3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxyphenylpyruvate reductase
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
2RH4A 2YW9A 4QFDA 4QTZA 4S3MA 1PJBA 1LDEA 4BVAA 4JK3A 5A3JA 3GG9A 2B4QA 3ANNA 4E4YA 1EEHA 2GN8A 4XWYA 4BGIA 1K3TA 3NDIA 3U5TA 5A03A 3OEWA 3LF1A 3EDMA 3TDKA 2W90A 2CVQA 4M89A 4PG8A 2OHXA 4WPGA 4EJ6A 4BGEA 1PS0A 2WJPA 1HXHA 1PZEA 3HDJA 4XIJA 5KJ6A 4E0BA 3FR8A 3CMCO 4CLRA 3H5NA 3DHNA 3IJPA 3OA0A 4GWGA 3ZWPA 4RF2A 4RCVA 2UVDA 4BIIA 2GDZA 5HS6A 1SNYA 1E7WA 3WOHA 4R1NA 2PD4A 4GX5A 3TOZA 1AHHA 4DGSA 3KV3O 2DTDA 1SEPA 2VUTA 1D7OA 4R16A 3OJOA 2Y0DA 1QMGA 5A06A 4FGWA 2NLOA 2X1HA 5T8KA 1LC3A 3R0IA 1T4DA 3UW3A 1DLIA 1M67A 5DOZA 4YYZA 4KP7A 1E7QA 1NBOA 3PRJA 1IOLA 4YJHB 1ZSVA 1HZJA 3D0OA 4DQXA 3DZFA 4J7XA 4IZIA 5B4UA 3R3JA 3AM4A 3QWFA 4ESOA 3WGHA 4Z6KA 3KYCA 4CUZA 2E4AA 1I24A 4ID9A 2ZIZA 4MKXA 3GVPA 3ITDA 1GYRA 1Q0HA 4OKIA 3ADOA 1PJ4A 4J1SA 3WFJA 1LDGA 4PLYA 1C1DA 3U62A 1PGPA 1PJ3A 2E37A 2WTBA 1EDZA 1UZMA 4M1QA 3ZGYA 5DCUA 2D1YA 4W9NA 4DBZA 1BDBA 5B37A 4YT8A 1PQUA 4A27A 5U1PA 1U3UA 2V6MA 1HDGO 3FI9A 3O8QA 4MVJA 2VHXA 4MVJM 3NJ4A 3VDRA 5TS3A 4IS2A 1N1GA 4O5OA 2E48A 3GPDG 4IBOA 4BS9A 4IGEA 4TRMA 3C1AA 2YV2A 4GI2A 1A4IA 3CPSA 2G1UA 1ISGA 2BFMA 2BMAA 3ENKA 4CLOA 4XRRA 2WEKA 3PLRA 4TRNA 4BO3A 4PLFA 2AQ8A 1ENYA 4I9NA 3PHJA 4OYRA 4WLUA 2C7VA 3H5AA 4TRJA 2HMTA 3LF2A 2QRJA 3H9UA 3IL2A 1LSOA 1ZW1A 4A0SA 3WGOA 3SLGA 4BL5A 2QW8A 3FRJA 1R12A 3BMNB 4FOSA 1WDMA 5ICMA 2BFPA 1DRVA 5AQ1A 5KVCA 1GD1O 4E13A 2NQ8A 3NTRA 1A9ZA 2I67A 3B1KA 4H3VA 2BH9A 1YS4A 4MVJI 3RC2A 2HK9A 1TXGA 3TNLA 4BGUA 3I83A 3B6ZA 2Y66A 4MP6A 3H2SA 2TMGA 4NFSA 5TT1A 4J9VA 2EJWA 3ZZNA 1VJTA 4QFCA 3QVTA 1P1KA 1QG6A 2H9IA 3ZWYA 2QZ9A 1XG5A 1UXGA 2GD1O 3GMDA 2FRDA 2HMWA 3L6OO 1R0KA 5JY6A 4AJIA 2HMVA 4KDEA 1YXMA 2IZ1A 4MDHA 1P1IA 3WYCA 3V2GA 2E49A 1T2AA 3PQDA 2HLPA 2NWQA 3NDJA 3U4IA 1EZ4A 4OH1A 4BKPA 4R1UA 3MEQA 2PGDA 3HE3A 3WX0A 1SBYA 4QXMA 2VQ3A 5EIOA 5CAEA 2EF1A 3D5TA 1GDHA 1C14A 3M1AA 2C5AA 1M6WA 3ANMA 3DOCA 3I9NA 4D42A 3I52A 2Q50A 2O23A 1FDSA 1KIFA 3S2FA 2JD2A 1VJ1A 1PGNA 4YBZA 5KIAA 3WGIA 2IXAA 4NG5A 3JD0A 1Y8QB 1ZEJA 2B4RO 3WG9A 3AOEA 1A9YA 1FF9A 2Q99A 1IL0A 2AQIA 1LSUA 4ZU3A 3VKUA 3HDYA 1DSSG 4IUYA 4MP8A 4O6VA 1PL8A 4ZRMA 1PJ2A 1LSSA 2Q46A 2XXBA 2Q1TA 3P19A 4D7AA 1X1EA 4PG7A 2NU8A 4XGNA 2A9FA 3SX2A 2C82A 1P1RA 3AM3A 5C5IA 3W4KA 1EUZA 3GRPA 3M2TA 4MOWA 3KHUA 2B5WA 3ROKA 5L4LA 3JQGA 2Q4BA 3BTUA 4CLDA 4AJ2A 2PD6A 2VWPA 5DZSA 1NAIA 3ITKA 3NTOA 1P3DA 1R6DA 3QA9A 5CEJA 1R66A 2QZZA 5G0UA 1M76A 1E7SA 1N7HA 1TT7A 4BMSA 4LMRA 4R1TA 4DIBA 1XQ1A 5ADHA 5IZ4A 3AI2A 4Z0HO 3I9MA 1MFPA 1AXGA 4CV0A 4D43A 1ZJZA 3PHGA 1LJ8A 4A73A 2Q2VA 2GPTA 1GQYA 2WD7A 2C54A 4CMJA 2WE7A 1HYGA 4YQZA 4LVUA 1YO6A 1T1SA 1LX6A 1NNUA 1ZK4A 1TT5B 4PLWA 1B3RA 3P2YA 2YFQA 4EUEA 1E3JA 3GR6A 2PA3A 2PY6A 2WWRA 5T8KC 3N74A 4M87A 5A5FA 2P5UA 1YQDA 1GUYA 3AUSA 4IMPA 1BGVA 1UZLA 2XAAA 5KVSA 1VLLA 4N54A 3PQFA 3VDQA 3AY7A 4YAIA 1F8GA 3ZWNA 1NM5A 5JO0A 5JDCA 4GBJA 4ZQGA 1PU2A 3UF0A 3C1OA 5BT9A 1GY8A 1X7GA 3UHAA 2VUUA 3BMOA 1GCOA 3D7LA 1VL0A 5T5QA 5CEFA 3JD4A 4CL3A 4W82A 1LNQA 1SPXA 2Q1UA 4CMEA 4B8WA 3DDNA 3Q2KA 4LGVA 4R51A 4W9NC 2HJSA 1Y9AA 3DONA 3IQDB 1BXGA 1LDYA 3I1JA 3RSHA 2CD9A 3RQSA 1C0KA 1NQ5A 2UUOA 3C7AA 1DPGA 2VCYA 3LZ6A 2GN9A 3QW2A 5EN4A 3JV7A 3WWZA 1NP3A 4ZICA 4EW6A 4LRSB 5DBIA 1VL8A 3C3XA 4YAJA 1QYCA 1LLCA 2J5QA 1H93A 4XIYA 4PN3A 4UULA 3ZWVA 4UEJA 4H7PA 1E1KA 3OQBA 5ER9A 3BMCA 4UVDA 5I8WA 2WYUA 1ZZEA 3QHAA 1E3WA 3C85A 2DFDA 2FR8A 3CTMA 5HM8A 3N7UA 1O8CA 3F3SA 1HE3A 4LK3A 4M86A 3RD5A 1X1TA 3HUDA 2O3UA 1UUFA 2G17A 3G1TA 3LT0A 3PFFA 3QRWA 4ROSA 5DBFA 4DVJA 4CL8A 2Q3EA 1L1FA 4XEHA 2AMFA 3NDRA 1YDWA 5TRTA 3NKLA 1XU9A 4K6CA 1XWFA 2O2YA 2WM3A 3DO5A 4CM8B 4UUMA 3ZHXA 5I7FA 4DYDA 1V35A 4LN1A 3W4JA 1LQUA 3RUAA 4CM4A 4AJNA 1Y7TA 1V3TA 1WVGA 3RUCA 4JBHA 4JQCA 1JKJA 4NBUA 4RPGA 2JHGA 2GLXA 4DPKA 4J16A 1JQBA 4CUJA 1WW8A 1KEWA 1MXHA 3ZV3A 1WAMA 2ZB8A 4OL9A 2DAPA 1NASA 2FR1A 3ZU5A 3KXDA 4XJSA 3GN1A 4PRLA 1F06A 3H6KA 3V2UA 5T6BA 1YBVA 5ILGA 5AXDA 5A1TA 4ZQFA 4YJGA 1N5DA 5IFLA 2RH8A 1LLQA 2JKVA 1HSOA 4NBVA 4RV9A 4PLVA 4WE3A 1GQQA 2J6IA 3OEYA 4CMIB 1YBAA 1W73A 4E33A 1P45A 2YY7A 4WLEA 3T7CA 2HO5A 1HDRA 4CPDA 1G6KA 2CZCA 3H9EO 5TJHA 4DIFA 2V7PA 5C7LO 1GZ4A 3ZV5A 4OMUA 1I3LA 3EC7A 4YPOA 4IZHA 4II3A 4XX0A 4GMGA 3ICPA 3FN4A 5K0ZA 5TNXA 3KOUA 3JYOA 3QLJA 3INGA 4XGIA 4XZ3A 1VPDA 2XXJA 1HEUA 1BXKA 4BO9A 3V8BA 4CM9D 1Y5RA 4I5EA 1I2ZA 3G1UA 4RGBA 2CSUA 2UDPA 4NJMB 4BNXA 4HFJA 3G3EA 2GN6A 1R0LA 1UP6A 3F1KA 5DDIP 2GZ1A 5TT0A 3D3WB 4UVIA 1I30A 2BHLA 2V6FA 1QV6A 4C7KA 2VT2A 2B5VA 5L7WA 2P4QA 5C7IO 5GMOA 3G49A 1ARZA 3WNVA 2D2IA 3F5QA 1VC2A 5C37A 1T24A 1N92A 4IPTA 1V3VA 4I9HA 5B4VA 1GV1A 1U4OA 3GY0A 4U5QA 3WR5A 4BO2A 1AXEA 3QVOA 3H9QA 2V6BA 4BKRA 1LRKA 5JS6A 1JWAB 1OC2A 2YDYA 3INRA 4PG4A 4FFMA 4S1VA 3VPHA 3KYBA 1KERA 3W8DA 4A5OA 1BG6A 3IKVA 1ISJA 4IDCA 4PLTA 3OIFA 5ILOA 4BOYA 3NT5A 3WNQA 4K9DA 3EMKA 4P4GA 1HDXA 1Y8RB 2HUNA 1LLDA 1DIBA 1ZSYA 3DL2A 3VZPA 5KWEA 4MVJF 1MX3A 1YL7A 5A5EA 4KUEA 3JQFA 4BNVA 1FDWA 4EI2A 3R1IA 4PCVA 1SB8A 1E3SA 1YJQA 4NBWA 4RDHA 5DBGA 3I6QA 3PGJA 1V0JA 5EESA 1ZK0A 1BW9A 4RLHA 1D1SA 3GQVA 5COAA 1S7CA 2FHSA 4BO8A 3DBRB 2PGLA 3JQBA 1DC4A 4NI5A 1LQTA 1HL3A 4CMGA 4YCAA 3ON5A 1E3EA 3GZNB 4PIVA 1JLLA 4BB6A 2EXXA 1P33A 4J1NA 3D64A 4HADA 5JDCC 5KCZA 4BO1A 1ZFNA 2X5JO 1AUPA 1HETA 3HNPA 1ZXBA 4FJ0A 2YHIB 1XR3A 4TROA 3RROA 4WCDA 1HE2A 4BNWA 5TIIA 2VNSA 1LTHR 2HMSA 1HZZA 3AOGA 3VPFA 1LI4A 4CMEC 1PGJA 1T1RA 1FXSA 2HRZA 2VOJA 3K2EA 1Z74A 3PPIA 1I01A 2I66A 2PWZA 2DBZA 3BZUA 5ICSA 4HKTA 3RAJA 2JFFA 3ZV6A 5JAZA 4R69A 4HP8A 1XSEA 2QQ5A 1BRMA 4YRBA 4R5MA 5F1KA 2EP7A 1FDVA 4XDZA 1LEHA 3CKYA 3ICCA 1Z73A 3WBFA 1RM5A 4YJFB 3SVTA 4QQRA 4U7WA 3JQ8B 2X23A 1OFGA 4XQCA 4FDAA 4CM9A 1G0OA 3OH8A 1HDYA 2C0CA 4WNCA 1H9AA 4RVGA 4CMBA 1ZMOA 3JQ8A 4FJ2A 1EDOA 3QVXA 2NVUB 3EZYA 4F46A 3WYEA 1U3WA 1E6WA 4K1LA 2RAFA 3H8VA 1BVRA 2X5KO 1DC3A 1D8AA 2VNAA 4MO2A 3AM5A 1MFZA 3DTYA 2FR0A 1ZK3A 2HRBA 5G0VA 4A7PA 5BSGA 4WGGA 4AJOA 1KEVA 2DBQA 2OXIA 3BHIA 4Z9FA 1KY4A 2NNLD 2Y1OA 3MJTA 1XGKA 3IC5A 5EPOA 3U0BA 1CIVA 3GGOA 3VVBA 4B3HA 1EVYA 3KYDB 1LDMA 3LC2O 1XLTA 3Q6IA 2O50A 7ADHA 5EL0A 1PJQA 4RLSA 3LK7A 1DIRA 2VRBA 4EZBA 1DAPA 1T2CA 2IDZA 2O7SA 1RYDA 4RL6A 1MC5A 4NQZA 4BNKA 3E1KA 5KKCA 1KYQA 2IZZA 2O4CA 1HYHA 3FWNA 1NX6A 1CQJA 5G4KA 1VJ0A 3SEFA 1GL3A 4E2WA 2PR2A 4GVXA 4CM7A 4B4WA 3OQ1A 3HN2A 1Z82A 1IYZA 3DZGA 4MINA 4YRAA 3OIDA 4IS3A 3SJUA 4PGFA 4RPKA 1PJSA 3EAGA 5GZ1A 1E5QA 4OJNA 2X9VA 1GFSA 3RBVA 1BXZA 2VT3A 3ETGA 2DVMA 4BO0A 1I2BA 3ZWOA 2YV3A 2XOXA 4ALIA 1R4MB 4IXWA 3ROMA 1ZH8A 1MLDA 5A3VA 1R4MA 1U9JA 1SMKA 5BR7A 4BV8A 1ORRA 2PGJA 1GPJA 4KWIA 1M6HA 1PJTA 4QO7A 1EVJA 3FPCA 3PWKA 2DPGA 2NQTA 1NWCA 5IDXA 4Q3AA 4R5HA 1X13A 2GUGA 4MVJD 1BWSA 2IZ0A 2Y1CA 1Y6JA 4UUNA 3MTGA 1HF3A 5JAMA 1HWYA 3IIEA 5BQFA 1LC0A 3AI1A 1C3VA 3ONFA 2NU6A 3Q9UA 2OL4A 4GSKA 4OKNA 3C7DB 3AU8A 1UDAA 3F1LA 3RCBA 3VZSA 5HWSA 2CDCA 1NR7A 3LC7O 3F6YA 4CQLB 4FFOA 1EVZA 4YXFA 5F5NA 1F8FA 2IODA 1IY8A 5DP2A 2D0IA 4DXHA 1ONNA 4ALMA 3TZQA 4RVSA 3GK3A 1MP0A 3HDHA 1N2SA 3PIDA 4L73A 1H6BA 1U4SA 1I3MA 4J4HA 4GPD1 3HB5X 1H6CA 1O89A 4D0SA 3JQFC 4AJ1A 1VE9A 3WSVA 1YB4A 2A92A 1VSUA 4FC6A 1CWUA 2ZKLA 3W6UA 4BNFA 1VL6A 4CLRB 4J0EA 1UXIA 2VYVD 4XA8A 2FMUA 3DXFA 3W4IA 4EUHA 4BNZA 4IMRA 2PZKA 5JBIA 3I5MA 1AE1A 3DZBA 3F46A 3JQBC 4U0KA 1O0SA 5A4DA 8ADHA 3MJCA 3LU1A 3PK0A 4A03A 1NQTA 3EW7A 4W4TA 1P0CA 2X0NA 4IIUA 3ABIA 1H6DA 2EKQA 3AFNA 2PV7A 4PZEA 3WGYA 5HA5A 1YQGA 4FGSA 1TB4A 5JE8A 2BGLA 5IN4A 5K6AA 1KETA 2NVBA 2VZ8A 4UREA 4E5MA 4EJ0A 1J6UA 1VKOA 1O95A 3S2GA 2HK8A 5TQVA 4N5LA 2VHYA 4IQ0A 1DJNA 2ZJ1A 1OI7A 1QR6A 3CH6A 3L4BA 1O9BA 4DL9A 4CLXA 5TGDA 3KYCB 1UDBA 2J8ZA 5G0SA 3DBHA 2J3KA 2PZLA 4PLCA 1S6YA 3OICA 1E5LA 3Q11A 3HSKA 3WDSA 4CM3A 4LSMA 1PGQA 1C1DB 3WB9A 4CQMD 2EHDA 2C07A 4FW8A 3C7CB 2O3RA 4Q3CA 4Z0TA 5I9MA 1P1JA 1CJCA 4RF5A 2G0TA 1PX0A 2V65A 3EZLA 4JN6B 1C1XA 3O8QB 4XYGA 1Q7CA 2VTDA 1E77A 2GASA 3GRKA 5I7SA 4JNKA 1ZNQO 1B2LA 1EQ2A 1B16A 4CM5A 5TLSA 2NSDA 4JJGA 3S55A 2I3AA 1H5QA 4IXTA 1KY5A 3GHYA 4RF3A 2A94A 4Q3EA 4CLOB 2H63A 1FJHA 2Y1GA 4XKJA 1QLJA 2HSDA 4JBGA 5I9LA 3QVWA 4RQUA 1R4NA 4BKUA 5IDQA 3ZW9A 4TSKA 2PNFA 5U4QA 3RFTA 2Y05A 4GKVA 1B8VA 3LYLA 2HDHA 5DF1A 2UV8A 4E5PA 1T25A 3G17A 4R41A 4HFNA 4QECA 3WWYA 5CDYA 3VH1A 5CG2A 3E9MA 1X7DA 4JJIA 4LISA 4WCFA 3RUDA 1MUUA 4UVHA 5ER6A 5IF3A 4IJWA 1XCBA 2BGMA 3IP3A 4B7UA 4EEZA 3WTCA 3UCFA 3ADPA 3IUPA 2G5CA 4EDFA 3K9QO 3UOGA 3UN1A 2ZTMA 1UH5A 2EG9A 3OMLA 3OJFA 4BV9A 5L4SA 2VYVA 3O26A 4LVCA 4OOEA 2B83A 2NUAA 1CRWG 3NUGA 1JWBB 3A14A 1P74A 5G4LA 2FPGA 3SC6A 1PL7A 1ULSA 4PRKA 3RUHA 4CV1A 5H82A 4I8XA 1K6IA 5I8ZA 3WJ7A 2OGUA 1P9LA 2JL1A 2PKQO 3H9JA 1HDOA 1GADO 4E3ZA 5ES3A 3VZQA 1NVMB 1GYPA 1RJWA 2H5LA 3QE3A 4RZIA 1V6AA 4O63O 4CR6A 3PP8A 3KLMX 1DAOA 1UP7A 1I8TA 1LDBA 1OOEA 2FSVA 2RBEA 3NTQA 4NBRA 1XEAA 4BMVA 3H5RA 3C24A 3Q0EA 4M55A 3B20A 2VWGA 1ZXLA 3GVXA 2Y67A 3HQ4O 3TWOA 5L7YA 4E30A 4D3DA 2IEDA 5EERA 3JYLA 4J7UA 4TRRA 4CQMA 2C59A 2D3TA 3AWDA 3P2OA 4J49A 4BMNA 5CDGA 4DMLA 2AXQA 4BUCA 1R15A 3GVHA 3QWIA 3RBZA 3ZWCA 2X8LA 4LW8A 2OORA 3VKVA 3DHEA 4MIEA 4CMKA 4EBFA 4B3JA 3NV9A 5MDHA 2BELA 3TPCA 2Z95A 2BI8A 4D46A 3PLNA 2GYYA 4Z9YA 4ZHSA 4XQ9A 1E3LA 3D4NA 1YVEI 1HYEA 1M66A 3JQGB 4UEKA 3JYPA 4XYMA 4QO8A 4NPCA 4CR7A 4MKRA 4FN4A 1PR3A 5H81A 3TSCA 2GN4A 1B8UA 3AUTA 3CZMA 1CEQA 4JXKA 3TZHA 3WGGA 3T4XA 3T7EA 1W0CA 3MOGA 4GH5A 2EKPA 1PQPA 1B3BA 4ND1A 5JXWA 1PZGA 1E92A 3NT2A 4OXKA 2JFGA 4RO0A 3AUUA 1BSVA 5DP1A 3RKRA 2LDXA 3PHIA 4DC1A 3NRCA 4P4LA 1ENOA 3D1LA 4EITA 2D5AA 3O4RA 1IPFA 4XB1A 4AJKA 4E12A 2HMUA 3RUIA 3PYLA 3K6JA 3PEFA 4E6PA 2DKNA 2WD7B 3FWZA 4LCJA 2P9GA 4B3IA 3WBBA 2Q2QA 1Z7EA 2O48X 5IDWA 4D44A 1MA0A 5KJ1A 4J2OA 4P22A 1JAXA 1I3KA 1MG5A 2OP1A 3GNQA 2EP5A 4YQYA 3K5PA 3OF2A 1YE3A 6LDHA 1ADBA 2Q49A 2UUPA 2P91A 5JO9A 2VOEA 1PQWA 3BTSA 1GQ2A 4FQ8A 3FHLA 3KLPX 1BVUA 4Z0PA 3RC1A 3HFGA 2EEZA 3K30A 4D3SA 4U6QA 5LC1A 4NU6A 1TLTA 4BNLA 4A2CA 1H94A 4KQWA 3BMOB 4BO4A 2O4UX 4Y67A 2ZQYA 1GU7A 3GFBA 1YBMA 1YOVA 5KVQA 3WLFA 4GX2A 4AVYA 5IN5A 3I4FA 3QJ5A 8LDHA 3ZWXA 5L4NA 3QY9A 1LLUA 1XIVA 4RVUA 4CUKA 4M8SA 4YAGA 1R16A 1QYVA 3L6EA 1BXGB 3GDGA 3DHYA 3GA0A 4KZPA 4YRDA 4WKGA 1QV7A 5LCXA 4E5YA 1K6JA 1WP4A 3K92A 4A26A 3ZNNA 3JQ7A 6ADHA 1G1AA 3D4PA 4IQ8A 4FPXA 3U49A 1DO8A 1QXSA 1D3AA 2FN7A 1W4ZA 1J5PA 5L3ZA 2ZATA 4NDNE 3BMCB 3ULKA 1Q7BA 1JDJA 1DIAA 4E31A 1HE4A 5AXAA 1E3WB 3OM9A 3A06A 4L4XA 2Z1MA 4N18A 2QHXA 2PKRA 4NK5A 1NFRA 2P9EA 1NPTO 1ZEMA 1WDKA 1CF2O 3AY3A 4H16A 4CM6A 4DRYA 3RC9A 3H2ZA 3HDQA 3DOOA 5FI3A 2Y68A 3QWBA 2QX7A 4I1IA 5F3RA 4C4OA 3GAZA 3GGPA 3ETEA 3H65A 4WCFC 3ZW8A 3IUSA 3RASA 3DQPA 4YB8A 5AYVA 1SZJG 4L75A 3AK4A 3ZWAA 4O1MA 2DTEA 3UCEA 1PIWA 4Y9DA 3KZVA 4RZHA 4ND4A 4CM4B 3HZZA 2VHZA 4WEQA 1I32A 2X0RA 4GWKA 2QYSA 1FDUA 3ZHZA 5MGBA 1VRWA 3NT4A 3ZHYA 3RBXA 3PWZA 2PK3A 4LCEA 4Y6SA 4Z3KA 3QIVA 2YYYA 1H6AA 4RJTA 4ND5A 3WMXA 1JW9B 4NR0A 4WOJA 5TF4A 4TZKA 3SJ7A 3MJEA 2DPHA 5KJEA 5B12A 1KEPA 4YJGB 4YA6A 1U5AA 3DAPA 4L4SA 4EJMA 1ONOA 2EWMA 2GRAA 3VAZA 3Q2IA 5U9CA 4E21A 3JD3A 3Q3CA 4XB2A 2ZJ0A 2ZYDA 1SC6A 3DFUA 3KEOA 1LA2A 1UP4A 1ML3A 1V8BA 4OAQA 1L7EA 5A05A 3M1LA 1UXKA 2VTEA 3NGXA 5HTOA 1MGOA 2QG4A 3JQEA 1DJQA 3DZJA 4EEXA 1DXYA 3DBLB 3E9QA 3SC4A 2FOIA 5EQDA 3ZV4A 1AHIA 1YL6A 3CEAA 3AOEC 3FNGA 3GPIA 3ETDA 2AG5A 3JQDA 3ZWBA 4CV3A 4YTEA 4RPHA 2DUWA 3DBLA 1B14A 1ZK2A 2VYNA 1ONPA 2NU7A 2D4AA 1D4FA 3L77A 2W4QA 1U8XX 4DWVA 4Y8VA 1EK5A 4JGBA 3QSGA 1Z7BA 2EIHA 2ZB7A 4R9RA 4DQUA 2AEJA 4MVJH 1NHGA 1ZIDA 1A71A 2C5EA 2W2LA 1F17A 4OIMA 4Q3NA 4F3YA 4J43A 1ENZA 1Y9EA 2JAHA 2W98A 3SBOA 5JNLA 2AQKA 4B4UA 2Q2WA 2OO5A 5JC8A 1YQXA 5GZ6A 1UZNA 5F21A 3VPXA 4YT4A 3FNFA 2I5PO 2W2KA 4IDFA 4OO3A 3U3XA 4J91A 3GVCA 4TKMA 3QWAA 3ANLA 1UAGA 1AGNA 2Y99A 1A7AA 4ZVVA 2JAPA 1VSVA 3BXXA 1J4AA 4URFA 2ZCUA 3JQCA 1U2GA 2R00A 3AU9A 5JC1A 4O59O 4KDFA 4Z3DA 1SO8A 2IRWA 4I5FA 1I3NA 2C2XA 3C8MA 1BW9B 1Y81A 2VZ9A 2R6JA 1KVUA 4ZN6A 3GAFA 3LVFO 3RFXA 3OBBA 1TI7A 1QRRA 3I9JA 3KUXA 4IQGA 1E6EA 1ISIA 1P1FA 4KMSA 2BGKA 3GMSA 4H15A 1E7MA 2FZWA 2UYYA 2YV1A 4KUHA 4QT0A 3PJDA 1KVTA 2AEFA 2DLDA 2NADA 2PH3A 2VUSA 1IZ9A 3SLKA 1Y1PA 4RF4A 2VN8A 4FBGA 4GAEA 4JBIA 5ENDA 4N7RA 4XR9A 3AFMA 3W8EA 2F1KA 2ET6A 3DB2A 3DZIA 4BQRA 2O3JA 5CDUA 1QYDA 2Z1NA 1PL6A 3X2FA 1Z75A 5JY1A 2Y1EA 2XPCA 5KVVA 4IJUA 4TVBA 2BI7A 4II2A 4KTTE 1B0AA 2YUTA 2SCUA 4WEOA 4AFNA 4GMFA 3W1VA 4KTVE 2G82A 4RORA 4XJTA 2OFPA 1LBEA 2DU8A 3MZ0A 5COQA 4DA9A 1T2EA 3RJ5A 3DBVO 1A72A 1NFQA 3RU7A 4MVJE 3PGXA 2A35A 3ENNA 1ZMTA 1GTMA 3WXBA 2ZQZA 4AL4A 2Q1SA 5T64A 3E6AA 5I9NA 5TJ9A 2YFHA 2YJZA 3D5QA 4YT5A 3KTDA 4CR8A 2Y0CA 3F47A 5LDGA 4DYVA 4UUOA 2WYWA 1WPQA 2P4HX 5FEUA 1HLPA 3PZBA 4PLPA 3TN7A 3CZRA 1OBFO 1GPDG 4L4RA 4NZ9A 5JLAA 4PVDA 1W6UA 3WJAA 1DEHA 3JQ6A 3HN7A 4YDRA 3NX4A 4EUFA 1OAAA 3BYZA 5CP8A 1XHLA 3ZCXA 3JQAA 1JU9A 1JAYA 1PWXA 2DT5A 1U1IA 3E8XA 2QRLA 2O7QA 3GG2A 4XGKA 4GGPA 1QSGA 3H7AA 3UUWA 4O0LA 5DCWA 3I3OA 3E48A 5G4KB 1IHXA 1EE9A 4JCOA 4R3WA 2EV9A 2YZ7A 3GNSA 5F1PA 2R2GA 3ZU2A 1H2BA 2CDBA 4P8RA 4WASA 1XU7A 3ASUA 1RKXA 1PZFA 1NTOA 1RM3A 2OBYA 4JIGA 3VTFA 1WMBA 4J3FA 1ZO8A 4CLEA 5EJ2A 1GZ6A 5ITVA 3STHA 5I7VA 2JCXA 3LQFA 3OJ0A 1PJCA 2AG8A 3HWRA 4E5NA 5EMHA 3MOIA 5G2OA 4AJEA 2VRCD 4HFRA 4J9UE 2OZPA 2GCGA 4IDEA 5T57A 4UVGA 3PTZA 5BNIA 4IDDA 2P68A 3ONEA 4CLHA 1KEUA 4XYBA 2EW8A 1YWGO 4W7IA 1F14A 3UICA 1JKIA 4XDYA 4PFJA 3V5NA 1A4UA 4JROA 4CMCA 3TFQA 4FSHA 3TL2A 3F4BA 3QV1A 4TVOA 4ZD6A 2X9NA 4BNNA 2AA3A 4BNUA 1U3TA 3PJGA 4PZDA 1YRLA 5DOVA 4KOAA 3WIDA 1YH3A 1X0XA 1PGOA 4QX6A 3NJ8A 2JCYA 5IXSA 1ZBQA 2VWQA 4N5MA 4GX1A 4D79A 1DB3A 2IEBA 3L9WA 3JTMA 5DULA 4BNTA 3K8ZA 3GEDA 2GZ2A 4YR9A 3T4EA 4WNIA 4YAEA 3HADA 4OHUA 3L6DA 4G5HA 3IDSA 5KKAA 1PTJA 4R3NA 3Q1LA 2BLLA 3D4OA 5JCJA 4Q39A 4RDIA 2ZTVA 3FD8A 3GNTA 2Z5LA 2AE2A 1NVGA 2R00C 3ONDA 4I5GA 1OC4A 4E5KA 3WQRA 2AE1A 2DBVO 3FNHA 2NTVA 3UH1A 4PLZA 1N9GA 3WFIA 1DRWA 1LDNA 2ZCVA 4ND2A 7MDHA 3I9KA 1H0KA 2IYOA 4MPDA 3ZN2A 4NJOA 1UDCA 2WSBA 2E82A 3DMYA 4W6ZA 1EE2A 3PWSA 1DRUA 4RVHA 3LC1O 3LSYA 4TWRA 1K89A 3VPSA 1UAYA 5CDSA 5IZCA 2I6TA 3MJSA 3WGZA 3IMFA 3IKTA 4R54A 3K31A 3U09A 5JMPA 1RM4A 1NVTA 1UJMA 4R9SA 3COSA 4D3FA 1A7KA 1HLDA 4CJXA 2DM6A 2GGSA 3ZH2A 4BNYA 5DT9A 1E1NA 1B15A 1PS9A 1HRDA 2RCYA 2ZYGA 3DAGA 3DBHB 3VPGA 3ROPA 5L45A 2X7HA 2TMDA 1P0FA 1M75A 4U0JA 2GSDA 3E5MA 3B70A 4AJJA 2VRCA 3GUCA 1Q7GA 1NPYA 4N5NA 3MWEB 3L07A 1JA9A 1LXCA 3GT0A 4NMHA 3RJ9A 4G65A 1C1XB 4E2XA 3NAQA 2YQ5A 3GN2A 4ZA2A 1K2WA 2Y1FA 3GDOA 3AJRA 3WLEA 1ISHA 3E82A 3HJAA 4P38A 4MIYA 4NFHA 3H9GA 4LSWA 2UAGA 5AXCA 1HDZA 2ILTA 3WSWA 1EVIA 4Z9XA 1PSDA 1T4BA 4FCCA 4K6FA 1C0IA 4ZQHA 1G0NA 2AW5A 1PWZA 3KB6A 1I2CA 1YONA 5JYDA 2H1SA 5JCXA 3S2IA 4J2HA 1R4NB 4YJHA 2FPIA 3IAHA 4XRGA 1GUFA 4PLGA 3ZWMA 4AJHA 4L0QA 3KM0A 3X2EA 4BKQA 3F5SA 5KJCA 3BAZA 4IJKA 1QLHA 1DC6A 1DFHA 5HRUA 2EJVA 3F4LA 2VHWA 4R4JA 1DFIA 3HG7A 3EY4A 4L8VA 2JHFA 3AI3A 3BTOA 1N1EA 4WCFB 4ITUA 4GSLA 4KUGA 3VVCA 3RC7A 2FPPA 2QYTA 3PYXA 4R1SA 3RFVA 1AN9A 2CF5A 1B7GO 2I76A 1KVSA 4K26A 1BDMA 4AG3A 2C7GA 1BHSA 1MV8A 1X7HA 2PZMA 3HHPA 2B36A 4GL4A 3SXPA 1JN0A 2ZYAA 5A9SB 4QEDA 3WMWA 4BKOA 4HV4A 4F6LA 4G2NA 2V6GA 4ZGWA 3NYWA 4WLFA 4OM8A 3VTZA 3RI3A 1XYGA 1YB1A 5THQA 5A9SA 1HE5A 3EYWA 5FYDA 3DC2A 2GZ3A 3R6DA 5COBA 5TX7A 2D59A 1IUKA 1UXHA 3S8MA 1QKIA 2NV6A 1E7RA 1TVEA 2RIRA 3KRTA 4HNHA 1P44A 2PZJA 3FBGA 1YGYA 4XR4A 1WNTA 4XD2A 1WWKA 1RPNA 3TZ6A 1K0UA 2EERA 3BMNA 3PZRA 4R68A 4ZJUA 3FNEA 5A04A 3ST7A 2WE8A 3CINA 4PLHA 2CUKA 3PDUA 5THKA 3ZNPA 5JW6A 1LRLA 3PHLA 2CF6A 2FZEA 1J0XO 4Q9NA 1ZKMA 4DQVA 3PHHA 4DC0A 3RVDA 1VI2A 1DFGA 3KETA 1SAYA 3RU9A 4CQMB 2JJYA 4F6CA 5C3MA 2QIOA 3UCXA 1E7YA 3HFSA 3JQ9A 3ZWWA 4OQZA 4IINA 3IS3A 1ISFA 4FD3A 3E9NA 3VH2A 5ENVA 3DZHA 1E0DA 4CMHA 1X0VA 4IM7A 2D8AA 3A4VA 5BSHA 3M6IA 3W8FA 3K73O 2WD8A 4OGWA 1W8DA 2ZTUA 3WYBA 1MB4A 1MC4A 2NVWA 4Y98A 4A10A 1T26A 2Q4EA 4NFYA 1DDOA 1NXQA 2FP4A 2HJRA 3P5SA 4E2YA 2B37A 3V1UA 1I33A 3CMMA 3A9WA 1PZHA 1SOVA 3OSUA 1PEDA 3CIFA 4M54A 2X22A 2I65A 3CE6A 3TQHA 4BGVA 4RQTA 1Y8QA 5CPBA 2EKLA 2IYPA 1ULUA 5AXBA 3B1FA 3BTVA 4FC7A 4DUPA 2H6EA 4B4VA 1R0SA 3DR3A 1LRJA 4L9RA 3W6ZA 1D1TA 3OFSA 1KC3A 2NTNA 3OIGA 1CERA 2BRUA 4Q3DA 4B8ZA 2YQ4A 4IDGA 3FR7A 3TZKA 1FK8A 3AW9A 4FJ1A 1X14A 2J5KA 5BNFA 1T2DA 1ZJYA 5DN9A 5IZCC 1A5ZA 1PR9A 2ZK7A 2I9PA 4HUJA 4OOFA 1EBUA 4D45A 2RHRA 4TQGA 3AUAA 5K6AC 5JDIA 3GVIA 1GZ3A 1NWHA 3JD2A 4HY3A 1B26A 1MG0A 4INAA 3ZU4A 4AJPA 1WLYA 1E6UA 3GDFA 5JYEA 3OP4A 3L4BC 1EUCA 2O3QA 2O2SA 1DC5A 2OP0A 1YOVB 4B7XA 2B69A 1NQOA 2OMEA 2BFAA 3BMQB 3K96A 4B4OA 3DWFA 1L7DA 4JP3A 1NFFA 3LT4A 2PKQP 2LDBA 4FFRA 4RVDA 4C7JA 4JLWA 4MVJG 1Q0QA 3B1JA 2X4GA 3CSDA 3BMQA 1YKFA 1OMOA 2VZ0A 3ZDFA 3UXYA 4UUPA 5H83A 1HT0A 1U7HA 3TL3A 3DTTA 1I10A 1RYEA 2G76A 2VYND 3BHMA 3V1YA 2P5YA 3L4SO 1C0PA 3JQ7B 3UAGA 4ND3A 3GOHA 1YDEA 4W99A 1EFKA 1TT5A 1N7GA 3TF5A 3S2EA 4Y6RA 3C1TA 2Q1WA 4CMAA 3D3EA 2IE0A 1XA0A 3NEPX 2W2LD 4E32A 2DC1A 1EUDA 1EQUA 4DPLA 3A1NA 1GEEA 2P2SA 1ZSNA 4MIOA 4BNMA 3KBOA 1KBZA 4J7CA 5ITWA 5KNLA 3VOSA 2GERA 1EMDA 2X6TA 3WQSB 4ALJA 1UR5A 4BNHA 3KSZO 1NPDA 3GUYA 2J3HA 1ADFA 1Q2XA 4J4TA 4MJLA 2C20A 3VC7A 1WZEA 1ZUD1 3PJFA 1GR0A 2B35A 4YEDA 4DMMA 4PVCA 1U2DA 2D5CA 4IGFA 4JP2A 3FPLA 1FDTA 3KO8A 1LSJA 3EVTA 3GC6A 4J1TA 3QVSA 3I9OA 4BNIA 5EINA 3DZKA 4BO6A 2JD0A 3IP1A 3UVEA 1O6ZA 1VKNA 4LMPA 1U28A 3WGTA 4RPJA 4G81A 4UAGA 3KSDO 3PI7A 1XKQA 2IXBA 3IJRA 4WUVA 3O38A 3ZU3A 2PH5A 4NNJA 2NM0A 3GEMA 2O3SA 5DNAA 1DIHA 1BMDA 3KSUA 1PS8A 1V3UA 3CUKA 3A28A 3DAFA 3ZNOA 3LDHA 1KVQA 1E3IA 1HTBA 3OA2A 4TMFA 4YVFA 3NGLA 5TSDA 2WYVA 1QP8A 1VM6A 4ZQBA 3G0OA 4J1QA 2CFCA 3I6IA 4HXYA 4U8GA 3U4DA 2Q45A 4XQGA 4CM8A 4WK6A 3VHRA 2JFHA 2FY8A 4GVLA 4NH4A 2DUUA 3FTNA 3JQ9C 4IJVA 5AOVA 3LT1A 2CVZA 3PXXA 2HCTA 4FOOA 2PLAA 4OQYA 5CHEA 4PG6A 3IOYA 3I9LA 1GCUA 1JTVA 2WDZA 4YACA 1NR1A 2OBNA 1OZAA 1KVRA 3ORFA 4EYEA 2X58A 4NHEA 4BNJA 5HS4A 1ID1A 5GY7A 3V2HA 2X9GA 3QWHA 3Q9NA 2PFGA 4NK4A 3OJLA 3WS7A 4GLLA 4IDAA 3PFWO 3PVZA 5A02A 5B1YA 1DHTA 4R01A 5FI5A 1E1LA 1EK6A 4CMIA 1E1MA 2XF8A 4DTIA 2C29D 3DMTA 4GQAA 1QYWA 4DLLA 2W2KB 3JD1A 3TJRA 1H9BA 3JYNA 2X86A 4CV2A 2PTGA 2X0JA 2AHRA 3BA1A 5L40A 1EBFA 2B4TO 3TZCA 2YDXA 2GR9A 3GH3A 4J0FA 1ENPA 1XELA 5CPFA 3O03A 1Q0LA 3MWDB 3JQAD 5FFFA 2E6UX 1GV0A 3WICA 3KVOA 4GKBA 4AJ4A 2DBRA 2Y1DA 2CY0A 2CNBA 3EK2A 1EFLA 4NJMA 4I08A 1LU9A 1ZVMA 3P7MA 1RWBA 4HNGA 5CFZA 1RM0A 5A9TA 3OJEA 3E03A 1UXJA 3D3WA 5EQFA 3ZNQA 5JMWA 1H2HA 2F00A 4XYLA 5A9RA 3RIHA 2JD1A 5BSEA 4ZQEA 2J3IA 5FF9A 4DLBA 4FR5A 1I5RA 3E5RA 5FWNA 5C7OO 1KS9A 3PDJA 5JDIC 4J4BA 1C0LA 1JVSA 4AICA 3EHEA 3I23A 5CEEA 1T2FA 2BFOA 3GGGA 2EGGA 4M49A 3H4VA 2BKAA 2BF7A 3O9ZA 3LLVA 3VZRA 1WMAA 3JSAA 5BSFA 1GUZA 5JPIA 2ZTLA 4CODB 2CDAA 3OHSX 1R37A 1Y8RA 1NYTA 1PJLA 4U6SA 4L76A 2EW2A 5G0TA 5IDYA 1IZ0A 1CQIA 3ASVA 4J90A 4D0RA 3KEQA 3VH3A 2I99A 1GEGA 1O5IA 4OSOA 1Q1NA 1ISMA 1ZK1A 5BNTA 4X54A 2AEMA 1QYXA 3GF4A 4ZRNA 4IDBA 1IB6A 3PIIA 1O94A 3DOJA 3TOXA 3F9IA 3RUFA 3TRIA 3VH4A 2J5RA 4XYEA 3WQQA 3DFZA 3DBRA 4WOKA 4XCVA 4BO5A 5CDTA 1ADGA 3PYMA 1XQ6A 4RPLA 3LLSA 5L51A 2NTJA 4W7HA 3GZNA 4DLAA 3MTJA 5L53A 4DPMA 2OOSA 3CXRA 3GZ4A 3BIOA 4FIZA 3OECA 3U4HA 4NBTA 4GLOA 3MJ4A 1N8KA 2YHIA 3WIEA 3N58A 4WJZA 3MJVA 3EGOA 1XDWA 3EUWA 5KTKA 1BTOA 3R3SA 1DIGA 2GNAA 4RVFA 1TEHA 2Y0EA 5G0WA 5JCJD 3TFOA 3U4CA 4PZCA 1K6XA 4DREA 2WMDA 3QQPA 1B8PA 1I36A 1M2WA 3INTA 3JQAB 4BNGA 3WTBA 1Z45A 3FSRA 1P77A 3OQ6A 1P1HA 4UEOA 4GGOA 1SB9A 3S1LA 4BHTA 4J6FA 2B0JA 2CVOA 3H3FA 4ILKA 4HX5A 4D41A 3ZI0A 3E18A 1QORA 1X15A 1J49A 3K2BA 4WLOA 4YJFA 2HU2A 4MKZA 4HFMA 4K28A 4FS3A 4Q3BA 4KQXA 3ROQA 5F1OA 5L7TA 1HDCA 4L74A 3L9XA 2A4KA 5GZ3A 2NVUA 1GYQA 5IXYA 1CETA 2HKIA 5F5LA 4UVEA 3FCOA 1U3VA 1F0YA 1F12A 1WDLA 5L9AA 1CYDA 3RKUA 3V1TC 4WECA 4YT2A 5T67A 3BHJA 4PG5A 1SOWA 5DCYA 5J23A 4F45A 1HKUA 3JCZA 4LRTB 5JAIA 2J3JA 1U5CA 4HWKA 4NU5A 3ZHBA 2NACA 1IE3A 3GLQA 4CM1A 4BO7A 1ADCA 3H3JA 5JSFA 2HK7A 4IY1A 4B79A 2DFVA 1DBVO 1WZIA 2P9CA 2X0IA 5CG1A 5I7EA 2HQ1A 3RUEA 2VHVA 4TKLA 1U7TA 2PD3A 4YAKA 1DOHA 3KYDA 1KC1A 3LT2A 1ZCJA 1YB5A 1IHYA 2QRKA 3EVNA 1TA4A 1DLJA 1K5HA 3MCVA 4XQEA 5KJFA 4I5DA 3G79A 4IIVA 5K9ZA 5JAQA 5IJZA 2X5OA 2DTXA 3OETA 4AJLA 4JJFA 3WGQA 5B4TA 4HBGA 4ALNA 2C2YA 3UKOA 1P31A 3GFGA 2DQ4A 3JYQA 1JKFA 1SCUA 5JFOA 1LUAA 2CMDA 4TZTA 2ZB4A 3GHHA 3DMTC 4WLNA 4OSPA 4OXYA 1IULA 3FBTA 4FFPA 1NHWA 2BD0A 4P4NA 4WLVA 2W8ZA 3M2PA 4YWJA 3QP9A 4DIOA 4ONEA 3HB4X 2POQX 3UFXA 5IAAA 1I0ZA 1YJ8A 3L0DA 1NAHA 4FFLA 4JX8A 4E2ZA 2AQHA 4FB5A 2YHUA 5HBRA 3RWBA 4NIMA 2FSSA 3DEYX 2JCVA 5TC4A 2HAEA 4MP3A 3U9LA 1HSZA 3I4CA 4ALKA 9LDBA 1GAEO 4YJDA 3FF4A 3GEGA 3UGKA 4QUKA 4KWHA 4QSMA 3PQEA 4FFNA 4ALLA 1A27A 2VWHA 4EGFA 4GX0A 4Y6PA 1N9GB 2RHCA 2GO1A 1Y5MA 2GF2A 2O3TA 4BB5A 9LDTA 4OXNA 3PJEA 4I9UA 3AY6A 5IG2A 1MXFA 1FMCA 2Y93A 4BQPA 5LDHA 1IPEA 1NQAO 2NU9A 1SEVA 1U8FO 3FTPA 4DBVO 5L95A 1WXDA 1Z6ZA 1V9LA 5KOIA 1KOLA 2ZB3A 5AVOA 1JVBA 1YL5A 2I3GA 2OUIA 4MVJP 1CDOA 1DHRA 4B7CA 2EGHA 2FWMX 4CQLA
chains in the Genus database with same CATH superfamily
2YW9A 1Y1SA 1ZRHA 4QFDA 4QTZA 3TIFA 3WC4A 2MMCA 1SUFA 3UYKA 2NTYC 4BTLA 4HRXA 1NZJA 2WM9B 3WLLA 5JCPA 4MKFA 3DVSX 1NVDA 3ANNA 4IV5A 1ESEA 4RX1A 4XWYA 1JDPA 1Z06A 2XQJA 2DQKA 1RC1A 3LF1A 3OWXA 5EMJA 3U5TA 4RTOA 3ZK9A 2CVQA 4M89A 5CNKA 1PLLA 1BJKA 1M6VA 5A3QA 3WYFA 2IBMA 1P62B 2ID9A 3GJ4A 3SS9X 1PZEA 1BA3A 4XIJA 1MEOA 3I5UA 1U7ZA 3CRZA 3OFNA 3LS2A 5NLLA 5KREA 5LMZA 3K0CC 4AS1A 2E21A 5AI4A 2I22A 4WD3A 4KRFA 4GWGA 4JHLA 2DJ5A 4PGHA 4O0MA 4RF2A 1J5XA 2UVDA 4LRQA 2P7HA 2Z57A 4RWZA 2JLCA 3L7IA 1IIRA 4J0HA 3MLAA 4KEAA 5DH9A 4EW1A 3ESAA 4PNPA 2WWGA 1AHHA 1JQKA 2AZ4A 4KQJA 3HP1A 4LXQA 3VR0A 2QRVB 1SEPA 4E08A 1T6XA 4R16A 3K4QA 4KQMA 1K8QA 5TEVA 1DAGA 2ZT8A 3AVXA 3PCXA 1GNVA 3GZJA 3TSOA 1GGVA 3MPUA 1FQOA 2ODNA 2GBFA 2R7MA 2NLOA 3OT5A 3B9PA 1JGTA 3WYGA 1LC3A 3R0IA 3UV7A 1T4DA 2X19A 3UW3A 2AZMA 1M67A 5CFNA 3PEYA 4YYZA 3OZIA 2FE4A 1EWRA 2Z0MA 3PRJA 4Q9DA 2Q3BA 2QMYA 4AKEA 3Q41A 1FX1A 1UXOA 4EG7A 2ZT5A 5K05A 4IDHA 2H1OA 1COWD 1KJYA 3CUSA 2NXCA 3PEUA 3A9TA 3F97A 3N6RA 4LF5B 1BH6A 1LPBB 1R2QA 1O6GA 3P4YA 2ZIZA 4ID9A 4IRMA 4MKXA 4NPHA 4UOQA 5CA0A 3RIEA 3V7WA 1GYRA 2X4DA 4CF3A 3OZTA 3KB8A 3U7RA 1MOQA 3WFJA 2EHJA 3PQ3A 4GM4A 4DSTA 3DNFA 4LF4B 4KVFA 3S1SA 3A37A 2JJ2A 1YS9A 1AA6A 4GNKA 4M1QA 4HQKA 3V1NA 5BUCA 2B8JA 1V71A 4LJ4A 4NOMA 3E9ZA 5U1PA 3HJNA 3D3NA 1U3UA 2YHSA 1HDGO 2QL9A 2XB8A 3FI9A 3HV0A 3O95A 4RZ2A 3VDRA 2NSYA 4NZZA 4HLQB 1I6MA 3K0HA 3N0XA 1N1GA 2IPNA 3N3BC 1UCFA 3SSNA 4D0LB 1KF0A 4UHFA 2Q0HA 3IB6A 3HTXA 1U8EA 3OTQA 1XZBA 5EP2A 3L6CA 2WEKA 4TRNA 4O8CA 4N12A 4E2FA 2AQ8A 3MAJA 5EKDA 3MB5A 1IONA 4I9NA 4HDOB 4AMGA 3L7BA 4ROTA 3BQMB 5EC8A 4KQKA 1U7WA 1LK7A 2WJYA 3HUEA 1ZW1A 3CM0A 4WACA 5JR3A 3SLGA 4WBNA 4RENA 2NZXA 4FOSA 2YVQA 3BMNB 4M6WB 1D07A 1KI8A 1DRVA 1RHQA 4TMTA 5LZ8A 1TCBA 5AQ1A 4YDQA 4E07A 4KOEC 2QGFA 1ZMBA 1ZCFA 3NTRA 5GVRA 1DRKA 2PYZA 4RZXA 1TXGA 1X42A 4RH3A 1ODSA 1RLOA 4XCQA 2H9YA 3B6ZA 3BCRA 1N8TA 3I83A 3H2SA 2PBRA 2ROQA 4J9VA 2EJWA 4WFKA 1C9YA 3TQRA 3BIJA 4CT5A 2R8PA 2V7WA 3A32A 1K8RA 1KJ8A 1YCFA 4FD2A 5KQSA 4R7TA 2PMEA 4N6OA 1A7JA 5BVGA 1UXGA 4FIDA 2FRDA 2JFNA 3NVMB 4KK3A 1N2CA 4LDJA 4KNWA 4UM7A 3I1FA 1YASA 2IZ1A 2VBIA 2OXTA 1ZUNA 1GNQA 5AIAA 1P1IA 3DEHA 3V2GA 2PKYX 4YRPA 4CG0A 1VFNA 2Q8NA 2WD9A 1NURA 1W48A 2NWQA 4UUBA 4YFVA 4B87A 5HTKA 3OZUA 1QCZA 5LQKA 3V97A 1T3GA 3MEQA 3HE3A 5CAEA 3PFCA 1SBYA 1V4BA 5EIOA 5KYKA 2YX1A 4PYOA 1GDHA 4BZZA 1GN9A 2VJMA 3M1AA 3OE1A 2C5AA 3ANMA 4UBJA 1L7QA 4B75A 3DDOA 4D42A 4UAVA 2JH3A 4RKEA 3AJ8A 3QVGA 3G85A 4UM9B 4B81A 2ZJBA 4KGVA 2ECFA 1FS4A 3C1UA 4FE7A 3GRUA 4JJZA 5KIAA 3VR6A 1VHLA 5SICE 1YA6A 3JD0A 3ICQB 4TWAA 3SX4A 1ZEJA 3AOEA 1A9YA 1V1MA 2G4CA 5CFPA 4H6WA 1BJRE 1U3GA 3ACDA 1Y9DA 4DUYB 1IL0A 1FFGA 2D2FA 1TQDA 2ERYA 2JJ1A 4JNCA 4UM8B 1KPGA 2G7MC 2VXOA 2ZSAA 1NULA 4N5HX 4D3YA 2QMUA 1DAKA 1H65A 3U19A 2OBXA 4MV6A 1JNYA 1RT9A 5DU2A 4IUYA 4MP8A 4OGFA 2FPWA 1LSSA 3G2OA 4QC2A 5FDFA 2XXBA 2YNMA 3IUEA 3N07A 4M53A 4L8YA 4D7AA 1W4RA 2GUWA 1X1EA 1KZYC 2NU8A 2WMYA 1M1YE 1PW7A 5A5DA 3SX2A 2FUNB 3IQWA 3RF7A 2OPBA 1QQ7A 3GRPA 3SDBA 1RXUA 2H2GA 3KHUA 4MOWA 1G21A 4ZC8A 5KHLB 3EMVA 2I8CA 3VNAA 4KO8A 1OLXB 2PD6A 3RSGA 3NVKI 1NAIA 1OWNA 1V5IA 3W5HA 3ITKA 2IVZA 3NTOA 1QHIA 4FNOA 3U4QB 4EJ2A 1R66A 1ML4A 2QZZA 1X94A 4BB9A 1XZQA 1EUCB 3CV3A 3WIOA 4NMMA 1TT7A 1N6LA 2V74B 5JH7A 1FW6A 3B1ZA 4LMRA 5JSYA 2H4FA 5K01A 5DTEA 4L9SA 4FINA 3H1TA 3RWOA 4FFBB 1XQ1A 1RJ9B 1PFUA 5KNDH 1RZRD 4KN6A 5IZ4A 3AI2A 3EEQA 3I9MA 1MFPA 1AXGA 4D43A 1ZJZA 2IL1A 5ALRA 1W88B 5IBRA 2QWXA 3I04M 1L4BA 2ZS8A 4Y6LA 1TTPB 4LVUA 4YXWA 4G07A 5LR6A 1OHHA 2AS0A 1YO6A 1T1SA 3QX7A 4Z7JA 1BKYA 1G2PA 2IX3A 1AU9A 4IH1A 1J0DA 2UZ1A 3S3TA 4EUEA 1E3JA 1XBTA 1HE8B 2Q4TA 3UANA 1VDMA 3R9WA 3WGJA 5A5FA 1I80A 2QVCA 1GUYA 5CLIA 1BGVA 4AZSA 2HCFA 2XAAA 2WJHA 2XBLA 3COPA 2HMYB 3C3PA 3VDQA 2WKRA 4NONA 1XAIA 1J2YA 1WCYA 2R1VA 3DVQX 3B6JA 4HVCA 3IT0A 1NM5A 3ZWNA 2V3VA 2P5TB 1KE1A 1PWHA 4X7BA 4RH0A 2IUTA 5DHFA 1MRNA 5DXJA 5F2KA 4G09A 4FGZA 4Q6BA 3R5HA 3JVEA 2AH5A 4ZQGA 5BT9A 1GY8A 1X7GA 3UHAA 2VUUA 3BMOA 2XKJE 2W00A 3FFXA 1A5AB 3FNQA 4FNMA 1VL0A 1E6MA 2D8MA 5JJ5A 2LNDA 4YS6A 2NP7A 4MR7B 2O07A 2F1IA 3U44B 4UPEA 2AR7A 3EVCA 3H8JA 1SPXA 5KYUB 4KXWA 3P4XA 3OX1A 4Y2YA 1BXGA 3ESYA 1XCJA 5G1NA 3RQSA 2UVQA 2WUFA 4OYHA 5ICFA 4COKA 3C7AA 5F2NA 1IVNA 4UNSA 2VCYA 4NV0A 2GN9A 3WWZA 1NP3A 3N39C 2JCGA 4LRSB 1DJPA 4PN3A 2J5QA 1LLCA 2Z30A 2X2FA 2ICAA 1PQ4A 2VHJA 1ZCBA 1XHFA 1Z8HA 4H7PA 1EP1B 2X4LA 2FMFA 3KL2A 4XH9B 4DJEC 4M7PA 1B74A 3OQBA 4KB5A 1GGFA 2PMKA 1W5EA 3B1XA 3VOSA 2R4QA 1TYEB 2FR8A 4P92A 3V8MA 4BDTA 2POCA 2WKWA 3BE8A 3QLUC 4YLGA 1A5BB 1GZ5A 2AX4A 2VP5A 5BSVA 4MICA 3RD5A 1TQHA 2XNDD 2G17A 2ZT6A 4JVNA 3T5AA 2Q3EA 1L1FA 4MLDA 2SNIE 1R3UA 4I6JA 4L3VA 2ZUDA 1VKJA 2PJUA 2CXNA 3NG1A 2PM8A 4RFSB 2IHVA 4R9VA 1XNRB 3I8OA 1BDJA 3H4IA 2WM3A 3HCNA 4Y2XA 3BUSA 1N0UA 2X8BA 3O2SB 4UUMA 2YWFA 1VG1A 2B1IA 2EFEB 4Y7DA 3ZHXA 4K9LA 4AN0A 4C21A 4EQZA 3B5IA 5K09A 4DYDA 3VR4A 4GL2A 1LQUA 1WV0A 1UKAA 4P7KA 4A2CA 5AVXA 1FMTA 4FYHA 1XQWA 2X2PA 3CZQA 4YWHA 3RUCA 3L8HA 2B8TA 1IZ7A 2FAXA 3G02A 5EQJB 3ROTA 3W6PA 1VIMA 2O2EA 4J16A 3P96A 1WW8A 1KEWA 5CVDA 2XCRB 3CF4G 2XE6A 4QYSA 1WAMA 3M6XA 5FR1A 2DAPA 3KD2A 1NASA 1V47A 1Y8CA 2FR1A 2GN2A 3GBPA 1BH2A 1YMQA 4XJSA 1F06A 4KIGA 3RT7A 5C53B 2B4YA 5AI0A 4R8VA 1CX9B 1S1CA 2W71A 4Q4JA 1YBVA 5CNMA 1T8YA 2YV4A 4KFUA 5A1TA 4U7JA 4YJGA 4ZQFA 1E2IA 5IFLA 4LV6A 2RH8A 1GPAA 1W96A 3PC2A 4ZZIA 4EB3A 1BD3A 2DQSA 4NBVA 4RV9A 4WE3A 2W58A 4JJKA 1Y33E 1A8UA 1WSBA 3EIFA 3AESB 3K70B 1YBAA 3IMEA 1W73A 4BX3A 4MITA 1H8ED 4E33A 2GDJA 5JROA 3WAGA 4P5PA 3ZTTA 1KI6B 2C0PA 4KJZA 1K06A 4C3VA 4F8JA 4LWZA 5DHUA 1HDRA 4IQ4A 3H9EO 1U0BB 4DIFA 2FFAA 3V7YA 3X1XA 3ICPA 4IDQA 4DLPA 5JNVA 3FN4A 2GH1A 3N8IA 5TNXA 3SCZA 3EXIB 2FJUA 1UBCA 5M2QA 2ZRHA 1W1WA 2P67A 3GLGB 2Z4TA 4YP9A 1JIUA 2FV8A 4W5NA 4P4SB 4CM9D 4I5EA 2YJTD 1W9MA 4JDPA 4ZCTA 4BNXA 4NJMB 2WF5A 1GNLA 2XGOA 4Q12A 2JGDA 5FOVA 3G3EA 1YFLA 4GOLD 5EA2A 3KOZA 1FFEA 3FJYA 3D3WB 3B82A 3TNDA 4MI3A 1I30A 2V6FA 5AKJA 4OQLA 5CLFA 1YR3A 3RHFA 2BE7A 3L4JA 3KSBC 4C7KA 2CJWB 1U2RA 2P4QA 3LH5A 4HGOA 1S01A 3HMQA 4HZGA 5BQPA 3MHTA 3FBWA 5B3AA 2YOGA 3EUEA 1DWQA 3MN1A 3UQZA 1F0NA 1KJIA 5AUNB 2QBYA 1SG6A 3F5QA 2EFCB 3GT3A 1PYGA 1T24A 4POOA 1V3VA 3HCOA 4Q4LA 1E64A 5C37A 1FBNA 4KK4A 2LTAA 3WV5A 4ZYYA 1W36B 3GY0A 721PA 2J0EA 7REQB 1Y48E 5AOCA 2ATIA 2V6BA 3CX7A 2G70A 1LTQA 3VPHA 3W8DA 1BG6A 1ISJA 2LE0A 1KAQA 4IDCA 5ILOA 4QJIA 3NT5A 4ED9A 2R8BA 3CLHA 4P4GA 4PC6A 4QJ4A 2OCIA 3PUIA 3PS9A 3THYA 1GG8A 3DL2A 3HBNA 3EIQA 2E3JA 4TQ9A 1CS0A 1WHSB 3EXG2 3IP9A 3LUCA 5DTRA 2XEXA 3M6WA 4BEVA 5IT0A 1FJXA 4BXOB 3WIVA 1EFPB 1YL7A 2V8OA 3HBJA 2O2XA 2VEOA 4BNVA 5IUJC 2XXAA 2OYSA 2Z1DA 1JQJC 2RAPA 5FFMA 4F2WA 1IEXA 3MCUA 3GJ0A 3PGJA 1IQ0A 2FSGA 4HEQA 5DHPA 4C0BA 4MO9A 4H7HA 1VA4A 2AOUB 3LVQE 1N2XA 3RK4A 4EHLA 1QTIA 3KS9A 1KARA 4FX5A 1S7CA 2FHSA 3C6BA 5COAA 4B6PA 3KIPA 2XNHA 2VP9A 2PGNA 3KELA 4V0NA 5K3EA 1JHAA 1JSXA 3QI7A 4L95C 3UXMA 3RM3A 2Y77A 1JAZA 1H05A 3CISA 4QAQA 4H1HA 2WAYA 4PIVA 3HRKA 1JLLA 2YJ4A 3TINA 2EXXA 4BB6A 3W2FA 5JAOA 3IP5A 4HADA 2BFFA 2N9UA 2QW0X 3OE7A 5JDCC 3PUKA 1F8UA 5DBEX 1BMQA 3I1IA 1K5DA 3WAKA 1XR3A 2XUQA 2ZYSA 3OMWA 1XTSA 4BNWA 2G5GX 1URPA 3QBDA 3BE6A 2PPVA 4PQEA 3H2IA 1H1LB 3HRIA 3MXTA 4KPYA 1E4YA 2IYNA 5K3OA 3HXOA 1IU9A 1Z74A 2BL4A 3OIUA 1IBLB 2I66A 2PWZA 5IMBA 1RBMA 1R5JA 2EDCA 3RAJA 1SVNA 3RAGA 1EE1A 5A3SA 5JAZA 3NC1C 2Z5FA 2I91A 1XSEA 4F21A 5ALGA 3RSLA 4L5AA 2ZSFA 1IN8A 1J2RA 1UADA 4PSKA 3FKJA 4P7BA 2W4IA 521PA 2I54A 1DUVG 2F43A 1LEHA 4JODA 4K6HA 4LVNA 3CKYA 4OHXA 1W1UA 4D6YA 4FYMA 3MPOA 4YJFB 5CH3A 3SVTA 2WRZA 3BRWD 4OFXA 4G5YA 4U7WA 3DMRA 4WKPA 2X23A 1OFGA 1RI4A 5IULC 1USVA 4L1KA 3P9ZA 1VE5A 1NG9A 2XECA 4AK9A 5L3SB 3HDTA 1MPTA 4WZBA 1EDOA 2NVUB 2VPQA 2BJHA 3WYEA 4YYEA 3EA4A 3P20A 1T5BA 2JDID 4K1LA 5FI0B 5AW2A 4RM2A 3CLUC 1CRLA 3D0RA 1X1CA 5J2UA 2X5KO 5ALXA 1D8AA 1QIMA 3CUYA 3R7DA 3TECE 3ZK7A 1QQ5A 2CDRA 2IOHA 4HPXB 2OCDA 3WKCA 1BKDR 2CMKA 3AHIA 4A7PA 5DNUA 1NRJB 2F3SA 2Z2JA 1KEVA 2DBQA 1XZHA 2OBFA 1KNXA 3AETB 1TYBE 1RWMA 3BHIA 4GXTA 3T94A 4Z9FA 4CF4A 5A0TA 2Y1OA 1UC8A 2B4AA 1XGKA 1V7PC 1NDHA 3VVBA 4B3HA 5TY0A 2KHZA 2OSBA 4DABA 4A8PA 3QUTA 1C3EA 2PEYA 5JVDF 3KYDB 1KMQA 4QBHA 1TCCA 2AEEA 3FOAA 3JSXA 3P2EA 2BKVA 3QBJA 3T9FA 1ZR4A 2MOKA 3LC2O 1TM2A 2KW5A 2O50A 2IZ6A 3D6MA 3LHFA 3OQIB 2UZ0A 4MWCA 4DJ5X 4YRRA 4Y9UA 4DMKA 3FTCA 4HZUB 1T2CA 1ATIA 2O7SA 1A0OA 1TNDA 2QAJA 5F77A 4ZXFA 5IU6A 2IZZA 1Q5PA 3FMVA 1TQ2A 1CR0A 3T3PB 4AKIA 4LMBA 5J2TA 3P9PA 3ZIAD 3UWPA 1VJ0A 2BFEA 1W0KD 2ZU6A 1GL3A 3RYHB 1I5EA 5CH5A 4MGZR 3KYIB 1JSZA 2PUTA 1VPEA 3V1KA 3TR6A 3U4DA 4I8IA 2WV9A 3DZGA 3H16A 3TW6A 2VYQA 2NW6A 3IULA 5LA6A 2ADFA 3I76A 4N5IX 4AQYB 1NTRA 3NDPA 5GZ1A 4OGGA 1XZJA 4D26A 3OE4A 2C9CA 5E4JA 5T4FA 1GFSA 1BXZA 3F6CA 4LZJA 2DVMA 2YN0A 3ENQA 5AW1A 1OXXK 2PYIA 2CFRA 4I4TA 3I58A 4KI7A 1C9MA 1COZA 5BYAA 2O8DA 1X39A 2XOXA 5AK0A 4J94A 2OZVA 3IIKA 1ZM3A 3ROMA 5C80A 2X3UA 3TVTA 2ZPTX 4UBKA 3S2SA 1PT5A 1OR8A 1Z26A 4DNQA 1L5QA 4YCDA 3MQFA 2P0YA 3IKMB 4EY4A 5K0JA 2F4VB 3IV9A 3ZXUB 2I29A 2VP2A 3ODPA 4C22A 5MF6A 3PTAA 5BR7A 2QN2A 3HCAA 3NHUA 4KWIA 4ND8B 2VUHB 3FPAA 5AM0A 1E8NA 3UJ7A 3PFHA 2CZQA 1PJTA 5LKRA 5EWMA 3RRXA 3LP6A 4QASA 3HI4A 4MA5A 2NQTA 1ZLYA 1YMUA 4F5DA 1NWCA 2QL6A 3BM5A 1W34A 3HVKA 4MUKA 4Q3AA 5IDXA 5C8YA 4I7EA 1U04A 2IZ0A 4Q3OA 1Y6JA 3G23A 1PD0A 2CYBA 3TW0A 3U7IA 5B3KA 1QHNA 1AGPA 2B6HA 2HF9A 2GAAA 1AUQA 1IZYA 4ZVRA 1BHQ1 3BL8A 1LC0A 1HE1C 3DHWC 3G13A 2ODEA 1SC3A 4BFVA 3VJRA 1Z0FA 4R2MA 4GSKA 1HOXA 1WB6A 1X7YA 3BK2A 3LQ4A 2ZZNA 2DQYA 4GECA 3F1LA 2FPSA 1YTLA 1KEEA 3VZSA 3K05A 5FKJA 3A1WA 5JS1A 1NR7A 3OC0A 1AMOA 2X14A 5FAXA 3T0FA 1KRHA 4TL6A 4D4KA 1MO4A 4FFOA 2BGIA 3EDRA 5BP7A 1SUSA 1Z2PX 3PEWA 1E0JA 3CPEA 4L9AA 1YHYA 1IK4A 1ZIYA 5DP2A 4ZARA 5FUXA 3WGNA 2IPMA 4RJLA 1ONNA 2V1UA 3I1YA 3TZQA 5CDFE 3N7TA 1EM8B 3JALA 2G67A 3R3HA 3SKYA 4QUAA 5LQSA 4Z4QA 2CVPA 4C2AA 4F3KA 4B8YA 1JU3A 2Q3CA 1E79A 1AGRA 1GKLA 3BWXA 5GP1A 2V55B 3WA6A 4AJ1A 3A1FA 5HJ5A 3ICVA 1YB4A 1CWUA 1XPUA 3W6UA 4EATA 3T9CA 4BNFA 1RYFA 3K6SA 3T5GA 1SC1A 4J0EA 2QSJA 3OFKA 2ZGVA 1KKUA 4G1FA 4R98A 1UXIA 4RSHA 2FMUA 1CUSA 3FYUB 4RNCA 3WB1A 1XNQB 3IRUA 4DIUA 5A1JA 1WD5A 3FGZA 1AE1A 1L1QA 1HQKA 2JIPA 3JQBC 5D3ZA 1O0SA 4Q4AB 3NWOA 2EBFX 4OSEA 3IDQA 3JASB 1A8HA 2GJSA 2HJHA 4W4TA 4X61A 3KPWA 4IIUA 3UJAA 2EKQA 3DXZA 3GLTA 4MHSA 1JHRA 1NJ5A 1IK6A 4FGSA 3SF8B 5HCNA 2G8LA 4BMOB 3ETCA 4IEIA 4WFIA 4PSUA 1EX9A 2IUUA 3UMRA 4Z8XA 3S2GA 4J7AA 2HK8A 4JQSA 1B8NA 1FVFA 4IQ0A 4HDMB 1DJNA 4Q02A 1HZZC 1OI7A 3LJKA 3N3AC 1O9BA 1QKJA 2V7BA 1T5HX 1ZN2A 3VFDA 3R0VA 1XRPA 3ZIDA 1Z16A 1K92A 4I36A 3DPIA 5AVQA 1M72A 4UBMA 4MQBA 1FNNA 4O4HB 5DIZA 1XWIA 3OICA 3Q11A 3VR6D 2G1AA 3HSKA 4NECA 4CM3A 4X1YB 1PGQA 1RAFA 1C1DB 2EBHX 2VDVE 1BD4A 2EHDA 5FWXA 3VX4A 3B9QA 4Z54A 3KJNA 4Q3CA 2F1HA 3IQIX 2XA1A 3EIHA 4ZV9A 2JJ1D 4ISCA 2D2EA 3O2QB 4BBJA 4MCIA 5BPFA 4MARA 3QKSA 4NCXA 5ESRA 2V65A 4F3NA 4JN6B 1T43A 4X8MA 4J0DA 2P6MA 1C8KA 1CUVA 1WEHA 1LB1B 4EMBA 5AVUA 4YAUA 4FQ7A 4KR3A 1MZPA 3FZGA 1EQ2A 2CJYA 3I32A 2CE7A 1XRRA 4CM5A 4NP6A 3TD9A 3WK4A 4Z4CA 3RARA 1RLMA 2KLHA 1M2GA 5TLSA 3MTBA 4XEUA 4JJGA 1QRTA 2I3AA 1H5QA 2V5UA 4C06A 2DB3A 1KY5A 1VE6A 2HF2A 3KTAB 4Q3EA 4CLOB 2BFNA 2H63A 2WY2D 1W2WB 1MBZA 1RU3A 2D00A 1QLJA 2H08A 1U0RA 1EM6A 2HSDA 2QX8A 4JBGA 1D4OA 3AT1A 3TLMA 4G85A 4LFBB 5IDQA 1W2GA 1YAHA 2VQ6A 3ZW9A 2QLBA 2PNFA 3V7UA 1YOBA 2WNIA 3AF3A 1JTFA 2OK8A 2YR0A 3RVRA 2HDHA 1XLUA 5ALMA 2UV8A 4JI4B 2ZW9A 1IY2A 3C7TA 5E38A 3QX3A 2ZBQA 1FRNA 2BAGA 4JJIA 4LISA 5LN1A 2EKZA 3AL2A 3RUDA 5IF3A 4XJXA 1G8SA 4HEJA 4J0IA 2J1LA 5JWRA 3NOOA 5CCDA 3R7WA 1XCBA 4B7UA 4EEZA 1YB2A 1GGHA 2BIFA 3M6VA 5JXGA 5HIAA 4EDFA 3K9QO 1IPHA 4AZWA 4O08A 5HKKD 4YUYA 1TU0A 1X1SA 1GPMA 1L4NA 2SICE 3KJQA 4GQIA 4K9NA 3L84A 3GPCA 3PNMA 4Y6QA 2EG9A 4EH1A 5LZ9A 2F8LA 5HCIA 4JLSA 5DHSA 4BUZA 3JARB 4BQQA 4LVCA 3AYXB 4MB0A 3DJFA 2B83A 4X24A 4G0WA 1W0JD 3EGCA 2A84A 1SHKA 1I4DD 3E8SA 5SYNA 2GHTA 2XITA 3VV3A 2V0GA 3KQQA 4IMIB 4I0WB 2A88A 1Y8ZA 4MV1A 5IUKC 3WADA 3Q7EA 2PKWA 2OHFA 4KJXA 5AKEA 5DYGA 4DBLC 3KPUA 3T06B 4YPVA 1EGHA 5BXQC 1DUIA 3OCYA 4HAIA 4LECA 1NLZA 2OGUA 1NUQA 2RK3A 4EHAA 2PSJA 4LAFA 3SEQA 3G68A 5HNKA 4E3ZA 3VZQA 5KX5A 4M21A 4XUDA 3TI9A 2JLUA 1NV8A 1UBSB 1N6IA 1NMZA 3BXZA 2H2DA 4FHDA 3TJZA 6YASA 2H5LA 1A9PA 3QE3A 5F51A 1G19A 1V6AA 1FP1D 1L1RA 3RO7A 4CCWA 2XA9A 2RBEA 1XEAA 2R6ZA 2XWPA 1U8TA 4YC7A 4ER3A 3AXSA 4LXXA 2M6SA 2GCIA 4G86A 4E30A 5FPKA 1I9GA 2VYCA 3H1GA 3JYLA 3PC8C 3I2HA 1AKQA 4RA6A 4TRRA 3D2CA 2EARA 3MIIA 4BMNA 1TTHA 3GMTA 5TB5A 5CDGA 4KQ2A 4DMLA 1KP3A 2OV4A 3GVHA 1EQAA 3QWIA 3RBZA 4LCBA 5LVAA 2GFQA 2X8LA 2GAIA 3KTOA 3PFNA 4LW8A 3ZWCA 3R6TA 1K8YB 4CMKA 4YV2A 4OBEA 3LQ1A 1S2NA 3FCYA 4PSCA 3PPVA 2BELA 3ZHSA 5GGYA 1WKVA 3H4TA 3ROEA 4PU0A 2PYDA 2PO7A 3IE0A 1Z7YA 3V48A 4FYVA 4IKPA 3OZ7A 5IAOA 4IGKA 3LXMA 4IR7A 2B61A 3B5EA 3EAFA 5ULLA 1SIUA 1DC7A 2HR1A 1AJEA 2A14A 4XYMA 5I7OA 3FUWA 1JZSA 1PR3A 4FN4A 2QMHA 5H81A 3NLLA 1RR6A 2HQBA 2DYKA 3KKKA 2GD6A 3QUSA 5WRFA 2AD1A 4XUEA 1TIBA 4LNHA 1EB9A 1P4GA 3BGDA 1M5UA 4FB4A 1XXHA 1TM1E 3RDPA 1B0UA 1JR4A 1BSVA 4MRMA 1W52X 2EWVA 5CVTA 1N9KA 1DBSA 4I50A 2D5AA 3O4RA 1K7CA 1EA7A 3NBZC 1N5RA 4P5DA 4YBRA 1X92A 1N1DA 2HMUA 1QUFA 3MRVA 3IB3A 3A4YA 4H08A 4MEAA 3K6JA 2WFZA 3WLKX 5IJ9B 4OTZA 4QHSA 2XMBA 1KP2A 2YL2A 4UTXA 3FCAA 2JJ8A 4NV3A 16PKA 3FX2A 4HQOA 4FTWA 2IC5A 2LKCA 4D44A 2C4MA 1I4TD 5AK4A 4DG8A 2SECE 2J3MA 3GNQA 2PU7A 3BULA 1FP7A 3H1AA 2BYTA 1O5TA 2LR0A 1SXPA 1KY2A 3PXEA 2QSYA 6LDHA 3F6PA 5FHQA 5KYWA 3L8ZA 2GHIA 5A2GA 5FNZA 1O95C 3STTA 1QG0A 1GQ2A 1TF7A 3AXTA 2CL0X 3SOPA 5TPWB 3B7WA 3QOXA 3OJXA 4FQ8A 5F23A 2RHDA 3FHLA 4HDKB 3RF6A 1BVUA 4LJLA 3V4PB 2C1EA 3O8OB 4Z0PA 2IYEA 4Z4IA 3AF4A 3HFGA 3K30A 2ONYA 1RWWA 4N3BA 2J59A 3ZE9A 5LC1A 4D3SA 4D56A 1M54A 3B6KA 4NU6A 1GZHB 2CEAA 4ZZ3A 1H94A 4KQWA 4MV4A 3SF0A 1RRCA 2REXB 4JOQA 2WYHA 3PNOA 4BX9A 3HCCA 3S4YA 3T5TA 4AVYA 5IN5A 3I4FA 5CYPA 4YRZA 1NV9A 8LDHA 3IAS1 1IN1A 4RVUA 2XZOA 4JLMA 1KZHA 1XZGA 2OC9A 1S3SA 1QYVA 1Y1QA 3L6EA 2W48A 4UU8A 3ZY4A 1FEZA 4RLQA 3GA0A 5A7GA 1ILEA 1CJVC 4KZPA 1CYEA 3HB7A 3ZKAA 1QV7A 2XUGA 4E5YA 2DJIA 3R3WA 4OB7A 1G20E 1K6JA 4CKCB 3K92A 3ZH9B 5JFGA 5E1DA 2QUBA 5EIXA 4LXIA 4N01A 2PG3A 4JASB 3I34X 1G1AA 3L1JA 4ZT5A 2PKXA 4J75A 1FU8A 1DO8A 1D3AA 1QK4A 4PPQA 3V2IA 1AV7A 4A23A 2UYGA 2ZATA 3IODA 4EMTA 3BMCB 3ULKA 1Q7BA 1I2MA 4L51A 1X8XA 1Z4JA 4OU4A 1L7MA 3CVVA 1D4ZA 5AXAA 1E3WB 1XT6A 4X92A 4ZU1X 2UKDA 1TUGA 3OM9A 3L02A 2Z1MA 4N18A 4IYRA 3X1MA 4PN7A 2PKRA 1F5SA 1NPTO 2P9EA 2CL7X 1WDKA 4H16A 4CTNA 3WV4A 2J0SA 3RC9A 1AH2A 5IX8A 2XNJA 1ZRSA 3DW1X 3SZUA 4LPSA 5FI3A 2XUJA 2Y68A 1NI3A 2QX7A 3FDFA 3QWBA 5CX4A 5F3RA 3TTXA 2C2KA 5IKMA 4PQFA 4P80A 3K32A 3AVWA 3ZW8A 1TA9A 2FOXA 5JQGF 4RZ3A 1CUFA 4YY3B 1I0LA 2FN3A 1D6JA 4E7PA 1USIA 2ZSHA 4YB8A 1JG6A 4EVQA 4G36A 4L75A 1F0PA 2IPAB 2ZRIA 1JHZA 1G5FA 2AN3A 1RI1A 2BFDA 2HHAA 3KZVA 1R7RA 2ZYRA 4ND4A 1JXAA 1I32A 1E0KA 4NH0A 2I80A 3KEMA 3OT1B 3SXJA 1JKJB 2Q29A 3EIUA 3NT4A 3EIEA 4U63A 3PWZA 1P6UA 1PR0A 2F67A 4LCEA 3V1MA 1U3FA 4ARBA 2J5BA 3PPXA 3SQMA 3S6JA 1EP9A 3QBEA 1FSGA 1P0QA 2Q07A 4K7JA 4ND5A 4WOJA 3A1TA 5TF4A 2YV5A 4G5XA 3CCBA 4HXFB 2J7PD 2FVXA 3DKVA 5FO0A 4H1WA 2GBGA 5KJEA 2JZNA 5B12A 4CG2A 1KEPA 1THGA 4CIVA 2HB6A 4YA6A 4CU5A 2CXQA 1REQB 4L4SA 3ZLUA 2HQRA 2A9QA 2Q4RA 3QLTA 2PUGA 1DTSA 4E21A 1Y63A 4YR7A 2W7TA 1AV6A 4TT3D 5JG7A 1TEXA 2H06A 3ZE6A 3PIRA 3VTAA 4G0PA 1JYFA 1T36A 4GMXA 2KJQA 1UP4A 2IYRA 2Y92A 2YRXA 4R8RA 4NOKA 5FCDA 5LQAA 2VTEA 2WHRA 3NGXA 4YCNA 5L3RA 1WJGA 3C45A 1SCIA 4UQPA 1DJQA 4PTYA 3SBEA 4B31A 2VIIA 4EEXA 3UMSA 1JEQB 3E9QA 3SC4A 4MPPA 1BO6A 1M10A 3USES 1AHIA 3ZV4A 3C98A 1FX0B 2NO1A 2RHJA 2RK4A 3AKEA 1WULS 3GPIA 2AG5A 3JVVA 1E61A 1QCYA 4K9MA 4X63A 1PEKE 4ZCPA 4YTEA 5K51A 3UHOA 1BCRB 3DBLA 4H3HB 4D5EA 2VYNA 1ONPA 3KJZA 4ZTUB 2B8EA 5D00A 4M0CA 1D4FA 1WSWA 3OUTA 4EYQA 3BXEA 4KPEC 4PAOA 4Y8VA 5HXAA 4KXFB 2EFDB 1EK5A 3CKMA 5E1BA 3IAAA 1GCIA 1YS2X 3QSGA 2EIHA 3F5DA 5CIWA 1AGXA 1KBOA 2EFYA 2WJVA 2E4XA 4EMUA 1LNSA 2YZGA 1OBVA 3R9XA 1UQTA 4QUHA 4R9RA 1PDOA 3AEQB 4L0CA 4DQUA 4PGGA 4MVJH 1NHGA 4PBTA 1ZIDA 3NWPA 1WZUA 3X1ZA 1EZZA 2PLRA 2E0IA 2JFPA 1R6VA 5JNLA 1RHUA 3PR1A 4JJ7A 4QU5A 4KSCA 3CN7A 1USUA 5GZ6A 3VPXA 4YT4A 2WM2A 1X7ZB 1R27A 1Z2NX 3FNFA 5D85A 3X1DA 1Q1EA 1O97C 2I34A 4IDFA 5EVCA 1EHIA 2ZAMA 1YQ9A 5EEGA 3BWVA 1T3ZA 1CCWA 2GSWA 4RKWA 2OWDA 4BJ6A 3PWTA 5HJEA 1FMJA 3ANLA 4UD2A 1UAGA 4OI2A 2CMHA 1FS6A 2W6ID 3T1TA 1BX1A 2Y99A 1A7AA 3EIWA 1G5RA 1WKCA 1VQ1A 3VO9A 1R6UA 2OBLA 4M8NE 4XLTA 1FXWF 3AU9A 2HPZA 2VPTA 1NY5A 3BJMA 3DF9A 4O59O 5IABA 5KSYA 4Z3DA 1SO8A 3FLBA 3DD5A 1JPUA 1K63A 1EDBA 1E20A 4B3BA 1BW9B 2RHMA 3V33A 1WG8A 3O1LA 3QE0A 4XFDA 1Y81A 4ZN6A 1Z2OX 3LVFO 4Z0NA 1YQWA 3H18A 3I9JA 3EG9A 3KUXA 1OYVA 1V7QA 1V4NA 2YIJA 4GM0A 1NE7A 1QFMA 1SUAA 3GMSA 3B2QA 3F6SA 1E7MA 1T0JB 3CEMA 3GQBA 3TKYA 4ZEMA 4XPZA 4EARA 2AEFA 2PH3A 2DLDA 2NADA 2VUSA 4CIWA 1KP9A 2AVDA 1JG2A 3PNPA 2QY9A 5CJ2A 2JI6A 2Z98A 2C8KA 4G5QA 4GAEA 4JBIA 4YP1A 5ICGA 1RLUA 3O2NA 4B3TB 2G4LA 2G71A 2VJNA 3A3NA 4RVCA 4Q9KA 5BN4B 5T4BA 5C8DA 2ET6A 4RD2A 3DZIA 4YHHB 1YR6A 5J9FA 3K0AA 4Z2AA 4KBGA 5EJGA 3DKPA 3U17A 1SXJD 2H54A 1P19A 4UCFA 1NN1A 2XUFA 3KQSA 1NVEA 2CNLA 3AY0A 4IJUA 4TVBA 5EZYB 5A4AA 1OXSC 1B0AA 1GRQA 3KVRA 4JH0A 1NXPA 3LX8A 4D96A 4Z5XA 4GMFA 5F7OA 1Z5VA 5KYXB 5FFNA 4X93A 4RHXA 3OQMA 4N7MA 1LI5A 2Y27A 3HCRA 4DA9A 2EKBA 3AB7A 5COQA 1U1EA 1T2EA 4BFXA 5K5EA 2XIQA 3H7IA 1DCKA 4NCIA 4AF7A 2QBYB 1QIJA 3HCBA 1G20B 3JY6A 3C6MA 4LHXA 4OY3A 1A72A 1PG2A 1RZ3A 1WNFA 3E35A 4O2BB 4MVJE 4YRTA 1TMKA 1UFRA 2H4XA 3PGXA 2H1WA 1C9EA 1P80A 2QTFA 5A0FA 2VDKB 4B3RB 4JMPA 2ZQZA 3HP4A 1Z4IA 4ACBA 1NVFA 3GUZA 1HGXA 2FFJA 3MAGA 4CCYB 3GLSA 4N41A 3U40A 4QOGA 4NVRA 4MYCA 2VDJA 2WYOA 5D1NA 2YFHA 3FF1A 1LZKA 3STVA 3M4YA 3QUQA 3V46A 3D5QA 3QIAA 4YT5A 1QVZA 1HBJA 2XUHA 3CLTD 1ZNYA 5CFRA 1M6YA 3SHVA 5BY2A 2OCGA 5LIRA 2Q5HA 3FNRA 1JE0A 2FOLA 1K7EB 2YRWA 3KZKA 4OLFA 5KYYA 3CZRA 2IF0A 1PR2A 2OPHA 4RD4A 8GPBA 4URXR 5JLAA 2BFWA 2P11A 5FUMA 4XM2A 5JWHA 3TLEA 9ABPA 1C1YA 3FHTA 4BUJA 4DT1B 3NX4A 2VT7A 1VSQA 1C4XA 1OAAA 1T8UA 1IZZA 3EGEA 1SWWA 3ZCXA 2BZ1A 2WHPA 4XQ0A 4EY5A 3QQ5A 1U1IA 3E8XA 1XDZA 1AQ6A 4OHWA 2O7QA 3WNBA 1S8NA 2ZE5A 4XGKA 5ALUA 3SSOA 3F73A 1W19A 3DP9A 2H0QA 4DZTA 3G2PA 4IILA 5AJXA 1Y82A 3NVAA 1D09A 4DLVA 1QRDA 1CQJB 4M8KA 4NE9A 2WJWA 5K0GA 4W63A 3ZGVA 1T1GA 4JCOA 3ABOB 1WF6A 5FQOA 2B34A 2NO6A 4PIPA 4YRSA 3M1IA 3CWZA 2CDBA 1OD6A 5LPNA 3HGQA 4J0KA 1T9DA 4MGYR 3HY6A 1A95A 1MH9A 2RGAA 5K0LA 3VTFA 1WMBA 3QKRB 1QU2A 2Z6VA 2GTHA 2JK1A 3KVYA 4UMEA 2VAPA 1SIOA 2QXTA 2EC5A 1HI9A 3R5SA 4L4ZA 5EJ2A 5LZ4A 3CVXA 1GZ6A 3CEPB 1FFCA 1PR4A 2IXDA 5I7VA 1UPAA 2JCXA 4E5NA 4C6HA 5DX1A 4AF6A 3MOIA 4CKEB 3NS7A 4AJEA 4DR2B 3L93A 1AUVA 2VRCD 2K4MA 2ZIXA 1CF9A 1SBIA 2GF0A 2OZPA 3EXHB 4J9UE 4LE1A 4B33A 2PZEA 4OMCA 5IFKA 5D3KA 2B0CA 2W6NA 4JOSA 1D04A 1W87A 2VAXA 5IP5A 3T5BA 5EJEA 4WGFA 2CZGA 1S96A 2P68A 1PZNA 4ZK6A 3LIIA 3FG9A 5AESA 5LQCA 2CFTA 4MWBA 2ZS7A 2EW8A 4CKWB 3FMOB 4XDYA 2KBFA 2ZU0C 5U4XA 1AA9A 3HB9A 3NI2A 2OCXA 3F4BA 4RH1A 2BWJA 5EMLA 4B6GA 4WSOA 2BLNA 1NBMA 1Z56C 3KG2A 5HILA 2AA3A 2XYRA 1SG0A 2YXBA 3PJGA 1GGMA 3NV7A 5FPQA 1YRLA 4DMHA 1UJCA 3D8HA 4YIHA 2MU1A 1DCFA 1PGOA 1G3RA 3VR1A 5AW8A