4YR9A

Mouse tdh with nad+ bound
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
308
Chain Sequence
PPRVLITGGLGQLGVGLANLLRKRFGKDNVILSDIRKPPAHVFHSGPFVYANILDYKSLREIVVNHRISWLFHYSALLSAVGEANVSLARDVNITGLHNVLDVAAEYNVRLFVPSTIGAFGPTSPRNPAPDLCIQRPRTIYGVSKVHTELMGEYYYYRYGLDFRCLRYPGIISADSPGGGTTDYAVQIFHAAAKNGTFECNLEAGTRLPMMYISDCLRATLEVMEAPAERLSMRTYNISAMSFTPEELAQALRKHAPDFQITYCVDPLRQAIAESWPMILDDSNARKDWGWKHDFDLPELVATMLNFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase, mitochondrial
publication title Structural insights on mouse l-threonine dehydrogenase: A regulatory role of Arg180 in catalysis
pubmed doi rcsb
source organism Mus musculus
total genus 95
structure length 308
sequence length 309
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2015-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4yr9A00
1I33A 4XGNA 1D3AA 3ZV4A 1X1EA 2Y67A 1T26A 3L4BC 4CUKA 1EMDA 4MO2A 4N5NA 3MWEB 5CG1A 3BIOA 4TZKA 2PD6A 3DMYA 3NGXA 3I52A 4CMJA 1U3VA 1LSOA 3VPSA 5ENDA 4EEXA 4UVIA 1ML3A 3AFMA 3JTMA 3IQDB 3MEQA 4J0EA 4TRNA 4LGVA 1FDVA 1HDZA 1YB5A 1Z45A 4D41A 3F3SA 2OZPA 3T7EA 4DYVA 2YV1A 3H3FA 3DAFA 2EIHA 2GDZA 2VZ8A 1GZ6A 2J3IA 4YRDA 5A1TA 4LVCA 5MDHA 4QO7A 1LLDA 6ADHA 1R4NA 3FF4A 5KNLA 3CMMA 1M6WA 3OJ0A 1WDKA 5A3JA 3ONDA 2JCYA 3H9UA 3NEPX 4Q3NA 4ZN6A 5JDIA 1UP6A 1O8CA 1K3TA 3B20A 2AE1A 1YJ8A 1H6BA 3VAZA 2VWHA 5COAA 2OXIA 3QVWA 1EK5A 3VHRA 1XWFA 4GPD1 4XYEA 1HRDA 1AXEA 4BNUA 2DKNA 2OGUA 1GQ2A 3T7CA 1SEPA 2B69A 3JQCA 3PP8A 3HWRA 1X14A 3D3EA 4J7CA 3PPIA 2C2XA 2RH4A 2HJSA 4YT4A 2Q99A 3PQFA 1EDOA 1ORRA 4XQEA 1K2WA 4EBFA 1G0NA 3LLVA 1DSSG 1HF3A 3PWKA 2TMGA 4BKOA 2E48A 2WE8A 3Q3CA 5IDQA 4F45A 3RUEA 2DM6A 4RLSA 1T25A 1M75A 1QLJA 1U3TA 4OYRA 4DTIA 3DAPA 1GQQA 1YS4A 5EESA 1HDCA 4RGBA 4I5EA 3TFOA 1DDOA 3D3WA 1RYEA 4IJWA 1K6JA 3JQAD 4EZBA 3I9OA 2O23A 3BMNA 1CIVA 4PVDA 5T64A 2Y1DA 4BNZA 3D3WB 1E7SA 3NTQA 4IXTA 4BNFA 4AFNA 1NHWA 1ZKMA 3RBZA 1DJQA 2O4UX 4IDEA 1B3RA 1GUYA 2YDXA 1ISIA 2OORA 3I1JA 3OJLA 4PLTA 4AJLA 4E5NA 1ISHA 3A28A 2O7QA 3MJVA 4HADA 4IY1A 3UOGA 3ZZNA 1I5RA 2GN9A 4TKMA 1NASA 4OHUA 5TRTA 4C4OA 4D3SA 3K6JA 2EGGA 2ZB3A 1HL3A 1FK8A 3D1LA 3U4DA 3WYBA 4NIMA 2IXAA 3KSZO 3WICA 1E7YA 1DEHA 4L74A 9LDBA 9LDTA 3KSUA 2VHZA 4E32A 4NBWA 3DMTC 2VZ0A 1Y6JA 2O4CA 1EUZA 4DYDA 3GGGA 5LDHA 4QX6A 1NTOA 4NMHA 1NPTO 1E7WA 3W6ZA 4EUHA 2G76A 5HBRA 3BMCA 4Z3DA 5KJ6A 4LCEA 1V6AA 2BGLA 2Y1CA 4JK3A 5A06A 3NTRA 1GUZA 3ROQA 4XIJA 3IIEA 5AXBA 1OFGA 4Q3AA 3PHGA 3GGPA 3NT5A 4PLGA 1GZ4A 3M2PA 3E48A 1CEQA 4GI2A 3K73O 3GVXA 4I9UA 4TZTA 3VPXA 4JBIA 4EEZA 4FOOA 1ISJA 2C29D 1YDWA 4O59O 3I9LA 4L75A 5AXCA 1HXHA 2PZMA 3NJ4A 2HU2A 1VRWA 5JAIA 2A92A 4CLEA 1NBOA 2X9NA 2EV9A 2FOIA 2I66A 3RSHA 3JYPA 4E2XA 4Z6KA 2FP4A 1DFGA 3L9WA 3U62A 1LDBA 3DFZA 4RL6A 5DBIA 4BKPA 5C5IA 1O89A 1B2LA 2NLOA 4YRAA 2GZ1A 1LRJA 3ANLA 4UUMA 1GPJA 3LT1A 4KWIA 1KVQA 1BGVA 3P2OA 3WX0A 1QYVA 4QSMA 3G3EA 4FFOA 4WGGA 1D7OA 3VDRA 1VLLA 2NU9A 1PZHA 2X6TA 1QKIA 1I3NA 1DFIA 3KRTA 2RHCA 3GNQA 4A26A 1ULSA 3PWZA 1PWZA 4XRGA 5B4UA 4B79A 5JYEA 4N7RA 1HEUA 1N92A 1E6UA 3NX4A 1UZLA 1VJTA 4I5FA 2POQX 4BNHA 3F47A 1P9LA 2OUIA 4RVDA 4KUHA 4DA9A 4EUFA 4IPTA 2B5VA 3NAQA 3OIFA 2VHXA 3PK0A 3Q6IA 1KETA 1SB8A 1E0DA 2PH3A 1BHSA 3D4OA 3HZZA 4CMGA 3WSVA 3EMKA 1DXYA 1A9YA 3GAFA 3OF2A 4LSMA 4JBHA 3FNGA 4MVJP 5K6AC 2VCYA 4ALKA 1LX6A 1I10A 4FPXA 4RPLA 3C7CB 2X5OA 1F8FA 2IZ0A 3RUAA 2HLPA 1YOVB 2SCUA 3GEMA 3TRIA 2W4QA 4NFSA 4ROSA 3HSKA 1YVEI 4XYLA 5DCUA 4B3IA 1NFRA 2NVUB 1LI4A 1QORA 4Z0PA 4BO9A 1Q7BA 2C2YA 2JAPA 1Y1PA 3VZSA 1LC3A 5I7EA 3E5MA 3WBBA 2VT3A 2O7SA 4CM9D 1V3VA 3AWDA 4J90A 5I7SA 1LXCA 1MX3A 2AE2A 3ZHZA 1MFPA 1B8VA 2FHSA 3UCXA 4DXHA 5HS4A 4FN4A 4HNGA 4HFNA 4D46A 1P1IA 2CY0A 2HRZA 5H81A 2Y1GA 5F1PA 5I9LA 3ULKA 2CNBA 3MTGA 4CM7A 1LEHA 1KOLA 3VC7A 1R0KA 3A9WA 3EUWA 1M76A 4EW6A 5CFZA 1XQ1A 4BS9A 2B83A 4GWKA 2X0NA 1X15A 3DWFA 4WCDA 1A9ZA 4BNJA 4BMNA 4DIFA 1H6CA 1C0PA 1T2AA 4IZIA 4M54A 2I3AA 1QP8A 5AXDA 5IF3A 3E6AA 1G6KA 3C7DB 3IJRA 3RFTA 4W7IA 4BV9A 4FS3A 4ND4A 4BNTA 4UEOA 2Y1OA 1WDMA 5B4VA 2ZB8A 5TJ9A 1QXSA 3CKYA 3RASA 3L07A 4R3NA 4YT8A 2VNSA 1LQUA 5L7TA 2I76A 3GZ4A 1VJ1A 2IZZA 3H6KA 4ALLA 5KVVA 2PA3A 3IC5A 4K6CA 5AXAA 4FFPA 3I9KA 3PXXA 1X7GA 1A27A 2FSVA 3QV1A 4TMFA 2O3QA 4U7WA 4PZCA 5G0SA 3ADPA 4XZ3A 2VUTA 3QLJA 3GR6A 3IP3A 2D59A 4MKRA 1U3UA 5DCYA 2WWRA 1E6WA 3ZH2A 2WYUA 1DIBA 2C7GA 3DOCA 3E82A 4DPKA 4M86A 5BSFA 2WSBA 4UUNA 4GMGA 5T6BA 3WLFA 4R1TA 3V2GA 1G1AA 1OBFO 3QRWA 1H5QA 1Q1NA 3HADA 4HFRA 4J91A 1GCOA 1HYGA 1LLUA 4Y8VA 5A9RA 3RC7A 1CRWG 1GYQA 3NJ8A 5I8ZA 2FY8A 1N9GB 3OETA 1NWCA 3DZFA 1LQTA 1IPEA 4F46A 4M49A 3PZBA 4IDDA 4Q3EA 4XKJA 1Z7EA 1PJSA 5EL0A 3VKUA 5JY1A 4KQXA 4DLBA 1ZK4A 1D4FA 4I9NA 3H2ZA 4FC6A 4CMEA 1P45A 3UHAA 4BGEA 3NGLA 4MP6A 2X23A 1Z73A 5A9SA 5B12A 2GZ2A 4OM8A 2PLAA 3R3JA 2VRBA 3ZN2A 2OOSA 1PJ4A 4XDZA 2Q1TA 4RF2A 1Y5MA 2FMUA 1TEHA 3AU9A 5U9CA 4B8WA 5KCZA 4HV4A 2JKVA 4JP3A 4LN1A 3GC6A 4ZVVA 3H5NA 3INTA 3TZQA 1I30A 4JGBA 1MFZA 4R5HA 3BTOA 4DC1A 1C1XA 3WGGA 2JHFA 1NQTA 3NDJA 4U0JA 4CMBA 3SBOA 1LSJA 5EIOA 3T4XA 5T67A 2DAPA 3DZBA 1C1XB 4OKIA 3QIVA 1ZSNA 2EKPA 2GPTA 2CDBA 2JHGA 4C7KA 2O3SA 3ONEA 4PFJA 3QWFA 1NVMB 3PLNA 2GSDA 4Q39A 3JQEA 3UUWA 1UUFA 3X2EA 4YAIA 4ZICA 4X54A 1SC6A 2Q1SA 3BTSA 2IZ1A 4BVAA 5A02A 3FCOA 1T1RA 1MC5A 2XXBA 4UREA 1QYXA 1ULUA 1VJ0A 2ZTMA 3VPGA 2CF6A 2W90A 1P1JA 3K30A 2VZ9A 4RZHA 4K6FA 1ONOA 1T1SA 1WNTA 4ZQGA 2BMAA 3L4SO 1D1SA 2FZWA 3TDKA 3FI9A 4MVJE 1EVIA 1IOLA 4W6ZA 2HJRA 2O3UA 3IMFA 5DP2A 2C20A 3LYLA 3VTZA 4B4OA 1DB3A 3ASVA 3BYZA 3UICA 3PFWO 1AXGA 2I6TA 4KTVE 1CJCA 3ZGYA 1CQIA 3ORFA 3QVOA 4GSKA 4P22A 1LSUA 4EUEA 3G79A 2C82A 4R54A 5HTOA 1AUPA 4YT5A 4E5PA 2OMEA 2NM0A 2WYWA 5ENVA 4RDIA 4CQMD 1GFSA 3ICCA 3JV7A 5G0TA 3RWBA 3H5RA 3V8BA 4BB5A 4K28A 1YONA 2QZ9A 5KWEA 1UZMA 2EG9A 1CQJA 3FSRA 4DQXA 3FPCA 1ZXBA 1ONPA 3P2YA 4IQ0A 4CLRA 5L4LA 1HE5A 1NWHA 3DL2A 4TRRA 2VTDA 4CM8A 3Q2IA 2ZB4A 2W2LA 1LU9A 4CLRB 1E3WB 5IJZA 4JP2A 1GD1O 2GERA 2AA3A 2ZKLA 3RVDA 4YJHB 2EWMA 1YKFA 3B1FA 3PHHA 3TL3A 4D43A 1YL6A 1GV1A 1K6XA 4XQCA 2Q46A 4R5MA 3GK3A 3INRA 1Y9AA 2O2SA 2ZJ1A 1Q0LA 5L7WA 4Z9FA 2ZB7A 1YL5A 2ZCVA 3SC6A 1WW8A 1DRWA 1PGQA 1ENPA 1PJCA 1ZJZA 1IPFA 2J8ZA 1ZK0A 1MG0A 3DZIA 3IS3A 3F1LA 1YBVA 3PQEA 1NQ5A 2YHUA 3LU1A 1HT0A 4UUPA 3ZNPA 1LUAA 4PN3A 4AJ4A 4GH5A 2NVBA 1TXGA 4W9NA 1DLIA 3LF2A 1AN9A 4CV3A 2J3KA 3FBTA 4W82A 3CZRA 3L77A 3CXRA 5IDWA 1KY4A 1XIVA 3I9NA 2GN6A 2CDAA 2C07A 2EW8A 1ZZEA 1X7DA 4XYBA 4YXFA 4YQZA 3HN7A 3DO5A 3W6UA 4PLYA 4RV9A 1DLJA 4BOYA 2Y0DA 2CZCA 3AM4A 1EQUA 4JIGA 3EZYA 3SX2A 3KEQA 5ES3A 4CM1A 1P0CA 3WOHA 5CDYA 1NNUA 4IDAA 3TZKA 4ALIA 4AVYA 5G0VA 3E1KA 3BTVA 4F6CA 2CVQA 8ADHA 1MV8A 5BT9A 4DUPA 4NDNE 4OSPA 1PJLA 5DBFA 3O4RA 5L7YA 4E5YA 1KEPA 3SXPA 4Q3BA 2DPGA 4IDGA 1FDSA 3E8XA 3HFSA 4TVOA 2X0RA 4WNIA 1DC3A 1S7CA 4QT0A 5LC1A 4FGSA 4CM9A 5F1OA 4ZRNA 1JAXA 3S2IA 1FMCA 3DB2A 4CMEC 2QG4A 3FTPA 3V1YA 2B4QA 4LMRA 3DHEA 3PJEA 5BSHA 3ON5A 4NBVA 5CG2A 3GFBA 3NUGA 4OAQA 3U0BA 4CQLA 1HLDA 5H82A 4Y6RA 2UV8A 1H2HA 3QWIA 4Q9NA 2D2IA 4WUVA 3ZU3A 1SCUA 4ZQEA 3ZU2A 1DHRA 2VHWA 4B4WA 5CDUA 4KUGA 1QV6A 4CMIB 4XWYA 1GCUA 2GO1A 4P4GA 1L7EA 4B3JA 1ZK2A 3G1UA 5TLSA 1JLLA 4BQPA 1FDTA 3WGYA 4IQGA 2H9IA 2PFGA 2GLXA 2ILTA 4CPDA 1RKXA 1UP4A 3QWAA 3S55A 2JD0A 1DIGA 4R41A 4S1VA 5JW6A 1H9BA 6LDHA 1IYZA 1UXGA 2BELA 2LDBA 4FFRA 1SZJG 4D7AA 3KYCA 2IDZA 3VH4A 4XB1A 2VHVA 2EHDA 4NJOA 3DDNA 2E82A 1PL6A 3IKVA 1X7HA 3MJEA 4FGWA 4FBGA 3UW3A 4ZGWA 4IM7A 1IE3A 3QVXA 3H65A 5L4NA 5F1KA 2DFDA 1C1DA 4F3YA 5H83A 2CUKA 1JKJA 4MJLA 4I5GA 1F14A 2EKQA 3RI3A 1ENZA 3OP4A 3QJ5A 4CR6A 1AGNA 3MJ4A 1BG6A 4PLHA 1YE3A 3RUFA 4PRKA 3L6OO 3B6ZA 4IBOA 4E2YA 2I67A 1IY8A 1HKUA 2EJWA 4EGFA 4XJTA 1FDUA 2I3GA 4FW8A 2P2SA 4AJ2A 1A4UA 2VYVD 3GOHA 5AVOA 3AY6A 3Q2KA 3RAJA 5IZCA 2Q2WA 3UGKA 4DBZA 1U9JA 4TQGA 4FB5A 3NDIA 2GYYA 2G82A 3OFSA 2AQIA 3GDFA 4WOKA 3PQDA 1EZ4A 4IMPA 3RFXA 1I3KA 3WIDA 3RU7A 1QSGA 4H15A 4Y98A 2D0IA 4O63O 3GPDG 2BFPA 4HY3A 1SMKA 3EVNA 4YDRA 2E6UX 1I2CA 2QYSA 3TZ6A 3IJPA 3KLPX 3WYEA 1KVTA 1RM3A 1R4NB 4ALMA 1PS8A 2HRBA 1UH5A 3NT2A 1BDBA 4MP3A 3U4HA 1OC4A 5EQFA 4PG5A 3GHHA 1FDWA 2QIOA 2V7PA 4A03A 4HXYA 4C7JA 3PGXA 2X1HA 4YCAA 2OL4A 1ARZA 1ZK1A 4PGFA 5JSFA 3AM3A 4E21A 2ZQZA 2V6GA 3SJUA 2PGJA 1E77A 3H7AA 4HWKA 3W8DA 1ENYA 5TF4A 2DTEA 1HDYA 2C54A 1R6DA 1MUUA 4NG5A 1A4IA 3JCZA 2C5EA 4A73A 4LISA 2FPIA 1TT5A 5BNTA 5L40A 1ADCA 4WECA 1GEGA 3PYMA 2IYOA 2TMDA 3DHNA 4NPCA 4W9NC 2FR0A 2J3HA 4IS3A 4RQTA 3ITDA 5ER6A 1UR5A 3WNQA 1ZBQA 4Y6SA 4L4SA 4AJ1A 1KC1A 4AJOA 1HDOA 1PGOA 3QWBA 2NTNA 4IZHA 1DC5A 3KHUA 3DTTA 5C7LO 1VC2A 3B1KA 2EW2A 3BMNB 2BD0A 4JBGA 1ADGA 4E13A 4JJFA 4BNWA 2EXXA 3U4CA 3E03A 3UCFA 3KM0A 2X7HA 4RVHA 1GR0A 4FQ8A 1LLQA 3WG9A 3CPSA 2BRUA 1E1NA 2Q3EA 3L6EA 2X5JO 1LDGA 4FIZA 1BXKA 3JQGA 2NQTA 4GKBA 5IAAA 4OXKA 4QEDA 1E92A 4XGKA 1HTBA 1R37A 2WD8A 4XB2A 3WGIA 3TOXA 3S2FA 3I5MA 3PFFA 1WAMA 1Y8QA 4J3FA 2DUWA 4CV0A 4YWJA 3KB6A 5LDGA 3PEFA 4DQVA 1SBYA 5FI3A 3AK4A 4MOWA 5JO9A 5A5EA 1V0JA 4JNKA 2GCGA 3WFIA 3AOEA 1EDZA 2GASA 2ZYDA 4P4LA 1F12A 3PJDA 3TL2A 3COSA 4L4XA 4LK3A 1ZFNA 5EMHA 2Y93A 1BXZA 4CMAA 3WGQA 3BMCB 4PG4A 3OICA 1BXGA 2HSDA 5JAMA 1I8TA 4G5HA 2P9EA 3DR3A 2PZKA 1V3UA 2NU8A 3UKOA 3WIEA 3C1OA 5COQA 3ZU4A 1IB6A 1ZMTA 2B4TO 4DLAA 4J49A 1TI7A 1U8XX 2FPPA 2PGLA 2PWZA 1JVSA 4BMSA 3EK2A 4FJ0A 1T2CA 4XYGA 4P38A 2QZZA 3BZUA 3OQ1A 1T2EA 1U8FO 1DAPA 3DBHA 4IDFA 3K8ZA 4BO7A 4CM6A 3HHPA 2J3JA 1B14A 1DIAA 4E6PA 1TLTA 4XRRA 4ND1A 1J0XO 5DF1A 3DBHB 4RLHA 2YFHA 5JPIA 1R0SA 5THQA 5JCXA 1NPDA 1KVSA 1T24A 4R51A 1VL6A 3DHYA 3GLQA 4WCFA 5FWNA 2JJYA 4CM4A 1HZJA 3WTCA 2V6MA 1O94A 1ZO8A 2WJPA 3JQ8A 3JYOA 4ZU3A 2G0TA 1XKQA 2YV2A 3ROKA 4WCFB 1XDWA 2QW8A 3SC4A 3S2EA 4CM4B 3FBGA 4BNIA 3M1AA 3JQ8B 1N2SA 4DPMA 4JROA 1VL8A 4YJFA 1H2BA 3ETDA 1GZ3A 3U49A 1T2DA 4CLXA 1W6UA 5CAEA 1ZEJA 3MOIA 4J2HA 2A35A 1HETA 5JAZA 4NU5A 1YH3A 3KXDA 5DOVA 3MCVA 2X86A 1UXJA 5I8WA 2E37A 3GFGA 4YEDA 2C7VA 2LDXA 3JYNA 4M8SA 4GSLA 2BLLA 3GQVA 5IZCC 1R16A 5A4DA 3ZWMA 3VZPA 4DIOA 2ET6A 3CINA 2NSDA 1GUFA 5JLAA 2G5CA 4Z3KA 3UF0A 3D0OA 3IOYA 2VUUA 2BFMA 3K96A 3JYQA 3H9QA 5C7IO 1NFQA 4D42A 5TIIA 1TB4A 4YT2A 1NPYA 5IXSA 1Y81A 2PR2A 4BNXA 2Q2QA 2VYNA 4DMLA 5IN5A 3HDJA 2AMFA 5JDIC 1MG5A 1HYHA 1MXFA 2W2KA 2NVWA 1PJQA 1PJTA 3MOGA 1J49A 2UYYA 3WMXA 4BNMA 1BMDA 1CF2O 3PVZA 1LDYA 3G49A 3QVTA 1KIFA 2OBNA 3E9NA 4RVSA 5A3VA 3OA0A 5TJHA 4J9VA 3MJCA 1BVUA 4U0KA 4XCVA 3NRCA 2YUTA 1DPGA 4J1NA 4E5KA 3L6DA 1Z7BA 3GRKA 4OQZA 1H6AA 3PLRA 3D7LA 3WQSB 3D4PA 5MGBA 1PGPA 4O0LA 3PZRA 4II3A 2WTBA 3FN4A 3DXFA 4BO6A 2UVDA 1CWUA 3ONFA 4OOEA 4R69A 1ZXLA 3VPFA 4CR8A 5TS3A 4XIYA 1WMAA 4WEOA 4YAEA 2CSUA 4BKRA 4H3VA 2ZQYA 4HFMA 3VVBA 1QYDA 4KP7A 2HDHA 3OJFA 3WYCA 1YO6A 1UXKA 2Y0EA 2CMDA 1H93A 1I36A 3DOOA 4NFYA 1JKFA 4R3WA 2IE0A 2FWMX 2Q2VA 3WB9A 3U9LA 5L45A 2VOEA 2HKIA 2PNFA 4Q3CA 1U3WA 4BGVA 3VPHA 3W4IA 1DC6A 5ITWA 2D1YA 3WJ7A 2VRCD 3GAZA 1ID1A 4NZ9A 1I3LA 4UULA 4IJUA 5EERA 4DBVO 3FWNA 2PD4A 1PQUA 1E6EA 1EFKA 2VHYA 3TOZA 3SEFA 2EEZA 1JA9A 4WE3A 3GRPA 5ITVA 1XGKA 4D45A 2AXQA 1QV7A 3AOEC 5B1YA 3DQPA 2YHIA 4INAA 4OMUA 4J7UA 5JC1A 2Y1FA 3DOJA 4EJ0A 1UXIA 2FN7A 2HMSA 1PU2A 4MDHA 1MGOA 3ETEA 1U1IA 5HWSA 2AW5A 3QW2A 5TQVA 4A7PA 1HE2A 1C3VA 1JVBA 3AU8A 4A10A 4YQYA 2JD1A 4AL4A 3H5AA 3LT0A 4GBJA 2O3JA 3HN2A 2EGHA 3VZRA 2UDPA 4B7XA 3ZWXA 1LRLA 3IP1A 5TT0A 1SOVA 1I2ZA 3WGOA 5I7FA 3O03A 4YVFA 3PGJA 2O3TA 4NK4A 3QE3A 3SJ7A 3FNEA 3WLEA 1BSVA 4WLNA 1XA0A 5T5QA 2Z1MA 2ZK7A 1XQ6A 2F1KA 3K2BA 1PQPA 3FTNA 4ND3A 4URFA 4WK6A 1E3JA 5TNXA 4ID9A 5KTKA 4HBGA 3LSYA 3GVHA 1RM4A 2AQKA 3Q0EA 4CL3A 5G0UA 4CUZA 3C7AA 2NTVA 2W98A 3FR8A 2OFPA 4ITUA 1J5PA 3ZWVA 1B15A 4WCFC 3DBRA 3GT0A 4IXWA 3GDGA 2IEDA 5A9SB 4BO2A 1KEVA 3KOUA 4L4RA 3RC9A 1ZUD1 1N5DA 4BO3A 4E33A 3S2GA 4MVJM 5JXWA 2QRJA 4GX5A 2H5LA 2C59A 1GTMA 3DBRB 3O38A 3PHLA 4IINA 4ZQBA 3STHA 3VZQA 3JQAA 3WWYA 3KO8A 5GMOA 4DIBA 2JFGA 2X58A 2X5KO 2V6BA 3GMDA 1UAGA 2Q50A 1F8GA 2G1UA 3F5QA 4A0SA 3GNSA 2EKLA 2HMVA 1UJMA 4XX0A 1WZIA 3Q11A 3OQ6A 1KEWA 2WD7A 4I08A 1SOWA 4DVJA 1MLDA 3O8QA 4TROA 4ZQHA 4A5OA 4AG3A 3JD0A 3KZVA 3AI2A 3DFUA 4RF5A 5FFFA 1PSDA 4BO0A 3NV9A 3KYDA 4IGEA 4J4TA 4NK5A 5FI5A 1QYWA 2Q1WA 3ST7A 5CP8A 1N7HA 2CD9A 4HKTA 1WP4A 4XDYA 4RF3A 5DNAA 3RQSA 4JQCA 2GRAA 4K9DA 3NDRA 1S6YA 5HRUA 4QFDA 1C0LA 4TSKA 5KJ1A 4FCCA 4BMVA 1P1KA 3ZW9A 2DBQA 4WPGA 3JQ9A 4CMCA 1YQXA 5A05A 3TJRA 1NR7A 1NQOA 1O5IA 4JJGA 4M55A 3SLGA 2P4HX 2EERA 3GA0A 1YDEA 1XU7A 3LVFO 1JTVA 2JD2A 1JWAB 2NADA 2JCVA 3TSCA 4P4NA 3TN7A 3C1TA 3DZGA 1OI7A 4WJZA 2YYYA 3RROA 1ISGA 5EN4A 1SAYA 3QHAA 4ZD6A 3GZNA 3OEWA 3DZHA 4L9RA 3VH1A 4CLOA 4ZRMA 2NUAA 4K1LA 4E30A 2HMWA 4GL4A 1IZ9A 1LDNA 4K26A 3BAZA 1QG6A 1ZVMA 1QLHA 2Q45A 5JE8A 3WS7A 5DN9A 1GYPA 5CDSA 1WDLA 3WGZA 4J6FA 4RPHA 4MVJH 3ZI0A 4NU6A 4J1TA 3RD5A 7ADHA 2IRWA 2GR9A 2Z5LA 1PJBA 1P1RA 4BL5A 4J1SA 4CV1A 4YB8A 1P77A 4G2NA 5TX7A 2GZ3A 4P8RA 2FSSA 5BR7A 2NNLD 3E5RA 4OJNA 1NAIA 4IMRA 4CM8B 3FR7A 3TZHA 4UVHA 5EINA 4FFMA 1J6UA 4KQWA 1IUKA 3UN1A 4RVGA 1DC4A 3JQ6A 2W8ZA 1R4MA 2AHRA 2BFAA 4HP8A 2X0IA 5GZ6A 4BV8A 3OSUA 4OKNA 5ILOA 2Z95A 5EJ2A 3LT2A 3PTZA 1R4MB 3ANNA 4ND5A 4XR4A 2DBVO 4A2CA 4QQRA 5KJEA 4FFLA 2HK7A 5A9TA 4KOAA 5JDCA 1LNQA 3JSAA 3LT4A 4CLDA 1YL7A 3CMCO 3I9MA 1NM5A 4GVXA 4U8GA 4LW8A 1DBVO 3FNFA 3EYWA 4LMPA 5G4LA 1E7RA 3ZCXA 2V65A 3DEYX 2J5KA 2QRKA 1ZMOA 1ZSYA 2NTJA 4G81A 4XR9A 5F3RA 3X2FA 5AQ1A 4XYMA 2DU8A 1ISMA 4MVJI 2WEKA 4Z9XA 5BSGA 4E3ZA 4I5DA 3UCEA 3P7MA 4J0FA 4RF4A 3H9GA 1TVEA 3OM9A 4MVJD 4J4BA 1EBUA 3H2SA 5BNFA 3WWZA 3PWSA 5IN4A 2IYPA 3JQDA 4R9RA 3D5TA 1ZJYA 2OBYA 4UEJA 5EQDA 3V2HA 4TRMA 1HDGO 3CE6A 3F5SA 4L8VA 1XU9A 1UZNA 4M87A 4KTTE 4N54A 3WR5A 4DWVA 3PIDA 2UUPA 3IDSA 1NX6A 3KUXA 1VI2A 3VH2A 1J4AA 1CDOA 1YBAA 3LZ6A 3CZMA 3UXYA 1U4OA 5FEUA 3I4CA 4RVUA 3INGA 1Y8RA 3U09A 5DOZA 2DLDA 5DCWA 3AJRA 3GGOA 4CM3A 3DBLA 4BKUA 4GAEA 4YRBA 4R9SA 4KWHA 3OECA 4D3FA 1Y8RB 1I3MA 3B70A 3EAGA 2HK8A 3U3XA 3C24A 2RBEA 3QVSA 4R01A 4YAGA 5FF9A 3H9JA 1U5CA 1V3TA 3JQFA 1DHTA 1IHYA 4CQLB 3DMTA 5DT9A 4HFJA 5L53A 4RPKA 3C8MA 2BI7A 4BO8A 4JXKA 4L0QA 2PK3A 2IODA 2BF7A 3JYLA 2Q4BA 4NNJA 2PKQO 4QUKA 4CL8A 3I83A 1W4ZA 1RPNA 1XG5A 2V6FA 2VUSA 1M2WA 3RJ5A 4D3DA 3RKRA 2O2YA 1EK6A 4FR5A 4AICA 1Q7CA 1QYCA 2H63A 4H16A 4W4TA 4XEHA 4DC0A 4WOJA 3OJEA 4AJPA 4D0SA 2X9GA 3RFVA 4YJGA 1P3DA 3DBVO 3CSDA 2ZTLA 2XAAA 3WJAA 4PG7A 1L1FA 4KMSA 2ZTVA 3EC7A 3KYCB 4UVDA 3WTBA 1X1TA 1W73A 2IEBA 2PKQP 3BMQA 1U4SA 1LDMA 1YBMA 1UP7A 3HE3A 2ZYAA 2QQ5A 3ETGA 2GD1O 4Y9DA 4GX1A 1E1KA 1C1DB 3BMOA 2JCXA 4YJDA 2R2GA 3B1JA 1DFHA 1Q0QA 1U28A 1WWKA 1ZNQO 1JWBB 5U4QA 3ZHYA 1ONNA 3JQ9C 1VL0A 5TSDA 4RDHA 1PJ2A 3AUSA 1MC4A 3QP9A 3BMOB 3GUYA 2H1SA 1DIRA 3GNTA 2Y0CA 3P5SA 4OOFA 5ADHA 2NU6A 3PJGA 1KS9A 1Q7GA 4J1QA 5G4KA 3WGHA 2VQ3A 2BH9A 3GMSA 3O26A 4B3HA 4R68A 1PR3A 2GN4A 4ZHSA 4XA8A 1LTHR 2GGSA 3WNVA 2QX7A 3E9QA 4RPJA 1OC2A 1DIHA 2GUGA 4I9HA 3MZ0A 4PCVA 3F4LA 2PY6A 3F9IA 1R15A 3D5QA 4NR0A 5IZ4A 2YY7A 5L95A 4H7PA 3F4BA 1P31A 5JMPA 5ICMA 3LK7A 1PGNA 3HJAA 5IDXA 4GLLA 2DBZA 4BHTA 1HSZA 4MIOA 1LRKA 3GVPA 1GL3A 3AW9A 3NKLA 4L76A 4WKGA 5K6AA 3ASUA 5G0WA 1D8AA 3LLSA 5AYVA 3SLKA 3K9QO 3RCBA 2C0CA 4CR7A 2DTDA 3W4KA 1JDJA 1PZFA 1P33A 4B8ZA 4UEKA 3W8FA 1ZH8A 2R6JA 5JBIA 5A03A 2CFCA 2WE7A 1SEVA 3UFXA 1F0YA 1GADO 2B4RO 3TNLA 4QO8A 3ZV3A 4RVFA 2Y05A 4YAKA 4PLVA 4QFCA 1N1GA 4NBRA 1N1EA 1NR1A 1U2GA 4PIVA 3ZDFA 5KVQA 1UDCA 1EVJA 3ZHXA 4BNLA 4A27A 3FWZA 1K6IA 5JDCC 2AQHA 3DZJA 4FJ1A 5C37A 2GNAA 3C3XA 1B0AA 2JL1A 1EQ2A 2BGKA 1BVRA 1EUCA 1CERA 3RBVA 3U4IA 1BDMA 1YB1A 2D4AA 3M1LA 1TT5B 4RORA 4WLFA 3TWOA 1FF9A 4DGSA 4YPOA 4CV2A 3AUUA 2ZYGA 3LC7O 5DZSA 1OZAA 1MP0A 8LDHA 1ZIDA 1PX0A 1ENOA 2VNAA 1DO8A 1YGYA 2D5AA 3RC1A 4S3MA 3AI1A 5JCJD 4GKVA 5L4SA 4F6LA 2ZIZA 3A4VA 4GGOA 1IL0A 3V1TC 4NI5A 5KJCA 2PTGA 4NFHA 1XHLA 2ZTUA 1Z74A 1U5AA 1LDEA 3PDJA 1PS9A 1V35A 1QRRA 5B4TA 2YJZA 1A72A 1Z6ZA 3HQ4O 5CPFA 3A06A 3ZNQA 5A5FA 2BHLA 1X0VA 3JQGB 1ISFA 1EEHA 2A4KA 3L9XA 4OIMA 3GH3A 2R00A 2VN8A 4GLOA 5KIAA 3ZWOA 3AI3A 3PHIA 1M6HA 2EF1A 3ZWWA 3EHEA 1Y8QB 1KEUA 4MKXA 1LSSA 4D79A 4CQMA 1CYDA 2Q49A 5G2OA 5JY6A 3IUSA 3PHJA 1PGJA 1VM6A 3H8VA 1P0FA 3OA2A 2YDYA 3GUCA 2BFOA 4E0BA 2A9FA 2C5AA 2DT5A 2CVZA 1Y5RA 3CUKA 1DAOA 1HWYA 2QYTA 4CQMB 3JQFC 3IUPA 2FR1A 1A71A 1O0SA 1B7GO 5BSEA 3WQRA 5KJFA 1BXGB 1NAHA 3RKUA 4ESOA 3ITKA 3PJFA 3F1KA 2DVMA 2AEMA 4JN6B 4Z0HO 3ZWNA 2DTXA 1T2FA 4NBTA 4MKZA 2DBRA 4XQGA 3DC2A 1N8KA 4TWRA 5IDYA 1ZK3A 3DONA 2B35A 3EGOA 3QA9A 1Q2XA 4IUYA 4RZIA 4HNHA 1XR3A 1EE2A 1PS0A 1ZSVA 3K5PA 1NVTA 1A5ZA 3G1TA 1E5QA 1B3BA 1WLYA 3PRJA 4FJ2A 5IG2A 3MTJA 3GF4A 2WM3A 1JW9B 4NBUA 2O3RA 5J23A 3RUHA 3KTDA 1E5LA 2RH8A 1VPDA 3NT4A 1K0UA 1XEAA 2DQ4A 4XJSA 3ZHBA 4W99A 5HS6A 3OMLA 1AHHA 1OOEA 1RYDA 3ZWCA 5T57A 4CODB 2W2LD 1JQBA 3OH8A 3QY9A 2ZATA 3HDQA 1NFFA 3ANMA 1A7KA 5GY7A 3HNPA 4MIYA 4CM5A 4YJFB 4FFNA 4UAGA 1Q0HA 4MVJA 2XOXA 4Y67A 3RIHA 3GY0A 4U6QA 1F06A 2PV7A 5ER9A 4N5MA 4E4YA 4HUJA 3JQBA 5FYDA 3TPCA 4BGIA 4J43A 4E5MA 2PH5A 4NQZA 2VOJA 3KVOA 3HB5X 2H6EA 4YACA 3O9ZA 3IKTA 2PZJA 1M67A 2Y66A 3CIFA 5ILGA 5KKAA 1WZEA 5C7OO 4WNCA 1RM0A 3RJ9A 1YRLA 1GU7A 3P19A 4KZPA 3OJOA 4BNYA 1RWBA 3CEAA 3ADOA 1E3IA 3EY4A 4O6VA 3QWHA 2X9VA 3E18A 1YOVA 4OL9A 4XGIA 1WPQA 3WGTA 5U1PA 1BW9A 1A7AA 4B4VA 2WDZA 3SVTA 4M1QA 3ABIA 4E31A 5CEFA 2QRLA 1BTOA 1FXSA 5JNLA 2DC1A 3D64A 4WASA 2NVUA 1BW9B 2W2KB 3F46A 1UDBA 3FHLA 4BO5A 1DRUA 3ENNA 1OAAA 1SB9A 2WMDA 3GPIA 5CDTA 3W4JA 4TKLA 5I7VA 2P91A 4I1IA 3GEGA 4KDEA 4AJIA 1MA0A 2FZEA 1DRVA 1E1LA 3ROPA 2Y1EA 2WYVA 3AFNA 3MJSA 5IXYA 3HDYA 5JS6A 4J2OA 2O48X 4J7XA 3R0IA 5JYDA 1I24A 1VSUA 4ND2A 2VT2A 3HB4X 4WLEA 1KYQA 1I32A 3D4NA 4R4JA 1B26A 5DP1A 4W7HA 2YFQA 4PZDA 1YWGO 4ZA2A 1O9BA 5TGDA 1YQDA 3ZNNA 1I0ZA 5C3MA 5IFLA 4MPDA 4B7UA 1VE9A 3GG9A 3VTFA 1YB4A 1ZW1A 4GX0A 1HZZA 2FRDA 1O95A 3F6YA 4RO0A 1NXQA 2HAEA 4DREA 1QR6A 3LC2O 2HK9A 3KBOA 4RJTA 5I9MA 3WDSA 4PG6A 4YBZA 2CVOA 2D5CA 2FPGA 3RUIA 3VDQA 3RUCA 5ICSA 5L9AA 3PDUA 1E3SA 1NVGA 4GX2A 1E3LA 3BHJA 3OEYA 3VVCA 4DMMA 4U5QA 2R00C 2VYVA 1VKNA 3EVTA 1P1HA 3BHMA 5TC4A 1VSVA 1V9LA 4YR9A 3AY3A 4KUEA 5L3ZA 4XQ9A 2XF8A 3AOGA 4MP8A 1EVYA 1H9AA 4O1MA 2J5QA 1Y7TA 3OBBA 3WQQA 1U7HA 2EJVA 2YHIB 3G17A 4R1NA 3OHSX 5COBA 5TT1A 1PQWA 4JX8A 2NWQA 3K31A 3RC2A 5THKA 2B36A 4JCOA 3I6QA 4CMHA 2NACA 2G17A 1I01A 3DAGA 1ZEMA 3PI7A 4LSWA 1XELA 2DPHA 1P74A 4DPLA 1HYEA 2PD3A 4NJMA 3LQFA 5L51A 1SNYA 3KSDO 5A04A 2P4QA 3MJTA 1K5HA 1I2BA 2P5UA 2GF2A 2P9CA 2F00A 3HG7A 4ONEA 5BNIA 1T4BA 4YTEA 4NJMB 4DRYA 1CETA 1V8BA 3KV3O 2A94A 5EPOA 1N9GA 3PYLA 3NTOA 4GVLA 4GMFA 4NH4A 2VWGA 1LC0A 1RJWA 3HDHA 2BGMA 1R0LA 5CPBA 5F21A 4CLHA 3VKVA 4BIIA 4D0RA 5GZ1A 3GVCA 4EYEA 1NHGA 3C1AA 5I9NA 4IS2A 4MINA 3ICPA 4E12A 1EVZA 1JU9A 3M2TA 1KY5A 2I99A 2JFFA 3Q1LA 2PZLA 3W8EA 4YYZA 1C0IA 4J4HA 4DL9A 4AJKA 3K92A 4UUOA 4EJ6A 1PJ3A 3CTMA 1WXDA 3GVIA 3TFQA 2Q1UA 3JQAB 1PZGA 3U5TA 1B8PA 3KLMX 1GPDG 2HO5A 1C14A 2AG5A 3HUDA 5JCJA 1BWSA 1C0KA 4EI2A 3Q9NA 2B0JA 3V2UA 3ZWPA 4Z9YA 4G65A 1HSOA 2HMUA 2YW9A 2XXJA 4WLOA 4E2ZA 1B8UA 2WD7B 3VH3A 4OGWA 4BNVA 4RPGA 4IDCA 3JD3A 4LCJA 1U2DA 4BO1A 3JQBC 4CMKA 2HCTA 4RCVA 3R6DA 3O8QB 4B7CA 2I9PA 5T8KA 2P5YA 2P68A 3BXXA 5B37A 1PL7A 3I3OA 2PGDA 3WSWA 1TT7A 3KYDB 1R66A 2EP5A 5KVCA 2YZ7A 2EP7A 1KERA 1ADFA 3GDOA 1JN0A 3MWDB 4ALJA 4E2WA 4UVEA 1P1FA 1F17A 2VWPA 2Y99A 1UAYA 2E49A 3JD2A 4M89A 2BKAA 4EJMA 3DZKA 3WFJA 1XSEA 4BNNA 1PL8A 4RQUA 1R12A 4IJKA 3GN1A 4D44A 4BB6A 1MXHA 4OQYA 2B37A 1HDRA 3H3JA 3N74A 5CEJA 4Z0TA 5CDGA 4GWGA 4KDFA 2X8LA 2PKRA 4LRTB 3AUAA 2OP1A 1SO8A 1E7MA 1HDXA 3GHYA 4U6SA 1GQYA 2VTEA 1NQAO 1X0XA 2X22A 3GZNB 3AY7A 4TRJA 3IL2A 4CLOB 3L4BA 2P9GA 2YQ4A 5KKCA 1KVRA 3M6IA 4FOSA 2BI8A 4AJNA 1IZ0A 1D1TA 1N7GA 1IULA 5AOVA 3H9EO 1XYGA 1H0KA 2I5PO 1KC3A 4IGFA 4BNGA 3RU9A 3EDMA 4MVJG 5JAQA 4DLLA 2RAFA 1DOHA 3TQHA 4EITA 1QMGA 4GQAA 2CF5A 3WMWA 4FDAA 3KETA 4R16A 3ZV6A 7MDHA 3HFGA 4TVBA 5JC8A 3AM5A 4II2A 2OHXA 4IDBA 4L73A 3EZLA 4NHEA 3RBXA 4BNKA 3FPLA 1E3EA 1OMOA 4MVJF 1E3WA 4Q3DA 3S8MA 4IIUA 3ROMA 3OIDA 4PLCA 1FJHA 3GN2A 1X13A 2DUUA 2NQ8A 3LF1A 4YJHA 3GG2A 3NYWA 4FD3A 4WLUA 3W1VA 4PG8A 3QSGA 3WXBA 3OIGA 4N5LA 2HQ1A 3BTUA 2X4GA 1LJ8A 4XD2A 1PZEA 2RCYA 2DFVA 4GGPA 3JD4A 3E9MA 3T4EA 1LLCA 1LA2A 2ZJ0A 3KEOA 1E1MA 5DDIP 3IAHA 3GEDA 3V5NA 5DBGA 2D8AA 4ILKA 1NYTA 3TZCA 1O6ZA 4BUCA 3UAGA 5CHEA 1IHXA 1P44A 1PIWA 3I23A 1L7DA 2NU7A 1E7QA 2YV3A 2CDCA 2RHRA 4J9UE 5JO0A 2QHXA 1DJNA 3C85A 4J16A 3RUDA 4ZJUA 3JQ7A 1ZCJA 4UVGA 3R1IA 3ZW8A 3R3SA 3DTYA 1Y9EA 5HA5A 1Z75A 4PZEA 1NP3A 1T4DA 2GN8A 3JQ7B 1UXHA 2HMTA 4WEQA 1YQGA 1HE4A 4B4UA 3BHIA 2IXBA 4CUJA 3V1UA 5F5NA 3KYBA 1PWXA 3FRJA 1XLTA 5F5LA 4AJEA 3JD1A 2FR8A 1W0CA 4I8XA 4IIVA 3UH1A 3N7UA 1H6DA 3ENKA 1EFLA 2E4AA 3H4VA 4BGUA 1LBEA 2NV6A 2UUOA 4OXYA 1VKOA 3I4FA 1PR9A 4AJHA 1M66A 2YQ5A 1TA4A 3DBLB 4YAJA 3ZV5A 1ADBA 2AG8A 4HX5A 1AHIA 4IQ8A 1PTJA 1U7TA 4CJXA 3I6IA 1KBZA 2AQ8A 2RIRA 1K89A 4OH1A 5CEEA 1H94A 4ALNA 1B16A 2ZCUA 4BQRA 5HM8A 5DULA 1YXMA 3K2EA 5BQFA 3AUTA 2VYND 3CH6A 4OXNA 4R1SA 3ZWAA 4IJVA 4PVCA 4R1UA 1AE1A 3ZWYA 4CMIA 3QQPA 4O5OA 1GAEO 4N18A 3FNHA 1GDHA 1WMBA 4QTZA 3LDHA 1JKIA 1KVUA 3UVEA 1EE9A 4MIEA 3FD8A 1JAYA 2X0JA 3VOSA 1GV0A 4FSHA 4BO4A 5JFOA 3A14A 4PRLA 4PLZA 1HLPA 3N58A 2Z1NA 4YJGB 3I9JA 3TF5A 2VWQA 1WVGA 2AEFA 5T8KC 2Q4EA 4ZQFA 4LVUA 2VRCA 3ZWBA 4DQUA 3EW7A 1PEDA 1RM5A 1EBFA 2D3TA 5JMWA 4WLVA 1MB4A 3BMQB 4BKQA 2O50A 1GEEA 1G0OA 3ZNOA 2XPCA 4JJIA 4OO3A 4PLWA 4QECA 4EDFA 2B5WA 3L0DA 4YA6A 5KOIA 3A1NA 3PIIA 3LC1O 4JLWA 5K9ZA 2I65A 1UDAA 1Z82A 4Y6PA 2UAGA 1EUDA 3BA1A 4FC7A 2OO5A 1GY8A 1W8DA 2Y68A 2HUNA 2J6IA 1GYRA 3PYXA 1BRMA 4QXMA 2JAHA 3OQBA 2J5RA 1YJQA 5LCXA 3S1LA 1HE3A 5GZ3A 1SPXA 2JFHA 5KVSA 4LRSB 4PLPA 4OSOA 4PLFA 5G4KB 3ZU5A 1XCBA 3Q9UA 4AJJA 3WBFA 3G0OA 2OP0A 5K0ZA 2AEJA
chains in the Genus database with same CATH superfamily
3FETA 1ZA2A 1GZ5A 4MI6A 5AM5A 2WF9A 1D3AA 3P1JA 1X1EA 4XGNA 2Y67A 2Q9BA 2PX6A 4GQIA 3N3BC 2NG1A 3X1MA 4CUKA 1EMDA 3A1CA 1JEQA 4N5NA 3MWEB 1QHHA 3LFTA 5CG1A 5MN6A 3BIOA 3IE1A 3BN3A 4PGMA 4CMJA 1HNZB 2A5FA 3VPCA 2OXFA 4HNUA 4KO2S 3QITA 1N3IA 1JEQB 1QHHB 4WERA 3TE7A 1E4OA 1RYZA 2ZBDA 5IF9A 3Q3GE 4MLPA 5KYNA 1R6BX 1DADA 2AOUA 1YB5A 3SZOA 3TRKA 1Z45A 4B35A 1RXIA 3BCSA 2BHSA 2XY4A 3AR8A 3MYRA 4MVCA 3W34A 4D41A 1KRWA 1NUSA 3TCXB 3G68A 1VHJA 4U02A 3TIXB 1GQFA 1EP1B 1LPBB 2AWNA 2VZ8A 2ZM6B 4QDJA 4V0KA 1VP9A 3QYJA 1WB6A 3LHDA 1VCMA 1JBQA 3LBHA 4OG2A 2VYQA 1Z12A 2JJ1A 4UU1A 5MDHA 2H57A 6ADHA 5AOAA 1QTNA 2V0CA 1SOMA 3DOHA 3GNLA 1V2GA 3BWXA 3OJ0A 4RQAA 4X94A 4DAEA 4EKEA 2K87A 3H9UA 1VFNA 2V9CA 5HCUA 2B1RA 1UBSB 3AFHA 5IHPA 3IT3A 1T9DA 5JDIA 1V1MB 2OOKA 2WKWA 3FTCA 3KUCA 2BGRA 2M6SA 3G8DA 2ZWIA 3PUYA 3VAZA 2VWHA 1UT6A 2BEKA 4PR3A 3N8NA 2FSPA 5AUNB 4TL9A 4TXNA 2R8PA 1XWFA 1HBJA 4RFVA 4AQ7A 1UODA 2OV1A 4CF4A 3NONA 1T2VA 1UF9A 5JH7F 2PUAA 2OGUA 1GQ2A 5FTLA 4Z3OA 1BZYA 1RKVA 1IAQA 2QSJA 3JQCA 4LRWA 4TQAA 1X14A 1T0UA 1U0NA 3D3EA 4J7CA 3AL2A 4P35A 2C2XA 1E2BA 4YT4A 3GEBA 2I4IA 4JUFA 5E4FA 3TEFA 3L1UA 3E53A 4UMVA 3WLPA 1DSSG 4Q1CA 2G3YA 3QG1A 2QR3A 2GYVA 1CNMA 2TMGA 1NN3A 2JGNA 4JI5B 2BFCA 2J3LA 4QEZA 4F45A 1P2BA 2YIMA 3LY9A 5JCOA 3MRTA 1U3TA 4PSDA 3TG8A 3DAPA 1R9GA 1DEOA 3K9BA 2IFTA 4HDRB 4RGBA 1RVV1 5I47A 1UZUA 4U7TB 3MCUA 1UPUA 5F64A 5D3KA 3JQAD 5FLEX 3BK7A 3TFWA 2FK7A 3PQ3A 4PVDA 1MT0A 5E2AA 2JH3A 4ETIA 1AGRA 2ZRBA 3DZ8A 4BNFA 4ZVNA 1D0VA 4H7FA 3O73A 1RJFA 3BK2A 2PZGA 2GO7A 2IX9A 3PC6A 5ALOA 3PNOA 3Q7SA 4XPZA 3RBZA 3JRXA 1QS0B 4BVBA 5EZQA 1XZHA 1NUUA 2WWHA 2YDXA 3PUVA 1Y1LA 2MYNA 2XV1A 1ORIA 4LY9A 6REQA 1ISHA 2LVBA 4LUCA 1YK1A 3AP2A 3TSYA 3ZZNA 3STVA 4CIDA 4ZO6A 1D2EA 2EGGA 2AK2A 1XZCA 3D1LA 4NIMA 2HIGA 3KSZO 2QVZX 2OM6A 4BLWA 1NW3A 3TYXA 6REQB 1EIWA 3FOWA 3UXHA 4RH3A 2O2HA 3M5DA 4WACA 1FFSA 2CXRA 2VHZA 3JAKA 4I1VA 3UJDA 3K71B 4Z1MD 4DYDA 2HSWA 2O4CA 2BE7A 4DARA 3EVCA 4BX9A 3OT1B 1KDRA 3WRXA 1PG5A 3PGKA 1TQ2A 4ZVSA 2JAWA 2RGGA 2JLUA 1TFRA 4EUHA 3JAKB 3VHQA 3E7PA 1GLGA 5HBRA 2I2BA 4Z3DA 4HXFB 2M1XA 1ATIA 4I6GA 1M2VB 1V6AA 1VDMA 3UHPA 4NS4A 4V0MA 2Y1CA 2CKDA 1N2JA 2XBLA 3VAYA 5KUTA 2F3TA 3IPRA 5AXBA 3DHVA 3AC0A 1OFGA 1UBJS 3COPA 3GGPA 1TF7A 2B8JA 1EHCA 4PLGA 3M2PA 5CCEA 5I4CA 3AFOA 5AUQA 2PU7A 4P92A 3QUQA 3PFHA 4TZTA 3IEIA 5L3QA 1NJSA 3RHTA 4JBIA 1BN7A 2QR2A 3VU9A 2I78A 2O0MA 2ZI4A 3TIFA 4L75A 2NZYA 4K81B 4HVTA 4EGAA 4WINA 4MV0A 1KJJA 4BEVA 2PZMA 2PL1A 3AEKB 3L7CA 2ZSUA 2IH4A 4QLBA 1O4VA 2HU2A 3FOCA 3VU9B 4AW9A 4CLEA 4JHLA 1NBOA 3V4FA 2QPAA 3JYPA 1WXXA 2AVNA 2VQ6A 2AEEA 4UQPA 4U7JA 5EMKA 1G3UA 3P27A 1BH6A 1LDBA 3AUFA 4RL6A 5C5IA 5C8DA 2J7PD 1C9KA 4JXXA 1I6LA 3AINA 3WFZA 3TECE 1UINA 1U0LA 1J2RA 3D8NA 1WZNA 5AI6A 1HQDA 5KQSA 2XB8A 3FW1A 4C4RA 4NU0A 3P2OA 3THXB 3TKLA 5KCMA 3G3EA 3PF9A 5T4HA 2COEA 3KQTA 2OO5C 1IHPA 1TTTA 1F0PA 1PZHA 3C3CA 1K3UB 3KRTA 4DADA 3VPAA 1ULSA 1LK5A 1RJ9A 3F8SA 2BM8A 3ZQUA 4ZO8A 3DCIA 4MYTA 4B34A 4XRGA 4YRSA 2BJHA 2Q5OA 7GPBA 3B51X 4LZPA 5ANRB 2YMQA 5JYEA 1K98A 1RDFA 1Q19A 2I2WA 1HEUA 4GLBA 3GJSA 1XCOA 1XNJA 3CRQA 1F4LA 2IC5A 4NEQA 4OYHA 3U3KA 4C87A 3GRRA 2ZYIA 1N1MA 1C80A 3AR7A 4FNGA 4W5RA 4I3HA 1QZTA 1Z56C 1LTKA 5LBTA 2GZMA 2B5VA 3QFRA 4KR0A 2CVFA 3K4HA 5C8ZA 4N03A 4X41A 2DF8A 1JB9A 3QIAA 4CMGA 1F8YA 3NC4A 1I1OA 1DT3A 3N3AC 4NYMR 3EBOA 1GUAA 1VKRA 1N6NA 2REBA 2O8BB 3KZXA 2EDCA 2LRHA 3FNGA 3CN7A 2YN0A 5K6AC 4BU0A 1RXVA 1SCAA 4LF7B 4ALKA 3BD9A 1LX6A 4P3OA 3Q0TA 4QDUA 4C0WA 1M6YA 4RPLA 3GLGE 2P4SA 3KG2A 2X5OA 3EPHA 5CLIA 4ZDKA 2NAFA 2DPXA 3NIFB 2R6DA 2J5XA 3HGQA 2EZUA 3RUAA 3G5TA 1JWLA 5MGNA 3G9QA 1U7XA 2V97A 1GSAA 3D4IA 5HJEA 1RQLA 2IYQA 2VFAA 4XUGB 1IK4A 2ZQ5A 1XXHE 3MXOA 5DCUA 4B3IA 4HAIA 4B2LA 3FYDA 4K6GA 5H80A 1LI4A 4LOAA 2YRFA 5DYGA 3R9XA 2RHDA 5JS1A 3L82B 4MVWA 2ZJFA 3MWJA 4NOJA 1Y6QA 3UYKA 4J29A 5EJGA 2O1WA 4AZWA 4BO9A 1Q7BA 2C2YA 4QOHA 1FYWA 3VZSA 4UAJA 5I7EA 3E5MA 4MW2A 3WBBA 2VT3A 3QENA 4LQ4A 4X65B 1Y5NA 3THWB 3LA6A 2P4UA 1DCMA 2DKFA 1V3VA 4QJ3A 1F7UA 2GEFA 1OI4A 2VDPB 3R3WA 1A8PA 1ZXXA 2XUGA 4MV4A 2WJZB 1B8VA 4JKYA 3ZHZA 5HS4A 5LQAA 4LFBB 4OXXA 4GZ5A 4HNGA 4CTJA 3LVRE 2RAUA 5CT8A 3IA7A 1HNWB 3L5OA 4YR7A 1KQFA 2WPDA 1YVPA 1R5BA 1L1RA 2YC4C 2Y1GA 3JVIA 3L8FA 1CY8A 1U6IA 3LMKA 4BTEA 5TF0A 4ZYTA 2R1VA 3MTGA 3GCXA 1LEHA 3HCCA 4EHAA 4OLAA 2LE0A 1AM4D 3UJ6A 1FS6A 3BJRA 1M2FA 2MOKA 3VC7A 2X19A 1CE8A 1Y63A 5FB3A 5DO9A 1O0BA 4WUTA 4FYJA 3T9AA 1OHHA 2BGIA 3DE3X 3JRWA 3K9NA 5IABA 3AHCA 3DWFA 2O05A 3IBSA 3QPAA 4BMNA 1M1YA 3LX5A 1M6EX 3UJHA 1U7WA 3B5JA 4Z5XA 3M0EA 2I3AA 2C9ZA 3AF0A 1Q0UA 1I0LA 1QP8A 2CJPA 3H04A 4JC5A 5KMGB 1G6KA 3IJRA 1ETUA 2OORC 1E18A 1M1YB 1Y9ZA 4W7IA 3RFTA 3STYA 4Z7QB 5B36A 5KQPA 2OG2A 2Y1OA 5CXQA 2ZZMA 5B4VA 1PJ8A 1F6WA 4MGIR 1U3CA 5EWJB 3R4VA 3L0IB 4EPTA 3L07A 2VNSA 4Q47A 3MSXA 4RD1A 4F56A 5L7TA 1NULA 3ZD7A 3C6KA 1RXCA 4AP5A 4WY5A 4OMCA 4JI0B 1JLRA 2PA3A 5AXAA 2Q0XA 3VX3A 1HC7A 4MW7A 2RK3A 3LYUA 3PXXA 4GZ6A 4TMFA 5A4JA 5LUBA 5KYGA 4BQNA 2G67A 3LY8A 1NATA 4U7WA 2X2EA 4DCOA 1NBWB 4JYPA 4WFQA 3AVUA 1KPGA 3ADPA 3T35A 3LXXA 4XZ3A 3ELBA 1PX2A 1AGPA 1BRTA 4FU0A 4X7RA 5H9WA 1LZLA 1W5BA 1YCGA 1N6OA 1U98A 2RJOA 3C3WA 3GR6A 3QEMA 4X7MA 5ECGC 3ZHSA 3ZQJA 4C78A 1QZZA 1B6SA 2QLLA 1Z8FA 2YN2A 1E6WA 2F59A 5DWQA 5ULLA 2J5BA 3LDAA 2BMWA 4QXPA 2C7GA 2XRZA 1UBKS 2CUZA 3DCJA 5IKPA 1CK4A 2YXDA 4G8DA 4GMGA 2YINC 5BVGA 4ZI5A 2ZE8A 1S3GA 2GZHA 4HR7A 3QRWA 4CEHA 4HFRA 4BFCA 1MEOA 3MRVA 5FNVA 1SH7A 2JEOA 4HO1X 1C50A 1LLUA 3C2QA 1JTFA 3RC7A 1BU8A 2H29A 4NBSA 3C70A 1GYQA 2Z43A 3Q85A 2FY8A 4RK6A 1LY1A 4HWPA 1N9GB 3ANSA 2CXNA 3R44A 1YV9A 3UT6A 4B0PA 4PFKA 2ZRPA 4KRYA 2VJCA 4R71A 4PAGA 2Y3IA 3F6BX 4UM5A 3RGWS 5K2MA 3V97A 1PJSA 4UEQA 3MK31 3GGJA 4FLMA 3B48A 4KQXA 3HVJA 1D4FA 2WKRA 4I9NA 3GGSA 4PICA 1ACJA 4JVMA 1P45A 4YY3B 1K88A 2Z57A 4L4UA 2IPNA 4U1RA 1MU0A 4MP6A 4MQ4A 4JXZA 1AJEA 1Z2EA 5A9SA 2VRBA 5DLPA 2WKSA 4YP9A 5BV0A 3K1JA 4C7OB 4XDZA 5T4EA 5JALA 4Q7EA 1FP6A 3A6PC 4R7TA 2YJ5A 1ILEA 1CUGA 3WLIA 5U9CA 3R40A 1UWLA 3RC8A 1V6CA 2J6BA 2ZRKA 5AO9A 4D5EA 3CH4B 5I45A 4JP3A 3RFUA 4GRAA 1K9VF 5DE3A 4IIJB 3DJFA 3H5NA 3OIUA 4BMXA 2B2CA 4HVAA 3IE2A 4ARBA 16PKA 4LXUA 1RBYA 1QRUA 1BDJA 1TO1E 2G71A 2ZJ4A 3H8WA 1S2GA 2AC4A 4LE1A 3DEAA 1JFSA 1H2FA 3E15A 5H1YA 4MTCA 5T67A 4UAVA 1UJ6A 1DQZA 2DAPA 4E70A 1COWA 3E0XA 1E9FA 3KQMA 2EKPA 2JHGA 2CDBA 3A70A 1GSHA 3TAUA 1OYYA 2HWUA 2VQDA 4BIMA 4LF9B 1VSQA 3QWFA 2BN4A 5IU6A 2GSDA 1CUAA 4YRZA 3UUWA 5IUNC 2XB2A 4E7PA 4YAIA 1K66A 4ZICA 1FLAA 2Q1SA 2IX3A 4PPYA 3MCTA 3GWGA 1OX4A 4BVAA 2RDMA 1UOEA 4ZO4A 2XTJA 3NHYA 3KHSA 1T1RA 2HF2A 3AVOA 4EKDA 3PC4A 2XVMA 2ZUDA 3AR6A 4QIHA 4YMWA 2PSEA 4ZV4A 5CB4A 3AVYA 1ULUA 2YHBA 4LGYA 3COVA 5I9IA 4PXSA 2DG2A 3AWIA 1Q77A 1R0ZA 2HJWA 1OX4B 3N9IA 3OZTA 4Y2RA 3AF1A 3RIYA 3K30A 3TLKA 2HX1A 4JUCA 1ONOA 1MO4A 1SXIA 1WNTA 3PR2B 3RK4A 3L4SO 4BX0A 2CGEA 2CYBA 3GPCA 4DR6B 1RBZA 2VDNB 2E4ZA 1W0JD 2ZIVB 3FI9A 1OXVA 4AZ3B 1ZA1A 1PNRA 5JZOA 2QF7A 4KQJA 3NP7A 5DHTA 2JI8A 3LIPA 4BZQA 2ZG6A 3ASVA 1UFRA 4QPCA 4BB9A 2H2FA 3PFWO 4LC0A 4KTVE 5EG5A 3S99A 2AOVA 1CQIA 3ZGYA 1GARA 2WHPB 4P22A 1G8YA 2QMOA 3FGZA 1YS6A 3BGSA 3AHJA 1LSUA 4RSMA 4EB6B 3G79A 1KZYC 5AP9A 2DQSA 4WD3A 4R54A 4GPIB 4YT5A 3NVKI 1Q3HA 1NF9A 4TYMA 1D6SA 1WE2A 4RPCA 4B76A 2NM0A 3GX1A 4N82A 2ZR7A 3W1WA 4RDIA 4WKNA 3GJTA 3CLHA 3IAM6 1TUEA 3ICCA 3JV7A 1JECA 4WNAB 5G0TA 3RWBA 3V8BA 5H70A 4OJMX 3VKFA 1JNYA 3U6BA 2JBAB 2EL9A 2PLWA 1FZQA 1ONPA 4J0IA 3U48A 1SBCA 1MW9X 3B2NA 3OKFA 4I3GA 4MS4B 3TBKA 3V00A 3MD0A 4N40A 2V7UA 3IAFA 4TRRA 2OBLA 1YS2X 1BNCA 2F1OA 1QGAA 1QH9A 1GTL1 3L05A 1LU9A 1L1QA 3VNBA 2EZ4A 1GD1O 1GZDA 3IQWA 3PDCA 1F9EA 2YJ3A 2AA3A 3VC3A 1RHRA 3RVDA 4YJHB 1TNDA 2EWMA 4UUBA 3PHHA 3PPYA 4BWGA 1YL6A 1BQ4A 2DHQA 2PVCA 1NKVA 3OOYA 5LB4A 5JNSA 4BPBA 1UOPA 1VG1A 4R5MA 2UXCB 4FCWA 1DOZA 4J0GA 5KAPA 1F3LA 2R7NA 3UHJA 3WDLA 3INRA 1E2QA 1PHRA 4UBNA 4Z9FA 1Y0BA 3IPCA 2JAUA 3SC6A 3SBEA 3EFOA 3DPSA 1ENPA 4MA5A 5LB2A 1VMDA 1LBHA 2PLNA 5JPCA 1IPFA 4M1MA 2J0QA 1JSRA 5DM60 1MG0A 3SY8A 3IS3A 2PKXA 1WJGA 1YBVA 4C9BA 2EWWA 4BNDB 3QKRA 1QP7A 4PC6A 3RRBA 2FSVC 2YHUA 1LUAA 3W8RA 5LIRA 1BE8A 4QQKA 4GH5A 3UK1A 1TVMA 2QPLA 4JZYA 3R3VA 3DA8A 3A1TA 2CXOA 4YP6A 4V02A 4W82A 3NXSA 3CZRA 2RARA 2CJWA 1VXOA 4NSNA 1ZH4A 1XAIA 2QAIA 4AY6A 1XIVA 3LHFA 4EM6A 1TMYA 2GN6A 3K5HA 1SQFA 1C9EA 4R9VA 4ZAXA 4UTPA 2MSDB 5JEEA 4YUXA 5BWNA 1WPXA 3SM9A 1G9XA 3P9KA 4ZQCB 3W3AH 1CJSA 1JYEA 1SD5A 1Z0IA 2CLMB 4G9GA 4LWPA 4YP7A 4B3DA 3STWA 2Q3BA 1KPHA 3KD2A 3WK8A 1P81A 3M4JA 3OFVA 3T5AA 2QTBA 4RK7A 3WOVA 3SX2A 1DKPA 2WF7A 5ES3A 5AW1A 3NDPA 5BN3B 3R8CA 2COKA 1AKYA 1PFVA 3FB4A 4TSRA 3ZBPA 4D6YA 5IBPA 1G5FA 2WU0A 4ALIA 4ERXA 2B78A 1CKEA 4Q37A 4ZXFA 4BMYA 5CDHA 3PDWA 4PTLA 2AUMA 3FMGA 4C2UA 2HCRA 5BT9A 3UMGA 4ZCQA 2HHJA 2Q8PA 3QVJA 4E5YA 3QFTA 3LQ2A 3NIBA 3N7TA 1D09A 2QZ4A 3AYZB 4RHUA 2CL0X 2OHVA 3OCUA 4CM9A 2SICE 4WTOA 3WZLA 5F1OA 3Q0IA 3ZBQA 2J67A 3DB2A 3ID6C 3VO2A 4YRIA 3HDVA 2V7QA 4GQBA 2IPMA 5BSHA 4COKA 2GQ0A 3H1AA 3ON5A 3PJEA 4BV3A 5AKLA 2HLDD 3KUKA 4ES6A 1U0TA 2X0DA 3L84A 3VR4D 4OFBA 4ECAA 1AZSC 3EWIA 3G2PA 3IMGA 1OXXK 2C92A 2GK3A 3MGCA 3QWIA 4K46A 5JRDS 4BY9E 4B4WA 2QD4A 4FFBA 1DXHA 5TY0A 3NS7A 4ZXPA 4KUGA 2H9AA 4B3BA 5CDUA 5BSMA 1QV6A 1V1RB 4XWYA 3Q5DA 4P4GA 4F2PA 3JALA 2JGRA 1L7EA 4B3JA 3ENWA 3VR6H 4JSTA 4YMLA 4RIFA 1AK1A 5AW6A 1FDTA 1DAGA 3SYMA 2XWBF 3Q7TA 2PFGA 2GLXA 3OY7A 5IP5A 2Y8EA 1CW2B 4BE9A 4HWOA 3ORSA 5D1HA 3TB6A 1GNVA 4S1VA 2BISA 3EZ6A 5I9SA 3MT9A 2UZ1B 1K86A 2VBCA 1IYZA 3W6NA 5ALTA 3KYCA 2IDZA 2H59A 4DKJA 4PZ0A 4Z4EA 2I71A 3WL5A 1PP4A 4FBGA 4UMEA 4EZIA 1RRCA 2VK8A 4LGCA 3QVXA 4LHEA 1U8YA 3H65A 4MI9A 3DV0B 2ZDQA 2HPHA 2KI5A 4F3YA 4FZRA 2VJMB 4HYEA 1KQPA 2N1BA 2C4WA 2CUKA 4ZT2A 3T5TA 3AHHA 1BEEA 4KNWA 4FNAA 1W44A 4FGJA 4F85A 1XMOB 1F14A 5H3LA 3RI3A 1ODTC 4UCWA 4ACBA 1A88A 2FMHA 1O95D 4L22A 1I5EA 4MB6A 4G1CA 5CXUA 3KJGA 4GKAA 5J47A 4YCNA 2W7TA 4BFLA 4CDRA 5K0FA 2XQFA 2OWEA 1FX1A 3CSUA 4K9PA 4HMPA 1U1FA 5FNVF 3W5CA 3D9QX 4PLHA 1T5DX 3L0OA 3RUFA 3IAM1 5BY2A 3G8YA 1XRQA 3B6ZA 3HA7A 4AMUA 1NBMA 2DECA 1IY8A 2I4RA 4OJQA 4IEFB 2OYRA 2CUNA 1WF6A 2IYFA 5LOVB 1GIAA 3TAHA 1POXA 2C04A 3MCWA 3KJHA 2VYVD 1OY1A 3GOHA 1ZI8A 2R85A 4INOA 4AZVA 1OREA 4KFUA 1RKQA 3VZCA 4FWTA 2LCIA 3QMVA 3RAJA 1B23P 3N2ZB 3D7NA 5ABPA 3N0XA 4FB5A 1WABA 3OESA 4YRLA 1MF7A 3CX8A 1B76A 3GV0A 4BMPB 3GDFA 4N1AA 5FBLB 1M34E 2CFIA 2O14A 4HMOA 3R9KA 4GI3A 4WXEA 3SMQA 4WZAA 3RVOA 4Z4GA 4DMGA 3A9SA 3FYUC 3RU7A 1QSGA 3P26A 3CKKA 4R98A 3OU7A 1N4DA 5JWRA 2IXDA 5CNKA 2VUHB 3MILA 6ABPA 2Z8ZA 2BFPA 1LBIA 4Z7NB 1SMKA 1ZD1A 4WZAB 1KI4A 1T9GS 2E6UX 3II6X 4MWBA 4FMBB 2O59A 3GYGA 1FEZA 3QXCA 4G0XA 2IV7A 3WYEA 1RADA 2JJMA 2Q27A 4WFJA 2YJNA 5KWVA 4ALMA 2VJPA 5DTEA 5LP6A 1PS8A 1RLOA 2HRBA 1UH5A 2JZOA 4MP3A 5LU9A 3U4HA 5EQFA 5E1MA 2X8JA 3KTOA 3GHHA 3I73A 2V7PA 4TN5A 4A03A 5LP6B 4HXYA 1FP7A 1JLMA 1L5GB 4UUQA 1D5CA 3MMSA 4C7JA 3PGXA 2R84A 2YWDA 1FVXA 4YCAA 1N6KA 3Q8KA 3BEOA 3KLNA 2VDQB 3U0VA 5JSFA 4CT4B 5JCPA 1GXSA 2JI6A 2IHNA 2ZQZA 2ZUVA 1XVIA 4Y6LA 1YZHA 4DDUA 4P0TA 5ESRA 3W8DA 4DLSA 5CB4F 1WBBA 1ENYA 3OX2A 4O3MA 4GOLD 1MUUA 4LOLA 4NG5A 1NJFA 4FW9A 5DJ5A 4FE4A 4LISA 4UOEA 2Y6UA 1NVWQ 1Z5GA 2PS0A 1VA5A 3CRMA 3O8OB 3WIBA 5C51B 2GTHA 3OQHA 3DHNA 2NAPA 4NPCA 3PQ5A 3IXMA 4BLQA 2J3HA 1S1MA 3A6ZA 3ITDA 2Q4OA 4MAMA 4OGKA 3FMVA 1R27A 2IOFA 4L4SA 3ZXUB 4AJ1A 4AJOA 4HDNB 3F74A 1EI9A 2NTNA 2P40A 3QWBA 3KHUA 1JQDA 1VC2A 3BD7A 3PUXA 2V54A 5HKAA 4HMQA 1BJKA 3GLUA 3V8MA 3BMNB 4URXR 3LIIA 2BD0A 4JBGA 2P7IA 3IV7A 3H75A 4INPA 2ZSHA 4IIHA 3KM0A 3R6WA 3VVMA 4C4XA 2X7HA 1XI2A 1MO2A 1K68A 4HEQA 3RHSA 1VLVA 5JJ5A 4B3GA 4MITA 1E1NA 3DXZA 2KWIA 1TLLA 3JQGA 4XXHA 4E15A 5E3IA 1RZRD 3VQTA 1S8OA 3I01M 3V7YA 1E92A 1FQWA 1RHMA 4EB0A 2VSYA 1FRZA 1R37A 3VNSA 4XB2A 4ZI7F 1IRXA 4PHTA 3T61A 3HYNA 4I1RA 4UBMA 3WLQA 1WAMA 2YQZA 4KDRA 3OQMA 4L8LA 2R0QC 1EFAA 1FNMA 2VHJA 4ZAVA 5KYXB 1XMVA 2JJ2A 3G9XA 4H0FA 5LDGA 4KYVA 1PV4A 1L4HA 2C95A 4G5YA 1SCDA 5FI3A 1GTRA 2XXAA 4KC0A 3WMFA 2GCGA 2O52A 3FNRA 3ODPA 2P8JA 3WFIA 4W5NA 2ZYDA 4L07A 4EA9A 4QARA 4Y6QA 2XJ9A 4UE2A 1ZOPA 3FWKA 3LUDA 1KYIA 1C29B 3HVIA 3KQNA 1VHTA 2XXAB 3BMCB 4PG4A 5DYYA 1OVGA 3TI9A 4KNYA 2FK8A 3X1ZA 3TLGA 4GUAA 3F78A 5A4FS 5JPDA 1ZD9A 3WYFA 3RABA 2WRZA 1ZUHA 3UKOA 4DSZA 1J8QA 3TZLA 3C1OA 3F6CA 1YR3A 5J2TB 4QRHA 1I13A 3S28A 4MQUA 5IULC 2B4TO 2ZWOA 4JR2A 2CE2X 2DRIA 5C46F 3KQKA 2MTBA 4J49A 1KAGA 2C5SA 1E66A 4B3TB 3D8RA 4UDOA 4B6OA 4US2R 5LA6A 4CEJB 3CRW1 3EK2A 4ZCIA 2POCA 4OHMA 1BCSB 1T2CA 3OKAA 2Z30A 1AB5A 2CFSA 2ZJYA 3OQIB 1O54A 3AONB 2O8EB 2KLHA 1FTYA 2ECKA 3KPJA 3OD1A 4I4NA 4H35A 4MNTA 5BV7A 5CFRA 1HG0A 1IQRA 1T2EA 5LA6B 4XLZA 1AMOA 1E9SA 2ERXA 2W43A 3I05A 2F1IA 1G98A 3K8ZA 7REQA 3C6YA 1DVRA 3AY0A 1XZFA 3HHPA 3O84A 1IBKB 2J32A 3K0CC 1JJIA 1UMDB 1TLTA 4MAFA 4XRRA 2PE5A 3I0MA 1T4MA 4ND1A 1JI0A 3UT0A 4BP8A 1VMIA 2JK1A 4LJLA 2OCIA 4IV5A 1A76A 4RLQA 2JIOA 4QYWA 7REQB 5HIKA 1DQSA 1JSCA 2QUHA 4EAAA 4AWBA 4BP9A 1T24A 4NZOA 1OLUA 1JAIA 3DHYA 3S2ZA 2XZPA 1ODSA 2WJPA 5LR6A 2JI4A 3JQ8A 1Z15A 4K7JA 4F5EA 2XF2A 2R4QA 4PQFA 3I09A 2ZT8A 4D99A 2HU7A 4JT2A 1M33A 4F0JA 1OLUB 4G4JA 4E1AA 1JJAA 2QW8A 1VIVA 3SC4A 2E6KA 3S2EA 4O2LA 2RKBA 3H3XA 3A2KA 3JQ8B 4DPMA 5AJUA 4GP7A 4JROA 2A88A 3NBYC 2C31A 4MMYB 4XSGA 3RAGA 1UDRA 4P84A 4LQLA 1T2DA 5E1OA 2BDEA 1Z5UA 1QIFA 1ZEJA 4OJTA 1RHUA 1HETA 3KFXA 3W9YA 1P18A 1JGTA 3NH6A 4IXNA 4X90A 1YH3A 1M73E 2LD4A 1EAYA 3ZGOA 5AVYA 3MCVA 2X86A 2QR5A 4DNPA 5I8WA 2E37A 3GFGA 5F2OA 2RJ3A 4O2BA 5KEIA 5E9JA 2VBIA 2ANCA 4M8SA 1K06A 4GSLA 1GM5A 1YTLA 2B3DA 2BLLA 2H4ZA 2HBRA 2QKYA 2Z5FA 3CUUA 2J7KA 1RWWA 2EWVA 4JB2A 1N0WA 4QUBA 5G40A 3VZPA 3ZWMA 4NENB 4DIOA 2GXAA 1GUFA 4OI2A 5DHPA 3SC2A 2IYRA 4MIKA 4XTCS 5FTNA 3IHTA 1YJBA 3IOYA 3LL7A 3HY3A 4OB8A 4K87A 1G3QA 1KRXA 3E9YA 2CNDA 4CL0A 1HLFA 5C7IO 4R1QA 3MWKA 5TIIA 1NYRA 1EWVA 3KLOA 1Y81A 3P71T 3SC2B 2PR2A 4RKFA 5CBKA 2ZUTA 1CFZA 5F4ZA 1KL7A 2OK7A 1T3GA 2J9GA 3I2JA 3BUSA 2AMFA 4LYAA 1JX6A 3E5HA 3NHLA 4KIWA 4NLLA 1E6CA 5DNWA 1HYHA 2H17A 1NN1A 4MDYA 2NVWA 3S4YA 1A82A 1PJQA 5EFZA 3EULA 3HNOA 4IDQA 5EP1A 1NNEA 4F6RB 2JFBA 3CX6A 4JEUA 3WLTA 2PA0A 3DMPA 3UPDA 1P5FA 2B82A 3G49A 4ARIA 3N2YA 2PQ2A 5TJHA 2H7VA 3UJ3X 4MUIA 3EDQA 4AM8A 5B7PA 3A6DA 4LNAA 4QNMA 2QMUA 4U0KA 2P27A 4PNPA 1P1BA 4XUDA 2XZDA 3SEZA 3K6SB 1I4TD 4J1NA 4TMVA 3KEGA 5CVEA 3GRKA 2IPLA 1IUPA 4OQZA 4RZ2A 3D7LA 1Z5VA 3PJRA 5HRCA 2GPSA 3OPMA 1DJMA 1SURA 2PS9A 4HB2A 1EJBA 1BXRB 2YCBA 2X3YA 3Q3EA 3D02A 2ONJA 3ROGA 3U2QA 5MFPA 3FN4A 3WWCA 1CWUA 3JWGA 1OVMA 2E4XA 3ONFA 2JCSA 4Q9HA 5KHAA 2LW7A 5DNYB 2ZSIA 3FSGD 5LBUA 3ZDCA 1MJGM 1ZXLA 4CR8A 3LLCA 2C7BA 2XQGA 5TS3A 5WRFA 4KSCA 3CBQA 3ZHOA 3OAAA 4WEOA 5F77A 1IIRA 1D04A 4LSGA 2QTRA 2WUVA 4CQJA 2Q5LA 4QNRA 5HE9A 4H3VA 4N6GA 4Q3LA 1A1SA 2L19A 3FUXA 1GA4A 1R3UA 2FW8A 2HDHA 4DM3A 3R5JA 4JFRA 3L7AA 1YO6A 3WYCA 2YVUA 1WMFA 1P4JA 4WFKA 1UEIA 3QVMA 3EF3A 4KCGA 1CZOA 1I36A 2BRUC 4DY4A 4WZBA 2IE0A 1R8JA 3L0ZA 3MTIA 3WISA 3UMFA 2FZVA 3U9LA 4A8TA 3DTVA 4K40A 1AQLA 1Z4QA 4JLPA 4BGVA 1Y3FE 2X1VA 5FFMA 4FQ5A 2YV5A 5FA5A 2VRCD 1FVHA 1YCDA 1ID1A 3UC9A 2AMYA 3WYGA 2ALJA 4CNQA 3T8YA 1VJ5A 3ZHTA 4YV7A 3IVRA 3UG7A 4B7AA 1XBTA 3E9DA 2W2TA 1ZINA 1EWKA 3THSA 1I6MA 1EFKA 3BXFA 1WSDA 5ITVA 2EEZA 3OJXA 4D45A 2NZ8A 4Q9DA 1KIMA 3HY4A 3TM5A 2B6NA 1JFFA 1JJ7A 3H4TA 1OTXA 4LKRA 4OMUA 3VU0A 4RTQA 4HWSA 4W5JA 5CM9C 3RQIA 4AYWA 2K7ZA 3NTVA 3OKCA 1UXIA 4MDHA 1MGOA 2KBEA 3DQQA 2XE7A 4EWLA 5EIFA 5TQVA 1D2CA 1HE2A 2GCNA 4FX2A 3AU8A 1U6KA 1AO0A 3B78A 3ICEA 2JD1A 4AL4A 2NUBA 2IHVA 3HN2A 2EGHA 4RDCA 2NO0A 4B7XA 2QZSA 1LRLA 2ZR0A 4S1OA 4J0QA 1T1JA 3E81A 3WGOA 5KNDH 4RE5A 5D2CA 1TA0A 2W2MA 5I7FA 3L18A 2LGJA 2I03A 4NK4A 4M7WA 3W5JA 1JEDA 1NRIA 4KAJA 2WYHA 2WTNA 3LLMA 1QVRA 4M7PA 4WLNA 3RG2A 1YFZA 3WB1A 4BVEA 1IN4A 1DXQA 4U2GA 3REGA 2ZI3A 2ZK7A 1AQNA 3DEZA 3K1YA 3SN6A 2F1KA 1A8HA 1WKVA 4URFA 5IHXA 4OHYA 1E3JA 1SR8A 3VR5H 2F55A 2CNLA 4KITB 4NONA 1N77A 1NW4A 5ALFA 2ADFA 3LSYA 1SA0B 1JHDA 1LF0A 1EVQA 2ZUCA 5L6MB 2O0KA 2HPVA 1DG9A 5D85A 3T06B 3UV6A 3ZWVA 1J5PA 1B15A 2QRUA 1OT3A 3DBRA 1IJBA 2BFEB 2IEDA 4JQZA 2JHPA 1XKLA 3WB2A 1JDZA 1KEVA 2BP7A 4V0ME 2FWNA 4ATNA 3R7NA 3TD6A 3NBKA 5JUWA 3O75A 3WK5A 2XMRA 2IXEA 1NLYA 4KW7A 3DBRB 3PHLA 2I7TA 3P0FA 2HSEA 3JQAA 1KEEA 2Q5CA 3WWYA 4Y2GA 1EXDA 2OMKA 1S4MA 4MYSA 4DIBA 3V4PB 3QE4A 2A5GA 5IYZB 1UBTS 1GVHA 2V6BA 2VLBA 3CZ9A 2G1UA 2IY9A 5H5JA 4JYZA 3OURA 2P67A 3ZZ1A 4KPFC 2NYRA 1UJMA 1KAMA 1R18A 1DKQA 2C2ZA 4XX0A 5CXSA 1G6OA 2YTZA 1TJ4A 2PRSA 2AFHB 1FMFA 1OE0A 4ZYXA 2JGJA 1DRKA 2ZIEA 2VHTA 4H0CA 3RVMA 4RH0A 4TROA 1F60A 2HT1A 4ZQHA 3JD0A 4D74A 1Y3IA 5KTPA 4Z4HA 3P45A 4FLFA 4XSHA 2QTVA 3DKVA 2R65A 1SHTX 1IN5A 2AYXA 1LK7A 2BWJA 2Q1WA 3H9CA 2JZCA 3LPDA 2V9PA 3KDSE 5CP8A 5JBNA 5KNDA 5JYBA 3PX7A 1V16B 5TPZA 4Z1MA 2V3CC 1PT5A 3D8TA 1ZZGA 3L0CA 4RF3A 4XDYA 1T4CB 1I7LA 4MQEA 1RQGA 4OQ4A 4WMLA 1XDDA 2Y4NA 3O9MA 4GR4A 3THRA 4KPYA 3NDRA 3NRBA 1MJHA 3BHNA 2C98A 1YT5A 3PNYA 4S1TA 2JARA 4QFDA 4GBMA 5DSZA 2W2XA 3L43A 3KWJA 4GUDA 5DKFA 4K8OA 3VX4A 4UTNA 3FCCA 4BMVA 4ZT7A 4MMZB 4MQEB 2DBQA 2W6QA 4D9HA 1JALA 4GZLA 1YQXA 5A05A 4EGJA 1NR7A 1FXUA 3GXOA 1N9ZA 1NQOA 4JJGA 1WB9A 3PFIA 1B6RA 2EERA 4NICA 1YDEA 5KOIA 1YJCA 4WY2A 1FW6A 4NBNA 1JWAB 4RGVA 3OQVA 1QLWA 2VR1A 2BR4A 3TN7A 3C1TA 3LWZA 3R0JA 3E9CA 2JKYA 4LRQA 1DJPA 3RROA 1LBQA 3OEWA 1JR3D 3DZHA 4DDWA 4CLOA 3CNNA 1SU4A 3ZJ4A 3ZPXA 2FWRA 3RV4A 4E30A 3KIPA 2II6A 1LDNA 3LQKA 4K26A 2I6FA 4EPYA 3OVMA 3HCBA 5JE8A 1TC1A 3JU3A 3WS7A 5NLLA 3SE7A 1J2YA 1AURA 1WDLA 3KXPA 1W2HA 5TMDA 3EZFA 2IU4A 4QD3A 2J7PA 3WB0A 3SKVA 3I5YA 3IT2A 2CJFA 3FPHA 4Z0NA 3RD5A 4Z4CA 2PXAA 2ZYHA 3G2IA 2NT4A 3QOYA 3T3OA 2GR9A 1KORA 1VBFA 1SUIA 1YHZA 5FPPA 1QTQA 3HU3A 3C1UA 4M36A 3RPEA 421PA 3NYRA 3KKZA 1P77A 2X13A 4CKBB 4P8RA 3QYFA 2FSSA 5K0LA 1ZL2A 2PGOA 4GHWA 2NNLD 4EHKA 4YH1A 2WTXA 2CYCA 3SR4A 2NYVA 4OJNA 1U1EA 4MRPA 3WLKX 1T9ZA 5TS2A 1HMYA 3FR7A 1B93A 4UVHA 4EA6A 5BW8A 1FB5A 4FFMA 1CJUC 5IVKA 3NQ41 2ZRCA 4JZKA 2FFRA 2VNHA 3RS0A 2G7MC 1BWQA 2B7LA 4RVGA 2PXHA 3UN1A 3WBKA 4MCHA 4AULA 2PRYA 1K3FA 1R4MA 1ZJ4A 2BFAA 2W8ZA 5GZ6A 1ICEA 3WLJA 3VI4B 3VYVA 2VSOA 2XRYA 4PSCA 5EPEA 2QRMA 3QXSA 4O2BF 5J2UB 1TM3E 2FJ0A 3VTAA 1G59A 4J75A 4EB8A 3NRJA 3PX3A 1R4MB 3QUTA 1VL2A 3ANNA 3B6IA 2YWHA 3M6VA 5SYNA 5FR1A 2G4VA 1CZUA 1WV1A 2BAGA 1JU3A 1UFQA 3NH9A 3SQNA 3T7SA 4KFSA 2FWAA 1L4NA 1D9XA 4CKXA 5J4LA 1A8SA 1CIPA 2JH9A 3BF7A 3CMCO 3EGIA 3I9MA 1DBVO 3CURA 3U81A 5KNCH 3FNFA 4LMPA 2CHFA 4QULA 2YWEA 3P5BA 3LDUA 2V65A 3LUCA 2J5KA 4IL5A 1VI6A 2QRKA 2NTJA 1JEYA 1Y3BE 2IZOA 1G38A 4UM8B 3WLMA 1YFJA 3EODA 2QDXA 5TEVA 5EXDA 5E1BA 4Z9XA 3L40A 1WUYA 3OT4A 3UCEA 4KYUA 4DANA 4RF4A 3EQ9A 3WWDA 2ZI6A 1TVEA 3A4NA 1T10A 5CBPA 4Q9AA 1U0GA 3KU4A 5EJAA 1S1CA 5JOQA 3FYCA 5KOHB 3GWZA 4HLUC 2HHCA 3T9DA 2JEYA 1DCTA 4PQRA 2DT8A 3D5TA 4MS1B 2OBYA 3A6JA 1OSNA 4KVAA 3W5UA 4PQEA 4NHOA 1XU9A 5BV8A 1YTUA 1AQUA 3WGNA 4DWVA 1WMDA 5E1DA 4PYLA 3IDSA 3PQCA 3JZMA 3DOEA 1X70A 3LZ6A 1QKKA 3CZMA 5MGBA 1QH0A 2UYQA 1R5OA 3ZGXA 3L4EA 3INGA 2G5TA 3U09A 2LZ0A 1WV0A 4X1IB 4BE4A 2H1FA 5ICFA 5EZYB 1YU6A 3AJRA 3GGOA 5HMLA 4BKUA 4GO1A 3VU8A 2C5HA 4X95A 5CDFE 4Z51A 2I33A 1Z5NA 4HGPA 1G2QA 1SVIA 4YAGA 2HA3A 3FKJA 3H9JA 4FIDA 5FF9A 1D7AA 1DRJA 2MR5A 3JQFA 3VU1A 3CT6A 3L3BA 5DT9A 4HFJA 4RPKA 4CIXA 4JXKA 1M9NA 4IH4A