4YR9A

Mouse tdh with nad+ bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
308
Chain Sequence
PPRVLITGGLGQLGVGLANLLRKRFGKDNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYSALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPSTIGAFGPTSPRNPAPDLCIQRPRTIYGVSKVHTELMGEYYYYRYGLDFRCLRYPGIISADSPGGGTTDYAVQIFHAAAKNGTFECNLEAGTRLPMMYISDCLRATLEVMEAPAERLSMRTYNISAMSFTPEELAQALRKHAPDFQITYCVDPLRQAIAESWPMILDDSNARKDWGWKHDFDLPELVATMLNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights on mouse l-threonine dehydrogenase: A regulatory role of Arg180 in catalysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase, mitochondrial
total genus 95
structure length 308
sequence length 309
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2015-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yr9A00
3O03A 1PJ3A 2O7SA 1JWBB 3ZWMA 3KOUA 3DBLB 1QORA 1YBAA 4R1TA 3ZDFA 4XDZA 5I9LA 2I65A 3TRIA 2IYOA 4RL6A 4WE3A 1A7KA 5B4UA 2Y99A 3ZV3A 1HE5A 3CUKA 1SEVA 1HYEA 3STHA 5C3MA 4WOJA 5BNFA 3LF1A 4CM7A 4CMKA 4PG6A 1AN9A 4I5DA 2G5CA 3TZKA 1YBMA 5JBIA 4EZBA 4W7HA 3JYPA 4BO3A 4GVXA 3UCFA 5CDSA 2WTBA 1O95A 5DN9A 4YQZA 3ZW9A 2EXXA 3EZLA 4PZCA 1J5PA 3HDYA 3UW3A 2X4GA 1BDMA 2QW8A 4C7KA 3H6KA 2C20A 4LISA 5BT9A 2AQIA 1PJLA 1BG6A 2NNLD 2PLAA 3GF4A 5IN4A 1XG5A 4DTIA 4YT5A 1I32A 4J4TA 3AM5A 3DONA 1H0KA 1QR6A 4ZVVA 4GKVA 4D0RA 1HDGO 4MP3A 1C3VA 1E1NA 5ITVA 3EGOA 3F6YA 4NBTA 3HSKA 3OJ0A 3WJ7A 3JSAA 1LSSA 2ZTLA 4DWVA 1HLDA 2QG4A 2VN8A 2YHIA 4RGBA 4D3FA 2PNFA 4PVCA 3S8MA 3CZMA 4D42A 1DAOA 5CAEA 4A73A 1H6DA 1ONNA 4N5NA 3ENKA 4JQCA 1Z73A 2VT2A 3M6IA 3T4EA 1V9LA 2PH5A 2VYND 4BHTA 4WNIA 2ZTVA 1Z75A 3H5AA 4RPJA 5IZ4A 1XA0A 4KQWA 4OM8A 1QYVA 1YONA 4R5MA 3ADPA 3WOHA 1U9JA 4J4HA 5JPIA 4GBJA 4IQ8A 3RU9A 2YDXA 3SC6A 4XR9A 2NQTA 2R00C 3NJ8A 3OM9A 1R66A 1LDGA 2VRCA 3EMKA 1X13A 3F1LA 1QRRA 4I9NA 3TZHA 4L4XA 4E32A 3KYDB 1BMDA 1C0PA 3DR3A 4NFHA 3IP1A 2VRBA 1JAXA 1P77A 4TROA 3WWYA 1XGKA 1E7MA 4BO4A 1GCUA 3DO5A 3NGXA 4L75A 1A72A 5G0WA 5TRTA 1FDSA 3BA1A 3WDSA 3KBOA 1Z74A 5F5NA 4FFPA 2DPHA 4NBUA 4PLGA 4GQAA 3WNQA 2O3TA 4UULA 5EIOA 4L73A 3RC7A 5GY7A 1EVIA 4M54A 2AEJA 2FZEA 3T7CA 2C7VA 1YH3A 2GRAA 2E37A 1O9BA 3VZRA 1YGYA 4BNUA 2FSVA 3TOZA 4D3SA 1ZK3A 3PZRA 2JD1A 3DL2A 1N9GA 1UZLA 1HSZA 2E82A 1PL7A 1ENZA 2I5PO 5JDIA 3RUAA 1GZ6A 1OFGA 3QSGA 4LSMA 3C8MA 2NVUB 2W2LD 1PZGA 1X7GA 2PZMA 3O4RA 2W90A 5EPOA 5A3VA 2FZWA 3LC1O 3I4CA 3GVXA 3Q3CA 2JD2A 5JAZA 3QE3A 5I8ZA 4XKJA 1KC1A 2DUUA 2Q3EA 4K6FA 2GN4A 2JHFA 3OH8A 2ZATA 5KKAA 4E5MA 2I66A 3OQBA 4J2OA 3TZ6A 4LGVA 3MJEA 1PGJA 5MGBA 3RROA 1AXGA 1JTVA 2VYVD 4F3YA 3K5PA 4YA6A 1Y5MA 3DZHA 1TA4A 2PZLA 3GNQA 4J7UA 1SOVA 1KEWA 1OAAA 4YBZA 3H2SA 4MINA 4AJNA 2O2YA 1A9YA 1U5CA 2Q99A 2Y1FA 2GZ3A 2P5UA 2UDPA 3WGZA 1E3SA 4XJSA 4B4VA 5K6AC 3Q6IA 3RD5A 3MOIA 1LLUA 2PTGA 1IE3A 4UVDA 4IDFA 3TL3A 2ZCUA 1GU7A 1YVEI 1ORRA 3A4VA 5JC1A 3HNPA 2O23A 1ZZEA 1P9LA 3LSYA 1IHYA 1IPEA 4NNJA 4RF3A 3VTFA 1NQOA 3VH4A 4L4SA 2G76A 3NDJA 3WYCA 4A0SA 3FPLA 3PDUA 2GASA 3RASA 1GPDG 3DTTA 4BNFA 2EG9A 3W6ZA 2GSDA 1CQIA 4ID9A 3WGTA 1PX0A 2FSSA 3ZNNA 3TPCA 2JAPA 4YDRA 3ZWCA 4OYRA 2X22A 3NT5A 5T64A 2Y1DA 4XGKA 3AM4A 3ZWYA 2BKAA 3HG7A 5CFZA 3QVTA 1RYDA 3AK4A 3OJOA 4CQLA 2DTDA 2FP4A 2WD7A 3H9EO 1P3DA 3JV7A 4HNHA 4Z9YA 3G49A 2CVOA 4OOEA 4ZJUA 3LC7O 3PLRA 1LDMA 4B3IA 4J1NA 4CJXA 1HE2A 3O38A 4ND2A 4QT0A 5JE8A 1CJCA 3KEQA 1ZSVA 3QIVA 1VPDA 5IN5A 5BSHA 1VJ0A 4OIMA 4W9NC 3DBHA 1ZMTA 2C54A 3KXDA 2ZB3A 4LN1A 1Y8RA 1XEAA 4GMGA 1I2ZA 3X2FA 5JDCC 3D3WB 3F4LA 5AYVA 4AJLA 2ZYGA 3TQHA 3UAGA 2ZB4A 2DBZA 2YV1A 3HADA 3TN7A 5TT0A 3JQDA 4HWKA 3P7MA 3ONEA 5G4KB 2AW5A 4XZ3A 1KVSA 2PK3A 1I01A 5CDGA 4R9RA 5JAQA 4EEZA 2AA3A 5G0SA 3E18A 4OXYA 2R00A 4F6CA 5JCJA 4AJPA 1EUZA 1EE9A 3N74A 3DMTA 1Y9AA 3B1KA 4ZRNA 3WGYA 1ZXBA 3JYLA 1MA0A 3VKVA 1I10A 1B3RA 4IJKA 4B4OA 2Q45A 1ZK0A 2Y0DA 3KZVA 4OKIA 4CMJA 1EQ2A 3D4OA 3LT2A 4ZRMA 1CRWG 3Q2IA 1VL6A 5HM8A 2JFFA 5KWEA 1NHWA 1OZAA 3OIDA 2OHXA 1NFQA 4XD2A 4D45A 4U0KA 4OSOA 5KNLA 4UVGA 3G3EA 4RPKA 3OA0A 2GPTA 4GGOA 5BSGA 4YAKA 4N5LA 4R69A 1CWUA 1HRDA 4WUVA 4WLUA 4A27A 4Z3KA 1DOHA 3ZHXA 4OXNA 2VOEA 1H6CA 3KM0A 1JA9A 1WAMA 4NG5A 3K73O 1XELA 2AEMA 3VZPA 4CV2A 2YQ4A 5I7VA 3SLGA 3ADOA 3I9MA 2RIRA 3GVCA 4B7XA 4BB5A 5FWNA 3BXXA 2LDBA 1V35A 3DHYA 2HRZA 2FWMX 5CPFA 5T5QA 3LZ6A 5B37A 3JTMA 2EV9A 2GGSA 4KDFA 4HFNA 2ET6A 4A2CA 4PLZA 2DUWA 2DTXA 3EY4A 2FPPA 4DMMA 1ZSNA 1PQPA 1AHHA 4Q9NA 7ADHA 1F14A 4WLNA 3AW9A 1RM3A 5AXCA 5KJEA 4RVSA 5CDTA 1H6BA 1U8XX 1C1XA 1ZKMA 5JXWA 1I8TA 1UDCA 3JYOA 3RUCA 2RBEA 4CLOB 1M75A 1HKUA 1RPNA 2BFMA 2DVMA 4BS9A 1HDXA 1UDBA 3L6EA 1JW9B 5BSEA 3K30A 2JAHA 1IL0A 5I9NA 5JO0A 2PR2A 2B5WA 3ZU4A 4BGUA 3Q2KA 4BNMA 2IZ0A 4IDAA 5CP8A 4RPGA 4CR8A 4PFJA 1WVGA 2FHSA 4LVUA 3ZWWA 2UVDA 3GG2A 1ZFNA 4MIYA 1DC5A 4DL9A 3TFOA 3VZSA 1GYQA 3JD0A 1T1RA 3QWBA 5G0VA 1QXSA 4KZPA 4UVEA 5U9CA 4NFYA 3GDFA 4N7RA 3QVSA 4FOOA 3ZHYA 1WZIA 3AY6A 5ICMA 1VE9A 1I3NA 4MVJE 4DRYA 3ROMA 4ZU3A 2OBYA 1O94A 4TRJA 4RF4A 1DLJA 3I9NA 3CKYA 1P1KA 3RJ9A 3ZV4A 3H5NA 1YBVA 5BQFA 3RUHA 1YXMA 2BHLA 4WPGA 4P4NA 3VPFA 1AXEA 4DIBA 4JBGA 4DYVA 1N1EA 3TOXA 1JKIA 1N8KA 4M49A 8ADHA 4R51A 3UCXA 5A4DA 4F45A 4AICA 1A4UA 3RC9A 1PJSA 1NWCA 5G0UA 4CMBA 1FDVA 2AMFA 3H9GA 2EWMA 3DWFA 1CIVA 1XDWA 3PTZA 4HNGA 1E3WA 3K9QO 1Y8QB 3L4BC 3LDHA 5COBA 1GQQA 1IYZA 3PJEA 4YJHA 3RI3A 4I08A 1W73A 3CIFA 1E7RA 2YHUA 1X1EA 1QYDA 1YB5A 1E7SA 1LQTA 2PV7A 4JBIA 1NAHA 4XRRA 5DP2A 1O0SA 2CSUA 4L4RA 4BNGA 2EW2A 2JCVA 5ILGA 3FD8A 3MOGA 3IIEA 3ZU3A 4MDHA 4XWYA 1BDBA 2P4QA 3AOEC 1B14A 2BGLA 3P2OA 3INGA 1O6ZA 4YRAA 1JKJA 1P45A 1Y6JA 5JLAA 4RF2A 4FN4A 1V8BA 1M6WA 3DZFA 4OQYA 2PA3A 2OP1A 5C37A 3D4PA 3V1UA 1NVGA 5TSDA 1OI7A 1PSDA 3OF2A 3UVEA 4BNIA 3PIDA 4E12A 4XRGA 1DO8A 1LA2A 4LCJA 4U5QA 4FPXA 4ALKA 4IMRA 1DJNA 3GC6A 2Q1TA 1YJQA 3LT4A 2D5CA 1HZZA 2A9FA 1R6DA 2WYUA 3E9NA 5FYDA 3BHIA 1SNYA 3MJVA 4QECA 4J0EA 5KJCA 3ZN2A 4Y9DA 4N54A 4YJDA 3RUFA 4XQCA 4AJEA 4L74A 2VWHA 5HS4A 3DZKA 3EAGA 2ZKLA 4JBHA 1UXKA 4BO7A 4L76A 4PRLA 2YYYA 5HWSA 3CXRA 3WX0A 1HYGA 4Q39A 1P74A 2JFHA 2IRWA 5DCUA 5JAIA 5TF4A 5IXYA 3HWRA 3GY0A 3WXBA 4YCAA 2B37A 1P44A 3IQDB 3W8FA 1AE1A 2NVUA 4J9VA 2XOXA 1I3LA 1RM5A 1UUFA 2PGDA 3Q1LA 4J90A 1KETA 3E9QA 4RO0A 4EYEA 3U62A 1PS9A 4J6FA 4AJ4A 1IHXA 2BI7A 1CQJA 5F3RA 3V8BA 2X7HA 3OETA 5C5IA 5IXSA 1E3WB 2YY7A 1AHIA 1ISIA 1PWXA 2OL4A 3ETEA 4MVJD 2QX7A 4XQEA 2PZKA 1VSUA 3RFXA 4BGVA 4CM5A 1BWSA 1EMDA 3GGPA 3PGXA 4KQXA 1ZVMA 3EDMA 1HWYA 2XXJA 3KRTA 4RPLA 3I5MA 4XDYA 5DDIP 1J4AA 1LRKA 2ZQYA 3JQCA 4RVFA 3BMNB 4CUKA 2P4HX 2O4CA 1BVUA 3JQBA 4DBVO 3WMXA 4HFJA 4R01A 3RVDA 4YT4A 3WIEA 1NR1A 5DCWA 1V6AA 3ZWOA 4WK6A 2QIOA 4JROA 1U2DA 2J8ZA 3V2GA 4IJWA 1HF3A 2Y67A 5L9AA 4FFLA 5A03A 1F17A 1P0FA 2CD9A 2XF8A 5EMHA 5HBRA 4B7CA 5DOZA 2VZ0A 4K1LA 4RORA 5DF1A 3ETGA 1B8PA 2IXBA 2Z5LA 5IDQA 1IZ0A 3K2BA 5B12A 1YDEA 4TVBA 2O3JA 3RFTA 3M1AA 1F8GA 4CV3A 4UVHA 1YQDA 3V5NA 1T4DA 2J3JA 1E5LA 2W4QA 3WYBA 5A5EA 1BSVA 1XR3A 3P19A 2EJVA 4W99A 5GZ6A 3ROKA 2ZTMA 4WECA 1ZNQO 4AL4A 2OXIA 3WNVA 1P1FA 1E5QA 2QRLA 1WPQA 2IDZA 1MX3A 4DREA 1N1GA 1FDWA 2W98A 3LYLA 5LDHA 4Y6PA 4KWHA 1UR5A 2W2KB 3IJPA 2P2SA 1PJBA 2J6IA 3L6OO 4E30A 4EUEA 3COSA 1HTBA 3DZGA 2XAAA 3AY7A 2AHRA 4YAIA 1QYWA 3L4SO 3UFXA 1M66A 1B0AA 4EJMA 1GPJA 4J0FA 1DJQA 2GZ2A 1ADBA 1K6JA 2C59A 3Q11A 1E1MA 2X23A 2H63A 4W4TA 3PQDA 4LVCA 2AG5A 3S1LA 5B4VA 2EKQA 2BELA 2IEBA 3PHJA 4XB2A 1CEQA 2E6UX 4BUCA 1LX6A 4BO5A 4CM3A 1LSOA 3HN7A 1YS4A 3E6AA 3BMCB 4FDAA 2OOSA 3JQ9C 4JLWA 5KJ1A 3F46A 1N92A 3OIFA 2VWGA 1ZCJA 4PVDA 2ZB8A 3HFGA 2B5VA 4CMIA 1FF9A 3KEOA 2PKQP 5JMPA 3RC1A 3KVOA 1QYXA 2AEFA 3GHHA 5GZ1A 1ENOA 4BKOA 2D3TA 4E5PA 4GMFA 1T26A 2FPGA 1M76A 3VVBA 1EDOA 1T25A 3IS3A 4DLLA 2VNSA 5CDYA 4AJJA 3U4DA 4WCFC 1WW8A 5TC4A 5B1YA 5B4TA 5KKCA 1YOVA 2CF5A 3V2UA 4EUHA 3JD3A 4AVYA 4MVJF 1DXYA 5ES3A 2DBRA 3H4VA 4G5HA 4RZHA 2QYTA 1W0CA 2Q2WA 3OMLA 1W4ZA 1WNTA 4RZIA 4NFSA 1NX6A 2F1KA 3I9JA 4IY1A 4WKGA 3DEYX 4FGSA 3H7AA 4CM9A 2A35A 2IE0A 2CDCA 2YFHA 3DTYA 4YRDA 4EITA 1EDZA 1PJTA 4AJ1A 1W6UA 3JQFC 4ZQGA 5T8KC 4ZD6A 4ALLA 4YR9A 3PQFA 1PS8A 1UH5A 2EHDA 4FD3A 4OQZA 5TLSA 2X0RA 5JC8A 1PQUA 1GEGA 3ZWAA 4GL4A 4GX0A 4A5OA 3AOGA 1ADGA 4J43A 1F06A 1X7HA 5KOIA 1V3TA 4LK3A 1HLPA 1GUYA 3MJCA 4KMSA 1LSJA 4E5YA 1I2CA 1EK5A 4CV0A 2ZJ1A 3ANLA 5L7YA 3BMOB 3PGJA 5DBIA 4HX5A 3TNLA 3S2EA 1E7QA 1M2WA 2WD7B 1I2BA 3DHNA 1V3VA 3HUDA 2AQHA 1PZFA 2NTNA 2QZ9A 4FJ0A 1MC5A 3I52A 2X1HA 3U9LA 1GD1O 3JQFA 5T8KA 3W4JA 2GCGA 1Q2XA 5HA5A 4M8SA 2BFPA 4MVJP 5IZCA 1XU9A 3EYWA 4YWJA 2X8LA 1ID1A 3G1TA 3GK3A 1IOLA 3BTUA 3NDRA 1JU9A 3AI2A 4CLEA 1SB8A 4E13A 4E2ZA 4NI5A 3R6DA 5IG2A 2VZ9A 3SXPA 4BNZA 3PPIA 1T2EA 4RQUA 1RKXA 3ENNA 4ZN6A 3FN4A 5COQA 1HT0A 4P22A 1G0OA 4YT8A 3HB5X 5A02A 4R68A 4O63O 2V65A 1GFSA 4BO8A 3ITDA 5A06A 4IBOA 1NVTA 5JNLA 3R0IA 4K6CA 1Y7TA 1MGOA 3PYMA 2NVBA 3D0OA 4QEDA 4XCVA 1NVMB 3TZCA 3QP9A 2WYVA 4OJNA 1CERA 1D1SA 1NQTA 3CINA 1X1TA 1K2WA 4D3DA 4DUPA 2O48X 3AUUA 1DHTA 1J49A 4WEQA 1J0XO 4OOFA 4KTVE 4R16A 2IYPA 1T2AA 1ENPA 4WNCA 3QVXA 3MWEB 1GTMA 1ZK1A 5KVQA 5I7EA 3GMSA 3C85A 5JS6A 1Y8RB 3E48A 4A10A 4FFNA 1ONPA 3IL2A 2GN9A 6ADHA 4B4WA 3PI7A 4CMGA 4B3HA 1PJ4A 4CMCA 4RJTA 1N9GB 4Y98A 2PH3A 4ZGWA 4BNJA 4KUGA 3DBRB 2HO5A 3WSWA 5JW6A 2WDZA 3JYQA 3RSHA 2EKLA 1LUAA 3P5SA 4Q3AA 4DQXA 2B69A 2FMUA 3ZNOA 3U0BA 3E9MA 3GPDG 4R3WA 1Y81A 4RQTA 4E21A 1DAPA 3FF4A 5AXDA 3D5QA 4DMLA 2Y1OA 5TX7A 3BIOA 1SBYA 1ISFA 3AU8A 3QQPA 3AUSA 1LLDA 2I9PA 1XSEA 2RH4A 1GUZA 4PCVA 3ORFA 2YDYA 1YE3A 1K3TA 4KOAA 5KVVA 1QP8A 4RDIA 2TMDA 4LW8A 3PFFA 5EESA 4GI2A 4ND1A 3E03A 3G1UA 4IZIA 4D79A 2D0IA 3DMYA 5BR7A 3JQBC 3UXYA 1B26A 1SC6A 4GPD1 1UXHA 1OC4A 1B15A 1CYDA 4MVJG 3WFIA 1VKOA 4BV9A 3DZBA 4CMIB 3WJAA 2PD4A 3BMQB 4D41A 1K89A 1Q0QA 2IZZA 4F46A 2J5KA 3I3OA 1R4MA 3JQ7B 4K26A 1KVQA 1FK8A 8LDHA 4WOKA 5JDCA 3FNEA 1MFPA 3CPSA 3A1NA 2EF1A 3ZU2A 2HU2A 2ILTA 4BL5A 4RDHA 1WWKA 1GZ3A 1UP7A 1DIGA 1EVZA 1O8CA 3GRKA 3TL2A 1H5QA 5THKA 3CZRA 1PGPA 1IB6A 3G0OA 2OFPA 3G79A 4CPDA 1IZ9A 3PVZA 4AJ2A 4HADA 4BNHA 1LDBA 2POQX 1YL6A 3QW2A 1DBVO 3FBTA 4P8RA 4CLXA 3OJLA 3WQSB 4D7AA 4O5OA 4YAEA 3OBBA 2GO1A 4YT2A 1HL3A 1IUKA 3DMTC 3GG9A 1A71A 1MXHA 2NU7A 3NT2A 1IULA 2PD6A 1NPYA 3I23A 1H2HA 4IUYA 3PLNA 4MP8A 1KERA 5JCXA 3UICA 4LSWA 4DPKA 4Q3BA 2ZIZA 1R37A 5I7SA 1UXGA 2D5AA 4HKTA 4IIUA 4NHEA 4JGBA 3CE6A 3UKOA 5EINA 2V6FA 3C3XA 1LQUA 3RAJA 5MDHA 1P1HA 3JQ6A 4OKNA 5CG2A 1ZSYA 4Q3DA 3EHEA 3U5TA 3PWZA 3M2PA 3EVNA 1R0KA 1U4OA 3F4BA 2AQ8A 1ONOA 2A94A 2DKNA 2VOJA 3BMOA 4M86A 4K28A 3KLMX 5A9RA 2FR1A 4J1TA 5AXAA 1HZJA 3DHEA 5FFFA 5BSFA 5KTKA 4E33A 3A28A 2EP7A 5JO9A 1LNQA 3K8ZA 2DT5A 3PZBA 4RVUA 3IOYA 4XEHA 3VH1A 4EJ6A 2HCTA 4R1SA 1U3WA 3GAFA 2O3QA 3FTNA 4YJGB 1KEPA 4ALMA 3QVOA 3L77A 1X14A 2EEZA 2CVZA 4QTZA 2FRDA 2X86A 3DXFA 4FFRA 4B4UA 4BO9A 4HY3A 4Z9XA 1DPGA 2OGUA 5EJ2A 1U8FO 3H5RA 1UDAA 4GLOA 4Z3DA 1ZIDA 5TS3A 1YL5A 4G2NA 5C7OO 1HDCA 3EUWA 4F6LA 4YJFB 4L0QA 5HTOA 1KC3A 2AQKA 4Z9FA 2DFDA 2DQ4A 3IJRA 2TMGA 4UUPA 3WMWA 5JSFA 2GD1O 4NIMA 4R3NA 2GERA 3S2GA 1EK6A 3NUGA 4QUKA 5F1PA 2GUGA 2WJPA 3M2TA 4U0JA 3GVIA 1ZK2A 2YFQA 4XX0A 5KJ6A 3C7CB 4TRNA 1CETA 3ABIA 1HE4A 5HRUA 2Z1NA 1XLTA 1GADO 1I24A 5L7WA 1B3BA 3WIDA 4DVJA 2B4TO 2UV8A 1EBUA 2C2YA 3KHUA 1P33A 4JCOA 4OAQA 2HMSA 2B83A 4A7PA 2YW9A 1Q1NA 2AE1A 3VHRA 2HK8A 1ULUA 4UEJA 1HYHA 1WMAA 1XIVA 3AFMA 4OHUA 5DBGA 1JVBA 4E5NA 5DCYA 3S2IA 4FC6A 3DBHB 3OQ1A 2FR0A 2D59A 5KCZA 3TZQA 2UUOA 2Q1SA 3FR7A 2NUAA 4O1MA 2GDZA 1FMCA 2BFAA 3F5SA 5TJHA 1DRVA 3TJRA 2ZB7A 4IJUA 4GSKA 4MKRA 3MJSA 4H15A 1E6EA 1ML3A 3WFJA 4CUJA 1XWFA 3I83A 5G0TA 4IINA 1P31A 4RLSA 2HSDA 3L07A 3AUTA 1B8UA 1NM5A 3ZCXA 3RUEA 4J4BA 1NPDA 2V6MA 4Y67A 2RHRA 4DXHA 2G0TA 4JP2A 1Y1PA 1H2BA 4M89A 4CODB 3GLQA 3GR6A 5F5LA 3B1JA 3GFBA 1TLTA 1NHGA 3AU9A 4TKMA 3ZU5A 4FGWA 3ST7A 4WLEA 3WLEA 3H3JA 4URFA 3IAHA 1PGOA 2H9IA 1X0VA 3ROPA 4XB1A 5CDUA 1PEDA 1PIWA 2I3AA 2I99A 1HDZA 1I3KA 5H83A 3NTRA 5FI5A 2QRKA 3GUYA 1Z45A 2BGMA 3JD4A 3E82A 3EK2A 4BKRA 3PFWO 1GV0A 4II2A 4FJ2A 1R4MB 4LMPA 1BTOA 2OO5A 1QLJA 1PJCA 3PQEA 3AOEA 1QMGA 2C07A 3GEDA 4I5EA 5COAA 5L45A 2WD8A 4DC1A 2ZQZA 4D0SA 4EBFA 5FEUA 1TT5B 3WGOA 4NBWA 1U5AA 1BXZA 5DULA 1U3UA 3QRWA 4JJGA 5L4NA 1NQAO 3VOSA 4IZHA 1UJMA 1O5IA 3U4IA 2O4UX 3GN2A 4UEOA 3PWKA 4U6SA 5CEJA 3WGGA 4BNWA 1WMBA 4NH4A 3UF0A 1DRUA 1LDNA 3PJGA 3RCBA 4XIYA 3KO8A 3FI9A 1P1JA 1DIRA 3NDIA 3KV3O 4IS3A 4CV1A 3JCZA 1ZW1A 4P4LA 2SCUA 1V3UA 1TT5A 4BNLA 2JKVA 2P9GA 4NQZA 4MVJI 1JN0A 4DBZA 3HN2A 4LMRA 1WDLA 2PY6A 3H9QA 1EVJA 3NTOA 3VVCA 4JX8A 3ZWPA 4G81A 5IDWA 4TKLA 1EE2A 2C5EA 1R4NA 2HJRA 2XXBA 4NR0A 4OH1A 5L4SA 4I9UA 3LLSA 3DOOA 5H82A 3OP4A 4UUNA 3PDJA 1KVTA 1J6UA 4Z0HO 1PQWA 2X6TA 1ENYA 5GZ3A 3FWNA 3AUAA 4NU6A 4TVOA 4AJHA 1R4NB 4ZA2A 2BI8A 1U1IA 1UAGA 2I67A 1A9ZA 3JQAA 4J2HA 4WCFA 3ZZNA 5HS6A 1MXFA 4MP6A 2FR8A 1Z7BA 3V1TC 5L51A 4CM8B 2C29D 4CLHA 4BO6A 5TIIA 4IS2A 1X15A 3C24A 2I6TA 3QLJA 3T4XA 3LU1A 2VNAA 2PWZA 4QFCA 3RBXA 1ZK4A 2VRCD 2QRJA 4IQ0A 4RVHA 3INTA 2NU9A 3P2YA 3VDQA 4CL8A 2NSDA 3WGQA 4ALJA 5A5FA 3FBGA 1SCUA 4PLTA 4KUEA 3GNSA 3L6DA 3ONFA 4PLFA 1C14A 1FDUA 4WCFB 2O50A 4U8GA 1R12A 3VPHA 1G1AA 1PJQA 5DT9A 1EUCA 4IDCA 2Z1MA 2A92A 1XHLA 3NT4A 2GF2A 4GLLA 4WLOA 3OJEA 4CQMB 4ESOA 4FR5A 4BQRA 5A3JA 5K9ZA 4UUMA 4UVIA 1QV7A 1IY8A 1T1SA 2CUKA 1XKQA 3QJ5A 5LCXA 4JJIA 1JVSA 2LDXA 3KUXA 3W1VA 1ADFA 2YV3A 2O2SA 2YHIB 3C7DB 5ITWA 3D7LA 1LJ8A 5U1PA 1YOVB 2CVQA 4IDDA 1RM0A 5CG1A 4XGNA 1PGQA 5IJZA 3QWAA 1KYQA 2CFCA 3GZ4A 1MG5A 2WM3A 1U7TA 3I6IA 2EIHA 1NFRA 2EJWA 1FDTA 4HUJA 3ZWBA 3W8EA 3PHLA 3EZYA 4GAEA 1PL6A 1ZJYA 5JDIC 4PG5A 4TQGA 3MZ0A 3UUWA 3HHPA 3TWOA 2R2GA 3GEGA 1DFIA 5IAAA 4Y6RA 3OSUA 3GVPA 4KDEA 1DSSG 2DLDA 4FOSA 4PG4A 3UCEA 2FPIA 1LEHA 1LRLA 2ZJ0A 4HBGA 4QX6A 2DM6A 2OZPA 4YACA 1F8FA 4OL9A 4ILKA 1OOEA 3ZWXA 3DZIA 4R1UA 1VJTA 2GN6A 1B7GO 3PK0A 1YQGA 3NEPX 3GH3A 4XGIA 3EW7A 3GEMA 4AJOA 3SEFA 4JNKA 4YYZA 5CPBA 3L9WA 1CDOA 4J7CA 1M6HA 4MOWA 4HXYA 2FN7A 3ZNPA 2FOIA 4CM8A 1A4IA 4NU5A 2E48A 3KETA 1MV8A 1TEHA 3H3FA 3GMDA 3GOHA 1DEHA 4CQLB 4ND3A 4KWIA 4J1QA 5L95A 4AJIA 2HKIA 5EN4A 3B6ZA 2X5JO 5IDYA 2GLXA 3OIGA 1Q7CA 1QKIA 2HK7A 1B2LA 3ZI0A 4ZHSA 4BNKA 2X5OA 4FFMA 2QZZA 4CQMA 1DDOA 4Z0TA 3GDOA 3ZV5A 3DFZA 3GPIA 4LRTB 4QXMA 1GQYA 3RKUA 5JAMA 4NDNE 4QQRA 3AI1A 3HFSA 3B70A 3F1KA 3MJTA 3GVHA 4PLPA 3QWIA 3ON5A 1LC0A 5KIAA 1LC3A 1ULSA 3ZGYA 4W7IA 1L7EA 2W2LA 3OJFA 5EQFA 2QYSA 1T4BA 4MVJH 2EW8A 1OBFO 1DB3A 4O59O 3H2ZA 4YJGA 4BKPA 4I5FA 4QO8A 1OMOA 1Y5RA 2GZ1A 4L9RA 4PLHA 4DLAA 4E2YA 4ZQHA 1HDYA 4GH5A 3TDKA 5THQA 4BQPA 3H65A 3V2HA 2GYYA 3DAPA 4WCDA 1NYTA 3QWFA 2V7PA 4R41A 2HDHA 5F1OA 4R9SA 1KBZA 3BMNA 1MFZA 3I1JA 1LLCA 2BH9A 3DDNA 2WMDA 4UREA 4XYEA 3DAGA 3R3JA 5G4LA 3GGOA 3SVTA 3W4IA 3WQRA 1LXCA 2VHXA 2O7QA 3BMQA 1PL8A 1QG6A 3U4CA 4X54A 2NTJA 4YVFA 2W2KA 1XQ6A 2NTVA 3NV9A 3GGGA 4S1VA 2HJSA 2G17A 4II3A 1NAIA 3U4HA 2VT3A 1NTOA 1G6KA 3L4BA 3NKLA 4RCVA 1E3JA 2X58A 2R6JA 4PZEA 4IGEA 1LTHR 2QHXA 4B3JA 3CH6A 1Q0LA 1KS9A 2NADA 3JYNA 4IDBA 4XYMA 4CQMD 3GT0A 4OGWA 1E6UA 1YWGO 4H3VA 1NWHA 4I1IA 1GDHA 3H8VA 4IGFA 2X0NA 3GQVA 1GR0A 1QLHA 2Y0CA 1WZEA 2H6EA 3UOGA 2H1SA 1LDEA 3FHLA 5F1KA 4E2WA 5ILOA 1DIAA 4BMSA 1BGVA 1C1DB 1NQ5A 4AG3A 2W8ZA 5A05A 1DFHA 5L4LA 1KIFA 2J5QA 1ZJZA 1A27A 5CEFA 3AFNA 1FXSA 4CM9D 4Z0PA 1EQUA 5KVSA 4IMPA 1LLQA 1Y9EA 2DBVO 3DAFA 4HFRA 2NM0A 2JD0A 2GN8A 3QHAA 3VAZA 2P9EA 2XPCA 2B4RO 4BV8A 3E5MA 3VPSA 3PHHA 2UUPA 1U3TA 3JQ8B 3AY3A 3W6UA 5ER9A 3EC7A 4RVDA 4DIOA 4IM7A 1PZHA 3DC2A 3I4FA 4NJMB 5AOVA 4ONEA 3I9LA 5ENVA 3UHAA 1P1IA 2EGHA 3FWZA 4CLRB 4PGFA 4Q3CA 3QV1A 3SJ7A 3WGHA 4EDFA 2Q50A 3VC7A 1RM4A 5TGDA 1VM6A 1YRLA 1C0KA 3TF5A 2VHZA 3VZQA 3ZWNA 4BKUA 5ADHA 4H16A 4DLBA 5JYDA 3RBZA 3BZUA 4XA8A 2BF7A 2VQ3A 2ZYDA 3WICA 4RV9A 1ISJA 4XYGA 5T6BA 2DU8A 2GNAA 1TB4A 1SOWA 2HQ1A 2D4AA 1R15A 1VL0A 3PJFA 3DQPA 3B20A 3W4KA 2P9CA 4J7XA 1PWZA 1Q7BA 3RUIA 1ZMOA 4I8XA 5A04A 1D1TA 3BAZA 3SJUA 3DZJA 2E4AA 2Y1EA 5GMOA 3O8QA 4JXKA 3C1AA 4ALIA 1ARZA 5AQ1A 5T57A 2QQ5A 1Y8QA 1PR9A 4BNNA 3IUSA 5ER6A 3TFQA 2YQ5A 4HFMA 4WLVA 1UZMA 1ZXLA 2AE2A 3D64A 1YQXA 2HMUA 3JQAD 4BO0A 3JQGA 4CM4A 3OHSX 4E3ZA 2X9NA 1I3MA 3NRCA 3NGLA 1N2SA 1VRWA 2D1YA 4GWKA 2CY0A 3DOCA 4KUHA 1E0DA 3PEFA 4N18A 1LI4A 3MWDB 1U28A 3PXXA 3VPXA 5DP1A 3KSZO 1QSGA 3U3XA 3RJ5A 1T24A 4TZTA 4AFNA 2O3UA 5ENDA 5A1TA 5TT1A 1K6IA 5L7TA 3RKRA 5ICSA 2JL1A 3OFSA 3WB9A 3JQAB 1E6WA 2NWQA 2P68A 4CUZA 4RVGA 4DC0A 5LDGA 1PS0A 5T67A 4KTTE 4WJZA 4Y8VA 2E49A 4MJLA 4FBGA 4M1QA 4CMEC 1E77A 2JCYA 1VSVA 3FTPA 3RIHA 4WLFA 5JY6A 3Q9UA 4OXKA 1Z7EA 3EVTA 3KYBA 3X2EA 1AGNA 2NV6A 2VUSA 3VH2A 2CZCA 4E4YA 1YJ8A 2C2XA 4R4JA 1LBEA 2GR9A 4YRBA 3ANNA 4RPHA 4ALNA 5A9SA 1GEEA 3RFVA 2J3IA 3FRJA 4EGFA 3QY9A 4BO1A 3NAQA 2OMEA 3PP8A 1ZH8A 1KOLA 2HMVA 3ICCA 1NP3A 2D2IA 2VTDA 3N7UA 4IDEA 2O3RA 4NBRA 3GRPA 4DYDA 3JD2A 1DRWA 3T7EA 2G82A 4BO2A 3JQ7A 4YJFA 3E5RA 2WE7A 3ANMA 3M1LA 4JJFA 3C7AA 3FNGA 2DC1A 3FPCA 3ZNQA 1BVRA 4FQ8A 4Y6SA 2NLOA 3INRA 3JQ9A 4QFDA 2ZTUA 3FNHA 4BOYA 3I9OA 5U4QA 1L7DA 3RC2A 1NNUA 3KYDA 2JHGA 2JJYA 4FSHA 4GSLA 3Q0EA 1DC4A 5L53A 3L9XA 3JQ8A 1KVUA 4OMUA 2JFGA 1GUFA 3U49A 3OA2A 5K6AA 1BRMA 2DBQA 2VUTA 3H9JA 2VZ8A 4UAGA 3RQSA 4DQVA 2PFGA 3A06A 3ASUA 4YB8A 3F3SA 3ICPA 3JD1A 5CHEA 4EW6A 3B1FA 2UAGA 3PHGA 4FJ1A 3KB6A 1EBFA 1PTJA 4INAA 1GAEO 5DNAA 3MCVA 2VWQA 1NBOA 3MTGA 3ZWVA 2X0IA 3JQGB 4CM4B 1ISGA 2NVWA 2Z95A 4OSPA 2NU8A 3ROQA 1WLYA 4DA9A 4CLOA 4Z6KA 4CLDA 1A5ZA 5EL0A 1MC4A 3K31A 4YAJA 4MO2A 1I36A 1U4SA 4ZQFA 1ISMA 1GYRA 1NXQA 1DIBA 2OP0A 2Y66A 4ITUA 3LT1A 1YDWA 3CEAA 1H9BA 3GUCA 3HDQA 4UEKA 4E5KA 3LF2A 3IDSA 4BKQA 1OC2A 1SZJG 3WYEA 5JCJD 4D44A 4WGGA 4OO3A 1KEUA 4XJTA 1NPTO 4FB5A 3A9WA 1HE3A 1K5HA 4CR6A 4D43A 4A03A 4R1NA 4PG7A 3N58A 3IKVA 4TMFA 4TRRA 2EP5A 5CEEA 5L40A 3KTDA 2WSBA 4NBVA 3WLFA 2UYYA 2B0JA 2CNBA 3BTOA 2HUNA 1MUUA 3ITKA 1K0UA 4B79A 1AUPA 3JQEA 3E8XA 2Q4EA 3AWDA 3BTSA 1UZNA 4R5HA 2WWRA 1PR3A 2AG8A 3LLVA 4QSMA 4W9NA 1SEPA 2NU6A 5J23A 2J3HA 4DIFA 4CLRA 1M67A 2Y93A 1BXGB 3MTJA 2PKQO 3VPGA 5IFLA 1C0LA 4QO7A 5I7FA 4GX1A 4ND4A 3WTCA 1I5RA 2NQ8A 1PZEA 1W8DA 3C1OA 2HRBA 4BGIA 4GX2A 2IZ1A 6LDHA 1MG0A 3WR5A 1D3AA 1EZ4A 3O26A 1UP6A 3O8QB 4UUOA 2RHCA 4CM6A 3WTBA 2DPGA 1B8VA 3OECA 4BNTA 4EUFA 1ADCA 1H9AA 1E3IA 2VWPA 3NJ4A 3QVWA 2G1UA 3PYLA 4RLHA 1UXIA 4YEDA 1N7HA 1WXDA 3K92A 4FC7A 4YJHB 2HK9A 4PN3A 2PKRA 3GN1A 4XYLA 2BMAA 3WSVA 3IKTA 2Y68A 2OBNA 3UH1A 1JKFA 2VUUA 4IQGA 1K6XA 4PLWA 4TSKA 5EERA 1EFLA 1YKFA 5AXBA 4BNVA 4DPLA 1H6AA 2VCYA 4FIZA 3IUPA 5DBFA 4KP7A 3S55A 4FW8A 4HP8A 1FJHA 2C5AA 4E2XA 5JMWA 1D4FA 4XQ9A 2Y1GA 1SO8A 3HE3A 1LSUA 4BNYA 1R16A 1MLDA 1E1LA 1SMKA 4CM1A 4IPTA 3UN1A 3LK7A 1KEVA 4D46A 1VLLA 3ZHBA 3GDGA 4YAGA 5KVCA 2BGKA 3PIIA 1F0YA 1H93A 4BMVA 2FY8A 4CMHA 2PGJA 4LRSB 4H7PA 2Q2VA 1X7DA 4J3FA 4W82A 2WEKA 3D3EA 1C1DA 1EVYA 1JQBA 3DBLA 2Q1WA 4PIVA 2PZJA 3D1LA 1EFKA 4W6ZA 1BW9B 2RH8A 2V6GA 3GZNB 5BNIA 4IXTA 2IODA 1LRJA 3FSRA 1EEHA 4TZKA 3I9KA 4PZDA 1TT7A 1YL7A 3UGKA 3WS7A 5JYEA 2ZCVA 1L1FA 4NMHA 4U6QA 4E6PA 4XQGA 2YZ7A 3KYCB 3ETDA 1PGNA 1E1KA 1NASA 4I5GA 4IIVA 3WBFA 4XYBA 4C4OA 3S2FA 2OORA 3PHIA 2ZYAA 1V0JA 3Q9NA 3I6QA 3HDHA 4NJOA 3KSUA 1VC2A 1UP4A 4XIJA 2IXAA 2CMDA 4IDGA 1XYGA 2Q46A 4NJMA 3WG9A 1JAYA 1SPXA 2Y05A 3E1KA 4J49A 4N5MA 3A14A 4AJKA 7MDHA 3TSCA 4GX5A 4CMEA 2J3KA 3DBRA 3FNFA 1I30A 5H81A 2O3SA 3ONDA 3PWSA 3CTMA 4J16A 2OUIA 3OICA 4XR4A 3SC4A 3F5QA 2B4QA 1GYPA 3AM3A 3ASVA 3RUDA 1D7OA 3R1IA 5LC1A 4E31A 3OEWA 2X9GA 2C7GA 1IPFA 1B16A 2D8AA 2JCXA 3NYWA 4WEOA 5TJ9A 4PG8A 4R54A 2BLLA 4P4GA 1HSOA 1BHSA 3G17A 2AXQA 2Y0EA 2J5RA 3GNTA 1O89A 1T2CA 3WWZA 1KY5A 3IC5A 3K96A 3HQ4O 5JY1A 1E7YA 3PRJA 4IXWA 5A9SB 2NACA 3FCOA 1RWBA 2EGGA 4RF5A 3ULKA 2EKPA 1U7HA 2P91A 2YV2A 1DC3A 5I8WA 1Z6ZA 4L8VA 3LVFO 1F12A 5EQDA 1ZEJA 3CSDA 1LU9A 1MP0A 4MPDA 3WGIA 2DAPA 4YQYA 4B8WA 3IP3A 4GKBA 2Q49A 1VL8A 1I33A 2A4KA 4M87A 4BB6A 4BGEA 2CDBA 2WE8A 4G65A 2HMWA 2HAEA 1VKNA 2BD0A 1C0IA 1GY8A 5TNXA 3C1TA 4BNXA 1T2FA 2BRUA 4WASA 3RWBA 4JK3A 4A26A 5JFOA 4J9UE 2PGLA 1YB4A 3QWHA 1BW9A 3GZNA 1QV6A 3DFUA 1P0CA 4B8ZA 3RU7A 1ZUD1 4EI2A 4U7WA 2B36A 2Q2QA 4TWRA 1DFGA 3D3WA 3BHJA 4MKXA 1DHRA 2VTEA 3BMCA 4ROSA 1KVRA 4CMAA 1GV1A 1G0NA 2VYVA 2C82A 1GQ2A 1GCOA 2CF6A 1R0LA 4PLVA 3NTQA 3K2EA 3VKUA 1U3VA 2CDAA 3CMCO 4Q3EA 5K0ZA 4GWGA 3ZW8A 1UXJA 2IEDA 1XU7A 2F00A 3DBVO 1NR7A 3SLKA 3WQQA 4JIGA 1D8AA 4GGPA 4C7JA 4ZQBA 1JDJA 2B35A 3LC2O 4ZQEA 3GHYA 5AVOA 1WDKA 2H5LA 2HMTA 4ND5A 1N7GA 3SBOA 4FFOA 1PJ2A 2P5YA 3BTVA 2YJZA 5FI3A 1UAYA 1RJWA 3ZH2A 1KY4A 1Q7GA 4BVAA 1VI2A 5KJFA 1Z82A 3LT0A 3VDRA 3FR8A 4MKZA 4DGSA 3KSDO 4B7UA 2Q4BA 4NK5A 4ZICA 1JLLA 3PYXA 4BIIA 4PLYA 1BXKA 4S3MA 3F9IA 4TRMA 1CF2O 1QYCA 1ZBQA 1JWAB 4K9DA 3KLPX 1SB9A 1GL3A 2Y1CA 3BYZA 4I9HA 2EERA 3KYCA 4IJVA 2BFOA 2RAFA 3MEQA 1E92A 4FCCA 2DFVA 4PLCA 3WBBA 3D5TA 1MB4A 2VHYA 1ZEMA 3ZV6A 3GAZA 3DOJA 4EJ0A 1U2GA 2V6BA 4MIEA 4LCEA 1VJ1A 3W8DA 1WDMA 4GVLA 3V1YA 4J1SA 3U09A 9LDBA 1HXHA 4P38A 1Q0HA 3HZZA 3HDJA 5IZCC 1TVEA 4MVJA 3IMFA 4M55A 1ZO8A 1BXGA 3F47A 3L0DA 2I3GA 4FS3A 3ZHZA 1HEUA 4CL3A 1X0XA 4CR7A 1E3LA 3OQ6A 3PJDA 5A9TA 1T2DA 5BNTA 1ISHA 4YTEA 1TXGA 3R3SA 2X5KO 4BMNA 3SX2A 2DTEA 4Q3NA 3D4NA 1GZ4A 4O0LA 3GA0A 1NFFA 4EEXA 4O6VA 3AI3A 3AJRA 1EUDA 1HETA 1XCBA 1HDRA 1YO6A 4NK4A 2C0CA 4DPMA 4NPCA 3VTZA 4MVJM 2X0JA 4YPOA 2WYWA 1P1RA 1H94A 3DB2A 3CMMA 1XQ1A 1HDOA 4PRKA 5F21A 1WP4A 4J91A 1PU2A 4JN6B 5DZSA 4HV4A 5C7IO 5IDXA 3HJAA 1R0SA 5TQVA 3VH3A 1DLIA 4YXFA 2YUTA 5I9MA 5IF3A 5C7LO 2VHVA 1SAYA 2X9VA 2HLPA 1I0ZA 3NX4A 1TI7A 3OEYA 4E0BA 4JP3A 3RBVA 5DOVA 5L3ZA 3H9UA 3HB4X 4MIOA 9LDTA 2I76A 1DIHA 1DC6A 1YB1A 3MJ4A 2RCYA 5G4KA 1S7CA 2VYNA 1RYEA 3BHMA 3QA9A 2PD3A 3K6JA 3LQFA 2ZK7A 1N5DA 1E3EA 1C1XB 4NZ9A 1E7WA 1A7AA 3O9ZA 2VHWA 5FF9A 5G2OA 4DQUA 1LDYA 1S6YA 2Q1UA 3GFGA
chains in the Genus database with same CATH superfamily
1JWBB 2QN8A 3GJ6A 3LBAA 5CVCA 3FDZB 4F85A 5IVPA 1QORA 3PD1A 1QFZA 4BJ5A 5AW6A 4XDZA 3CGWA 4PYJA 3AMVA 2BUBA 1S1MA 2MSWA 4MUNA 3WLNA 4AZTA 2MR5A 4WY5A 1JHMA 1OASA 1XF1A 5AW1A 2V96A 3FETA 3OEHA 1XNQB 2JARA 3OE4A 3C14C 2FE4A 2RB5A 1HY3A 2G5CA 3TZKA 5EJ4A 2IV3A 3AF6A 3W34A 3WMGA 3RHTA 3JYPA 5AWFC 1NU8A 1UMCA 4O2AA 4YGXB 4BC0A 4OHCA 1NVFA 4M9ZA 1PLKA 3FZGA 3DMDA 5AUQA 3U6BA 5DN9A 3H1PA 4YQZA 2OFFA 1CUDA 3UW3A 3ZW9A 3HDYA 3Q1KA 4ZI5A 2C2MA 4JEMA 5GINE 3IQXA 4ARAA 2BTOA 1NU6A 1JVNA 1TQ6A 4KFTA 2R65A 4DJDC 4HDRA 1R7RA 2JRCA 1IWOA 2H57A 1U6IA 1KDPA 2NNLD 1IC6A 2QM3A 3GF4A 2OHGA 4P9NA 1XG5A 4HATA 5IN4A 5LA6B 1I32A 5CH3A 3THYA 3HR8A 1JFFB 4FMDF 4IXDA 1QR6A 2ISSD 4ZVVA 3U81A 3T1HB 1VGRA 1Y4ZA 4D74A 3AR2A 3HO8A 4LYGA 3ZE8A 1UK7A 4F8EA 1OLSA 1HDGO 5IM4F 3LHSA 4EFNA 1IN7A 4MP3A 2IYEA 5CX1B 1VBFA 4MWZA 1JNYA 4R05A 1V6SA 2W6OA 1N2JA 1AUVA 1POWA 1KJNA 2ARKA 2HZ7A 4BUJA 4DJAA 5ITVA 1R0RE 5L8VA 1ECCA 2COEA 1UINA 1SC4A 4ETMA 2DBYA 3ENZA 5EJ8A 2C4HA 1KYTA 2AFHB 1H6DA 2Y9MB 3VR4H 3ZJ5A 3FNRA 4HMQA 4N12A 5JCOC 2HN9A 3CSSA 4F4CA 4DVGA 3M6IA 2CDRA 2HRDA 4D9IA 4PGGA 1OXSC 4C7MA 3ACCA 2ZTVA 1MQ9A 1Z75A 2WSIA 2WU1A 4KQWA 1C7EA 1QYVA 4OM8A 4WDQA 1BC5A 1P91A 1NNLA 3ADPA 3IESA 2R96A 1G2OA 3DF9A 1Y3BE 3SDSA 5JPIA 2AC2A 1X42A 3R7NA 4LOHA 3K6SB 1VCHA 4P33A 4YAOA 3ND6A 1UC8A 3VVMA 5JV5A 3S81A 3T5PA 5LBTA 3ROXA 1D0VA 8AT1A 5FADA 2ZG6A 3H97A 4HTFB 4R2XA 1VG0B 4NV0A 3HMQA 2HJVA 1VI6A 1LZKA 1R6UA 2Z8ZA 3EMKA 1KZ1A 3QEOA 4N6NA 3TZHA 4BYMA 4E32A 4HDNA 3NOXA 5K3CA 1U8EA 4EJ2A 3HLTA 4KGVA 4DANA 2IY9A 3KYDB 1BMDA 1PEYA 3WSTA 2B1RA 4QU5A 4FFBA 5F78A 5CBPB 1EUQA 3WWYA 2J9FB 4WZ6A 3EXG1 3TLMA 4B6EA 2OGWA 4H0NA 5BOSB 4DAOA 2GN1A 4L75A 2WSYB 3E9RA 1TYBE 2CBZA 4RD0A 4TXJA 5G0WA 5TRTA 3BA1A 3T5MA 3VMMA 2C3OA 5ICFA 4BLUA 4X45A 3AZPA 2IBTA 4Q6WA 5F5NA 4B31A 1MJHA 4JJ7A 3TRJA 4GQAA 3DKVA 4DSOA 1SXJE 5B3JA 2GRJA 1J1IA 3I2IA 5MN5A 3WZ2A 2PJRA 3I04A 2QTNA 2C4KA 4D8UA 4XVQA 2PWBA 5B36A 1EVIA 5ALXA 2QVCA 2AEJA 2VZEA 3O91A 4MV5A 1L5SA 1USKA 2HU8A 4NAUA 4LC0A 3NU1A 3VPBA 5EUBA 1I7LA 1XZQA 2JCGA 3TOZA 4BNUA 1G17A 3AVUA 2I9KA 3D3QA 4G0OA 5HKAA 1N9GA 1PL7A 3PVCA 3V3TA 1JDBC 2YXDA 4LSMA 5JR3A 1UF9A 1JNXX 1QF7A 3BBLA 2AZTA 3PIRA 2NVUB 2CFOA 2PZMA 1NURA 4OH7A 5JNUA 1YK0A 2ZP1A 3O4RA 1A97A 2W90A 2XVMA 3CLKA 3O90A 3KXIA 3VKFA 1MRSA 2CNLA 4XWGA 1D7AA 5FWAA 2C9CA 1U8CB 3UMBA 3R24A 3ZE9A 2CMKA 1V16B 1FNDA 4ZQCB 5HZMA 1XEFA 3CPEA 5I9IA 2GN4A 3GXBA 4KMOA 2EJTA 3OH8A 2NYRA 5KKAA 1ZU5A 2I66A 4MUHA 1RIIA 1Z0AA 3BPSA 1TFUA 4M1ZA 1BCSA 1GPBA 4W5HA 5MGBA 4HRAA 5EKSA 1L5KA 4YO7A 1YR6A 3C8HA 1DX4A 3JQRA 2OKGA 2PZLA 4NAHA 4YA6A 3PXCX 5EFZA 2J4CA 3ZQKA 4B9EA 2WIJA 5AVSA 1P4GA 5CUQA 2W6JA 2IPOA 2Q8NA 3HJNA 3ROFA 3VR3D 1U5CA 3IE1A 2WSMA 1TM3E 4BCCA 4GLJA 2BZ0A 2YBEA 4MGIR 3SSMA 1QGUA 2GZ3A 3UWMA 3WGZA 1E3SA 3LRTA 1Y33E 3MMSA 2W6NA 3H8SA 3HYRA 5G53C 1CZOA 4ZOBA 4X20A 4WXMA 3TL3A 3TNJA 4GE3A 3EFOA 2AUMA 4ALJA 4CIYA 4IR7A 4QYMA 3UMJA 3FRHA 3HNPA 1KRHA 1ZZEA 2WZQA 3GCDA 3KHKA 1KAEA 3AUJB 1IHYA 2BTQB 2I6XA 4JUCA 4OQFA 5DO9A 1SC3A 1KSFX 5J43A 3P96A 1AQIA 3OZEA 2CXUA 1ESEA 4C43A 2D0OB 2VH5R 3DFIA 3ANSA 4GUDA 3UG7A 2GASA 3RASA 2PX5A 2ATIA 3DTTA 3QVJA 3V8NA 2YS6A 3VR6A 1NQXA 4QDOA 1J8VA 1DQYA 2IYQA 1V39A 4FMBB 2VYQA 3AV0B 4HZGA 1PX0A 4RQBA 1OXVA 3WGTA 3TPCA 5FA6A 1E1QD 2IL1A 3RH0A 1IQ0A 4UDNA 3ZWCA 4OYRA 2OG2A 3T1YB 3CWQA 1JPUA 2Y1DA 3C3BA 4HAXA 2Z3WA 3RWMB 3WB1A 3AM4A 4CIAA 5JSHA 1RYDA 2AYYA 4PPFA 2FP4A 2WIFA 3C98A 1U9IC 3EAFA 3E05A 4Q9HA 1HK7A 1J24A 3JV7A 5D8DA 2OK8A 2CVOA 3E27A 1M1ZA 1G38A 2XXAA 3LC7O 2BMJA 1LDMA 1LPMA 3UC9A 3R5FA 4F4HA 4DV1B 1GN8A 5B6JA 4B3IA 4I9FA 1RBQA 1OB5A 4NZMA 4X8MA 4DEYA 4RYLA 1NDQA 3KEQA 5JE8A 5ALRA 1AF4A 4HWRA 3VR6D 1KDTA 1Y8CA 2AOUA 2I55A 1SKYE 4J0IA 5DASA 3SNHA 4AG6A 1XEAA 1GLVA 1QWSA 4GMGA 3TOCA 3X2FA 3W04A 5FAKA 3PVSA 1QB8A 3CJTA 1J20A 2HSWA 3D3WB 3OFNA 2C3PA 2VHJA 2FW9A 3F4LA 2O59A 1EPUA 2DUMA 1IUOA 2XUQA 5AYVA 3CVYA 3QEAZ 1VXRA 1MR3F 3UAGA 3WVNA 2ZB4A 2ICAA 2WAXA 4AWAA 4Y0NA 1JLRA 4KQGA 1FQOA 3VI3B 4D2IA 4DA0A 3P7MA 3V97A 3A1WA 3KS9A 3Q6NA 2AW5A 3PGA1 4OD0A 4XZ3A 1P7WA 3R7AA 5HKOA 1KVSA 1QFYA 5K45A 2DH6A 2OQIA 3MK31 1I01A 1E61A 3OKPA 2GBPA 4KE7A 4Q02A 2AA3A 5K09A 3ZVRA 3FYCA 5G0SA 4CE6A 2VK4A 4P7JA 4CHTA 4EVRA 3E18A 4YCCA 3R6GA 4P3KA 3THXA 2OZLA 2R44A 3OF3A 4OKSA 1EP2B 5DXJA 3SEQA 1EUZA 2Q7DA 3FPBA 2C8LA 3I45A 3FZNA 5JZ9A 3MAJA 5BR1A 3N74A 2Q6OA 4ZRNA 1UOEA 3ZE1B 3IP6A 1MA0A 4IIJF 4YP0A 3UWDA 2G9RA 3GROA 1L2TA 4O4IF 3IDZA 1T9HA 2ZUVA 1EQ2A 1R10A 4DSZA 4ZRMA 4TMWA 4IIFA 2QE7A 3AB3A 2PANA 1BO6A 2FUNB 4EG0A 1L4KA 1P4AA 1Z7WA 1P2BA 1BS2A 4U0KA 4UVGA 4B34A 4O2AB 4IX1A 5KNLA 3K70B 1Q15A 5BSGA 3FLEA 5EGSA 4R69A 5F51A 3FPGA 1JIJA 3EZ7A 1EWTA 1UQUA 2OV3A 3GJ0A 4JSTA 2JBAA 1JG7A 3HKEA 3CLSD 3BB1A 1DOHA 1Y82A 3QF4B 3UUFA 3ZHXA 5FUXA 4NCAA 4OXNA 1UJ2A 1XTIA 1MO2A 3T3PB 1S3IA 1JA9A 4NG5A 2AEMA 4JL6A 2VT6A 1UDXA 2CWWA 2REXB 1SN7A 2W2PA 3HJCA 3TR6A 1OWNA 3TAXA 3WBJA 4D9HA 4YV7A 2RIRA 3U7QA 2WA1A 4MJXA 1IN6A 4BB5A 5FWNA 1G8PA 1LQ2A 1YUNA 2LDBA 3DHYA 3KAPA 4YMGA 5T5QA 1XRSB 4DJFC 5IU6A 4QGAA 3JTMA 2QAGA 1UPFA 2BGTA 3D6VA 3CH5A 5FKJA 2E5LB 3RS2A 2ET6A 1KQPA 3AXTA 1PCXA 1EKXA 2DUWA 1W5FA 2DTXA 1N8TA 2FPPA 3FPHA 1ZSNA 3CUTA 3K32A 4JX9A 4DMMA 1AHHA 5J40A 4BBAA 7ADHA 3LXMA 1FLDA 1CQPA 3R5JA 4D3ZA 4KIUA 2CL5A 5EWJB 2FG7C 2CNWD 3KEFA 2L82A 2HJ9A 1U8XX 4W1PA 1KYVA 4RXMA 1ZI6A 3USES 2PUCA 1I2MA 1SC1A 1C8VB 3G68A 2DCUA 2RBEA 3OZTA 1Y5NA 4UHHA 2R84A 4ATNA 4CLOB 5FEMA 2DVMA 4BS9A 3BWMA 3KB8A 1JW9B 1FA9A 3K30A 2JAHA 3OTHA 3L6UA 1IL0A 5CR9A 4FEAA 2ETXA 2BHNA 4G6ZA 3Q15C 4HDOB 5AKZA 2ZJAA 4J2TA 4XI9A 3WQBA 4EVIA 4CKEA 821PA 4BGUA 4BNMA 5ALHA 2IZ0A 5H1YA 2HQRA 4DM3A 3H0EA 3B9BA 2QUAA 4XIGS 1P72A 4NEHB 1KAOA 4PFJA 1MAUA 2BFFB 4HDKB 2JASA 4LVUA 2QKYA 1VGQA 1RQGA 5CVJA 4YMIA 4A2WA 1F6DA 3V7WA 2C99A 3TTXA 4B4DA 3TFOA 2E4YA 1THZA 3A3KA 2C8VA 3G0DA 1BX3A 5FBZA 2PO5A 2VQ6A 3NVAA 1G7TA 4ZI3A 1KQFA 2HHAA 2VH2A 4UVEA 4ZK6A 3ZDCA 4NFYA 2W2QA 1DKOA 3IBGA 1JXOA 3ZD8A 4HTAA 1DBIA 2RGDA 4GZ5A 3U3OA 4E5VA 4EYKA 5ICMA 1RWXA 3KQSA 3FW1A 5JJBA 2OBYA 1QKKA 1JE1A 3CKYA 2HA7A 1OKKD 2WT9A 1YBVA 3KR9A 4EHAA 2ORYA 4WPGA 4JP5A 4JODA 5HDQA 3VPFA 2QPOA 1AXEA 3KPYA 2GAJA 3CH7A 3DLBA 4PIMA 1Q1QA 3FOEC 3HZHA 4EI9A 4X8HA 2XB9A 3VSAA 2CCKA 1RXSA 3PGVA 1ZRSA 5DM4A 1WB9A 4AICA 4LX8A 4DNFA 8ABPA 4JEHA 1NWCA 1U8YA 1FDVA 4CMBA 1ODFA 3ZUPA 3T9BA 1TVMA 3JWJA 4QL3A 5TGTA 1FQJA 3HO1A 2XTAA 4HNGA 4LRQA 3H6GA 2QTHA 4MEJA 4DV3B 4LKOA 5COBA 3QPCA 2J45A 5AJVB 2C9BA 1UMDB 2XQFA 4BAZA 4ZDKA 1F0NA 1CEEA 3PJEA 3RI3A 3E2PA 5LM3A 2FFQA 5CT4A 2W42A 3T54A 4JL8A 3ZCUA 4CF5A 3M5CA 2HJWA 4ENSA 1YB5A 4KMMA 4XRRA 4BNGA 4FTWA 4DMRA 4LJSA 1O0SA 2CSUA 1ZAYA 2NXNA 1TKCA 2EW2A 3EAQA 2P40A 3EBLA 3TZLA 3PA8A 1HOXA 1ORDA 2BRUC 3FD8A 3H4MA 4GOKA 5IF9A 3OTQA 4MDHA 3THXB 4RV5A 4IKEA 2Q7XA 4S1OA 3AOEC 5MFPA 2P30A 4HNTA 1T1JA 2ANBA 1TTPB 2X3YA 3C43A 1R6AA 4PNPA 4F2DA 4BAGA 2A3NA 1P45A 1Y6JA 1K06A 1OTYA 2VDMB 2AF4C 3L82B 1V8BA 4RF2A 1URPA 3NBMA 5C37A 2ZDHA 3D4PA 2QGNA 5HJ2A 5TSDA 3V1UA 3CU5A 4MDEA 2DJ5A 1FSSA 2IHUA 3NKFA 3OQNA 5FOXA 3PIDA 4E12A 4N41A 1DTSA 2HNKA 4YH1A 4UTRA 1LA2A 2JBHA 4LCJA 3UMRA 3F67A 1X7WA 3GC6A 2BP7A 2Q1TA 1RBYA 2EC5A 3HRIA 3AEZA 3EXG2 2D5CA 2VDRB 3DLIA 5DIFA 2VP4A 3JQQA 1RBZA 3IELA 2VEOA 3BHIA 1SNYA 1KJQA 2RHBA 3BD6A 2XRYA 4M8IA 4QECA 5EEGA 1J5EB 1RRCA 4UBJA 3UK2A 1ESMA 4LY0A 3ZN2A 1U9YA 4N54A 4ZTZB 4FMDB 3MS7A 2LIPA 4PWZA 4LA4A 4YGYA 4ZOCA 5K4AA 1AQNA 3RSQA 3ANYB 4GQIA 4BO7A 1UXKA 5K3OA 1FYWA 3HH8A 4RJJA 3KALA 3MTEA 2QLNA 4WT7A 1XPUA 1EXWA 4Q39A 2UUCB 1P74A 2X9LA 4AMZA 4Z5XA 5TF4A 5K8JB 4LPSA 2J87A 5G02A 2GHIA 3RABA 4B6GA 2F8TA 3GLFE 5ULLA 1G3UA 3LDGA 3W8FA 7MHTA 1DV1A 2AX3A 2NVUA 3OQVA 2QZSA 4Q7EA 1XBTA 1G98A 2H08A 3IMKA 3Q7RA 2ZAMA 4NEQA 2WB2A 1GZ5A 2ZI6A 4GEKA 4E1VA 2VI5A 4D96A 1PS9A 4AJ4A 4OHPA 5IABA 1IHXA 4EY4A 3C8UA 1U9ZA 3H5WA 3W9SA 1F6BA 3FCUB 1FU4A 1P29A 3IBYA 3OETA 3UKDA 2J32A 1DU4A 3VI4B 5IXSA 2YJGA 1I4OA 3T3DA 1B4DA 1Z3CA 1NMSA 1V37A 4I4TF 4N6OA 4DMHA 1WXWA 2OL4A 4MVJD 4ZMBA 3HVKA 4Q7KA 1Q7RA 1ZD9A 3HHEA 3FY4A 1VSUA 2X7JA 3QKRB 5CVDA 1V8ZA 3FX2A 4NH0A 5JHHB 1EMDA 2DR0A 3ENVA 3LXXA 2FLWA 1PV4A 4W1QA 5LP6C 3EFOB 1HWYA 3FXAA 5DDIP 1J4AA 5SZKB 3VC1A 4BFWA 3FMFA 1R1DA 3DT8A 1OFIA 1KY3A 1WY7A 1EAYA 1HOTA 3P0JA 3NR2A 2P4HX 3MAAC 2GCOB 1L3CA 2XUIA 1BVUA 4I1RA 3SXJA 1K66A 3L7JA 1J0DA 1U9IA 1M2FA 4KVGA 3WIEA 1FYDA 1NR1A 5DCWA 1J39A 2XTNA 2EW1A 4HEA1 4KSBA 4G9BA 3N0XA 3LYHA 1YI1A 1MEEA 2QIOA 2DQZA 1T5HX 2HCRA 4DR6B 4FN5A 4FFLA 5L9AA 3I58A 1SKMA 2WUFA 3TRKA 3AVXA 1U7ZA 2XF8A 1V8PA 1N0WA 3LC0A 4NOKA 1JV2B 1QBKC 2XE6A 3AL0C 2PZEA 3GRZA 4OEHA 5SY4A 4RORA 3FH0A 1S8AA 2IXBA 3U7GA 1IZ0A 2DUJA 4HAOA 4LZAA 4PS0A 3T9EA 3V42A 4ZTUB 5B12A 1JMVA 4QM7A 1C1HA 4TVBA 4S12A 1H3FA 1XXHE 2O3JA 3E9DA 3THOA 4QTYA 3OZDA 3CNBA 3P0HA 4G8CA 2JCBA 2G8NA 2ONYA 3VHXB 1U04A 5AVUA 4MTLA 1E4VA 4NTZA 4X95A 3WWOA 2YVKA 5BMVA 1N2CB 2JIMA 1P6QA 2RJNA 5E7JA 5FPYA 3WYBA 3H42B 2NO7A 2IELA 3JWPA 2CZQA 2XMPA 3BG5A 4PBTA 1NMEA 1XZBA 3P52A 4OB7A 1ZNQO 4AL4A 1N34B 2JGMA 5KTTA 3TKYA 1P1FA 4GM1A 2YJ4A 1C7RA 1C8KA 2XD9A 1D9ZA 2BKXA 2JKZA 3IHKA 2MYUA 4OB6A 5HQJA 3KOYA 2GSWA 4F3RA 2X3UA 3R7BA 1RMQA 1R5BA 1IXZA 3AP1A 1PFGA 2VJCA 3LYLA 3GH1A 2C2GA 4KWHA 4KR6A 1Z4QA 4EUEA 3COSA 3AIMA 3UT5B 4YO8A 4PICA 2XAAA 2AHRA 2F3PA 1Z2AA 4GMKA 2RHGB 1M66A 3ZCQA 4EJMA 1GPJA 2K4MA 5B1HA 2YXPX 2AOXA 3NIBA 4HDRB 1ADBA 1HQDA 5ISMA 1XP5A 2C59A 2H63A 4K6OA 4B83A 2AG5A 1IFXA 3U7QB 4QDJA 1C9JA 5IC5A 3VYTB 4XB2A 5ED0A 2CUZA 2Y1WA 1B0UA 2J08A 4PRZA 4GL2A 4YN3A 4BO5A 4BUCA 1YQTA 5ALVA 3KQPA 1CUWA 5E9QA 1D2CA 2PX4A 4LZWA 3OE1A 1Z88A 3ESDA 2VWGA 4HGQA 1R9MA 4NESA 1YU9A 4F04A 4PVDA 2ZB8A 2CV1A 3QNMA 1X9GA 4CMIA 3MCTA 2I2DA 3PQ5A 1W1UA 3CLSC 2IPLA 3D8SA 3X2SA 2XCOA 3KVOA 3ABOB 1QYXA 2BEUA 4YPFA 3WNDA 1EXVA 4RPIA 5KQSA 4HNAB 3NATA 1NTRA 4QICA 3T7DA 4DEVA 1T26A 2ODPA 3CRQA 3QOXA 2AG1A 5CDYA 5J9FA 4AJJA 1QR2A 3BGDA 2J5BA 1BU5A 4Y2UA 5B4TA 1KP3A 3GCGA 1RI4A 3EXFB 4HDKA 1K6MA 4AVYA 4AECA 2OAP1 4MKHA 2P2YA 1GJRA 3H4VA 5KNCD 1BA2A 2CXRA 4FYJA 3O2SB 4H7FA 5FOUA 3SQOA 3D31A 2QD1A 4P86A 1FIUA 4GSYA 1VPTA 2Z6AA 3USZA 2Q07A 1MHPA 4JLJA 4NFSA 3TEJA 3I9JA 4UJ3A 1XJQA 5HTKA 3EVAA 3A31A 3THWA 2YFHA 1K5DA 4YRDA 2GEKA 4QGHA 4C5AA 4O0MA 3RSLA 1UZAA 3NM5A 2FFHA 3NHSA 3SR4A 1W6UA 3JQFC 4ALLA 3FOCA 2ZQ5A 4ZD6A 4NECA 2I7DA 1JF8A 5DMXA 1PS8A 2O8FA 2JA1A 3GB9A 1V8DA 1ZCZA 3P26A 4OQZA 1PYOA 1Q95A 4U2DA 1PR1A 3OWOA 1AKTA 4HZUB 2WJJA 1YZYA 4UDYX 4DMGA 1A5AB 3N05A 5C1PA 4BPBA 4M1YA 4K6HA 4V0LA 4C20A 4GC9A 4IILA 4MR9A 4MW9A 4GX0A 3PJRA 3IDOA 4WBNB 2QMQA 3KKLA 2VC2B 5AESA 4PPNA 1ADGA 1QQAA 1NLFA 1COZA 1V3TA 2TSYB 3AETA 5L3RA 2D1FA 3MJCA 4E5YA 1I2CA 3NTLA 2GBFA 5K7SA 2AH5A 3ANLA 3LOUA 3ZHCA 3BMOB 4Z4FA 2ZJ8A 4S05A 3S2EA 3F6SA 1Q92A 3BJEA 5CIWA 2HV9A 1I2BA 3DHNA 4XIFA 3ZHTA 2IS4A 3WL5A 3HUDA 2QZ9A 1RYZA 3L0SA 5DKFA 3BULA 2JFNA 5K6TA 3H8WA 3I52A 2HRCA 1GD1O 3M83A 1FW8A 5KYUB 1E0KA 5DLDA 2DHCA 3L8HA 4M8SA 3IBSA 5MGNA 2M98A 4PZYA 1WF6A 2GHRA 2R7NA 3JALA 2BCGY 2J30A 3FCAA 4YUWA 1K92A 1WXQA 2X15A 1X70A 3IAAA 4D4JA 5JS7A 1ID1A 3S0JA 1FX0B 1WEKA 1CX9B 3UOWA 1T9CA 3CLUC 3DNFA 5EHGA 4CLEA 1G5RA 3SYLA 4E2ZA 4WVFA 4CCYA 1LGYA 1P5ZB 4NI5A 5AOBA 5IG2A 3SXUB 2QM7A 4C30A 2ZUDA 4K7JA 4Z49A 1M7HA 4HRYA 2Q27A 5EFOA 3COYA 4O4HA 5COQA 4QUJA 4HLUC 3HUFA 3DOEA 2GXSA 2Z5GA 1YAJA 1NXXA 2V65A 3A4YA 5EZYF 2FQQA 4H77A 3ITDA 4P2GA 4MI6A 1THMA 1LV7A 4IBOA 4ZGBA 3R0IA 4G89A 1QGUB 2RK3A 4E5UA 1NA5A 3T99A 1E89A 4QEDA 4XCVA 3VJMA 3FUWA 3KJFA 4DRXA 2QP9X 5ECWA 4C08A 3OQIA 5JBNA 1AV6A 1DL5A 4N7JA 3QBTA 4DCUA 4EUNA 1GA1A 1D1SA 1KO4A 2O8VA 3PNKA 1D0SA 3ND8A 5C5CA 3ZCVA 4ZEXA 4C4SA 4JU9A 4HEHA 4D3DA 8ATCA 5CDHA 2X7XA 4B2LA 1IJEA 1L1RA 3FWKA 1J49A 3LXRA 1A9QA 1AGPA 1UWKA 3L2OB 1DCTA 2PMWB 1VE5A 2L42A 4ZVNA 5I48A 2QLTA 1CP2A 4V02A 4BE9A 1ENPA 4MR9B 3QVXA 5B30A 1GTMA 4FHGA 4OI4A 3R41A 3LUAA 4PHHA 3P4XA 3WKEA 4EPWA 2JK0A 2HCBA 4B76A 3C85A 2C4VA 2P8JA 2PYIA 4PW0A 1WX1A 5F5XA 2FW6A 3GRYA 3PT9A 2PMEA 4A10A 4ZIRA 2QQFA 2A2ZA 2PUJA 4CMGA 1W36B 1EFPA 4QIHA 4RJTA 4RIFA 5LOVF 4ZGWA 5JJ5A 2VP5A 5M29A 1X7ZA 3DBRB 4QAJA 3I5XA 5JW6A 4Y0VA 4NCIA 2ZJFA 4IH1A 5F7OA 3BQMB 3P5SA 2JLSA 2XYGA 3QXXA 4JVNA 4G41A 3UWOA 3T0GA 4LFAB 4B6FA 2B69A 4R2MA 3UHFA 2W48A 4HGRA 5HE9A 3GPDG 3W5DA 4E21A 4EFMA 2OHVA 3SDZA 1ZH2A 2YNMA 4DG9A 2ZYSA 5F4ZA 3PD7A 2H2HA 4UMVA 3IEPA 5KQLA 2Y1OA 3DE4X 3HP1A 1Y1RA 3PRHA 4M6WB 4I55B 1SBYA 1LV8A 1R27A 4RSGA 3AU8A 3QQPA 4P83A 1ESNA 2Y2UA 3SZRA 1LLDA 5FWDA 2I9PA 5JCOA 1XSEA 4N49A 3ORFA 4OUKX 3JPYA 1L5HA 3VHLB 1CQZA 1YZ3A 4YDHB 2OYRA 4R31A 4KOAA 3I30X 3LOQA 1QP8A 1EEXB 1X39A 3ESRA 2WLSA 3QJYA 1NNI1 2J3QA 1MU0A 2TMDA 1ZOLA 2ZE6A 4ZO7A 5FBWB 4GI2A 1PFYA 3PX3A 4LS3A 4WOPA 4ND1A 1HKHA 3WRYC 3G1UA 1F2UA 4FYPA 1GPNA 2PV0A 4IZIA 3DW3X 5TVKA 4EQ6A 3CN9A 4RU1A 2XR1A 3BFXA 4CRWB 5MHTA 4OFXA 5KREA 4ZAVA 1FNSA 1B15A 4FOTA 3TIIA 5K0BA 2HBRA 3O8OB 1VKOA 1W88B 4O1HA 3B6MA 3EUFA 4HOYA 5A4FS 3R0QA 4F60A 2G4LA 3EZ9A 2HR1A 2VK8A 4G0YA 3P32A 2FN4A 2H65A 1VE3A 1E1RD 2WNHA 8LDHA 2BKLA 4DDWA 5C35A 1FK8A 4GOND 4WOKA 5LZ9A 3FNEA 1MFPA 2WWHA 3CPSA 3DAHA 2EF1A 2HU2A 4BL5A 4BVLA 4BLSA 1WWKA 3X1KA 1EVZA 3B1WA 1L4FA 3TL2A 4KN8A 2XUFA 4G0XA 5JATA 1IB6A 1NQWA 2PQMA 1Q57A 1Q6YA 2OFPA 3G0OA 3IPRA 3PVZA 1ZG3A 3AZQA 1KEKA 4B75A 4OJMX 4BNHA 5I4CA 4XLLA 2POQX 3K1TA 1YL6A 3LUFA 1DBVO 1GPWB 1U0LA 3GEBA 4P8RA 4GKJB 4V0QA 4YAEA 3OBBA 1PR4A 1V71A 2GO1A 3NUZA 4B6OA 1IUKA 3MRVA 2Q1YA 4YMLA 3GG9A 2NU7A 2GM4A 4AT1A 1IQUA 2ZM5A 1NPYA 3I23A 2DFKB 4IUYA 1KERA 1JFFA 1C3LA 2AJCA 2A67A 3N2ZB 2OG1A 3UICA 3LW7A 4DPKA 4Q3BA 3GGSA 1ILWA 4E70A 1W5AA 3CF2A 5JSYA 1E6KA 1GA6A 4HKTA 4NHEA 3CE6A 1J90A 3QOWA 3KB2A 3RYFA 1G20B 3RAJA 1Z5NA 4Q4AB 3OT1B 4KIJA 4YRCA 4EHIA 1EVKA 2E1RA 2ODEA 4P3NA 2XCTB 3RTDA 3PWZA 3M2PA 4FHZA 2F59A 1SWVA 2NU8B 3UXMA 1LZLA 3EFHA 1X80A 3F4BA 3RIXA 3SZUA 4WA8A 4Z1OA 2DG2A 3FG9A 4NMXB 2DKNA 1UM8A 2H54A 4FXOA 5KTKA 4C01A 5FFFA 3W5UA 2FPKA 5LXTB 2VAXA 2OQRA 2FHPA 4F2PA 5DEIA 1Y1LA 4HNRA 3TLCA 3TVDA 1PZNA 3QKSA 2YUIA 4B6JA 3CUSA 5ADUS 3A28A 1G8JA 3AR5A 2GCOA 2Q4RA 3WY9A 1LNQA 1WDWB 2ID8A 3G7SA 4I1UA 5DHRA 2AJDA 5EIFA 1GPLA 1UBEA 3N5CA 4JA0A 5DNEA 5F73A 4GOMD 1PN3A 3D1VA 1M0TA 1B6RA 2HCTA 2F43B 3C4JA 3KLNA 3Q6MA 3GAFA 1XAGA 2GJ8A 2HNBA 4RUKA 4RXUA 4YQEA 1G1MA 3T1NA 4X3PA 3O8OA 3R0VA 1BKDR 2I87A 2EEZA 3I6MA 4OHKA 2FRDA 1K3UB 2XBMA 1G9TA 2AFIB 4MDFA 3PUXA 1DPGA 2OGUA 1PTJC 5EJ2A 5BO5A 4DIMA 4DFDA 3HJTA 2BJHA 2ZAGA 2UVPB 4KXUA 5SZIA 5TS3A 5KSYA 2NN3C 4K0RA 4L0QA 2DMRA 5JNTA 1N9KA 3AKYA 3MLAA 1U7XA 4Q9AA 5M2QA 4CN8A 1NKSA 4BTLA 1OFHA 2DFDA 2DFPA 2C92A 3QLUA 3RTBA 1Z56C 4ENQA 1U8ZA 4Y6LA 5D7NA 5JSFA 2C00A 5B58T 1I94B 3QEMA 2B30A 3OEED 1FP4A 4R3NA 2GERA 4R40A 3O94A 1UEJA 2GUGA 1U0TA 1VRVA 5CLQA 4U0JA 2RHDA 3VZCA 1AJEA 3ESYA 4DCSA 1DWUA 4KXYA 4Z8YA 1QP4A 5AHKA 3H5TA 1OXXK 3C7CB 5KJ6A 1CETA 2G1PA 4BLQA 3ABIA 3K20A 4G0UA 1KIAA 1RRVA 1Z0FA 4UCWA 2DY1A 1O03A 3H84A 1R9NA 5I9SA 2PS3A 5JLJA 1J07A 4DVJA 1KMIY 1T9DA 2VUHB 3AF2A 4GI7A 1FL9A 1E8MA 4DG8A 1KAGA 2HMSA 3DVLA 1N6HA 1V5IA 5FR1A 4OBEA 4GGMX 4FS8A 1ULHA 5JTUA 1RWPA 5F9MA 1RRFA 3CZ4A 3D8HA 1HYHA 4JI3B 5CLFA 1C3JA 1OLXA 3IPCA 4DW8A 3EGDB 5DCYA 2BVNA 4LTDA 1JHOA 3DBHB 4OSEA 4EPXA 5KDOA 3TQTA 3OIYA 3ANTA 2YVQA 2ZI9A 1K7YA 2ENWA 3H11A 3NVDA 2PLNA 1XDUA 3EH1A 3TZQA 3VJRA 3QFFA 1M33A 1WUJS 2OCAA 3L4JA 5CT8A 2ES4A 1L7QA 1C4XA 1QK5A 1QO9A 3IXMA 3NVMB 4QBTA 1U90A 5K2OA 2ZI7A 3W77A 2X8JB 2PXHA 1E96A 4H15A 3C1UA 4YDSA 1E1CB 4QC2A 1DAHA 3B8HA 4ZVQA 3WFJA 5D5PA 3WLOA 3Q7EA 4MGHA 3ZIUA 1XWFA 4CUJA 3JAMA 2JNWA 3DE6X 3I83A 2H4HA 3EWNA 2ZIAA 4UXHA 1NM5A 5EKDA 3ZCXA 2CUNA 5CYPA 5LQJA 4IX9A 3OI7A 4RKFA 2A9VA 1EM8B 1NPDA 4X92A 4Y67A 4ZO4A 1UKEA 2XNKA 2G0TA 2Q3CA 3T7TA 4HB3A 2GKOA 4NXNB 3JWHA 4JP1A 5AKGA 5K0FA 1AY0A 1RYYA 3T38A 1H2BA 2VXYA 1D2EA 4M89A 3TRFA 2ZAIA 3ZBUA 3LUHA 3L7CA 5GJWC 3C6MA 5H3LA 4CU5A 4Y6OA 4C6HA 1EINA 2JLWA 2WFMA 1NHGA 2GVNA 4IXNA 3GEEA 4JS0A 5D3ZA 4BWFB 4HAWA 3WLEA 2OSVA 5TQ0B 1XZDA 3TAHA 4Q1BA 1RLIA 5BWMA 2DOKA 3V4FA 3GLIE 3RVLA 3SN6A 3KOXA 1P4JA 2V7TA 1PEDA 1PIWA 5JI3E 3NM4A 1W0JA 5FI5A 2CNWA 2QRKA 1ZJJA 3EY9A 1QPZA 1S2MA 2HXYA 2UUBB 4ID3A 1L5YA 2HLNA 2WFLB 3R75A 3S4YA 2A1TR 4EY5A 4LF6B 1ZMRA 3PFWO 4G85A 5DXFA 2AX4A 1R4MB 1VDMA 2QUKA 2WMNB 1BTOA 1IPHA 1YS1X 2A59A 1MB2A 2HBQA 4PBSA 3AOEA 4NLLA 4ZVOA 2C07A 3I1IA 1H69A 1COWD 2WD8A 2WHPB 2ZAYA 1Q0PA 5E6RA 4NBWA 1U5AA 3BE8A 3HU5A 1BXZA 2ZANA 3NPMA 4P36A 1KE1A 3DJYA 3CRVA 3QRWA 6PFKA 4LXIA 3OZFA 4HRVA 4PE5B 3TMAA 1Z8FA 3MJFA 1YQWA 2LUOA 2GYVA 3A9TA 4IFBA 5B1SA 3LQYA 3ZHUA 4EGJA 1XZNA 4UEOA 5EP3A 4U6SA 1CNMA 3E9EA 3H1BA 4NMLA 1WMBA 4OQXA 3UF0A 4MWOA 5EA2A 4BNWA 2C2OA 1XFAA 2ID9A 4JVSB 3F6EX 1QH1B 4FQ7A 2GPNA 4PQFA 4UAVA 1I1QB 4Q3KA 5EWMA 4IRMA 1CHDA 1RHKA 4U7JA 3WK8A 1P1JA 3NDIA 3S40A 1ZJ5A 1NW9B 3JCZA 4JJ4A 2GHQA 2C2HA 1H2RS 1TRHA 2P9GA 5CCDA 1YIOA 3A70A 4MVJI 1CD5A 4WK4B 3HN2A 4LMRA 1YF3A 3H6HA 4O4JA 3H2JA 4PBRA 4UEWA 4C29A 4CVNA 2F8LA 2Z09A 4ER0A 1YRHA 1PDOA 3QOFA 3ZWPA 4G9EA 4EKDA 4OAOA 4TKLA 1CUZA 1T5IA 4TTTS 4RETA 2IT1A 2XXBA 4FNOA 4JITA 4WK2B 4BC1A 4EJSA 1W0KD 1XU4A 3VV2A 5H82A 1OXBB 4Q21A 3OP4A 1TZMA 5JH7A 5HQTA 4B48A 1KVTA 3HCDA 1XXHA 3DDWA 4TWAA 4Z0HO 1PQWA 1CQWA 1EUYA 3UENA 3HM2A 2J0QA 2FMFA 2WM2A 3CNEA 3D7NA 4LE1A 1QWOA 3UMCA 2JLAA 1UFQA 3BZWA 3VGJA 1UAGA 4EIWA 2XB8A 1V2GA 5EP4A 3C8DA 3RFCA 4J2HA 3N39C 4UEQA 4HH3C 1U1FA 1QVAA 2Z83A 3EIXA 5HS6A 2WJZB 3MGAA 4MP6A 4TSRA 4Y3UA 2IYTA 2PBZA 1SXPA 3C6XA 2WG0A 3V1TC 5L51A 1FJXA 1AN0A 1OZ0A 4O4JF 1FCJA 1TQDA 4AZVA 4YP7A 2GBLC 2AS0A 1RYFA 2D3WA 4ER7A 4JUFA 1TYEB 2HRQA 3LU1A 1SULA 4K3VA 2VRCD 3C74A 2VJNA 2NU9A 3GLTA 3HGMA 3VDQA 4CL8A 1O9GA 3ZDAA 1PE0A 4IWYA 1OR8A 3FBGA 4RE6A 1GTG1 4NBNA 2FZVA 1L5LA 3ONFA 5FO1A 1A4XA 3UJBA 3HBMA 3PHCA 3F2IA 4HLUA 5F2OA 4O4LB 3L1UA 1XQ9A 3M3HA 3VPHA 3SICE 4DKJA 1HMYA 2UZ4A 2BBTA 2R5NA 2Z1MA 3KLOA 3IURA 3VKHA 2A92A 4ZO6A 1ADYA 2VRWA 2JAQA 4BQOA 1WO8A 4DR7B 3KTFA 4GC5A 4EHHA 4TV9B 1CUYA 1IY8A 2R66A 2FSUA 4ZMSA 1AZLA 4NATA 5FAXA 4AF8A 1TIBA 2RHOA 2OFWA 3DXYA 1KHHA 3W1VA 2P6PA 2J0UB 2YHIB 3C7DB 4MCAA 3D7LA 1LJ8A 1WQ4A 4KWTA 4NV1A 1YOVB 2QIPA 4IDDA 3H5IA 1THGA 2OO7A 1EP3B 1Y5LA 1RPZA 1CJSA 1EFHA 1TK3A 2CFCA 5HFNA 3C4VA 3WJ2A 1PKEA 2ACWA 4AQDA 1SQGA 2PQ6A 3H8JA 3E3LA 4JT9A 4M83A 2XF2A 2PDAA 1T9GS 3CLVA 1PL6A 3GDWA 3Q0IA 1KQ3A 1TMOA 3EGVA 1L8LA 3CB4A 2PE5A 2YZMA 4HQFA 2FPLA 1W5BA 1EB9A 4FBLA 1ZS9A 3QVGA 4Y6RA 2JHCA 4F2HA 3G9ZA 4MAAA 3LKZA 2UYQA 4FOSA 2I0FA 5EPEA 3K0EA 2RKOA 4IOJA 1EX6A 5C53B 2FJPA 2IX9A 5LP6B 2L0XA 2RK6A 3D6TB 3M81A 4AX8A 4CT5A 1F8FA 3U4GA 3PC8C 1XP8A 2AT1A 1BQ3A 3DEIA 4OL9A 4R2KA 3EGEA 3GJTA 5DHUA 3CZPA 3HEBA 4NQRA 3W06A 3G9UA 1VJTA 3GT7A 3O8BA 5IJ9A 2QLMA 1B7GO 2CLDX 5KPJA 3KKOA 3IT2A 5D51S 1D5WA 3IMEA 1RMYA 1NRIA 3N76A 4K9OA 3SEFA 4AJOA 4Q4AA 4YYZA 2OM6A 5CPBA 5E7IA 1NLYA 5C3UA 1M6HA 3M89A 4R8SA 1SBZA 4HXYA 1QVZA 5BMOA 1Q20A 1QF6A 3M1IA 1O77A 1MV8A 1TEHA 3S7TA 1ILEA 1RLTA 5J1TB 3WAKA 1KDOA 2IF2A 2IOFA 3GMDA 4JR2A 1UWLA 4MEBA 3AJEA 4G9GA 4EA7A 1QH8A 4R8VA 1GNPA 3B6ZA 5IDYA 3SPXA 3TI9A 2Q3BA 2GLXA 4FX5A 1ZD1A 2ATXA 2XYQA 3AG6A 3FPAA 3JRNA 4HLQB 3ZI0A 3NWBA 5IC4A 3GIDA 2PKXA 3LCRA 2X5OA 3VKWA 4QUGA 1YB6A 4XSHA 1K2VN 3EDOA 3HCRA 2IITA 4AF6A 1XD8A 1RWVA 3BD9A 5K0ZA 1M2HA 4LRTB 3KCNA 1ZGCA 2O8CB 4ZV9A 1X1DA 5JZSA 4RESA 1T9ZA 3MJTA 4EG7