1Q7BA 3IDSA 4CLXA 4TKLA 5HTOA 4CLDA 4BKQA 5GZ1A 1ARZA 1E6UA 1E3IA 3DL2A 4PZCA 3H5NA 4D43A 1Q0HA 4C7KA 4EJ0A 1EK5A 2GZ2A 3D7LA 4ZRNA 3TWOA 3JYOA 4I5DA 1YBAA 3WSVA 2YDYA 1Z45A 1PJCA 1X1EA 4IJVA 3CTMA 1C3VA 1DFIA 2J3HA 1MGOA 1UAGA 4IIVA 3ZHYA 2G0TA 4YJDA 4HFNA 3ZW9A 4E3ZA 4JROA 4OKNA 3IIEA 2WD7A 1YBMA 4Y6RA 4UAGA 3KYCB 4CMAA 3OIGA 3EZLA 1CERA 5BNIA 4ALMA 4IJWA 1D3AA 1P74A 3H9EO 4ALJA 5TF4A 2NU7A 1IULA 5L7YA 4XYEA 5JY1A 4CMJA 2HSDA 1PWZA 4Y67A 1H5QA 4BO0A 1O95A 4JGBA 7ADHA 1BMDA 1HT0A 2CNBA 3JQAB 3DZBA 4EZBA 3QJ5A 4BNTA 3RFVA 3U4IA 1CQJA 4W9NA 3L07A 4PG6A 1R66A 4Z0TA 4J4TA 3KV3O 3ICPA 4J7XA 1HDRA 1YRLA 1JKFA 3GY0A 4FFRA 5KTKA 1GQ2A 2A35A 2Z95A 1P31A 3GZNB 4HFJA 4YVFA 1KY4A 4JP2A 2YQ4A 3CUKA 3VH3A 2BGMA 2Z5LA 4EBFA 3F47A 1LQUA 3JQ9C 1GYRA 1YS4A 4PLGA 4BO5A 1ZK4A 1D7OA 3NTOA 4J43A 2DPGA 4L75A 2EERA 4OXYA 3BMQA 4P8RA 1ZBQA 1BXGB 5A9SB 3RBZA 4CMIA 1ZFNA 1YVEI 2D2IA 3WYBA 4J7CA 4CM8A 3S2FA 3C24A 3W4KA 3H2SA 1VKNA 3PQFA 3IJPA 3ZWNA 4Z0HO 3JQBC 2CMDA 2OP1A 2H5LA 5EIOA 3QRWA 4QX6A 1XELA 5A04A 5C7IO 1C0IA 3P2YA 4JIGA 1Q0LA 4II2A 4BGUA 4YPOA 2C82A 1MA0A 5B4TA 1HETA 1R4MB 3FHLA 4J9UE 4WCFC 1ADGA 1C0KA 4P38A 2Y66A 4Z9YA 1BRMA 2VOEA 3D3WA 4IQ0A 1Y9EA 4OJNA 4ND3A 1ZK2A 3DAFA 1PZEA 3FNEA 3K31A 1ZVMA 2Y93A 4PLFA 4RORA 3V5NA 3ZU5A 2HK8A 4J90A 1QLJA 3JQ7B 3ROKA 1H0KA 1Q0QA 2IZZA 5IFLA 3RC2A 2DKNA 2W90A 3CKYA 1QG6A 1BDMA 1T2AA 4IMRA 3WTBA 5K6AA 4BO9A 3WGIA 1ZKMA 1E1LA 1ZMTA 1G0OA 4M55A 5A1TA 1YH3A 3H6KA 1T26A 3UCEA 4PLCA 3AI2A 4IDFA 5JW6A 2NTVA 4CMHA 3QVOA 4NH4A 2C2YA 4WE3A 4J4BA 2YV2A 4YJFA 4J0EA 3WLFA 5G0SA 4B8WA 4PN3A 1L7DA 3V1TC 2JHFA 3SLGA 1M66A 1A72A 3V2GA 4I8XA 5L40A 3AM5A 1IZ9A 1IPFA 5F1PA 3ZI0A 4AJOA 4PRKA 1F14A 3U4HA 3IAHA 2H1SA 1R15A 3PJEA 5C3MA 5KJ6A 3DMTA 1KVSA 3NT4A 2B37A 2P91A 3A14A 4ITUA 2Y0EA 2WJPA 5IDWA 1V35A 4XZ3A 5L53A 1R16A 2VWPA 1QYCA 3LT0A 1H94A 4TRMA 1EUCA 4U7WA 4AJIA 3PFFA 1E3EA 1XSEA 2YV1A 4PLYA 1FDTA 1NQ5A 3E18A 4LCJA 3D5QA 1HSOA 3ZWBA 1C14A 1H6CA 1MXFA 5A9TA 1U2DA 1MX3A 3ST7A 1RWBA 1JA9A 4YJGB 1K6XA 4ALNA 5JC1A 1O0SA 5IXSA 1UH5A 3BHMA 2GNAA 1E7YA 4BMSA 3JD0A 4BNJA 1IL0A 1AXGA 4E5NA 3DZFA 4XQ9A 1WWKA 3I83A 5L3ZA 4YBZA 3GUYA 2HMTA 1HTBA 3VTFA 1DC6A 2EW2A 3QVWA 3ZU3A 4E21A 2VZ9A 4PIVA 4EJMA 4M54A 5G4KB 3QV1A 3G17A 3F46A 2WM3A 4FC6A 4CLOB 2Q1TA 1X7HA 4PRLA 1DXYA 3LC1O 2JL1A 1NASA 4O1MA 4LMPA 3IC5A 4Z9XA 4BO6A 2J3JA 5HS6A 1PIWA 4P22A 3A1NA 3VKUA 4W9NC 5DZSA 3UICA 3W6UA 2PGJA 1DOHA 4F46A 5DCYA 3AJRA 3LT2A 5TNXA 5KWEA 4BNXA 3AUTA 4GX1A 2V6BA 4I9UA 3PHIA 2QRLA 4MP6A 4CLEA 4WNIA 9LDTA 1MUUA 3FPLA 2W8ZA 3ZCXA 2C2XA 2X5OA 3VOSA 1P45A 3A28A 4TVBA 4K6CA 4YAIA 3DOJA 2D59A 4FFLA 4QO7A 2VYVD 4D3SA 1M76A 1Y1PA 1IYZA 4XX0A 1ORRA 3WGZA 3MTGA 4BNHA 1GPJA 1SOVA 3K73O 3ETEA 4A7PA 3F6YA 1ISIA 4JJFA 3FR8A 4BOYA 2VRCD 4QSMA 3U09A 2DM6A 5F1KA 4CUKA 5HRUA 1EVIA 3BMCB 1I3LA 3VKVA 4ZU3A 3ABIA 4PFJA 2PD4A 4NNJA 4PVDA 1F06A 2GN8A 4OQZA 3V2UA 1T25A 1WZEA 3JQEA 2VHXA 4XCVA 5EERA 3AY7A 2CD9A 4KDEA 4LRSB 1PJTA 3IL2A 1SB8A
chains in the Genus database with same CATH superfamily
1P4SA 2VHVA 4QVKA 4AKGA 3EPRA 4LK3A 1J25A 2QYOA 1DKUA 3CNOA 1S5PA 4TMVA 1IBMB 2VYVA 2A9RA 2AWNA 3TZLA 4EHLA 1Q11A 1XTBA 4XGQA 2PWBA 2ZWVA 3UY4A 8OHMA 3ZVMA 3RTGA 3L7AA 4YCDA 2IIVA 1ODFA 2F64A 2R1TB 3JPYA 4R54A 1S8FA 1PYDA 4BMXA 1UM9B 3RAPR 1TK9A 3RFFA 4F4DA 3SGLA 1H3EA 1FDVA 1HE5A 2XTZA 1GFSA 3EVEA 1NOKA 3KOYA 4H0FA 4BLOA 1GPBA 5FPHA 4MRMB 5BPFA 1SHZA 4TZ0A 4LOHA 4OI2A 4EDHA 5AVJA 2FQQA 4FYMA 4YO8A 1J39A 1HDOA 4F3RA 4F8EA 4ZAWA 4O4LA 1UOEA 2G63A 5J63A 4B48A 4D81A 4ESEA 2X1HA 3SSOA 1X0VA 1WCIA 1RJWA 1UK8A 3G9QA 4N5DA 4RPKA 3LPDA 2RG7A 2ZTHA 4Z0NA 4ZV4A 1QHIA 1IVYA 1MA3A 1P4JA 4B0OA 5BRAA 2NSYA 4MUAA 4RA9B 3ESCA 3IILA 3VR0A 1G1AA 1YJBA 1A4IA 5BR1A 5FI1B 3D9QX 1QF9A 3TEMA 1E2QA 2QLFA 3I0NA 2HMUA 2X41A 2YHIB 4QGFA 4BO2A 1NVKA 1EUDB 1GGNA 1TQ6A 1U1GA 1JRLA 1I3OA 2VJBA 3SEFA 4QDOA 1HXHA 1WUHS 3UJ9A 1U0JA 1ITZA 2FPPA 1L7MA 1N5RA 2IUEA 5AHWA 1MIHA 3SD7A 2DHRA 3WOVA 1J0DA 1LBEA 2WWIA 3DMTC 3QTLA 2AF4C 3TIGA 2OZLB 3OX2A 1JFRA 4DREA 2FOXA 4EI9A 1FZTA 4GC9A 1EX1A 4OHBA 4ZARA 3ZCPA 5B6PA 1R0KA 5AW8A 3F8TA 3BD6A 2QLJA 3DJFA 3CR7A 3OPYI 4TTSA 4OJTA 4M21A 2Q7OE 3DLCA 4B7UA 4JWKA 4JBNA 4K88A 5B36A 1XU4A 4IPTA 4IIHA 2GXUA 2ZVQX 3AEKB 3A6JA 3L0YA 4DM4A 3FFWA 2F9LA 3H2KA 4OTZA 3OIUA 3E6AA 3KZXA 3MC1A 2XZTA 5C32A 3R9XB 4ZP1A 3SBXA 5EJ7A 2AEFA 3CXRA 5IBCA 3P7MA 1E6KA 1CX9B 4Z2YA 3WBKA 5KVCA 5LSAA 2UZ4A 1KEVA 3R1IA 3K96A 1JYSA 2VT2A 1KQNA 1DC4A 2QUBA 2TS1A 4X64B 1JNXX 1P1IA 2V9PA 4K6FA 5LYJB 1BXKA 4X24A 1H2FA 1DHTA 1ID1A 1KI6A 3K2QA 3T7DA 4ZO6A 2HHCA 3TUZC 1XKTA 3CSSA 3OQJA 4MWCA 1H1LA 2O48X 3A4NA 4ZYWA 1Z8NA 4S12A 1RC0A 5DI3B 2JIBA 1NNLA 1UC8A 1YVRA 3L0IB 4M8KA 2EJUA 4HDOB 4MR8A 1NYLA 3GAMA 4I2NA 3ZH2A 1QVRA 3U4GA 4BY9E 2A1TR 2YHUA 1JKMA 3CKMA 5EI5A 4FYWA 4RPIA 3BIWA 2HU2A 1ZKDA 2BM1A 2A9PA 2YYAA 3T35A 2QD3A 3DDWA 3RCBA 1E94E 3A1CA 2PT7A 3UVEA 5SYAA 4BQIA 1QG0A 1SZPA 4OXQA 2AKEA 1PJBA 3KHTA 1W30A 3LHKA 3LYHA 2FSSA 3FUTA 3K0FB 5CYPA 5AKEA 2BFMA 5K8TA 2GOYA 3L8EA 1NOJA 4GOOD 1GGVA 3M1AA 1GPWB 5HCUA 1U94A 3IXQA 1W76A 2FCAA 2WU8A 4XJXA 1Z5GA 3RUPA 4F1WA 1H1DA 1JKXA 3B85A 2Q9UA 5BRNA 1ZHHA 1OWMA 2QZPA 4ZJZA 4BXOB 4FCVA 2PZFA 1BMTA 4IICA 1IZZA 4X92A 4W7HA 5KTSA 4GW3A 3LCCA 5I9IA 2DT8A 1OX6A 2YMMA 2AE2A 1GN9A 5COAA 2AXPA 3O8OB 4WUVA 5DM0A 1FEZA 1RYHA 3FDIA 4YJHA 1BKSB 1Y42X 3EIWA 1SWVA 4JX8A 3OZBA 2O3UA 3N2LA 1MEEA 1P7ZA 1YS7A 2ZGVA 4DCUA 3R4VA 2IF2A 3FWNA 1RIIA 1S8OA 4R1LA 2BISA 4N12A 4NL4H 2YMQA 5IAGA 3KZCA 4JLWA 4P3PA 1EYZA 3DR5A 2G70A 3EAFA 5L6MB 3KOUA 3D0QA 5FI5A 2VP2A 4JI6B 1PFVA 3TW6A 3NVKI 1GAQA 2OD9A 2ZYRA 5DYGA 4XIYA 2OYCA 2RGEA 3Q7EA 4QXOA 2DJIA 5KTNA 4TL7A 1MGPA 1T1IA 1W52X 1EVZA 3RTAA 1GGJA 2QROA 2PJUA 3GMDA 3ORYA 1E58A 4OBWA 1MC1A 2QV0A 1VIDA 1X7ZB 3GEEA 4JYBA 4OHUA 1SUCA 3IHWA 4B7XA 1CVIA 5JS7A 5CIYA 4LF5B 3AL0C 1T8TA 4S1PA 4BVFA 1L7RA 2QI9F 3L01A 3OLZA 2DTXA 1QK3A 1IHDA 4ER6A 2QE6A 3IAFA 1I2DA 4YRRA 2J7PD 1ZGAA 4PO3X 4FCCA 4ROTA 3SXUB 4LVCA 4K9MA 1DCFA 3SJUA 4ZHQB 3DQZA 2OXIA 2HGZA 1EDBA 2O1EA 5K0LA 1XU9A 3TN7A 2XITA 1I4DD 2BEKA 5LQCA 1ZHOA 1WUKS 2DR0A 2NACA 3FMFA 2XOKD 4Q3CA 1XWWA 5CYFA 1Y63A 1HFEL 3GG2A 9GPBA 1XQ9A 3O31A 4EMUA 3ND7A 1NDQA 1UBNA 4E6EA 1V16B 4FDAA 3K2BA 3G8AA 3MZ0A 2WJIA 1OT5A 5TPZD 1OI7A 4KKXB 1OC4A 3UENA 4B85A 3EQ7A 1KYWA 1QLHA 2XDQA 3NUGA 3P0HA 4IDQA 1KJQA 2JLZA 3KVYA 5C8XA 2BUAA 5HE8A 2QPOA 1LK0A 2Y1KA 4MRRA 4OHXA 5H5JA 1VG0B 4JXZA 3HV0A 4MWEA 2HAEA 4KIWA 3QA9A 4IIJF 2V7EA 3IP3A 1OGJA 1P2VA 3TTUA 5M5BA 2J7PA 2ZU6A 4Q16A 3QKRA 2WZBA 5K45A 4N6OA 2GBLA 4KIUA 1SKQA 1GUYA 3KDAA 1IJEA 5GVSA 2M32A 3L1KA 2QTWB 5T57A 1TVCA 4NICA 3QPDA 2XOKA 3TMKA 3TTWA 1NFRA 4QE3A 3HKCA 1PT9A 4J07A 2H8KA 4Y2HA 1KXZA 3IHTA 2HSJA 2QUIA 3NDPA 2JCVA 3B38A 4QTZA 4HR7A 1BD4A 2C3YA 3JY6A 5TPZA 3H2ZA 2VP3A 2D4HA 3D7KA 1FMFA 4UHBA 2GSWA 2NXEA 5EQTA 3UMSA 5KVQA 1PKXA 2Z1DA 3ZWPA 4KR0A 2QBYB 4NDNE 2IZ0A 4IIGA 5K0NA 4OYHA 3LZ6A 3B70A 1II0A 1ZL0A 1MC5A 3D4LA 1DFGA 1M34A 3GLHB 1OI3A 5EHIA 2B7BA 2CHGA 4IP0A 4DIDA 1XYVA 3SQXA 1QS0A 4UBIA 4J0GA 2G28A 3OM8A 3UNXA 1ENPA 1G2OA 4REQB 1R4NB 2PD3A 5G1NA 3RTBA 1FE8A 3T06B 1HEYA 1QYDA 3K7EA 2E82A 4XB6B 3UQYS 1YJAA 4G0NA 1TJ3A 1FFYA 4ZMRA 1Y9AA 4YAGA 3IQXA 1CUYA 3GJ8A 4GE0A 1U9JA 1OAOA 1OUMA 3TLGB 5BXQC 4HDMA 2QLTA 4LJSA 9ATCA 2G04A 4V39A 4UJ3A 1CJBA 3T15A 2RSLA 1Z7WA 2UZ1A 4O2BF 4DLNA 3FGPA 5KTRA 5TJ9A 5GZ6A 2H2WA 1MJHA 1VGRA 2A9JA 1MPXA 2IP4A 1IHYA 5GPBA 1GUZA 4Q4HA 2R6R1 1CQZA 5ARBA 2I6XA 3VVLA 3WLIA 3UK6A 4EA8A 3NV9A 1B15A 1Q1GA 2V9ZA 3EK2A 3M9WA 4XDHA 5H3LA 1Z4OA 2HXSA 4G36A 3ZKWB 4N8DA 3C98A 4L5CA 3QJYA 4GX0A 3HJUA 2JKZA 1A4RA 4CKWA 3RKUA 2ZRMA 3H11B 3M6XA 3BFJA 3IKLA 4IIJA 4RSMA 3WLAA 4DYDA 2O20A 1P0MA 4M36A 4IVPA 3WGTA 2UUAB 4RLHA 4PYMA 3ZDRA 2I65A 1EI9A 1FP4A 2PX0A 5FWAA 5HG0A 1QTQA 2XHZA 4L50A 5IJ0B 1NVXQ 1U7ZA 1XVLA 3RE1A 3RRBA 3UCXA 3QE0A 3EUWA 1RKUA 1Z5NA 3BRWD 4DIOA 4N41A 1DAHA 5A3SA 5I8WA 1NRWA 4TL8A 1AURA 4Q1AA 4A0SA 2AFHA 2PRJA 3FRJA 1GT6A 3VDRA 3ZDEA 1RJDA 3NCTA 1IN4A 1YS6A 4Q1VA 1QCCA 2PA0A 4GVLA 2Q9CA 1IMJA 1HYQA 1CF2O 4Y8VA 3DHNA 2VT6A 3X43A 2UYYA 3B3FA 5TS3A 2Y6UA 3GLIE 3THYA 1NDHA 4BCBA 1E3WA 3STVA 1LV8A 4DEXA 4L8WB 5DIZA 1TJPB 3VR3A 2Y67A 2Q9BA 5HXAA 4K7JA 5LD2C 5ELXA 4YIHA 3VHXB 4N01A 1LJ8A 3OCZA 1E6MA 1V39A 4HYTA 5DXAA 5ERGB 1Y6GA 1D8AA 5J58A 1JDBC 2HRRA 3C6BA 2B1IA 3D2CA 3LS2A 2YRFA 3I8XA 1OX5A 3F4BA 3TZHA 2R7NA 1XZQA 4E5MA 4GSKA 2QPTA 3IQFA 3UC5A 3BRWA 3FSRA 2R6AA 5IMBA 2FW9A 3DYBA 2YFYA 2HT1A 2KX7A 1NPDA 4JK3A 3B7GA 3UJCA 4HAWA 221PA 3FIJA 4D8WA 1BW9A 3A6DA 1ZD4A 3HV2A 1SCJA 2OHHA 5AVYA 2O8CB 2XZLA 5AJWA 2Q2VA 2X4IA 5KHAA 2XKBA 4LHXA 1TI7A 4O2BA 3KBBA 3PF9A 2XJ4A 4R83A 2GZRA 3L0ZA 1JIIA 1LX6A 1TU4A 1ZW6A 4BP1A 5F1YA 5HQJA 2YBDA 3E0QA 4JV5B 3QVGB 3RADC 1BVHA 3I1YA 3ZDCA 4OH7A 1QRUA 4QYIB 3AKYA 1HT3A 1JQBA 1Q0PA 1KKLA 1G55A 1JAIA 1VI5A 2AKAB 4FOOA 4IX1A 3OZTA 4X6XA 4B8ZA 5LBIA 4W1PA 4ENSA 1NU6A 4L7VA 5HIKA 1NYTA 2DFLA 1SG0A 2P7IA 1KL7A 3D7MA 3RV3A 3EXG2 4RFVA 5BMOA 5DWVA 1O58A 1FXSA 5JDIA 4P0QB 4EJFA 4RK4A 2OCYC 2XMRA 3HFJA 5AP9A 5C2JB 4MV9A 1E6LA 3FZQA 2OQIA 4J1NA 4LCEA 1JQEA 2UV8A 5KOIA 4HDQB 1C2YA 3AERB 4CIAA 1PVOA 1YUNA 1HOXA 4MPPA 1E62A 4NOMA 1BVRA 5IK2A 1ZI9A 2IGBA 2LCQA 3V4LA 4BBZA 4AULA 3C5CA 2YIVX 2IZOA 3Q3HA 2YZKA 2NG1A 2MMCA 3EDOA 4LE1A 5DGIA 4J0CA 5F2KA 3T38A 4G6ZA 4DCVA 3WGOA 5GIPE 1U2EA 3VU9A 3G0CA 2Q1UA 1E2GA 1BE0A 2CXUA 4HFMA 4I55F 4IDNA 4IQGA 4K3UA 4YGYA 4FFWA 1NGSA 2KB0A 1KNXA 2JFXA 5AOBA 5GTDA 3H8JA 1N33B 1KBZA 1OA0A 4LMBA 4W7SA 5CTJA 1H2EA 4RHYA 2C9BA 4E3ZA 2ZVPX 1P18A 2B7CA 4N0MA 4RBNA 2AK2A 2XGGA 3LUFA 2PZLA 3TEFA 4EQ6A 3OH8A 4IXWA 2VQ6A 2Z4SA 4OOFA 4YMSA 4O2AB 3LH5A 4Y2QA 4KAJA 1RHRA 2BFWA 1TFUA 3L8YA 4MO9A 4BNLA 2A92A 4YQYA 3E9MA 1X1AA 2DC1A 1M5TA 4UJ5A 3RUDA 5KEIA 1KAGA 1IY0A 2VHUA 4JU8A 2G17A 4KZKA 1AVTA 2I1VB 2HH9A 5D1HA 5CDUA 4DDHA 4XJTA 4N5HX 2WTNA 3C3PA 5CT8A 1D1SA 1Z0FA 3CX6A 3TBFA 5BVHA 3CINA 3GRVA 2V45A 2JBAB 1LDNA 4JL8A 1V37A 4WESA 2OSBA 1I3NA 1XEWX 3D02A 3HUUA 2EKQA 3FUWA 1P7VA 4K6GA 2C8JA 1R9NA 2P3SA 4MWGA 4TTPA 2PUVA 4F3KA 1OXMA 2AG0A 3ZIDA 5CVTA 3E5RA 3KWJA 5EXTA 4OQEA 2EJBA 2YQ5A 4EY4A 4MUKA 1Y89A 4CKZA 1JFTA 3VPGA 3K4HA 4JQOA 1KO4A 2YZGA 5HIAA 4G5HA 1GV0A 4NZMA 1JYFA 3BFVA 3N8GA 3VOBA 1KIMA 5LIRA 1A5BB 1Y6ZA 1H2BA 3L0PA 4P82A 5SV2A 1IOLA 1DDOA 2IY7A 1SELA 2GWRA 1NF8A 4UFNA 3BWMA 2CB0A 1DG1G 2WRZA 4HQOA 5GV8A 4DLSA 3WGJA 4BMOB 3U1BA 1VKHA 1XRNA 3H5OA 2HUPA 5T64A 5KOJA 2W93A 3LUCA 3HY6A 3WLPA 1I8TA 2WPDD 5KQSA 2OVBA 3KSRA 3C2QA 2GCEA 3C3AA 3IMGA 1ECJA 4KXXA 2QTNA 3KWMA 1RM5A 4Z4QA 1QYXA 3CJTA 3TCNA 4GKVA 3ADPA 4MMXB 4WXMA 3OD1A 3G1TA 2AYXA 1QUEA 4FINA 2C3OA 4IH1A 3PGMA 4ND2A 4I55A 1JG3A 4Z49A 4G4SP 1CF4A 2ZB4A 1FX0B 3KYBA 1CT9A 3OLVA 3DHVA 5KTOA 3L4BA 1K2VN 2GLUA 2FSPA 2NVWA 2JGAA 1SU7A 3BZBA 3AX6A 3CCFA 3T3EA 4HXGA 1W0KA 2QSZA 3CYFA 3D4IA 3FLBA 3IA2A 4M0LA 4PZYA 4YALA 2PXXA 5DHUA 4BUZA 1ZM9A 1T2FA 1DPFA 1JG1A 1RXSA 4EB6B 1JFFA 4O4HF 3FDJA 2JGNA 3GRZA 3GIDA 4HGPA 2WPDA 3ENQA 3L7KA 3QEJA 1ZUNB 3D31A 3F7MA 3IP1A 3UHPA 2R1VA 3HO8A 4D2IA 3HGTA 1SBIA 1EVQA 1H9AA 1T91A 3PHJA 1YOVB 3HFRA 4R8KA 3TOZA 2QRHA 2X0RA 4QFBA 4BLUA 3LRXA 1UPCA 2H4JA 3E81A 4FT2A 2OILA 1G6Q1 4FUQA 2H51A 3OJLA 2AB0A 1TKBA 1X8LA 1YKGA 4JT4A 4MMYB 1Y1TA 2WAOA 3BE6A 2F8MA 5KJEA 3TRFA 1ZA2A 1DEOA 4E1VA 2W70A 1X70A 1FS5A 1W4RA 2CZCA 4Y6PA 5JS2A 3ZBTA 4EJSA 4KXQA 3EPLA 3CX4A 1QH9A 3R41A 4H16A 3GPDG 3C5EA 4GIBA 2ZUTA 2J0SA 1KO7A 3ZQKA 2DPXA 4DV7B 3HDHA 3E3NA 5BRJA 1GFWA 3H19A 3ZD8A 2Q5JA 4EBBA 2YVQA 4EFNA 2EHJA 3B6IA 4F2GA 1CS0B 1YCFA 1I1HA 2X9VA 4YMTA 3W9BA 5BMVB 2IT1A 4LF8B 2O7RA 4MRSA 3NIWA 3PXEA 3A2MA 4NECA 5K3FA 3RUEA 4DYVA 2WMNB 3RSFA 5CVEA 4F21A 1FS6A 5JY6A 4GF5A 4F3TA 4IMPA 3HPRA 1E3SA 1HPLA 1PGJA 1XA4A 3O3NB 5D7BA 3R5HA 3P20A 1JJIA 1RKQA 4TSRA 3K6SB 2CV2A 1WU7A 4B35A 4AVYA 2OBLA 1KMNA 1CUAA 4HDKA 2Q2WA 4REOA 3SVTA 4U7DA 3KVVA 3C48A 4R8LA 4O5AA 5U9CA 1JAZA 2OWEA 4DR7B 3ZYZA 3H1EA 3KL2A 2PLNA 5JO0A 1J23A 4IEFB 1HMPA 1T4MA 1GRQA 1K0UA 5EP4A 1Z0JA 1FFBA 3MMXA 3IKTA 1N8TA 2AYYA 2JLQA 2RJ3A 3AOGA 4BO8A 4XX0B 2JCBA 3N3BC 1SUIA 4UBMA 4CG3A 5DBFA 3BA1A 4F38A 1CW2B 4TTTS 5CCEA 2HPAA 1EFRD 4LJ7A 3SEZA 1ECBA 2A78A 4PSAA 4MRPA 2IITA 1L4KA 3I6ZA 4D5GA 3R74A 1ZGHA 5BR7A 2H5JA 4O4HA 1YR8A 4IRMA 4TQ9A 2VG8A 1NMZA 1ZW1A 3KYJB 5DLQC 5DO9A 2QR2A 4YAUA 3CEPB 3PV0A 1AQJA 3SZLA 1Y82A 1YFZA 1KK1A 1MN6A 3EBOA 4ZC8A 4UE2A 3K70D 4I6EA 4NOKA 3CQ9A 1GXSA 1ZZEA 3HWSA 2AZMA 4LK2A 1GA1A 1MDBA 1I4WA 4IIDA 3C43A 1KFCB 2ZCUA 1JIUA 1GR0A 1N2BA 2JJYA 3FWHA 5JO9A 1GWNA 3HA3A 1G21B 1J0EA 4LA4A 2W6OA 4Q01A 3W1EA 2UUCB 5FTJA 3H1TA 1WZCA 1YAHA 2XDYA 3OF2A 4M0DA 2C2ZA 4JMPA 4R1OA 3PBKA 2UYGA 4LMRA 5C53B 4AJ4A 1EFRA 2BGLA 2ROQA 3GR6A 4EJ2A 3GJQA 2ISSD 2P27A 3QP9A 2SKDA 1PR6A 2LKCA 1DQRA 1GIAA 4U2GA 5TQJA 1XRRA 4KUGA 2GUGA 2RI6A 3S7TA 4WKOA 1R0YA 1TAQA 2HRCA 3ER9A 3G6WA 3MWFA 4CR8A 4DY4A 4EG6A 2FZ4A 3BJIC 5CVVA 4CRWB 3IOCA 3Q9NA 2JLAA 4TWJA 5KHOC 2OCPA 4ZAZA 2E6KA 3A9CA 3QMWA 1P1JA 4E2YA 4MRNA 3EMDA 5ENVA 2EBHX 2W11A 1PLKA 2WG1A 1S9HA 2GRUA 2CFOA 3DOIA 5I9BA 4M0EA 3TIXB 5FFMA 3SIPA 3PVCA 3CIOA 4ZIRB 5JHHB 1HG1A 4IIFA 1JDZA 3T4XA 3VDNB 3RIMA 4OI4A 3CNBA 2H7CA 1QH8A 1Y1KE 4UHDA 3T9EA 2YV3A 5D1NA 3VPXA 1I01A 3W06A 3W5JA 4UM7A 2HK6A 5EINA 3NTQA 2PJDA 2PMBA 4OMUA 3BXZA 4OM8A 1TM7E 1AE1A 4GR9A 2BELA 4D46A 1PQYA 1BDJA 3DZCA 1D0VA 3PDHA 2TMKA 1YFLA 1B14A 3IAM1 1EX6A 3KHKA 4BBPA 3FUCA 3R4CA 4MDFA 4ODIA 5BT9A 4B2IA 1Q1AA 3MJCA 1UKZA 2L69A 1II8B 2BGKA 4QG7A 3VA7A 1TQHA 3ICQB 4EVIA 4UCQA 3WC4A 4C1NA 3EQ2A 4GUDA 1ADBA 1DNPA 4YDSA 2DYKA 1YS9A 3OT1A 1QAOA 3OZCA 4HN2A 5KSPA 3AM1A 2WJ3A 4UBKA 4DY6A 1QFZA 5BUZA 4HUJA 2XA2A 3L8GA 4R6WA 1EAMA 3O4JA 5EXDA 4B3MB 5ECWA 5DHRA 1KJZA 3SG0A 3DHYA 3RIGA 1RPNA 1A50B 2GBFA 3WLSA 1UKCA 4BGVA 3Q8XB 4WK0B 1IB0A 3U3OA 3RS4A 2XCOA 2IYXA 4EL5A 1JWLA 3KM0A 1KZ4A 4WH0A 2IS4A 3SF8B 5K4GA 3FMPB 4MHOA 3W9YA 4A10A 3UCFA 4X62B 2O8EB 4M8NE 1M6NA 1EB9A 4J2OA 4HLUA 5AVKA 3L8MA 4JXJA 3BKWA 5T4HA 3NHSA 1ENOA 4LPSA 3R40A 1OOEA 2FI1A 2X4LA 5EJGA 1ZMXA 3KWFA 3K1AA 4BFWA 4YQFA 4Z1MD 1FRVA 1S0UA 4GRIA 4MGHA 5IPFA 4C14A 3JQGA 4BE7B 3DEIA 4TSFD 3TUIC 4C7XA 4JLDA 1BDBA 5AOCA 4KE9A 2BUBA 3F5MA 3BZWA 4FFPA 1R4ZA 3AM4A 2R84A 4B6FA 4IV8A 4JOCA 5D3KA 5G0WA 4A6DA 4EOGA 3COWA 2JI7A 3E5MA 3LLVA 1JR6A 3WVNA 4DMUB 4ZN6A 1NI4B 2PPLA 3PHHA 1Z56C 2KWIA 5DHPA 1XE3A 3INRA 4O08A 3MMNA 3PEYA 3V6MA 3C6XA 3V9PA 2P6UA 1W88A 4F93B 2VPWA 3CO0S 4NXNB 3I62A 4IDEA 3FG9A 2J5BA 4PZDA 4X8HA 3SXJA 2BUCA 4ZYUA 4M98A 1SQ5A 1OXTA 3ELUA 3TL3A 1N2CA 4IFTA 5E2IA 4ABTA 3D4BA 4RPHA 4Z1MA 1WQ4A 5DRTA 5SZHB 1Z7YA 1MX5A 2IVFA 3JRWA 1K63A 1IY1A 1P0QA 3L92A 3DLAA 2HRZA 2ILTA 3NYRA 1TYZA 4TSFA 3T41A 5C8YF 1JVBA 1CDOA 4PHCA 1DKNA 4MIYA 1SXPA 3TS1A 3I2KA 1MQ8B 1PL7A 4GGOA 1RSZA 4ZOEA 3TG8A 4GOMD 3PLNA 5BY2A 4Y3UA 4HNAA 1FVFA 1ZI6A 1WG8A 3D54D 3I1JA 2ZE7A 1J20A 2W2KA 1OT3A 4YT8A 3DMRA 4S1VA 4J3FA 4ARIA 3BXPA 3E9EA 2PTHA 4KE7A 3UA4A 2A3NA 2ANBA 5FTMA 4X1OA 3E53A 1WD5A 3QPAA 5LD2B 4YP0A 2O57A 2H2FA 1V41E 1YQWA 4B3IA 2O14A 1HKUA 1JXQA 2B2XA 3P19A 1PR5A 1JDBB 2BEUA 4R1SA 1C29B 2PEZA 3MTJA 4GWKA 6CHYA 1C1XB 4HPWA 1BHQ1 3IPYA 4OMFG 3WHLA 3PKJA 4NK5A 3EVTA 3K92A 5IBRA 3VPAA 3L6UA 1GSHA 1X13A 3IQEA 3MPUA 1W59A 1EM8A 1YS1X 3WGVA 4CI9A 7AT1A 3SJCA 4LY0A 1UBLS 3Q98A 3R77A 1OLUA 4NE7A 2EJVA 3BF8A 5DLPA 4ZI7B 3EVZA 3MPOA 3PXCX 4QVIA 3MXTA 1D7AA 2RK6A 3ANMA 1T6BY 3ILXA 3M6IA 2XJ9A 3M6MD 4MV4A 2CXTA 2YS6A 3Q6NA 1JDSA 1KEWA 1W5AA 4PYOA 4UMDA 1RWKA 4MQUA 4LYDA 1B2LA 2IOFK 5K4HA 3WMGA 5FULA 1G8GA 1TYEB 4IEIA 4QGBA 4OHZA 1E1RD 2HSWA 1X1TA 4MKFA 5CNIA 2X2FA 2AMJA 2FLWA 1UFRA 1DUVG 1DL5A 2H7YA 4ZVNA 4LC1A 4HT3B 1FDUA 2DE0X 1DTWA 3T0FA 4PV7A 2ZDHA 3KT8A 2QRQA 4J03A 4HGNA 1XQ1A 3OUTA 3IXMA 5DTEA 4H0NA 3ZCUA 4E15A 1UMDA 1A9ZA 1C3XA 1BAPA 1CLUA 2C9OA 2PVCA 4QUIA 1L5KA 2BGUA 4B82A 3IJRA 1V7PC 1NIPA 1AGPA 4JB2A 4C0QC 2GSDA 5C8YA 4ZQIA 1R6UA 1GNSA 1YRBA 3OMWA 5I7FA 5KVVA 5LVAA 4RVUA 2ZBFA 4XQCA 3HYTA 5I01A 1A7AA 2EKBA 4HN9A 2IH4A 2NUAA 3A9SA 3O6VA 3JZAA 3RC8A 2GVZC 3HI4A 1GRRA 2FV8A 4N3AA 1E1RA 4FGSA 1A0OA 4K9OA 4EW3A 2NZUG 1CJUC 1N5LA 3E9CA 5F21A 4QQFA 4CBVA 1ZSVA 2SECE 4C4OA 1FRNA 5IS2A 4KMOA 2ODPA 3D4NA 2BKXA 4JLPA 2H48A 2QE7D 3OBIA 3GLQA 1A27A 2QGZA 1AUPA 3RYIA 2OCLA 3ZTYA 2DBQA 3RUCA 3TO5A 3WRYA 1BEEA 1D2RA 5EJEA 1LPOA 4JIMA 3L1HA 3Q1KA 1CHNA 2JGFA 3DA8A 1NVVR 1X7DA 3DKVA 2EYUA 2X8LA 5AUOB 5K8VA 2GHIA 3C7DB 3DWEX 3ED5A 2HTEA 3F9IA 3HYRA 5F51A 1THTA 1T9HA 4DUPA 3KZVA 4U6NA 4LKRA 4KGXA 4PX9A 2P9CA 2GR9A 3N0VA 4LZOA 4V1CA 3K8ZA 4KMMA 3PWKA 4ND1A 1M7HA 2IYWA 3AF2A 3WNDA 2XXJA 2IZ5A 1EFLA 2B0JA 1Y81A 3TW4A 2XW6A 4L5JA 5D5QA 4MVYA 4JY7A 3WB9A 3ZY4A 1T3GA 1GAEO 1P2TA 4YS6A 5HRCA 4MQ6A 4UMEA 1SCDA 2QE7A 1CP2A 2H2IA 4G8JA 6LDHA 5FOVA 1UODA 1BKDR 3P2OA 2V8OA 4EB0A 4RGBA 4JAVC 1S1CA 1X9GA 1VE6A 1CPYA 1GHTA 1HWYA 3KQLA 2ZYAA 4YAKA 3QVSA 1AO3A 3CO5A 5A62A 3R7SA 4PPNA 1C7JA 4ND6A 3BEDA 4DNPA 2FZ5A 4P4SA 2NPOA 2YOHA 1X7XA 3NGLA 3T1NA 2F8TA 3PD7A 3TNJA 3AT1A 4AZ0A 2GDZA 3P4XA 4EZIA 1V45E 2FWMX 3LC7O 4B81A 4AKIA 1NUSA 3CMCO 3H8WA 3CY6A 2VR1A 1ODIA 3L0SA 4KGDA 1S6YA 4YAEA 5JSQA 4CXMA 3I9NA 1V71A 1K3FA 2YVAA 4S1NA 5HGJA 3CGGA 2O2XA 5DVZA 1FYEA 3Q8MA 1L5HB 3KAPA 3Q12A 2BM9A 1QIKA 2Q8NA 2JIMA 2WA1A 2V58A 1KP2A 3NC1C 1C7EA 3PSHA 5BR8B 2PGXA 1I14A 3D6AA 4ZHSA 2XUDA 1Z5ZA 2D3TA 4XLZA 3SYKA 1YNSA 4XUDA 2BFPA 1U65A 1Y4UA 3ZCTA 2EL7A 2P40A 2ZI7A 1O4WA 3IVGA 1HZZA 3B3AA 4FGUA 5IDYA 4TKVB 2J08A 3G5TA 1J8FA 1EIWA 4ZOCA 1EA5A 3LSYA 4XM1A 5JCOC 2PD6A 4XGNA 1MENA 3QSGA 1MIOA 5BYBA 2WI8A 4MGYR 4RKYA 3O95A 2PT9A 2X0IA 1Q91A 2F3TA 3G13A 3GFVA 1CV2A 2G9NA 4IXMA 1XTSA 3FNQA 3SJBA 2JAUA 1VLLA 1GCIA 2JI9A 2VRWA 3DGEC 3F96A 4W5JA 1X9HA 2B4RO 5JV5A 4R1MA 5LFAA 1ESDA 1VKOA 2WJGA 2FSIA 3BCRA 4R3NA 2QUKA 2XRFA 4RQUA 1FYFA 4BL5A 1TJ4A 5G0UA 1I80A 1OMOA 4P3OA 2HBQA 4KXWA 4DBZA 2I62A 4KPEC 1YJCA 2VEDA 1XJ5A 1VA5A 1T36B 3L02A 4J91A 1TECE 1MO2A 2X8WA 2ASVA 3NKLA 4U02A 4KQGA 3TJMA 1EP3B 1K66A 4HAVA 4JGGA 5BNFA 5FLXA 1G42A 2AUMA 1S2MA 4R2JA 3PJRA 4D8VA 2BP7A 2HMYB 3FAKA 2QTTA 5ILQA 4EHBA 1S8NA 5CB8A 3S1SA 3ZDYB 2VDUE 1GGFA 3LFUA 1DJQA 1KY3A 1TZKA 2F6RA 2ATXA 4BV9A 1OZHA 2H4YA 4M6WB 4JNKA 3K4PA 1AKUA 4AAYA 2F9MA 5BNZA 2XXAA 2RHMA 3MWDB 1JSLA 1NTRA 2OSVA 1XPUA 3VNUA 1W73A 3RLFA 1WXIA 5B4VA 1R9MA 1A9YA 2GETA 2JAPA 4IJ6A 4OHMA 5B3LA 4TZTA 4EKIA 3CLSD 4HJXA 4N7BA 4TRRA 4BNKA 2PL1A 4NZYA 3T7EA 2GN9A 2XUHA 5LQDA 2VUSA 2ET6A 2A0XA 1PYOA 3WZMA 1Y6RA 1JAXA 2HPVA 1JB9A 3KE9A 5TEWA 2AFRA 4K0KB 2ZIUB 2VHQA 3LPCA 3SR3A 2G4LA 1ZVVA 1W4ZA 3H17A 3L6EA 5ALWA 1CDZA 5IKEA 3OO1A 3KD3A 3OJ0A 1R9JA 1KOLA 3BTSA 4ER5A 2YRWA 7GPBA 1SCUA 4X7RA 2XT6A 5G40A 2H5IA 2R62A 5IDVA 3H9UA 3T3HA 5FNVB 2A1UA 2G40A 3CKLA 4QHSA 4LRWA 3JYHA 3WE7A 4GDFA 3JQ8B 3PYXA 5FQOA 4XIFA 1O6FA 3DAGA 2JVJA 4N8EA 1Y8ZA 1ZIPA 1DT3A 1PK7A 4BLWA 4I14A 1EBFA 3BD7A 3FWZA 1K97A 2C0QA 5HIIA 4KVGA 4HUTA 4G4IA 1QIDA 1KDPA 1MX1A 2OM2A 3PUWA 1K88A 1SUAA 1QIHA 2Q07A 5BQ3A 3RC9A 2QTVB 1W4BA 1UXKA 4KLNA 4RZQA 1RZUA 2OXRA 2RHWA 3ICVA 1A2BA 5AKIA 3SZ3A 4V0OA 4G0MA 2CMFA 4FYVA 2ZWOA 3E2PA 1UKAA 4TPKA 4YRLA 2XKKA 4NX2A 2Q8PA 2HO5A 4G4GA 1N9GA 3GPBA 2JKVA 3AJAA 4XR4A 5LBUA 2CMKA 3RYCB 2C03A 5EHGA 3MIZA 4DIBA 2AZXA 2ZYDA 1QZ3A 4U1RA 5JNWA 1DJMA 4UASA 3C6MA 4FMPA 5JNSA 3F7NA 4PC3A 5FWDA 4DC9A 5CDYA 1RJFA 1PFQA 2ZS8A 1FLDA 2E5FA 4NQRA 5EY5B 1L5FA 2B3DA 4UTVA 2E6UX 3PT9A 4GMFA 5ITZB 1VA4A 3CXUA 2XNSA 1RYMA 4C0BA 2YW2A 1DS6A 3HDYA 2I7CA 3IAS6 5DTIA 3FETA 3KLMX 3MCTA 3N87A 4Z4FA 3ABQB 3PNMA 1AU9A 3R7FA 3HH8A 5EKXA 3OECA 1Y0BA 3GRPA 1FU8A 2C5LA 3C45A 1WW8A 3WYFA 1YOBA 3BB1A 4MLPA 1B6RA 1CUGA 1RLUA 3AZQA 1SGWA 4GOLD 1XXHE 4N1AA 2C5AA 4Q15A 5TDHA 3HP4A 2TECE 3KZOA 3EDMA 3OEED 2EP7A 2J7KA 1XLVA 1H9BA 1ZICA 3LCJA 3UGTA 4KQFA 4BCDA 2DPLA 4Y2PA 3GNLA 1SVIA 4C0KA 1GZUA 1R9GA 4YRPA 4CV2A 1GNLA 2AS0A 2J3QA 2II6A 4K6OA 2XA1A 3CVWA 4QUJA 2VKTA 1ICIA 4BB9A 2Q41A 2Z3WA 3E82A 5JQGB 2JJMA 4DNXA 4HDCA 2Q1SA 1F7UA 4EP1A 4XDZA 4JI3B 4F5DA 1AMUA 4YHBA 1T5DX 1Z83A 1P9LA 4NKRA 3D1LA 3F90A 1FDOA 2DUUA 1JGTA 2ZIXA 3CONA 2JEZA 3B6JA 3OUUA 4R98A 4C2AA 5ULLA 3NKVA 3KU4A 1GFZA 5DTQA 3K9QO 1Z6XA 2QG4A 3KPYA 3VH1A 5C8ZA 3HXTA 2GLTA 3OEEA 1TA0A 3W5UA 2CHUA 4KRFA 3TCXB 1OWOA 3PJGA 4OP1A 1T8RA 3GYBA 2FEWB 3HRHA 4X00A 3CZQA 1U6IA 3BB4A 1TJYA 3HN7A 4C3ZA 2DBZA 2OBNA 1EWTA 3DDCA 2OPBA 3T5DA 4ZFNA 6ADHA 1X92A 3UV7A 3WBBA 3W8NA 5BN3A 3OSZA 1OWPA 3PR1A 4LJLA 3L0DA 2FSVA 2WE7A 4PNZA 3U48A 3VZSA 4FI3F 3MAGA 5FX2A 4DR4B 2N9UA 2NUPA 2P35A 1CUIA 3NR2A 3RSLA 3HR8A 2MMGA 3H99A 1PX0A 3GEHA 1B1CA 4R9VA 3CLKA 3OFSA 1VP9A 2ZSHA 5KNDH 1U28A 2Z6UA 1KQPA 1T9BA 2QP4A 3HU1A 3NAZA 3OOJA 4WASA 5JMPA 3DL7A 4DRXA 4NQZA 1N78A 4PHTA 1YJXA 2QZ9A 5HM8A 4KQEA 2IS2A 2O8BA 1E2FA 3NAMA 2WIGA 2XXBA 1TKRA 2PBFA 4MVJM 3M34A 1U8CB 1EUCB 1EJ2A 3CNEA 1P7WA 2J6IA 3U49A 3QV2A 1KDYA 3QXXA 3DE1X 1ZSNA 2VJMB 3MRVA 3C1OA 2O2GA 3OZVA 4DR2B 4QJIA 1I0LA 1I6KA 3EGDA 5FOSA 5HUJA 5LMZA 2WG0A 4OM7A 1SPBS 3DYVA 2GYYA 3T5BA 3ND8A 4GPEA 1QQAA 4IGKA 1MXHA 3EXHC 1T2NA 2GTIA 3RJ9A 3U0BA 3NHWA 3C3WA 2FUG1 3OJCA 1HRKA 1K8XB 2FFBA 1XRJA 3W3ZB 2J5RA 2ZR9A 3GT4A 2ETXA 2KPOA 3HS3A 1XYYA 3JAKB 3PFNA 2CCKA 2CFCA 2GD6A 5AVZA 2D13A 1KI8A 4GMHA 1D9ZA 1V6AA 4BQSA 2Z2YA 4BGDA 4GSLA 1M54A 3L8FA 1ZP6A 2VWHA 1EGHA 4OP2A 4UDOA 6AT1A 1NLFA 3L7BA 4L3VA 1XZ8A 3NVDA 2I3BA 3ORRA 4W8HA 1WF6A 3ANTA 3C3DA 3QX9A 2PPVA 4F85A 4Z2AA 3L49A 4NPHA 4GZLA 4GPTA 4JWTA 4AYXA 3DTNA 3IUMA 4EW6A 2YKGA 4HGOA 2PZGA 3KXLA 4JQCA 3IP7A 2X9LA 2QRUA 1PZGA 2W6ZA 2A67A 2Z3VA 4HDAA 5F3DA 5H02A 3X1DA 2IELA 4LNHA 4AUMA 4MPTA 2Y1GA 5TMPA 3DQPA 1NXOA 2FMIA 1JLMA 1E7WA 1OGYA 1FNDA 1Y1SA 3EIEA 3FROA 1WMDA 2FRVA 2BH2A 1VE7A 3VDMA 4GPIB 2I4TA 3Q3IA 2GEKA 1ESCA 5IARA 2HLHA 4F0JA 4F4HA 4I4CA 5IJZA 2P6RA 3U2QA 1P8JA 2A8YA 2YCLA 4YJ3F 5CDFA 2XCIA 4CMEA 1U8AA 2HQ1A 1G9XA 3PFGA 5CX1A 2QTLA 2HRDA 2VTEA 5HE9A 4JUBA 2QT9A 2ZSJA 4O4IF 5JFGA 1YDMA 4R7ZA 1BFUA 2AZDA 4CT0A 3UT6A 4H7EA 5A02A 4QGGA 1DUSA 2XNCA 3A06A 4QOFA 1QGUB 4BIMA 4BQRA 1GZDA 1G3QA 1PJSA 4H6XA 4OK5A 2VZ8A 5DM4A 5FWYB 1KMQA 3V7UA 1RAAA 1AF4A 3KCNA 2JZOA 2J30A 3MWEB 4IYRA 1RPTA 4K26A 4XXHA 1GTRA 1V11B 2ZYSA 4LE0A 2YIDA 4GR5A 5DHAA 5FT9A 4OUKX 1TT5A 2FR8A 1ORWA 2QPLA 1HQYE 2WYVA 1CIJA 5F5LA 1M2FA 1HKHA 1ZVQA 4OHYA 3DYIA 3QMVA 3FB4A 3RVMA 2GNPA 2XI4A 1JKIA 5KC9A 2ACVA 3MRSA 3UFBA 2CSXA 3AJ9A 3Q8LA 4CKEB 1BC5A 1KZ1A 1TYAE 3TQSA 2O07A 3EQZA 3AHGA 5U4XA 2C8KA 5BV7A