3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
molecule tags Oxidoreductase
molecule keywords Hydroxyphenylpyruvate reductase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
1DHRA 3QSGA 4GLLA 2AE1A 2C29D 4O5OA 5GMOA 2OORA 1K6XA 4FQ8A 2GGSA 4TKMA 4DQVA 4XQEA 2B5WA 2BELA 3VH4A 5TC4A 3PI7A 1LU9A 3VZPA 5CAEA 3CZRA 4LRTB 2O50A 4NFSA 3DDNA 2IYOA 1VSVA 4MOWA 4JROA 5DN9A 5FI3A 3HJAA 2JD1A 2Q1TA 4CM8B 4UUPA 5CP8A 3H3FA 1AHIA 3ZU4A 1F0YA 1QV6A 2HK7A 4ZD6A 3WMXA 1WLYA 3X2EA 1LBEA 3Q0EA 3WOHA 4CL8A 3LU1A 4J16A 3T4XA 1UDBA 2C59A 4BVAA 2EJVA 4D0SA 4OAQA 2BHLA 1WP4A 1U3VA 3A4VA 3B70A 3DZHA 4M49A 3P5SA 1FDVA 4J7CA 2JAHA 2AEMA 4H15A 4ZJUA 4CLOB 1ORRA 3LLSA 1VJ0A 4FFNA 3W4JA 2TMDA 3I9JA 2X0JA 3B20A 4PLWA 3M1AA 3NDIA 4GBJA 4INAA 4XRGA 1ENYA 1ADCA 2EKPA 1PL6A 3SVTA 5DCUA 3VC7A 2AEFA 4XB2A 1NAIA 4LMRA 4EZBA 3TSCA 2O2YA 3V5NA 4JLWA 4GX2A 1PGJA 5K6AA 1W6UA 1QLJA 3TNLA 4BKUA 1NNUA 2BFPA 4DL9A 4FS3A 1HLDA 1EZ4A 2Q45A 4N5MA 1KEPA 3I9OA 2I6TA 4K26A 1ZSVA 3NJ8A 4NBUA 4CJXA 2O3SA 4ZVVA 4PN3A 2W8ZA 1ZZEA 3L0DA 4HFNA 1K6IA 2PFGA 5ADHA 2PH5A 4K6CA 4GKVA 3PEFA 4MINA 3SX2A 5F21A 2FR1A 1WPQA 2Q99A 2WD8A 4RL6A 2YZ7A 3PDUA 1PZEA 3RIHA 4MVJP 1AHHA 3H3JA 3HSKA 2BMAA 1NQ5A 2PGDA 2CF5A 4FPXA 4YEDA 5TLSA 2VN8A 3QRWA 5B37A 3RU7A 2RH8A 2E6UX 3H9EO 1LDGA 3H5NA 1D1SA 5AOVA 3ZHBA 1WMAA 4Y98A 1ONPA 1N5DA 3KM0A 5IZCA 1RPNA 3RFXA 3TZCA 1FJHA 1C1XB 4BNGA 5AXAA 1NX6A 4GSKA 5L95A 3JV7A 2HUNA 3WMWA 2EW8A 1UXJA 1R4MB 2OBNA 1XYGA 1IHXA 1OC2A 1Z75A 1CDOA 3RJ9A 1RYDA 3HDQA 4YJGA 1X7HA 3PFWO 1X0XA 1I5RA 1YGYA 1V3TA 4XCVA 4CM7A 4P38A 4TRNA 3FN4A 1XCBA 4TRRA 3JD2A 4PZEA 2IZZA 3PJFA 5JSFA 3H9GA 3TL2A 4XQ9A 4DXHA 5TX7A 5FWNA 2YHIA 4PG7A 4LMPA 3S2IA 4WLNA 1WZEA 4Y9DA 1HDCA 2D3TA 4XQGA 1QR6A 4YJHB 1CRWG 4D3DA 4UEOA 4ZN6A 2FMUA 5ER9A 4XGNA 1MXFA 3OBBA 3W4IA 5C5IA 3CIFA 1ZXBA 2BD0A 3KXDA 3KYBA 1T2CA 2I67A 3VH3A 3V1YA 3OH8A 2CVOA 3OJOA 4Y6SA 4D44A 1PGOA 3WQRA 1EUZA 1C0IA 4BNWA 5KKCA 1TT7A 4UVGA 2PY6A 3FTPA 3EHEA 5I9NA 2ZB8A 4RF3A 5CFZA 4BGEA 3FR8A 2JCYA 2SCUA 4GWKA 3ZWXA 4ALIA 4CLHA 1WDMA 3V2UA 1Q7BA 1H2BA 2HDHA 2C7GA 1IL0A 4YRAA 2X0RA 3HFSA 1GD1O 1ZSYA 2VWGA 3ANNA 4A73A 3FSRA 1PQPA 2GR9A 2DLDA 1NR1A 3O38A 2NADA 3ETDA 3AY3A 4FFOA 2HSDA 2OUIA 4BKOA 3JD3A 5TJ9A 2VHZA 1IYZA 5I7EA 1PL7A 2QW8A 3UKOA 1RYEA 3FBGA 4GLOA 1ZJZA 2DBZA 1UXHA 1E3IA 3M1LA 4Z0TA 2X58A 1T24A 2X5KO 5BR7A 2CDAA 4ROSA 4JN6B 4P8RA 1DHTA 3D4OA 3F9IA 3Q2IA 1T2FA 5HA5A 4PIVA 3K92A 1N7GA 4BNFA 4TSKA 2QIOA 1J4AA 3WLFA 1TI7A 3BMNA 3DMTC 3D4PA 1PJTA 3VPXA 5CG2A 1G6KA 2D4AA 4MDHA 4OSPA 4W7HA 4WCDA 1NPYA 3QVTA 1U3UA 3EVNA 1O8CA 4IM7A 2I66A 3KZVA 1MG5A 4YB8A 3WGGA 2Y1CA 2CMDA 4XJSA 1PR3A 5JPIA 2GZ3A 3JQ9C 2J3JA 3SLKA 1LSJA 3I9MA 4W82A 4FC6A 2X22A 4EUHA 2O3JA 1NQOA 4L9RA 3WSVA 2Z1NA 1A5ZA 4R16A 1JKFA 2HCTA 3I52A 4YYZA 4EEZA 3E5MA 4RJTA 1JWBB 5IJZA 4MVJE 3IC5A 1PZHA 5AYVA 4MO2A 1RM5A 4RCVA 5KOIA 1EE2A 2BFAA 2JD2A 1YRLA 1FDTA 3KB6A 3NKLA 1N92A 2CDBA 2HKIA 3WQQA 2D5AA 4ZA2A 1N9GB 4Q3AA 1BXKA 2Q1WA 2I3AA 1YB5A 1GEEA 3KBOA 1VLLA 3INGA 1T1SA 2VWQA 3D3WA 3ZWOA 2V6GA 3TZHA 2PLAA 3AWDA 5L7WA 1ZW1A 1ZH8A 1E3SA 2QHXA 2C7VA 2H5LA 4CUZA 2ZJ0A 3RKRA 1HEUA 3I5MA 2FPGA 5EIOA 2PNFA 4II2A 5HS6A 4E30A 1UXKA 2Q49A 3NTOA 2C82A 3AW9A 1PGNA 3LC2O 1LDYA 2GN6A 4MVJH 1ZSNA 3H2SA 3H5AA 5IAAA 2UYYA 3GF4A 3RD5A 4S1VA 1C0PA 4CLRA 4FN4A 3K30A 2NU7A 3HADA 2ZB3A 1GR0A 2PKRA 1UAGA 5JAZA 1E3EA 3O03A 1IZ9A 1GFSA 3UF0A 1DBVO 2PD3A 3MJ4A 4EW6A 1EDOA 3DWFA 3GRKA 4I5GA 1DIGA 3K5PA 4GPD1 5KVCA 1GUYA 3C1TA 4MIEA 3ZWBA 3TQHA 3AOEA 4Q3CA 4OXYA 4E13A 2JHFA 1JTVA 3TOXA 3W8FA 5JW6A 3PHLA 4QFDA 4R01A 3PZRA 3GEGA 1KETA 4DYDA 3GT0A 2QRLA 1LLDA 1ONOA 1P1IA 2GN9A 3AI3A 1E7QA 2VYNA 2PV7A 4OQZA 2JFFA 3AUTA 1OAAA 4AICA 2IEBA 3F47A 3C7AA 4J0FA 3WBBA 4CMAA 1NBOA 1N2SA 2B69A 3UFXA 2ZJ1A 2VOEA 5A1TA 1WZIA 1Z45A 2VZ9A 4J4TA 2V65A 2X5OA 1U5CA 4CLDA 3N58A 3MJEA 2IDZA 5L40A 5L53A 4LGVA 2ZCVA 4UAGA 4WASA 5G4KA 4Z9FA 1FDWA 1VJ1A 4O6VA 1XSEA 1O89A 4CMIB 1AN9A 1ZBQA 2WMDA 1IHYA 3VKUA 1E5LA 1CEQA 5EQDA 3CKYA 3AFNA 4DRYA 1MUUA 1U8XX 2JAPA 2NQ8A 1O94A 2YDXA 1MGOA 4UULA 2VYVD 4JP2A 1ULUA 3ZGYA 2AA3A 5A3JA 3FHLA 5THQA 1B8VA 1P0FA 3PLNA 4JQCA 4YCAA 2O7SA 2J3IA 1DRWA 4PLGA 3GOHA 3AUSA 4UUMA 4BO5A 2FR8A 1BG6A 3CZMA 5A9SA 3UH1A 4URFA 1T1RA 1D4FA 4FJ1A 5IF3A 4NR0A 1WVGA 1WDKA 3ZWYA 4WUVA 1S7CA 3NAQA 4W99A 4DTIA 5AXCA 3U5TA 2V7PA 2PWZA 1A27A 2NTNA 4IDEA 4BGIA 2OO5A 3H2ZA 4ZU3A 2HJRA 3TRIA 2GO1A 4WE3A 3F3SA 3ON5A 5G0VA 4LRSB 1P1JA 5DBIA 3EUWA 2G1UA 4JK3A 3FNFA 1KVTA 4WJZA 1R0LA 4E4YA 5ENVA 3JYQA 3M2PA 1LUAA 2J6IA 4JX8A 3KETA 3IP3A 3L4SO 3U9LA 1P33A 1HWYA 1V3VA 2JKVA 3K8ZA 4ND1A 5ENDA 4N18A 4B7XA 3TZQA 1LQTA 2I76A 1KVUA 5AXBA 2Q46A 1YB1A 1R4NA 1QXSA 3L6EA 2Y0DA 2WD7B 1YDEA 1MXHA 1PQUA 1ZUD1 4L4XA 4M89A 4U6SA 4WCFB 5JNLA 5EMHA 4R1UA 5I8WA 5EL0A 5COQA 2C20A 3GH3A 5JLAA 1LTHR 2ILTA 4ZQBA 4JBGA 5T8KC 3B6ZA 3TDKA 1TLTA 5L45A 1B16A 1K2WA 4Z9YA 4DVJA 4IUYA 2VHYA 1Y9AA 4NQZA 2G82A 4IXTA 3S1LA 1JA9A 1SEPA 3QVOA 2D0IA 4KMSA 4PLCA 4HXYA 1J6UA 2VYND 2H6EA 1NPDA 5G4LA 3WX0A 4A03A 2B4QA 2LDBA 4R1TA 5CG1A 4GI2A 4Q3NA 2ZYDA 5IFLA 2XPCA 4WLEA 2HMTA 4CV0A 2IYPA 3U3XA 2VTEA 1U2GA 3WGIA 4IJKA 3ZV5A 4LK3A 1B8PA 1E3WA 4NJOA 5CDTA 4MVJI 4UVHA 3OIFA 2D5CA 1Q2XA 2ZQZA 1ID1A 4DPLA 4I9UA 5COAA 2NVUA 3S55A 4CMJA 1DAOA 4W4TA 1YE3A 2Q50A 5L7TA 5JY1A 4NI5A 4F45A 1PEDA 1HYHA 2FZEA 5A5FA 4C4OA 4AJ1A 4D42A 4E32A 1JN0A 1O0SA 3AM3A 4BKQA 4UUOA 3C8MA 4ZQGA 1DC3A 2PH3A 3F6YA 1Z74A 1EK5A 4JBHA 4LN1A 1R4MA 5A02A 4BNYA 5JAQA 2OXIA 1U4OA 4J2HA 3DEYX 5T67A 4YT5A 1E7RA 3GDOA 1Q0LA 1I10A 4FD3A 1GAEO 1K3TA 3HB5X 4YJGB 2VZ8A 1SNYA 1M6HA 1Y5MA 1ADBA 3EZLA 3HN7A 3DXFA 3AI2A 3W4KA 4UVEA 1IPEA 3A9WA 1Y9EA 3FNEA 4PRLA 3WG9A 2B5VA 5DCYA 3S2GA 2JCVA 2UV8A 2EW2A 3E82A 2PZKA 3RVDA 3JSAA 4MPDA 4WOKA 4E21A 1U4SA 3DTYA 4PG5A 2ZTMA 3DBRA 4XQCA 2W2LA 1PJBA 5K6AC 4DPKA 2VHWA 1KYQA 4TVOA 1KOLA 1E6EA 4B4OA 5JXWA 5HTOA 2UDPA 1HZZA 2GLXA 1ADFA 3A1NA 2YFHA 1DAPA 4RVHA 1DC4A 3PLRA 4IQGA 1LRLA 1MB4A 2C2YA 2DT5A 1FK8A 4W7IA 1GZ4A 1PJ3A 3JQBC 1M75A 4YA6A 3VTFA 2VT3A 4WLFA 3PHIA 3W8DA 1D1TA 5L51A 3TFQA 4DLBA 3JCZA 2GZ1A 1KY4A 3ROPA 5BSEA 1JKIA 1DLJA 3COSA 4J7UA 3NTQA 1VM6A 2QX7A 1KEVA 3VAZA 5A3VA 3U4IA 5TIIA 1XQ6A 4IPTA 4IBOA 2D59A 3GN2A 4OMUA 3QWIA 4BNHA 1ZO8A 1KEUA 1BXZA 1C1DA 3E18A 1CWUA 2PKQP 4R68A 1EEHA 3MJCA 2PR2A 3LT4A 4AJEA 1R6DA 3AM5A 4N54A 1U1IA 2R6JA 3FWNA 4HBGA 1RM3A 4CM5A 4L0QA 2OBYA 1YQXA 2ZATA 3DMYA 3FI9A 2NU9A 3QW2A 1PX0A 2NV6A 3D64A 3PK0A 2IZ1A 1CQIA 1CERA 5CHEA 1EFKA 3KOUA 3ITKA 5FEUA 1BXGA 1U9JA 1E3WB 5B12A 2P91A 4WEQA 4KWIA 4B3JA 1Q0QA 3MWDB 5A03A 5KCZA 2P2SA 3DBRB 4LISA 3ZDFA 1L1FA 3ANMA 3OQ6A 2IXAA 4ND4A 3D1LA 3OJLA 4E31A 3W6UA 3LT0A 1P1RA 4FGWA 3VZSA 3AOEC 5JDIC 4L75A 4BV9A 4BO1A 1T25A 4D43A 3IAHA 3GVCA 2PZLA 4EITA 3L6DA 4YVFA 4NJMA 3WDSA 4KZPA 1H6DA 3RASA 5A5EA 1YL5A 1NVMB 1FXSA 1EBUA 1ONNA 2OZPA 3LC7O 2XXBA 3BMCA 3GFBA 3GGGA 2FSVA 3PDJA 1WMBA 3WR5A 2EP7A 3I1JA 1DIHA 2Z95A 4OKNA 1B2LA 1PJCA 4KDEA 4W9NA 1SAYA 4E5KA 3FBTA 4O63O 2BGMA 4CODB 4NNJA 3ZI0A 2QZ9A 2GRAA 4CMKA 3HNPA 4D41A 3ZWVA 5LDGA 3GMSA 1ZK1A 3IJRA 2Y0EA 2VT2A 3VVCA 1GYPA 1BDMA 4NHEA 4MJLA 4DMLA 2BH9A 3CPSA 2G5CA 1IUKA 4E5PA 2AQKA 1R66A 2V6BA 3IP1A 3DTTA 3KLPX 4IDDA 1BHSA 1YBAA 4U5QA 1EVZA 3PQEA 3DZJA 3C7DB 2YW9A 3UICA 3I6QA 4GX1A 3PP8A 4DUPA 2CVZA 1X7DA 4CM8A 2YHUA 4Z3DA 3RBXA 3DAGA 4CM9A 2EP5A 1I33A 4R41A 5AXDA 3L4BA 3A28A 3TPCA 5A04A 3E6AA 3HZZA 4DLLA 4WLOA 4EYEA 3INTA 1GCUA 3PHHA 1F17A 2W90A 1WXDA 2WWRA 2DAPA 1RJWA 1KEWA 3WFJA 5HBRA 1T4BA 1X14A 5CDGA 1NWHA 2BRUA 3P2OA 1SC6A 3ITDA 4CLXA 1KC3A 1TT5B 3WJ7A 1ISIA 2RIRA 3DBVO 4MKXA 1RKXA 3ANLA 3PGXA 3JQGA 4ALMA 4FFLA 1GUFA 1LLUA 1Z6ZA 4Q3BA 5DP2A 4CQMA 1G1AA 2I5PO 3BMNB 3OJFA 4BO7A 3I9NA 4TMFA 1P1HA 4XYEA 3W1VA 3WGTA 2HRBA 3OA0A 3RC9A 4IZHA 3W8EA 3IQDB 1A7AA 4FJ2A 3RC7A 1W4ZA 1SZJG 3Q9UA 3JD0A 2BI8A 3SJUA 3DZFA 4PLPA 2CDCA 5F3RA 4RQUA 3PJGA 4WOJA 5H82A 4D3SA 1I36A 1N1GA 1AXEA 2QRJA 2RCYA 3GNQA 3GVXA 1A4IA 1OI7A 3ONEA 4PLVA 4CMIA 5KJ1A 1GUZA 4RZIA 5F5LA 3C1OA 1ZMTA 2X8LA 1PIWA 4WKGA 2X9VA 1ADGA 1TT5A 4TWRA 1MC4A 4A0SA 2J5KA 3LYLA 3BA1A 3TZ6A 4ND2A 3K96A 4HY3A 4R4JA 4K28A 2X5JO 2YV3A 3C7CB 1H9AA 4P22A 3V1UA 2ZYAA 4YJHA 4A7PA 2BFMA 1JVBA 1SMKA 1D3AA 1HL3A 2QQ5A 3VZRA 1UXGA 2HLPA 3HDYA 1ZKMA 3P2YA 5I7SA 3ICCA 3GG2A 3WLEA 2WE7A 4QEDA 4E6PA 1XKQA 2GERA 3LQFA 1VPDA 1HLPA 4U8GA 1XQ1A 4WGGA 4LCEA 3VDQA 4NJMB 1H5QA 2RHCA 2FPIA 5EN4A 4YPOA 5JYDA 2AMFA 2DTDA 3ZZNA 3GDFA 3H9JA 4YRBA 5TF4A 4BNZA 2AW5A 3ZWNA 5DT9A 4CQLA 3AM4A 3JQ8B 1ISGA 3IDSA 3K2EA 5TQVA 1X13A 1WDLA 3RKUA 2J5RA 1EQUA 3HQ4O 5GY7A 2P68A 4E0BA 3BMQA 3QWAA 2GNAA 1ISMA 1DFHA 3C1AA 3DFZA 4GWGA 3U0BA 1B3RA 4ILKA 5A9SB 3MJTA 3DL2A 2IRWA 2HU2A 2B37A 5CDYA 1YJQA 2AQHA 4LW8A 1KIFA 4OM8A 4XGKA 3LLVA 3ZW9A 5C3MA 2ZB7A 3CSDA 4KQXA 2F1KA 4D46A 3NEPX 5G0UA 3D0OA 2D1YA 1C14A 1SOVA 3HWRA 4QXMA 1C1XA 1BRMA 3EMKA 4EEXA 3GR6A 2HAEA 3PWKA 4YAJA 1B0AA 4B7CA 5HWSA 1YBVA 3NRCA 1IE3A 2Q2WA 4MKZA 3ZWCA 3F1LA 1GCOA 4CL3A 5IXYA 2CNBA 3KEOA 4AJOA 5DP1A 4J9VA 1W73A 4PLFA 5G2OA 4J1NA 3GHHA 1M2WA 2HMSA 5KKAA 3OQBA 3V2HA 1EUCA 1I30A 2DPGA 3AOGA 4RDIA 3L07A 3G49A 4JIGA 3FWZA 1ZXLA 3B1KA 4GGPA 5I9MA 4J1SA 1ZK0A 4M55A 2Q4BA 3RI3A 3W6ZA 3L9XA 5T5QA 2VNAA 5TSDA 4BNVA 1CYDA 1CIVA 4GVXA 4CQMD 3OEYA 2FN7A 3NT5A 1HDYA 3O9ZA 5JYEA 2ZIZA 1LSOA 3ASUA 1UDAA 4XX0A 2PK3A 4J90A 3S2FA 3WYEA 4BNUA 2B0JA 4EI2A 3OIDA 4ZHSA 1PJQA 1KVQA 3LC1O 4PG6A 1TA4A 3F5SA 1HKUA 3KUXA 1I3LA 1LDMA 5JS6A 3JTMA 3BTOA 5F1PA 3DONA 1V8BA 1H93A 2BLLA 1LQUA 2VRCD 3QV1A 4Q39A 4CQLB 1E1NA 1GQ2A 2GUGA 2VZ0A 3AJRA 1U5AA 3E8XA 4R5HA 2G17A 4B4VA 3GVPA 1XU9A 5KTKA 1X0VA 2RAFA 1YQGA 4JGBA 2YDYA 3PGJA 4NFYA 4YRDA 4MKRA 5DCWA 3X2FA 3ZHXA 5JDCA 3ST7A 3LZ6A 3ABIA 3GVHA 3MJSA 2OL4A 4XR4A 3ROKA 3KYDA 3M6IA 2CF6A 2NVUB 1H2HA 1EK6A 1S6YA 3F5QA 4BGUA 4PG4A 2H9IA 3E9NA 4HV4A 5IDQA 4M87A 1FMCA 3OSUA 1U2DA 1EQ2A 1N1EA 1UAYA 1PGQA 1KY5A 1E1KA 3WB9A 2UAGA 1VKNA 4FFMA 3Q9NA 3L9WA 4CUKA 1Q7GA 3RU9A 4I9NA 2ZK7A 1AXGA 5C7IO 1ZMOA 1I01A 3RFVA 1IOLA 4OIMA 1G0OA 2CUKA 2QRKA 3JQAB 5JAMA 3C85A 5TGDA 1XELA 1Y8RA 4D45A 3AY6A 1ZCJA 4HFMA 3RBZA 2BKAA 1PS9A 1QRRA 1F8FA 1LJ8A 3ORFA 3VTZA 4GAEA 1A4UA 3WQSB 1LEHA 2FZWA 3PZBA 4CR7A 1B15A 1SPXA 1E1MA 3QVWA 2DC1A 1N8KA 3EYWA 5DNAA 4IDAA 4NH4A 4F3YA 4PLTA 3EK2A 3JQGB 2HO5A 2WJPA 3PHGA 3AFMA 3IUSA 2FSSA 3HDHA 4YQZA 1YOVB 3BYZA 4NK5A 5L7YA 1BDBA 2JCXA 5KJFA 4BKRA 1YVEI 1M66A 1GPJA 1X1TA 4FGSA 3OJEA 3N74A 2VHVA 3TN7A 1YKFA 3LT1A 2EXXA 2Y1OA 3KYDB 1GU7A 1MP0A 3U4CA 2NUAA 5DZSA 2WDZA 2O3QA 2JJYA 3PQDA 1P0CA 1W0CA 1XEAA 4YT4A 1MLDA 1YXMA 1WW8A 2UUPA 4ID9A 5THKA 3U62A 3GUCA 2JL1A 3MZ0A 1H94A 4AJ2A 4I5DA 3DC2A 3GZNA 3NDJA 4MIOA 1P44A 2ZQYA 1LDNA 1E7SA 2R2GA 1XA0A 3JQ9A 2VCYA 5BNTA 1LDEA 3EZYA 4RF4A 3QQPA 4G65A 3AUUA 1A7KA 2A94A 3BHJA 1ENOA 1B26A 4BKPA 2O7QA 3I9KA 4BMVA 1RWBA 3KTDA 3PWSA 4XRRA 5A05A 3T7EA 2LDXA 5L4NA 2P9GA 2R00C 5BNFA 4OSOA 3QE3A 3WNQA 3JQFA 3GUYA 4AJPA 3UXYA 4S3MA 1U7TA 2NTVA 3DZBA 1KVRA 1U8FO 2FHSA 4IIVA 1F8GA 4D3FA 1E92A 3CMMA 3IKVA 1EVJA 4H3VA 3RUEA 3D5TA 3PJEA 3ZWMA 3VDRA 4BNJA 5ITWA 2DFVA 5TJHA 3GPIA 3JQAA 3UCEA 4F6LA 4GVLA 4EJ0A 1HDXA 4ZRNA 1YJ8A 2A92A 1DOHA 1GQQA 3IUPA 4JCOA 1GYRA 3RC2A 3LSYA 1GTMA 5U4QA 1NPTO 4GX0A 2FRDA 4D0RA 4H16A 4E5YA 5I9LA 4I5EA 1R37A 2E49A 1UXIA 2YQ4A 3TWOA 1HDZA 2EV9A 2EGGA 1NQAO 1E5QA 1ZJYA 1VSUA 2BFOA 4NIMA 4Y67A 3IIEA 1PU2A 2A4KA 3GK3A 4KUHA 4ALLA 4Y6RA 1OBFO 2NSDA 5FYDA 1Q7CA 1GV1A 3RCBA 3CXRA 5L4LA 4R9RA 1WWKA 1NTOA 4OJNA 2YJZA 1JQBA 5ER6A 3BAZA 3JQAD 3ICPA 3JQBA 1HSOA 4J91A 4OQYA 5G0WA 1MA0A 1C1DB 4WPGA 4KUEA 3RROA 4IS2A 3JYLA 1HT0A 1JVSA 1UZLA 2O48X 4N5NA 4RLHA 4ND5A 2VWHA 3DAPA 3U4HA 4ALKA 1ZNQO 1ZVMA 2WSBA 1UP7A 3DFUA 4DGSA 2P5UA 3ZNQA 4B4WA 3GMDA 2NU6A 3HHPA 4LSMA 3EAGA 2PTGA 2X4GA 2HK9A 1JAXA 3ULKA 1A71A 3F1KA 3QJ5A 3QY9A 5JDIA 3WS7A 3ONDA 1HE2A 1SEVA 1J49A 3GGOA 5KVQA 3DBHA 3OP4A 2A35A 4OYRA 4WK6A 1NXQA 5COBA 1TXGA 3CE6A 3GFGA 5I8ZA 3ZV3A 5KJEA 1LRJA 5T8KA 4YR9A 3GAFA 5G0SA 5JE8A 1WNTA 4E12A 3KSUA 3BTVA 4XGIA 3BMOB 1LSUA 3QIVA 1ARZA 3B1JA 1DB3A 1VL8A 3RQSA 3BHMA 1LDBA 4OO3A 2NACA 2X6TA 4OGWA 1BXGB 2XXJA 1LRKA 1T2AA 3GQVA 4I9HA 1UZMA 1Y7TA 3WFIA 1UUFA 5JDCC 1Q0HA 2YQ5A 3OM9A 4YACA 4YJFA 1FDSA 3HG7A 4X54A 3UVEA 4K1LA 1PS0A 1W8DA 2YV2A 2VTDA 4IGEA 4NK4A 3IL2A 3I6IA 4TRJA 5KIAA 1XGKA 3NJ4A 1YL6A 3F46A 1U3WA 4U7WA 3F4BA 5ILOA 3QWFA 3WJAA 1P74A 4HX5A 4ALNA 4HUJA 2J5QA 4RPKA 1HE5A 3DHEA 3SLGA 2P9EA 3AI1A 1GADO 1K89A 3PJDA 1HXHA 2A9FA 3EY4A 3QVSA 2Y0CA 3BXXA 5L4SA 2C5AA 4EDFA 1E3JA 3WIDA 4CMBA 5J23A 4CQMB 1TVEA 4RF5A 4GKBA 3WICA 4DBVO 4XD2A 3ETGA 5MGBA 3H7AA 3UAGA 1MV8A 1PTJA 2RH4A 1Y8QA 4ESOA 1R0KA 2ZCUA 4FDAA 1SBYA 3JQ6A 2X23A 3RSHA 2CY0A 2OP1A 3ENNA 4R3WA 5A06A 1EBFA 4BL5A 4ZGWA 4YAKA 2VNSA 2CZCA 2OHXA 4BB5A 5DBGA 4NPCA 5A9TA 4CMGA 4QQRA 1ENPA 4TZKA 3HN2A 4UVDA 1BMDA 2VQ3A 2PA3A 4WEOA 1GZ3A 2W2KB 2H1SA 4R3NA 2Q2QA 2WYVA 1R4NB 2TMGA 4R1NA 1PJLA 2Y1DA 4MVJA 2ZTVA 3L4BC 5H83A 5F5NA 4CPDA 3ZU3A 1HZJA 3DHYA 3K31A 5IDYA 1BGVA 4RVDA 1DO8A 3ZHZA 2VRBA 1P77A 2D8AA 3RUHA 2DKNA 5IN5A 2NVBA 4JJFA 4CR8A 2VYVA 4IJVA 3KEQA 4XWYA 2DVMA 5B4VA 1E3LA 4EJ6A 5JFOA 4ALJA 4U0JA 1VRWA 3WBFA 2GZ2A 4MP8A 5TRTA 5LDHA 3MJVA 1OMOA 4MVJG 4FB5A 1HDRA 4HADA 2X7HA 4CMEA 3WTBA 4A2CA 1OOEA 3MTJA 4HWKA 2FR0A 2CSUA 2DQ4A 3E5RA 3K6JA 4PGFA 2GD1O 4OOFA 3IOYA 4LCJA 4R54A 3VH1A 4EUEA 1I32A 4DYVA 1O5IA 5U9CA 1UP4A 1DXYA 2DTEA 1V6AA 4DPMA 4HFJA 1LA2A 2B4TO 1ZK2A 5T6BA 1P3DA 4OOEA 3UCXA 1NYTA 4B8WA 4OXNA 5DOZA 4BNKA 4GH5A 2WYUA 4JNKA 2FOIA 1BW9A 2GDZA 3RFTA 2W2LD 4M86A 2B83A 2EJWA 3H8VA 4IZIA 4WLVA 4M54A 1DEHA 4B7UA 1UZNA 1VC2A 2EF1A 4N7RA 4J0EA 3Q3CA 3LVFO 3C24A 1NQTA 4XR9A 3V2GA 3VPSA 2AE2A 5DDIP 4PLYA 4E5NA 3VZQA 4CLEA 1PZFA 1AUPA 3AU9A 1P9LA 1Y8QB 1QYXA 3G79A 3QVXA 2GPTA 2EKQA 4IQ8A 1KS9A 5DOVA 1XR3A 1CETA 1YL7A 5DULA 1AGNA 1G0NA 3PHJA 3M2TA 3QWHA 5K9ZA 2IZ0A 5FFFA 5IN4A 1I3MA 1VE9A 4TVBA 3FRJA 2V6FA 3WNVA 2I9PA 2I3GA 1DJQA 4YT2A 3JQCA 3G1TA 1OC4A 3GC6A 3D7LA 4F6CA 4PVCA 1GL3A 3BMCB 3K2BA 1DRVA 4DMMA 3DMTA 2PZJA 2CFCA 3OMLA 4KUGA 1C0KA 3Q1LA 4LVUA 1OFGA 3E1KA 2X0IA 3DZIA 4XJTA 3NUGA 3OETA 3DBHB 4QSMA 1MFZA 3DOOA 4QO8A 5ILGA 6ADHA 2JD0A 3ETEA 3QLJA 4OL9A 3UHAA 3LF2A 4R9SA 1PL8A 4R69A 3EDMA 2Q1SA 1I8TA 3GNTA 1ZK4A 3IKTA 3IJPA 3L77A 4Q3DA 4BQPA 2AXQA 3GZ4A 1EFLA 3GHYA 3U4DA 2RBEA 1HDGO 2CD9A 5DF1A 1K6JA 1PGPA 3ADOA 4GL4A 3PIIA 2O23A 3GGPA 4WLUA 3R1IA 5CPBA 4B3HA 3QP9A 3R3SA 1CJCA 1HDOA 1XWFA 3LDHA 4UUNA 3FNHA 4J43A 4QT0A 1NR7A 4L4SA 2E37A 3IMFA 3ZNNA 2QG4A 2WEKA 2VUTA 1VKOA 1QYVA 1PSDA 2X86A 2BGKA 4FBGA 5CDUA 2HQ1A 4I1IA 4Q9NA 5BQFA 4J49A 1T2EA 3ZN2A 4FC7A 5IXSA 2QYTA 3GDGA 3DAFA 1X1EA 4P4NA 1P45A 2GF2A 4II3A 2G0TA 4QO7A 1I0ZA 2F00A 1A9YA 2DBQA 2DBVO 2ZB4A 3FNGA 2BI7A 4JJGA 3P19A 4YXFA 4RPLA 3O8QB 3TOZA 4E2WA 2G76A 5JBIA 1PJ2A 2B4RO 3O4RA 5JMWA 4PFJA 1I2ZA 1YDWA 3CUKA 4MVJM 3WGQA 1B7GO 1PWZA 3ROMA 3GA0A 5CEFA 4P4LA 1DDOA 1I2CA 4NZ9A 3NYWA 4FSHA 1M6WA 4RPJA 3WGOA 4JP3A 1DLIA 4XZ3A 4FJ0A 3RUCA 3L6OO 3OEWA 2DM6A 8LDHA 4G2NA 4IGFA 2ZTUA 1DC6A 1NVTA 4J1TA 1IZ0A 5A9RA 5JCJA 4N5LA 2O4UX 2OFPA 3GPDG 2AHRA 5EPOA 1V9LA 4FFRA 4Z0HO 3FR7A 4IQ0A 3NDRA 4O1MA 5ICSA 4BO4A 2ET6A 4DLAA 3OHSX 6LDHA 3ZU2A 3OQ1A 1EE9A 3EVTA 1DRUA 2IEDA 4A26A 4HKTA 2P4QA 1UJMA 4RGBA 4CM9D 1T4DA 3GN1A 1BW9B 2POQX 1F12A 4GSLA 4U0KA 1B3BA 3GVIA 4I08A 2GCGA 4MIYA 4XDZA 1H6CA 3WGYA 3UCFA 1I24A 5A4DA 3CEAA 3V8BA 3ROQA 3GEDA 2C0CA 1E7MA 3VH2A 4AJHA 3JYOA 3CH6A 4YBZA 4NBTA 1VL0A 1YOVA 5GZ3A 4ND3A 5BSHA 4YDRA 3WYCA 3VPHA 4R1SA 2EIHA 3PYLA 3DB2A 2DU8A 4MVJF 4QUKA 4U6QA 3MWEB 4J3FA 8ADHA 4WCFC 5LC1A 3WWZA 3DOJA 1IPFA 3H9QA 4BNTA 1ZEMA 3SC6A 3SJ7A 2WD7A 1JAYA 2XF8A 3K9QO 3JQ7A 4EJMA 2OMEA 3K73O 3VVBA 3UOGA 3MEQA 4GGOA 2IE0A 2ZKLA 3ASVA 3MOIA 1PQWA 1VL6A 3OICA 4Z0PA 1F06A 1ML3A 3MCVA 3F4LA 4O0LA 4XA8A 4YAEA 4RF2A 3ZV4A 5L9AA 4RZHA 1B8UA 1B14A 1U28A 1Y6JA 1ENZA 3D4NA 1O95A 3JYNA 2R00A 2AEJA 3MOGA 3ADPA 2DUWA 3SXPA 3MTGA 2NM0A 3BMOA 5FF9A 1GV0A 1XHLA 4CMHA 1M67A 5JMPA 4IDGA 1E77A 3RC1A 2IODA 4AJKA 2BGLA 3VKVA 3GLQA 2EG9A 4UEKA 1X15A 2DBRA 4XIJA 4E2XA 2E4AA 4PG8A 1YQDA 3ZW8A 1K0UA 1XG5A 4BNXA 4BOYA 4CM4A 2FPPA 5TT1A 2NQTA 4DREA 2Y67A 3AK4A 2AQ8A 3RWBA 4B3IA 3HDJA 2X1HA 4MVJD 2Y66A 1IULA 1EVYA 5MDHA 3ZCXA 4E3ZA 1QYWA 2YUTA 3JD4A 4PLZA 5CPFA 5KVVA 4EUFA 1FF9A 1GQYA 2WE8A 3JQFC 3KSDO 4WECA 2DPHA 2GYYA 3AU8A 2PD6A 1BVUA 5B4UA 4L8VA 3P7MA 1Y81A 1GPDG 1PR9A 1E7YA 4DBZA 4PCVA 1DPGA 1ULSA 4XIYA 1GY8A 4RPGA 3WSWA 2VWPA 5I7VA 2NLOA 5G4KB 2Q2VA 3JD1A 3N7UA 3CMCO 3KRTA 4J4HA 4BUCA 4A10A 4FFPA 3PWZA 4KWHA 2P4HX 2FWMX 4RPHA 5CEJA 4RLSA 5ES3A 1DFIA 4GQAA 5EINA 2Y1FA 2AG5A 3WGHA 5JC8A 4PLHA 1XLTA 4HFRA 4IJUA 3KVOA 4NG5A 9LDBA 2P9CA 4JBIA 4IJWA 3FD8A 4BO2A 3ZU5A 2Q3EA 4IDBA 1KVSA 3OA2A 4BO8A 3UUWA 2B35A 5H81A 4BGVA 1UR5A 5JAIA 4YT8A 1CF2O 2J3KA 1KBZA 4WNCA 5IDXA 4Z9XA 3DZKA 4BNIA 4MP3A 3FPLA 1I2BA 1ISFA 1DFGA 3BZUA 3NGXA 2JHGA 4I8XA 1QV7A 3PTZA 1LI4A 2YYYA 4Z3KA 1WAMA 1IY8A 3R6DA 4IS3A 5IZCC 5B1YA 3EW7A 3KLMX 1PZGA 4R5MA 3GEMA 4XYBA 1NWCA 3FF4A 4YJDA 3H65A 1O9BA 4GMFA 4IINA 4NDNE 4DQUA 2NU8A 4W9NC 1HYGA 2QYSA 3DHNA 3AY7A 1SOWA 4IXWA 4C7JA 2D2IA 1PWXA 3CINA 4D7AA 2GN8A 5JCJD 3D5QA 4CUJA 1QORA 1H6AA 4DQXA 2VOJA 2JFHA 4NU6A 4CV1A 3ZNPA 1ZK3A 5AQ1A 4WNIA 1HE4A 1HETA 2PGJA 3A14A 3PPIA 4RVSA 2O3RA 4XB1A 5KJCA 3PYMA 2NTJA 4L4RA 4BNLA 5CDSA 4FCCA 4B79A 1Q1NA 1NASA 1DIRA 3GNSA 3KYCB 5IZ4A 2Y99A 5TT0A 4L74A 3OFSA 4EGFA 1BWSA 3HUDA 2YFQA 3U49A 4BO0A 3I4CA 5K0ZA 3RUDA 4OHUA 1QLHA 3JQ7B 4E2ZA 1LSSA 2ZTLA 3Q11A 2EERA 1ZIDA 1GYQA 1DIAA 4A5OA 4ZQEA 3SBOA 1UP6A 1YH3A 4H7PA 1J0XO 1E7WA 4BMNA 3D3EA 1E6WA 1N9GA 3T7CA 2C54A 3D3WB 4KTTE 3Q6IA 3S8MA 3GRPA 3I9LA 2X9NA 4UEJA 4DC1A 5B4TA 5F1KA 5KVSA 4FOOA 2OP0A 1ZEJA 3OECA 5EQFA 1V35A 4O59O 1RM4A 1JDJA 4RVUA 5FI5A 2I65A 4IDCA 3GZNB 1MC5A 4M8SA 1SCUA 5IDWA 4BMSA 4YTEA 1QYDA 3CTMA 4UVIA 4CR6A 1EVIA 4E33A 3TFOA 1OZAA 4J4BA 1UDCA 1C3VA 4BB6A 1YONA 1KERA 4CV2A 2UUOA 1HTBA 1YS4A 3RBVA 2EEZA 1J5PA 3G0OA 5JC1A 3BIOA 4ZRMA 4J6FA 4OKIA 2C07A 4NBRA 1DJNA 2NVWA 4AFNA 1R16A 1Y5RA 3PFFA 4TZTA 4W6ZA 1Z73A 1K5HA 5G0TA 4GX5A 1NP3A 3STHA 2Q4EA 4PZCA 3EC7A 4JJIA 1NFFA 1X7GA 3DO5A 3I4FA 1YWGO 5KJ6A 3UW3A 1P1FA 4XDYA 2VHXA 3B1FA 3DBLA 4PZDA 3WYBA 5U1PA 3BTUA 3OIGA 3H4VA 2J8ZA 1D7OA 3RUIA 4XEHA 1LX6A 4AJIA 3G1UA 1HYEA 1QSGA 2C2XA 1SB9A 4RO0A 4EBFA 4CM6A 3QHAA 2CVQA 5ICMA 2XOXA 1BVRA 4ZQFA 2Q1UA 4AJJA 4Z6KA 3JQDA 3HFGA 4HNGA 3E48A 4C7KA 1P31A 3PVZA 1V0JA 3LF1A 3A06A 5BSGA 2HMUA 2V6MA 3WXBA 4B4UA 2HK8A 4IMPA 2Z5LA 1EDZA 5TNXA 3SC4A 3ZWWA 3ZNOA 4J9UE 3I83A 4BO9A 4LVCA 4M1QA 4QFCA 3E9MA 1Z82A 2AQIA 2DTXA 1E6UA 4NFHA 3RAJA 4BS9A 3U09A 2OOSA 3WWYA 3E9QA 4CM1A 2OGUA 3NT4A 4I5FA 1L7EA 1CQJA 4KTVE 3BHIA 1R12A 1PJSA 3WIEA 4OH1A 4PVDA 4Y6PA 4DIBA 4BIIA 2HMWA 3BTSA 3NGLA 2YHIB 3G17A 5JO0A 1P1KA 5CEEA 3ONFA 4KOAA 3PQFA 2JFGA 5JCXA 4D79A 1VJTA 4IIUA 4WCFA 3RUFA 5EESA 2X9GA 2FY8A 4BV8A 4KQWA 1PS8A 1H6BA 4NMHA 4RORA 1F14A 1MFPA 2DFDA 2EGHA 1GEGA 5BSFA 3DBLB 3ZWAA 2X0NA 4IDFA 1U7HA 3FTNA 1VI2A 4ONEA 1H0KA 1LC3A 2E82A 2GN4A 1H9BA 3G3EA 4Q3EA 1BTOA 2NNLD 5T64A 2WM3A 3TL3A 4AL4A 1DC5A 1A9ZA 1HF3A 1R0SA 1RM0A 1Z7EA 4QX6A 5C7OO 3INRA 4RVGA 3DR3A 1UH5A 3GG9A 2HRZA 1HE3A 7MDHA 2O4CA 1D8AA 1LXCA 3KSZO 2Y1EA 2IXBA 2PD4A 3DOCA 1E0DA 3KYCA 1NM5A 5HRUA 4CLRB 2O3UA 3NTRA 4YJFB 1NHGA 1XIVA 4XYGA 1L7DA 3JQEA 1ISHA 1JW9B 1Y1PA 1N7HA 2Z1MA 3OJ0A 4CMCA 2UVDA 3JYPA 4HP8A 3NX4A 1AE1A 3O26A 3H5RA 2O3TA 2VRCA 4BO6A 2VUUA 3ZH2A 3I23A 1JWAB 2O2SA 5T57A 4GMGA 2RHRA 2VUSA 4J2OA 2ZYGA 1EUDA 3VOSA 5AVOA 4LSWA 4FR5A 3JQ8A 5EJ2A 4DWVA 4AVYA 2H63A 4KP7A 1BSVA 1U3TA 4B8ZA 4PRKA 3NV9A 3KHUA 4MP6A 1O6ZA 1QYCA 4P4GA 4RV9A 4XKJA 1JLLA 4CM4B 4ZQHA 1QMGA 2PZMA 3LK7A 2Y68A 1DSSG 1NHWA 1T2DA 3BMQB 4L73A 3PRJA 2PGLA 4FOSA 3RUAA 4YAGA 3PXXA 1ISJA 3HB4X 1XDWA 1SO8A 1JU9A 1T26A 2B36A 4DIFA 4TKLA 1GZ6A 3ZWPA 1SB8A 2HJSA 2NWQA 3TZKA 4DA9A 4CM3A 4RDHA 5JY6A 1MX3A 4BHTA 4BO3A 3O8QA 4YQYA 5BT9A 1YO6A 3ZHYA 4ITUA 3R3JA 2W98A 1LC0A 2Y93A 3SEFA 4DC0A 5BNIA 1E1LA 1YB4A 2Y05A 4UREA 4NBWA 3ENKA 4RVFA 3PYXA 4IY1A 5L3ZA 3UN1A 2W4QA 3TJRA 1TB4A 4F46A 1KC1A 5JO9A 2BF7A 5TS3A 4CLOA 3TF5A 3QA9A 4J7XA 4BQRA 4XYLA 3S2EA 1Z7BA 3EGOA 1LLCA 3IS3A 4JXKA 1PJ4A 3V1TC 2HMVA 3KO8A 5IG2A 4HNHA 2GASA 4TROA 3HE3A 4RQTA 3T4EA 3WGZA 2I99A 4QECA 1TEHA 2EHDA 3NT2A 4BNNA 3GY0A 2E48A 5I7FA 3RJ5A 3WTCA 5C37A 1DIBA 2Y1GA 4FIZA 4CMEC 4AJNA 1LNQA 1YBMA 4YWJA 3VPGA 1FDUA 1NFRA 2WYWA 1Y8RB 1MG0A 3FCOA 5KWEA 4G81A 1LLQA 3DZGA 1NAHA 1JKJA 3ZV6A 1C0LA 1A72A 2GSDA 3AUAA 3C3XA 3E03A 2C5EA 4G5HA 4TRMA 2WTBA 5KNLA 5LCXA 2PKQO 1QP8A 3DQPA 4K9DA 4L76A 4R51A 3FPCA 4Y8VA 2YV1A 2QZZA 2J3HA 4E5MA 3KV3O 1R15A 9LDTA 2EKLA 5GZ1A 3OF2A 3VHRA 4YAIA 4QTZA 5C7LO 5ITVA 1XU7A 5DBFA 4TQGA 5F1OA 4NBVA 3QWBA 1NVGA 4AJ4A 5HS4A 4K6FA 4AG3A 4IMRA 4KDFA 1ZFNA 5GZ6A 3H6KA 3R0IA 1HSZA 4CV3A 1EMDA 1GDHA 1I3KA 1NFQA 2AG8A 2YY7A 4E2YA 7ADHA 4J1QA 3H9UA 4DIOA 1V3UA 2EWMA 4A27A 3VPFA 4AJLA 2W2KA 4BNMA 1IB6A 2FP4A 2P5YA 3UGKA 1HRDA 1QKIA 3Q2KA 2DUUA 1I3NA 3LT2A 3GAZA 5HM8A 1M76A 3I3OA 4FW8A 4NU5A 4OXKA 4ZICA 4XYMA 2XAAA 1QG6A 5EERA 3PIDA
chains in the Genus database with same CATH superfamily
2WTNA 1KI3A 2PJDA 3FHOA 1CE8B 1UBTS 2B1RA 2P3OA 2O05A 3QSGA 4GLLA 5C4GB 1IY1A 3JASA 3A6KA 5T4HA 4MV5A 4P4SA 1E94E 4TWAA 2P2YA 1Z56C 1UKYA 4TKMA 2O6HA 2WIKA 4XQEA 2BELA 2PSJA 2CEKA 3VZPA 1A9SA 1M8FA 2LBPA 1L4LA 2ZVDA 5CD1A 1XWWA 2VJAA 4IHJF 2P6NA 4NYMR 3SN6A 4ZI7F 4X84A 5HSGA 1XZQA 3ZQJA 5IC6A 3NKVA 4YJ3A 4ARAA 5HPYB 1R8JA 5A6SA 3WIUA 5FWXB 4HZIA 1ZUNB 4MJ3A 3RS8A 5EE3A 4UUPA 5CP8A 3UA3A 4LJYA 2GZDA 3H0CA 3TQRA 3N2NA 1T2NA 1S2LA 1GSIA 2J7PD 3M6VA 5LBTA 3X2EA 2IHNA 5IXJA 4PSCA 3LU1A 1XZIA 5AI6A 4D9MA 7ABPA 1NT4A 5A4FS 3A8TA 4KQ2A 4EI7A 3IEMA 5EP2A 1Z29A 4M49A 3HZOA 1U2TA 1PNQA 3SKXA 2XTAA 1Y6RA 2P27A 4PO8A 1S2DA 3DGEC 3NFYA 2F17A 4H15A 4PWYA 4ZT2A 1NSFA 1UOQA 2A1UA 3MRXA 1CB7A 3R3YA 4ZJUA 2QX8A 3LLSA 4WADA 5LXTA 2IHZA 3ZGOA 3B20A 4OU5A 1WB6A 2W7TA 1PJ8A 1N9KA 4ICIA 4MRMA 5JBQA 3HXQA 3HEAA 4URXR 1XEXB 4MUFA 5AJWA 2EQAA 4MMYB 5D1HA 3TSCA 2XZPA 2O2YA 4L4UA 1RC8A 3KXPA 4R3UC 5E6RB 4EZIA 2J5BA 4P0QB 3RSGA 2K4MA 3MPUA 1SOMA 1PGJA 1L8AA 2GK3A 3WLJA 4C4YA 4WTOA 5K6RA 1MMFB 1G20B 2D54A 1RHKA 3TNLA 4C03A 1LD3A 2JH3A 4L4ZA 5IK2D 4DL9A 1EZ1A 4FKBA 2VJQA 1AKRA 5BYBA 2P2DA 4WXPA 1RRFA 1L7RA 2RGBA 3OOSA 3W5IA 5ELXA 1YC2A 3I9OA 4MARA 3AEKA 1JHVA 3IIMA 1VCHA 4HFNA 3MD0A 3NO4A 4UTXA 2MIIA 4OQDA 4G4JA 3TR6A 3LO8A 4HB0A 1XZFA 5LB4A 1XPRA 1A2KC 1JMYA 2JZCA 1PSWA 3EIQA 1U31A 2LXNA 5FV4A 2ECOA 3A0RB 2PSFA 3OCVA 4HH0A 4YRLA 1XVIA 2WD8A 3M7IA 1TUBB 1V71A 1M6VA 1E4EB 3LW8A 1KJWA 1PZEA 2QRZA 4O2BA 1CS0B 3F97A 3T1QA 3CHYA 3LP6A 1JYFA 3KJHA 4MVJP 4QQNA 4BMDA 5HOQA 3CFYA 1NQ5A 2PGDA 4HRVA 4ZXPA 5JS2A 1PF7E 4AUNA 2BV3A 3QRWA 5B37A 2E6UX 5AOVA 3H5NA 4Y1EA 3EZXA 4GMKA 3ZHBA 4YUZA 1GZUA 2XMCA 1MABB 2A8YA 2ACKA 4ND7A 1JPVA 4KNYA 3QFSA 5CW2A 1GNPA 4NENB 2MR6A 1G55A 1Y8CA 4CIDA 3W5AA 4UJ3A 2PMBA 5KAPA 1Z06A 5A5VA 3O75A 5B2EA 3O91A 4BNGA 1MJ5A 4C9BA 1QHNA 4AS2A 4C4SA 4I8DA 6NULA 5TV2A 4YJ2B 1EHCA 5HQTA 1CUHA 2E9SA 1JF8A 2GKGA 2VT7A 3ZE2B 2EW8A 4OYLA 4HN9A 1YI0A 3WP1B 1TMOA 1UXJA 4OP2A 1V5GA 4BZQA 1XYGA 1TFRA 4IRXA 4F5WA 3C5HA 3MLBA 1E2HA 1U7XA 1XCJA 2AWOA 4KXFB 1GTJ1 3PDWA 2OXTA 4R8RA 5EUQB 1HQYE 4KO2S 1Y1TA 1GQSA 5IARA 4IO1A 3VR5H 3HP4A 2CL5A 2JIZA 5BSUA 3F3KA 3KHSA 1OT5A 3JD2A 3RIEA 3T9BA 5F5XA 5HK8A 4BMXA 1OGJA 3FOAA 3LH5A 1LH0A 2W9XA 1UPTA 1UKCA 1WQ3A 3H9GA 1X7ZB 4DXHA 3FJOA 5TX7A 1ZUIA 4O4LA 3SXUA 4Z4HA 5FWNA 2QNRA 2E5FA 1SC9A 2X2FA 3S2IA 4WLNA 1US8B 3BE4A 3H1FA 1RC0A 3NDBB 4FYMA 4GIBA 3T0FA 3CO5A 4R31A 4FZ5A 3UMFA 4ZN6A 3OQNA 1N5JA 1GHTA 4GP9A 2XOEA 3TVYA 1ZXBA 1PWYE 3W2HA 1D8TA 3A9SA 4Y1GA 4CG3A 3PPXA 1U8YA 4KWTA 2F64A 4I50F 2KI5A 4K86A 1HTTA 5CLFA 1FFXB 6GPBA 3AFGA 1RLJA 2W8BB 1I51A 4ZRDA 4AMVA 3T9DA 3T9FA 3FTPA 1VRCA 3BBLA 2XUPA 2QI9C 3UHJA 1Z2AA 1ZD5A 1L5OA 4PEVA 4RF3A 3K0AA 3EDRA 3FLEA 4WERA 3GZJA 4WY2A 4KQ9A 5E6UA 3DF7A 4ALIA 4HAWA 2DQZA 3ZU6A 1F5SA 3HJCA 3JTEA 1CRQA 1IL0A 4YRAA 5D84A 3IDZA 2X0RA 3RC8A 1BD4A 1KJ9A 4C87A 3CC8A 3IQHX 4RA6A 2VWGA 2L69A 4FINA 3CM0A 3K6SB 3SNHA 1NJSA 3A9VA 4P3XA 2KM1A 2NO9A 2CHFA 1FDRA 3CF0A 4M1OA 3FOCA 1R0RE 4FFOA 5LYJB 3RFCA 2VHZA 1IYZA 5HQ3B 2V54A 2QW8A 4M1EA 3A9UA 4GLOA 2C0QA 1KRWA 1E3IA 4Z0TA 1CUGA 2C1ZA 4X41A 5BR7A 1W5EA 2XQKA 1DHTA 1L7BA 1SC4A 1EVLA 3SOPA 2QVXX 2JGNA 1Z0DA 3TGLA 4OX9Y 5H59A 4KE8A 3LHDA 1ECGA 2XUQA 3K92A 3P0RA 4TSKA 3SEQA 3TVTA 3NHFA 3Q7SA 4NNPA 3VVMA 3WLFA 5BWNA 2N47A 1Q7RA 2Y1WA 2QWXA 3D4PA 1PJTA 1IONA 1J2UA 3KPJA 1G6KA 3MN1A 1M6YA 2IYYA 2ZT5A 4LI0A 1Z63A 4WCDA 1NPYA 2VNHA 3I72A 3QSYA 2I7XA 3QVTA 4I81A 5IM4F 1GPBA 2YV4A 5IWAB 3P32A 5E0KB 1CUIA 2CXNA 2QKYA 3W2GA 1PR3A 5AK0A 5JPIA 4BN4A 2GZ3A 4B8YA 4YAWA 5F51A 2J3JA 3T1TA 2J0SA 3AETA 5CA1F 1G16A 1ITZA 1LSJA 2WK1A 4PTZA 5JARA 1FXWA 4XUDA 4FC6A 2X22A 5LD2B 1NQOA 2P65A 3NKFA 3ZWQA 1F3LA 1KDTA 3BF8A 3KD3A 4L9RA 4M7OA 3R7BA 5C35A 3OIVA 1CS4C 3MHPA 3W77A 1WCWA 3F5MA 1JSZA 1A5ZA 4DDVA 4OX9B 3TIIA 2SCUB 3ROGA 4IG4A 3AB7A 2V4UA 1N9ZA 3E5MA 1YQEA 1JWBB 2QGFA 3D2BA 5EWMB 4XPIB 2D7DA 1M1XB 2W93A 2XVAA 3FMFA 4M88A 1EE2A 2C03A 3K16A 3TRJA 1RPZA 3I9FA 2BFAA 3PNOA 5TR9A 4QG3A 2PIDA 2HCBA 2HKIA 1N7JA 1I3CA 1RAGA 1N9GB 1S0UA 3ELWA 1BXKA 4Q3AA 3KBOA 2H17A 1P4SA 3DAYA 1AHPA 5JV5A 2V6GA 2VJMB 4QDZA 1LTKA 4OQEA 3TZHA 2DFKB 1T9ZA 1FW8A 2WSLA 2ZSHA 2QHXA 3K5HA 4PZLA 4CUZA 5LP6F 1AGPA 4I3FA 1Q11A 2PNFA 1PAUA 3OCCA 3RWOA 1ZX1A 4E30A 4EGCB 1GG5A 2ORWA 1UXKA 5ENZA 4L5AA 1PGNA 2UVPB 2G72A 1EI9A 3FKSA 4Q47A 4RY2A 421PA 3EUAA 2FG6C 1K7SN 3CNEA 4HEQA 3SJAA 2CL7X 3G0IA 1IN5A 1F20A 2AHOA 3PL5A 4P32A 3ZGXA 5A9SB 5DYYA 1EAMA 4TMZA 3NVAA 1YNSA 4PYIA 3P9PA 3UJNA 4D3XA 4CLRA 1TF5A 1I80A 4QKQA 5LP1A 4HRYA 2NU7A 3HADA 4YONB 1OAOC 2ZB3A 2OV3A 1Z6TA 1UAGA 1FP7A 2PKRA 3GP3A 1U0TA 1IZ9A 4TYWA 3WY9A 3I01A 4LFCB 3TQOA 3GYGA 3KJQA 3MJ4A 4MJXA 3E15A 4RHXA 1KFJB 4EW6A 1F0PA 2HIGA 4ZAZA 2Z6AA 4LNUB 4H77A 3K5PA 4K7JA 5KVCA 1XCOA 5IYZB 2CXQA 2WOOA 1O96B 4OK5A 4MYCA 2JIMA 3C1TA 4N3NA 3CPHA 3ZWBA 3TQHA 3AOEA 4KOEC 2FQXA 4E13A 1EB8A 2JHFA 1Z88A 3NHBA 3PZRA 3ENWA 4OBEA 5C8XA 1JR4A 2QRLA 5JH7A 1UJBA 3RH0A 3LX6A 1LLDA 1MENA 5HIMA 2AKEA 3WRVA 4PTYA 5ALGA 1E7QA 3A3KA 3IESA 4CE6A 2QY9A 2XNHA 3GRVA 5AR1A 2HHJA 1IN6A 1L4HA 3M8KA 3F0TA 1N0VC 1FNBA 4NONA 1Q14A 3UY4A 3F47A 3C7AA 3B9QA 3N5CA 3O95A 1GNLA 4PGHA 1NBOA 1N2SA 2Q8NA 1QPZA 2ZJ1A 5DJ5A 2AMVA 3DW3X 4JOQA 1E62A 1Q1EA 1QG2A 5AKZA 1JBQA 1U5CA 3SC2A 3GJ6A 4CLDA 1INLA 3B2EA 2XDWA 3N58A 3PNYA 5CU7A 3DDSA 1EXWA 1F38A 1RZRA 4I50B 4UHHA 5FXMA 2ZCVA 3B36A 4I4TB 2HQOA 4WASA 5HUQA 5JIBA 1FY2A 3UJCA 3ODGA 2C98A 1BAPA 1FDWA 5DV9A 4LYHA 2L19A 1VJ1A 2Q0QA 3TQCA 4Y2RA 4ZHQB 1XSEA 3RS5A 1W36D 4NV3A 4FXPA 4CMIB 1AN9A 2WMDA 5FNZA 4I6JA 3UMBA 2A0FA 1PNVA 4GEGA 4MS4A 1U8XX 3RSLA 3SIWA 2J6BA 5AVSA 1QO9A 1O94A 2JI7A 5B7NA 5KUTA 1IVNA 3MUNA 3QLEA 4IV8A 2AA3A 1QH0A 4MLZA 4B3BA 4X6UA 3MGBA 1Z37A 1Y3FE 3CT4A 3WGKA 1NBAA 3FHLA 3FTQA 4ER6A 4YRKA 2C4WA 5C1DA 1DE0A 3PLNA 2I2AA 4RABA 4DPLA 5G3ZA 2VNIA 2M1XA 3DZDA 2EJTA 2GF0A 1G7CA 4LYGA 5CX1A 4ZIRB 2FWAA 2HA2A 2LCFA 1B73A 4TS4A 3AUSA 5EWLB 7AT1A 3T5MA 1BG6A 2Z2KA 4B33A 1KZHA 3N2YA 1P5ZB 3UH1A 1A8HA 3TLCA 3SQWA 4L0CA 4BZPA 3OWHA 1E9BA 4UU7A 2RBKA 5FYQA 3SP1A 3CLVA 3UYKA 2EKZA 3KR1A 4HPXB 4GDFA 1AOXA 1D2EA 4JT2A 2HSJA 4IO0A 5EUBA 2XT9A 4W99A 1YB7A 5AXCA 1OU4A 4N4AA 1Y63A 2FN4A 1A27A 2XDQB 4L9AA 2A0KA 3R9IA 4D9KA 4RIEA 1WHSA 3TRIA 2H85A 1R6BX 2PUGA 3VDXA 2P8SA 4EB8A 4OTZA 3WLLA 2YWHA 2CLOB 3EEYA 3L6UA 3KJIA 2IQ5A 4ZYWA 3DM9B 1N75A 3EUWA 3ZS8A 4WW0A 3GJ7A 4QUEA 1WXIA 4JI7B 3HEMA 4YNBA 1GU1A 3A6FA 1PNRA 3JRWA 3WMEA 3WWEA 3EEQA 5BVHA 1GZVA 5CM8B 3LWBA 4DIEA 1K8XB 5ENVA 4IDNA 2FFQA 3JYQA 3N2IA 3Q4GA 4X60A 3R8XA 3IP3A 1XN4A 2VF5X 2ZI5A 3FROA 4PQEA 4WOBA 2ABWA 4AUEA 2WAXA 2EYUA 2H59A 3A1CA 5EJ9A 5LNK1 5I7HA 2P4UA 1JR6A 3EOZA 3B2NA 4BVGA 5AOBA 2QU7A 4HRAA 4B7XA 9ABPA 1F2VA 3X1XA 1KVUA 3ASZA 2Q46A 4QUJA 4RSGA 1BMFA 4PC6A 2R97A 2QZ4A 1EB9A 2AX4A 2VF2A 1MXHA 2WMYA 3PITA 1E2LA 4X1KB 4M89A 4L4XA 2G9UA 2JFYA 4W5NA 1UKVY 1IH8A 1V6SA 3EC1A 3TNJA 3SM9A 1T0IA 3GH3A 1QUFA 2CVFA 2Q5OA 3BB3A 2EBWA 3BEDA 1OQAA 2HIAA 2IHTA 4OAPA 2FFAA 2JRLA 3HR4A 4TQAA 5JSHA 2H4JA 3TDKA 1ZIOA 5K0CA 1OTYA 1V47A 3UK7A 3KFVA 1VFNA 4YK7A 3VOAA 3ZCRA 4DVJA 5D85A 4AECA 1IBRA 2ZUFA 3LUFA 4B6SA 2JA2A 2G82A 4CIBA 1G6HA 4GZ6A 2LCIA 5IAJA 4IMJB 5D87A 3CRRA 4XVCA 3ZCUA 2UVQA 3QVOA 3DEJA 4KMSA 5ALUA 4P35A 4CVNA 4BQFA 1N0WA 2VYND 1J56A 3AUXA 1MRSA 1GPYA 4JL8A 3WX0A 2I9KA 3T1YB 4RJ2A 1FFAA 2BW0A 1V8DA 5DNVA 1DJOA 4GI2A 2JAWA 4YBRA 4ISCA 3GJYA 2DG2A 1CUZA 3S28A 1XZJA 3GQBA 4CV0A 2J0QA 4AWAA 1EXNA 3M4XA 3WGMA 1IIRA 1U7OA 4KW7A 1QQ6A 4LK3A 4HS4A 3SYKA 3UK1A 4EPXA 4GOND 1JR3E 3OIFA 4HDSB 4UHEA 5LB2A 4UUAA 2ZQZA 5FLKA 1YJAA 3EEFA 3E3NA 4NNOA 4I9UA 1ZIYA 5COAA 3IMEA 2PJZA 3S55A 4AQ7A 3RIYA 4OP3A 1YE3A 4B6JA 2Q50A 3RV3A 1PEDA 3CJQA 3SQDA 1QJCA 2YVUA 5JXIA 1JALA 3A6GA 4LECA 1SUWA 1O0SA 3CONA 3G9XA 5L8VA 4M1ZA 3SD7A 5BT8A 2G9QA 1QHYA 2W22A 3B52X 3C8MA 2F9MA 4X7PA 1D2AA 2CLEB 3DCIA 1GNSA 1G8GA 3FFBA 4LN1A 1LCIA 4PS0A 1KI7A 3TZEA 2GARA 4EGSA 3EJ6A 2QV0A 2EOAA 4X8LA 1FUKA 1WX1A 5JAQA 2OXIA 2WUVA 3ZZUA 5JPDA 2QR3A 4A8JB 1Q3TA 3TXYA 3VC3A 4JLDA 4LHZA 2G0NA 4YT5A 2WYIA 1JFLA 1OJ7A 2EJCA 2RCNA 1MB0A 1UXOA 4YRFA 5AK5A 4HJRA 5HILA 1NVFA 2ZBVA 1XHEA 1OZ0A 1QJ4A 2HIMA 1K3TA 3L7YA 1AJEA 2VZ8A 4H60A 4AXXA 5FTNA 3OTGA 4AX8A 2ZWMA 1JA1A 4JJ8A 4RY8A 1XA3A 1IXSB 1QQBA 3AGPA 4QWWA 5M5BA 4EG0A 3M81A 4UVEA 2F1HA 4LOLA 3DEZA 4LC0A 4ZYXA 5G1NA 4BJHB 1O57A 2XA1A 4DV6B 1R10A 5SZKB 5IM4A 3WG9A 5DCYA 1NN3A 1NW5A 4H1VA 2JCVA 2EW2A 4WOKA 1IEVA 1Z0UA 3OZAA 1U4SA 1M1YE 3IAAA 1Q84A 1PUXA 2ZTMA 3DBRA 2IP1A 3ACCA 2D2VA 3SC3A 4CCAA 4EUKA 3QEMB 3WYGA 2Q29A 1KYQA 3T35A 4DLPA 2BDTA 5AP9A 1IUPA 4GG1A 4HUQA 4E5DA 5HK9A 3WLTA 1K8ZB 2IHKA 4UBMA 3SX4A 1KOLA 1E6EA 3VFDA 1X2EA 3LCVB 4DTCA 4KH0A 4ENSA 5HTOA 5AVXA 2YJ3A 1HZZA 4O4JA 4YDSA 3H2KA 1KMIY 1DAPA 5BUZA 1K7YA 3GB9A 1WCIB 5KDOA 2XEXA 4WNAB 3A6HA 1FK8A 3RTBA 4AAYA 4RTPA 1H22A 4JXJA 2PYIA 3GLSA 3JQBC 4FE3A 4YWHA 1M75A 3G88A 4J0GA 1EG2A 4B7ZA 2E5WA 1VE7A 2PHZA 1QZTA 3PHIA 3HVIA 1QP4A 1L7NA 3TFQA 4YN3A 4MXDA 3VYRB 2B5OA 2GZ1A 1KY4A 1XQVA 2ESRA 3B6JA 3NBYC 3NHZA 4F4DA 4DV2B 3C6ZA 2IBMA 2YIJA 4FHCA 2ZIWB 6AT1A 1Q3HA 1VHTA 2WT9A 1NNSA 2YJ6A 2D5BA 1VM6A 2QX7A 2QNIA 1A9OA 4YMSA 1YZLA 1R0ZA 2H4YA 4DMUB 1OFVA 1MOSA 1ZD9A 3CURA 3CX6A 4IPTA 3VGPA 3U4MA 2CMKA 3N8NA 3S2SA 1J24A 4X91A 3OJXA 3A6PC 1T5TA 2J31A 2NIPA 3ER9A 1C1DA 2PKQP 5F78A 2ZBEA 3LPCA 2IGBA 3MJCA 1NNEA 3LT4A 3QLTA 4NBNA 3BS4A 2CBGA 4HBGA 1FRNA 1Y82A 3ESAA 2CUTA 2GQ0A 5H16A 4ZGBA 2N3ZA 3D64A 3AL3A 4U39A 5SZJA 2GFIA 4MHTA 1TO2E 4H0CA 4M6WA 3ITKA 4PYKA 5FPQA 3SIRA 3RWMB 4WEQA 2MHCA 4KWIA 3MWDB 4LX8A 2P2SA 2ONCA 3C87A 4LISA 4Y1RB 5E1BA 1L1FA 4WY8A 3D1LA 3T94A 1Y3CE 3AZPA 1ZD3A 3EUEA 4P6VF 1XDBA 3KTOA 4BV9A 1FJ2A 1T25A 4BO1A 3JAWA 2FDXA 2W11A 3PKJA 3C3WA 3R8CA 1U94A 4K3UA 4Y2VA 1IWBB 1E99A 1Y4AE 3WDSA 5P21A 3WHPA 1GPNA 2FW6A 3OFND 1EBUA 4QPNA 4YH1A 4XIIA 1O94D 2FN8A 1YHNA 3EH2A 2OXRA 4G4SO 4HH3C 1TA0A 1J7KA 1WUTA 2RAUA 3PDJA 2C78A 3WR5A 1PV4A 2CHQA 5E7IA 2Z95A 4TXLA 1Q19A 2TYSB 4BAGA 5IKMA 4HDQB 1A50B 2BGMA 4NNJA 3ZI0A 1RRPA 2QZ9A 5FD8A 1J1ZA 3PQ8A 5IDVA 2Y0EA 2F3SA 1CJTC 2UUAB 1J8FA 1UODA 4G1UC 1ZMRA 2PZ8A 4C3UA 3GFRA 1BDMA 3RAFC 4MJLA 3SZUA 4CF6A 1WNFA 4ME6A 1EUYA 4V1CB 2Q3MA 4IJ5A 2GAFA 2R5NA 3NG1A 6CHYA 3EAFA 3DTTA 3KLPX 5C46F 4BVHA 4NDAA 1YBAA 3FE2A 5H3CA 4JJKA 2PLFA 3RJZA 5B36A 1K27A 4TYQA 1QG0A 2HC9A 4D4MA 4PHGA 2HJ9A 1H8HD 4DY6A 3PP8A 1H2RS 1MOPA 2BAGA 4DUPA 5T7BA 1JEYA 4RY9A 5CB8A 4EA7A 2F8MA 2M6LA 4HH4A 1DAMA 2YHUA 4Z3DA 2NUBA 4RSHA 3RBXA 1XQ9A 4M0EA 4CL2A 4F92B 4N5IX 1KJNA 4O33A 3FUUA 4QVGA 4R41A 1EVKA 3A04A 4K40A 3TPCA 5AJYA 2ON6A 3HZZA 1J22A 2H1WA 4URHA 3TGPA 4DLLA 4WLOA 2LUOA 3INTA 3T3HA 1RBYA 2B98A 3R20A 2GAAA 1ULHA 3E7PA 4JLSA 1XRRA 2QL9A 5EWJA 2Q5QA 1K9VF 3SU8A 4DUZB 2WWRA 1KEWA 4GU5A 3WFJA 5A2GA 3UAZA 2FDCA 1LZLA 3O92A 1T4BA 2PMFA 3FWHA 3VM6A 3O2JA 4ZOLA 4CLXA 3H86A 1C3JA 1KC3A 1RRVA 2Y4NA 3D8TA 1W85A 4H4CA 4YRJA 3UT6A 3WJ7A 3HJNA 1W93A 2QB5A 3UIEA 3PGXA 1KMHA 4FILA 4OIFA 3L7AA 1YR3A 4TLDA 4ALMA 4C14A 1CDEA 4A1FA 3ZBPA 1CZNA 1G1AA 2WKSA 1K8RA 2I5PO 3R24A 5JEEA 1AK9A 4TMFA 3W1VA 4JBXA 5JNUA 5ALDA 3LJKA 5TQ2B 4ENWA 3S3TA 4CG1A 4IZHA 3VDMA 5I9BA 3IQDB 1A7AA 4OJMX 3TLBA 4DWOA 2JGAA 4OQFA 2H5JA 4WKBA 5CNMA 2O20A 3DZFA 3CBGA 1BA3A 3L18A 4IZ6A 4PLPA 5F3RA 1Z5ZA 2GF9A 2AFHA 1FYEA 3G2PA 2A3RA 1DWPA 2QVZX 4FHZA 5DISB 1N1GA 4X20A 5F1YA 4DE5A 4CF7A 1DKRA 3L0IB 5A3QA 1V7QA 2AW3A 2FMKA 1ZR4A 5FO1A 5DRTA 1GXSB 4RZIA 4RGYA 3C1OA 1REQA 3QI7A 1ZMTA 5F5LA 4A2PA 5BWCA 4K9OA 5F7OA 2DKFA 1VLHA 4LE2A 3JRXA 1OA1A 3K05A 3N8KA 4TWRA 3LYLA 3BA1A 2NUPB 3TSOA 1VIAA 4M0CA 4XWGA 1KRXA 1T9AA 4JS0A 5FI1B 1E2IA 2ZYAA 1DINA 4MYUA 1C8VB 1U8AA 2BFMA 1Z47A 1JVBA 4MGHA 3SSAA 2ZBQA 1D3AA 2QQ5A 3LW7A 3VZRA 1TZMA 4E6EA 4DANA 4XWKA 3T8YA 4HI0E 3P2YA 3BZWA 1TUGA 3T7AA 2BMVA 1HI9A 4E6PA 1XKQA 5IH7A 1VPDA 1W9HA 3PTLA 3ZBQA 3BH6A 2HRQA 4LCEA 2H2GA 4YUYA 3PX2A 4AKEA 3WAGA 2J07A 4EY5A 2AMFA 2DUJA 2DTDA 1O9HA 5C34B 4KR2A 5TF4A 4BNZA 1II0A 3PUYA 1EFDN 4QJ3A 2HNAA 2C8LA 3BE5A 5TQVA 1NLMA 4U7DA 1CVIA 1G8KA 2FYTA 4BNDA 2CV0A 3FFXA 2ZULA 3KS9A 4JL5A 3QWAA 2ECKA 2GNAA 3E4CA 3U3DA 4TSFD 3U0BA 4ILKA 1WSWA 2C4NA 3MJTA 4PANA 5TPZD 4OV6B 4CU2A 4LW8A 4OM8A 1KIFA 2Q8PA 5JSUA 1KIAA 5DLQC 2LNDA 4Z49A 2JA1A 3CSDA 3CLTD 1GZDA 4ZT4A 1ZUWA 3E53A 3NEPX 2BKXA 1KSFX 2P5TB 5G0UA 1QF7A 1NYLA 1C14A 1SOVA 5DN6A 2NZWA 2QOEA 4M9ZA 1SHTX 3VHQA 5BR8B 2WM9B 4X97A 3T3PB 1FL9A 3W5JA 2BWJA 4PSVA 4RV5A 3ZWCA 4LV8B 5IXYA 5JNTA 3E3AA 5DYGA 1D5CA 1HH4A 4AJOA 1YC5A 1BMTA 2IXDA 4DW8A 1JSLA 2VDLB 2VQSA 1RACA 4DIKA 1CHNA 2J3DA 2VP6A 4ZQCB 1WO8A 3IBSA 3C1UA 4PBTA 5CT9A 4C04A 5IHXA 1P9OA 3QXXA 1PYGA 1XMXA 4PZ0A 1M2WA 2HMSA 2JJMA 5JCOA 2WHPB 1EUCA 3HA2A 4YQEA 4BASA 4ZOAA 4MHOA 2H18A 2WV7A 1G8PA 3DOHA 1UPAA 3DYIA 4K2HA 3L07A 3ZPXA 2BFDB 3ZD9A 4F5DA 3SHVA 1NLYA 3FWZA 2VBIA 2JGMA 1VLMA 4BLVA 3OQJA 4C22A 5LKAA 3PFKA 3RI3A 3W6ZA 5JHHB 4UW9A 3BULA 1W581 2BGNA 1BH2A 5CIQA 5TSDA 3OTOB 4TV9A 2AOTB 3TLXA 1CIVA 1NMQA 2WJHA 3KUUA 4JOSA 4AU1A 3FDIA 3W1WA 4MWZA 2EJBA 2XRMA 4KJZA 3FYCA 2XUZA 2Q3CA 3NT5A 4CQMD 4RTKA 2BEVA 2ZIZA 3B6MA 5F7XA 4TZ6A 5JNLA 1QV9A 4GC9A 5E2IA 4AUKA 5CK4A 4RHYA 1U3DA 1S9DA 2PK3A 1FP6A 2NTEA 4GOJA 4ZU1X 2XWBF 3WYEA 1ZCBA 1VMKA 4NCXA 4EI2A 1PJQA 1KVQA 4EHNA 1T8PA 4HZUB 5IW8A 5I01A 3ADCA 4G5YA 2O1EA 4M7PA 4MTCA 1EK0A 4ZQIA 1TA4A 3CPJB 1HKUA 4N12A 1LDMA 5E8RA 5C1PA 3NWEA 4GLBA 1Z33A 1Y1RA 3FVWA 1EUDB 5CVCA 1H93A 4I1UA 2I3DA 1UT6A 2D5LA 4P34A 1RZUA 3M9LA 1A5TA 4FFWA 4AMUA 2DB3A 3K0EA 1U5AA 2WB2A 5KX5F 2JIZD 2R8XA 5DFAA 2QN8A 1UJ2A 1XZDA 1W35A 1A88A 2YDYA 5KYKA 4YRDA 1IVSA 1OFTA 5I9SA 3ST7A 3UWPA 1JB1A 1EE1A 3WRYA 1O9GA 1HQCA 3LHFA 5SV2A 1OXBB 4NOLA 1QZ3A 4CN8A 1O94C 3HXMA 5GONB 2OOKA 4LTMA 4JLJA 3OZUA 2QXYA 2B34A 1EK6A 1HYQA 3ZVMA 3S5UA 4OHPA 5KYUA 4AK9A 5JISA 2H9IA 4HDMA 4B5LA 4M87A 4CYMA 2EBFX 3PKZA 5AKKA 5KNCH 1N1EA 1UAYA 5KNBD 1PGQA 1KY5A 4C6SA 3M1YA 2GA8A 3QKUA 3WB9A 2UAGA 1VKNA 4CUKA 3L9WA 3TPZA 2RGEA 3OPNA 4FI3C 4I9NA 4F2WA 1I01A 1XCPA 1ZISA 4N5DA 3R6LA 4C89A 1M0EA 1JHZA 3NORA 5SYNA 2JIPA 3B3GA 3ESCA 4L6CA 1JEDA 3L7BA 1UM9B 5TGDA 3PFCA 3GJXC 1O7JA 2MINB 4UJ5A 5D2CA 3VDNB 4D92A 4F9TA 1WBDA 3RBZA 2ZRDA 2XCSB 2FLVA 2PN1A 3KSRA 2HRCA 1MEJA 3MJFA 4UCWA 2YXPX 5LLTA 1F8FA 2XQVA 3ORFA 5F4BA 3U3OA 1ZRMA 2VAXA 3MWLA 1A4UA 4ID3A 2VHUA 1N6KA 3DLAA 1B15A 4EJSA 5EIFA 1O08A 5EUMA 4O2AA 3QVWA 2BFFA 5DNAA 1JNXX 2ZRBA 4PLTA 3EK2A 3AFMA 2FSSA 4JITA 4YQZA 3W9UA 3BYZA 1BEUB 4AZ0A 5L7YA 4GVPA 1NGSA 4IIFA 3CUSA 3N2GA 1E63A 3ESXA 1VXOA 2Q3JA 4IUDS 3W06A 3DVAA 2OK8A 4QE3A 1GPJA 1OGIA 3IHTA 3OJEA 4A8HA 4UD2A 4OHMA 3TN7A 3RG2A 1SXGA 4DLYA 4ETMA 3O2QB 2ZJOA 3OPYA 3G5TA 2EXXA 2QRVB 4MQ4A 1JQLB 4J0QA 5DBEX 5ALPA 1GU7A 1PT7A 2QSYA 1P73A 1SA0A 2ZQ5A 3R0ZA 1J2RA 1KBQA 2CDNA 2ECFA 2JJYA 1USKA 1P0CA 1W0CA 3C3CA 2H1HA 1MAHA 3JARB 4HNUA 3REFA 1OIVA 2VPIA 3IALA 4G67A 1MZVA 4P58A 4AY5A 3CUEF 4MR9B 1ZRSA 1QRAA 3O4FA 4YV1A 2LD4A 1BYIA 3MZ0A 2H1VA 5DLDA 3V3KA 1D9XA 1LZKA 1EUQA 2RGDA 2P6UA 1E0SA 3PNSA 1N2GA 1N5IA 1VFPA 4BLPA 4D80A 3BSSA 4D81A 3T38A 1FRVA 1KDYA 1KKMA 3PR2B 2MSEB 3UHOA 2VCYA 1XJWA 4RF4A 2J7PA 1IWPB 1JB9A 1S1CA 2Y0PA 3HUTA 3PUJA 4ER7A 5K4HA 2PPLA 3NBUA 2A94A 2C9DA 4LZPA 4BMOB 4MWCA 1HT2E 4BCDA 2ZU0C 1QPBA 1MPXA 3CZ9A 2PSEA 1G4UR 2E85A 4XRRA 4E46A 3T7EA 2LVBA 3AR5A 3EMBA 2PWPA 5HFNA 2OA0A 4F11A 2C94A 1W29A 4Z4GA 1PLLA 3G8YA 1BVYF 5CFQA 1MQAA 1RXSA 4AJPA 4KXWA 5DCLA 2V8OA 1CUSA 3AB3A 1FYXA 2P2GA 3NBKA 2PIAA 4HQOA 1U11A 3EVZA 2DRIA 2FHSA 4LG1A 5DSZA 3W3AA 1EZZA 1M72A 1EVJA 3RUEA 4I1OA 2O06A 4KVZA 1F4LA 2A1TS 4G1VA 2A57A 1IZZA 3DVRX 3PJEA 1KRHA 1MW8X 2BCEA 3D31A 1WOYA 4X24A 3GPIA 3JQAA 4NXNB 3UXEA 2HBRA 2AYYA 4U2DA 3UCEA 2GPYA 4LA4A 4F6LA 5AJHA 5C53B 3LXXA 3GELA 3ZZ0A 2DLNA 3AF6A 3OEEA 1DDGA 3ZXIA 2A92A 3AJAA 5K8LA 4XH9B 3IUPA 3WL4A 2X6RA 3P94A 1GYRA 5HJ7A 2ZJFA 3VR4H 3HFRA 1HMYA 1Q91A 4GX0A 1NMEA 4C4TA 3PNMA 2B61A 5JD4A 1UMDA 2YQ4A 1UXIA 2JFNA 3C16C 3QUQA 1K98A 1RTKA 4NYJQ 4LGMA 1KDPA 1ZKDA 4OP1A 3DF9A 3IURA 4Y67A 3R7NA 3CZCA 4NIMA 3UUEA 3IIEA 1KPGA 1YZKA 2A4KA 2ID7A 2PA0A 2P79A 3CLTC 3GK3A 3HYCA 4KUHA 4ALLA 1USUA 5FBHA 2WIAA 4P3NA 1Q7CA 1GV1A 2FW7A 2FDRA 2DWUA 4CEJA 1WWKA 2BCJQ 4TGLA 2QT0A 3HKBA 4W8GA 5TQJA 3VZCA 4EB6B 3T1NA 3ZDZB 1PJZA 2J9RA 1YDFA 1HSOA 4OQYA 4QGAA 3R44A 1PO7A 1OKKD 3QBEA 1FPMA 3P45A 2ZG6A 4UMEA 1C1DB 1GL9B 2VDNB 4KUEA 3RROA 5AW2A 1HT0A 4N5NA 2XCQA 4ND5A 3TIVA 3U4HA 4M1SA 4KXNA 4NJEB 4TUYB 3PCRB 2X8JB 3WC4A 2P5UA 3KYIB 4MUBA 2I6QA 4XJXA 3VSEA 1UEIA 4B4WA 5ED4A 4TLLB 3K5WA 2QIPA 4FNGA 1T29A 4LSMA 3EAGA 4AC9A 1KO5A 1YMQA 2BHTA 2A33A 2YJGA 2DGDA 5JQGA 3BILA 3FYUC 4X94A 3F1KA 3ULKA 1SCNE 4O2BF 3QY9A 4RZSA 3WS7A 5KVQA 1SEVA 1KQFA 3GGOA 3IOMA 3LP8A 3ZS9A 1X39A 3DBHA 2WRZA 2HOQA 1N8NA 3ETHA 2OAQ1 3LQYA 4OYRA 4WK6A 4YC7A 3KU4A 2O8BA 3GFGA 2ZRMA 1H1DA 1EIWA 3D6NB 3MMXA 1LRJA 4KO3S 5H02A 3GAFA 2I6GA 1V41E 1UKBA 2P6PA 3VNSA 4TN1A 1O6CA 4LHSA 4MCAA 3RT9A 2GJ4A 3NANA 1JG3A 3KSUA 3WV4A 1DTEA 4NU0A 3BMOB 3PXGA 5B7GA 2RAPA 1BHO1 2WWXA 4BP1A 3U44B 3U56A 1X1SA 5A4MS 3O5AA 3LA6A 3QFTA 3L0CA 4OO3A 2NACA 3KBBA 4LK2A 4A3SA 1UC8A 1RQNA 3LXUX 1I7SB 1IB0A 3DDOA 5JDCC 2WG2A 3SSOA 1FDSA 3HG7A 4X54A 3UVEA 1PS0A 2IXTA 1PCXA 4NK4A 1W30A 1K0FA 3I6IA 1SU8A 1HT1E 5LWHA 2I0FA 4PSUA 5KIAA 4TYNA 1JR2A 2IVFA 2R9VA 1WZCA 2D0PB 4BX3A 1FFEA 3NJ4A 2PGAA 4YGYA 2P30A 3OOEA 2OZKA 1T3LA 2FX2A 1YS2X 2QW1A 3B8HA 3F4BA 4U7WA 4DYHA 5ILOA 4ISBA 2Z6QA 1ZN2A 2HF9A 4HUJA 1WVIA 1G3UA 1D0IA 1HE5A 4HLDA 1NBMD 3SLGA 3O2NA 3ME5A 3AI1A 1LBTA 3NHPA 1HMPA 2IZ5A 2X19A 3R2JA 4GHWA 1N4AA 2QVGA 4Y2SA 2H5EA 3BXXA 5GOZA 5EXSA 5EMJA 1YE5A 4F4UA 1YA4A 2RDMA 1PKEA 4CMBA 3UXHA 1R8YA 2GCEA 1N34B 1T3SA 3IIJA 2VJCA 3QYJA 3WICA 5JJLA 4XD2A 3ETGA 3AEUA 3IPAA 3H11A 1MV8A 3OTWA 3PFIA 2I71A 3OCXA 5C8YB 4ESOA 2FZVA 4UNRA 3JQ6A 1OXMA 1II8B 3ZXXA 5JZOA 2HD4A 2O0MA 4B73A 4JWKA 2VXYA 1P91A 1EBFA 3TKLA 3QEBZ 4M9RA 2YXBA 3I28A 5DMHA 2OHXA 4UBOA 1HRKA 2OHHA 4A6XA 4EG4A 2KQUA 1B0PA 3HN2A 1A5SB 4NX2A 5K0LA 1BMDA 4CM5A 2Z2ZA 3WL7A 1VSBA 3KFXA 4WEOA 5AIBA 2W2KB 2H1SA 4NYJR 4GI3A 1R8QA 2Q2QA 2RK3A 1R4NB 1SXJD 2ZBDA 3FTDA 2VJKA 1PJLA 1DEKA 2HU5A 2FPKA 3FSGA 2FXVA 4GP6A 3L4BC 4V0NA 4B9AA 3H04A 5F5NA 4CPDA 2W37A 3K31A 1ISPA 1KOFA 3CO0S 3PF8A 1LB1B 1V2GA 5A7FA 1RVDA 1NVWQ 2D8AA 4E7OA 3HXKA 4Q3DA 3GLIE 2IOYA 4RKEA 1G21B 4Y6OA 3NWJA 2XD4A 2XYPA 4R8VA 1HURA 4CR8A 1U6KA 5JS8A 2XEDA 1UKEA 3KEQA 4R1QA 1KYWA 5B4VA 2H2DA 4OXRA 3K6SA 3IR6A 2QL5A 2HT1A 2AS0A 1G42A 3EC2A 2PWYA 2XZTA 4U0JA 2X3FA 3AEQB 3FCXA 1Q1QA 1GNRA 1VBFA 3H4MA 4MP8A 5TRTA 1NC3A 1G63A 1T2UA 3MJVA 3A11A 4MVJG 1TIKA 5IC5A 3E9ZA 4EM6A 3K20A 2IPXA 4QODA 3A3NA 4HADA 1U65A 2X7HA 2XKKA 4G9BA 1FFHA 3AR8A 1G8HA 2W4IA 4D56A 5CDHA 3ZX4A 3NAGA 4Y0NA 2ZSKA 3K6JA 4PGFA 4EUFA 2YN4A 4CNBA 1RABA 3LZCA 4LCJA 1JQJC 3VH1A 4DYVA 3ITEA 2DWPA 5A5FA 1DXYA 2GJSA 3HVJA 3WK6A 1CBUA 2R8ZA 2WWFA 2J9XB 3VAAA 4YX9A 1P3DA 2W0MA 3UCXA 4E32A 4OH7A 3BCRA 1Z3CA 1SCJA 3NOOA 4RK0A 1T3ZA 3ERCA 2WYUA 4FYWA 1W4RA 4G09A 3RFTA 2GDZA 4TLAA 2QG6A 4P84A 2WSYB 5BN5A 3G2NA 2XWQA 4GBED 5DE3A 5EJMA 5BRJA 2EJWA 3CNNA 5L3SA 4KQEA 5LQCA 2I2BA 1L4FA 5AI5A 4D8XA 5IJ9A 3VGJA 3TXXA 1ORDA 4F3NA 4N7RA 5D3ZA 4KBYA 4JLNA 2ODBA 3MIZA 3VPDA 3C3DA 4PHFA 3SF8A 1NQTA 2L17A 3ESZA 4XR9A 2VJDA 1B1AA 1UBEA 2XZDA 5I4CA 5F98A 3UG6A 3O8BA 1Q20A 2ODPA 3OZIA 3V33A 3AU9A