3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyphenylpyruvate reductase
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
molecule tags Oxidoreductase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
1NWCA 1P1RA 2FHSA 4YJGA 1N9GA 3OMLA 4UREA 3GVHA 4IZHA 3UXYA 2AQIA 4RO0A 3WMXA 4C7JA 4CV1A 3M1AA 4IM7A 4XKJA 4Y98A 1FDTA 2O3TA 3DOCA 4BUCA 4DLBA 4MVJF 4Z6KA 1PL8A 1P74A 1MC5A 4CMGA 1R66A 3O26A 2G82A 3DEYX 3ZV3A 2WEKA 5IXYA 3NT5A 1PZHA 3KM0A 2I3GA 1ADGA 4J1TA 4KQWA 2LDBA 1KVQA 1N1GA 1DAPA 5IF3A 4NBWA 1YL5A 4YT8A 4O6VA 1SPXA 4NBVA 1A4IA 2JHGA 5H81A 3GEMA 1SEVA 1HTBA 4M87A 5DOVA 1ZW1A 4XJSA 4PLHA 4Q3AA 3BTOA 2X5JO 4Q3EA 1VL0A 1B8UA 4JXKA 2AA3A 2IYOA 5L4SA 3LVFO 1T1SA 4RL6A 3DO5A 3ZU3A 5TLSA 3JQ8B 3GOHA 1FF9A 3HFSA 4R68A 2Y1FA 5JCJD 2O3UA 2X0JA 3UFXA 3E5RA 5L3ZA 4NPCA 4WNIA 4D44A 3RAJA 5CPBA 1UH5A 3PLNA 3Q0EA 4A5OA 1IY8A 2B4RO 4DXHA 4PZCA 3IKTA 4Z9YA 4OOEA 1EVZA 4I5FA 2ZTMA 1GADO 4PLTA 3S2FA 3PQFA 1I01A 4EW6A 1S6YA 1EBUA 5HS6A 5IN5A 1PGOA 2WYUA 4YVFA 1DLIA 1KC1A 5A1TA 2NV6A 1F14A 3PIDA 4P38A 1QV6A 2C5EA 3RUDA 1EUCA 2X86A 3TZCA 4HUJA 2VWPA 1QYDA 1SEPA 4ONEA 3JQAD 4BKUA 5BQFA 1J49A 3DBVO 3LZ6A 1W8DA 1RYEA 4RPLA 4WCDA 3WIDA 4MVJG 3ZNOA 3GQVA 4N18A 1N9GB 1KIFA 2CDBA 1VKOA 1I8TA 4R51A 4CMAA 2HDHA 2V7PA 4O63O 3KSZO 1YONA 3RKUA 2WSBA 3UN1A 2XAAA 3Q9NA 4FSHA 1HDZA 2Y66A 1DPGA 2SCUA 3MJ4A 4CUZA 4CQLB 3ITKA 3VPXA 5JO0A 1E3JA 1MG5A 4CMIA 3TL3A 1LLDA 3E9NA 3I1JA 3L4SO 2DKNA 1EE9A 3NYWA 2VWHA 3KEQA 1F8GA 5KVSA 1XA0A 3IP1A 1ZFNA 3T7CA 1R37A 1HETA 1LDNA 4MP3A 1D4FA 1B16A 3RC2A 4BGIA 4N5LA 1HWYA 1RPNA 4YA6A 3C7AA 4IJUA 1RM0A 4RGBA 3V1TC 3LQFA 3DZHA 4BNWA 2Q4EA 5A5EA 3VTFA 1KBZA 2OORA 1ADFA 4J7UA 1PJ2A 3PGXA 4JCOA 5EN4A 1OOEA 4GI2A 1NQTA 4Y6RA 5KJFA 3BXXA 3LC1O 4CMCA 1R4MA 3KYDB 2HMSA 1ZZEA 2OUIA 4RVHA 4DUPA 1Z45A 3BHIA 1ZEMA 1NX6A 2P5UA 4MVJA 3ZNNA 3GZ4A 1Y9AA 3F4BA 4WEQA 4A26A 4GSLA 2CVZA 3ANLA 1H6CA 4B7XA 3DBRA 2G0TA 3I3OA 4WGGA 4YTEA 1ZK2A 4ZJUA 5IXSA 1CQJA 4K1LA 4KTTE 3L9WA 3BMOA 3H3JA 1UZMA 4JN6B 1I5RA 5DBFA 2GR9A 4AG3A 3FNFA 3DAFA 4I9NA 1VE9A 4XX0A 2DTDA 4ALKA 3QE3A 1O94A 3I9MA 4PLGA 4ZGWA 5ENDA 1LSOA 4XGNA 7ADHA 1D7OA 5A02A 1U8XX 5JC1A 1QMGA 1YDWA 1GEEA 2Z1NA 2ZQYA 4J6FA 2AG8A 2Y68A 3OIDA 1Z6ZA 1E7WA 2TMDA 1QORA 4JBGA 5G0VA 4Y8VA 3ZGYA 1ZH8A 2YFQA 4CM6A 4BMNA 3CMCO 2O2YA 3LLVA 5AXDA 4TKLA 3LYLA 3LT4A 4LCEA 3ZDFA 3IJRA 2ZTLA 4JROA 1TLTA 4NIMA 3K9QO 2ZTUA 4XYMA 3PDUA 1WZEA 1XWFA 3QLJA 4XEHA 2Y0DA 4EDFA 1UAYA 3HDJA 1F12A 1K5HA 1J6UA 4CMJA 4Y67A 2DFVA 4R41A 1KOLA 3M6IA 2YJZA 1PJCA 2A92A 2R00A 1XSEA 2D8AA 2R6JA 3O9ZA 3I4CA 1LQTA 3G17A 1MFPA 4MO2A 3D3EA 3JTMA 5F1OA 3INRA 1DOHA 3JD3A 2X9GA 4H7PA 2Q50A 3FNEA 3RASA 3UHAA 1DJNA 3JD1A 3U5TA 3JQGA 1R4MB 2FP4A 2C82A 1ZO8A 4IXTA 3R1IA 1C0LA 4R1TA 3U49A 1ZBQA 5A3JA 1IZ0A 1HZZA 2X0NA 4R01A 5GZ3A 4DC1A 3DBRB 3WWYA 4FOSA 4ROSA 3LF1A 1M6WA 4YJHA 2Q49A 4IGEA 4AJIA 2DPHA 1I2ZA 4LSWA 2PZMA 3FNHA 1C0KA 3E03A 3VZQA 4DVJA 4BO8A 1E7QA 4E5PA 1U3WA 1JAXA 4HXYA 5BSHA 3JCZA 4PGFA 2VUUA 3BHJA 3LT0A 1FDVA 2W2LD 3OJ0A 2DAPA 4WOJA 1AUPA 1U1IA 3JD0A 4W99A 1A71A 5KKCA 4XIYA 1H6AA 4E33A 4JK3A 4OOFA 5A3VA 5TNXA 4L4XA 3RBVA 1H0KA 4K6FA 3KRTA 3QQPA 1KVUA 3OICA 1R4NA 3HN7A 1DFGA 2P9EA 2Z5LA 1H9BA 3ICCA 1N1EA 2BI8A 4I08A 4QECA 5CP8A 4AICA 1YOVA 2EG9A 3JYNA 3OEYA 4FJ1A 5A9RA 2UUPA 3MJVA 2NM0A 3GLQA 1XYGA 2C2XA 3ONDA 4UVEA 4L75A 3UGKA 4GMFA 3ZCXA 3B1FA 1DRVA 3S2IA 3ZW8A 4CPDA 2PH5A 2JD2A 3DZIA 4IS3A 4PLPA 4XYGA 4CLOA 1BSVA 5JO9A 4I5GA 5C37A 1JAYA 1P33A 1WPQA 1I3MA 1NTOA 4D3DA 3GN1A 4EGFA 5B4VA 1DHRA 2CDCA 2Q1TA 3QJ5A 1EUZA 1YBMA 1WXDA 1CETA 3HE3A 4JBIA 4CLDA 4RF5A 4OSPA 1G0NA 1DEHA 4YXFA 3GAZA 1EE2A 4YDRA 2EJVA 1PS8A 3N58A 1UZNA 3JYPA 4U0KA 4Q39A 1HYHA 2EHDA 4P4LA 1SBYA 3VPFA 2YUTA 2JCXA 1H6DA 5DF1A 3QY9A 4CM3A 3WGTA 3PTZA 1PZFA 3OETA 5ITVA 4J2OA 5DCYA 1JWAB 4FDAA 1RM4A 1U2DA 4NR0A 5JDCA 1E7SA 4CLXA 3JQGB 2NTVA 3R3JA 2JJYA 1OI7A 3FRJA 3OIFA 5U4QA 4WCFB 4FS3A 1L7DA 3W1VA 4FIZA 2G1UA 3GA0A 1W73A 4OGWA 4R1NA 1NFQA 1U3UA 1HRDA 2Q3EA 4YJHB 4RZHA 2WYWA 1MC4A 2D2IA 4WLFA 1I3KA 5GZ6A 3WJ7A 2HUNA 2P91A 4NZ9A 4E21A 5KWEA 3W8EA 3BYZA 1BW9B 1JKFA 3GRPA 5L7YA 2J8ZA 4Z3DA 3VAZA 4EJ6A 1LSJA 3DOJA 2DC1A 3MWDB 2WE7A 1CEQA 4ITUA 1LXCA 8ADHA 1GPDG 3G49A 1UP6A 2I65A 5L7WA 3RBZA 3B6ZA 2I5PO 4LGVA 3WX0A 5I7SA 3OIGA 1HE2A 4OXKA 2FR0A 2GZ3A 3WYCA 5CDTA 5CEFA 1XG5A 1PJ3A 5JYEA 3SBOA 2GERA 4GL4A 3ANMA 1Y5MA 1YB5A 1EBFA 3FBGA 1YOVB 2EGHA 4CMEA 3UCFA 3JQ6A 4IS2A 1PZEA 4IXWA 4OM8A 4E4YA 5FEUA 3L6OO 4HADA 5AXAA 3KBOA 1DO8A 2P9CA 4GGPA 1K89A 1NM5A 1PTJA 2BD0A 4F3YA 3PJFA 2PA3A 1B7GO 4U6QA 1GAEO 5I7EA 1OFGA 4KTVE 3RUCA 3ONFA 2VRCD 5J23A 3BAZA 4PZDA 4Z0TA 4L9RA 5DBGA 4MOWA 5L95A 1BXGA 1I30A 3OECA 2H63A 3R3SA 4AJHA 1AXGA 1WW8A 2VOJA 3PXXA 3L0DA 2Y0EA 5TSDA 3D7LA 3WGOA 1QYWA 1CQIA 5KJEA 3DB2A 3NUGA 3K2BA 4LVUA 2OL4A 1DC6A 4A27A 5TRTA 2C7GA 2H9IA 2WD8A 5A4DA 5B1YA 1DDOA 3AUUA 1KY5A 4M54A 3BA1A 2B69A 3ZN2A 4CL8A 3E6AA 2DQ4A 4K28A 3F46A 1GQ2A 2JCVA 3KO8A 2GRAA 1PR9A 1LQUA 2DBRA 3V1YA 4QQRA 1KEWA 1WDMA 4WK6A 4E6PA 5U1PA 3GC6A 2BRUA 1ADCA 2I6TA 2OMEA 4BNZA 3O38A 2FPPA 4L73A 4PG6A 6LDHA 3HZZA 4WLEA 5CAEA 2B4QA 3EHEA 4JJIA 5JCXA 2LDXA 1YBVA 3VVBA 2X23A 5CDSA 5I9NA 4XGKA 2J3HA 1HDRA 2FY8A 2CD9A 5L45A 1E92A 1GD1O 3SLKA 3SVTA 1GV1A 3KETA 3PHHA 3JQDA 1HYGA 4FCCA 5JNLA 4L0QA 2YQ5A 2Z1MA 2O3SA 4XJTA 4KDEA 2H5LA 2HLPA 1YO6A 1E6UA 3K96A 1HLPA 5T8KA 1GTMA 4PLWA 4XA8A 1ENZA 2O4UX 3ON5A 3B1JA 4RORA 2YY7A 3QVTA 1X7GA 2DBVO 2X0RA 1TT7A 3WGHA 3DTTA 3ABIA 4CQMA 1Y8QA 1BDBA 3L07A 2HMWA 3ETEA 1LRLA 2VN8A 5T57A 3IAHA 3RJ9A 3AY3A 1M75A 3RKRA 3INGA 3W4KA 1ENPA 1XQ6A 4IGFA 1PIWA 1BG6A 2WM3A 4MKRA 4HFMA 1YWGO 3JQBC 4N54A 1IHYA 1X15A 4AJOA 4J7CA 2J3IA 3ROKA 3W8FA 4EEZA 2NTJA 3NTRA 1BXGB 4MP6A 1LLQA 2CSUA 3KSDO 3K6JA 4A10A 3E9MA 3LF2A 1FK8A 3PYXA 3VDRA 1X14A 4GKBA 1UZLA 4NK5A 1BGVA 3F9IA 2XPCA 2B4TO 4M49A 1P1KA 5DP1A 2X9VA 1QKIA 3HFGA 2DUUA 4J91A 2V6GA 1A4UA 1EK6A 4MINA 3PRJA 4RF2A 2GSDA 1PWXA 4BNTA 4XDZA 2BLLA 3ONEA 1FJHA 4GX1A 4QXMA 1Y7TA 1C1DB 3JD4A 3ETGA 3FN4A 1R16A 3TFQA 2J6IA 4YYZA 1PGPA 2BI7A 1JKIA 1QV7A 5G4KA 2JD0A 2PGDA 3DL2A 1Y1PA 4WLUA 3ICPA 5JY1A 3X2FA 1EVIA 2NU7A 3GVPA 4C7KA 4HNHA 3QRWA 4YJFA 3NGLA 4ZQBA 2V6FA 4NJOA 3V2UA 1B8PA 2GN8A 1N7GA 3UOGA 3JD2A 5TGDA 1IL0A 3KSUA 4J90A 2O3QA 4URFA 5BR7A 1XR3A 1ZK4A 4CLEA 5HWSA 3G3EA 1CYDA 2ZB4A 3PJGA 4U5QA 2RHRA 2R00C 5A06A 2POQX 1GUFA 1YVEI 3EUWA 2WE8A 4CQMB 3IUSA 1Y8QB 2WJPA 2DTXA 3JQ7B 2XOXA 3PFWO 2X0IA 1T1RA 1JW9B 5JE8A 5A9SA 1VL6A 1ENYA 4YB8A 4GAEA 2W4QA 4D45A 3QVOA 1ARZA 1I10A 4YACA 5JSFA 5C7IO 2I66A 3VPSA 3MJTA 2IDZA 3E48A 3PEFA 3AK4A 3IDSA 2R2GA 1UXHA 3HSKA 3LLSA 2C59A 1VKNA 2D5AA 3IQDB 3OJLA 4CL3A 3NEPX 1PR3A 2YV2A 4QO7A 3E18A 3L6EA 3RSHA 4L4SA 3TZHA 2X5OA 5CFZA 3WQRA 5BSGA 3GNSA 1QSGA 5A5FA 1YQGA 3PP8A 2PGLA 3IS3A 5COQA 4Z3KA 5KJ6A 5ER9A 3EY4A 3DZJA 2P68A 3GH3A 4IMPA 2E82A 3WWZA 4YPOA 4ZQHA 1GY8A 4RLHA 4YAKA 2AHRA 2B35A 2C20A 1QP8A 4TVOA 4DWVA 1TA4A 1SZJG 1Y5RA 3L4BA 1FDSA 4MP8A 2PFGA 5JW6A 3HG7A 3AJRA 4E2YA 1DC4A 3DZBA 3PHJA 1E5QA 4QO8A 1ML3A 4AJLA 2P5YA 2QZ9A 3WG9A 3PHGA 5EPOA 1YE3A 3ENNA 5G4KB 2Y1DA 4KZPA 3ZWVA 1WLYA 1Y6JA 3L77A 1KETA 1P1FA 3NTQA 3UCEA 4YAGA 4YJFB 3VC7A 3D1LA 3WICA 5IDYA 1GR0A 2V6BA 1ENOA 4ID9A 4DIOA 5CG1A 5IZCA 4ZQGA 1JDJA 3WQQA 3E5MA 1NP3A 1U4SA 4LRTB 4FJ0A 1E3LA 1ZK3A 3DAPA 2D4AA 2WD7B 2OBNA 3BTUA 3G1UA 3IUPA 3U4IA 1V0JA 2VYVA 2A35A 3VOSA 2B0JA 1GQYA 5T64A 2WTBA 4ZD6A 4J0FA 5DZSA 3IC5A 1WMAA 1GZ4A 4B8WA 2X5KO 4NBTA 5JBIA 2ZJ0A 1Q0LA 2J5QA 2HK9A 6ADHA 4TROA 1N5DA 2RH4A 4M86A 3GGOA 4G81A 5JDCC 2W8ZA 3WIEA 2QQ5A 4DPLA 2YQ4A 1RWBA 1PS0A 3GVXA 3ROPA 4N5NA 4Y6SA 5TT1A 4JLWA 1XGKA 3OQBA 3M2TA 4FOOA 1RKXA 1AN9A 3RUAA 1U7TA 4O0LA 5TX7A 4C4OA 1NFFA 5KKAA 3DXFA 2Y1GA 4CM8A 1WMBA 2QYTA 4MVJP 1V9LA 4XYBA 2BKAA 1DC5A 4XD2A 4YJGB 3LDHA 1NQOA 1EDZA 3ZI0A 3COSA 1JLLA 2CDAA 4BO9A 1K6JA 5HM8A 2BF7A 5DOZA 3IL2A 4DREA 1SAYA 1QXSA 4GGOA 3H9JA 2NVWA 4DBVO 1DIBA 3PQDA 4BKOA 1BDMA 1GUYA 4PLCA 1X1TA 3K30A 4IJKA 1Y8RA 4WE3A 1H2HA 3H9GA 4BNUA 4D7AA 4GVLA 2AEJA 3EYWA 1ZSNA 2Q1WA 4PIVA 3M1LA 1PGJA 3K8ZA 1EZ4A 1C0PA 3CH6A 3Q1LA 4DQUA 4J4HA 4B3JA 4FR5A 3TNLA 1E3EA 3WR5A 1NQ5A 2EV9A 3IJPA 3AM3A 1E1KA 4PVDA 1O95A 1YB4A 3RVDA 2HMVA 3AWDA 3DZFA 3E82A 3AW9A 3PZBA 3WDSA 4CMEC 1UDBA 3NDJA 3PLRA 4FFNA 3NAQA 2OXIA 1EQUA 2FMUA 2IE0A 1TXGA 2P9GA 4TQGA 3L9XA 2J5RA 3IKVA 3D5TA 4ZN6A 3QSGA 1W0CA 2HJSA 4CM9D 3GVCA 2PZLA 3JYOA 1OMOA 2YV1A 4PG5A 3I52A 1PJTA 4YJDA 2VYND 4F6LA 2E49A 1YH3A 3ASUA 4W6ZA 1SO8A 2NSDA 1KS9A 4ZQFA 1NYTA 1KY4A 4UULA 4CV2A 2EF1A 1KERA 1G6KA 1TVEA 3WNVA 1P0CA 1ZEJA 2O3JA 1PQPA 2OBYA 3GHYA 3I4FA 3IMFA 2XXBA 4IJWA 4IQGA 4KUHA 3ST7A 2BFMA 2Q46A 3QV1A 1PZGA 2GPTA 4J43A 4Q3BA 4J9UE 5F5NA 3EC7A 3X2EA 3GGGA 3PIIA 4I5DA 1XQ1A 3H2ZA 3EVTA 1LJ8A 1UR5A 4XQGA 2BMAA 3O4RA 2WMDA 1EQ2A 1E3IA 4H3VA 3OEWA 3WBFA 4G2NA 4CLRA 1ONOA 3HB4X 3P2YA 4PG7A 4EUHA 2CVOA 2RH8A 2YHIA 4CM8B 3FI9A 5JC8A 1I24A 4K9DA 1PEDA 3VZSA 3OJEA 3Q2IA 2GYYA 2EW8A 4YQYA 1JVSA 1QRRA 4M55A 4INAA 3AOGA 5EINA 3OHSX 2Y1CA 2PH3A 4ZA2A 2HQ1A 3OH8A 3WOHA 1VSVA 5LC1A 4BV8A 4BNGA 2V6MA 3GT0A 4UVHA 4NU6A 4UEKA 2IXAA 1I36A 4UEOA 4CMIB 1OC4A 3QWHA 1Y8RB 2QX7A 3ETDA 3I83A 3I9OA 1LDMA 3DZGA 5CHEA 2NU9A 2GN9A 1O9BA 5AXBA 5KNLA 3UCXA 1R15A 2O23A 1GCOA 2XXJA 1IUKA 3AUAA 2FSVA 1R0KA 5A9TA 1L1FA 1ZVMA 5U9CA 4WJZA 3TPCA 5T8KC 4IMRA 5FFFA 3DONA 4NJMA 4HFNA 3I6QA 4YAJA 1PL6A 3GVIA 3SXPA 2FPIA 4ZVVA 4BMSA 1ZIDA 2VHZA 4WPGA 1QYCA 1XCBA 5MDHA 3SX2A 4BV9A 1N7HA 2NVUA 4R5HA 2OP0A 4II2A 5BNTA 4TSKA 5G0UA 4DQVA 1CF2O 3Q2KA 3B1KA 1CIVA 4QUKA 3M2PA 1W4ZA 4E5YA 4LISA 2HO5A 3MWEB 5JS6A 1R12A 2FR1A 4CR7A 1EK5A 1OC2A 1DBVO 1F8FA 2EP5A 2IRWA 3WXBA 3ZU4A 4KP7A 4HY3A 4CMBA 3ZZNA 4J3FA 5JAZA 3BMOB 3U3XA 2VTDA 3VKUA 2J5KA 3BMCA 1K6XA 4MVJH 4DYVA 5BSEA 2B5WA 2ET6A 4LCJA 1PJBA 3GRKA 4FFOA 1A72A 4OH1A 4GWGA 3NDIA 4DMLA 2IEDA 4IY1A 4BMVA 1PU2A 2VUSA 4IIVA 2JCYA 3MOGA 4J9VA 4YBZA 5EESA 2FN7A 2Q1UA 3RU9A 1EUDA 3ZV6A 5K0ZA 4PRKA 1NR7A 3QVSA 4CLRB 3UH1A 1XU9A 3TL2A 4B4VA 1IE3A 1LEHA 1MV8A 3SJ7A 2YHIB 1DIHA 4G5HA 1X7HA 4DC0A 3I9NA 1GUZA 5IZ4A 3CKYA 3OJOA 2AG5A 2VZ0A 4P22A 4B3IA 1T4BA 5F5LA 3V5NA 3OQ1A 4J2HA 2UDPA 3W4IA 1UDCA 3FSRA 4LMPA 4HFJA 1E1MA 1SC6A 2CVQA 5JDIA 2VHVA 3BTVA 2WWRA 2C0CA 2AE2A 3CMMA 1QLHA 4OIMA 5L51A 3TRIA 1K2WA 1U28A 4KUGA 1X1EA 2X7HA 1E1LA 1GCUA 3KLMX 1NASA 4IDDA 1IPEA 2B83A 2AMFA 3A4VA 3RWBA 4DIFA 3H7AA 1CERA 4YR9A 3WQSB 1T2FA 3ENKA 1B26A 4NJMB 3V2GA 4EEXA 1U2GA 1QYVA 3PGJA 3RUEA 4BIIA 1VJ1A 4R1SA 4XR4A 1R0SA 1P1JA 3HJAA 2BFOA 4GWKA 3U62A 3WSWA 4IQ0A 3FWZA 3PWSA 1SCUA 3H2SA 1J4AA 4WKGA 3VPGA 1M76A 2C5AA 4OKIA 2X8LA 4J7XA 4TVBA 1ONPA 3ZWWA 2FSSA 1C3VA 1T24A 3VH1A 2QW8A 2JAHA 2ZCVA 1QLJA 4UVIA 1UAGA 4EITA 1HL3A 3ZU5A 4NFHA 3RC7A 1LRKA 4XIJA 4DA9A 3C8MA 2QHXA 3OFSA 2PWZA 3TOXA 1AE1A 2G76A 2G17A 2YFHA 4L74A 2YW9A 1Z74A 3RUFA 3MZ0A 3RFVA 5JAMA 1ZJYA 2W90A 3RUIA 1VJ0A 4BNJA 3BMCB 4O5OA 4D43A 3GFGA 2VQ3A 3GR6A 4OXYA 4CV3A 1U8FO 3W6ZA 4R9SA 3HDHA 3DFUA 1OZAA 2GUGA 1R4NB 4I1IA 3PJDA 1IPFA 4BO3A 3EAGA 2O4CA 4TZTA 1YJ8A 2O7QA 3ZWCA 1YXMA 1HT0A 4IQ8A 5K6AA 3ZWMA 2X4GA 1T26A 4II3A 1JN0A 4DRYA 1YDEA 3L4BC 1KC3A 2EJWA 3NJ4A 1V3TA 2PGJA 3WJAA 8LDHA 5JXWA 4MVJE 5AOVA 1ZUD1 4WLNA 1QR6A 4RVFA 3U0BA 2UV8A 4MVJD 1EVJA 5ADHA 1HZJA 2EGGA 5HTOA 3D4PA 4FW8A 3QWAA 4D46A 4HNGA 4J49A 2B36A 3S8MA 5IZCC 3JQ9A 3CSDA 1HDCA 4ZRNA 3KVOA 4CLOB 1LUAA 2BGLA 3H5RA 2NTNA 1X0XA 2NU6A 3WLEA 1L7EA 3ADOA 5B4UA 4ESOA 3STHA 1PQUA 2Q1SA 3NT4A 1BXZA 1KEPA 1YQXA 2EP7A 3V8BA 4MIYA 1T2DA 1GQQA 4GX2A 3RROA 1MX3A 2I9PA 4N5MA 4FQ8A 4Q3DA 5FYDA 2VNSA 3DAGA 3LK7A 4HWKA 1DIGA 2DBQA 4Q9NA 3SEFA 3H9UA 1AXEA 3ZV4A 1ZK1A 1F06A 1HEUA 1VRWA 2HJRA 4N7RA 3GZNA 4UUPA 3GPDG 4S3MA 3ZWOA 4TKMA 5G0WA 2ZKLA 4MIEA 3C3XA 4W9NA 3S2EA 5F21A 3WS7A 4HFRA 5JCJA 2AQHA 1I2CA 3GGPA 5TC4A 3PDJA 4AJPA 4BGVA 1H5QA 4IJVA 3AM4A 1MA0A 4XQEA 3RFTA 5B12A 1ZK0A 2NUAA 3GF4A 4JJGA 1XEAA 3K2EA 4KWHA 5KVVA 2JAPA 1P44A 1CDOA 4TWRA 1PQWA 4IDBA 3WGIA 4RDIA 4LSMA 1ZMTA 4TRJA 3RC1A 3IIEA 5CEEA 3VDQA 1ULSA 4PN3A 4L76A 5DCUA 5KVCA 4R54A 3A1NA 1U4OA 5A04A 1P31A 5AQ1A 5B4TA 3RUHA 2CF5A 4BKRA 3DOOA 4ND1A 4BNIA 1XHLA 2NNLD 3F1LA 4H16A 2OGUA 2Y99A 3WFIA 1EEHA 3K31A 4ZRMA 4CR6A 4JBHA 2O3RA 3C24A 3ZNPA 4GLOA 4Z9FA 1HDYA 2ZCUA 4J1SA 2ZTVA 5FWNA 4MKZA 4I9HA 3JQAA 2PNFA 2NVBA 4DTIA 4FPXA 2D1YA 2UUOA 1YL7A 1V35A 4B4OA 3FPCA 4CV0A 4RVDA 1DLJA 2HK7A 2AEFA 2IZ1A 1ISHA 1ONNA 2YDXA 3LSYA 3HADA 4E2XA 1NVGA 4BO6A 3DHYA 2VHWA 3TF5A 4BNNA 3I6IA 4XDYA 3HN2A 3PWZA 4BNFA 3BIOA 3F1KA 1M67A 3AI2A 2PTGA 2PY6A 4RQTA 3GG9A 4BO5A 5KCZA 5EQDA 3NDRA 2F00A 4NFSA 5MGBA 2IEBA 3ZWYA 1UDAA 3D64A 4NBUA 4A03A 4LW8A 1GV0A 3T7EA 2VHXA 3GG2A 5ITWA 3FF4A 4AJ2A 3OA0A 5I8WA 3ZH2A 2O50A 4WLVA 4NHEA 5ILOA 1DIRA 1NNUA 2AE1A 3GDGA 1WP4A 1GYPA 2Q2WA 2I3AA 4UVDA 2FZWA 2O2SA 5BT9A 3QIVA 1PX0A 3CINA 3H6KA 3EW7A 3RJ5A 3T4EA 1HDOA 3UVEA 2A94A 2C54A 1NVTA 4PLYA 5THQA 1PS9A 3GZNB 4R3WA 1Q1NA 1FXSA 1SOWA 4RQUA 3MCVA 4BGUA 3D0OA 3H9EO 1SOVA 3OP4A 2GZ1A 3WYBA 2PK3A 2NWQA 3QVWA 1O6ZA 1J0XO 1T25A 3ADPA 3IOYA 4O59O 4U8GA 2NU8A 4IZIA 4QSMA 1TI7A 2VT3A 3C7DB 3OSUA 2F1KA 4XCVA 4ILKA 3N74A 5B37A 3G79A 5TJ9A 2EXXA 2BFPA 4J16A 2PD4A 4RZIA 2DFDA 2VTEA 2HAEA 3U9LA 2ZATA 4FB5A 4A2CA 5AVOA 4RVSA 3D4NA 3GNTA 2C2YA 3P19A 1JVBA 1IOLA 2PV7A 3QA9A 3R6DA 2IYPA 2ZYAA 1UP4A 2D5CA 1HDGO 3ROQA 2EIHA 4B3HA 3JSAA 1E7MA 4DGSA 3S1LA 3BMNA 1LDYA 3JQAB 4Q3CA 1BVRA 4GQAA 2Y67A 3AU9A 2GF2A 5GY7A 1T2EA 2NQ8A 4BL5A 2YV3A 3E1KA 1PWZA 5LDGA 1I2BA 3K73O 4BQRA 2HRBA 1GDHA 2PKQO 4OSOA 2E4AA 1E7YA 4D79A 4RVGA 4E12A 3WBBA 1PJQA 4D42A 3VHRA 3ORFA 5ICMA 3PI7A 4QFDA 1ZXBA 3FCOA 2ZYGA 3OJFA 3SLGA 2ZQZA 2Q45A 1EFKA 4J4BA 3W8DA 1HE3A 1X13A 4YRDA 1VSUA 2OFPA 1G1AA 2GN4A 4DBZA 5ICSA 3K92A 2VOEA 3EZLA 4NG5A 1LLCA 3H9QA 4B79A 4TRNA 2GZ2A 3RIHA 4CM7A 3I9JA 4YWJA 4U0JA 1XELA 3QWFA 3CIFA 2VWGA 1Z7EA 1IULA 4XWYA 5KOIA 3JQCA 4RPJA 1ISIA 4EUFA 1WDKA 5H82A 5G0TA 3ZV5A 5L4NA 4BO1A 1Z82A 3LT2A 4E5KA 3GNQA 5T67A 3ZWXA 1P3DA 2IXBA 2OOSA 5IDWA 2RIRA 2I67A 2ILTA 4LMRA 3W6UA 3U09A 2DU8A 2AQKA 2HMUA 3I9LA 1C1XA 1F0YA 9LDBA 1DHTA 1A7KA 1MFZA 3JQFA 5HA5A 4GMGA 4BVAA 2CY0A 4S1VA 2PKQP 3PHLA 5DULA 2CMDA 2JKVA 4YRAA 2ZB8A 1HSZA 4NDNE 4CQLA 1D1TA 3CUKA 3WGZA 3AU8A 3FPLA 4OHUA 4CM1A 4BHTA 2UVDA 1O5IA 4I9UA 3UKOA 1XU7A 3VTZA 2W2LA 4LRSB 3DR3A 3NT2A 1YJQA 2C7VA 1MB4A 3D3WA 1H93A 1UP7A 5DDIP 4BO0A 5JDIC 3HDYA 1KVSA 5TF4A 5L9AA 4NFYA 4B7CA 4O1MA 1ORRA 1RJWA 4NK4A 4AVYA 2D3TA 4J4TA 1Q2XA 2GGSA 4BO7A 4FFPA 2CNBA 4GVXA 4P4NA 4CMKA 1NAIA 5DN9A 1B14A 4NQZA 4OAQA 3BMNB 1DC3A 3CXRA 5FI3A 3DBLA 4WECA 5BNIA 4RLSA 3DMTA 1FDUA 4M89A 4MDHA 4M8SA 4Q3NA 2E48A 2YZ7A 3KYDA 2NLOA 2A9FA 3DBHA 2Y93A 4IINA 1JQBA 1ISFA 3U4CA 1V3UA 2CUKA 3DTYA 4HX5A 1GPJA 4QFCA 2EKPA 3GAFA 3SJUA 3H3FA 4ND4A 1DB3A 2Y1EA 3LT1A 4OXNA 5KJ1A 5A9SB 5HBRA 2Q4BA 3S2GA 4E32A 2I99A 1U9JA 4XZ3A 1HYEA 4PZEA 1P1IA 1PGQA 1B3RA 1WVGA 2HCTA 4EJMA 3W4JA 1E77A 4EUEA 1UUFA 5EMHA 3TFOA 2JL1A 1T2AA 4ALIA 2BHLA 4DLLA 5I7FA 1ULUA 1E6EA 3AI1A 3G1TA 2FWMX 4E2ZA 1WNTA 4U6SA 3DDNA 3I9KA 3WLFA 4AJ4A 4CM4A 3RQSA 1A9YA 4OQYA 1O0SA 3GHHA 5CEJA 3Q6IA 3AFMA 3PYLA 4J0EA 1BRMA 4ALJA 4AJJA 4AJ1A 4FBGA 1ISMA 3ZHZA 4GX5A 1Y81A 2I76A 5CDYA 4B7UA 1DRWA 2RAFA 1DAOA 1HXHA 3EZYA 4D0RA 1JU9A 4FC7A 1I3LA 1ISGA 3DHEA 1IHXA 3O03A 4NH4A 4EJ0A 1D8AA 1C1XB 4IDGA 2H1SA 5K6AC 1LDGA 2DVMA 4CQMD 3P5SA 3TN7A 4TZKA 3DHNA 4CJXA 1NPYA 3WB9A 1BVUA 2JFGA 4GH5A 4MVJM 1KVTA 2W2KA 4B4UA 4BS9A 4R5MA 3RU7A 1IZ9A 2B5VA 1E1NA 4KDFA 3PPIA 2EKLA 3VH2A 1XIVA 4A73A 3GFBA 4A0SA 1NAHA 3D3WB 4DLAA 3CPSA 1X0VA 1E0DA 1WWKA 4FFRA 1P1HA 2ZJ1A 1HSOA 3JQ9C 3Q9UA 4BNVA 1N2SA 5ENVA 3D4OA 1LC3A 2ZB3A 3AUTA 4BNYA 2OZPA 1TEHA 2YDYA 4EZBA 5JMWA 3FTPA 4NNJA 3RCBA 4Z0HO 4ALMA 1Z73A 3UICA 3PZRA 1NXQA 2VHYA 4XB2A 1Q0HA 5F3RA 3NRCA 4X54A 4DQXA 3ZWAA 1ZSVA 3DBLB 2VZ9A 3QVXA 4MKXA 4MPDA 4M1QA 4PLZA 2WDZA 4JP3A 3DBHB 3FHLA 1N92A 1HF3A 1GZ3A 1MP0A 4DIBA 1TT5A 1KVRA 3JQBA 2GASA 4OMUA 5AYVA 1J5PA 2Q2QA 1IYZA 3VH4A 4W9NC 5EQFA 3C7CB 5JAIA 3MTGA 3MEQA 2P4QA 1LBEA 3MJCA 4TRMA 4WOKA 1OAAA 1YS4A 2VRCA 2G5CA 2PZKA 1DIAA 2RCYA 3K5PA 1DFHA 2PLAA 4PG4A 3AOEA 4B8ZA 3BTSA 4UUOA 3B70A 3FR7A 3KUXA 3WFJA 3RFXA 4BO2A 4CR8A 5IJZA 1C0IA 4K26A 5KVQA 3A06A 1MGOA 4CM4B 4IIUA 1ID1A 3GN2A 4GKVA 3EK2A 4F45A 3QW2A 4IPTA 2D59A 1M6HA 2QIOA 3I5MA 2NQTA 3NX4A 4HKTA 4BB6A 2ZB7A 1A27A 1M66A 3FTNA 4ND2A 3TJRA 4KUEA 2ZK7A 1NR1A 3VH3A 2UYYA 3QWBA 3VKVA 3Q3CA 4NU5A 4RV9A 1C14A 2FOIA 1LU9A 4R9RA 1S7CA 2X9NA 4RF4A 4RCVA 2VCYA 5T6BA 5T5QA 5DNAA 3C1AA 1U7HA 9LDTA 2VWQA 3RBXA 2J3KA 1U5AA 1VM6A 3A14A 4ND5A 5A05A 3N7UA 4TRRA 2W2KB 3PFFA 4JGBA 2NADA 2FR8A 1A7AA 5COBA 2EW2A 3ZWBA 3DWFA 3GK3A 4PVCA 3VZPA 4BOYA 2AW5A 1U5CA 1SMKA 1BTOA 1XLTA 4K6CA 1Q7GA 4PFJA 1AGNA 2JD1A 4BKQA 2CZCA 5TS3A 4OYRA 4YT2A 5BSFA 3DZKA 2GN6A 3EGOA 4EBFA 3ZHXA 4HBGA 1GZ6A 3OBBA 1SB9A 3ITDA 3CZMA 1I33A 1LA2A 1VLLA 4NI5A 1CJCA 1E3WA 1UXIA 2BGKA 5FI5A 2FZEA 1VL8A 3KYBA 3KEOA 3KTDA 4BNMA 4I5EA 1TT5B 4WCFA 1V3VA 1RM5A 4QTZA 3ULKA 5C3MA 4OO3A 4J1NA 4CM5A 1LSSA 3ZW9A 3A9WA 3RD5A 5IN4A 2E6UX 1U3TA 3LU1A 5JY6A 4J1QA 4XR9A 2V65A 4FGWA 5A03A 4DL9A 1T4DA 4E0BA 4AJNA 1EMDA 4FFMA 1BW9A 1UXGA 2IODA 1F17A 3TZKA 3WGYA 4E5NA 1NFRA 2A4KA 3NV9A 1E6WA 1O8CA 3RC9A 4D3SA 1Z75A 3VVCA 3P7MA 4XGIA 2DBZA 4PRLA 2UAGA 3PK0A 1TB4A 3DFZA 1Q7CA 2Y05A 5JYDA 1H2BA 5F1KA 2AQ8A 2Q2VA 4BGEA 1GYRA 5JAQA 2FPGA 3B20A 2VYVD 1PL7A 4BO4A 5C7LO 1SB8A 4OJNA 1PGNA 1LLUA 1B3BA 5CPFA 3T4XA 2HKIA 3WMWA 3I23A 2EEZA 4AFNA 4E5MA 3VZRA 5TT0A 1RYDA 1R0LA 4WNCA 3H5AA 1LI4A 3ASVA 2TMGA 1QYXA 4R16A 3GY0A 4KQXA 4E2WA 3E9QA 3FD8A 4YQZA 3H5NA 1GU7A 3TZQA 2W98A 1JWBB 4JJFA 1ZJZA 3AY7A 4HP8A 3ZHBA 4FGSA 2DUWA 2NVUB 1V8BA 2X1HA 3AM5A 2P2SA 4PG8A 5JFOA 2PKRA 1YBAA 2RHCA 1W6UA 2H6EA 4OQZA 4UUMA 2C29D 3ZWNA 4E13A 1YB1A 2HU2A 4EI2A 1UXJA 1EDOA 2QRKA 3AFNA 3HWRA 5G4LA 5I9MA 3RI3A 1U3VA 5IFLA 4XB1A 1E5LA 1LC0A 2GD1O 5AXCA 5HRUA 4I8XA 5CDGA 1MUUA 1VI2A 3HB5X 4FJ2A 4XYLA 3WYEA 5COAA 2PD6A 4DPMA 1E3WB 3MJEA 3ZU2A 1RM3A 1E3SA 3U4DA 2EKQA 4P4GA 5I8ZA 1BHSA 1H6BA 1VPDA 4F46A 3HNPA 4W4TA 3GDOA 4BNHA 1NPTO 1XDWA 3JYQA 1PSDA 5TJHA 3VPHA 3D5QA 4IBOA 4F6CA 1OBFO 3JQFC 4E3ZA 1D3AA 3AUSA 4GPD1 4OKNA 4IDEA 3OM9A 4D0SA 1BMDA 4FD3A 4ND3A 1Q0QA 4L4RA 2QRJA 1PJSA 3F47A 1YKFA 3KHUA 5DT9A 1Z7BA 1GYQA 2X6TA 3V2HA 3PWKA 2GDZA 2GNAA 5JLAA 1B2LA 2JFHA 4RPGA 4CLHA 1B15A 5TIIA 3C1TA 4XQ9A 3GMSA 4KOAA 3ROMA 1E7RA 2DM6A 4RDHA 4XRRA 4YAIA 4KMSA 4ZU3A 3LC2O 5TQVA 3PYMA 2VNAA 4UEJA 3PVZA 1CWUA 4PLFA 1VC2A 4TMFA 1N8KA 1HDXA 1LNQA 3C1OA 1ZKMA 4R69A 2GCGA 1I3NA 3EMKA 1ZCJA 3DMTC 4BKPA 3DMYA 3GUCA 3DQPA 1H94A 5I7VA 3F5QA 4IDAA 3GDFA 2QRLA 3IP3A 1M2WA 3KYCA 3OA2A 4QX6A 1WZIA 3Q11A 1NVMB 4PCVA 1EVYA 2J3JA 5G2OA 3QWIA 4ALLA 4BB5A 2BGMA 1T2CA 5C7OO 3A28A 3LC7O 2YHUA 2IZ0A 1HE5A 1ZMOA 2HSDA 2PZJA 3O8QA 4GSKA 4IDFA 1LRJA 2CF6A 1UJMA 5JMPA 3UW3A 4DMMA 1MLDA 4W7HA 3S55A 1PJ4A 2EERA 2X22A 4QT0A 4LN1A 2VUTA 3AI3A 3WTCA 3INTA 2Z95A 1DXYA 1GL3A 2QYSA 4KWIA 1DFIA 5BNFA 4UVGA 5CG2A 4Y9DA 2X58A 1ZNQO 4H15A 3NJ8A 3E8XA 1AHIA 2DLDA 3UF0A 4P8RA 1NPDA 1WDLA 3WTBA 4E30A 2E37A 4WUVA 3KV3O 3H4VA 2C07A 5ES3A 5DCWA 1DRUA 5CDUA 3NGXA 2YYYA 5EJ2A 4CUKA 1C1DA 3F3SA 3U4HA 1NQAO 2BELA 4PLVA 4GX0A 1HLDA 2JHFA 3CTMA 2JFFA 4IDCA 3ZNQA 4L8VA 4CUJA 2QG4A 1K3TA 3F5SA 4JQCA 4YCAA 5L7TA 4YAEA 2OHXA 1DSSG 4FN4A 5L53A 1G0OA 1XKQA 3L6DA 5ER6A 2VZ8A 5FF9A 4ZICA 4JIGA 4YT5A 1NBOA 5LCXA 3HQ4O 4RF3A 2CFCA 3C85A 3MOIA 3F6YA 5DP2A 5H83A 1YGYA 3DC2A 4NBRA 5KJCA 1K0UA 2HK8A 3AY6A 3KZVA 4AJEA 1P9LA 3WGQA 2Y0CA 4E31A 1I32A 1KYQA 2BH9A 2OP1A 2HRZA 1NHGA 4WLOA 3CEAA 2DTEA 4DYDA 2AXQA 1HE4A 1FMCA 3KOUA 4JP2A 1P0FA 4CMHA 2HMTA 1X7DA 3FNGA 3GMDA 3CE6A 3CZRA 4BNXA 1P45A 2Q99A 1MXFA 5I9LA 3UAGA 1ISJA 2RBEA 3GEDA 4AL4A 2D0IA 3KLPX 1B8VA 2DPGA 1DJQA 4GBJA 3JQ7A 4W7IA 5EL0A 1NHWA 1BXKA 4EYEA 3HHPA 3SC4A 1KEUA 5K9ZA 1NWHA 1LSUA 2P4HX 3GPIA 3HDQA 4D41A 3KYCB 2VT2A 3MJSA 4LK3A 3FBTA 2VRBA 3F4LA 4U7WA 1MXHA 1Q7BA 1CRWG 3PQEA 3SC6A 3BMQA 3JQEA 2AEMA 2FRDA 4CM9A 1LX6A 4D3FA 5KTKA 1LTHR 3GUYA 3NTOA 4FFLA 3WNQA 4XRGA 1YRLA 4ZHSA 5DBIA 5LDHA 1LDEA 3TDKA 5THKA 3OQ6A 3O8QB 3FR8A 2VYNA 4RJTA 3AOEC 5IG2A 4NMHA 5C5IA 4IUYA 3HUDA 4R4JA 4R3NA 2PR2A 1QG6A 5ILGA 3UUWA 1EFLA 4MVJI 1YQDA 3NKLA 3H65A 3ZHYA 4RPHA 2B37A 5KIAA 1WAMA 4WEOA 1LDBA 5F1PA 2WYVA 1B0AA 5IDQA 2PD3A 5HS4A 2EWMA 1KEVA 5GZ1A 3ANNA 3QHAA 4LVCA 3BZUA 3V1UA 4Z9XA 3WSVA 2DT5A 3TWOA 2ZIZA 3ZWPA 3PJEA 4BNKA 4GLLA 1ADBA 5GMOA 1R6DA 1Y9EA 3R0IA 1A5ZA 3WGGA 1JTVA 1SNYA 5L40A 2NACA 3QP9A 2BFAA 4G65A 3BHMA 5EERA 1MG0A 3JQ8A 3OF2A 4JX8A 5IDXA 2QZZA 3JV7A 4AJKA 4MIOA 4B4WA 4Y6PA 1O89A 3H8VA 1P77A 1FDWA 3TZ6A 4YRBA 4BQPA 4RPKA 4W82A 2O48X 4YT4A 4ZQEA 4UUNA 5IAAA 2WD7A 1H9AA 1BWSA 2ZYDA 5JPIA 3FWNA 4JNKA 1YL6A 3PHIA 4Z0PA 1V6AA 1HKUA 2O7SA 4DPKA 1JA9A 4MJLA 3JYLA 4HV4A 4RVUA 3KXDA 1I0ZA 3G0OA 5EIOA 7MDHA 2GO1A 4XQCA 4UAGA 4BNLA 1ZSYA 3P2OA 4R1UA 4XYEA 1GEGA 4ALNA 5L4LA 3GEGA 2GLXA 3EDMA 1UXKA 1D1SA 1GFSA 4CODB 1ZXLA 1K6IA 1IB6A 1VJTA 1JKJA 4WASA 3EVNA 1AHHA 2IZZA 4WCFC 4QEDA 1PJLA 2XF8A 2Y1OA 3TOZA 4A7PA 3MTJA 4OL9A 2OO5A 4YEDA 1A9ZA 3TQHA 3KB6A 3BMQB 5G0SA 3TSCA 4FC6A
chains in the Genus database with same CATH superfamily
1DGQA 3IXQA 4OQQA 4H6WA 2NU8B 1UIRA 1FYDA 3HB7A 1N2ZA 3P96A 1NW3A 3GVHA 5ED0A 2Y1KA 3UQZA 2VC2B 2ZPUA 2QN2A 3LXMA 4CIWA 3WMXA 1O5OA 4CV1A 2IZ5A 2QSJA 4IM7A 5DLEA 2E5FA 3V8VA 2NXEA 1VJ5A 4X45A 4ZZ0A 2J0QA 2QX9A 3E3AA 4HYTA 5K6TA 5AVUA 3SC2A 1JFRA 3ZV3A 5IXYA 4P32A 1UBTS 3BIWA 3H97A 4PZ9A 1PZHA 2REBA 3E9ZA 3CIOA 3KM0A 4FSDA 1R9GA 1ADGA 2QN9A 1JFVA 3EVGA 1M9NA 4KPUA 2RG7A 4J1TA 4KQWA 4NH0A 1KK3A 1KVQA 1N1GA 1NKTA 1UWVA 3F9RA 3SIXA 5JASA 1SUFA 2PR7A 2DE0X 3RRJA 5CXXA 1LCIA 3SBXA 5DBHX 1YQQA 1SJ9A 3HU3A 1XOIA 1SHUX 3OWOA 2X5JO 2M9MA 2PX8A 4A8HA 3KT6A 1SHTX 2RGNA 3GP3A 5F4BA 1YVRA 1BEZA 1UQTA 4FDVA 2AA3A 5JQGB 3STXA 4X1YB 5IX8A 3L6CA 4W63A 4DJJA 4KR2A 2Q5QA 4RL6A 3DO5A 4JUAA 3ZU3A 5KSOA 2H65A 2ZJAA 3LY7A 3QYJA 2BGRA 3FUXA 1FS5A 3JQ8B 3OURA 1FF9A 4B2IA 2XA9A 3LL4A 2WPDD 3FNIA 1PR0A 2Y1FA 4OLFA 5EGSA 4LOHA 4AT1A 4OK3A 5T4EA 1QG4A 4NPCA 4D44A 4UCWA 1J8YF 1E98A 5CPBA 1UH5A 1QVRA 3DWEX 3Q0EA 3OD5A 4YN3A 1SPBS 4DXHA 4I50B 4PZCA 1QTQA 4ZFNA 3ZE9A 1EVZA 3W5BA 4UNQA 2WU4A 3HLYA 2YWEA 4I5FA 4TXHA 1XFDA 2FPKA 3TLGA 1CZHA 4IIXA 4DCVA 1DKNA 3DTNA 3P2JA 4IVQA 3ECSA 1R88A 4R9VA 4YV7A 1S6YA 1TMOA 2LKDA 5IN5A 1LZKA 4GMDA 4HLCA 3LUFA 1W49A 3PIDA 5IBRA 2FNAA 1NNLA 2E87A 3K3PA 1G2PA 3G8AA 3GFVA 3GP8A 2IYVA 4IEEA 1CF4A 1GSIA 4LTDA 3RSLA 4BFVA 1EPUA 2MINA 2AI1A 2GTHA 4DZTA 4LXYA 4DLVA 4RUKA 4DDKA 4X63A 4KKVA 1A7JA 4X91A 5F5XA 1QRSA 1ZU4A 2V7GA 3WC4A 3EE6A 1C9KA 1NN0A 1SEPA 1EESA 4PC7A 4AO8A 1F38A 3C43A 4QLAA 2J7PD 1W29A 2BFBB 4IUBS 5HBGA 1AM4D 1J49A 4RPLA 4MRMA 1DEKA 3I04A 1U5BA 3QGMA 3BRWD 1FQJA 1PR6A 1RHRA 1VKOA 2PO5A 3DP9A 3PE6A 4LQLA 2D2EA 2ONJA 4CMAA 2WF5A 3KSZO 3EVAA 3RKUA 3UN1A 1ZD3A 4DEVA 1JFTA 1RXWA 2SCUA 3R5JA 3MJ4A 1YRWA 4CQLB 5JO0A 2PRYA 2WR8A 3HXPA 4S04A 1KI4A 5AOBA 4ITVA 5H5JA 3FHOA 2YWXA 3I28A 2DKNA 3NYWA 3SP1A 3LWZA 3HABA 3KEQA 4CF3A 2QD1A 4QHSA 2BJVA 3TIFA 1NF3A 2GVZC 1W581 3X0DA 3TG8A 4FYVA 2X77A 1RDFA 2P5SA 4BGIA 5IKPA 3GJ0A 1UBHS 5UKDA 4ZYTA 1SBQA 3PL5A 4IJUA 2XEXA 3BFJA 2O8DA 1Z39A 1XMIA 1Y1QA 4BNWA 1G20E 1AQNA 2P7HA 3PC8C 1C3LA 2HREA 1ADFA 4MO9A 4GI2A 3RPEA 1NQTA 2W6OA 1VIVA 3PNLA 3O73A 1G9TA 4QWWA 4W5WA 1PK9A 2A9OA 3W0LB 4FHDA 5HMMA 1ZZEA 3JASA 1E2NA 2VPWA 3N75A 4D6YA 4IHAA 3Q40A 3ZNNA 2NYRA 3GZ4A 4D99A 3QY0A 1JT9A 5E3HA 2NO9A 1AB6A 3BXEA 4GSLA 4PEVA 1XZAA 4FZ3A 2CVZA 4B7XA 3MF4A 3FUVA 4YIHA 1L7PA 2Q3CA 3I3OA 1MB0A 4MYSA 2G8LA 3UMJA 5DJ5A 4WUTA 3THYB 2DWQA 4OH7A 3HTXA 1W94A 1LJUA 1MPXA 4YTEA 4I6EA 4GOOD 1T34A 2ECPA 1CQJA 3GD5A 2B8TA 4G5RA 3NGMA 4MDYA 4QOGA 3LQRA 1FZTA 1UZMA 4LZLA 5KAPA 3TZBA 2OHOA 1I5RA 5DBFA 1DARA 2OGTA 5FXMA 3V55A 2CUNA 4RCZA 4EGJA 3DAFA 2QQGA 1UMCA 4TLDA 5EVJA 5CXSA 1N6LA 2XQJA 3TCKA 1Q19A 5IF9A 1OBHA 1I4LD 3EDRA 3JVIA 5LZ4A 1NUSA 4CWAA 4TLAA 2DKOA 3GP5A 3O4FA 4C76A 4MDFA 3QE3A 1BGXT 3I9MA 4PLGA 1O96A 2BFCB 5ENDA 7ADHA 4LHXA 5A02A 1U8XX 1Z5NA 3RAPR 1C9MA 1YDWA 2IU6A 3MBOA 2YVUA 2Z1NA 2EBWA 2Y68A 2OFFA 2OENG 5JIBA 4X66B 2JH8A 4MRMB 4YBRA 2O5RA 3TLZA 5DYGA 3UJ9A 4EEKA 1TOAA 2YFQA 3RE1A 3ADDA 3AJ8A 2O2YA 1WL8A 3AINA 2GH1A 2VJKA 3FSGD 4HRAA 2QAGA 3LT4A 2I4NA 5JOQA 4BRUA 2HIAA 2R86A 2FHPA 4GG1A 5I7WA 4JROA 1TLTA 4YCJA 1NU8A 3HB9A 3NRJA 1X3SA 1Q83A 5FULA 5I6DA 1N6NA 1H1LB 4JBWA 3TIIA 2Y0DA 3B2EA 1T36B 4OM7A 2ENUA 3ZIUA 3H3XA 3OQVA 4H6XA 1UAYA 3HDJA 4X7PA 4EDFA 3GUHA 1K5HA 1UEXC 3CR3C 4IDOA 3CW2A 4R41A 4F7WA 3LO5A 1O57A 1NP7A 3PXDA 3E7XA 5E1OA 1H8EA 3O9ZA 2WTUA 1SVMA 1XZ8A 2VDLB 1MFPA 1RQRA 2ZVJA 1O58A 4Q1FA 2IXEA 4TVOA 5CLJA 3HY4A 5MFPA 4O4LF 4F3NA 5LIPA 2CFOA 4HDMA 2QMHA 3JTMA 2P2ZA 2CLHB 5F1OA 2EU8A 1FW6A 1DOHA 5JNSA 1V25A 2X9GA 4FZ5A 3I76A 1G3UA 4M7PA 3FNEA 2QLMA 4H7KA 4KK3A 1QK4A 2YWCA 1IJKA 1DJNA 2ZULA 4Y1RB 3ZBTA 3U5TA 5ALWA 3E81A 6PFKA 1FQOA 4E4TA 1ZVVA 5IP5A 5FBZA 1IZ0A 5JFGA 2V0GA 4UD2A 3VV2A 1T6ZA 1Z29A 4GMXA 2FA9A 3IE1A 1M0EA 1K88A 3G0IA 4XWAA 4IILA 2A84A 4AJIA 2DPHA 1I2ZA 5FA6A 5LA6A 1DKRA 1C0KA 4X7BA 1G4UR 1CQJB 1ZN2A 1Y4SA 2QAJA 1JAXA 4GNRA 1NLZA 4HXYA 3EZ9A 3A2NA 5E3JA 5B53A 4O4IF 3T0IA 2PUDA 3BHJA 1FDVA 2CNOA 2DAPA 2DUJA 4K86A 1EDBA 2VHEA 4W99A 1P61B 4QPDA 4FZJA 2R6CA 4OA5A 2VA9A 3A6ZA 1OA1A 4K2AA 1GA1A 3RBVA 1GNPA 1UMCB 4L4XA 3UWKA 10MHA 2CV2A 4K6FA 3NQ41 2F8LA 1ZD2P 3OICA 1S2MA 3ABOB 3AEUA 1U0GA 3EXG1 5H59A 5NULA 1W59A 4C0SA 3EIEA 3N8DA 4I08A 1H9BA 3C5EA 2BI8A 6CHYA 3VXKA 5JS7A 1IXRC 4GRAA 5DHFA 4C88A 5JD5A 3LP6A 2W2VA 1XZCA 5FNVF 4A6XA 4YJ2A 2JIZA 1P2DA 2PRJA 4DG9A 5LZ7A 3PICA 1W85A 5IWAB 1U8CB 4JI4B 3OX4A 3S70A 4FJ1A 2WDPA 4NOJA 3RTCA 1KAQA 2NM0A 4JI1B 1V7CA 3KETA 2C2XA 3AIOA 3J7TA 2WAMA 2WK1A 1XA3A 2XGSA 3UGKA 4GMFA 3IODA 3RS4A 3GDWA 2QAGB 3DLBA 1WPRA 3NJRA 3T61A 4DDWA 4MR8A 2PUAA 3DLHA 5K20A 3AF1A 3DZIA 4RA6A 5A0FA 4YP6A 4JZKA 1ESCA 1Z62A 2BEVB 4PZLA 4XYGA 5EP3A 4EFLA 2HA4A 5KSZA 1E64A 1IEWA 821PA 3DZCA 5BYKA 2Q1TA 3MMPA 4U7HA 1VE6A 1WSDA 1EUZA 3QJ5A 2F9LA 4MEJA 4MGHA 3AERB 1RI2A 5C8YA 3KKZA 4JBIA 2G1PA 5BW4A 3K16A 2YN4A 2PLFA 2HJGA 2Q8NA 4RF5A 5AO9A 4BX3A 5EIEA 1XQWA 1U31A 4KQJA 4O8ZA 1GO2A 4YXFA 1L1RA 1DU4A 2PRIA 2ORED 2EJVA 2MHCA 4U0KA 5I7AA 3D02A 4D7AA 3QJGA 1QG2A 2EHDA 4P4LA 5T4HA 1XCLA 3FOBA 4HDMB 4JHLA 3MB5A 3HA2A 3CT4A 1DKOA 4I9GA 5G40A 3WGTA 1F8UA 3KPVA 1Y3BE 3BGVA 5HNKA 3IO3A 2CLEB 3QFTA 4UHDA 4TL9A 5DCYA 2JA1A 3T8YA 1E7SA 2WTXA 1N6PA 2JJYA 1HG0A 2Q5JA 2SNIE 3BQNB 3F2VA 1XF1A 3T35A 5BN1A 1SKAA 1G6HA 1X80B 2AOTA 4TV8F 4ZHQF 3W1VA 3MUOA 4MWOA 1KMQA 1I4DD 3WLQA 1KQ3A 1U3UA 1O6FA 2EP8A 3IHWA 3QLVC 3WYGA 5HPYB 2VT7A 4IOLA 4Z1MD 1O54A 1JSZA 4Y6LA 3ZE1B 1U3GA 1T9AA 1OSNA 2REQA 1FYEA 2WYWA 4Q4CA 1N8TA 2KSQA 2ZJYA 4K05A 1PLLA 1G9SA 1KYYA 2CHEA 4NZ9A 4MR7B 5LA6B 3SZ3A 3VU8A 5B1EA 3C4VA 3KP1A 4MA0A 4X60A 1JKFA 3PXCX 3N2ZB 3LX4A 1I2DA 5L7YA 3IOBA 1W0JA 3DOJA 5K4GA 4KWEA 3VR4A 4ITUA 1U8EA 1LXCA 1NY5A 2H31A 2QZSA 3DE2X 5TVGA 4MHTA 3KJFA 4IG9A 4IGKA 3JAKA 3EBOA 1N36B 4K6KA 1Z6PA 3GJ6A 1HE2A 2GF0A 1Y1TA 2FR0A 2XVMA 4G63A 5IHPA 2CDNA 2D2XA 4PTLA 1J2TA 5IVDA 1KQNA 5CDTA 4UM9B 3PCRB 1H2FA 1TUGA 4L5CA 3DG9A 3R6WA 4CCWA 3IUYA 5C80A 2HT6A 2GERA 3SBOA 4QTYA 1Y5MA 2ZSDA 2Q6VA 2W11A 3CYFA 4M8NE 4WXYB 1GL7A 2ETXA 4YJ2B 2Q6IA 2W6ZA 1GPAA 1WEKA 1OREA 4YRLA 2XSZA 1IJFA 5IAKA 1OFUA 4HT3B 1W85B 1T0JB 3PDIA 4TXJA 5AW6A 1YB7A 1U8YA 3CLTD 5FEUA 4OD0A 5JNTA 4HADA 4QBIA 1CPYA 1A8UA 2EFYA 1M2HA 2WUGA 5FWYA 4X97A 1DO8A 2AK2A 1FJXA 1X1BA 3KAQA 1QC5A 1K89A 4G5YA 1YU6A 2EF0A 2PA3A 2GEBA 4M21A 4K9PA 4MR8B 1U8ZA 2FUCA 4RA6B 1TEZA 3F78A 3BD8A 1QQ7A 3T99A 1BVHA 3ONFA 3RFUA 1E61A 2VRCD 4LJSA 3O91A 4AX4A 3OE7D 4PZDA 1SOAA 4Z0TA 3KXKA 1KR2A 1PAUA 5CVUA 5G1NA 3ROXA 4MCHA 3LGSA 4HTFA 5HCNA 4AJHA 1M7HA 2PUEA 2YOGA 1KSGA 4W8GA 2FVXA 4ZAYA 2Y0EA 2PZGA 3V9PA 1QK5A 1O87A 2WVAA 5KJEA 1V3QE 1ZA1A 3TTVA 4RVCA 1N32B 4WXMA 3ENQA 5C34B 3AG6A 3PV0A 4LJ6A 2O2ZA 4NZYA 2QXUA 5TRTA 1GTRA 4ZAWA 1MPTA 1OLSA 2Y2VA 3L8HA 2H3HA 4JFAA 1JG2A 1G8SA 5TARA 2XI4A 1PJAA 1N0HA 1Z8DA 2XT0A 4QATA 1T5BA 3JAMA 2OV6A 4R8RA 1F51E 2RGXA 1NJ5A 4MJ3A 1GTVA 5K8IA 1ZAYA 1IMOA 1CNEA 2XUQA 2FEOA 3MFQA 4TQ9A 4YXWD 4G25A 2AOTB 1XXLA 2Q8PA 4K28A 5CFMA 4QD3A 3A6JA 3E05A 4JNCA 1LQUA 3QX8A 4QQRA 1PT7A 1C4KA 1OCEA 4JMLA 2PEZA 3GJRA 4WK6A 2C84A 5U1PA 4URWR 1MQAA 1ADCA 2CE7A 4EENA 1X1RA 2EL9A 3PUKA 5SYAA 5EFOA 3VDXA 4A4DA 5E4YA 2Q28A 2WHXA 2XGOA 1FMTA 4UBLA 2FWNA 5I45A 2ROQA 2Z58A 1DJOA 2FN9A 5FQOA 3NKFA 2X23A 1OXBB 4YPFA 3VVBA 3G8BA 3ZQ4A 5I9NA 2O07A 3K32A 2BFDA 1ZC4A 5E1MA 1U9ZA 4RANA 3R7LA 4NZOA 5L45A 1QFYA 1W5SA 3SLKA 3ZWKA 2W2MA 3PEEA 4UBIA 1IOVA 4WZAB 4RY0A 5EKXA 5EVCA 1E99A 3CV3A 5G02A 3JQDA 5TMDA 1I7PA 1HYGA 4PW0A 2AW3A 4FCCA 2H0AA 2YQ5A 2Z1MA 3PUXA 3O92A 1HK7A 4J7AA 4PHHA 5BN4A 3K96A 1I80A 4RKRA 1I1QB 4XA8A 4HC4A 1ENZA 4BVFA 4F2HA 3ON5A 4ID3A 3ZUPA 5LUAA 5C81A 2DBVO 3D8NA 4G0PA 4NJEB 1PG2A 3SMQA 4BU1A 3AF0A 3WGHA 3BEDA 4ZOCA 4QGHA 1EFVA 3L07A 1CZRA 3N2IA 2WTNA 4AKTA 1WF6A 2OD2A 2QTNA 1XL0A 1CBUA 1Y7IA 3IAHA 3MYRA 4JL8A 1M75A 1DX4A 1QC5B 1R2QA 4BQFA 2X2FA 4H1UA 3FYUC 3LDGA 3JQBC 4G0XA 3PUIA 2P9QA 1E8DA 3OOJA 4P5PA 4G07A 4QLOA 2OQVA 2VHTA 5HZKA 2QRNA 1ZH2A 3I37X 3WY9A 4AG5A 4J7CA 1GUBA 3P1JA 5H16A 2R48A 1QNLA 4EEZA 1Q0PA 3C6ZA 4MMYB 3RYFA 1OH8A 1N8SA 1XL1A 2RDMA 4NEHB 4HTFB 3S5UA 4QGFA 4DDVA 2F64A 5GGYA 4CIAA 4RETA 1KPIA 2CBXA 5G53C 1I94B 4U2KA 4CQJA 3WGUA 1FK8A 1G5FA 1KSHA 2CWWA 5D3QA 4D0GA 5JCOC 2V3WA 3ZDYB 5YASA 3VR3A 3F9IA 4NCBA 3H2HA 2XMDA 3NBXX 2JLQA 3B1XA 4HAIA 4PONA 4OQFA 1PHRA 3QKSA 2BGIA 2HZBA 4E5DA 1TW2A 3HDTA 1DEXA 1NJ2A 1OLSB 3V32A 3LRTA 1L5WA 1I1HA 3LPNA 2JA2A 3MCUA 2CCGA 1SKQA 1EK6A 4L7QA 4WOPA 3PRJA 3N0TA 5HDQA 1X6VA 4NP6A 2BF4A 3FA2A 4MQLA 1RJGA 3D43A 3GLHE 1PDWA 2CXPA 2ECKA 3ONEA 3RC8A 3FDZA 3D5EA 2BZGA 3NHYA 3TQIA 3ZJYA 4QXMA 2QGNA 1Y7TA 1NXVA 4HXEB 2V59A 2ZSHA 2GEFA 1NUTA 4LBVA 4FGLA 4L6CA 2PFKA 2YWRA 2VXCA 1TZ2A 3NEAA 1R16A 1FW8A 2IPMA 1XTTA 1SKUA 1P2UA 1TMGE 1YBHA 3OM0A 3UFBA 1PGPA 1UC9A 2OB1A 1JKIA 1JYSA 4NABA 4CQNA 1EX1A 1QCCA 3DL2A 5FBHA 3F6RA 3GZJA 3ICPA 3LKDA 4IUDS 4Q93A 1QDUA 2AYXA 3GVPA 1ECLA 3O8DA 3MINA 3UJCA 1RYZA 4ZQBA 2V6FA 5AK4A 2FG5A 3SSAA 1B8PA 3BGOS 4OXXA 1WOMA 5TGDA 3BWMA 2IY8A 3KSUA 2ZROA 3MIZA 2VDOB 3GXBA 4HGNA 2PGOA 4HNSA 1RI5A 4AK9A 1XR3A 2I7DA 2OCAA 2RGGA 1GPKA 3TNYA 1KORA 3IGFA 2R00C 4JQYA 4D25A 1QGUB 3KIPA 3UW1A 4WWHA 5ECWA 1QIJA 2VJQA 1JSXA 1T9DA 1EWVA 3ODGA 3OIUA 1T5LA 2VF2A 3C8ZA 1CHNA 1ZNZA 2PUTA 5AM5A 4X62B 1K6MA 4BASA 1GAWA 3AVTA 1UBEA 3TD9A 1L1EA 1C9JA 1EFVB 4RW0A 3VR5D 1T1RA 1IQUA 2ERCA 1SXJC 1JW9B 2XCIA 4DR6B 3HUTA 5JE8A 4C9BA 5A9SA 1R5BA 2ACEA 1E5VA 3H5IA 4QYIB 3RTBA 4M1WA 2W4QA 3AILA 4UJ3A 2WT8A 4D45A 1PVOA 2JLAA 4EO4A 2V0CA 4RSMA 3MJTA 1GNVA 1MQSA 1F1JA 2ZUWA 3DV2A 1V43A 5DYTA 1I7NA 2P9FA 3PEFA 3IDSA 3RYFB 4YMVA 4NXNB 5CD1A 1P7VA 4EMSA 2CJPA 3LLSA 3O83A 1Q12A 1VKNA 2QE7A 1EYZA 3IQDB 1QYRA 4JLMA 1KO1A 1XN4A 1MAVA 4MITA 4RKWA 2BR4A 4MW5A 3U1VA 1IONA 2YN0A 4D5EA 2QVZX 4EI8A 3RSHA 1Y5NA 2H51A 2X5OA 1N2EA 3HFJA 1T43A 3IUEA 4P4UA 4QYWA 4HHEA 2AGVA 4BVLA 1KI9A 1TYCA 3AYZB 4P84A 2VXBA 4GP7A 5A5FA 5AJUA 3VO8A 5K8VA 3QKSB 3T5MA 3WMGA 2NNWB 4QM6A 4GMKA 1VSBA 5AW4A 2QMYA 2QG9A 3A6LA 4FMCB 2WT9A 3HJNA 3ZXXA 3JATA 3RANA 1E1RA 2HUPA 3WWZA 4D9MA 5KQSA 4M88A 3R9XA 2AHRA 2B35A 2PXAA 4TYNA 1QP8A 2O7VA 3MPUA 2PX0A 1TA4A 3FDZB 3JAWA 3QUAA 2WHYA 1WMSA 4KLCA 4MP8A 5HKOA 5JW6A 3R6GA 5BSKA 3AJRA 1L9KA 3B48A 5EWMA 1IOWA 2ZUVA 4Q7MB 1BHQ1 2HIHA 2Z6VA 3Q3HA 2XYPA 2QPAA 1YD7A 1Z13A 1JSCA 2ZEJA 3ENNA 2VNHA 2Y1DA 4KZPA 4M9RA 3U1BA 4AU1A 1KAOA 1TKCA 3D1LA 2NOAA 4ZAGA 5IDYA 2O0JA 2V6BA 3P9SA 3CNNA 4BTEA 4DIOA 1I0IA 4A0RA 5D87A 5CG1A 3HDVA 2NXJA 1M72A 4L15A 3D1VA 3E5MA 1XCJA 4UJ5A 3SD7A 3WQQA 1Y7LA 2BEKA 2F59A 1VG9B 1MQ9A 1C4OA 1UZUA 3BTUA 2WTAA 3IUPA 4WADA 1WE2A 3MOSA 1CW2B 5CLHA 2VYVA 2R6GA 3IUJA 4RIIA 2Q9AA 2FOXA 4ZAZA 2X1LA 2XNSA 5T64A 2QD4A 1A2KC 2GBCA 2QW1A 4ZC8A 2YFKA 1JEQA 1GZ4A 4YY3B 2Z1DA 5CVJA 4OHOA 4KVFA 1Q0LA 3I6BA 4UTVA 3K09C 1AS2A 4M1ZA 2QGFA 6ADHA 1W36C 4FKZA 4DV4B 4GC9A 3PKJA 4TUYA 5AKYA 3OPYA 3WIEA 3NOOA 1Z5WA 1YQUA 1RWBA 4BX2A 2W2PA 1JKJB 3PNKA 3KQQA 1GFZA 4JC0A 4LTMA 4OV6B 2NX2A 4FOOA 5A4IS 3K0CA 4Y2SA 2AVDA 1AN9A 1UC4B 3FYSA 1U7TA 3C3MA 2ARKA 3PUJA 2YWGA 3U7GA 4LXXA 5JRDS 4O0LA 3VSAA 2VPXA 5KKAA 1DV2A 4U4AA 2YJ6A 2R60A 4O2BF 3H9BA 4XYBA 4L9SA 4YJGB 4EHDA 2EDCA 3CH4B 3IXLA 4M0FA 3SLRA 1X1QA 3ET5A 4KFCA 4EHHA 1G8PA 2I1QA 4MAAA 2D1SA 1K6JA 4M9UA 2BF7A 2W70A 4HXFB 4DREA 3OQOA 2IVFA 3LQ4A 2NMVA 4D96A 1GSOA 1P2TA 1VB5A 2F3QA 2YOFA 4IIYA 4YGXB 5JU6A 3JWPA 5ALNA 1E60A 2LIVA 3GLSA 3CF4A 4GPIB 1BDMA 4BKOA 1KE1A 1S3IA 3CFYA 4PLCA 1S2DA 4IJKA 2XCOA 2PZEA 4HDKA 5IAJA 2QT0A 3PT5A 2C96A 2AEJA 2EIXA 2FW6A 3L4KA 4HGPA 1ZSNA 3G9TA 4Y3UA 4BWYA 1MJHA 1ZICA 5IUNC 1UKCA 3Q1LA 4LIPD 1F7UA 4FR5A 3TNLA 1XDBA 3JATB 1NQ5A 2AYZA 4H3HB 1S2LA 2JGNA 3W5IA 1MDBA 5LQJA 3R9XB 6ABPA 1WMDA 5B1DA 1JDBB 1OU0A 4A6EA 2PSDA 3U37A 3AWDA 3JAWB 3PZBA 1WTAA 4MTLA 1UDBA 3TNFA 3GIDA 3L7MA 2RAVA 4EG8A 4ZI7A 4IH9A 3PXUA 2D7DA 1B8OA 2FMUA 3PXEA 2P9GA 3WA6A 2J9GA 3FZYA 2ZGVA 2BFFA 2Q41A 2W5UA 2Z43A 3FVWA 2HJSA 4R7GA 2F7SA 4EG1A 1J8DA 1ZJ5A 5C5CA 3KLOA 1ILEA 2YS7A 2R6AA 3FOEC 4PG5A 1PBTA 4R7ZA 2ZS8A 5JJCA 3I52A 5E1DA 3BQ9A 3CX4A 3GA7A 2HF8A 4BLWA 4Q03A 3HO8A 2VYND 3CM0A 4NDZA 4YHHB 3ASUA 4EPYA 1RYYA 4MNTA 1SO8A 4RACA 1GCAA 1XMPA 4MYUA 4PX3A 1D6MA 4G0QA 4MLCA 4KVZA 4KNYA 3NNNA 1KERA 1G6KA 1TKBA 1F8XA 4ZDKA 1NRJB 1P0CA 1KDOA 1AG9A 5JVDB 1PQPA 3I4FA 3VO2A 5FHRA 3GRFA 2WQ6A 2HJVA 1VIYA 4GXQA 1PNTA 1NVWQ 2WSMA 3QV1A 3KQOA 4KGXA 4EMTA 1E66A 2QENA 3EA4A 4F56A 5F5NA 5JXIA 3FROA 1BU8A 1BZYA 3SR4A 3QXGA 1FLVA 3GEPA 3X44A 5A5DA 4TUYB 5CLIA 1JHYA 3OPYB 3H2ZA 2OAP1 3EVTA 1LJ8A 3DEHA 4PAOA 3AVVA 3P26A 4XQGA 2C5FA 3GAAA 5B2EA 1NIPA 1YNOA 4JLVA 1E3IA 4BFYA 4I55A 2WB4A 3B60A 3UTCA 4KQEA 4ENSA 1NJ1A 3UKDA 1XPUA 2ZBDA 1VA4A 2HXGA 1DG3A 4GE3A 4L6IA 3VDNB 4KR9A 1YRYE 5JG7A 3WKBA 1BWPA 5JC8A 1E58A 1Z0AA 1PEDA 2QUAA 2BRUC 3OJEA 3Q2IA 2X4LA 3GJYA 2QSYA 1E2PA 1Q15A 1IUPA 1T8RA 2QXTA 4L5IA 5AIAA 3GLFE 3AOGA 1GN9A 4JLAA 2Y1CA 4JEUA 4ZA2A 3C7TA 1WXWA 5A4JA 2GM9A 1USWA 2R6R1 1VSVA 5LC1A 1GKIA 3AUJB 2IXFA 3KV1A 4DCPA 4NKRA 5JS1A 2IXAA 1BX3A 1KOJA 2AFIA 3JX9A 4CMIB 3QWHA 1RWMA 2QX7A 4GSYA 1ORWA 3I83A 5JD4A 1LDMA 1JDUA 2WNIA 3N3BC 5CHEA 5E8RA 3IALA 1RYFA 1O9BA 3LPCA 1BN7A 4WBXC 2WVHA 4UFNA 3WIBA 1QX4A 2FXIA 1R15A 5KNLA 3NP9A 4N40A 4WKBA 5FORA 1R0KA 4I8IA 4RKQA 3ESXA 2UXDB 4WJZA 3I09A 5T8KC 1XYVA 3I8OA 2A88A 5JMTA 4HFNA 4QRHA 1P5FA 5DTIA 4ZOQI 1PL6A 4JGGA 4TTPA 2Y6VA 3GNLA 4F85A 4YMUA 5AK6A 2ZYSA 2NT4A 3GJQA 3OOEA 1XTRA 5HCIA 1KQGA 1ZIDA 2IQIA 2NV0A 1CY4A 1P80A 3MHPA 4C4ZA 2DETA 4ZI7B 5AVYA 2HA3A 5B7GA 4DBLC 3P2EA 4BV9A 1N7HA 5C31A 1XNHA 5BORA 3WHLA 5BNTA 3C16C 3IPLA 4TSKA 4DQKA 4DQVA 5GWXA 1DIOB 1KR5A 2BFFB 2QT9A 2IOYA 4TWJA 4ACAA 4QUKA 4Z4EA 2G9QA 4EG4A 1W4ZA 3OZGA 2ZRCA 3RRYA 4E5YA 4KSBA 1I7DA 2NO5A 1E0AA 4IQFA 1SCAA 2PMEA 1N6HA 4P3YA 1TGYA 1R12A 4C1BA 4EIWA 2N75A 4QQNA 2FR1A 4FGUA 4EECA 1F8FA 4CF7A 1L3IA 3WXBA 3ZU4A 4EVIA 2QXYA 3NIFB 5FOVA 3EXEA 2IOHA 4HY3A 2GCEA 2OGZA 4MYDA 4CKBA 5K09A 1CUZA 4J0KA 1CUGA 4WDQA 2ZI9A 5HEKA 4G5QA 2Y4OA 4F1WA 1G7SA 3A6KA 4OAPA 1RWKA 1TEXA 3F8WA 2ZE5A 1X8KA 4QVIA 2AOUB 4FDUA 2B5WA 1LK0A 1YHNA 1H85A 4QTTB 3GRKA 4FFOA 4V38A 1JE1A 1G21E 4QYTA 4NNPA 5HIMA 3HLKA 1TU3A 1YCDA 2IEDA 4L4ZA 2TMKA 4DILA 2AJLI 2HYDA 2WIBA 5BYBA 1EJ0A 4BMYA 4BMVA 5JRZA 4X8MA 1E5XA 1Y37A 5FV7A 3MOGA 2C5LA 1SVUA 3SBDA 1TMYA 1ZMBA 3RU9A 1K7XB 1H5UA 3ZV6A 2MSDB 3JARA 1NR7A 1KF0A 4BU0A 4DN6A 4MQBA 4I55B 4OHKA 5FOSA 4DM4A 2H4HA 3VR2A 1ZJ4A 1HBJA 3UH1A 3VI4B 4IGAA 4KI0A 1IE3A 4B4VA 2RGWA 1KGDA 4RSHA 1CZUA 2P0EA 3EHDA 1PF7E 3IJ5A 2FEMA 3CKYA 3MMXA 3RO7A 1SVNA 2AMVA 2R8PA 3DDWA 1C9YA 1SXHA 4TXNA 3QFHA 4YFYA 2H4FA 5JBNA 1QAMA 2UDPA 3W4IA 3FSRA 3ZTYA 2Q4RA 5ESRA 1ORVA 1E1MA 1UBLS 4LQ4A 2VHVA 3U3MA 3A58B 4D4JA 2BDUA 2MYUA 5LQAA 3BTVA 1CZOA 1UK7A 4HEJA 3LH5A 4MI6A 2C0CA 2AE2A 4K8OA 3VX3A 3ABRB 3UT0A 4JLUA 3FGNA 6Q21A 3QNMA 1N2OA 4EQ6A 3FZEA 1Q91A 4I4TA 2NSYA 3IR6A 1WCV1 1RZUA 3UB4A 1OASA 1WB5A 4S1TA 4YR9A 4H4EA 4AMYA 5KYGA 3SVLA 1B26A 1MVNA 1FNCA 1JL3A 1DADA 1U2GA 2XY4A 3LXXA 4HSEA 4AMUA 2VUIB 2GFIA 4R1SA 4BZWA 3EGWA 3K9FC 1P1JA 4GWKA 2RH5A 3PSAA 4XVCA 3EULA 1OF1A 1T2NA 2JEZA 3R6LA 2C57A 4MVXA 1IBMB 1U7OA 2WSSD 4PQEA 1UKBA 2PIDA 5CGZA 3OJXA 4B0OA 3LQ2A 5C53B 2C5AA 4M0LA 4OKIA 4AZ3A 1BE0A 4ZO8A 4TVBA 2IOQA 3ZWWA 2FSSA 1SIWA 1KDPA 2VJBA 2FP4B 1DQRA 3N6VA 1GAXA 4J0DA 4QU5A 2JAHA 5AJYA 1RYHA 2LUOA 3W79A 4DMCA 4DYHA 2ZAMA 3IQHX 3HXLA 1YZTA 4ZRDA 5CDHA 4XIJA 4HLUA 3C8MA 4B3XA 4BRWA 1L3CA 2DY0A 3HP7A 2G76A 2C7PA 5LKAA 2G17A 1U1CA 4YUVA 1Z74A 4ZEWA 3USES 1EXMA 5KYYA 1FLNA 4CKBB 5BRNA 3R20A 4FE4A 2JNWA 1DVRA 1KH1A 1ZIPA 3M5PA 1TCAA 2P65A 1S1MA 5DO9A 4L0CA 4QGBA 3BWEA 4QDUA 4Y2YA 4HNTA 3ISTA 3GR6A 2VXOA 3WYDA 5CW1A 1WUYA 4DV0B 2RIPA 4R9SA 4UE3S 4DUZB 1ZCZA 1E1DA 3GMIA 2QN1A 2WIDA 4RBNA 1VHWA 4D4GA 1AA6A 4HTAA 3EZNA 5K5EA 3CKMA 3INYA 2R9VA 5TGZA 1R4NB 3BK7A 3BM5A 3PJDA 4I1IA 5HOQA 1PVDA 4BO3A 4OQNA 2IC5A 3F96A 1G8HA 2O7QA 1YXMA 1OV4A 4WA8A 3LIIA 4KV7A 2KMLA 5K6AA 1A2OA 1WW3A 3JARB 1R0BA 1ZONA 3DYIA 3KZKA 4P33A 4UBKA 4BLTA 2RGCA 2DERA 3ZQUA 2EJWA 5JXWA 3NJ4A 3WE7A 5K0JA 3BILA 8LDHA 1KO5A 3GROA 1BDHA 3OZEA 3N2YA 4OBWA 2NZWA 4JI2B 3CBQA 2BHTA 4HVCA 3KALA 3OPXA 1TU0A 1DJPA 1EVJA 2AH5A 2FFQA 7REQA 1R6VA 1LPAB 3D7RA 4BCCA 1ZRNA 3IO5A 1XVVA 1YV9A 2ZIEA 1E2IA 3V1LA 1Y4UA 4HDQB 1VDMA 4J49A 2X4IA 3JQ9A 1J8FA 1EFPA 3KFVA 3KVOA 1ZGCA 4OTZA 5HDBB 2WJ3A 2NTNA 2NU6A 4LHEA 5HGXA 1G3RA 3L0PA 3E7DA 4PYNA 3L93A 4EYGA 3GFRA 2PIAA 2ZDHA 1SCJA 4JH0A 2PRZA 3HMKA 2FQ1A 3WAGA 1AH2A 3ELYA 1GQQA 1HQDA 1D2EA 3EVDA 3IERA 4BEVA 3GIWA 4GX2A 4MGIR 4WZBE 2AFHE 3Q3GE 1E89A 1Y9DA 4POAA 3C3CA 4FQ8A 1NLYA 2VNSA 3VNSA 1YF3A 2Z8XA 4TTRA 3W3AH 1EXDA 3DAGA 3OFNA 1K92A 4C04A 1L7XA 1QO9A 2MWMA 3H9UA 4YCMA 1AXEA 5FR1A 5JYCA 1HEUA 2H2AA 4KO4S 4N7RA 3GZNA 5CHYA 4V03A 1M5UA 1Q77A 2VHUA 4S3MA 2HA0A 4AZ3B 1HG1A 1W48A 2QZ4A 1QFZA 3C3XA 1JU4A 5F21A 1KI1A 1IBKB 4P6VF 3WS7A 5JCJA 3AO0B 2ZSEA 3D8HA 4FYKA 1I2CA 4N4AA 3IULA 3C5WP 3Q7TA 4FYPA 4MWZA 1OFUX 1OAKA 1E79D 4G0UA 3U40A 1ZK0A 4CU5A 1XEAA 1I0LA 1QBGA 5ALMA 4C03A 1P44A 1I3CA 2PZFA 2O6HA 1G3MA 4G8CA 4RDIA 4TRJA 4CIVA 1KZ4A 5KX5A 2YMLA 2YC4C 1WS6A 1GZ5A 2I7CA 3CUUA 4J0QA 3X1WA 2W6ID 4ZEXA 4R54A 1W4CA 3RODA 5AI5A 3S8YA 3CLHA 1T5OA 2WIKA 1GGJA 4X8LA 5B2ZA 5B4TA 5C8ZA 4B76A 3F49S 3WLIA 3DOOA 3F1LA 3NNSA 2Y99A 1PI3A 1EEHA 2B1JA 4CR6A 1H8ED 1GCGA 1UPTA 3C24A 1QM5A 2FZVA 4M4SA 4Z9FA 4QASA 4PQGA 4ZDIA 4BN4A 1MZPA 2ZCUA 4F2GA 2VF7A 3NAZA 5EZSA 3JQAA 2PNFA 1RI4A 1J97A 1LY1A 2W4MA 3MT8A 4RK6A 4WY8A 3L43A 4JOCA 3EF1A 1HC7A 4FPXA 1DKMA 5BUQA 4CUJA 1O95C 3F0TA 3W9YA 4CV0A 1N4DA 1XTVA 1DLJA 5KQMA 4HPXB 4IKEA 4B7AA 4CN9A 2YDXA 3HADA 1CK4A 3QX3A 1Q16A 1NVGA 2H92A 3DHYA 2VHWA 4MYHA 3X1XA 2O0LA 2Z3ZA 3ETNA 4XDYA 2BGTA 2WG0A 4BNNA 5AESA 2PL9A 3BUSA 1V37A 1Z4MA 1M67A 2R5FA 1A50B 7REQB 4C5CA 4NBSA 5KCZA 2BSQA 2VPPA 5EQDA 5MGBA 1UT6A 1BJRE 4IW3B 3DEZA 1K8YB 1UDAA 1RLOA 3G2HA 4EJSA 4AM8A 2ECFA 2X3UA 2MMCA 4KQ1A 4K5QA 3S8MA 1EFPB 4AJ2A 1NC3A 2NU6B 3LW8A 4PTYA 2O50A 3ZH2A 4HWRA 2XCLA 3GDGA 4JT4A 4MB6A 4YR7A 2NO1A 2XCUA 1TF5A 1O9HA 2I3AA 2V9CA 3ABZA 5BT9A 3VAAA 2AK3A 3MJDA 3V3KA 3ACDA 3CINA 1SVKA 2PT5A 5EE9A 1EIZA 1JG1A 9ATCA 3EFOA 3T4EA 4R7TA 1VIDA 5B58C 2IGTA 3UVEA 3UJ6A 4OP2A 1PJ8A 2AEEA 1NVTA 2O2GA 1JGTA 1G20A 2RK4A 5THQA 3MTBA 2YX1A 3GZNB 2EGUA 3QTBA 3EZ6A 4HG2A 1SOWA 1II8A 3CPEA 5KKNB 2PS0A 3G5UA 1ZD5A 1RLIA 3CR7A 3H9EO 4MWCA 2D0OB 2JIZD 3M6AA 2IUUA 4F1JA 4EW2A 1T25A 2YHSA 3ADPA 4F9GA 1ESEA 2ON6A 4RKYA 1VG1A 3AR8A 1AXRA 2IDKA 1RXIA 5IJXA 4XCVA 2WMYA 3N74A 1TO6A 3SNKA 1BE6A 1EA5A 1QV9A 2BFPA 2XNHA 3JPYA 3KV3O 4E2FA 4YLYA 1PFQA 5J2UF 3QV2A 1B4DA 4IFIA 4IYRA 4S12A 2R7NA 2VTEA 2WV7A 2XDAA 5EG5A 3U9LA 1TTHA 2ZATA 1M6NA 1D8TA 5IWCA 5KX5B 4K2HA 4A2CA 2O8BB 1V9CA 1Z08A 3D4NA 3MXTA 3QPAA 3GNTA 1D2RA 5K3DA 2YVAA 3LFHA 2JDIA 2QX4A 3PHBE 2C2HA 3HHEA 1E4VA 1NKVA 4HH3C 4WQMA 4I9FA 3EXHC 2IYPA 3U6BA 5EXPA 3MK31 3OTIA 4RELA 1RLUA 2GI4A 2DFKB 4FUTA 2EIHA 2LCIA 3AR5A 3JYHA 2CHVA 2GJ4A 2VA8A 3QOFA 4L08A 4NE9A 4KE9A 3KKMA 5NLLA 2AX4A 4RGQA 2FSVC 3S1LA 1XK7A 1J99A 3NW9A 3BMNA 2VRNA 1LDYA 3JQAB 2G6TA 4Q7EA 1BROA 1Q7TA 4X9XA 4RTSA 2AYYA 5CA0F 2C3YA 1J8VA 1T2EA 3OZWA 1CZLA 1TCCA 1IXKA 4YUYA 3CRRA 2CYAA 3E1KA 1PWZA 4FLFA 5LDGA 4ENTA 3K73O 5JJ5A 2HRBA 4MYCA 1CJMA 1PR2A 4FKBA 1RKVA 4KLAA 1IATA 4MW1A 3FPEA 2UYCA 5H8WA