3BA1A

Structure of hydroxyphenylpyruvate reductase from coleus blumei
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
312
structure length
312
Chain Sequence
EAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLALQAESIRAVVGNSNAGADAELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLRRICECDKYVRRGAWKFGDFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSRSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHFSGKPLLTPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxyphenylpyruvate reductase
publication title Structure and substrate docking of a hydroxy(phenyl)pyruvate reductase from the higher plant Coleus blumei Benth
doi rcsb
source organism Solenostemon scutellarioides
molecule tags Oxidoreductase
total genus 109
structure length 312
sequence length 312
ec nomenclature ec 1.1.1.237: Hydroxyphenylpyruvate reductase.
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ba1A01
4MVJM 3OF2A 4AJOA 1E3LA 2P4HX 5KJCA 1K2WA 1P1RA 4OO3A 3ABIA 2AQ8A 3ZWYA 2ZYGA 2VT2A 3QWIA 4RZHA 3WG9A 1U4SA 1C1XB 3WIDA 1Z75A 3V8BA 5JAMA 1X0XA 2Q4EA 3JQFA 4XYMA 2QZZA 1R4NB 4YJGB 1AXGA 1Z82A 1O9BA 3H2ZA 1E3EA 2HJSA 4I9HA 3C7DB 3LC7O 3GFBA 3ICPA 1FDSA 4R9SA 1OOEA 1ZW1A 4WOKA 4OQYA 3RROA 2B0JA 4YCAA 3NKLA 2VYVA 1LC3A 3PLNA 4CR6A 5A03A 1FDVA 3L4SO 5CPBA 4WLUA 1UXKA 1IPEA 1KERA 5KOIA 1GL3A 1R4MA 4XYGA 4LW8A 1J0XO 1X1EA 3ZH2A 4BO1A 3EHEA 2EF1A 4Q3NA 4BKOA 1YKFA 1D8AA 5JC1A 5HRUA 1EFKA 5C7IO 1V3TA 3RUIA 3VC7A 2Q1TA 3JQAB 1M6HA 4UEKA 4RLHA 1GYRA 4DMMA 3MTGA 1QG6A 4OM8A 4W9NC 3K8ZA 1I3MA 3VPFA 1GEGA 1NR1A 4R1NA 1V6AA 3F9IA 4UUNA 3EYWA 1SOWA 4MVJA 2LDBA 4UULA 3X2EA 2DPHA 3M2TA 4UREA 5AXDA 3DZKA 3ROPA 3ST7A 4X54A 3V2HA 1YB4A 3R3SA 5TT0A 5KJFA 4AJ2A 4LISA 4N5LA 4OXKA 3WJAA 4NHEA 1ISFA 2V6FA 1P44A 3G49A 4XA8A 2X0RA 1YL5A 1B16A 4AICA 1R12A 1YL7A 2ZJ1A 2RIRA 4XGNA 5AXCA 1TLTA 2NVBA 3TZ6A 4E2YA 3BTSA 4WLEA 4JLWA 1RKXA 3U5TA 1XHLA 3D3WB 3QVTA 2PGDA 4OXYA 2PY6A 2O2YA 1UP7A 3I5MA 1AGNA 1JU9A 3DQPA 2CNBA 4L0QA 3W6UA 2PH5A 4IXTA 3BA1A 3EVNA 3HADA 1MUUA 1ZBQA 2Y1EA 3B1KA 3O8QA 4BNWA 4DPLA 5JW6A 3IP3A 3QRWA 3GG9A 4ZICA 1VKNA 3DAFA 3G1UA 1VL6A 4R41A 3EAGA 3KV3O 2JFHA 5KJ6A 1P1JA 2NU6A 4YA6A 4CM4B 3I4CA 2QHXA 1GV1A 2GR9A 3QA9A 4A2CA 3K31A 2EKPA 1Y6JA 4JK3A 1MV8A 1ISIA 4GSLA 4YYZA 1UXHA 4O0LA 4YWJA 2Q99A 1LDMA 3B20A 1GPJA 1U5CA 1C3VA 3FBGA 3PGJA 4JP2A 2I9PA 2NQ8A 4JJIA 3DZHA 5JMWA 5B37A 4CMCA 1EE2A 3L07A 1NVGA 4KDFA 4N54A 5EMHA 3ZWAA 1VSUA 2A4KA 2PTGA 4YAIA 5F1PA 4EUEA 1T1RA 4YXFA 3AFNA 2YUTA 4LK3A 3WMXA 2GDZA 3IIEA 4Z0PA 1LLUA 1KY4A 1IB6A 2P2SA 3SLGA 1B14A 4C7JA 3FF4A 2YHIB 1U8FO 1DSSG 2W2KA 8ADHA 5I9LA 3GZNA 1ZK1A 4N18A 3RAJA 2VYND 5I8ZA 5T67A 1X15A 1DC3A 1OMOA 5ES3A 2PD4A 2WTBA 3C1OA 2ZTLA 3QVXA 3EDMA 4RQTA 3RFVA 4DQVA 1H9AA 4WNIA 2HMUA 4I1IA 3HHPA 1T4DA 1L7EA 4CMHA 4BMNA 3DOOA 1T2EA 5DP2A 4IQ0A 3NAQA 5JCJA 3WQRA 4GPD1 4J90A 3D5QA 4CLEA 1S6YA 2XF8A 3Q3CA 1DIBA 1FDWA 1GU7A 4FC7A 1C14A 3U4IA 5T8KC 3PWKA 4DPKA 2YV3A 4B3IA 3QIVA 4IXWA 3W8EA 1BTOA 1QSGA 3NGLA 3ZZNA 4JX8A 2JD1A 5DBIA 4DWVA 4WLNA 2FWMX 4WECA 3JV7A 2W2LD 3NV9A 4RPKA 3KETA 1YH3A 3OJ0A 1KVUA 4NJMA 4XGIA 5L40A 4JBHA 2JHFA 3VH3A 3GDOA 5I7EA 1RYDA 3KM0A 1UAYA 1DFHA 5FI5A 1D4FA 4FJ1A 1IULA 3H5NA 1U2DA 1HLPA 5H81A 2D3TA 2PV7A 1JWAB 3K30A 4BNYA 3AM4A 3H9JA 1FXSA 3VDQA 2FPIA 2FR0A 4J3FA 3ZHBA 4PG8A 3I9JA 4Q9NA 4ZQBA 2JCXA 4MKXA 4E2ZA 2DUWA 4Q3CA 2CZCA 4BV8A 5EN4A 2EP7A 3VKUA 4FFOA 5HS4A 3PHGA 3WXBA 4BIIA 1K6XA 1X1TA 4IJWA 2VHWA 3WFIA 1JVBA 4S1VA 3BHMA 3K92A 3KLMX 1JA9A 4BUCA 2RH8A 4NBVA 1UJMA 1JDJA 4BNLA 1KC3A 1U3VA 3I52A 2I66A 4WPGA 3QJ5A 4J0EA 5DT9A 5TSDA 4WK6A 3ZHYA 2D2IA 1KBZA 3K6JA 4U7WA 3AUSA 3DTYA 4UUMA 1PS8A 3ETGA 4W99A 2VNSA 1BGVA 1DJQA 3C1TA 1H94A 3DFUA 3ITDA 1N92A 5JDIC 2BFAA 4CPDA 5L95A 1HDOA 3OETA 1BWSA 1SBYA 3KLPX 4YT8A 4HWKA 1KY5A 3LT1A 4CQMA 2ZYDA 1XU9A 1Z7EA 5FF9A 4WCFB 3UICA 4PZEA 3WGYA 5GZ6A 1SNYA 4DLBA 3BYZA 4U6SA 2PZJA 4RGBA 5C7LO 3AY3A 3KO8A 4TWRA 4IS2A 4J6FA 4NK5A 1HETA 1NR7A 1OI7A 4OOFA 1A7KA 1N2SA 3GAFA 4Z0TA 3N58A 3GVPA 1PS9A 4OQZA 3VDRA 1HE5A 1TT5A 2NU9A 2RHRA 1PGPA 3QWBA 2I76A 4B7XA 1Y9AA 3HDYA 3RC1A 2Q3EA 1KOLA 3WS7A 4NBWA 2WE7A 4IMPA 1GD1O 2AHRA 1YJQA 2GUGA 3U3XA 1YJ8A 4R3NA 5A1TA 2OUIA 2IDZA 3ADOA 3IUSA 1Z7BA 1FF9A 4MP8A 1PZGA 4JBGA 3I6IA 3ZU3A 4AJHA 3TJRA 5GMOA 4B8WA 1QLHA 3GMDA 1P9LA 5BQFA 4ITUA 1GZ3A 1CRWG 4GGPA 5JXWA 4RQUA 1E1KA 2VZ0A 4HBGA 3MWEB 1PR3A 1A7AA 3NEPX 4Z0HO 1QP8A 3RUCA 1WW8A 4EEZA 5ENVA 5L51A 3WMWA 5JY6A 1I3KA 1E0DA 1J4AA 1RYEA 1N9GB 4K26A 2VOJA 3UCXA 5BSEA 3I4FA 5G0TA 1RM5A 1XSEA 5IN4A 3QW2A 2AQHA 4L75A 3DTTA 1KEPA 3D0OA 2OBNA 3DZBA 4XQ9A 3MJEA 4AJEA 4MKZA 4W6ZA 3LF1A 3GOHA 5TT1A 1G6KA 3HB5X 3U4DA 3DHEA 2CDBA 3KTDA 2BI8A 3WFJA 1KYQA 4P22A 4TRMA 1K6JA 3NTOA 4S3MA 4FFRA 5LCXA 1XQ1A 5A9SB 2GSDA 2OO5A 2O4UX 4HFMA 4ZVVA 4E33A 1LTHR 1MP0A 4ESOA 4CUZA 1XCBA 2G82A 4I5EA 1PQPA 1VL0A 1F17A 3GGGA 3OMLA 4L4SA 4FFLA 2FPGA 4JBIA 4JN6B 4E3ZA 3ZNOA 1WLYA 3ZWOA 1IHYA 2BFOA 4TQGA 3OIGA 3WDSA 4OSPA 4QEDA 2Y1CA 4ALJA 4CLHA 3FBTA 4J4BA 2YV1A 2PD3A 1TVEA 3P19A 3ZU4A 1YGYA 1DHRA 5JLAA 1Z74A 3AM3A 4E2XA 3JQ8B 1C0IA 1YBMA 2C82A 1JTVA 2J5QA 3C7AA 3A14A 2V65A 2VYNA 3SXPA 3ONEA 4JJFA 1M75A 4CQLB 1ADBA 2NTJA 2ZQZA 1Y8RB 3WYEA 2WSBA 2QX7A 2YY7A 4ND4A 5EESA 4D3FA 5B12A 1LDGA 4FS3A 1L7DA 3M2PA 3S2FA 4CJXA 5CDGA 1HYGA 1HZJA 4O63O 2PLAA 4I8XA 1AN9A 2HK8A 3E6AA 1AE1A 4Q39A 5DNAA 2HCTA 1Y8QB 1H6CA 1N1GA 1HL3A 3PJDA 4IPTA 1QXSA 2AW5A 2E82A 4M86A 3GUYA 1C1DA 4J43A 4LRTB 4GX5A 5FI3A 5L7WA 3BMOA 1R6DA 1NQ5A 1I2ZA 3PWSA 1ZO8A 2B4QA 5L3ZA 1SAYA 4ND5A 2NM0A 2YQ5A 3GHHA 4EBFA 3ZCXA 4BQRA 4CUJA 3CKYA 3CZRA 2AG8A 1IPFA 1HWYA 1H6DA 2CUKA 5H82A 3LSYA 1P31A 3SX2A 1I0ZA 5HWSA 1N7GA 2PGJA 5KJEA 2GF2A 3O4RA 2FY8A 5IG2A 3JQGA 4GVLA 1V9LA 4DREA 1I5RA 1Y5MA 3PZRA 1S7CA 4EUFA 3OP4A 1LUAA 4DQUA 1DAPA 1GPDG 1DJNA 1ZMOA 3EC7A 1Q0QA 5G4KA 3Q6IA 4L4XA 2WD7A 4ZQFA 5JSFA 4AJPA 4RCVA 1RM0A 3SJ7A 2BH9A 2WM3A 4XYEA 2W90A 3COSA 3NT2A 5THKA 2HDHA 1E7QA 4IDGA 4Q3EA 2O23A 3GN2A 3F6YA 2P91A 1OC2A 3ETEA 3KBOA 4YPOA 4B7UA 5L9AA 3WQQA 1LEHA 1D1TA 2DAPA 1PGOA 5C3MA 1NFQA 3MEQA 4B4VA 3QV1A 3EY4A 3PEFA 4J1NA 1YQXA 3L6DA 3INGA 5IDYA 1OC4A 4WUVA 4ZQGA 3H3FA 4IINA 5TX7A 1OAAA 3KEQA 1LSOA 1YOVA 4ROSA 4BO2A 3IAHA 3GR6A 4EYEA 1G1AA 5IF3A 1GV0A 1LLDA 4IDAA 1E3SA 4FQ8A 5L45A 3RJ5A 3C8MA 2AMFA 5JC8A 1EDOA 4TRJA 1DBVO 3PYMA 4E21A 3RC9A 4DYDA 1HYEA 4TZKA 3PWZA 3INTA 3AI1A 5EQDA 3KZVA 3PGXA 1YQDA 3HUDA 2VN8A 1F8GA 2ZTVA 3PFFA 3T7CA 4CV0A 2PKQP 2BF7A 4E2WA 2Y99A 2GN9A 4Z3KA 5JFOA 3VVCA 4CM1A 2UDPA 3QSGA 3F1KA 1HZZA 1EBFA 1B3RA 3BMQA 3GLQA 3HN2A 4QX6A 4F6CA 4EEXA 3PHJA 1QLJA 4IJVA 4UVGA 1O0SA 2ZCVA 3LT0A 3DMTA 2C5AA 2CMDA 4IBOA 1LDNA 1YDWA 2VTEA 1LDBA 1CERA 4CMIA 4NG5A 2UAGA 2QZ9A 2Z1MA 1ORRA 5K9ZA 4B4UA 1N7HA 4ID9A 4NFSA 4NK4A 3RBXA 4FW8A 5JAIA 3I3OA 1I2BA 3BTUA 3AUTA 5ENDA 1GQ2A 4KP7A 1PL6A 3RQSA 1NNUA 3R0IA 5ICMA 1PR9A 3AOEC 4GWGA 5KKAA 1NX6A 4AJKA 3IDSA 4LVCA 1E1LA 2XOXA 2FZWA 2CD9A 4BNVA 4IGEA 1B2LA 3GEDA 3H8VA 3AUAA 1QYXA 2DC1A 4KUEA 4XYBA 1M6WA 3IQDB 4RF4A 4RL6A 3ZW8A 3QWAA 3JQBC 4WEQA 3ZV5A 1YBVA 9LDTA 5IZCA 1Q0HA 5L7TA 3HB4X 2JJYA 3RIHA 1C0PA 2BELA 4CLRA 3JQAD 4QECA 4R16A 3LDHA 1AXEA 4Z3DA 2R00A 1GYQA 2Q1UA 2LDXA 2X9GA 4FFMA 1YDEA 2BHLA 4GLLA 4D7AA 2H5LA 5T64A 1M67A 3CUKA 3ORFA 3WBFA 1HE2A 2NVUB 2Q1WA 3U49A 3DZJA 4YACA 2O7SA 5BNIA 1EEHA 2WDZA 2JFGA 4BGEA 2X5OA 3FR7A 1I8TA 2IZZA 5L53A 3K96A 2VUUA 1A4IA 2AEJA 3WLFA 2ZTMA 2YW9A 2ZYAA 4YJDA 5J23A 1NWCA 1GUZA 3B1FA 3M1LA 3DMYA 2JHGA 1DC6A 2YZ7A 3JYLA 3L4BC 3MOGA 2IRWA 3DC2A 3M6IA 3VVBA 3S2EA 2AE1A 1IY8A 3QY9A 2C07A 1B26A 4XCVA 4J16A 2VRCA 4HP8A 3GQVA 4UVEA 4BOYA 1YE3A 1P1HA 5MDHA 1KVQA 4DL9A 2ZB3A 1P33A 3OQ6A 1DRVA 4EW6A 3L77A 4DC0A 1KIFA 2DFDA 2JD2A 1BSVA 4MIYA 3TFOA 1KETA 1ADFA 3EZLA 2EERA 4CLOA 4QXMA 3NTQA 2F1KA 4J91A 1LC0A 3H65A 4TKMA 5K6AC 1I30A 2JAPA 3B70A 2HRBA 3ZWCA 1E92A 3I9OA 1YL6A 3MJCA 4Z9XA 4F3YA 3IP1A 4YEDA 1ONNA 1GCUA 1I33A 2VHZA 4R9RA 3UF0A 1NAIA 4NFHA 2GZ3A 1DB3A 4RPHA 4BKRA 5L4LA 3OSUA 3ZWVA 4CM8A 2OHXA 1BXKA 2DPGA 3HN7A 3GNSA 3DBLA 2NVWA 1T1SA 4J7CA 3WGIA 3C85A 1XU7A 1YXMA 3FWNA 5TC4A 2BGKA 3LU1A 1EK6A 3O9ZA 2OORA 4UUOA 4MKRA 4D45A 4M54A 4BNUA 3KEOA 1SB8A 1FMCA 1X7DA 4ND1A 2QW8A 3KSZO 1VJ0A 3EZYA 3HFGA 4JCOA 2I3GA 1RJWA 4K9DA 5KCZA 3PIIA 1O6ZA 2Y68A 5IDWA 5L7YA 3AUUA 3KYDA 5ILGA 1LDYA 4G2NA 3GFGA 4IQ8A 3WNQA 2XPCA 4ND3A 2PFGA 4IQGA 4F46A 2EGHA 3BTVA 1A9YA 4FSHA 4K1LA 2RH4A 3V2UA 2C0CA 3I9MA 3ENKA 5ADHA 1ZK0A 1CQIA 3ZNNA 5CDYA 1HE3A 4D43A 2O7QA 4KTVE 4C4OA 4ZN6A 4AG3A 1GDHA 4H3VA 2GASA 3S8MA 4XX0A 1YVEI 3WIEA 3AW9A 3KYCB 1LSJA 4U8GA 2NACA 4YDRA 5CEFA 4BNNA 4BO7A 4AJIA 3GEGA 1HDRA 2C7GA 2B35A 4KQWA 2OP0A 3VZPA 4BMVA 5KJ1A 1I10A 4YQYA 4E6PA 1DRWA 1M66A 1WZEA 1D1SA 2Y05A 3PHLA 1PX0A 5G0SA 4GAEA 7ADHA 1C1XA 3AY6A 3V1UA 3DZIA 1JKIA 5CDTA 1F14A 1R4NA 3F4BA 5TNXA 3AI2A 2YQ4A 3UUWA 1PZHA 4RVHA 3T7EA 1UZNA 1PQWA 2B37A 4XZ3A 3P2OA 3GRKA 2ZB8A 4RVDA 3F3SA 3GRPA 3UAGA 4P4GA 2BLLA 2HO5A 4WLVA 4PLVA 2O4CA 3ONFA 1B0AA 1NHWA 2QG4A 4DLLA 1MG5A 4FPXA 3IC5A 3OQ1A 1UR5A 1V3UA 5JY1A 2EWMA 3OICA 2IEDA 3UVEA 4DGSA 5ITVA 1PZFA 3FI9A 3N74A 4XRGA 3FN4A 5EERA 1Q7BA 2JCVA 4YRAA 1E7SA 3FPLA 1BXZA 1PJCA 3PDUA 4FFNA 4BNFA 1C0LA 2A35A 1K89A 5EQFA 2NADA 1RM3A 2X5JO 4ZRMA 5GZ1A 3N7UA 4GI2A 4L8VA 1PGJA 3JQAA 1U3TA 2ILTA 3VTZA 4JXKA 3AJRA 3VPSA 5KIAA 2I3AA 3PJFA 4DYVA 4QTZA 1IZ0A 4NDNE 4XRRA 1NVMB 3ASVA 3OJEA 3W6ZA 2PH3A 5JYDA 1NAHA 5AYVA 4RVSA 1KEVA 5ILOA 4IS3A 2BFMA 4FIZA 5G4LA 4CQMB 1DXYA 1V0JA 5HM8A 1N5DA 1ZEJA 4MVJF 3VKVA 3ZWXA 1MB4A 1Q2XA 4BO9A 1CEQA 1UZLA 1KS9A 3GAZA 1A27A 4EJ6A 3TOZA 2BRUA 4OMUA 3GEMA 4JJGA 3LT4A 3GNTA 2VZ8A 3QE3A 1U3UA 4RORA 4U5QA 1P0CA 1ENOA 3BHJA 2C5EA 3TN7A 1WDLA 1ZK2A 3OHSX 3HJAA 2HMSA 3D3WA 3QQPA 4J1TA 3L6OO 2IXAA 2PK3A 1V8BA 3WYCA 1BRMA 3ASUA 3W4JA 5COQA 4PRKA 2FSVA 3T4EA 3K73O 4ZQEA 4E0BA 2VQ3A 2XAAA 4FBGA 2OGUA 1NM5A 2BGMA 2VOEA 4WASA 1OZAA 1W73A 4EZBA 2ZB7A 1U5AA 4BL5A 4K28A 4O59O 1HDXA 4TVOA 3G79A 3E9MA 3JYPA 4HUJA 3FD8A 4GMGA 1N8KA 4XQGA 4Y67A 1SEPA 1LRLA 5AXAA 1LRKA 4CM4A 2GRAA 4XJSA 3RASA 5CHEA 4CV2A 1T2FA 2A92A 2X6TA 2X7HA 3QVSA 2D59A 4J7XA 4RZIA 4XQEA 3UHAA 3RUAA 3KVOA 3F5SA 2Z95A 4CMBA 2PKRA 5BNTA 1WNTA 2X5KO 4EI2A 4HNHA 4YTEA 4CR8A 1PU2A 3IS3A 4W7HA 1PTJA 3G17A 1MC4A 4J1SA 1ZUD1 4KWHA 4GWKA 2RBEA 3E9QA 1LJ8A 4OOEA 4UEJA 4M49A 3RWBA 4NU5A 1PGQA 1E1MA 3TL2A 1EVZA 2Q49A 3VPHA 1RWBA 3QVWA 3G0OA 4RVUA 1UP6A 3ANLA 3DBHB 3JQFC 4HXYA 4D3DA 2FPPA 1O5IA 1T2AA 4PRLA 3JQ9A 3PFWO 2QRLA 2X23A 2YHIA 3NX4A 3CIFA 5IN5A 1H9BA 4BGUA 4M89A 3ZHXA 4Y6RA 3JQCA 1BHSA 3FNHA 4ZA2A 4QO8A 2DQ4A 3WGOA 3RUHA 2Q50A 4N7RA 4YJFB 4DLAA 4YAJA 5HBRA 4OSOA 5KVQA 3UW3A 3PHHA 2CF5A 4L74A 4RPLA 1MG0A 2EKLA 2J8ZA 1SO8A 1O8CA 1Z45A 4BB6A 3JQ6A 4CMGA 1T4BA 1YONA 1BW9B 4H7PA 4LVUA 5I7VA 2EKQA 4BVAA 4E31A 2IYPA 2HK9A 4WEOA 4RJTA 4I5FA 4MIEA 5JAQA 4BKUA 3ROMA 3MJVA 1ISHA 3IMFA 1E6UA 4YJHB 5TRTA 2AE2A 4HFRA 4I9UA 4AL4A 4HADA 4RPGA 5CG2A 2WYVA 1TEHA 1EBUA 1LSUA 3RU7A 3S55A 3I1JA 3DL2A 4FJ2A 3D64A 3ZNQA 1O89A 1HLDA 4YT4A 3ON5A 2R6JA 3MWDB 1TB4A 4QSMA 3GPIA 3VH1A 3DDNA 3RJ9A 1E6EA 1GY8A 3DBRB 2QIOA 1NWHA 3O26A 1CF2O 2WYWA 4NPCA 4XKJA 4WKGA 3VZRA 2GPTA 1UXIA 2DKNA 4NMHA 1GUYA 3BMCB 4AFNA 5F3RA 3BMNB 5JBIA 2Q2QA 5L4SA 2Y0EA 3TDKA 2NTNA 2P5YA 4ONEA 3BZUA 3JD2A 5F1KA 2EJVA 2J3JA 2V6BA 4MP6A 1MXFA 1T2DA 3KRTA 4BO5A 4DBZA 5EJ2A 3SVTA 4R3WA 4LN1A 2DTXA 4CODB 4XWYA 2EW2A 3K2EA 2HMWA 3LLSA 5BNFA 4GX1A 3NJ8A 3D7LA 5JCXA 2UUOA 1Y81A 1EMDA 1H2BA 5IJZA 4M55A 4GMFA 4GSKA 3VHRA 4H15A 3ANNA 2DBRA 1TXGA 1R15A 3A28A 5I7FA 5B1YA 4WCFA 4L4RA 2X0NA 4LMRA 1JN0A 1GAEO 3OEWA 2C29D 4BQPA 1CJCA 4IM7A 4IUYA 2Z5LA 4E5YA 4II3A 1R0SA 1MXHA 1C0KA 4FGWA 5U9CA 1O95A 3GY0A 4FD3A 3WSVA 2OOSA 4CLXA 4MVJI 4OKIA 4MINA 1Q0LA 3UCEA 5I9NA 1NVTA 1IZ9A 1J6UA 1X13A 4BKQA 3ZV6A 4CR7A 3IOYA 2J3HA 5JDCA 2Q45A 4PG7A 1AHIA 4RVGA 5G0WA 4YAGA 4HNGA 1K6IA 3PDJA 4PCVA 2W2LA 2Q1SA 4DMLA 2HMVA 3H6KA 2DTEA 3MJSA 1WVGA 3HWRA 3GGPA 3NUGA 1WXDA 2G0TA 2VCYA 3F46A 4YQZA 1NASA 1QYVA 1ZMTA 3I23A 2R2GA 4IIVA 3GH3A 1LNQA 4IDCA 4YAEA 1EQ2A 4P4LA 1DC4A 2J5RA 2B5VA 1G0NA 3U4HA 4PLPA 1N1EA 4MOWA 1N9GA 2ZJ0A 2ZQYA 4PLYA 3K9QO 3DZFA 4E12A 4AJ1A 4BMSA 4I9NA 4EJMA 1BXGB 3LVFO 4OJNA 4FOSA 1X7HA 4WLFA 4DPMA 3FHLA 2Y1FA 1EFLA 1DIHA 4Q3AA 4P38A 3WTBA 4GL4A 5CP8A 3GUCA 4D44A 4KUGA 1E3WB 5JMPA 1YS4A 3NJ4A 3STHA 5A9SA 2ZTUA 1P77A 4ZGWA 1IUKA 4Z9YA 5JS6A 1F12A 4E32A 4BNMA 3PVZA 4PIVA 4TROA 1JKJA 2YFHA 1E7YA 3RC7A 3JQ7B 1PZEA 1U9JA 1P45A 1HDGO 4W9NA 1GZ6A 3DB2A 1EUCA 1NPYA 3C3XA 3H9GA 2VYVD 5DP1A 3RUFA 4J4TA 5JPIA 1JW9B 3PJGA 4MDHA 1YBAA 2QQ5A 5BSFA 3JQ8A 1UDBA 2UV8A 2PZKA 2Y67A 4BO4A 3FNFA 4E4YA 5EPOA 4CQLA 2J6IA 3CE6A 3ZV4A 1W4ZA 2CSUA 4NR0A 4O6VA 3O38A 1Y8RA 4CV3A 4DRYA 3TZCA 4HY3A 3JQDA 3KXDA 2HLPA 4MIOA 4BNJA 3OJLA 4PZCA 3DOJA 3HDQA 2E4AA 1WP4A 3WJ7A 4F6LA 3TZKA 1Y8QA 3GT0A 5A5FA 5ITWA 2Y0DA 1FJHA 1I01A 3PYLA 5TLSA 4IDEA 3JQ9C 2FR8A 1LI4A 4LSMA 3TRIA 3EK2A 2UVDA 2DUUA 3WTCA 2VHYA 4Q3DA 3RFXA 4OH1A 1VE9A 3HDJA 5FYDA 1E3IA 2O3SA 4XYLA 2VZ9A 2P9GA 2O50A 4BKPA 4CLDA 1EK5A 2P9CA 1DEHA 4Y6SA 4AJLA 4BV9A 1MLDA 3SJUA 2G1UA 2P9EA 4DIBA 4FOOA 1G0OA 3DAPA 4HFNA 3PXXA 1PSDA 4GQAA 4MVJH 1WMBA 1D7OA 1GYPA 1GTMA 1B3BA 3M1AA 3CH6A 3KHUA 3UH1A 4A73A 5A02A 4ALLA 4FR5A 4LGVA 3BIOA 2IE0A 2Y93A 3D4PA 3DONA 1ADGA 2VWHA 4DA9A 1ENZA 4R51A 2W4QA 3V1YA 3GVIA 5BSGA 4OHUA 4RVFA 4YRDA 1H6AA 2TMGA 4LSWA 4ALMA 4G65A 1QV7A 5B4TA 2ZATA 3O03A 1ARZA 2DTDA 2V7PA 1U28A 3H5AA 2B83A 1XELA 1DRUA 1H0KA 1UXGA 2GD1O 3RKRA 5DCUA 1DC5A 2EGGA 2JL1A 4MJLA 2C20A 2YHUA 1JQBA 5TGDA 2WJPA 4DBVO 3NDRA 3UGKA 5TJHA 3OA2A 2Y1OA 4D41A 2A9FA 1QV6A 2ET6A 3BTOA 5A06A 1PIWA 4NBTA 4M1QA 3ITKA 4J7UA 1SCUA 1ZIDA 2X0IA 1A71A 4PVCA 2X8LA 3FR8A 1OBFO 1R4MB 3DEYX 5GY7A 1XG5A 4CM9D 2EW8A 1YRLA 4BO3A 1EZ4A 1GZ4A 1HDZA 4TKLA 3PQFA 4P4NA 5T8KA 4CUKA 1B8UA 2VHVA 3CZMA 4YR9A 1I24A 4W4TA 1Y1PA 3WGQA 2AXQA 4OKNA 1A72A 1E7MA 1F8FA 3ZI0A 3E03A 2P4QA 2AA3A 1QKIA 1Y5RA 4J9UE 4M87A 3Q2IA 4Z9FA 4PLGA 1ZK3A 1ML3A 2VRBA 4E5MA 1LU9A 1LQUA 4FDAA 5CEJA 5JCJD 3WGZA 1ZK4A 4BNTA 2HUNA 2DLDA 1H2HA 4EDFA 4WNCA 1ISMA 1PS0A 1BVRA 1Q7CA 1SC6A 2DVMA 3SC6A 4TVBA 1PQUA 4IDDA 2X1HA 1T2CA 2X9VA 3GMSA 5G0UA 1BMDA 3H9QA 3MTJA 2HQ1A 4W82A 4WJZA 2NWQA 2B4RO 3IJRA 5DULA 3OH8A 3CTMA 3U9LA 4NJOA 1HT0A 2WD8A 1ADCA 4PG5A 3VPXA 3Q11A 1I32A 5MGBA 3HFSA 2W98A 5U4QA 1DAOA 1QYDA 3CINA 1YB1A 3AOGA 3WSWA 3WQSB 5JDCC 3OQBA 4BNXA 4R1UA 1EUZA 4DIFA 3INRA 3H5RA 4FCCA 1LBEA 4TSKA 1U7HA 1CDOA 2WEKA 5TJ9A 1IOLA 3QP9A 2XXBA 4A10A 2AEMA 3ZNPA 1YO6A 4A5OA 3OIDA 3PLRA 3O8QB 4E5KA 2J3IA 3JD0A 5DOZA 3LC1O 5IXYA 5DZSA 3B6ZA 4KTTE 4GH5A 2YV2A 5JDIA 3WYBA 2FMUA 3C1AA 2ZKLA 2F00A 3FCOA 1GCOA 2Y66A 4GKBA 4INAA 3FWZA 2O3QA 4F45A 1ZCJA 4DTIA 3T4XA 5CPFA 5A9RA 3EGOA 4ALNA 2P68A 3DAGA 2V6GA 1GEEA 4WGGA 2A94A 4B4OA 3ADPA 4RO0A 3W1VA 3WOHA 5A3JA 3ICCA 3RU9A 1NFFA 5LDGA 1WAMA 1GQYA 1L1FA 5LC1A 3V2GA 3VTFA 4XR4A 5FWNA 4OXNA 1JAYA 1ZSYA 4YBZA 2Y0CA 5TIIA 1SB9A 2GN6A 2NVUA 1VKOA 1KC1A 4U6QA 4N5NA 4YAKA 4RPJA 1Z6ZA 1BVUA 3GG2A 3H3JA 3FPCA 1PJ4A 5DOVA 2W2KB 4XQCA 4CQMD 3GZNB 5C7OO 2IZ1A 2VHXA 1UAGA 1ONPA 1NQTA 4IY1A 1GR0A 3U4CA 4YT5A 5DBGA 3NYWA 1I3NA 2BKAA 3WBBA 6LDHA 1YQGA 4DIOA 4FGSA 1EE9A 4IZHA 1RPNA 3DXFA 3ULKA 1PL7A 4D0SA 1A9ZA 4MP3A 4UVIA 3GNQA 1M76A 2Y1GA 2E49A 3KYBA 2ZIZA 2FSSA 1E7WA 5KVSA 4NU6A 5G0VA 2G5CA 1T26A 1WWKA 2HU2A 2BD0A 3QHAA 4I5GA 3OBBA 2NUAA 1LSSA 3RC2A 3F5QA 4NFYA 3ZN2A 1JWBB 3DR3A 3A4VA 2DT5A 1ZXBA 4IMRA 1E5LA 4BNZA 5GZ3A 1HF3A 1HRDA 4GGOA 1FDTA 4NJMB 4QFCA 2IEBA 4L76A 1UH5A 1LDEA 2RCYA 3R6DA 4YJGA 5COBA 2C7VA 3MOIA 4NZ9A 4J2HA 4B3HA 2OMEA 4A03A 1ZZEA 4LMPA 4JQCA 5CG1A 1ISGA 2CVOA 3HG7A 1MC5A 3W4IA 3LZ6A 1PJ3A 1B8PA 2FRDA 3AFMA 2XXJA 3BAZA 1AHHA 1ENYA 1LX6A 4XGKA 3DMTC 1DLJA 3E1KA 2WMDA 3JYQA 1BG6A 4GVXA 2IZ0A 4ZU3A 4RV9A 4NIMA 1KVSA 1NFRA 1NTOA 2B36A 3H9UA 2YDYA 4FFPA 1HXHA 4PLZA 3MCVA 1I2CA 3RI3A 3IKVA 3RUDA 1LQTA 3LK7A 4D3SA 4J49A 2CDCA 3HNPA 4Q3BA 1LLQA 3V5NA 3SEFA 5IZ4A 1IL0A 2NV6A 3IJPA 5JYEA 3F47A 2UYYA 1GADO 5TF4A 2P5UA 1IE3A 3U09A 1SEVA 3VOSA 1LXCA 1X0VA 2OP1A 1V35A 5COAA 4CM9A 3KSUA 3I9NA 4HKTA 2GLXA 2GYYA 4XIJA 1VJTA 3PP8A 3CMCO 2ZB4A 2NU8A 3GDGA 5BR7A 2O48X 4B79A 3PHIA 4AJ4A 2C2YA 5IZCC 2CVQA 5JNLA 3RVDA 1U1IA 1D3AA 2H1SA 4CM3A 1QRRA 3WX0A 1JAXA 4IJKA 1PEDA 2JD0A 3GVCA 5EINA 4D0RA 1P0FA 4BGIA 7MDHA 2R00C 2HSDA 3OJFA 4G81A 4R5HA 1K5HA 4IDFA 3GDFA 3IL2A 1ZJYA 1JLLA 3QWHA 4MVJE 2PWZA 4HFJA 3AU9A 3ZWNA 1NXQA 1PGNA 2D5CA 2POQX 4Y8VA 3KYCA 1E3JA 1TT5B 5HA5A 1XYGA 2X58A 1DFGA 2HMTA 1K3TA 3W8FA 1A5ZA 4KOAA 3OEYA 4L73A 1A4UA 4JP3A 2RAFA 4J2OA 3TNLA 4LCJA 2Q2VA 3PTZA 5I8WA 4OIMA 4JROA 1VRWA 1TT7A 3ANMA 1KEWA 3CSDA 3DOCA 3KUXA 3Q0EA 5T5QA 3ROKA 3PI7A 1E7RA 3DO5A 2Z1NA 4JNKA 4MPDA 3RFTA 1H6BA 1BDBA 1LA2A 4WE3A 1EVJA 3DFZA 3ZWPA 4CMEA 5CDSA 4BO8A 3OA0A 3LC2O 3SBOA 3ONDA 1CQJA 4HX5A 1PJLA 1XLTA 4EITA 2DM6A 3AK4A 3S1LA 1GQQA 4Y6PA 1EQUA 3TL3A 4FC6A 2EG9A 1VLLA 3QWFA 2DU8A 1JKFA 4BO0A 5I9MA 3OM9A 5DCWA 1YB5A 4QFDA 4JIGA 4XIYA 5DBFA 1VJ1A 3TQHA 3L0DA 1XA0A 1E77A 4E5PA 3OJOA 4RF5A 3TF5A 5BSHA 2GN4A 4YB8A 1ZFNA 4I5DA 3TOXA 3HZZA 3ZWWA 4B8ZA 1PWXA 3L9WA 3CXRA 4ALKA 3QLJA 3TPCA 4WOJA 2QYTA 3L6EA 1IHXA 1QMGA 4IGFA 3UN1A 1F0YA 4QT0A 4UVHA 4FB5A 3BXXA 1I36A 2CY0A 2JCYA 5JE8A 5ICSA 2RHCA 3JD1A 3Q9NA 3K5PA 1ZEMA 5G2OA 2QRKA 2X22A 4OAQA 8LDHA 5AQ1A 4NBRA 2PD6A 1HSOA 3GVHA 3AU8A 4EUHA 2BFPA 2G17A 2D8AA 1U4OA 2PKQO 1HDYA 2X9NA 4K6CA 2O3TA 4TRNA 5KVVA 4DXHA 1NYTA 1HTBA 2GN8A 1EVIA 1HYHA 1VL8A 4NI5A 3WNVA 4M8SA 5IAAA 3S2IA 2YJZA 3C24A 4A7PA 2DBQA 1X14A 1NP3A 3NDIA 3VZSA 1GUFA 3U0BA 1F06A 1NQOA 1WZIA 5L4NA 3RD5A 2CFCA 4RF2A 4XB1A 3U62A 2Q2WA 3GN1A 5TS3A 1LRJA 2H63A 2HK7A 1WPQA 1WDKA 2EP5A 2JKVA 3HSKA 3VZQA 3PQDA 1DPGA 2I5PO 1C1DB 3W4KA 1KVRA 4R68A 1E6WA 1SOVA 1HE4A 3BMOB 2NU7A 5IXSA 5AVOA 4PLFA 2WWRA 4BB5A 2Y1DA 1YWGO 3FNEA 4R01A 5HTOA 1FK8A 2IXBA 3HQ4O 3V1TC 2BI7A 2J5KA 3AOEA 3PIDA 4PN3A 4E30A 4C7KA 4FN4A 4IDBA 1DLIA 3SC4A 1VM6A 4DUPA 3UOGA 3WR5A 4AJJA 3LF2A 3G3EA 1RM4A 1U8XX 3EMKA 3A1NA 4ALIA 3KB6A 4Y98A 2D1YA 1VC2A 3RUEA 1XKQA 3JQBA 4WCDA 1HKUA 2VWPA 2HAEA 1B8VA 5BT9A 5K0ZA 4UUPA 1TI7A 3JQGB 4J9VA 4XDZA 5B4UA 1CETA 3ENNA 4GLOA 4XR9A 1K0UA 3FTPA 2EV9A 1ONOA 2EJWA 1QYCA 1UDCA 2VWQA 2EIHA 4KMSA 1EDZA 5G4KB 4BO6A 3FRJA 2OZPA 4J1QA 2VT3A 2WD7B 1NQAO 5ER6A 3DBHA 2D4AA 3H2SA 4II2A 1VSVA 4ZJUA 4TRRA 2E37A 1VPDA 2GZ1A 1P74A 1SZJG 4A0SA 3EVTA 4CV1A 1XIVA 5U1PA 5T6BA 3QVOA 3JQEA 1VI2A 2BMAA 3I9KA 2H9IA 4KQXA 3ZW9A 1I3LA 3SLKA 3NRCA 1JVSA 1UUFA 3GF4A 1T25A 4KZPA 3MJTA 4CM5A 3LQFA 4Y9DA 4U0JA 1MX3A 3UFXA 2CVZA 2GNAA 3AY7A 4YJFA 4R1SA 1R66A 2B69A 4ND2A 3L4BA 1ZNQO 2OBYA 1YOVB 2NLOA 1V3VA 4XDYA 4PLTA 4A27A 1UXJA 3D4OA 1BW9A 1PL8A 2GZ2A 3AM5A 4OGWA 4RDHA 5DCYA 1Z73A 5JAZA 3IKTA 5FFFA 2C54A 3GZ4A 2PGLA 2ZCUA 3ROQA 1DDOA 3GHYA 3DWFA 3NGXA 3PJEA 4KUHA 1NBOA 3WWZA 3I9LA 4ZD6A 2OXIA 4O5OA 4RDIA 5I7SA 2HKIA 3TZHA 3D4NA 5IFLA 3MJ4A 4YJHA 1B15A 3R3JA 1P3DA 1ZVMA 3PQEA 5TQVA 3TSCA 1P1IA 2EXXA 2X4GA 4BS9A 5KWEA 1CIVA 3GPDG 5DN9A 1Q1NA 2IODA 3AWDA 1WMAA 1W0CA 2C2XA 4NH4A 2GCGA 2PZLA 1AUPA 4QUKA 1HEUA 3Q1LA 1Q7GA 5K6AA 3RKUA 4CL8A 2I67A 3BHIA 1ISJA 3RBZA 3JYOA 5A05A 4ILKA 4R1TA 3EW7A 4EGFA 2VRCD 3R1IA 3DBRA 3BMQB 3TZQA 1MFZA 2Q4BA 1QYWA 2FZEA 3S2GA 4E5NA 4MO2A 3W8DA 2O3UA 2JFFA 3BMCA 3RCBA 2GERA 4A26A 4AVYA 1H5QA 1P1KA 2FN7A 3BMNA 4NNJA 5FEUA 2AQKA 3MZ0A 4OYRA 4GX0A 4R5MA 1XQ6A 3PK0A 4IJUA 1ZSVA 4CMIB 4CM6A 2AQIA 1DHTA 4R54A 2X0JA 1MFPA 4PLWA 1CYDA 2CF6A 3GA0A 1XEAA 1UP4A 1ZH8A 2NSDA 3HDHA 3RBVA 1PJ2A 3WWYA 3EUWA 4K6FA 2J3KA 5LDHA 1QR6A 3JTMA 1NPTO 4TMFA 2I6TA 1ULSA 4JGBA 3WLEA 1LLCA 2C59A 1R0KA 2IYOA 3Q9UA 1KVTA 4CMEC 3PZBA 4BNHA 4DQXA 4BNKA 4CMAA 4CMJA 4IZIA 4CM7A 1ZJZA 5A04A 2W8ZA 3NT4A 2I65A 4XEHA 1DO8A 4RF3A 4R4JA 1DOHA 4U0KA 4PVDA 4BNIA 1B7GO 1XR3A 2VNAA 1J5PA 2AG5A 1W6UA 4J4HA 3ZWBA 3FNGA 3P7MA 2TMDA 3JD3A 4CLRB 4B4WA 1ID1A 4J0FA 3WICA 4B7CA 2WYUA 2O3JA 2ZK7A 4OL9A 4KWIA 1Y9EA 4PG6A 3A9WA 3H4VA 2AEFA 1O94A 2FP4A 1GFSA 5T57A 2VWGA 4LRSB 5B4VA 5DF1A 2NTVA 2E48A 4MVJD 2DFVA 3UCFA 5A5EA 1ZXLA 1P1FA 1SPXA 4XB2A 1WDMA 1Y7TA 1ZKMA 5H83A 2E6UX 3P2YA 1PJTA 3K2BA 4I08A 3E9NA 4GX2A 3UKOA 2QYSA 1DIRA 3G1TA 1DIAA 5F5NA 3X2FA 3FTNA 2X86A 3KOUA 3H7AA 3ZWMA 4YRBA 4ZHSA 1X7GA 1E1NA 5A9TA 1NPDA 5THQA 3E8XA 4BNGA 2HJRA 3DZGA 3I6QA 1ULUA 3H9EO 3NT5A 4UAGA 4XJTA 3KSDO 4D79A 5F21A 3DBVO 4FJ0A 4DC1A 3RSHA 5C37A 4HV4A 4PGFA 2D0IA 2V6MA 2G76A 3OFSA 3VPGA 4ZQHA 1MGOA 1DIGA 4PLHA 4WLOA 1R0LA 3GGOA 1HDCA 5F5LA 3ZGYA 1UDAA 4CL3A 3UXYA 4QO7A 1ZSNA 3A06A 4TZTA 1XGKA 1BXGA 1EUDA 4YT2A 1E5QA 3ZHZA 3E48A 3D1LA 1ENPA 4L9RA 2DBVO 4UVDA 4W7IA 5HS6A 3VH2A 5AXBA 4AJNA 1CWUA 4D42A 3LLVA 2BGLA 2PZMA 4N5MA 5KKCA 2UUPA 3JCZA 3Q2KA 3CPSA 2GO1A 4GKVA 1E3WA 3OECA 4H16A 4E13A 5A4DA 5IDXA 6ADHA 2EEZA 5EIOA 1PJBA 4CLOB 3PRJA 3ZU5A 2FR1A 3JSAA 3ZV3A 3TWOA 2D5AA 3CEAA 3WB9A 3B1JA 1PJQA 1H93A 1XWFA 5ER9A 2PR2A 4RLSA 3JQ7A 2B5WA 9LDBA 3F4LA 5KNLA 1SMKA 3FSRA 5CDUA 3WGTA 5IDQA 3DHYA 3LT2A 4R69A 1U2GA 1IYZA 2EHDA 4UEOA 1XDWA 5F1OA 2DBZA 4GBJA 2OL4A 1W8DA 3NDJA 4CM8B 3PPIA 3AI3A 4Z6KA 2Q46A 2FOIA 2YFQA 3GC6A 3TFQA 3DBLB 5EL0A 2O3RA 3ZU2A 5AOVA 4D46A 3GVXA 5JO9A 3WGGA 1J49A 4BHTA 5CEEA 3D5TA 3I83A 3IUPA 4NQZA 2PA3A 3E5RA 2NQTA 1MA0A 1U3WA 5A3VA 1QORA 4ZRNA 3E18A 4PZDA 2O2SA 1KEUA 2H6EA 3D3EA 3WGHA 5CAEA 2FHSA 2VUTA 3C7CB 1TA4A 4MVJG 2YYYA 5JO0A 2SCUA 4PLCA 2QRJA 2PNFA 1DFIA 1FDUA 4YVFA 4PG4A 5C5IA 2NNLD 3PYXA 3E82A 2B4TO 1BDMA 2CDAA 3KYDB 1EVYA 2YDXA 3OIFA 4IIUA 4PFJA 3CMMA 1R16A 2VTDA 3VH4A 4WCFC 2JAHA 1U7TA 4QQRA 5KTKA 2WE8A 1R37A 4NBUA 3E5MA 4URFA 4EJ0A 2I99A 1PJSA 3L9XA 1OFGA 2VUSA 4KDEA 4LCEA 4G5HA 4MVJP 4CMKA 4BGVA 1UZMA 3ETDA 3P5SA 1NHGA 2GGSA 3F1LA 3GK3A 4B3JA 3DHNA 4XD2A 1T24A 3ZDFA 5CFZA 1M2WA 2OFPA 3LYLA 1HSZA 4DVJA 3JD4A 3NTRA 1PWZA 2HRZA 4P8RA 4O1MA 5DDIP 3VAZA 5KVCA 3JYNA 3HE3A
chains in the Genus database with same CATH superfamily
4IDHA 4MVJM 1U9ZA 4KZKA 3NM5A 2P4HX 1WUIS 2ZR9A 4Q1BA 2IPMA 4JKYA 2OBXA 3MW8A 3LDGA 5HDBB 3EASA 2AQ8A 2XQFA 1IRXA 3BB3A 4KQHA 3ZWYA 3RIGA 1NKTA 4RZHA 4B4KA 1U4SA 1K8QA 1SCJA 3FHCB 2Q8PA 3IVCA 5FR1A 1Z75A 2QGZA 4UM9D 2W6MA 4KXYA 2QZZA 1R4NB 1QPZA 2QJTA 4FMCF 1L9XA 1WZ2A 2HJSA 1GKYA 1T9AA 3DVRX 3TSAA 2ZDQA 4M0LA 4UBJA 5HDQA 3BWYA 2O1EA 1VB5A 4TTIA 1OOEA 2GK6A 5CU7A 2JS7A 1ZHOA 5B64A 3OT4A 5LQCA 2JIRA 1BE8A 1KO8A 1LY1A 1PLKA 4M1EA 3L4SO 4WLUA 1JHMA 3QTTA 3HXQA 2VHTA 1KERA 3Q7IA 4OEHA 1GL3A 1R4MA 2O7RA 1U6JA 4NE9A 5CM2Z 4ZJPA 1IBRA 1J0XO 4TWJA 3RYHB 3V48A 5FOSA 2B8TA 1W5BA 1YMQA 3EHEA 4BO1A 4LNAA 2OBBA 1UFRA 1YKFA 1YVRA 1YAHA 4BKOA 4EB8A 4JC0A 1EFKA 2FSFA 2H1WA 5LQRA 1V3TA 1L7NA 4Z49A 3RUIA 3VC7A 4UEQA 1M6HA 2IYFA 4RLHA 1QV9A 2IY9A 1WW2A 2V9PA 4DMMA 3WMEA 1QG6A 5AW1A 1DGQA 1G8GA 3K8ZA 1I3MA 5DISB 1GEGA 5K2OA 1NR1A 4R1NA 3F9IA 3UHFA 4C4XA 1C5KA 4M8KA 1UC4B 1CF9A 5KC9A 2ZAIA 4MVJA 2LDBA 3HV2A 4UULA 4CF3A 4UREA 3KPUA 2QMHA 2V8BA 3DZKA 3ST7A 4DV4B 4Z53A 2BUAA 1V4VA 4ZCPA 4X54A 1G3UA 2AOTA 3V2HA 5K0JA 4L8YA 5KJFA 1CVLA 4LISA 1C9YA 4OXKA 1I6KA 1ZC4A 3P2JA 3V4LA 2V6FA 2HLNA 1P6UA 3BXHA 5I4KA 4ZTUB 1E98A 4XA8A 5LU9A 1JWLA 4IDPA 3GUUA 3KALA 1FSFA 1MX1A 1B16A 3TCXB 4AICA 1D03A 1YL7A 2QX6A 4XGNA 3CCCA 1B0UA 1TLTA 3OKFA 4Y1GA 3O4VA 4G5RA 5CVDA 3T7AA 1YQQA 1YIAA 2F48A 3D3WB 1Y9DA 4X44A 4OXYA 1NMZA 2FR8C 4Y9RA 1HDIA 1P2GA 1GPMA 1WB6A 3F97A 1J0AA 2HLDD 4L4ZA 4OP2A 4U9HS 4BVGA 3QOYA 5FI1B 2CNBA 1BHO1 1S02A 3FGPA 4RZ2A 4UBMA 1L7RA 2VAXA 1DXHA 2VQ6A 3AGPA 4L0QA 3TR0A 2PH5A 3UV7A 2BH2A 1VRCA 2ESRA 3WK8A 4JGGA 4EUSA 1F0NA 1PDWA 3B1KA 4BNWA 5JW6A 3VFDA 3AILA 3Q0IA 3PQ8A 1ORTA 1PEYA 1XDUA 2A8YA 3G2HA 4DZRA 3KQHA 2QU7A 4XM0A 1TNDA 3FZQA 4R2LA 1QK4A 2WJWA 4JX9A 4C4YA 2V54A 3ZGOA 2X40A 2BIFA 5KJ6A 1YR9A 5SY9A 1HY3A 4X7PA 1WKBA 4XH9B 3QA9A 4YP7A 4ABYA 2ZIVB 4J29A 1GPH1 1Y6JA 4BEWA 1IWPB 4GSLA 1G9TA 3ZKWB 4YYZA 2XF2A 5TB5A 1F8UA 3GEBA 1X7ZB 1HM5A 3IIKA 3B20A 1QGDA 4LRQA 4Z8XA 3WP0A 4X65B 2QYHA 1XX6A 1ZH2A 1U80A 3AR8A 1T2VA 2FSUA 5LA6F 4DCTA 1NLUA 4GRIA 2H9AA 1N4DA 4DCMA 2GK4A 3HHEA 1EE2A 3FROA 4Q9HA 4M7RA 3VVLA 2BR5A 4D8VA 3SYRA 4PFSA 2X13A 1F1BA 5EMHA 5KVAA 4FIDA 3GLTA 4KR6A 5BWLA 4BNYA 3HEAA 1CUXA 1RRFA 2CWDA 2PTGA 3QYAA 4W5JA 3RRXA 1ZVJA 4BP1A 1M5RA 3LFUA 4KC0A 1NVEA 3UJBA 4YXFA 2NMVA 1Z7WA 4OXQA 4HS9A 4RQAA 1U90A 2IEAA 4ZZ2A 3HTXA 3H8SA 4IO1A 2GMWA 2HBRA 2JLYA 4JVNA 3RFCA 1KY4A 3JWPA 3ZI7A 4C0XA 2P2SA 4AKTA 3BEOA 3Q8WA 4NYIR 1EP3B 2JGRA 3REFA 3FF4A 2YHIB 4B3GA 2WZCA 4G36A 4LNUB 1DSSG 1D2NA 5I9LA 2QUKA 3FCCA 1NW4A 4R6WA 2JGMA 1JQ5A 4PYMA 3LGAA 4U5XA 4L16A 1KDRA 2ZJZA 2QMZA 2FSHA 3TAUA 1DC3A 3TTSA 4BFLA 1QBGA 5ES3A 1RYYA 3RFVA 1XZEA 3AHFA 1Y4ZA 3N2LA 2JKZA 3HJBA 3R41A 2IOFK 2AKAB 1NLMA 2XDQB 4XX1A 2IBSA 4CMHA 5AVQA 3NH6A 4IQ0A 5ALJA 1TF2A 3D5QA 3SX0A 5LJLA 4MS4B 3PJRA 3OFNA 4PHFA 4BX8A 1S6YA 3SD7A 2V98A 1OXUA 4JC5A 3Q3CA 4IIYA 1DIBA 2PUBA 2PLNA 3FOFC 3TEMA 2X3UA 1JJVA 2YV3A 4KIFA 4YV7A 1CE8B 4B3IA 3LQ4A 1WCWA 3QIVA 4DLKA 4X1OA 3W8EA 4V0RA 5JNSA 4GPZA 4FWBA 1LW6E 2DECA 3K9GA 3QFFA 5FD8A 3ZDQA 1T2NA 2HDNB 2JD1A 4JDUA 4LTNA 3VTAA 4LF4B 4U2DA 2BBTA 2IA5A 2PL1A 4DV3B 2OCBA 4XIIA 2QP9X 3G0DA 1PZNA 4IIDA 4OUKX 1GPAA 2YWEA 4IFEA 2V58A 2BFBB 2ZREA 2W6JD 1KAMA 2AFHE 4DDVA 3H4TA 3PXEA 3USES 3JASA 4J0DA 2DETA 2ROQA 3PQ7A 2Z6VA 4HTAA 4XB6B 5IAJA 2CFSA 2FCRA 4V0NA 2D3TA 2B2CA 2H9YA 2FX5A 3FDXA 1PNTA 1T9KA 3K30A 4PZZA 3AM4A 3H9JA 4MWTA 5D51S 3UMRA 1FXSA 5FQNA 3PC3A 4GWLA 3VDQA 3D8HA 2COUA 2V96A 3GBPA 1GSOA 4WK2B 2ID4A 1CJUC 3QMWA 3I9JA 1RAHA 3P0EA 4RENA 3RVLA 4E2ZA 2ODEA 2Z4TA 5EN4A 2YHSA 1EPUA 1OWOA 2EP7A 3ZE0B 2IYNA 3K9FC 4MGZR 4Y1FA 3KWMA 4ZYZA 3PHGA 2XDAA 3VR3D 5HS4A 1NMEA 2EVWX 3IYLW 1B1AA 4IJWA 1FBTA 3BWEA 1RQ2A 4WZAA 3CUSA 3K92A 4H31A 4N3GA 3IEXA 4HWOA 4NBVA 5IJ0A 3J7AC 3JS5A 1ODFA 1E60A 1C80A 2OD2A 2R8OA 3H6HA 1U3VA 3VJKA 1P9NA 1T35A 4GXTA 5TSDA 2H08A 3ZHYA 2D2IA 3K6JA 1JYFA 4YMVA 2FN3A 4P33A 1YZFA 3PUXA 3KWJA 1E4VA 4FINA 3ZE6A 1KTIA 4MI9A 3U3KA 3ZQKA 4CPDA 5L95A 4U7JA 4LNHA 4MICA 1QGOA 5T4FA 1BWSA 3A7DA 4RU1A 2AJ8A 3Q3EA 4KK3A 5TF0A 4HWKA 5C4IA 1KY5A 4X6YA 4CQMA 5JSHA 2WNHA 1A4XA 1XU9A 4ARZA 1Z7EA 3F6RA 4RK0A 2BWJA 2VJQA 4B6OA 3SMQA 5DX0A 4PZEA 4MRNA 5GZ6A 1SNYA 2AD5A 4FLEA 1DT5A 3PDIA 3NBUA 5ED4A 5IDVA 4RGBA 2VEDA 1YV9A 4MQ6A 4BQQA 1AN0A 1BS2A 1RWQA 4TWRA 1H3NA 1OLXA 3QLTA 4KMMA 3RSFA 5ESXA 1XALA 4Q4AB 4OOFA 1QRTA 1AO0A 2E4VA 2JLAA 1EXNA 5AVSA 2XNSA 4CN8A 3SDBA 1PS9A 2XMSA 2W6ID 4GG1A 3VDRA 1HE5A 1DL5A 4ABTA 1A95A 2FJ0A 3NKVA 4GQBA 5KQPA 1FVFA 1C3OB 1PRYA 4IMPA 1GD1O 2DY1A 2PMFA 2H57A 1XVLA 3OE5A 2Q4RA 1E0JA 1G59A 1Z36A 3PDHA 1F2TB 5K0CA 2R5WA 4ZCIA 1GVNB 3AL2A 4QNMA 1A7UA 4O1HA 2AI3A 2IDZA 2XLCA 2DX7A 2VDLB 1U7DA 3RIYA 2WT4A 4YV2A 3I6IA 3ZU3A 1R50A 2FLWA 1H8HA 3N6XA 4QTUB 3H1PA 3W90A 1FVHA 4NOJA 3SF0A 4TV9A 4UTNA 2I6QA 7MHTA 3B53X 1ETUA 1P9LA 2GPBA 5DM2A 1PT8A 4F06A 3C8HA 5BQFA 3DD1A 4ITUA 3MSCA 3ROGA 1YCDA 4GGPA 4UDXX 5AMXA 1Y98A 3PFKA 5JZSA 2VZ0A 3HGMA 4HBGA 2BJHA 1XZDA 3Q3HA 2I6UA 2WA1A 3URKA 4JY7A 2WJHA 5F98A 1QP8A 3ICOA 3LZDA 4EEZA 4RTRA 4OQDA 3EPRA 3DWIA 5ENVA 5JY6A 1E0DA 4K26A 1RYEA 4MEAA 3NU1A 3UCXA 4EI7A 1H8EA 1XVIA 3QW2A 1TPZA 4M1OA 1T0BA 1JXMA 1KMHB 3D0OA 4O29A 4PX9A 3DZBA 4XQ9A 4M4SA 3LF1A 3TLZA 1G6KA 3HB5X 3I53A 1VBKA 1QGED 2J9FB 3EZNA 4LXHA 3KAPA 3NBXX 1MDBA 3WFJA 1V1JA 4C4PA 4CZ2A 4P22A 4DMGA 1TF5A 1U1GA 2BLNA 1IH8A 1K6JA 3BGIA 3SCZA 2I9KA 3E1SA 2ZYWX 2P6OA 2F9MA 1Z3CA 1K6EA 3R5FA 2GSDA 5A9SB 1KMCA 5KO2A 4ZVVA 3IAUA 1CUGA 3NAGA 1JG1A 2EQBA 1QGYA 5BW4A 3WI7A 1C3LA 1BS9A 3HZOA 2FPGA 4FFLA 3O1JC 4JN6B 4POAA 1KORA 4C7MA 4EA7A 1T5BA 3ER6A 3EGCA 3OIGA 3UPDA 1UMDA 3OZVA 4G0YA 3ZE2B 2ZRKA 4QEDA 3BBLA 3LY8A 1P72A 3AF0A 1V5EA 4H7FA 4J4BA 4ALJA 1CP2A 5P21A 2XMBA 4DN6A 2NT3A 4U7TB 3M81A 4KU4A 1Z6GA 1Z74A 3A3PA 3AM3A 1M6NA 3O7WA 4RVNA 3V2IA 1AKRA 1C0IA 1Q0ZA 2OQRA 3MQ2A 1RXWA 2C82A 3R9XB 3W9BA 3RC8A 3AERA 3T34A 3LD9A 3U3OA 2E5LB 2I4LA 3ILXA 3ONEA 3ZJYA 1M75A 2VF8A 1ECFA 3WWEA 3UANA 1FL9A 1ADBA 2ZAOA 2NTJA 1EWRA 3A27A 3E23A 1RHRA 4TLBA 1Y8RB 2WSBA 3MAAC 1GNLA 1M2VB 1G42A 1GTVA 4Z4FA 4EFDA 2VTVA 1PBNA 2ORVA 3SM9A 1GO2A 1L7DA 2FW9A 3UMBA 1QPBA 4PXAA 1QFZA 3I42A 4O63O 5DW0A 2ZWVA 1IXSB 2YN0A 4B3XA 1M2OB 1UDXA 2HCTA 4FTWA 1Y8QB 1H6CA 1N1GA 3GELA 3PJDA 1QXSA 2AW5A 2V0NA 4EJSA 4K40A 3RT9A 2H5EA 2NIPA 2WTAA 2HNKA 3BE5A 3N2ZB 1QVVA 2P69A 5GAJA 3BCSA 4PBRA 4NDAA 1KP2A 3G85A 3AI7A 1JSXA 4RK1A 1W46A 4CDMA 4W5NA 4MYUA 4K8RB 5BVHA 4RTQA 2VSXA 2WQ7A 2P3QA 1C7FA 1EFRD 2A0KA 1FYWA 2NM0A 2P2YA 1ICEA 3AJEA 4BMYA 1ESDA 2WV7A 5M7EA 1JR2A 1E9BA 1KI6B 2AUMA 3CKYA 4KFUA 4M60A 1MQAA 4OJYA 1H6DA 2ZIGA 2H4ZA 5A2QA 2CUKA 2RK4A 3MWKA 1KXZA 4Q34A 5EYPA 3FHOA 1BXRA 4HXEB 4ZARA 4FFBA 2FQWA 2PJRA 4HZUA 1I0ZA 3COPA 3SX2A 3DP7A 1K8RA 4B40A 5BV1A 4UHJA 1H2ZA 4ZCQA 2YKGA 3OCJA 4GM0A 4QYIA 5HF9A 3ZX5A 2PKWA 3CF0A 4D97A 1GKKA 1JPUA 2BR4A 2WSMA 3R7DA 2QLNA 3JQGA 3RYTC 4WJLA 1NJ5A 5IG2A 1N2HA 1OGIA 5IF9A 2MT9A 2FZ5A 3OP4A 1CV2A 1JDPA 1LUAA 2XVZA 5I5GA 4DQUA 4P4SB 4Y9SA 1GPDG 2PUGA 5DGHA 1Q0QA 1TM7E 4X8LA 4FMCB 3ZVKA 1XZPA 2HX1A 1ZNXA 3BBPA 2IUYA 5KYGA 2CL7X 1VGRA 2ZJ3A 2RHJA 1NR5A 1S4MA 4DG9A 1BOOA 2BH9A 3KLOA 1Z8NA 1WRBA 2YR0A 4ZZ0A 2QUIA 1GZUA 3ELWA 3NT2A 4MRRA 5THKA 3T61A 2HDHA 6ABPA 3DE2X 2YWFA 2CXPA 1XLTC 2O9JA 3F6YA 1P19A 2P91A 2WU4A 4LQDA 1WDWB 2VR1A 1RC1A 3MRTA 4MW0A 1VG0B 4KN9S 3KBOA 4YPOA 5B7GA 4K9KA 4B7UA 1D1TA 2JLBA 5LLTA 3MEQA 3AESB 5DLEA 4QBFA 4TKVA 1WMDA 2CLMB 3Q7QA 5CDFA 4YP9A 2BDTA 4DWWA 1YR6A 1DADA 2FWJA 3ZIUA 4BGDA 1NJ6A 5FULA 1XWIA 4O4IF 5F23A 4G0ZA 3INGA 2QRPA 2VNKA 9GPBA 2G4CA 1KAOA 4ZQGA 1A9TA 2P5TB 2RHDA 3NW9A 1OE0A 2O8BA 1T9GS 3KEQA 2XOKD 3WMGA 2G4LA 3UTCA 3CNOA 1KK1A 3IAHA 4GMKA 4CIAA 2PSDA 1YHNA 5D84A 5IF3A 5CFRA 4ZWNA 3Q9SA 1VB3A 2GBPA 2O5RA 4FQ8A 4CEJB 1EBBA 2IXFA 4WXMA 3S70A 2FW8A 1WCIB 1TKRA 4KN8A 1O8BA 3CZ5A 1PK9A 2HQRA 1Z4MA 3P9ZA 4L6IA 5BSKA 3PYMA 5LMZA 3LVBA 3DVLA 2FHPA 1EIWA 4KE7A 1U7PA 5AH0A 5JBQA 3RU3A 1Q3TA 1U0TA 3TVYA 2JIOA 2P4EA 1W30A 2IZ5A 2DE0X 4XIGS 4PINA 5FLYA 4HVTA 1F8GA 3FDFA 2PIDA 2ZWOA 1O96A 3H99A 1KJIA 1JSRA 2PKQP 2K5UA 3C8ZA 3KAKA 1YKGA 4QREA 1JLHA 2F59A 3I32A 2EX0A 1N8SA 1K6MA 1K8ZB 5JFOA 3KT0A 3FCUB 2CV1A 2XMPA 2LTAA 4CM1A 3MSXA 3NEYA 4Q9KA 1YVUA 1IHUA 4Q9AA 1HZZA 1EBFA 1I4DD 1YZGA 2PX2A 2XE4A 1B3RA 1J21A 1BU5A 2OY0A 1U3DA 1XDDA 2Y2VA 4EEXA 2R3SA 1AKTA 4UVGA 5AKJA 3LUAA 4H1TA 4N5HX 4HGPA 3RSQA 3H19A 3LT0A 4JODA 1U8UA 3F5FA 4MV9A 2NAPA 1G4UR 1QM5A 5I7RA 1A2BA 1GRNA 3SYTA 2CMDA 2DGDA 1LDNA 1YDWA 2EOAA 1IDOA 1KAEA 3NHMA 3IVGA 3RSSA 3MGCA 5FQOA 1EUQA 2NUTB 1O6GA 2WNIA 2SKDA 1FFXB 2HPVA 4XI9A 2F9LA 3RBXA 1HNXB 1N0WA 4G2TA 5JAIA 2FPUA 6REQB 1WHSB 4M0UA 1F3OA 5TQ0B 1P6QA 5AOAA 3EC2A 2H7CA 2I2CA 2AI2A 1PR9A 3AOEC 5JUWA 4PHTA 3OT1A 1YB2A 1IRIA 2VIIA 3IDSA 3GLFB 3GD5A 1GGJA 4BNVA 4IGEA 3GEDA 1FYVA 3NWEA 3AUAA 5LA6B 3U7IA 4F2DA 5JANA 1G38A 3IT2A 3UT5B 2K87A 2JAWA 4YJ3F 4XYBA 1WPRA 1MB3A 4ACAA 4RL6A 2PCLA 3T5GA 2RHMA 3JQBC 1NVVR 2A14A 2XKBA 4IXNA 4D9FA 5FPPA 2JAXA 2X8JB 1G66A 3UMCA 4XSGA 5J2UA 1BRTA 1Y8ZA 1TIPA 4LQ4A 1DI0A 1SOUA 1OLSB 4QECA 4UU1A 3ZLTA 4R16A 3AJDA 3D7RA 1G1MA 4Z3DA 5JXIA 1U04A 3F7MA 3KZMA 1S0UA 2X9GA 1AZSC 1NXXA 1BWRA 2VSOA 2MU1A 3GJRA 1IQPA 3NANA 4JB2A 1Z16A 5F5XA 5HFAA 4D7AA 2P8SA 3FH0A 2XGMA 3AVXA 1M67A 3WNCA 5BN3B 1CZOA 3WBFA 1HE2A 1PQYA 1UMBB 2PL9A 5HMMA 5CNIA 2NVUB 3LKBA 2B2XA 3NOOA 2X1LA 4DLUA 2O7SA 1EEHA 2JBWA 3HKBB 1QLWA 2QR2A 1NUPA 5EGSA 4BGEA 1J0EA 2HBZA 2ODNA 2TS1A 3FR7A 3KT3A 1EM8A 2A33A 3FXAA 3KZXA 4R9NA 4EY6A 3K96A 2GHQA 4ZXPA 1A4IA 3DE4X 1FUEA 2AEJA 3OJWA 2YW9A 2PN1A 3IEIA 2ZYAA 4YJDA 1QE3A 3NCHA 5DB4A 5FO0A 4W8HA 2BCGY 2X8AA 3BJRA 4OQNA 3CBGA 3DMYA 4F04A 2JHGA 2Q5HA 4Q05A 2PX4A 4IEIA 3VX3A 1UWCA 3EXHA 3MOGA 5DSXA 2DWQA 3I9V6 4YLEA 2VJYA 2AIRA 3LT5A 3M6IA 3VVBA 4K81B 5BMVA 1V96A 3FLMA 3K5WA 3UGQA 3UOAB 1FP4A 3QY9A 5ALZA 5G3ZA 4X91A 1QP4A 2NUAB 5J2UF 3ACDA 4UBOA 1QU2A 1W34A 2VRCA 5J58A 1SWWA 4G9BA 4Y2UA 3IELA 2QUAA 2OHJA 2ZB3A 3ELYA 3Q10A 1P33A 1DRVA 6Q21A 2OC4A 2SNIE 3L79A 5EG5A 5BQPA 1XK6A 3C4JA 1HQCA 3WHLA 1KIFA 3LTNC 3CLTC 4NYIQ 2JD2A 1KMIY 2RI1A 4DARA 4YMLA 2XGJA 3ZD6A 2XRYA 1L5GB 2GI4A 3JRXA 3NTQA 4G1BA 4GOJA 4DR6B 4R0VA 2DP4E 1MO2A 1XZIA 2P0AA 2XUJA 4KPGA 4TKMA 3WWPA 1RAFA 2V9ZA 5ECYA 3VHXA 3WLKX 2WF9A 5IP5A 4N4AA 2W6NA 1TQ2A 3HBFA 2YQZA 3JALA 4G24A 4FX5A 4RZXA 4OVKA 4F4DA 2B2NA 3V4SA 2Q4TA 3IP1A 3DL7A 5J3JA 3VYUB 4YEDA 1ONNA 1GCUA 2R6ZA 5BVGB 3UA3A 3ZEIA 2RGWA 3U6BA 1C50A 3NDPA 2XCIA 3OX2A 3NQ41 3IKMB 4ZV4A 3MTBA 4Q1FA 4X93A 5IS2A 1M74A 1DB3A 3EXG2 4RPHA 1OH7A 1E0AA 2VPYA 3TE7A 3ZWVA 1BXKA 1YRHA 1ZUIA 4W1SA 3ETLA 4NCBA 3M33A 3G5MA 4JL8A 4XUDA 1NE2A 2CNDA 1D6MA 2BTOA 2F2TA 4RHUA 3VISA 4E5SA 2GBGA 2IYLD 1TMOA 4QASA 2IHUA 3IOCA 4MQBA 4X92A 5DU2A 3LU1A 3Q7PA 4P7JA 2NXWA 4UUOA 5F51A 5FWYA 4MKRA 4QJ3A 4D45A 1R9NA 4M54A 1WLSA 3KEOA 1DU4A 1FMCA 3QMVA 3O8QA 2QN1A 3WLOA 2QW8A 2GWRA 3WB2A 3KSZO 4HSEA 5K4GA 4BMDA 1MEEA 1RJWA 2H2FA 2I3GA 2V97A 3F2VA 4UZFA 2XQVA 4B6RA 4EK9A 3PIIA 1VE5A 1P4GA 2Q9CA 3H04A 1VIYA 2Q5FA 2VPIA 2CUTA 2BM8A 1SVNA 5ANRB 1CNMA 3IP8A 2JGJA 3AIOA 3CRZA 3OY2A 1YZNA 4PAQA 5JCOA 1ZL0A 4RW0A 1RMYA 2AR0A 2ZE8A 4XPZA 4EL0A 5A4MS 4DNXA 2FJUA 2GVNA 3AP1A 5J5CA 4BAUA 5MN5A 4F46A 2PFGA 3WE7A 4JT4A 2EGHA 1A9YA 4FSHA 4YMTA 4O2BA 2MJLA 1PUIA 1NUUA 4XEUA 3V2UA 2G06A 2DUJA 3BGDA 1H22A 2IX9A 4FE4A 3N05A 2WG2A 4HDSA 2VDRB 3NS7A 4JSRA 1CQIA 3ZNNA 4LF8B 1HE3A 5T41A 4TYQA 1KYZA 3IT1A 4ZN6A 2FFRA 3G6KA 2FPXA 1ZMRA 1J9GA 5DSZA 1J70A 4MV4A 1MIOA 2J9GA 4PONA 2QRVA 1RQRA 2V7TA 1U9IA 3HN6A 3H83A 2WWYA 3RSOA 4K03A 3IBYA 4MQ5A 2AFHA 1KK2A 2OD7A 1E20A 2RGUA 5HVNA 4HDAA 4PNHA 1QQ7A 2XB9A 1LSJA 2ZITA 5DKFA 3BFJA 5H70A 2CW5A 4AJIA 3GEGA 1HDRA 2YMMA 1Z8HA 5JD6A 2C7GA 2B35A 1NF9A 1ZIXA 2GLTA 3CUUA 4UMDA 1X1QA 3ROZA 4DJEC 3TD2A 5AUNB 4PF1A 4NHOA 2CMHA 4RM3A 4Z99A 1WZEA 1OZFA 2O2JA 4E6PA 3PHLA 3ITNA 4EG0A 4QKQA 1GT91 3DE7X 3WRXA 3RF6A 1MJGM 1NXPA 2ZXFA 5G0SA 2HA7A 3AY6A 2JFZA 5CDTA 1S8AA 4YUAA 1F14A 4TKZA 4KR2A 1MC8A 1OI3A 3IPAA 3ZE9A 5IUNC 1I1NA 1PZHA 3T7EA 4R2IA 4L8GA 1PQWA 2B37A 3MAGA 4YC7A 1QH1B 3F3SA 1M0EA 2QTVB 4P4GA 5C46F 1SUFA 2K7ZA 2ZRAA 4I1YA 1VKJA 4PLVA 2O4CA 3ONFA 3GIWA 3PNBA 1KJZA 3R3ZA 4NF2A 3UXEA 4AKIA 2WAXA 1LPAB 3VR5D 3HM9A 1OV4A 1WEHA 4QRDA 3DZ8A 5ALYA 3R4CA 3IC5A 4FPXA 4NOLA 1LV8A 4Q93A 2EWMA 1E69A 2H0AA 5K3CA 1P4HA 3T7JA 3QENA 4MKIA 2FQXA 3TAXA 3TLYA 4DGSA 5ITVA 4GOLD 2A9PA 4L50A 4MVCA 4E08A 1VYUA 2ON6A 5EERA 5HIIA 5GINE 3OY7A 5CT4A 1E7SA 1V43A 1AURA 1BXZA 2UVPA 3NOQA 3PDUA 4TKUA 4BNFA 3R23A 4M1TA 4CEJA 1W5TA 1AV6A 2QUZA 5I47A 1NVBA 3CZ9A 4F9GA 1R0ZA 1USGA 1G6HA 3FAKA 5FDFA 2ORED 2VPXA 2NADA 4IXMA 1EDDA 2X5JO 3STYA 3SZOA 3NIDB 4L8VA 4HXFB 4AT1A 4BVKA 1B73A 3JQAA 1V4BA 2I22A 2WPDD 3VTZA 1CUCA 4BBJA 1EI9A 3CRW1 3AJRA 4JXKA 5KIAA 2GVZC 4KW7A 2AVDA 3WRWA 4HPXB 9ATCA 4NDNE 4G0PA 1T0IA 2IS4A 3G02A 2BSXA 4RD1A 1NRJB 3OJEA 5E6RA 1Z0AA 2PH3A 1VXOA 5JYDA 3THWA 1XRMA 5EC8A 3ZD7A 1ZUNA 4DCUA 4IHKA 3V97A 4IZOA 4HR7A 4DQLA 2Y77A 3GBVA 2GFHA 4KGZA 1E6LA 4ZAXA 4C9BA 3E1GA 2Q5EA 1A2QA 4G0XA 5EUQB 5FTLA 4AY6A 1MJGA 1NQVA 1QF6A 3HJGA 1Q6YA 1W88B 3BEDA 3N9IA 1QK3A 4FBMA 4OJTA 5ULLA 2YNMC 4MVJF 3T9AA 2ZM6B 1ZX1A 3EIWA 4TL7A 1MB4A 1M2FA 2ACWA 3K8OE 2VFAA 3IJ5A 4IQ4A 4YNBA 4PC6A 3OAAA 3W78A 4BP3A 3L1VA 2R47A 3GEMA 4JJGA 2VZ8A 4JUDX 1ELOA 2I4IA 4RORA 4CG3A 1OXXK 3IUYA 1WDLA 1ZK2A 1CRPA 3GD7A 2YUIA 4J1TA 2A30A 1I4WA 3IXMA 3L6OO 1U8AA 3O5AA 3HKEA 4TTPA 2HIMA 3B2NA 4HH0A 4Y0AA 1KKMA 1XFAA 3WYCA 1BRMA 5AESA 1DDGA 4GP9A 4UAUA 5CFNA 1BCRA 3D6NB 3T4EA 2W43A 2QJFA 2XAAA 3H5TA 4V38A 1M0SA 1NM5A 2BGMA 2VOEA 4FNMA 4R9VA 1OZAA 1BX3A 3G7NA 3WZ2A 2ZB7A 2KW5A 2BM1A 4NU8X 1TYZA 3PPXA 2IH2A 2X8BA 4O59O 4C29A 4FYIA 4G5FA 4HQNA 1ZCZA 2VKQA 1U81A 5AXAA 1F6WA 5SV2A 2LXNA 3DPUA 1IHDA 5HFNA 2QKYA 2GRAA 4XJSA 3UYLA 2WWXA 1MIHA 2X6TA 4MCIA 4MR8B 4TTVA 3UAWA 3AV0B 3IGFA 2HWYA 2R8BA 3QVSA 5AUQA 1GFIA 4J7XA 4BLVA 1AJEA 3KZNA 3M5WA 1PQ4A 2ARKA 3KVOA 4AF6A 3DDWA 2FE1A 3CVWA 4L9WA 1T6BY 4UEWA 4CMBA 4EHBA 2PKRA 3CKMA 5BYAA 4M22A 4MMZB 1RJ9B 1K7SN 4YCDA 1KQNA 4J3NA 4EI2A 5J4KA 2NO9A 3LUJA 2GHRA 2IXTA 1GIAA 5DFAA 2BY4A 5BW6B 5LXTF 4BXOB 4AKHA 4R1PA 3MWFA 1ACLA 4W7HA 2IYRA 5AK5A 4YYEA 3RWBA 1JDTA 2ZS9A 3QUAA 4FMPA 1K88A 2HSEA 3K0CA 3M1IA 2JAQA 4IL5A 4MYTA 1PK8A 5KS2A 3VR2D 3HR8A 1EVZA 3PEVA 2R96A 2HRQA 2JJQA 4RVUA 2DHRA 4OHPA 4URHA 2AYZA 3JQFC 3QW4B 4HXYA 2FPPA 4II7A 5C1IA 1T2AA 3IJEB 4D3DA 3GFPA 3N3BC 4ARVA 1MJNA 3JQ9A 2R85A 3A10A 2O8VA 4FMDF 5C1PA 2ZETA 2VK1A 2J0SA 3PFWO 2VJKA 1Z38A 1M1NB 3DS8A 3CIFA 3T7KA 1E61A 4CKZA 2CHVA 3VYTB 5FUQA 4KQEA 4X71A 3ZJ5A 1JQLB 5IN5A 4FCVA 1KJYA 3EMDA 4O4IB 5KNBH 2CYAA 1VKHA 4BGUA 3VZDA 3JQCA 3OM0A 1JG7A 1PVOA 1DMRA 3KZCA 3MNFA 4UD2A 2M6SA 2CLSA 2E7ZA 1AB5A 2DQ4A 4YY3B 5LZ9A 4OXXA 3JSXA 1E2LA 4Y2QA 1ULAA 4XJXA 2ZRBA 4E15A 4FN5A 2FWBA 1M83A 1RI5A 3ORHA 1J9EA 4YAJA 1GAJA 1JE1A 2CF5A 1T2UA 1O94D 4RPLA 2H65A 1SO8A 1Z45A 3QPDA 3NNSA 1WUJS 3CCFA 4QG7A 5J4YA 4J6EA 1OCEA 3HDGA 1JZQA 3DNMA 2WUDA 4KHZA 4DIMA 4TL6A 2NSLA 4YXWA 5I7VA 2IS2A 1EK2A 5C3UA 4UXJA 4GPIB 1L5RA 2ECKA 3NBMA 1RMTA 3K6RA 5E7QA 1E6UA 3EGXA 4YR7A 3Q7EA 2AE2A 3T3MB 5LP6C 3FA2A 4AL4A 1MQSA 4HADA 5EKTA 5A0TA 3WKDA 2BE7A 2WLTA 4CKWB 3SBXA 3JAWA 1GPWB 4KRXA 4MEJA 4U39A 3G8BA 2A57A 3HCCA 4ASUD 3ZHVA 3K1AB 2WG1A 4XLLA 3E22A 4D92A 5KSWB 4TYYA 3S55A 3VPCA 1OW3B 4GBGA 3D64A 5C34B 5FHQA 2Z5FA 5FRDA 2Z9BA 4GBMA 3TTYA 3C5EA 4DZTA 3MWDB 3GUZA 2XKAA 3PR1A 3I34X 1WUYA 4KIJA 4K9MA 1SZDA 3M4JA 4ZHQF 1OBHA 4GPEA 5HJ7A 1GY8A 1U11A 2QIOA 1XVVA 3MG9A 4W6QA 5K1ZA 3OZEA 3ABSB 4QUEA 5EE9A 3OP1A 1Y3HA 5CH8A 4TUYF 4B84A 1XYYA 3DJYA 1GUYA 4OHOA 3BMCB 5FLKA 2QMQA 1VZ2A 4GPTA 2P5YA 3KKEA 1JYSA 4KAFA 4PIMA 1N25A 1HGXA 3EFOB 3M3HA 4B81A 3H6GA 4YALA 4RBNA 2HWKA 3RVNA 1K3UB 2V6BA 4LDAA 1E2KA 5LQJA 3T3NA 1MXFA 1T2DA 1JVNA 4JITA 4P1ZA 5B2ZA 4CG2A 5JWRA 2XEXA 2BFEA 2MYPA 4OQPA 4BO5A 4U2EA 1YFKA 2AZ4A 3M0EA 4FEEA 4R3WA 1M1YE 1U1FA 4LN1A 1T3LA 4JT8A 4CODB 4YJ3B 2VQEB 3EGDA 4FBLA 1NBIA 2XA9A 4YRGA 2ID7A 4F92B 3K2EA 3LLSA 3ZLBA 1QKKA 4JLSA 3TXYA 2X2FA 4HTFA 4KJZA 3EVDA 3D7LA 1LH0A 2GPNA 5FBZA 4CKXA 3R6LA 3R3HA 5LBTA 3M70A 4AUNA 4GSKA 5FUWA 4X3OA 2B4KA 5IANA 3SEQA 1E2GA 1TXGA 1W52X 4PYRA 3DD5A 4HDMB 3EOZA 1L3IA 1S2OA 4L4RA 4WCFA 2D7DA 3FTEA 1GZ5A 3A26A 4I0WB 4QODA 2NO6A 3QGMA 3BJMA 3FOZA 4Q18A 2AFRA 5EJFA 2HNAA 1ZN7A 1QHGA 3GJXC 4FK8A 4M8LA 4TMXA 2HU5A 2Z5LA 3IKLA 1L4GA 2Y4NA 2HDWA 3PU6A 4QHYA 1ZLXA 4II3A 4UDNA 5IBRA 5F9MA 3ZD9A 3K0KA 4Q7QA 1T5IA 2Q3MA 2OOSA 3PT5A 4X84A 3OO1A 2QAGB 4XD7A 4DKXA 2XSZA 3L7OA 2FP4B 1NVTA 1KH1A 2HJVA 5I9NA 3KQKA 1T36B 3ZV6A 4C88A 4PZ0A 1ODCA 4MQUA 5LQDA 1LPSA 1R00A 5HKAA 3U56A 2H3HA 2N3ZA 1JFFB 1NULA 3VPAA 5HUJA 1UIMA 2HHLA 2P1RA 3IPCA 3AEQB 1KIAA 2YS6A 2GA9A 1RKBA 4HNGA 5K0LA 1K6IA 3PDJA 4PCVA 2BFDB 5B6PA 2W2LA 3GLVA 5EXEA 1EIZA 2Q1SA 3H6KA 1R88A 3LYAA 2P7HA 4PX2A 1EVEA 3CQ9A 3D59A 3DTVB 3PTAA 1GG5A 1M6EX 1TAHA 2DFLA 2XUAA 3FPKA 3F46A 3KB2A 1NVVQ 1W5AA 1QYVA 2VJCA 3UAXA 4UUAA 5J2UB 1X94A 2IH5A 1MO4A 5JMTA 1X9GA 2ZUBA 4IDCA 2PEYA 1UBFA 4RTOA 3M3PA 4NZYA 1EQ2A 4IJ6A 4PAMA 3ZDZB 4BP9A 4TLEA 2B5VA 5AIBA 4TV9F 5GVRA 2LCQA 3T9DA 1G0NA 3A4YA 2HEIA 2CUNA 3BN3A 1N1EA 2RK3A 3U3DA 3DOFA 3IAS6 3K9QO 2ERXA 1EK0A 4XWTA 4B31A 3C8UA 4LY3A 4AJ1A 4BMSA 3MD0A 3T9CA 1N77A 3HXMA 3G8DA 2QD1A 3B9BA 4F0JA 1V39A 2HHJA 4C01A 1ZR2A 4NP6A 4MLZA 1S3SA 1HPLA 3X43A 4KV9A 2CJYA 4M2LA 1KP9A 1MMFB 3GUCA 2GAOA 5AVKA 3X3HA 4U7GA 2IV7A 5I9TA 4AG5A 1GPUA 1KAQA 2VLBA 2ZTUA 2ZSAA 4Z9YA 2PPLA 3OZGA 1F12A 2QN6A 2VBFA 1OIXA 3KEGA 4KXVA 3PVZA 3BXOA 4HNAA 3RNOA 3E3OA 4JLDA 1QH0A 2YFHA 3B1YA 3II6X 3OKCA 4CQJA 1U2DC 4BYMA 3RC3A 3TIVA 4I50B 4UU8A 2QRUA 3GJ6A 1G9XA 2JLXA 1DXQA 2RGCA 1F8YA 1U9JA 2GEKA 3DKRA 3JQ7B 1P45A 3KT6A 4MJXA 3UNXA 2PBZA 1HDGO 4GL2A 3NC4A 4CEHA 5EWJB 2V8OA 2ADMA 4PZLA 3Q8MA 3C3XA 2PUDA 3A1VA 1NNLA 1E9SA 1QO0D 3MFQA 5DP1A 4J4TA 1KI2A 1Z22A 5JPIA 3RUFA 4EENA 3I5YA 1EWVA 1F20A 4A8JB 5EZYA 3JQ8A 1GGNA 1XJQA 3AVQA 4AKEA 1KZ9A 2Y67A 3LKVA 1IJBA 1E1DA 2JCSA 2I78A 1ZD3A 1UAAA 1DX9A 1ZGZA 1XRLA 1A5SB 4CNBA 4LJ8A 2Z8YM 4Z54A 3JZDA 5B30A 1D2AA 3O38A 1IK4A 1DEXA 3ETNA 3L8GA 3RRMA 1BU8A 3LYUA 2FFQA 3UMSA 2WMNB 2CHFA 4HY3A 3LX8A 5EI5A 1C9JA 3A6LA 4EUKA 2FW6A 2I3DA 3HGQA 1NSTA 1D04A 2A58A 2GKSA 3OJLA 4MUKA 2UXDB 1KGSA 4AMBA 1WP4A 3WJ7A 3GT0A 2IC5A 1VHTA 3IILA 1SOAA 3FFBA 4I1SA 5KDDA 2H2HA 3I39X 1G98A 1Z4NA 3HJTA 1YTUA 4KDCA 5CNMA 1CZKA 4LSMA 1I7LA 3AIMA 2ZG6A 1PFVA 3B2QA 5A6SB 3EVBA 5BWBA 2UVDA 3R77A 2IYUA 3PC4A 5KTNA 1VE9A 2XRMA 4MPJA 1ZGBA 1E3IA 2P9GA 4WVLA 1EXVA 3THXA 3BIJA 4TTQA 2GZRA 5H4GA 4ZKDA 2F4VB 4DJ5X 4C5BA 4Y6SA 4C4TA 3GCZA 1MW8X 1FYEA 1MC1A 1T4GA 4U7FA 3P9IA 4Z1MD 1MTZA 4FOOA 4BVFA 1YR1A 1LW7A 1S2DA 2WM9B 2X2PA 1TAUA 3BXZA 3PE4A 2IYAA 2W4IA 3RK0A 3FOEC 3O8CA 4AQ7A 2RMKA 1GTMA 2J32A 4RADA 4MA4A 3KHUA 2B3TA 2OV3A 4A73A 1UOQA 4TWBA 1FDIA 1XCLA 4F5ZA 2LRHA 5K0FA 4MTCA 1ADGA 4DA9A 4R51A 1VCIA 1VHLA 3GB9A 4C03A 3EDOA 3GVIA 1S7GA 4JLNA 1IBSA 2F9FA 2DF8A 4LZNA 1LVUA 3P9SA 2PCJA 1NXSA 2ZT8A 4ATNA 1QIEA 2D8MA 8OHMA 5E1MA 5EOVA 4BQSA 1QV7A 2Z8YA 3RAEC 4GKJB 1CZNA 3URMA 4ZEXA 3T3HA 4WNAA 1F9AA 4OD0A 1DO2A 2Z3WA 1AKMA 2OUKA 2QTGA 1PP4A 2YWXA 3OPVA 1MJ5A 1G7CA 3R5JA 4MPPA 1VHQA 3HNRA 4J7AA 4DLTA 2GPYA 1NJFA 2FAXA 3FUCA 3DFIA 1UQTA 1WMEA 2JAOA 2ZIFA 3C3BA 2EGGA 2OFOA 1BWPA 3HWX1