4YR9A

Mouse tdh with nad+ bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
308
Chain Sequence
b'PPRVLITGGLGQLGVGLANLLRKRFGKDNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYSALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPSTIGAFGPTSPRNPAPDLCIQRPRTIYGVSKVHTELMGEYYYYRYGLDFRCLRYPGIISADSPGGGTTDYAVQIFHAAAKNGTFECNLEAGTRLPMMYISDCLRATLEVMEAPAERLSMRTYNISAMSFTPEELAQALRKHAPDFQITYCVDPLRQAIAESWPMILDDSNARKDWGWKHDFDLPELVATMLNFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-threonine 3-dehydrogenase, mitochondrial
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structural insights on mouse l-threonine dehydrogenase: A regulatory role of Arg180 in catalysis
pubmed doi rcsb
total genus 95
structure length 308
sequence length 309
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2015-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yr9A00
1QKIA 3DZKA 3E5RA 4IXTA 3KRTA 1U8XX 3MEQA 4GGOA 3M6IA 1XU9A 4J6FA 2BRUA 3PK0A 1G1AA 3AY7A 3TRIA 1BVUA 2DBZA 2B69A 4IJVA 1XLTA 5CPBA 3DZGA 1C0IA 1DJNA 3C7AA 3QE3A 3CZRA 2Z95A 4GBJA 4KOAA 1X1TA 4WCFA 2WMDA 3MOIA 2QRLA 1X14A 4RF4A 2AE1A 3TL2A 4WLOA 2GD1O 1LDNA 5A9RA 5CDYA 4QTZA 3D3WA 2VYVA 3F5SA 3ASUA 5L45A 1XHLA 3FRJA 3TZKA 3SXPA 5G0WA 1JVSA 3ITDA 3WQQA 2ZK7A 1CWUA 1YL6A 4CUKA 4CM9A 3STHA 4TKMA 5B4TA 4FJ2A 4J7UA 1NWCA 2HMSA 4XA8A 4BNUA 3IKTA 4XZ3A 3DZJA 1E3LA 3JQ8A 3BMQA 4B7CA 4DLAA 3NEPX 1PIWA 4Y9DA 5I9MA 3PHGA 2DBVO 5IDWA 2Q1TA 4YTEA 3EHEA 4D43A 1DHTA 1GY8A 1V3TA 1VL0A 3CE6A 3GMDA 3OICA 2D59A 3ON5A 1VC2A 4YJFA 3KSDO 4NBUA 4RVSA 3F3SA 5A03A 4NR0A 4YAGA 3Q0EA 4BMSA 4IDEA 2HO5A 3OJEA 3VZQA 4E2ZA 1VL6A 3KXDA 1MXFA 5AXDA 4IIUA 2NVWA 1XA0A 3W8FA 4J7CA 3GEGA 4IPTA 3DC2A 1HXHA 3BA1A 4BHTA 4R1TA 1R15A 2WSBA 4XGNA 1J49A 1ZK3A 5ICSA 2QX7A 1D4FA 2Q46A 2VWHA 1HL3A 3O9ZA 4H16A 4IS2A 5CDGA 2ZYAA 1CEQA 4IMPA 3ZU3A 3GN2A 3F1LA 1R12A 4K6CA 1P0FA 2ET6A 2F00A 3BAZA 1YXMA 1DC4A 3LF1A 9LDBA 1HSZA 1Z75A 3A4VA 1QV6A 4A7PA 2RAFA 1FMCA 1EVYA 4QO7A 1ONNA 3AW9A 3GG9A 3K73O 4P4GA 2JJYA 4DIBA 4RVUA 4XQEA 1H6AA 2B83A 2EW8A 3TFOA 3QVWA 3B20A 4YQZA 4IJUA 4XQ9A 1UAGA 3PHJA 4A27A 4OMUA 1EE9A 3ZN2A 1IOLA 3DZHA 2OO5A 2X0RA 4LN1A 3JQ8B 1KY4A 2GN6A 3QWFA 4J43A 4BB6A 4AJLA 4UREA 3AWDA 3QVOA 4DWVA 4CODB 1NR1A 3DEYX 5BR7A 5A1TA 3GNSA 3HZZA 4TWRA 4YBZA 1DBVO 3SEFA 5KVSA 4CV1A 3ANLA 3OJOA 4OJNA 1NHGA 1X13A 2VHWA 3RAJA 4DQVA 3GK3A 3GFGA 3V2GA 2P2SA 3HFSA 4RVFA 4TKLA 3QQPA 4NFYA 3F9IA 4TZKA 3ZWWA 4BGIA 2JFGA 4BNHA 4LVCA 2XF8A 2NVUB 4O0LA 5ER9A 3ZV5A 1TEHA 1HDGO 4XYLA 3WGGA 2EWMA 3VPHA 3OHSX 2C29D 2FSVA 1H6CA 4CM5A 2Q99A 1VJTA 2I76A 2UUPA 1HLPA 4PLTA 1NASA 5FEUA 1F14A 3JQ7A 4M49A 4RPKA 5L3ZA 2PKRA 3BTSA 3O26A 1E3JA 2P9GA 3DO5A 1Y81A 4WK6A 3U49A 1DB3A 3H65A 3PWSA 1J5PA 4RDIA 4MVJP 2FHSA 3HUDA 2RHRA 3ANMA 4OXKA 4HUJA 1XSEA 2EGGA 1I32A 1QSGA 1SB8A 3WWYA 5A3JA 1QV7A 4YAJA 1P45A 5CEFA 2BFAA 1G0OA 4GMFA 3MJ4A 3GUYA 3L4BC 4RV9A 2ZCVA 5KNLA 4L8VA 3AUTA 1U8FO 2VT2A 4BOYA 4PIVA 1P1HA 4FGWA 4J1SA 2NV6A 4Z9FA 4BIIA 5C5IA 4DA9A 1MX3A 1E77A 3EDMA 3HDYA 1DEHA 9LDTA 4WE3A 4E2YA 3K96A 1WAMA 1O95A 2X0IA 2NU8A 4OXYA 1E1MA 5MDHA 2YJZA 2ZTVA 1H94A 1SNYA 5FWNA 3WR5A 3BXXA 4TRJA 3LLVA 2CNBA 1RJWA 2VT3A 4C7JA 3JYQA 1TT5B 5KVVA 5JDIA 4DBZA 1U2GA 5JS6A 3DOOA 4BMNA 1FDVA 3C7CB 2ZB3A 1B3RA 4A73A 2VNAA 1E7WA 3Q9UA 4FC7A 4PG5A 2A94A 3S2FA 3ZV6A 4D3DA 4FFLA 3NRCA 1P44A 2AG5A 4RVHA 1WMAA 1Z45A 3MJTA 4RVDA 4IDAA 2CF6A 1YRLA 2X0NA 5JAZA 1LLUA 3KUXA 2YFHA 2GZ1A 1WDMA 3WGZA 2IYOA 3WJ7A 4FBGA 4D0SA 3B1JA 1KETA 2CDAA 2WYWA 5L4SA 3BHJA 2WJPA 1ZMTA 4R4JA 4DUPA 3OQ1A 2HLPA 1YB4A 2JL1A 3G49A 2GZ3A 4EBFA 1N1EA 4WUVA 4JJFA 4CMBA 3K6JA 3WQSB 4PGFA 2GZ2A 4B79A 1BXZA 3UHAA 5G0TA 3JQGA 3KSZO 4OO3A 1E3EA 3OMLA 2X9NA 3PYXA 3ZWMA 1TB4A 1VSVA 4A26A 3AI3A 3MJSA 4JBIA 4YT4A 3P2OA 2AQIA 1X0XA 2VOEA 4M54A 5CDSA 3ANNA 1GQ2A 3VC7A 3TWOA 2A4KA 1C1DB 1NQAO 4E5KA 2DAPA 2QYTA 4YJGB 4CMIA 5IDQA 4DIOA 2G1UA 4BB5A 4BNXA 3JQBA 1NWHA 1MP0A 1HE3A 3C24A 2E6UX 1SMKA 2QQ5A 4L73A 1EDZA 5TIIA 4OOFA 1PS9A 4R41A 1NQ5A 3ONDA 4CMCA 2JFHA 2IZ1A 1DIGA 1KEWA 5EINA 4L74A 1RM0A 4ND2A 5GY7A 3A9WA 5JO9A 4PRLA 4JIGA 3I9OA 1NYTA 4MKXA 1H6BA 3D4OA 4GKBA 4E13A 2WEKA 5AVOA 3DBLB 3AUUA 1VJ1A 3QSGA 4WOJA 3NTQA 3P19A 4CR7A 2R00C 2PD6A 3CMMA 2ZQZA 4ZQEA 3ENNA 5DZSA 3UICA 3E03A 5CG2A 5L4LA 5G4KA 3WBFA 2XXBA 4UUPA 3PLNA 3GAZA 4W7HA 2HMUA 3SJUA 1UDAA 5TSDA 4GQAA 2JD2A 2JHGA 2AEFA 2O2SA 4LK3A 3RBVA 3S1LA 3K8ZA 2HDHA 2WD8A 1NVTA 2Q1UA 5A05A 4EUHA 4EJ6A 2OP1A 4J4BA 1DRWA 1ORRA 1OI7A 2Q2VA 3DBRB 4RPHA 3WBBA 4C7KA 1SPXA 2DLDA 2AQKA 4R3WA 1U7HA 1P1RA 1ZIDA 3ONFA 1NAIA 3U3XA 1E3WA 1UXHA 2PZMA 3RU7A 4BO6A 1NAHA 1O9BA 5TGDA 4IDCA 2Q45A 4UVDA 4HADA 4S1VA 1XDWA 4HV4A 3TL3A 2RCYA 4D79A 3WIEA 5IXYA 3PQEA 1NFQA 1E6UA 1ONOA 3G3EA 3Q1LA 2VUUA 4XKJA 3I6IA 4NK4A 2YV2A 4OIMA 5JNLA 5L51A 5U1PA 2BGKA 3RUIA 4RF3A 2NACA 3CIFA 4FFMA 2D4AA 1E1NA 4F6LA 4G5HA 2PY6A 1N8KA 3RFXA 3H5RA 3O4RA 3U9LA 3GLQA 5A5EA 1V3UA 3OA2A 3ZWXA 1JWAB 3LVFO 2HSDA 3PHLA 4TROA 5B4VA 3VDQA 1KVSA 4UVEA 1KIFA 4YA6A 1XR3A 4FN4A 5TNXA 5COAA 3L4SO 4WNCA 4PLGA 4CMIB 1QYVA 1R66A 2VQ3A 4BNVA 1A5ZA 4DBVO 3JQAA 2GPTA 3OA0A 2GDZA 1PGJA 3VZRA 1JAXA 1B0AA 1W8DA 4J2OA 3RWBA 1E92A 3ROKA 4ZGWA 3X2EA 2BELA 3SC6A 4E2WA 2YHIA 1B26A 1CF2O 2NUAA 2DPHA 1PJTA 1U3TA 3PFFA 3IP3A 4CM8A 5HTOA 2ZJ1A 1U1IA 3RKRA 1MFZA 2DUWA 3HDJA 3ADPA 5AYVA 4DTIA 3R6DA 1H9BA 2O3UA 2OORA 5JDIC 1B8UA 1EEHA 1UJMA 4GWGA 2C2YA 4CPDA 4CQLB 3KYCA 4GLOA 1JW9B 1HYEA 1YQXA 4J3FA 4CR8A 4MP8A 4PLVA 5TT1A 3KZVA 1HDCA 5TX7A 3SJ7A 4W7IA 1QYDA 1P9LA 2YDYA 2EKPA 2P4HX 3JQGB 4CMAA 3AJRA 1T24A 3HDHA 4I9UA 4DLBA 1QP8A 2FZWA 4ROSA 2YZ7A 2JCXA 4D44A 3H9UA 2VZ0A 5T5QA 1NNUA 1ENYA 1MC5A 1ADCA 4C4OA 4RL6A 3GDGA 1N9GA 4D0RA 1EK6A 2Z1MA 5DN9A 4B4UA 3GUCA 3KM0A 4IZHA 4O59O 2R00A 3OH8A 3Q6IA 3RD5A 5A02A 1B8PA 1J0XO 4YEDA 4FB5A 5TQVA 3LT0A 1B3BA 1EQUA 4CMEC 3BHMA 3JD1A 4RLHA 3IJPA 4FW8A 5G0UA 3I4FA 4L76A 5JE8A 3NT2A 2YW9A 3ZW9A 1C1XB 1M2WA 1NFRA 3CTMA 1M6WA 3QRWA 1LUAA 3IMFA 3WOHA 3WWZA 3ZNOA 4D42A 5EQFA 1RM3A 1AN9A 4Q3BA 3EZYA 4NQZA 3ZV4A 4YR9A 1IL0A 2W90A 5EERA 5L53A 1BRMA 1TI7A 4YAEA 5L7YA 1HTBA 1ENOA 2HJSA 3PZBA 4YXFA 1VL8A 1JN0A 3JCZA 2XAAA 1D7OA 5DBIA 1I01A 3CPSA 4L75A 4O63O 5BNFA 4YVFA 4N7RA 4E31A 3RUDA 2PK3A 1W0CA 3EUWA 4NBTA 3BMCB 1D1TA 1X7DA 4HKTA 3ZU5A 5ENVA 4W6ZA 1HLDA 1SOVA 3PDUA 4BNTA 1EDOA 1KERA 2GASA 1VSUA 4GH5A 3VDRA 1HWYA 3GT0A 4KDEA 3HFGA 4BKRA 1BW9A 1Y8RA 4CM4B 3EGOA 1LC0A 2YQ4A 4N5NA 3E82A 4Y8VA 1VJ0A 5L9AA 2UV8A 3DAGA 4IM7A 5ICMA 4FFPA 3WGYA 1SC6A 4YT5A 1E3SA 4IUYA 3CH6A 5IJZA 2PZKA 1UP4A 3I83A 3ORFA 1GUFA 1Q1NA 4OH1A 5B37A 4HP8A 5C7LO 5JCXA 1TVEA 1SEPA 5BQFA 3V1UA 4ZRMA 3TF5A 3BMNB 3FF4A 2QHXA 3GVXA 3ZI0A 1DPGA 1R37A 4Q3NA 2H9IA 1H5QA 4ZICA 1T1RA 2QRJA 3PJGA 1A71A 2O3QA 3ONEA 3DFUA 3L6OO 2YV3A 4J7XA 3WXBA 1E1LA 2JD0A 1WXDA 4XQGA 3VKVA 1PZGA 3GH3A 1XU7A 1U5AA 1YH3A 2BKAA 2QZZA 1P74A 4K1LA 4BV8A 2I65A 3PQDA 4J0FA 4IGFA 1I8TA 3QWIA 4J1NA 3ZGYA 2X7HA 5HBRA 3GDFA 3NJ8A 1YKFA 1NQOA 3T7CA 2B37A 1PJBA 1SB9A 4B8WA 5KOIA 2GUGA 1UR5A 3RC9A 1F8FA 3KSUA 1T2FA 3V1YA 3JYNA 2BHLA 3OJLA 4BVAA 5C37A 1GCUA 2I67A 3NUGA 3PVZA 4DPLA 5F1OA 2NNLD 2Y0DA 1IHXA 2I6TA 1DRVA 4IDDA 3ENKA 3FNGA 4BNFA 1PR9A 1HETA 1GPJA 4TVBA 4ZQBA 3TZHA 1NHWA 4HWKA 5JYDA 3HNPA 3V5NA 1F06A 3PWZA 1GEEA 1U4SA 2OOSA 4CQMA 3Q2IA 2JCYA 4P8RA 4PVCA 2A92A 4OQZA 1Y8RB 5C7OO 3GG2A 1RM4A 2OFPA 3DBRA 1LDEA 5THKA 3JQBC 4YWJA 2XXJA 1OC4A 3C1TA 2Y66A 2Y1EA 2R6JA 5ITVA 1HDZA 2G82A 2DVMA 4XRGA 5DCUA 1XCBA 3D64A 1I2ZA 4BNNA 5GZ6A 2JD1A 4I08A 1W4ZA 2C20A 3WYBA 4FR5A 5A9TA 4XR9A 4S3MA 4DL9A 2X5JO 2W98A 3E6AA 4BGEA 2QYSA 3JD2A 1LQUA 1H93A 4QFDA 3AK4A 5DT9A 3W8DA 3GEDA 3IKVA 2X9GA 1N7HA 3DOCA 3H5AA 2P9EA 3DAPA 4AJHA 5JY1A 2FWMX 4IDFA 4HXYA 3LDHA 4EUEA 3K2EA 3LSYA 1EMDA 3AFMA 4F3YA 4PLPA 3BTVA 2GYYA 3DL2A 3M2TA 4GX2A 1PGNA 3VH1A 2EP5A 4JCOA 1LSJA 1YE3A 3GVHA 5IXSA 3BHIA 3PWKA 2WTBA 3H4VA 2AQHA 5EMHA 5TT0A 4AJ1A 7ADHA 1GUZA 5J23A 4KMSA 4IJWA 3OIDA 2ZTLA 2HK8A 3EAGA 3K31A 3OIFA 4TQGA 3ITKA 1IPFA 3LT4A 4Q3DA 4GVLA 4E33A 3EK2A 4IDGA 2E4AA 3MJVA 1N7GA 1AXEA 3VHRA 2NU6A 5DP1A 2ZB4A 4PLZA 1LLDA 2V6MA 1Q2XA 5T64A 3W4KA 3WB9A 3Q3CA 3O8QB 1Z7EA 1GR0A 2TMGA 4W9NA 1I2BA 4Z0PA 2Q2QA 5JCJD 1PTJA 2VHZA 3PZRA 3UH1A 1X15A 4BO1A 2BH9A 4NDNE 1KC1A 1H6DA 4YDRA 2AW5A 1V8BA 3X2FA 4FSHA 1GD1O 1QLHA 1LNQA 4L4XA 2VWGA 2EGHA 1ISJA 3D5TA 2PH5A 2FPPA 1DIAA 4CUZA 4B3JA 2WYVA 3H9QA 4LMRA 1C3VA 5IZ4A 1LC3A 2I9PA 3UW3A 3OIGA 3C3XA 4NFHA 5F1PA 2FPIA 3U09A 3KHUA 3DMTC 1WWKA 4Q3AA 1T2CA 3JQ9A 3UCFA 3ZU4A 4BO0A 2VUTA 2HRBA 3ZV3A 3JQFA 3VPGA 5FI5A 2B4TO 1QYXA 4IQ8A 1WNTA 2P5YA 5I9NA 3SVTA 4MKRA 1LSUA 4WJZA 1YOVA 4UAGA 2R2GA 3W4JA 1C1DA 4J16A 2JAHA 2V6FA 1HF3A 2QW8A 1Y7TA 4J9VA 2C82A 1Y8QB 5EQDA 5EN4A 1UAYA 3N74A 3GRPA 4D46A 5KJCA 4GKVA 1KVQA 4AJOA 2ZCUA 4HX5A 1MG5A 2VNSA 4FFOA 3N7UA 4NFSA 3EW7A 5TJ9A 4CMEA 3PI7A 4AICA 4ND5A 1YVEI 1VKOA 4J91A 5TRTA 1PJLA 3U4HA 4Y6RA 4G81A 3RI3A 2P5UA 4WNIA 5G0VA 1NR7A 1ZH8A 1MLDA 4ITUA 2W2LA 4E3ZA 1LLQA 1CDOA 2PV7A 3P2YA 3QWHA 2W2KB 3WTBA 3A1NA 4MIOA 3LF2A 5H83A 4CLXA 1W73A 2ZYGA 4GAEA 1KOLA 4UEOA 1XWFA 3F1KA 4ZHSA 2D5CA 1H2BA 4B4VA 2BFMA 3HB5X 3GGOA 1WDKA 3RBZA 4AG3A 5I7EA 1N92A 4J4TA 2GN4A 2VOJA 1SOWA 3NGXA 1EE2A 1CIVA 1HT0A 5U9CA 1GV1A 3KLMX 1Q7GA 2YQ5A 3IJRA 1B16A 4K26A 1VKNA 4YRDA 3FBTA 4UUMA 4CM7A 4K28A 3WIDA 1DRUA 4PZCA 4N18A 4JJGA 4Q39A 4XYGA 3TDKA 4B3HA 1I0ZA 5JFOA 1NTOA 4KZPA 3DBLA 5TJHA 1E5LA 1QMGA 2AEJA 1A27A 5BT9A 3JTMA 2YFQA 3SX2A 5HM8A 1DFGA 1SEVA 1GYRA 4GWKA 4Z0TA 4CMHA 1U28A 3PLRA 4LRSB 4FJ0A 4M86A 3QWBA 3IDSA 2DFDA 5JDCC 3DR3A 1LRLA 4BMVA 5JC1A 4HBGA 1QG6A 4BQPA 1ISIA 1HZZA 2O3JA 3GNTA 3GVCA 4Y98A 1DLIA 4WOKA 3ZWBA 2JFFA 8LDHA 1GYPA 2OL4A 4PG7A 4YAKA 2ZTUA 1G6KA 3EY4A 3LC7O 2IEDA 4NJMB 3UOGA 1M76A 3FSRA 4DIFA 1YL5A 5DULA 2CY0A 5CHEA 2XPCA 3ZCXA 2AQ8A 1PZFA 3OM9A 4ONEA 5I7SA 1OOEA 4DMLA 5MGBA 1PJ2A 1A4IA 3S2IA 3D7LA 1CQJA 1E0DA 4P4NA 4EDFA 2V7PA 3I52A 4NU6A 4IQGA 2IEBA 1EFLA 5BSGA 1I3MA 4R3NA 4OXNA 4YYZA 3RIHA 3ROPA 3JD4A 3KLPX 4MOWA 1T2AA 2AMFA 4YCAA 4CV2A 4FOSA 4FGSA 1UZMA 2DBRA 1GFSA 2O3TA 4JX8A 4RPJA 3SLKA 4JP2A 2BMAA 4JQCA 4BO2A 5A5FA 3PTZA 2C2XA 2YY7A 3WSWA 1XG5A 4UUNA 3HB4X 1DDOA 1GZ3A 4ZA2A 4RVGA 4D45A 5IDYA 3IOYA 4PLHA 5C3MA 5TLSA 2FMUA 1DC5A 3FN4A 3NDJA 2CVZA 5F1KA 2ZJ0A 5F3RA 3WNQA 5KIAA 3BMOA 5B4UA 2C54A 3GNQA 3RJ9A 3RFTA 1HKUA 4XD2A 4RZIA 4ZRNA 4B7XA 1MC4A 1DLJA 4CR6A 3IUPA 5JXWA 3I9KA 1ADBA 5LDGA 2PZLA 1V3VA 4JP3A 1ENZA 1JVBA 2Y0CA 4HFMA 1DC3A 1HDOA 1O6ZA 2EXXA 5JLAA 3S55A 4KDFA 4Q3EA 3FR7A 1M67A 3HG7A 4MVJE 2WDZA 5CG1A 3RC1A 1OC2A 1I33A 1H2HA 2I5PO 2SCUA 5FYDA 3ZHXA 1YBAA 3FD8A 3GF4A 4LCEA 1EVJA 4CV3A 5BSEA 2GRAA 4DLLA 3FR8A 1K89A 3F46A 5KKAA 2HU2A 3KBOA 3T7EA 2OBYA 5ILGA 1O8CA 2PFGA 2DU8A 2C7VA 1EUDA 1O89A 2PNFA 4Z3DA 4BL5A 3VPFA 2X86A 5BNIA 1I30A 4FQ8A 1HRDA 1LU9A 3ZWAA 3FI9A 5JAIA 2X5OA 1PZHA 1P33A 4R68A 1ID1A 1WZIA 3QWAA 1ML3A 2DBQA 5JSFA 3JQCA 4CL3A 3UKOA 4KUGA 2Y1GA 3OQ6A 3UVEA 3NT4A 1PQWA 3VTZA 4PZDA 4I9NA 2POQX 4L9RA 4UEKA 5A4DA 1MV8A 4WLUA 3KYBA 1IUKA 4JGBA 1LLCA 1LA2A 3AOGA 3E9MA 1QYWA 3BTUA 1WPQA 4NMHA 1VPDA 1XQ6A 4XX0A 3L9XA 4ESOA 4U8GA 3WFIA 4AJEA 3VH2A 1JDJA 3ZWNA 3JQEA 1KEUA 1G0NA 4XCVA 4N5MA 3TZQA 2GF2A 1QLJA 3ZWCA 4QQRA 4R9SA 2IE0A 4WLEA 2YHIB 4E0BA 3DHYA 3SBOA 3PGJA 2DFVA 2JHFA 4MVJH 1V35A 4GX0A 2NSDA 1NPTO 4IDBA 5TF4A 1JLLA 4AJ2A 3I9NA 4BNJA 5K9ZA 4O6VA 2X6TA 3RUHA 3GA0A 1V0JA 1ZJYA 2FSSA 1CJCA 4JXKA 3F4LA 2D5AA 4BKOA 2OXIA 2IODA 3G17A 3D0OA 1EUZA 4FFNA 5IZCA 2IYPA 4B8ZA 4EJMA 1P31A 1U4OA 2G17A 1T1SA 3DMYA 3HWRA 1BG6A 4OL9A 3TSCA 3WTCA 2OGUA 1D3AA 2P91A 3D5QA 4AJKA 1PWXA 4DQUA 1T2EA 5JYEA 5KWEA 2Q50A 2EJVA 5A9SB 1KY5A 2O7QA 4OOEA 4E21A 5GMOA 2CF5A 4XEHA 1F12A 3RC7A 3V2HA 5I7FA 1HYHA 1ZO8A 3RQSA 2BI8A 1Y5MA 4R51A 3TN7A 2Y0EA 4FCCA 3DXFA 4II3A 2X58A 2CDBA 4MVJD 3ULKA 4E4YA 3IS3A 3JQ6A 2NM0A 2HK9A 3M1AA 5A3VA 1C0KA 5F21A 1LXCA 4QFCA 4RPGA 4LSMA 4M1QA 1UDBA 1P77A 3E1KA 3M2PA 3LC2O 4ZQFA 1DFHA 4MIEA 1WP4A 2E49A 3D3EA 1LDBA 2VRCA 4A03A 4W9NC 4GX5A 2QIOA 3JYPA 4WCFB 3GC6A 2Z5LA 4CUJA 5BSHA 3OQBA 4KP7A 4XYBA 1M66A 3O8QA 1IZ0A 4Z3KA 1KYQA 1LQTA 1X1EA 2IXAA 1EK5A 1VM6A 3DOJA 4CLRA 2ZB8A 3ZHBA 4CLDA 2WD7A 1ULUA 1M75A 3A06A 1PX0A 1KEVA 5JO0A 1B8VA 1LX6A 4CMKA 1T4BA 2NLOA 1K6JA 4R1NA 3TPCA 4CMJA 3RBXA 4BNKA 4TRMA 4WLVA 1ZK0A 4Y67A 4ZQHA 2Q4EA 2GN8A 3A28A 3H3JA 3UGKA 1AXGA 3WMXA 3E9NA 3ICCA 4BO9A 1B14A 1ZVMA 3WLFA 5KVQA 2HKIA 1JQBA 4ALIA 1GZ6A 5KJ1A 2GO1A 3A14A 3FPCA 5L7WA 2O2YA 5CPFA 2X0JA 4E5PA 4ND4A 1LRKA 3I5MA 3QA9A 3H3FA 2XOXA 3ASVA 1H0KA 4A10A 4ZJUA 4CLOB 1F17A 3NTRA 4UVIA 4NJMA 3KYDA 1Y1PA 3PEFA 4GPD1 3AOEA 2VZ8A 3ZNNA 2LDXA 5AOVA 4D3SA 4NH4A 4U5QA 2B4RO 4EZBA 3ETGA 3FNFA 3KETA 3DHNA 3VTFA 4OM8A 4PCVA 3Q2KA 3H8VA 4IXWA 2X22A 3I9JA 1LI4A 3FTNA 1RYDA 3FPLA 3B1FA 4B4OA 2WE8A 5CEJA 1O94A 4XYMA 4AFNA 3IP1A 4XJSA 3UUWA 1PJQA 4WEOA 4I5DA 1LSOA 4BNZA 1EUCA 2Y68A 3AU8A 3AU9A 4Y6PA 3PXXA 3AY6A 4QO8A 2ZKLA 4E5NA 2UVDA 3TOZA 1Y9EA 4J49A 4W82A 2C5EA 3DONA 1ZNQO 3UXYA 4WGGA 1IHYA 2PD3A 2J3IA 4UVHA 3DDNA 1I3KA 3NDRA 5IAAA 1FDWA 1T4DA 2EKQA 1BXGB 3KOUA 1ZJZA 5T8KC 3RSHA 4BNGA 3VVBA 4QT0A 1ENPA 3L6DA 2C5AA 2BD0A 4J4HA 4UUOA 5KCZA 1KS9A 3RKUA 4M89A 4Z9XA 3PJFA 5HWSA 1RWBA 1ISHA 1K3TA 3AM4A 3K5PA 1SO8A 3GY0A 1JWBB 1ULSA 1U3VA 5EESA 3WGQA 2PTGA 4GL4A 4DRYA 2J5KA 1GUYA 2O50A 4BGVA 4R16A 3WGIA 3R3JA 1GTMA 2RIRA 4URFA 1GDHA 4GLLA 4H7PA 3T4EA 1Z73A 3LU1A 4Q3CA 8ADHA 4NG5A 3O03A 2PZJA 4YAIA 1XGKA 1WZEA 5ER6A 1DAOA 4EJ0A 3GRKA 4IGEA 1I3NA 1LTHR 4OSPA 1E7RA 5EPOA 4CM1A 1C1XA 4E30A 1PJCA 4YRAA 3INTA 5BNTA 3MTGA 1BGVA 4BNWA 1ZSVA 1BXGA 1WDLA 1ZFNA 2D8AA 4DQXA 3TZ6A 2DC1A 3FNEA 1E6EA 2BI7A 1BVRA 2V6BA 3HADA 2H1SA 4KWIA 4YPOA 4XYEA 2LDBA 4OKIA 4KQWA 2CZCA 4P22A 3U4IA 4ND3A 1IY8A 4FPXA 4WCFC 5BSFA 1ZK2A 2OUIA 1C14A 3KB6A 3DFZA 3ROQA 1IE3A 4WECA 1RPNA 4BO4A 4U0JA 4DXHA 2AE2A 1OMOA 1Q0LA 3H2SA 5ENDA 4W99A 1DHRA 5K0ZA 3QVSA 3WFJA 3IC5A 4XDZA 3GQVA 4RO0A 2J5QA 2D3TA 3WS7A 1HE4A 2EG9A 1XELA 3IL2A 3V8BA 4Z0HO 4E6PA 4LCJA 1R0KA 1R0LA 2G0TA 4D3FA 3JQAB 3GPDG 1DJQA 1ZXBA 1ISGA 3DBHB 4RJTA 4I5FA 2NVBA 3RC2A 1R4MA 2FN7A 4RCVA 1DFIA 4ALMA 4AJJA 1VLLA 2AXQA 2NADA 2O48X 2VUSA 5DOZA 2GLXA 2J3HA 2WM3A 4CLHA 3UCEA 1JKIA 2DM6A 4GSKA 3C8MA 1E7MA 1UUFA 3E9QA 4XB1A 4B4WA 5GZ1A 3K92A 4PVDA 4MP6A 3R0IA 3BIOA 5I7VA 3S2GA 5JBIA 2X8LA 4Z9YA 4K9DA 1L7EA 4GVXA 5L95A 4HNHA 3FCOA 1LDYA 2QRKA 4IY1A 2G5CA 2RHCA 4LGVA 4ZD6A 1PWZA 1VRWA 2UDPA 5DDIP 3RUCA 2YHUA 1X0VA 4OYRA 3CZMA 3ST7A 3KV3O 3JD0A 2FRDA 2FP4A 1ISMA 2NTNA 4NZ9A 3VH4A 5JAMA 3FWNA 4KTVE 4RLSA 3KTDA 2AEMA 3CEAA 1OFGA 5AXAA 3W6ZA 1GEGA 1A7AA 2HCTA 2F1KA 4F46A 3CINA 3VPSA 2EKLA 3RASA 4BKPA 1KBZA 2O4CA 3HE3A 1E7QA 1P3DA 3I1JA 2H63A 3LT1A 3QVTA 5DCYA 1UZLA 1Y6JA 1BMDA 2PH3A 1B2LA 1T25A 1B15A 3EYWA 3GAFA 2VZ9A 4IINA 2Q2WA 3RU9A 3W8EA 2P68A 5JAQA 4UVGA 3ICPA 4TRNA 3WMWA 5C7IO 3KVOA 4HY3A 4RQUA 3GZ4A 4ALNA 3ETDA 4AVYA 1U5CA 1YGYA 4YJHB 2YDXA 4U6QA 1MB4A 3GGPA 5IZCC 1ADFA 3L9WA 1NX6A 1R4MB 4P4LA 1UXKA 2I99A 5DNAA 2PD4A 3JD3A 2V6GA 3I3OA 4CM9D 5HS6A 3MOGA 4HFNA 2BGLA 4ALLA 3KO8A 1ZSYA 3DWFA 4RORA 2RBEA 5DCWA 1D8AA 3PHHA 1N5DA 1U9JA 3W1VA 5KVCA 2EEZA 2I66A 4QSMA 4BKUA 4EEXA 3TQHA 4GMGA 4N54A 3OECA 4IZIA 3DZBA 1IPEA 4CM3A 1SCUA 2EF1A 3GN1A 1DAPA 2Y93A 3NJ4A 1UP6A 2GN9A 4MVJM 1Q0QA 4LMPA 1BDMA 1UH5A 1T26A 1MGOA 2Q49A 4L4RA 1PJSA 1YB5A 4R01A 1S6YA 1N1GA 1U2DA 3F4BA 3FHLA 3UAGA 1EVIA 4NI5A 1HSOA 2ZTMA 3QY9A 1QXSA 1ZXLA 1NVMB 3TZCA 3JQDA 3LC1O 1I3LA 1F0YA 2D1YA 4CM8B 5COBA 1R4NB 3ABIA 5CFZA 3HN2A 1NVGA 3BMQB 3PHIA 3H7AA 1RKXA 1V6AA 3U0BA 3NX4A 1EBUA 1YBMA 2O4UX 3L4BA 2CFCA 2ZQYA 3W4IA 3G1TA 3NV9A 1B7GO 1ZMOA 1FDTA 5L40A 1FDUA 6ADHA 2IZZA 3NTOA 2RH8A 3DZIA 5EL0A 3RUFA 4ZU3A 3AM5A 4RGBA 3C1AA 3GHYA 5TS3A 4TMFA 1VI2A 2B5VA 4XGKA 3TFQA 2Y67A 3G79A 1A72A 2Q1SA 1Z6ZA 3WYEA 4JN6B 4WKGA 2JCVA 1WLYA 1I36A 4J2HA 3E8XA 1K6IA 4MKZA 2P4QA 3UF0A 3G0OA 5AXBA 3ZWYA 3GMSA 3WGOA 4OGWA 1PQUA 3FTPA 4PG8A 3LQFA 3UFXA 1BTOA 1NQTA 2PKQP 3ZNQA 4F6CA 2AG8A 4YACA 1UXJA 4LSWA 4J1TA 5L4NA 4M55A 2D0IA 2BF7A 1K5HA 1IB6A 3GPIA 2Y99A 3NKLA 3SLGA 1XIVA 4AJPA 1TT5A 3ZU2A 1XEAA 5EJ2A 4XJTA 4M8SA 3PYLA 4RF2A 5FFFA 3EC7A 3TOXA 1UXIA 2JKVA 2UUOA 3F5QA 1EZ4A 4QXMA 2GCGA 4BKQA 2FPGA 2Q3EA 2J5RA 2W8ZA 1A4UA 4E5YA 4WLNA 5IFLA 2CSUA 5G0SA 2E37A 1ADGA 1UXGA 3AUAA 1I10A 4BGUA 1SAYA 2HMWA 3EVTA 3D1LA 5JCJA 1GL3A 2B35A 2A35A 5T8KA 1GU7A 2EJWA 4J9UE 1Y9AA 4R69A 3D4NA 4AL4A 3OFSA 4KTTE 3DAFA 5DF1A 3AY3A 3BTOA 3EVNA 4OQYA 3GVPA 4B7UA 3HDQA 4CQLA 1HE2A 3CMCO 2ZYDA 2EP7A 2EIHA 1E5QA 2BFOA 5AQ1A 2CVQA 2OHXA 1NP3A 3MCVA 3U5TA 2H5LA 2NU7A 2B0JA 5DP2A 5F5LA 3WLEA 1Q7CA 2VRBA 5T67A 3HHPA 4TSKA 3PQFA 1YONA 1EFKA 4QEDA 3IAHA 4Q9NA 3CXRA 3BYZA 3KEOA 3PPIA 1TLTA 3JQ7B 4PLWA 3RUAA 1FXSA 1Q0HA 2J3KA 4FS3A 2NWQA 2FR1A 1J6UA 4WCDA 4ZVVA 2O3SA 2C07A 3ZZNA 3L0DA 4GX1A 3KEQA 1AHHA 3ETEA 1W6UA 3HQ4O 4OSOA 4XIJA 2QZ9A 3DZFA 3F47A 3RUEA 1E6WA 3CSDA 4U7WA 1C0PA 1E1KA 1WMBA 4BQRA 4YQYA 2VCYA 4BUCA 4BNYA 1PL7A 1UZNA 4JLWA 4DREA 1N2SA 4KUEA 2QG4A 2GGSA 3HN7A 4IQ0A 3L77A 2OZPA 5CDUA 1YQGA 4I9HA 1CRWG 1NXQA 1GPDG 5HRUA 4NJOA 1K6XA 1MA0A 2HMTA 3HSKA 4NNJA 4XR4A 3UN1A 2X5KO 4MO2A 4PRKA 3WG9A 4CQMD 3N58A 2X23A 2Q4BA 4GI2A 3QJ5A 2ZIZA 5COQA 2J8ZA 3H6KA 3V1TC 3G1UA 4R5HA 3TJRA 1ZSNA 4Y6SA 4XWYA 4JJIA 1PQPA 2DUUA 1GADO 4NU5A 2CUKA 4JBHA 2Y1FA 2DTDA 1A9YA 3DBVO 3VZPA 1YJQA 4P38A 4ALJA 1ARZA 3B6ZA 3HJAA 3R1IA 1MUUA 3EZLA 4MP3A 4II2A 4NBRA 3JQAD 3WSVA 3ZWPA 3RROA 1NPDA 3B70A 4D7AA 2NQ8A 2NQTA 2FOIA 3OSUA 3DMTA 1R6DA 5G2OA 3WX0A 2DQ4A 2BLLA 3BMCA 3GDOA 4QUKA 3ZNPA 3DTYA 1OAAA 3WNVA 2CD9A 3Q11A 3ADOA 5IN5A 4UEJA 3FNHA 1YQDA 4ID9A 4YB8A 4Z6KA 4RZHA 1P1FA 2NTVA 4MPDA 4JNKA 1CQIA 1SBYA 1ZCJA 2VYND 4YJHA 1PS8A 3NAQA 3RVDA 2C0CA 4I8XA 2CDCA 1TT7A 1TA4A 1MFPA 3K2BA 4EI2A 1HDYA 4CLOA 1P1KA 3C7DB 5IF3A 1BXKA 1P1JA 1YOVB 5HA5A 2WD7B 1LDMA 4ZN6A 1HDXA 4TZTA 1UP7A 1YWGO 5CEEA 5I9LA 5DBFA 4BS9A 3JQ9C 5ILOA 3I9MA 2VTDA 3EMKA 2UYYA 1JAYA 2B5WA 2X9VA 3PIDA 1E3IA 2WE7A 2J3JA 3FBGA 3NYWA 5CAEA 5U4QA 2GNAA 2PGJA 2PGDA 1CYDA 1PL8A 2GSDA 2NTJA 3E5MA 1FK8A 4FOOA 1R0SA 3K9QO 3KYCB 4A5OA 4LISA 2UAGA 3RJ5A 4CM4A 1ZK4A 2HQ1A 2EW2A 1DC6A 2DTXA 4FDAA 4B3IA 1BSVA 4DYVA 3ROMA 5G4LA 1YDWA 4OKNA 2YUTA 3ZWOA 3I4CA 2FR0A 1S7CA 3INRA 4IIVA 1ZUD1 1L7DA 1OBFO 1R16A 1E3WB 4O1MA 1Q7BA 1IULA 3ZDFA 3H9GA 2I3GA 4BO7A 2VHYA 2OBNA 2GERA 5JPIA 3JV7A 1A9ZA 4YT2A 1L1FA 1ZKMA 4EGFA 3OJFA 4F45A 4NPCA 4YJGA 1PGQA 1GV0A 2O7SA 1ZK1A 4KWHA 3QVXA 4I5GA 4L4SA 2DPGA 1XYGA 4JK3A 4YT8A 3M1LA 5CDTA 1HE5A 3V2UA 2V65A 2CMDA 1YS4A 2FZEA 2ZATA 1PJ3A 5F5NA 4CLRB 2IZ0A 1QYCA 3CUKA 5A9SA 2PKQO 4D41A 3AFNA 3LLSA 3H2ZA 1NBOA 1HZJA 1UDCA 2RH4A 4AJNA 4BV9A 3VPXA 4NK5A 2ZB7A 1BWSA 4YRBA 1KEPA 4HNGA 2W2LD 3AI2A 2C7GA 1EVZA 1I5RA 2A9FA 4BNMA 1MXHA 3BZUA 4NBVA 1LDGA 2PR2A 1PJ4A 1KC3A 5CP8A 5H81A 2DT5A 3DBHA 4L0QA 4ZQGA 5G4KB 5HS4A 5ES3A 1O0SA 3GZNB 3UCXA 4H15A 4MINA 4IS3A 4XDYA 2HUNA 4PLYA 2Y1OA 2H6EA 4EITA 4EW6A 3AI1A 3MWDB 4E2XA 3B1KA 3H9EO 4CM6A 4CQMB 3ZW8A 3WJAA 4PG6A 1J4AA 4NIMA 4MDHA 5K6AA 1NM5A 3O38A 5JC8A 3F6YA 3DQPA 2VN8A 1YO6A 2PGLA 4G2NA 5KKCA 4FJ1A 4ND1A 1U3WA 1AGNA 4RPLA 1YDEA 4DC1A 5B1YA 3NT5A 2IDZA 3Q9NA 3QIVA 3WICA 1YJ8A 1PGPA 1DIHA 1P1IA 1PS0A 3OETA 5B12A 6LDHA 3LT2A 2I3AA 1ZEJA 1GZ4A 1PZEA 4H3VA 4N5LA 3LK7A 3PRJA 5FF9A 3I9LA 2NU9A 3MJCA 1KVTA 4BO5A 1DSSG 2YV1A 4WASA 4K6FA 1V9LA 3P5SA 2EV9A 5TC4A 1GAEO 1GYQA 1NFFA 2O3RA 4RQTA 2B36A 1DXYA 1JKJA 3P7MA 1KVUA 4IJKA 1YL7A 2VHXA 3GOHA 1LBEA 2X1HA 4DPKA 3QLJA 3C85A 4PZEA 1U7TA 2CVOA 4W4TA 4TRRA 3NGLA 3WGTA 4E12A 5THQA 3BMOB 5K6AC 3JYOA 3L07A 4LVUA 1LJ8A 1ISFA 3FWZA 2VWPA 3W6UA 3ZHZA 1ZW1A 3INGA 4U0KA 1AHIA 3R3SA 4PG4A 3OP4A 1Z7BA 2AHRA 3WQRA 5A06A 4HFJA 3PGXA 4YJFB 4INAA 4AJIA 5KTKA 5T57A 5JMPA 4OAQA 4MJLA 1RM5A 4I5EA 3S8MA 1PL6A 3DTTA 4MVJA 1IYZA 4XRRA 3SC4A 3MWEB 2GR9A 1JKFA 2JAPA 4AJ4A 1GCOA 1CETA 1U3UA 2HK7A 1LEHA 4MVJG 5LC1A 1Y5RA 2Z1NA 2TMDA 1X7HA 3DHEA 1HYGA 4EYEA 4O5OA 1TXGA 4EUFA 4I1IA 2EHDA 2HAEA 1ZZEA 2PLAA 1BW9B 1XQ1A 2HRZA 4NHEA 4U6SA 1PGOA 1K2WA 2BGMA 3I23A 4PFJA 4DVJA 3U4DA 3GZNA 1E7YA 2D2IA 4KQXA 4CMGA 4MVJF 3PDJA 3MTJA 2VRCD 4DMMA 1FJHA 4WPGA 4ALKA 1O5IA 2W2KA 2E82A 1WW8A 4M87A 2Y1DA 4A2CA 1HDRA 1JTVA 2X4GA 2VHVA 1DO8A 1QR6A 4QX6A 4R1UA 2WYUA 4HFRA 1NPYA 4XIYA 5IDXA 4E32A 4DPMA 2W4QA 5DOVA 7MDHA 2VTEA 3QV1A 3TNLA 3DB2A 5IG2A 4FD3A 4EEZA 4XB2A 3VVCA 3VKUA 1DOHA 3OJ0A 3LYLA 1BHSA 3ZHYA 2WWRA 5KJ6A 3H5NA 1A7KA 2B4QA 4JBGA 3WDSA 3ZWVA 5EIOA 1I24A 4E5MA 3I6QA 4MIYA 2DTEA 1PU2A 4LRTB 3ZH2A 1CERA 4QECA 5JMWA 4FFRA 5ITWA 4MVJI 4DC0A 3PP8A 3VH3A 1LSSA 1I2CA 3GR6A 1JU9A 5LCXA 4RF5A 3QHAA 3PJDA 4IBOA 4RDHA 3GFBA 1ONPA 4CLEA 5FI3A 4DYDA 3VZSA 1EQ2A 1K0UA 1BDBA 2ILTA 3CKYA 1SZJG 2G76A 1YBVA 4BO8A 1DIRA 3L6EA 1MG0A 4XQCA 1IZ9A 1T2DA 4FC6A 4BNLA 4X54A 4YJDA 2O23A 4IMRA 1AUPA 1P0CA 2YYYA 2Y1CA 1Z74A 3PIIA 3VOSA 2Q1WA 3AUSA 1QRRA 2VWQA 3E18A 3GVIA 1PEDA 1XKQA 3E48A 3COSA 2PA3A 1M6HA 1N9GB 3IIEA 4JROA 3K30A 4R9RA 4R54A 4J0EA 2AA3A 3PFWO 1RYEA 2J6IA 1JA9A 1FF9A 1VE9A 1FDSA 1EBFA 3JQFC 2PWZA 4ILKA 2IXBA 3OEYA 4CV0A 3D3WB 2P9CA 1F8GA 5I8ZA 3PYMA 4LW8A 1D1SA 2FY8A 2C59A 4G65A 1GQYA 4PLFA 3QP9A 4UULA 5H82A 1H9AA 3PJEA 1PSDA 2EERA 3GEMA 4WLFA 3JSAA 5KJEA 4CJXA 1DIBA 3MJEA 2IRWA 3H9JA 3MZ0A 4DGSA 2FR8A 5I8WA 2VYVD 3BMNA 3NDIA 4XGIA 3S2EA 3U62A 3OEWA 5IN4A 1X7GA 4PLCA 1WVGA 3KYDB 3WYCA 1Z82A 1ZBQA 4WEQA 1AE1A 5T6BA 3VAZA 1Y8QA 3OF2A 4BNIA 2Y05A 1KVRA 1LRJA 1OZAA 5AXCA 1GQQA 1PR3A 3RCBA 3QW2A 2VYNA 2OP0A 3AOEC 3U4CA 4A0SA 5LDHA 3RFVA 5DBGA 1E7SA 3GGGA 5JY6A 4R5MA 2E48A 5JDCA 2DKNA 4GGPA 2HJRA 4FIZA 2OMEA 5ADHA 3T4XA 1YB1A 4BO3A 2NVUA 1ZEMA 3AM3A 3GHHA 4GSLA 3C1OA 4TVOA 5A04A 3JYLA 5KJFA 1QORA 3OBBA 2BFPA 3LZ6A 4R1SA 4KUHA 5JW6A 1HEUA 1C0LA 3IUSA 2HMVA 3IQDB 4J90A 4PN3A 4OHUA 4NBWA 3WGHA 4CL8A 3D4PA 4J1QA 5GZ3A 5L7TA 1R4NA
chains in the Genus database with same CATH superfamily
3QX3A 4GKAA 4DLKA 1Q77A 3E5RA 2XGJA 4YRPA 2GXAA 3MWFA 4GGOA 1XQVA 2PM8A 4J6FA 4M0LA 3PK0A 2JIDA 2GVZC 2VTKA 3DHWC 3TRIA 4XVQA 3X43A 5JNTA 4B3MB 1BVUA 2EZ4A 3GFRA 4M2LA 2DBZA 3VZBA 4XVUA 2LD4A 4J0HA 1P7VA 4LXGA 2GB4A 2TYSB 3N87A 1IUNA 4ZPXA 1DJNA 3LM8A 4LMAA 5SYNA 3PX3A 3GV0A 4GBJA 4KXNA 3R74A 4BC0A 1VL2A 1TCUA 3IAS6 3LBAA 1X14A 1ZKDA 2GM3A 4CF7A 4HK4A 3WDKA 3VPCA 1U9IC 4QTZA 1ZW6A 4MWOA 4QUGA 3SFTA 1IJFA 3ASUA 3ZBPA 5L45A 3Q3HA 2PSEA 4JUDX 1T0JB 2ZR7A 1QQ6A 2XT9A 3WQQA 1JVSA 1GPAA 2GAJA 3LFHA 5FPSA 1FFXA 4CM9A 4IIJA 5B4TA 1E2KA 1W1WA 1EFVA 3I6ZA 1NWCA 3MF4A 4OQ4A 4RGVA 4XA8A 3STUA 4DCJA 3O3OB 3IKTA 4BP3A 3MT0A 5TMEA 1UBMS 5JHGB 1WQ3A 1RS0A 1IXKA 1UFRA 3UGQA 2L17A 4Y2PA 2B3TA 3CVUA 2WSLA 2XCIA 4PFQA 4MV5A 5IDWA 3B13B 2QZJA 4RX1A 1D2HA 2C9MA 5D3MB 2FK7A 2D59A 3FPSA 3KE8A 4YJFA 1XTZA 1C8VB 3G88A 1Q1BA 4UE2A 4NR0A 2YOFA 4KPGA 3SQLA 3DCYA 4BMSA 2GD0A 4C29A 2HO5A 3OJEA 1B4DA 2WIDA 4MUEA 1YTUA 2RMKA 4Z2AA 1OGYA 1N2CA 2QTNA 1MB2A 2UYQA 3LIPA 5D5PA 2BTQB 2RDMA 4PPFA 4IH9A 2IXFA 3DPSA 4M6WB 2EF0A 4IPTA 4UJ5A 4KGXA 4PHGA 4BHTA 2A9VA 2H11A 2VSNA 3G0CA 4R1TA 4RA9A 3VXKA 2IH5A 1MB9A 4XGNA 3IX7A 5AKYA 1SXGA 1FFWA 1ZK3A 4URWR 5ICSA 1XF1A 2QX7A 1CE8A 3DP9A 2PZEA 3N2IA 4H16A 4DLXA 2H07A 2ZYAA 4Q1AA 1O5TA 2I4TA 3VPDA 4B5LA 5AUOB 4MAAA 2PXCA 2H4YA 5AFSA 1Z7WA 2ET6A 2F00A 2QPAA 1YXMA 1DC4A 3A4VA 2G1PA 3ECAA 1N2IA 3DCJA 4POOA 2DERA 2H9AA 5CIQA 3VAAA 4EJSC 5IH3A 3RIEA 2Y4NA 2REBA 2XBUA 4XQEA 5D51S 4FFSA 4KPFC 2A9RA 4BDTA 2I8LA 2BFCA 3OBIA 3TH5A 4BVGA 1CQPA 2L42A 4UDNA 4MGYR 5FIUA 1V6SA 2Q5LA 4EFNA 3RVSA 4XQ9A 1UAGA 5IDVA 4LF5B 1KK1A 4YX9A 2BSXA 2I4IA 2COEA 2NQ2C 3IR7A 2G88A 2OO5A 2DH6A 3BQ9A 2F3RA 2GN6A 3JQ8B 1DWPA 1K86A 3LZDA 3SDSA 4EB6A 2V1UA 4L4UA 1CR2A 4KMMA 4MQMA 5BSVA 1YASA 1AS2A 5T3YA 1JDNA 2VTVA 5D3QA 4PIPA 5CFQA 1Y5LA 1NI4B 4YBZA 3GXOA 3BGOS 4XI9A 1DBVO 3ZWQA 2P9HA 721PA 4OJNA 4DQVA 2VHWA 1T0PA 3FIJA 3GFGA 4EF5A 4IGAA 2B21A 1Q92A 1KMQA 1SFRA 2P2SA 3HFSA 2D2VA 3NFRA 3LCRA 3QQPA 1UODA 2P3LA 3CBQA 2PO7A 4IV0A 2R8PA 1TOAA 4LVCA 2BKEA 1TEHA 3SNHA 1HDGO 3WRXC 2QMEA 2KS6A 4G1MB 2REOA 3WGGA 2EWMA 3DG9A 2IKSA 2V0GA 3RNLA 1HLPA 2UUPA 3RO7A 3O2NA 3ER6A 1C4OA 2B6NA 3OCUA 2BJWA 5DTMA 4YK7A 5L3ZA 4HVTA 2FSFA 1J0DA 2LR0A 1E3JA 2P9GA 2IEIA 4Q1CA 3WWCA 2WWXA 2PS3A 4FLEA 5T4BA 5KSZA 4HRVA 2C84A 3U49A 3HY6A 3PWSA 1ZUIA 4I6GA 4JB8A 3U9TA 2FHSA 5E6SB 4FYYA 4MW5A 3ANMA 1Z35A 2ZT8A 1QH1B 3GRVA 2WC1A 3MBIA 1WP9A 2H0RA 1RIIA 1U7ZA 1YFKA 5TR9A 4RE5A 5JS1A 3CLSC 5IJ9B 4UM8B 2LTAA 2BFAA 1XFAA 3Q41A 1X77A 4WMLA 1DO2A 3MTEA 5H3HA 3EQ8A 4GMFA 4OQQA 5FBQB 3A36A 2M6RA 1JWLA 3GUYA 1I94B 4TUYA 3GD7A 4LYJA 5BURA 2VUHB 2CJPA 3QJYA 2SHKA 3V4OA 3JSXA 2BDUA 3AKDA 2C5GA 5CU7A 1JJAA 1SBQA 1TJ4A 1Z6GA 3RANA 4TWZA 1E2UA 3W5VA 2YWXA 1RHMA 4FGWA 4AKIA 1UXOA 4LOIA 1HYBA 1B00A 3CM0A 2PQMA 1W1IA 2FI1A 2NO6A 2X2PA 1E77A 3EDMA 2ZI7A 3K8OE 1DEHA 9LDTA 1A8QA 1OBOA 1WAMA 3AF2A 4N03A 4OXYA 1G3UA 3B9QA 5D3KA 2YJZA 3A31A 2P9TA 2W0MA 3FPFA 2J4CA 3H1AA 1FS5A 3GRZA 4Q7KA 4XOIA 3U7IA 5FWNA 2J0SA 3ILVA 3KJGA 3LLVA 2QMOA 1Z07A 2VT3A 2QU7A 3TECE 3VNBA 5J47A 4ER6A 1TT5B 5CX1A 2IP2A 1G5QA 2Z6VA 1NYLA 3HACA 5J2UB 2VPYA 2Y2VA 4DBZA 1U2GA 1N6HA 5JS6A 3DOOA 2CCGA 4BMNA 4G37A 4B09A 2R1ZA 2H00A 1X7ZB 4FHFA 5JFGA 1XTJA 1E7WA 1CDEA 2W9XA 2A94A 4BLTA 4D3DA 3L04A 4MWTA 2MYTA 1YRLA 5JAZA 3RYCA 2BT4A 1TGYA 1LLUA 1ST2A 3QXHA 5IPFA 2GM5A 1WDMA 1E9AA 3WGZA 4CL2A 1M5UA 3RVRA 3WJ7A 7MHTA 5AW6A 2WV9A 3GXBA 2R8RA 4H4EA 1KZGB 1UBJS 3PXGA 1AKMA 4IVNA 4DUPA 3OQ1A 4BZQA 4Y1EA 2Y27A 1KOFA 4QUJA 4Z4FA 1YCHA 4HEA1 4AWAA 5B2ZA 2F67A 4UE3S 3U7QB 2FZLA 4JOSA 1M6YA 4CMBA 4R71A 2PUWA 4PGFA 3HXMA 4LTNA 2W7TA 2VDNB 4MXDA 1ZOSA 1OWMA 3PB3A 4OP3A 3VR5H 3ZDYB 4CG2A 4ER7A 1TEZA 1EGHA 2VK8A 1E3EA 1NULA 1UMBA 2J45A 2B20A 3M4NA 4IL5A 5GIOE 2HA2A 2BONA 2JH9A 1F5NA 2O2HA 4UM9D 2ACVA 1A4XA 2M9MA 2UVQA 4GLBA 4X1KB 2I2WA 2BGIA 3MJSA 1Z2EA 5CK4A 3PC4A 2V3CC 3T54A 4OUKX 2AQIA 1X0XA 2J9ZB 2VOEA 3BD6A 5E8RA 2A4KA 1ISPA 3AFHA 5E6RA 1OIVA 1XXLA 1G8YA 5K20A 2B0CA 4CEHB 3PLAE 2QYTA 2A7XA 3CF2A 2UZAA 4BB0A 1QU3A 3PEWA 2FUKA 5ECWA 2G1UA 4KQKA 4F2HA 4OMFG 5LU9A 2E6UX 3W2IA 5GJWC 4F6RA 1FUUA 1YZLA 4M9ZA 2EBUA 3A27A 1PS9A 1O5OA 2RC6A 2IZ1A 5EE0A 3HR4A 2E55A 3R6GA 5B1DA 3G5MA 1RM0A 5GY7A 3A9WA 3IQWA 3ACBA 3NTVA 3ZCUA 1OYVA 4FGZA 4KB5A 3QHPA 4ZV9A 5HIKA 3I9OA 1A9TA 2QTGA 1H5NA 1FSZA 3CUWA 4GKBA 3GLGB 2DKOA 3RRYA 1KEEA 1FMTA 4RVNA 4EQZA 2WEKA 4BASA 2OBLA 4H4DA 4NMMA 5FQNA 1CW2B 2IBTA 2R2AA 1VL5A 1CVLA 5H4GA 3KZNA 2I87A 3P19A 1Q1QA 3TQOA 1W5BA 1CFZA 2ERYA 2PD6A 3L18A 2ZQZA 5LBUA 2JAUA 1GA6A 5IVPA 3T9FA 1E9FA 1M1YE 1WE2A 3GAZA 3K20A 4OFWA 2VK2A 2JD2A 3LH5A 4U6NA 3E9ZA 1GTRA 1NUAA 3ZLVA 4LK3A 3ZJ4A 1XD2A 3E8MA 1ZN8A 4MWBA 3LWNA 2IGBA 3KTOA 3OZFA 1N1DA 2FZCA 4PSDA 5A05A 4EJ6A 5DMHA 3JQRA 3O75A 4QDJA 5AUQA 4EG4A 2JZOA 2DECA 2AQKA 4C88A 5ICEA 3NDBB 1XXHA 1Q15A 4OXRA 5GGXA 3FFXA 4UQOA 1DOAA 2GHRA 2W2QA 4S2EA 4PGMA 1FVOA 3Q7IA 4RKEA 4ASUA 2IUUA 4ZXFA 2CJWA 4XX0B 2SCUB 1N75A 3RHTA 4XXHA 3G9TA 2FP3A 4JFAA 1IPHA 2XY4A 2GVNA 1U2ZA 3AJAA 1WPRA 1QDEA 3HR8A 3HXPA 4IDCA 4RK6A 2Q45A 3WK8A 1VOTA 4UVDA 2PUTA 1M5RA 1SXJB 2H7CA 3OESA 4HV4A 4D79A 2FSVC 2JGDA 2WV7A 2KPOA 2QTFA 1NFQA 4Q9LA 5HKAA 3DFKA 5CH3A 5FBLB 4GHWA 1D2CA 1NV8A 4PZ0A 4IP0A 3QUBA 5BV1A 5LP1A 5JNLA 2XNJA 2YV2A 4TTTS 3ZBUA 2UUCB 1RHJA 5IVIA 3VR4D 3QTLA 2B9VA 2NACA 1K63A 3QFFA 4IIYA 1YBFA 1ODLA 1CT9A 2J6CA 4F6LA 3NBMA 1P9NA 4GXRA 3I1IA 1CY8A 4MQEB 4K81B 1IG0A 4GBED 1X7ZA 2ZAIA 3MNFA 2VAMA 3OA2A 4CXMA 1S7GA 5DX1A 2YJ4A 3VDQA 1E2HA 2QY9A 4K6OA 1CQIB 3H75A 2XKBA 4UVEA 5EXEA 4NF2A 1O94C 2XCQA 3CVVA 2H7YA 3BE6A 5TNXA 5COAA 3L4SO 5B1HA 3UPDA 1KEZA 2D7JA 4PLGA 4CMIB 4B74A 1QYVA 1L6IA 2O2XA 1WB5A 1YDMA 3HDVA 3TSZA 5EA2A 2GZHA 5EE5B 3JQAA 4DBVO 2GPTA 5CXUA 1Y6GA 2GDZA 4L0CA 2HU7A 3CWZA 5DTRA 3SSMA 2B5OA 2BCJQ 2ENWA 2JGAA 3IDFA 3YASA 1JAXA 2QVBA 1AK9A 1L0BA 1NOKA 1QVVA 3QE4A 2F8MA 2ICAA 1PJAA 5BRAA 3E23A 1H8HA 1OTXA 4RSGA 4JSRA 2G5PA 2P41A 3UC5A 1TUBB 4E2XA 3LLCA 3IXQA 2YHIA 5F51A 5TDHA 1DBRA 1CF2O 3V80A 4PNZA 1C4WA 3JVDA 1RMQA 1SZPA 4L51A 3HDJA 4JBNA 5EOVA 2O1XA 4I55B 3EDYA 5HG0A 4WZAB 5LD2B 2A5LA 2C2MA 3AHFA 5HDBB 3W5DA 2P0AA 1EEHA 5JBQA 2DYKA 3D3KA 2VSYA 1JW9B 1HYEA 1LKZA 3KYCA 4GLOA 4GU5A 4LA4A 1OIXA 2QKYA 3E8SA 3REQB 1EXDA 4FZ3A 4RIHA 4W7IA 1QHNA 1QYDA 1RCUA 1T9ZA 3CB4A 2GZAA 3GUZA 4PQGA 4ZALA 3ZQ6A 3ZHRA 1X8LA 5K0SA 2HRQA 5KTOA 2PKCA 1TZCA 3COWA 3T9BA 3AJRA 1CUUA 4CMAA 3F8SA 1H9CA 3F9CA 1MH9A 1RJ9A 2BMWA 2YZ7A 3SSNA 4Y6LA 4KACA 4TM7A 1MTZA 3FOWA 4BQSA 3H9UA 4D44A 5T5QA 3I30X 1I2AA 1MC5A 4MS4A 2JI6A 4C4OA 1EUCB 1ULAA 1EK6A 2OECA 3FTQA 3IIIA 2YMQA 1ABBA 3V6MA 1BU8A 3GUCA 2ZJ7A 4WNAA 3T5DA 1ZRNA 5C8YF 3RD5A 1B8PA 4ZVMA 4ARIA 3B78A 3P20A 2OO7A 1J5EB 4AS3A 1UJ4A 4G07A 4OA5A 4G67A 5EZQA 4H1TA 3TQCA 1SCDA 2QN1A 1VLMA 3ZOZA 1BVHA 1GA1A 4EFMA 4L76A 5JE8A 3NT2A 2YW9A 4WBNA 3KAKA 5HF8A 5BOSB 3A4YA 3CTMA 1M6WA 5EFZA 3WWZA 1RM3A 1AN9A 4R0VA 4D96A 1L2TA 5DO9A 3VU3A 1CRQA 2MSKA 3JATB 3UOAB 1HQYE 1GZ7A 2ALJA 3MCUA 4KXWA 1UWCA 1TI7A 4JY7A 1AHPA 3KR1A 5H9VA 3UG7A 3KT6A 3Q3JB 4HQOA 1DMRA 4B81A 1NYRA 2ECQA 1JN0A 2PRKA 4ECAA 4P98A 1WY7A 2AFIB 2KI5A 5DBIA 1YHNA 4MDYA 4ABTA 3SAJA 2YFKA 3RUDA 2PK3A 3RJMA 1N0VC 4NBTA 4TL7A 4ARAA 3FCUB 1J1IA 3EIQA 1ZHHA 3NC4A 3ZU5A 3SE7A 4QTUB 4JOQA 1SOVA 4DEVA 1RBYA 4RS4A 4E6EA 3VDRA 4GH5A 4CYMA 2HQSA 3AJ8A 3PCRB 4KDEA 3ZIDA 3O8CA 1ETHA 1G2OA 4JT2A 5T41A 3RHSA 1Y8RA 2Z9DA 5EEHA 3HN6A 1R9MA 3ZKAA 1MQAA 4HUQA 1C3OA 4B0OA 4FFPA 5AKKA 3TPZA 1RRVA 3AR4A 4XCQA 1KQPA 4EY8A 3DB1A 3RKSA 2I1LA 5HIIA 1PEAA 3IGFA 2OMKA 1E3SA 1CS0B 4IUYA 1N3BA 1OIWA 2VDJA 3JALB 3ACDA 3RSLA 5JS7A 4NX2A 2WQ7A 2PZKA 1UP4A 1Y5NA 2OO5C 3I83A 1GUFA 4OH1A 4HP8A 2XECA 4N39A 4FMCF 3BJRA 1N2EA 4O2BF 5EZ5A 2VJKA 5BQFA 5KU7A 2ETXA 1L7NA 1L4LA 4Q3NA 2MYUA 1H5QA 1YVUA 2QVLA 3M3HA 3PJGA 2JI9A 2QRJA 1PK7A 1F3LA 1WVMA 2Q3MA 1XCJA 3H18A 3PR1A 1GDDA 4G4SO 3DFUA 3HU3A 4AULA 3EVDA 3GRCA 4J7XA 2PBFA 1E1LA 1XZIA 1NQWA 1Q7TA 1RYZA 4NEGA 3MWKA 1CF4A 5LLTA 3WLMA 1H4TA 3IUQA 3OHPA 2XMSA 2O5EA 2QF7A 3BWCA 4BV8A 1RQNA 3PQDA 2EVWX 4J0FA 2XE4A 4EPWA 3ZGYA 4H6XA 1ZIXA 2VSFA 3NJ8A 2FCRA 5ELLA 2RGNA 5KNCD 3SP1A 1YKFA 1V8OA 4H7DA 1QWOA 2A4MA 4DRXA 2BMJA 2B37A 2Q3BA 4B8WA 5JR3A 1H22A 1UR5A 3KSUA 4RV5A 2IHYA 5AVVA 4IJ6A 3I0NA 4YPVA 1SM4A 3E4DA 3BXFA 1GZVA 4PSKA 3PEEA 3MYYA 3TOVA 2RJNA 3UV6A 2GPNA 2QI9F 3PVZA 4R1MA 1L4BA 3RSGA 2NNLD 3DOUA 3PUHA 3S70A 4DPLA 2BVNA 2I6TA 2I6UA 4HNSA 4Y30A 5EWLB 1S02A 1JVNA 2FRDC 3RTGA 2RKWA 3WZLA 2RARA 4ZDWA 1PR9A 1HETA 2I8CA 4F12A 4PQFA 4ZQBA 5A62A 1ECBA 4HWKA 4EMSA 5AJHA 3QEJA 4YASA 2X0FA 3ZLUA 3V5NA 2QUKA 1QFSA 1U4SA 3THRA 1BGXT 1YB6A 3Q2IA 2QTBA 2Z4RA 1MO6A 4Q4HB 1B1CA 4PVCA 2A92A 2W43A 2FMKA 1GWNA 4DLZA 8MHTA 2QG6A 3ANTA 1GHTA 4F5WA 2PQ0A 5J1SB 2OCDA 2XYPA 3QYAA 4FFDA 4QGHA 1TYDE 4NVRA 3C1TA 4O1IA 3UY4A 3LI2A 1C9YA 2Y1EA 1TCVA 2EG5A 3QIAA 1PQ4A 4H1UA 2J87A 3PRHA 3RVLA 4JT9A 3ONWA 1E9DA 2Q6IA 1XZJA 1IZZA 1M2JA 2W71A 4U7HA 4IYJA 4WZBA 2O0KA 3OM8A 2XDYA 2JIPA 5GZ6A 1L8QA 3CLUC 1P0QA 4FR5A 1KYYA 1XZBA 4L3WA 4XR9A 5KYXA 2GZDA 4UARA 5F98A 1Y82A 2QYSA 4UCQA 3Q72A 4BGEA 4OX9Y 1ECPA 3ESDA 2XUGA 2G36A 3B3AA 4QFDA 1KH2A 4ENUA 4Z4QA 4QLOA 4G63A 4DN6A 3L4KA 2X9GA 3HCFA 4WIAA 1RPTA 3MAGA 1ZI6A 4IMIB 1MBZA 3G7UA 5JY1A 1NI3A 1EJ6A 3HNRA 1DBIA 1Y1RA 5IYZA 5EUBA 2FG5A 5LP6B 5AH0A 1RI1A 1MJNA 3OPXA 3ADCA 4DIDA 4LDNA 1UZUA 4ED9A 3NWOA 1BDIA 2QQEA 3QH4A 4MRNA 4IH4A 2V7QD 4OHYA 1Y0BA 5EMHA 1IATA 3CZ5A 2OBXA 3H97A 2YIVX 2V58A 5IS2A 1XLUA 4IJWA 4BRWA 1E3MA 2IHJA 4TQGA 5TEWA 3NLLA 1RZUA 1QONA 1Z7YA 2EJUA 1JBKA 4HWGA 4DQDA 1P0MA 5CBKA 2E4AA 3AL2A 3KWLA 4WZZA 2N46A 2RKOA 3IYLW 4UBMA 3W7VA 2NU6A 3OLYA 1M8FA 2PSSA 2CNWD 1LLDA 4LXYA 3WB9A 2CV1A 3P8ZA 1Z7EA 3ND5A 4X7BA 1I2BA 4Z0PA 5ALMA 3KAJA 3MIIA 1PBTA 3QUCA 2IDKA 3A9SA 1DNPA 3BULA 3K71B 1O4WA 4C4RA 2INGX 2BH9A 2FW1A 3KQSA 2G04A 1FLNA 4YDRA 1QGAA 1V8BA 2AW5A 4UUBA 1P7YA 1QLHA 1XCMA 2QGZA 2B2CA 1GKUB 2GKGA 4ZZ0A 3LPNA 1G5RA 3D5TA 3NUQA 3F5MA 4L50A 1DIAA 3LWBA 1TO1E 4CUZA 5SY9A 1C3VA 4V1CB 4EY7A 1YOBA 5E0KB 3DXXA 4E5VA 1ZMXA 4FYHA 5AK6A 1GILA 3DGEC 3V97A 3DMTC 3CH5A 3WLIA 1Q22A 4DF3A 4P7KA 1Y5IA 3A25A 2AF3C 2XJ9A 2YUIA 1ACLA 1C7ZA 3HUFA 1Q6YA 5BYJA 2WSSD 1YI8A 3JQFA 3VPGA 3ZXUB 2C00A 1QYXA 4IQ8A 2WSSA 3WXMA 5I9NA 4TYPA 5KCMA 2R2GA 5HJ5A 2EFCB 3A11A 2JAHA 3SF0A 2Y6UA 1HF3A 1VIYA 2Z6AA 3HP7A 5F9FA 1M34B 2QQGA 3DDZX 1GG9A 4RESA 5HZKA 1SRQA 3N74A 2EL7A 3CHYA 4P3OA 1IZ8A 4KVAA 4D46A 2J4DA 1N6IA 4GKVA 3D3NA 1QQAA 1MJFA 2ZCUA 5TJ9A 2VNSA 3RAEC 5GV7A 3DOFA 4L6IA 1OZ0A 2V7WA 5HKKD 4I50A 1KQGA 3ROTA 1Y1SA 1U0LA 3D8NA 3FTEA 1YVEI 1VKOA 1SXJE 1JQ5A 2FSUA 3R3VA 4H6WA 5HUQA 2ATVA 4E51A 4D0GA 4ZEOA 5E3HA 4O3MA 3WGMA 4UDXX 5EHNA 1JL3A 3U4HA 1O1YA 4OQPA 2OGZA 5KYUB 1DTSA 3F97A 4HDSA 3VDNB 4BJHB 1SKYE 1CZKA 1C50A 2OXCA 1PG5A 5CB4A 3QEMB 1NR7A 1W2GA 4UKDA 3AVVA 2OCLA 1OREA 2R47A 2W5UA 3DOEA 2JHPA 2CXHA 4B0PA 2IWHA 3EZ6A 2HLDD 1DVRA 5H83A 3KXLA 1NF9A 1W73A 2XVMA 4GAEA 2WSYB 4DQLA 2YYAA 1ZQ1A 3HXTA 3NATA 1OILA 3N75A 3P5BA 1QH8A 3F1KA 4X63A 5H59A 3UW1A 3WL8A 4ZHSA 2CN1A 5J4KA 4DY6A 4IQ4A 1H2BA 3CFYA 4EYSA 2Z5GA 1QHHB 1QK4A 2X8BA 1T9HA 1NUQA 3TQQA 1JR6A 1WDKA 1AQ6A 4Q7MB 3TLBA 1KK3A 4RVCA 3TIFA 1PG2A 2GN4A 2AI3A 2VOJA 4YDHB 1EE2A 4MR8B 3DC7A 4GLJA 1HT0A 3QLVA 3NIGB 3HJHA 1PR1A 1Q7GA 1CS4C 1L9KA 2JATA 2XRYA 2YQ5A 2J32A 1QF6A 4G4JA 5L3VA 3T38A 3FBTA 5HZMA 4FMDB 3NG1A 4K28A 4LV6A 1FNDA 1G55A 1YDFA 4JJGA 4LJYA 4OUDB 2EBHX 3TDKA 5FOQA 1I0ZA 3B3FA 3HVKA 1F9EA 3WIBA 5TJHA 1O3YA 3JVEA 2AEJA 4ZC8A 1A27A 2C9OA 1KY3A 1A9QA 1HE8B 3VYUB 1ZGHA 2DF8A 2YFQA 4YMGA 3IBTA 1NW7A 2RGCA 4GWKA 4XPZA 2ORED 1NVVQ 1L4GA 2GAOA 2XNDA 4TKVA 3UAWA 1U28A 3PLRA 1AKWA 3PFCA 3WP1B 3ABQB 3IDSA 5EZYB 5KYTA 4Z4GA 3BH0A 4AS2A 2DFDA 3IAUA 3DR3A 1LRLA 1UKEA 3P4YA 4B1FA 4BMVA 1YRAA 4RACA 3TE7A 2D54A 3V7WA 3ZU6A 2RB4A 2OFWA 3RJTA 1U9ZA 4C6TA 2QVYX 1YMVA 3ZWBA 2HD4A 3ZE8A 4WOKA 2H4WA 5AOAA 2BKLA 1WZNA 3CNOA 1V45E 2VHTA 8LDHA 1M0EA 2WM9B 3TDNA 2JNWA 5D87A 4PG7A 1R8YA 1QPGA 2EW1A 4LZZA 4XD7D 2Z04A 4A16A 2HLDA 5CDFE 4N5DA 5IJWA 2JFXA 3D6HA 2DJIA 5DULA 1KDTA 1T1JA 2PJZA 1J39A 1M2KA 2AQ8A 1F6WA 4K1XA 1QB7A 2I33A 3QXJA 4GMXA 4I55A 4QYTA 3ECSA 4OHCA 3ZOKA 1DDGA 3H3XA 3KQYA 3G13A 3BDVA 2V45A 3LG2A 2KHZA 3OURA 1A4IA 4KO3S 1HE1C 1CQJA 5HVNA 1F2TA 2EP8A 2R3SA 4HZUB 5KYXB 1XI2A 4EIWA 2DR2A 1O9GA 2IEBA 5CA1F 3KQHA 1PNTA 2HREA 4N6GA 3R40A 5TQ0B 4BGDA 2X40A 3ROPA 2QMUA 4MOWA 4NCAA 1ZRSA 1VHWA 2AMFA 2C0QA 2Z30A 5BY2A 1LPBB 1KSFX 1AS3A 4YP5A 1JA1A 3ZGLA 1OLOA 2OCKA 1E99A 1W88A 2BFBB 2O3TA 1P5ZB 2HXYA 3B9BA 5JADA 5KYNA 1F38A 4JQCA 2WU4A 4RZ3A 3OF5A 5ALQA 2C2XA 4KI7A 2WJAA 4BO2A 2IWRA 4MAMA 121PA 3W1EA 1ZJWA 1FP4A 4HTFB 4Q1VA 3W3AD 2PUEA 1DDOA 3HXKA 1C9NA 4RVGA 5K8UA 4WK4B 2EQAA 4INPA 4OFBA 5B6PA 2IDMA 3IOYA 3LDGA 1YFJA 4JHLA 3SYLA 5FWAA 4A6DA 4HQRA 5KX5F 1L5QA 5ELMA 2ZJ0A 5F3RA 5CLJA 2V96A 1O58A 5EJ4A 4GYYA 3GNQA 4RTJA 2H51A 1K0FA 4M8LA 3C14C 1UOQA 2JIZA 4B7XA 1H65A 1MC4A 2ZUFA 4GPTA 4AKGA 3RM3A 4CR6A 3LW8A 5HEKA 5KQSA 2X13A 1EJ0A 2XQJA 1ADBA 4FEYA 4ANFA 1VHDA 4XD7A 3HJUA 3OIYA 4HFMA 1DC3A 2J85A 1YQQA 2Q0SA 2FN8A 3DLAA 4O1HA 1O6ZA 1Z8HA 1NATA 2QZPA 3S55A 4Q3EA 3W78A 4X1YA 3WC4A 4MVJE 2WDZA 3B82A 3OZRA 2ZSFA 4F04A 4X20A 1CP3A 1OC2A 2I5PO 4ZO4A 3ZHXA 2F62A 5FYDA 3HCOA 1PV4A 3ES9A 4YR7A 1WXXA 4R40A 3R20A 1EVJA 4CV3A 1EFAA 2AUNA 2P90A 3DCNA 3DMGA 4QYWA 3FR8A 1NNEA 3T7EA 2BFDB 5ILGA 3WRVA 5KNDA 1O8CA 2G9UA 3OPNA 1PW7A 4UQPA 3QVVA 1KGSA 2C7VA 3EHDA 2RGYA 4Z3DA 3PHBE 2HUPA 4LXUA 2O14A 3BE8A 4UU0A 3VPFA 4BFSA 5KNDH 3CLRC 3U60B 4UJ3A 3FKSD 3HCDA 4D3ZA 3ZWAA 1E4OA 1PWYE 1FRZA 3KAPA 4FNMA 4KQ2A 1KARA 5DYYA 5JSFA 3JQCA 3B5IA 2FMIA 1H85A 2EQ5A 2IIBA 4JQOA 3WAGA 4KJXA 2BR3A 4U2CA 3LGAA 3UMVA 4KUGA 5JNVA 3OQ6A 3H04A 3NT4A 3MUNA 2FH5B 3FLBA 3B7GA 4L9RA 3O4GA 2C98A 1HTWA 2Q1XA 3FYUC 3AOGA 4Q4CA 1KZHA 5LFAA 3E9MA 4K9KA 3ADBA 4LMBA 2OCPA 4JUAA 3PUKA 4NMHA 4Y6QA 3R7WB 3DE7X 4R0NA 1VPDA 4BQFA 1VSTA 4IW3B 1G7RA 2QV7A 3VYVA 2QNIA 5EKXA 1OVGA 4F85A 2OXRA 1UJNA 5CT4A 5K05A 3VH2A 2PL5A 5JWRA 1JDJA 3CWCA 1EEXB 2XYRA 3A6HA 1G0NA 1EP1B 2QTRA 5HOEA 3U7QA 3QPBA 4FGLA 1WLSA 4JLJA 3TX6A 3HCBA 3ZWCA 4R9SA 1JG4A 1HQCA 3DHVA 4LRXA 2DFTA 4DCOA 3N86A 3G2KA 3VHXB 1QK3A 2F1IA 3KHSA 5ALDA 1C3XA 1QAQA 1ZD3A 4KQ6A 3LHKA 3LUAA 4GX0A 2IS6A 2WKPA 2XF2A 3KU4A 1GGVA 4N9WA 3AEKB 5F12A 1RXIA 5HCIA 2JLVA 4O4HF 3TVYA 4JXKA 2BDTA 4FLFA 2DHRA 1MA3A 2X0KA 3JZMA 1XAGA 3OPQA 2OXIA 5CFRA 5KHOC 2VEDA 2A2ZA 2N75A 3CPJB 2NT4A 1B93A 1QGUB 3HM2A 2D7DA 2ZCJA 1U4OA 4CEHA 1T1SA 3L0IB 4NENB 2C77A 2R84A 3WJ2A 3KV1A 1WB6A 4OKSA 3JXEA 1SUDA 3U44A 4G4IA 2OGUA 3EJ6A 2P91A 4QUEA 4IX9A 5C8VA 3K0EA 3VR2D 4DDVA 1KK2A 3D5QA 3JVVA 3LX8A 2C8JA 4OEHA 3DV0A 4DLPA 1YFLA 3W9BA 2NXNA 3NVKI 4GZ5A 2Q50A 1DAMA 2EJVA 2IYZA 1JG3A 1H0RA 4PAWA 5K0EA 3R7BA 5I01A 2YRXA 1LFAA 4Q4HA 3FXAA 4H7EA 1XX6A 3EBOA 3RC7A 3JARB 3WY9A 5I7FA 2PXAA 1Y5MA 3F98A 3PNVA 1U3FA 3TN7A 4L95C 2R87A 4CCAA 3DXFA 4RTNA 2WNIA 2JDID 1SQ0A 1T9CA 2XBMA 1H0HA 1GJRA 4MVJD 1TZBA 3BRCA 3IS3A 4G8JA 5A3VA 4E4YA 2HK9A 4MI1A 1C0KA 5F21A 2J9GA 4QFCA 1HK7A 4BEJA 2XHZA 4QRHA 2Q9BA 1KOGA 1DJMA 4M1QA 1YUMA 1UDBA 2WI8A 4RMIA 3E1KA 3LC2O 4Y2TA 3WADA 1ILEA 1M7HA 2AI2A 4BX0A 1YIAA 4U7TB 3CY6A 3QOYA 4AMBA 1A3CA 4BWFB 3R8XA 4CFSA 1M1XB 4E88A 2XXAA 1KAGA 4A03A 3DW3X 2OCBA 3CUYA 4WCFB 5AJZA 1TCAA 4B43A 1MD9A 3ZYCA 3BWDD 1NL3A 4PO1A 3IB6A 1T9KA 4GOXA 3LA6A 1NMEA 3EEBA 1EB9A 3TW8A 3BSWA 4KP7A 2H85A 2JZNA 2IXAA 3GRUA 4XAQA 1VM6A 5H5JA 2W6QA 4TQ9A 1E58A 5KI6A 3TAHA 4CLDA 2WD7A 3ZDAA 1M75A 3PJRA 3DUFA 3KZCA 5D6OA 1JEQA 4HN9A 1Z83A 1B8VA 1KI8A 4Y7DA 5EIFA 3IAM6 1E1YA 3GEEA 4MV8A 3TPCA 4X85A 1Q17A 1NBWB 4WN9B 2Y0PA 4TRMA 1ZK0A 1FYEA 1BWPA 1KORA 2P11A 4GRAA 1TLFA 4C89A 3QGMA 3AYZB 3EIUA 3UGKA 3BD8A 1YS7A 3SQWA 1B14A 4NXNB 4DUGA 4S12A 2H2AA 3VR3D 4QRIA 5HHTA 2XMPA 1WL8A 1E1CA 2Y3IA 2ZI3A 1V16B 2X0JA 3LWDA 5CPFA 5HGJA 1ZOPA 4RDXA 4YP9A 4XWWA 3ASVA 1FTNA 2J9RA 3ABZA 3EMBA 3LIIA 1GRCA 1VPVA 3NYIA 1SULA 4K8RB 1Z29A 4ROTA 1DQRA 1Q57A 5CVEA 4CLOB 4FFWA 1ND5A 3GFSA 3IT3A 2CBZA 2FZ4A 4LJAA 4N1AA 4F5ZA 3EVFA 2DRIA 4TMVA 5C1BA 3LUKA 4F9FA 1G8PA 4MYRA 1Q3HA 1OTHA 1W29A 4NU0A 2HN9A 5AOVA 4D3SA 4CKCB 4UU8A 2QD4A 1QIDA 2B4RO 3GDWA 1VGRA 2FEOA 1N2JA 1QHXA 3LD9A 3PUWA 3GRAA 4WX2B 2PMBA 3HO8A 4LHZA 3VTFA 3LNCA 4RWZA 2JJMA 4QQFA 3B60A 3DMDA 4INOA 4IXWA 4MUAA 5DYIA 2AR0A 3COPA 5FJJA 3VSDA 4DADA 1GCAA 3I9JA 2O54A 3B52X 3MXOA 4B4OA 2B98A 4EA8A 1KJNA 5CEJA 3UH0A 2CL0X 3FTCA 2D7CA 2VP2A 4C7VA 3LYUA 1PL0A 1JLRA 1WMSA 5DGHA 3C45A 4I5DA 3O1JC 4KXMA 1W7AA 2FUCA 2WLTA 3DE2X 3LRPA 1X7WB 2YVLA 3AY6A 1U99A 3W5BA 2BBWA 1GGEA 1U0OC 3C43A 1FLVA 1PUXA 5LP6A 2WWVD 1VRCA 4WAUA 4X1YB 4JEMA 5J1TB 4WGGA 2OC4A 2G07A 5G1NA 3IBGA 1EQAA 1RHRA 2J3IA 4Z7QB 1J23A 4HDMB 1I3KA 2RONA 1XTUA 2FW6A 1O77A 4PRZA 4JKIA 2XCUA 2V9ZA 3L6DA 2A5GA 2C5AA 1A7UA 2PZAA 2JCGA 2C2HA 4NCJA 4ZKDA 3DPUA 4LF6B 5KTRA 2ZSAA 3L7NA 3PJFA 1W93A 1T3GA 2ZI9A 3OWXA 1IBCA 3FSGD 3VHXA 4KR3A 1FNBA 3AZOA 3GY0A 4Y2GA 1U3VA 4AMYA 2NZWA 2G77B 3HABA 2PMEA 4DRYA 2XNSA 2Q2OA 1V16A 2QRGA 2XR1A 1GTMA 1JG7A 1GDHA 1WUYA 2IW3A 5FPTA 2AD5A 8ADHA 1UM8A 4ENTA 4CKWA 2JA1A 3O03A 3CR7A 1MMFB 1IFXA 3QU2A 1II9A 3O92A 5DHSA 3G85A 1MO5A 3M6FA 5ER6A 1NRJB 2XMQA 1GNPA 2RHOA 5IK2D 4IJQA 4EKDA 1U7OA 4QGGA 4MV0A 2OPBA 3D2LA 1H4QA 3L2OB 1N32B 4HN4B 4OSPA 1E7RA 1IU9A 2ZYUX 2DFPA 1QH8B 1X8KA 2FSHA 4MWEA 1YIOA 4WBXC 4WJKB 4X6YA 1JNXX 5DVZA 5BNTA 2REQA 3IIJA 1U0SY 4KRGA 4BNWA 3KJQA 3MLEA 1BXGA 3U16A 5AI9A 4DQXA 4C0LA 4E1AA 3FNEA 1IONA 6ABPA 2F1OA 1Y80A 1CUFA 3OX1A 2X8AA 5F3WB 3G0BA 2Q5OA 5AJWA 1XZFA 3DPIA 3PTAA 3EVCA 4OH7A 4ECEA 1QIFA 3AZQA 4DILA 4HMOA 3UHFA 3U4IA 4ND3A 3HS3A 4CIXA 3WNDA 3L7DA 3V6LA 2ZDGA 5AM3A 4E2FA 5F4BA 1RJ9B 3TZBA 3O8RA 1IY2A 1X2BA 3KWMA 5FLYA 3ROQA 4EPXA 4M8NE 2QBYB 3SICE 1RPNA 2Q9AA 5I9TA 4U0JA 4DXHA 3FPHA 3RVQA 1Z13A 2CLSA 1OMOA 4V0MA 3R24A 5I5EA 2W70A 1QCYA 3HA3A 3NRBA 4BBJA 3IUEA 3EDRA 3KR0A 2D3TA 3SYMA 3WS7A 1HE4A 2CXTA 5GINE 4Z0HO 1KBQA 4WHMA 4AO8A 1NMZA 1R0KA 3T12A 3KQPA 4RENA 2K4MA 2H29A 4WSOA 1D5CA 2ZRFA 2GTPA 3DBHB 1Y6ZA 2NVBA 1JI3A 2G5GX 2FN7A 3GLKA 4PXAA 4QOFA 4UHEA 5K45A 2NADA 2O48X 5TS2A 4MTLA 4QOHA 1ORVA 5GZ1A 1TUBA 1A97A 3D7KA 2WUFA 4IXDA 4TMTA 4AMGA 1GLNA 2ISSD 3NTLA 3WZ2A 1RXUA 1WXQA 3I39X 2HHHB 3OCZA 3QTTA 2BZ0A 1AH2A 3HV2A 3VKGA 1NKVA 2X8LA 3KKLA 2DLCX 1WF6A 4K9DA 3NTUA 4F8JA 1EINA 2CVHA 2AC2A 3IV6A 1DQYA 1JDSA 1X7YB 3HZOA 3ELWA 3VAYA 4FNOA 4CIAA 1FL9A 4FD2A 4NCNA 5L95A 4CKBA 3GLFA 1ZL2A 1ZN9A 3BWVA 3IB3A 2G5CA 4OI4A 1XOIA 1V8DA 2UDPA 1JF8A 5I3ZA 3CZMA 1P7PA 4AIIA 1USGA 4KIFA 2FP4A 4NZ9A 1PD1A 4ENSA 2D0OB 2YIDA 1O6BA 2BC9A 3LP6A 4GC5A 4IFEA 4LJSA 4M9UA 3MMNA 2WMYA 5I9SA 2AEMA 2BZ1A 2QTVA 3H83A 4C05A 3IVAA 3W6ZA 2FN4A 1GAWA 2HCTA 2ZIXA 4ARVA 4O08A 2FFRA 4P4SA 3MILA 3QKWA 4HR7A 4LX0A 3L7MA 2RHLA 1OKKA 1ZYUA 1QTNA 1BS9A 2O4CA 4BKPA 4W5NA 2GCPA 4Y2JA 3S68A 1CJBA 4ODIA 2XV1A 1JMKC 4H7FA 3LT1A 4FOPA 4WXEA 5EXDA 1ZM4A 1Y6JA 4DS3A 4K2AA 3S81A 3NXKA 2Z1DA 3KR2A 3KYJB 1PV1A 1Y4SA 4I0WB 4A8JA 5C32A 1KXJA 1CVRA 5B1EA 1J8VA 5LDDC 1B15A 3GAFA 2JHCA 2Q2WA 3HBNA 3DAYA 3KKOA 1X2EA 4OQDA 3WMWA 1X92A 2Z09A 1H2XA 4RQUA 3THYB 3CONA 4PHHA 4U7GA 4W5JA 4CKEB 4YJHB 2YDXA 4CI0B 4ZHQB 1MB4A 2D1FA 3HKDA 3JR3A 5CXXA 3GGPA 3MS7A 5IZCC 2CHGA 2QJOA 1R4MB 3CTPA 4EUNA 4PPQA 1UXKA 2I99A 5DNAA 5FR2A 4Q24A 3U3RA