1PEKE

Structure of the complex of proteinase k with a substrate-analogue hexa-peptide inhibitor at 2.2 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of proteinase K with a substrate analogue hexapeptide inhibitor at 2.2-A resolution.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE K
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pekE00
5JXJA 2Z58A 2Z2ZA 1S02A 4WOCA 4DWWA 1C9NA 1CNMA 1TM5E 3I37X 3BX1A 4ZARA 3WHIA 1SN7A 2PWAA 4KG7A 1Y4AE 5JMOA 1SPBS 3DE1X 3I2YX 1AVTA 1GA1A 1SELA 1TMGE 1SCJA 2DUJA 2PYZA 1WMEA 1R0RE 2HD4A 2ST1A 1Q5PA 2X8JA 3QMPA 1P7VA 4OMCA 1OYOA 1P7WA 1ZVKA 1NDQA 2WWTA 2X8JB 2Z56A 3SICE 3DVSX 4HX2A 3DE6X 4WOBA 2P4EA 3VYVA 2PWBA 2ZWOA 1ST3A 2Z57A 3DE3X 1NLUA 2WUVA 1HT3A 3A3NA 1PEKE 3QTLA 4CG0A 4ZOQI 2SBTA 5JXHA 1V6CA 3H42B 1T1GA 1YU6A 4DZTA 1TECE 3EDYA 4NMXB 3WIVA 3AFGA 1SCBA 1R64A 1TM1E 4GI3A 1Y3FE 3UNXA 4NE9A 2PRKA 3ZXXA 1WVMA 1S01A 1V5IA 1C3LA 3Q5GA 4B5LA 1SIBE 3A3PA 4DJ5X 1SUPA 3GCXA 3LPAA 3BPSA 5FFNA 1GTJ1 1WMDA 3D43A 1YJCA 1PFGA 1AU9A 5FAXA 2WV7A 2E1PA 3VSBA 1SBCA 3CO0S 1AQNA 1Y48E 1TO1E 1KDZA 1ZVJA 1SH7A 3GCWA 3A3OA 4BWGA 1T1EA 2W2PA 3TI9A 1UBNA 1T1IA 3F7OA 2Z2YA 5AVKA 1EA7A 1SCAA 1TO2E 3D9QX 2PQ2A 3EE6A 2XTJA 3T41A 5AVJA 5I9SA 1KE1A 1SUDA 4J94A 1KE2A 1SUAA 3DWEX 1SIUA 1XF1A 1WSDA 3WIUA 4H6WA 3WQBA 1LW6E 1MPTA 5FBZA 1SCDA 1SUEA 1IC6A 1BE8A 1Y33E 2WUWE 1MEEA 1P8JA 1R6VA 1ST2A 3BGOS 5SICE 3DVRX 1SBHA 5AQEA 1PTKA 3DW1X 1DUIA 2B6NA 1TM3E 2IY9A 1EGQA 4NE7A 3LPDA 1GNSA 1DBIA 3F7MA 1SVNA 1IAVA 2GKOA 3DYBA 3LPCA 4MZDA 1AF4A 2W2QA 4H6XA 1PJ8A 3GT3A 4I0WB 1BFKA 2V8BA 4H6VA 3PRKE 1OT5A 3VTAA 1GTL1 1WMFA 3VHQA 2IXTA 1S2NA 1TK2A 1AK9A 3HJRA 1C9JA 4KPGA 2SICE 2G4VA 4AKSA 1KDVA 2XRMA 2ZRQA 1SIOA 3CNQS 4FONA 1SBTA 1SCNE 3PTLA 1OYVA 4JP8A 3VV3A 5JXGA 4RYDA 1YJBA 1YJAA 4M1ZA 3DDZX 2W2MA 4LVNA 4HVLA 2SECE 1TM7E 4Z2AA 2W2NA 3L1KA 2DQKA 1SUCA 1TM4E 1BE6A 4OV6B 2ID4A 1SUBA 3F49S 1C9MA 4C3VA 1GTG1 1Y3BE 5CW1A 3SQOA 4CFZA 2Z30A 3I30X 1A2QA 1CSEE 1AV7A 1Y4DE 5B1DA 3TECE 3ZXYA 2TECE 1Y3DE 5K7SA 1BH6A 1THMA 2QTWB 4YN3A 1Y3CE 3TI7A 3DE7X 2ID8A 3AJ8A 1BJRE 3LXUX 2SNIE 3OSZA 1NDUA 3DE4X 4OMDA 3P5BA 1SBIA 4CFYA 3VV2A 5ARDA 1GCIA 3DE5X 1SBNE 3QFHA 4AKTA 5B1EA 3GT4A 3I34X 3DW3X 5ARCA 1JEAA 5AMXA 2DP4E 2W2OA 3DVQX 1BFUA 1GNVA 4KB5A 1GA4A 1Y34E 2PMWB 2Z2XA 2PKCA 1GA6A 2ZWPA 3DE2X 3DE0X 1VSBA 1Y1KE 5ARBA 2HPZA 1AH2A 3AJ9A 3EIFA 5JXIA 1GT91 1KDYA 4LVOA 3Q40A 4K8RB 4C3UA 1Y9ZA
chains in the Genus database with same CATH superfamily
3T3NA 4RCZA 2ZRIA 4EAQA 1OBVA 4YBRA 1XROA 4YV0A 1PGQA 5F7OA 4U9HS 1CZRA 2NO7A 5AI4A 4A6DA 2WYWA 3F1KA 1MHTA 2YCBA 3GOQA 4CLRB 1N33B 1VL1A 2AX3A 1BX3A 1W88B 3UMSA 1XFDA 2G5TA 1P31A 1S4MA 5H70A 4A6XA 2DJIA 4PANA 4MPDA 1ZOPA 4CTMA 2V97A 3CZ9A 3DDOA 4WJLA 5H9VA 1JDVA 3F8SA 4X20A 3SQMA 4C4OA 1Q16A 4U3JA 3REOA 2V98A 5K8LA 3IAXA 4QDKA 3RVSA 5EY5B 4Q16A 4B3GA 4X8OA 1Z4NA 3IQFA 4F6RA 2CUZA 5DX0A 4V24A 5C34B 4IS2A 3U39A 1G8SA 2IYAA 2B30A 2WJ3A 3WIOA 2ZXEA 2HGSA 4HPJB 1A3CA 1Y4UA 2VYND 3ORFA 3QE2A 3PIDA 1SUPA 1YKGA 1XU4A 3CKMA 3LDGA 4ARZB 3OLYA 3OZXA 1GNTA 5CVUA 4K26A 1JDNA 2XX3A 4LX8A 3RS5A 4B8YA 5AR1A 2ZQ5A 5COQA 1TVKB 2R7NA 4J76A 1E32A 1Q7RA 3FCXA 4B5KA 4PF1A 5J4HA 3U6KA 4WZBB 4XUGB 4JP5A 3QJGA 1NASA 3BL8A 3L7NA 5H3HA 1XZMA 2GZ3A 4OM8A 4X94A 5HKKD 4MIYA 2NV2B 1F9AA 1LX7A 3DOEA 4FTWA 1XF1A 1G60A 1PK9A 4WLFA 3PWKA 1QNFA 3JCZA 4HVAA 4MGHA 2V3VA 3KVNA 4Y2QA 4EI9A 2VP6A 1GVHA 2AZMA 4D9NA 1WQ3A 1QQAA 2BE7A 1J42A 4FCCA 1U94A 2QP3A 2HMSA 2DOKA 2YWCA 3DZHA 4NE7A 3WYBA 4ZO7A 3HB4X 4J1TC 3HR4A 3I9LA 4RHUA 3M1LA 4QU5A 2MTBA 2G1UA 2YY5A 1SXJB 3FWNA 1UK7A 3OURA 4ICIA 3MMZA 4BL5A 1PJ8A 1JTVA 2JLSA 3WHKA 1W29A 2ZSFA 3RVOA 2V7UA 3K9WA 5HGXA 1I5EA 2HOQA 3VNUA 7ADHA 1MKYA 1UPBA 4K9KA 2ZU0C 2AOWA 3UT6A 2NOAA 2PZKA 4M0UA 3ECSA 4BNLA 6GPBA 4JYCA 1LDYA 4AJ1A 1J0BA 4U00A 3JS5A 1H22A 4WRRA 5LB4A 4REQB 2I1WA 3W5DA 3E82A 1L7OA 4UW9A 3KR1A 4MR9A 3NOQA 3LL7A 4J0HA 3PX7A 1ILWA 4IBOA 1BXRA 5DGHA 5HRAA 1RYZA 3T7RA 3VMMA 1QZXA 1L9KA 3GPCA 1KEWA 3R9WA 2A0YA 4HNAA 1LK5A 4FGKA 3O4RA 3WHPA 4BBZA 4CFYA 3DKIA 3Q1KA 4BNZA 4IGFA 4ZVQA 1EX7A 2ATVA 2PU7A 3BMNA 2H7VA 1MB0A 3B1XA 1ADFA 2X4LA 2XMGA 5JCJA 2OZLB 4BVJA 1QTNA 3K30A 1E58A 3NFYA 1PO7A 2CXNA 5D86A 5IK2D 1HSOA 2VJCA 4FMCB 4KXFB 4TS3A 1IATA 3GA7A 3OKPA 3KB6A 4X1KB 1E61A 4CMAA 1ZD2P 3AERA 3QW2A 4GW3A 1B43A 5EUCA 5C3UA 2X40A 3MELA 1A9OA 1N6HA 1YT5A 1KDYA 2WPNA 2C58A 1FUEA 2J3KA 3RVRA 4YCSA 1FY2A 1JG2A 3K20A 4TKLA 1OLXA 3B7GA 4ZT4A 5CRIA 2WD9A 4E22A 2DHRA 4BUJA 2AJ8A 1UXIA 1VKHA 1MU0A 1JHRA 2A33A 2Z4RA 4D9HA 4QRDA 1FW6A 3AUXA 2SHKA 2FPSA 5ELXA 2EWWA 1T8PA 2K2WA 5B3JA 1W36B 4ME6A 2QV7A 4LRTB 4CFZA 1K3UB 3FPEA 2WUVA 2GHRA 2PSSA 3TVTA 3UATA 4CM8B 5C35A 5CD9A 4D46A 10MHA 4GBED 4ER5A 1G16A 2N42A 3LW7A 4LBWA 3VNRA 1I5RA 4DYHA 1OC2A 3P26A 2G88A 3FXAA 4TRRA 3MWJA 2J46A 3L6OO 3IOBA 4FOPA 1MRZA 2Y0EA 3RVQA 3LV8A 4YCAA 3ZXSA 2C9OA 4QAJA 2OK8A 4O4HF 4TYMA 1GZ7A 1RQLA 1ZCBA 2ZJ5A 1G5HA 2E2WA 2DTXA 2PHZA 3MYYA 1L4NA 1OXVA 1FC0A 4N5NA 3NHPA 1JAYA 1T29A 5BXQC 2AJCA 3ETCA 4C0AC 1FCJA 4QPCA 4J2TA 3FTFA 4V3BA 1H2RS 1SHUX 1JLSA 2E7ZA 2C2ZA 4ZDJA 4JIGA 1E2UA 1QF7A 3FCUB 2FZWA 3C8MA 1JIQA 2FAXA 1H9CA 1M0SA 2R65A 4G5HA 4CLOA 1EFAA 4RENA 1SU4A 3TIFA 3STTA 2EC5A 4JLUA 5F3WB 3K0BA 3D4PA 1B41A 1FYFA 4YRJA 5LP6F 3N2ZB 3D4IA 3HBFA 4CKBA 4Q4JA 1AO0A 2ECQA 2O14A 2YC2C 3IBYA 3U44A 1BYIA 1E3JA 3CH4B 3HLKA 3CVWA 3OMLA 5B4TA 4IEIA 2ZBEA 2R66A 1WP4A 3KV3O 5AKGA 3EAFA 4WTOA 3NONA 3DFIA 3OKAA 5G0WA 2CW5A 1JA1A 1RM0A 2H6EA 4XLTA 4ECEA 3RWOA 3PGVA 2MWMA 1YL7A 3ZD9A 3ZJVA 2KI5A 5E6RA 1LV8A 1AK1A 1ZONA 2PR2A 4KBFA 4FEEA 4A82A 4YCMA 3ZLJA 2YW2A 1I0ZA 3KUCA 4Y18A 1FXUA 2DFKB 3HZHA 1OJ7A 5FBWB 1NE7A 4QE3A 3T7AA 1H94A 1Q1QA 4UNQA 1IOLA 2CLIB 2WTBA 3L82B 3T7CA 4B1FA 3ADOA 2P5YA 1T8SA 3PFFA 1SHTX 4RCYA 1FQOA 1VCOA 5KYUA 3FNBA 3J7TA 5EWMB 1P44A 2MJLA 3KYBA 4Q24A 4PNEA 2R00C 1PN3A 4RANA 2OAGA 3E1KA 2QLTA 3M6UA 4Y9TA 2FSIA 3ZIAA 1HZZA 2HBYA 2X1VA 3I23A 3SE7A 2ZBVA 1ENPA 1T1SA 4LUCA 3IQXA 1M34A 3OPXA 2QYOA 1FU4A 1C30B 2GD1O 1DHRA 5EHNA 2XQIA 1K8XB 3UGJA 3QUCA 4PXYA 2HWKA 3KHUA 3MFYA 4HNAB 4EUKA 4LA4A 1W4BA 3ENKA 3ZHBA 5IZCA 3RJ5A 1YZNA 2QR3A 2CHQA 2FRXA 2YW9A 2C0QA 3JV7A 2ZRHA 4ZEVA 1MAUA 4YMSA 4ZMBA 1H0KA 1TEZA 3LX8A 1XZCA 3OPYB 5ARBA 3VZSA 1GG5A 2FX2A 2ZJAA 3IBCA 3K9GA 2WUDA 4K2AA 2EP5A 2NT4A 5KKCA 4P2BA 5C18A 4MVCA 3PJGA 2BBOA 3AOGA 5KI6A 5KOYA 1YR9A 4XWOA 2OUIA 3P9ZA 1U1CA 3C43A 5FBLB 2ZRDA 1TYDE 3NPMA 4MW6A 3ST7A 3TLGB 1B16A 5A6VA 1WKCA 1VKJA 4U2BA 4YAOA 3TOZA 1AKTA 1OLOA 3VR6D 4OKSA 3EPHA 1E1LA 3EWSA 3K94A 2AFVA 4OLJA 4URFA 1WBBA 3D6MA 3RBVA 3PC8C 1E7QA 4FOOA 2P4EA 4EX6A 2PMFA 3V97A 3DP7A 2VDMB 1FTNA 5A71A 2C07A 3TTUA 3RH0A 3ZK7A 3C15C 1FU8A 5H3CA 1RLMA 4ABYA 1NN5A 1E4EB 3WXBA 1Y42X 2FFRA 2Y1OA 4JH0A 4OHRA 1ILEA 1CCWA 1M7BA 4YX9A 4V1CB 1OFIA 1DX4A 4HDKA 5FBRB 1RKVA 2H4HA 3D43A 5JATA 2EIXA 1GN8A 4LJYA 2FW7A 3S7TA 1G66A 1SG9A 2CSXA 1KEZA 3B5EA 1EZZA 1G4UR 1SH7A 3E15A 3R3JA 5JHHB 2W2PA 2XXAA 3AVTA 2ZSAA 4K03A 3ZDEA 2OFPA 2Z2YA 4ZVTA 3GJTA 2PQ2A 3HFSA 2ZSHA 1TVEA 1LPOA 3MERA 4X6YA 5AHRA 2ZYWX 4DS3A 1GL6A 1XZLA 3ZDXB 1ZVVA 2CXXA 2IEZA 4D99A 4X3OA 2IV2X 3AF6A 3R1IA 2G04A 1YVPA 2W71A 3FCSB 3KUDA 2RHCA 1VTKA 1TUBA 2ONZA 2W11A 3AOEC 4BCDA 5KOHB 4OI4A 2GVDC 1AF7A 5HPYB 1JPJA 3DYVA 5KX5A 3K9FC 3WICA 2IHZA 3UXYA 2VLBA 1N2SA 4OEHA 3V8PA 3ACCA 5CIQA 3LYLA 1E1NA 4R81A 4CGYA 4PG6A 1E2KA 5DDIP 4HEA1 3R4CA 3HBNA 3LSYA 3KQNA 1BIFA 3ZLVA 2AI3A 4BPRA 3OU2A 4LZLA 1OVMA 1QDEA 1BFKA 1N9GB 4ZDKA 1ZAYA 1V8BA 4RJJA 3WAJA 4M0PA 3KD2A 2Z2JA 4ZRMA 4H7KA 1T0BA 1U0BB 1R0BA 1ACLA 1NATA 1XLTA 5GONA 5G41A 2VS1A 1U8CB 3E27A 3E7FA 2VP2A 4UE2A 2ABWA 3A14A 2I4TA 3PE3A 3GRAA 2BR4A 4WPGA 2OBFA 1JDZA 3QHQA 3GHYA 3B6MA 2JGRA 3F3KA 3JZFA 4GYJA 4Q1EA 5FQOA 2YYSA 4NBRA 4U9UA 1JRLA 1E1DA 3GGOA 3UCEA 4KRGA 5CFPA 3BERA 3WMEA 4PZUA 4RGBA 1YS2X 1C3EA 2CDBA 4HNGA 3UUFA 2CEAA 1F3LA 1ESEA 4YRQA 1AB6A 3EGDA 3U3JA 3E2IA 1ZIYA 2QRKA 3G7SA 4Q4AB 3TCXB 1Y9EA 4OH7A 2MSEB 2Q5HA 1BKYA 2WAXA 1SHJA 5LZ7A 4L73A 2KSQA 4UUNA 3CMMA 5J2TA 1ONPA 3QM1A 2G0TA 1JSLA 3AEKA 4K86A 5AK5A 1QU2A 4JYMA 2CJFA 1D07A 4O3MA 1X38A 1A50B 4N3GA 2V3WA 1V1MB 3BA6A 3CB2A 3ESYA 3N0RA 2I55A 2PANA 1CZNA 4AP9A 4PVDA 1P33A 1V7ZA 3ILHA 1VLJA 3L0SA 4LC1A 3LQRA 1MJGM 1ZICA 3O1JC 4Z0NA 1WVGA 3W79A 2QTMA 4JGBA 4EMSA 3SFTA 3W5CA 1B93A 1C50A 3GYGA 5E6UB 3LBNA 3Q15C 3R76A 4DLKA 4WQMA 5FI0B 1XJ0A 2R7MA 1LSSA 3IMKA 4Z9BA 5C8YA 1IEQA 2AGVA 2D1YA 3DVSX 3T5GA 3HKEA 2GJKA 1PUXA 4GMGA 1FPMA 3CNEA 2C1XA 3TBFA 4L7QA 3TMYA 3NR2A 3K53A 4G63A 1DJLA 3U7RA 2OCKA 4L0MA 5HJ7A 3FI9A 3NTXA 5G1PA 1Z56C 1IDOA 4R9VA 4A8JB 3GH1A 3B9QA 1LWOA 3H11B 3VR3A 3QMMA 3A4VA 1NFRA 1G8HA 2HJRA 2Q2OA 1P7ZA 2RHDA 5T7BA 1ZD9A 3WK9A 1TQHA 1IOZA 4U1RA 1IZ8A 5CD1A 1E0JA 1F5NA 1I6WA 1LDBA 1PJLA 3GXBA 3NRBA 5AXAA 1PJRA 1LPAB 1Y1RA 1I3NA 2IVZA 3AV0B 4E2XA 2QD5A 3VPHA 4EOGA 3C3WA 1SD1A 3EGWA 3VSDA 2O2JA 4CM4B 2RAPA 4RTJA 1YR8A 2PXHA 3R0ZA 3V1TC 1XRQA 4BMCA 2CB9A 2MCFA 2XB9A 2H4FA 4FC7A 3AVPA 3FWHA 3OFJA 5BV8A 2WVAA 2O8DB 1M1NA 1R5JA 2Q2VA 3G88A 4LDRA 3CINA 4RSHA 3S2FA 2A1UA 1DGQA 1RC8A 4QGGA 5IKPA 3FMVA 2QPTA 2XNDD 3BKWA 2YMMA 5DWDA 3JQ8B 2IGBA 3P20A 5LLSA 4QGAA 1E7WA 3VDMA 3TUZC 3JSXA 1JL3A 3A1VA 3HYTA 3OHMA 1RPTA 2IT1A 3OY7A 1JAHA 4UBOA 3R0QA 4QXAA 4WKBA 3K8OE 2C5SA 1LK7A 3BCSA 4R16A 4RHXA 1XCOA 2A9FA 1OFUX 2C1EA 1E69A 1G20B 2F4VB 3GPDG 5KTNA 3FKQA 2HTFA 1JI0A 1K3FA 2RGDA 2DBVO 3K73O 5HKOA 4KPEC 1ZHOA 3AF4A 3PHJA 5K0SA 2K7FA 4IGIA 4PIPA 4YECA 1C1YA 4L2IA 1CUZA 2BV3A 2EX4A 4MYDA 4XX0A 1NBAA 3DDZX 4GSLA 4M9UA 1CDEA 1F2DA 3AOEA 4WASA 3RFFA 3X2EA 1KJYA 2W2NA 1PQYA 1CZHA 3DJFA 3AJAA 1Q7TA 2YUTA 4KK4A 4RTKA 2Z6VA 4BNHA 4LF9B 5CA0A 2B2XA 3SZ3A 2PGXA 2O1XA 4R2IA 3L8DA 3QKSA 1RJWA 2N1BA 2X9QA 1WB9A 4WHMA 4GXQA 5CDYA 3EF0A 1NUAA 5ECDA 4CLDA 3CVYA 2O2CA 3A6LA 5DGIA 3IJRA 2GMWA 3RWMB 1KFBB 4GZ3A 3VBEA 3U4QA 2G1PA 4KFCA 1ORDA 3TLMA 3CX3A 4YI5A 3L07A 3MD0A 1CZUA 3NBMA 3JX9A 3PKJA 4D8UA 2BFCA 4YJDA 2Y76A 3TN7A 3TVDA 3WFJA 1X7ZB 5CA0F 4PX5A 2I2WA 1FYEA 3GDFA 4ER7A 3P96A 1RC1A 4S1PA 2W2LA 4HMQA 5J2UB 3U81A 1WSWA 1C0PA 1N8KA 2PK3A 4N39A 2QUJA 4P4NA 1MJFA 3KQSA 1EIZA 1XD2B 3LF2A 1AUPA 2XD4A 5B2FA 4HTFB 3NBAA 1SC3A 4LI3X 4PYNA 3OEWA 2RGBA 1IMJA 4FHCA 3AV3A 1IPHA 2Q3HA 2EFCB 4YRRA 5HVNA 2JI8A 3QFRA 2G1AA 4WCFA 5AYVA 4OMUA 3HZRA 4LFCB 5C37A 1R0CA 4KG7A 4EF5A 2IU0A 3WLOA 2NMVA 2O52A 1NT4A 2RH9B 5C5EA 3QMVA 5DI3B 5FDFA 2F3UA 3QVSA 2PGOA 2HA6A 1GEEA 2P9TA 4F1JA 2OZKA 3PD1A 3K0CC 3CNNA 4JR1A 1UXKA 3G8YA 3S2ZA 1XKQA 1KJ8A 3JSAA 2H5IA 1OREA 3THYB 1V35A 4KN5A 4C2UA 3U7JA 2OLEA 2Z5LA 4YAWA 4AZWA 3CIOA 4YJHA 5ALGA 3QVXA 1B0ZA 4Q3DA 4P92A 3EVBA 2A30A 5KMGA 1N5RA 1YZYA 5HR5A 5G40A 1I4TD 1ZH4A 1UBGA 4P7FA 4Z0HO 3L6EA 1CUHA 3Q5GA 1ISPA 1Z83A 3OVMA 1X74A 2CNOA 1O89A 2OUKA 2INGX 3AUJB 3FNGA 1WMDA 3GUZA 3I01A 1ECPA 3N3BC 4S0XA 4BEJA 1QTQA 3LX6A 3ZY6A 3LF1A 5KO2A 5CT9A 3VYRB 2F2TA 4RWEA 1QHXA 1QWSA 2HA5A 1CR4A 2CL5A 3H2HA 2I6UA 3CSUA 5I48A 4KLAA 3P0EA 3QPVA 3PD0A 4Q6BA 3M8KA 4Y6PA 4H3VA 2HLDA 4FSHA 2GDJA 13PKA 2JIMA 2YZGA 4R84A 3FB4A 4PXSA 1TCVA 2GS9A 1KQGA 5F4ZA 2OKGA 3WWDA 4YPOA 4HFJA 4FYKA 1OZAA 4FI3F 2A4KA 4PAQA 2DETA 2P9HA 1E3MA 3IL2A 3SBOA 3ZXIA 2MDTA 5AH0A 4XRGA 3QE0A 1EGQA 3AUUA 3OJCA 1D2GA 5E8JA 2GEVA 3T8YA 1E0KA 4KPUB 3ADBA 3GN1A 5DT9A 4D0RA 1U0FA 3H0EA 4IDCA 1GPMA 1NM5A 1U3GA 3QBJA 2A0KA 2QA5A 1DBRA 3KJIA 5AKIA 3CA8A 2WIDA 4OSOA 4R1SA 1U7XA 4DUGD 1F8YA 1Z5NA 4GECA 3NNNA 5DASA 4K3UA 1BWPA 5AKEA 1AURA 2DHDA 3DO8A 4MVWA 5FFFA 4F5ZA 1OA1A 4PN7A 3B3FA 2YWRA 4FFWA 4GZ5A 5AOBA 3MLBA 2GEUA 2ZYUX 2VP3A 4HS9A 1RZ3A 1Y6QA 4X5OA 1VP9A 5B3JC 1E2EA 4R9SA 1FFHA 1RXVA 3CXRA 1VG1A 2XAAA 4CMIA 2QPAA 1SVWA 4FFNA 2Q5EA 4H4EA 2WKSA 3MGAA 1CTQA 3OCXA 4PO1A 4UOQA 3UYKA 1PKEA 4CF4A 2JGDA 2F1KA 4GLJA 3PEFA 4XJTA 3SNHA 4F4CA 1GKIA 2PO7A 2C2HA 4QTUB 1TT5A 4EL5A 4LXYA 4RSGA 4WBNB 4FIZA 5JRDS 2XKJE 2VTBB 2J41A 3PXDA 1DAEA 2IXEA 3CLUD 1DBSA 4JENA 4G8BA 5JEEA 1OKKD 3HL0A 4JS0A 5CR9A 2R5FA 3BDIA 3F71A 2VPXA 4FKMA 4FSDA 4JVLA 4RLHA 3SS7X 5IULC 3IOEA 4DJEC 1BXRB 1DDOA 1CX9B 4I4TA 4HQNA 3K70C 4A73A 2JKYA 4YCJA 1N2CE 1VJGA 5EHGA 3NTVA 1UPTA 3GL9A 2R1VB 3JQ7A 4PLZA 5U1PA 3ZD6A 2LIVA 4OJTA 3JASA 4DIEA 5ERGB 4IJUA 4XLLA 1G6KA 3UFBA 4OD0A 3H8SA 2WWFA 3Q3GE 2GZ2A 4LYJA 1NMXA 1W581 1W87A 2GPBA 2XJ9A 1Q15A 3PA6A 4NC9A 4IQ8A 5IH3A 1FYWA 4JEUA 4PBTA 2BCGY 1SCJA 1T13A 4QQRA 1I94B 2YL2A 1N0VC 1KH3A 3CBGA 2NAPA 2Q7XA 4ENPA 5IUJC 4EJ0A 4AMBA 1O6GA 1NDQA 2WT9A 2OCXA 2YV1A 3KT0A 4A0SA 2VJPA 1RQGA 1U2GC 2OZEA 3LYAA 4C0KA 4ETMA 2Q0HA 3DB2A 1ZKMA 1VPLA 1TL7C 4M21A 3V8EA 3WLEA 3DT9A 4L07A 5AXCA 1DC7A 4AG3A 4MVJE 4JI7B 1BW9A 3M6VA 2VDJA 3PDCA 4BJHB 1UWLA 4GR9A 4P3OA 7MDHA 3K0SA 2ZLBA 1HZJA 2FX3A 2Q3BA 4M98A 4PSUA 4GNKA 3CJRA 1S8FA 2VTDA 4A23A 4RPGA 4R05A 3HY3A 3DLAA 4HL6A 3RAGA 1T1JA 2P0AA 4KAJA 4M2LA 2J4FA 3V42A 3ZZUA 1I3KA 3COWA 4DUGA 4OQDA 6CHYA 3QX9A 1COWD 2P9CA 4KE7A 3W90A 1Z2CA 4LKOA 2GRUA 5ED0A 2NUPA 2JZCA 1XRJA 3HMQA 4ZCSA 4WLUA 3QBVA 2FMFA 3R7WA 4AD8A 1YCDA 2WEKA 1G9XA 3U3XA 2XTJA 1XUOA 2VOJA 3CRQA 3EISA 2ZITA 1CUXA 3M33A 4NV1A 1HDXA 2Q3EA 4ZI2A 3CUVA 4G0ZA 4J1TA 1KRXA 3MUEA 3CRRA 2V6IA 1NRWA 1VXOA 2AG0A 2W43A 2UYGA 4IUBS 2F55A 1AV6A 5ULLA 1T8YA 5KQMA 4R0MA 1MAVA 4UVDA 1Q0LA 2I6SA 4K9DA 2EFDB 3O74A 4NIMA 4UASA 3NWOA 3ZCQA 4ESEA 5A4KA 1PTKA 3IBFA 5CB8A 5EJ8A 1PL7A 2BGKA 2B4TO 3OUZA 5LWQA 1PL8A 1ZK3A 2GJSA 3LT2A 1NVWQ 4IIVA 1F8FA 2PWZA 2QLNA 2WFZA 2YXNA 3E53A 4JVOA 4FCWA 4BLRA 4DMKA 4G0UA 1JE0A 2QMOA 3DF7A 3P45A 4QUHA 3QLEA 4BUCA 4MPTA 1A8HA 2IKSA 2W93A 4GZLA 4H0NA 2FR1A 1ZGAA 3QBTA 5AJVB 1WCV1 4U7GA 5LP1A 1E7SA 3PNSA 1QZTA 1SA0A 2CZQA 2BZ1A 2I2DA 2Q3FA 1GILA 4C07A 3OICA 1RZRA 1YJQA 1FSSA 4YQFA 1WF6A 5EHQA 2YS6A 3ID6C 5JXWA 5EEHA 3R9XA 4DNPA 4FYPA 1IZ7A 4EENA 3NC4A 3PQDA 1CJSA 3DO6A 1IIBA 1TQ4A 2HSJA 4C4PA 3RS7A 4JLJA 1D4ZA 1MEJA 2CHGA 2D06A 2N47A 3CSSA 3GMSA 3MWLA 4Y2TA 5CFQA 4M0KA 3OE4A 4YP9A 3I2KA 3OSZA 1WCIB 1I4WA 2BZGA 3AHCA 4EGQA 5BWBA 1UBTS 1Z34A 1NVTA 3RLIA 3CS3A 1U5BA 3QXJA 4HLUA 4NPAA 3EXHB 4UUMA 3WXMA 4RTOA 1A82A 5CNJA 1QHGA 2CZCA 2GHIA 2D2XA 3RFXA 5KNCH 2Z2XA 3I6ZA 3HR7A 1JFRA 2PFGA 2ZWPA 4ARZA 4DY4A 3EIQA 2DR3A 3I1FA 2E3JA 3QELA 4F86A 3L8GA 3W2HA 4RIFA 3CZPA 5IH7A 1GRQA 2HA2A 2OCYC 2VTEA 1UPXA 2XOEA 1W5BA 4C7KA 2J8ZA 3Q88A 3BSFA 4IIBA 4DM4A 4TXNA 4RH0A 3PXBA 3HGMA 4F4JA 4WH0A 4F71A 3LRTA 3UEOA 2H9YA 5H80A 1E94E 1E9BA 2IP2A 3D6FA 3GZNB 4FNOA 4L4YA 4MSUA 5DLPA 5DM0A 2L17A 5M3BA 2DUJA 2NO9A 3OX4A 1D2HA 3MGCA 1LZKA 1WULS 3AYZB 3OLQA 1WPXA 2AEMA 2HHLA 4PG7A 3O1LA 4QJ5A 4RYLA 3X1JA 4CBVA 4Z1OA 4PTZA 5HTOA 1CY0A 4GVXA 1PK7A 1VHWA 4HVTA 4ZHQA 5I8WA 1SOVA 4EUSA 4ER3A 3KYCA 2FLVA 3B1KA 3FTPA 5BYBA 5DSXA 3KZKA 4HGOA 2PSHA 1JF8A 2IHVA 2V6MA 4CQLB 2HRZA 4FDAA 4CZ2A 1WKBA 3KQWA 4FNMA 4NMMA 4HP8A 5BSGA 4WADA 1YU6A 1LI4A 3W7AA 3L0IB 2ILTA 1P2DA 2J4CA 3FLBA 2IYTA 2IWRA 1TE2A 4QBGB 3BF8A 1PSDA 3I6QA 1MTOA 4WD3A 2Q3MA 2ZTLA 1SQ6A 3EZYA 4H77A 3EVAA 2OV2A 4ND3A 4UUAA 3KZVA 4NYJR 5REQA 2XPCA 3E3OA 4OXKA 3KSDO 1I1NA 4FB5A 1DC3A 1MX1A 1EBFA 5L4LA 2E1PA 1HG0A 3GGPA 2PUHA 1Y5IA 3K71B 2G82A 1GLVA 2K5UA 3A6HA 1U31A 1A98A 3WSWA 2K6GA 1E64A 2FPIB 5A4IS 1P73A 3QVGB 1KARA 1PZFA 3LI2A 3U4MA 1U0EA 1JR6A 4IDEA 5ALNA 4IDOA 1R6BX 4E2YA 1K7XB 4LJLA 4UJ5A 3W9YA 2P2LA 3LFHA 4HKTA 1E8DA 3L1UA 3IIJA 1W5SA 2X9NA 1HYBA 4BBAA 3JZMA 1BFDA 3RTBA 1ULHA 2KLHA 2FZEA 3R6TA 4P3XA 5COAA 3OECA 3R3YA 4IIJF 4OFXA 3KVVA 2V7VA 5I9IA 4B0OA 3ADCA 2OZLA 1ZH2A 3IP3A 3TLEA 2REXB 3IP6A 5D84A 4NULA 4D9IA 4PSKA 4E3ZA 3MJRA 3OWHA 3HCFA 1ULBA 2QRQA 4RGQA 5AKJA 3LE8A 4KQFA 4DLAA 2P8SA 5LMNB 4F3KA 2IOFA 1FFXB 3K5IA 2XT9A 1ZITA 3I9MA 5E6SB 3OJ0A 1UKZA 1VYVA 2Y2UA 2IZ0A 4I5DA 4R51A 5EFZA 5C5CA 3QVLA 3LY7A 3W2FA 2CLMB 1PWYE 3WNVA 3VVBA 3LWBA 4M36A 1B6RA 4AMGA 3DL2A 2J0SA 5I5EA 1NFQA 1GTG1 1UKAA 3IV9A 1G291 2PS3A 2RKWA 1GSOA 5JQGB 3HDQA 1TCUA 3D8NA 3F5DA 4MW0A 2JRLA 4PAMA 4ZU1X 4BKQA 3CVJA 1MABB 1NLMA 1DTSA 5K7SA 2QZJA 3EXAA 2DUMA 1YZVA 2VJKA 1VJ1A 2JJ2A 4J3FA 3ZBQA 4YDHB 1JMKC 4WN9A 5CDTA 2PR7A 4FR2A 4J0EA 1YUMA 5CYOA 3OTWA 2GBGA 3C3JA 1E9RA 3NU1A 4URYR 1JA0A 2LVBA 4B4DA 3GHHA 3GJZA 1ND5A 5K4AA 1TAGA 4C6SA 1QIJA 5LXTF 1WSBA 4K88A 3ZCRA 2UZ0A 1WOYA 4EFLA 3I9FA 2VPPA 1M2OA 4YPFA 2HBQA 2CDAA 3C6MA 5DOZA 5IFLA 2PSJA 4HDMB 4PGFA 1UBCA 4DG9A 4QOJA 4B46A 2EWVA 2IHJA 5IG2A 4IZ6A 3DONA 4IPTA 1T3ZA 2CLFB 4W1PA 4R98A 2PUTA 5C8YF 5TF0A 5KWEA 3WZMA 1S6YA 3G23A 4AYTA 5IABA 4KIJA 2WF6A 4UAJA 3L41A 2ZWVA 3V8VA 5J1SB 3BWEA 2CJXA 1INLA 3E3LA 3V4SA 1ZRNA 1UXJA 2WHPB 4HRYA 4WZAA 2XDAA 3D8SA 3H3FA 1R4NA 3F1LA 3I72A 3L8HA 5IYZF 2RGNC 5BYKA 4RTSA 1XC7A 3E3MA 2A8YA 4BV8A 3EJWA 4ZO9A 1E59A 5E0OA 3PFGA 4CNQA 1X94A 3FGOA 4POAA 2QLLA 3OF3A 5K8TA 1AQYA 3KFLA 3EA0A 4BN5A 2WFMA 1A8PA 1Y8AA 2PS9A 1S2OA 1X3LA 2ZTHA 2QLJA 3WADA 4EW6A 5HS4A 2B1GA 3A1CA 4P54A 2WWVD 3EBPA 1ORVA 2IV7A 3UPUA 3B9PA 1QOPB 4R5MA 3PPXA 2YX1A 2A0UA 3H9GA 4QFMA 5AVTA 4DB2A 5EMMA 2ZYTX 2ZS8A 1DJQA 2XVZA 1OILA 2HJWA 3CZCA 4BGEA 1C81A 4ZAYA 4F9FA 1SXIA 2VK1A 2EGUA 3LKVA 5TLSA 2IJGX 1GV0A 1FUUA 1Z7BA 4XJVA 1AKRA 5FADA 4FW8A 3RNOA 5HEKA 2E55A 3IT2A 5ALPA 5D7NA 1T2UA 5GGYA 5LB2A 4GI7A 3HS3A 4XSHA 1IXZA 5FOSA 1M3SA 2IPAB 4JQYA 2Q3DA 2IXGA 2WYVA 3H1EA 4OOFA 5GM2A 5FI3A 4IJWA 1DEOA 3W5AA 1Q21A 1I3CA 1UL1X 4Z0TA 4F93B 3EOBI 4Q3AA 2PZEA 4NZNA 3F8TA 1IUPA 3MJVA 1OXXK 2OO3A 3CRZA 1EP2B 1RJFA 4BO6A 1GQRA 2PMDA 4WVLA 1J5XA 5H68A 3ZBTA 5F33A 1LNZA 4ID3A 2PBRA 5CCBA 3LBIA 2NX2A 1RI3A 3O4GA 1XTPA 3PC6A 3K35A 4NBLA 3SVZA 2GKOA 3CH6A 9LDBA 1MGPA 2W70A 3E9CA 1F0YA 1MO2A 1JZTA 3E7WA 2ZP1A 4L4RA 4LTMA 2ZQYA 4C0SA 1T5SA 1C14A 2BH2A 1KEVA 1UFOA 2OP1A 4HWSA 1PP4A 2XRMA 3CLHA 3GAFA 3MBOA 4RLQA 1TLFA 4UUBA 5EIHA 4B75A 2I67A 5C1PA 1M10A 3IXMA 4BQIA 2NT3A 3FY4A 4RPCA 2I7DA 2JEOA 2QRVA 2V03A 3IB3A 4L50A 1ZXLA 4JK3A 5ALXA 4BUZA 1FRQA 1UXGA 2N75A 2CMHA 4TT3A 1VI2A 1FFAA 2RIRA 4CWAA 1XXLA 3CKKA 4FEAA 5IUKC 1UMBB 1WZIA 4RTMA 4KQIA 4YT5A 1WMBA 4PLWA 4KQEA 1T9CA 5IK2A 4E7OA 3IEMA 3OESA 5KPDA 2SNIE 1RLUA 1JYFA 1QIKA 5JBIA 2Q21A 1CDDA 2GAFA 2XUQA 3EW7A 3HUDA 4N7JA 4WESB 4ZT6A 3VZQA 5LQRA 2XNKA 4Q0MA 1VZ2A 1OGIA 4Y8VA 3LECA 2DU8A 3FETA 2W6MA 5T4FA 4PYKA 2WA1A 3EFOB 5NULA 3AY3A 5FFMA 1U63A 3WLFA 1GUYA 1WWKA 5LUAA 2QSJA 1JMVA 1K9SA 1RYMA 4GLLA 1J49A 4Q03A 1AJEA 1M2OB 4O08A 5JH7F 1NVBA 4Q7LA 2FF5A 1L1RA 1F2UA 3K2BA 1W5FA 1ZJ4A 1PR3A 1V3QE 3LCRA 3OTQA 3ZE2B 2C3OA 1RKUA 3T6KA 3T5DA 3DGEC 1P91A 3LZ6A 2Q3CA 1TIKA 3KOWA 2F48A 1UQTA 4PVCA 4Q7MB 4E5DA 1V6SA 5LKAA 1WMEA 3WIDA 1ZCAA 4QGHA 3EFBA 5H02A 4AB1A 1FFBA 1GGJA 4XQEA 3RF7A 4C2AA 1U8TA 3C6BA 1FYVA 4P98A 4XWAA 3TB6A 1L3IA 3AHJA 3D5EA 1O58A 3CR7A 3DMDA 3PCXA 1R0XA 1VCNA 1FUIA 1N9ZA 1XP8A 1NR7A 4OU5A 3UB3A 1RKQA 1GKYA 3JQ9C 3QFTA 3IODA 5BXYA 4DDUA 1DARA 3H7AA 1LRJA 3LC7O 3PUXA 1N2EA 3IILA 4YQZA 3UANA 1Z39A 4YA6A 2P6PA 4TS9A 3DBLA 3KYDB 2ZJ7A 1WABA 3CCFA 4GUDA 3W2IA 4G07A 1J0AA 1X15A 2Q4BA 3DMNA 1AT1A 1VDMA 4JXKA 4OHFA 4KVAA 1KQFA 3ZHUA 4NNOA 1KAOA 2AK2A 5IJZA 4KXNA 5HF9A 2ZJZA 3WGUA 2VEOA 5DSTA 4DLRA 4EKYA 2IIPA 3BFVA 3GJXC 5L7YA 3VNBA 1DNPA 1RU3A 4MA5A 2VDRB 1D04A 2WYUA 4A8JC 1PFVA 2GNOA 2FVXA 2GN8A 3TL3A 3ZWVA 5A62A 4L3VA 1L0BA 1DKUA 2VYNA 5FCDA 4LHWA 2YOHA 3G0CA 1JHPA 1M6VA 1ZAKA 3Q1LA 4KNWA 3SJZA 4LYAA 4EG5A 5KTKA 3GLGA 3CF0A 3QHAA 4YFYA 2IY9A 3MINB 3BFJA 4LZNA 1AUQA 1MQSA 1EWKA 2X7HA 4E51A 3PDWA 8MHTA 1JIKA 3KQKA 4H27A 1HLGA 4X97A 1AF4A 1MB2A 2I6XA 5JFGA 4ZTUB 5KJEA 1ODFA 4TLDA 5IDVA 1RZRD 1JTFA 1X1TA 2QSZA 3IXQA 3NBKA 5GV8A 3VKGA 3VR5D 1FJ2A 3UGKA 4HAUA 3ZU5A 4BX0A 2HQSA 2WIGA 4JNCA 3AR8A 2HU5A 1VL8A 2QP9X 4O63O 5AP9A 5BR8B 2O5CA 4MEBA 1DADA 2FMIA 2Q6KA 4TVSA 1OGJA 2B0JA 4Z2AA 5CBPB 3W2EA 1CF4A 2GOYA 3WA6A 3LLVA 2JBHA 3CISA 5J5CA 2I66A 3DNFA 3N2KA 1ISGA 2IHNA 1IBMB 3ZDAA 1BD4A 2AN3A 4HF7A 1YTUA 4QNNA 4OUDA 3AY7A 4ZGGA 3WY9A 1E96A 3QV1A 3ZXYA 5K99A 4NFSA 2I2BA 1F51E 3AKCA 2G70A 1Y7PA 2PL1A 4QBIA 2B2NA 3GJ8A 4CIDA 3LBAA 4MA4A 3RAFC 1WA5A 3GLIE 3P9YA 3I4FA 1F17A 2R2GA 1GKUB 1V8DA 3GLSA 2VK2A 3FFAA 4IEEA 3DE5X 2CL7X 4FCVA 5DNDA 1QH8A 4DV0B 3EVTA 3LT1A 1QPBA 4XGNA 3BJMA 4RV9A 3ANNA 1OLSA 1IB0A 2CLKB 3D0OA 5D5QA 1G55A 1RXIA 2DWUA 3MTEA 4KDEA 4TXHA 3ZH2A 2H5EA 1PV4A 4DPKA 3GUHA 2VOEA 4Q9KA 1SEPA 4EGFA 4F0JA 2YHAA 2OCPA 4UAGA 4DV7B 2BF7A 4BN0A 4HUJA 2Z8XA 3KJXA 1H2YA 1L7EA 1T9HA 1I6MA 4YJGA 1GEGA 4P34A 1UJ4A 4XEUA 3AFHA 3QMPA 2XF8A 4LE0A 1LW7A 1XNGA 3KVYA 3WDSA 1V5EA 2HMUA 2WHPA 2Z04A 5I4BA 1JALA 4IWNA 4AYWA 1B15A 2O3RA 4KO1S 3UTDA 3JD2A 5T3UA 3WYNA 5IM4F 4DSNA 2ZYRA 3WGZA 2GM3A 2AN9A 3K0HA 1PEKE 2WW8A 3F96A 3IVXA 4RXMA 4AKGA 4E08A 1M1YB 3WLRA 5CFRA 4BNWA 4C7JA 1OV6A 4OPMA 4UJ3A 2I91A 2YJTD 1QSGA 3TKAA 4DNOA 1IOVA 1YQTA 4HNHA 1Q0SA 1UMCB 3T5MA 3LVRE 4OBXA 1ZD8A 5AI5A 1LBQA 3RS8A 1JHDA 1KH2A 4JLPA 3UB4A 5JH7B 3E9QA 5ESDA 1WZCA 4FZ3A 1L4KA 1EHIA 2BDTA 2C31A 5IS2A 3E84A 5EFOA 5K0FA 2A94A 1R88A 3G2PA 4N82A 4BMNA 2WSMA 4ZZ1A 3KSAC 5H8WA 1I6KA 1SCAA 3W5JA 1Y5MA 2H3HA 2V7XA 4G2TA 4QVKA 5EPUA 4EA7A 4BKPA 2ZUFA 1R7RA 2R8OA 4Y9DA 4W5QA 5ICCA 2WM8A 4LGVA 1GQ2A 1ADBA 1P3Y1 1T9ZA 2C2OA 4OQEA 4H6WA 5ALLA 1RFGE 3I8OA 2FE4A 1QKKA 1U2DA 1CERA 2HFJA 3RJZA 3BH0A 4E21A 4F3RA 1EE2A 4IZHA 1SCIA 1VRWA 1Z5GA 2ZSKA 5J3JA 3G5TA 3M5WA 1M74A 2C57A 1VE9A 2RB4A 4G6ZA 1CDZA 2O8VA 2GT1A 2ZS7A 5CLHA 5GP1A 4CF6A 5HZGA 5I4CA 2EZUA 1ES9A 2H1VA 3OUUA 3R7DA 3TYXA 1VZ3A 2X5NA 3OOHA 2C2KA 3GN2A 4IOLA 2FPMA 4Y9UA 3RIEA 3Q8KA 1KA9H 3PIIA 1WUKS 4U39A 1U2SA 4PFKA 1L5HB 1EE1A 3GLHE 2E0IA 3OJLA 1E6CA 4EH1A 4WOJA 2WF7A 4BAZA 3HSYA 3KM0A 1RQ7A 1RR6A 3PQ6A 4G89A 4IDQA 1LNQA 4O25A 3RB8A 1V5FA 2C2GA 1RXEA 4L6AA 4RYDA 3R7BA 1U0GA 1MV5A 4CM1A 5KOHA 3WVNA 1YZUA 1Z6QA 2BM9A 4XM2A 2P1DA 1TUIA 2D2VA 5DVZA 2JI9A 2NVUB 3WJ1A 1LX6A 5ALMA 4ZI3A 5B7QA 3V4OA 4MV6A 3WK7A 1P77A 1Y4DE 3GA5A 1SUFA 5EWLA 1WDMA 2MMCA 3GWGA 3TQQA 3E9EA 3IXLA 3KWJA 1K2WA 4RH3A 2IXDA 3IEXA 1T6YA 2QXUA 1ZK1A 1GZ3A 2RC6A 4W9MC 3NZEA 4B6PA 1N9GA 3ZDDA 3AU9A 2DF8A 4O33A 2PD6A 1KIAA 3HA7A 4LTNA 1ZMTA 1B6TA 4J7AA 2O3TA 4MEAA 4OLAA 4AX4A 1TK9A 1FTWA 2P3QA 3OCUA 3VJKA 1JEAA 2B3TA 4JLKA 5DB4A 4OQZA 4YH1A 3ME5A 1Z28A 3GAMA 3G2IA 3WMFA 1JDBB 4ZO8A 1ZH6A 3T3EA 1Y34E 1VCMA 1FYDA 5EMJA 5B3AA 4PN3A 1KSHA 4I1SA 5CT5A 3AESA 1RLJA 3LWZA 4TZ0A 4XCQA 1KI3A 5A3RA 1YOVB 1IG3A 4AY2A 3AM4A 4TMZA 4YLGA 3AUKA 3UXMA 4JUIA 2QTBA 4ZARA 3QKRB 1HV8A 2UXDB 2BBSA 1Y98A 2XEDA 1ORRA 3DDNA 1TKAA 5CT4A 5HOQA 3LTNC 3DE1X 4CIAA 3QVOA 4OQXA 4FGLA 4IY1A 1AGRA 3EIXA 2NSDA 3BS4A 2FUKA 4LXTA 3TUIC 1N3LA 3U0BA 4A8TA 1YQGA 3ZHRA 5CCEA 3KEMA 1RCUA 1WD5A 3P0HA 3AKDA 4L4SA 1NLUA 2WB4A 5E7MA 3QX7A 5EOVA 4ZOQI 5JYDA 4C14A 1DJMA 3EARA 4RHTA 3INGA 2HL6A 1VL5A 3MTAA 2NO5A 1SZCA 3I6IA 1ZMOA 3KB1A 4JHLA 3T5TA 2HDWA 1PQWA 2JIRA 3P5SA 4P53A 1ZI6A 2VWPA 2I7TA 4ERNA 6NULA 2FPOA 3BREA 4EHAA 1GRVA 3OJWA 1VBNA 3HDJA 4KACA 2R86A 1V8OA 1MN6A 2VVTA 3LS2A 2X0EA 4B4UA 4MK4A 4CMKA 4MR8A 5GMOA 3R3VA 2Q5JA 4PPNA 4QPZA 4DHEA 1YQUA 4MGIR 3DKVA 1PEAA 3I5XA 7MHTA 1KSFX 3CM0A 1DJNA 2AMLA 2Q6IA 2VDUE 4ZTBA 3C6XA 1ATZA 2DQYA 1DFIA 2BJVA 4S35A 1AUXA 4S24A 2DULA 5WRFA 4QYMA 4UHJA 4ZT5A 1T2EA 2WTXA 3L01A 2E5FA 1G4HA 5C1IA 4BGDA 2PMKA 2ZPAA 3ZI7A 2XMCA 4XD7D 5KTOA 4KUEA 3PNBA 2XTZA 4PYLA 5B3KA 1A2KC 2CD7A 2VRBA 3WGMA 1UADA 2AIRA 4DQ0A 4CCYA 2JD2A 1WPQA 2GPJA 3FCAA 4RY8A 1Q11A 3RG8A 3B7PA 2VYVD 3HLYA 3DYBA 5A9SB 1ZIOA 4D4IA 2XUKA 3KKQA 1A5AB 1Q1AA 5D5PA 1VRCA 4PZLA 5TGTA 4RY9A 3FGPA 4F72A 3E2MA 4MHSA 1SXJA 3ROPA 2X7XA 4H4DA 3BIOA 3S2SA 5HQ3B 7ABPA 1GPH1 3EPLA 1UCFA 4UULA 1ENYA 4MGYR 4IKEA 4BZQA 5IDXA 5KQSA 4HAIA 3ETHA 2PNFA 3SS9X 4L0DA 3WK5A 4D3YA 2IWHA 1U7DA 4HUTA 3AM3A 3AEUA 2CT8A 4AY6A 1PV2A 2BOVA 2Y1FA 2CDNA 3INTA 3IEVA 4I4LA 4Z7OB 5JVDF 4OLHA 3H4IA 2UXBB 2XOKA 3W9UA 1QORA 1KNXA 2JGIA 2FZLA 2VJDA 4MV4A 4ARSA 1I1QB 4GWGA 4JFRA 3K0KA 4D3DA 4FWIB 4ENSA 1JZQA 4OHKA 3R7WB 3SS8A 3UY4A 3QYPA 4NU5A 3UYLA 3ZDRA 1KI6B 5ESWA 4S05A 4QTYA 1PG2A 1Y7HA 2B94A 3DFKA 4FMCF 4KXLA 4Y7CA 5IT0A 1EK1A 2ZYGA 1TZKA 2AS0A 1U7OA 2X6TA 3BJEA 3G13A 4D45A 4ZHSA 1C80A 2W6JA 4Z4CA 5G0UA 4QKQA 1ETHA 3TBKA 1GTZA 5CYGA 4A2WA 2WF5A 4N0EA 4TKMA 4RZHA 4U2FA 1QYWA 1XQYA 2WFLB 2HH9A 1EFVA 3AQIA 1X87A 3OZIA 4G5SA 2BFOA 4F3NA 4XUCA 4EG4A 2AW5A 2Q2WA 1L4GA 2AXEA 3FJOA 3QXGA 4K6OA 4LV8B 3BVPA 2CKDA 3KZNA 2QRJA 4XVQA 5BVGA 1QHHA 3RYFB 1S02A 2VDKB 5CIWA 3SIWA 3O26A 3SIXA 1EUYA 2JFWA 2D13A 2BP7A 2EKPA 1SAYA 4PCAA 2PRZA 1WXFA 2HT1A 2DB3A 3NYRA 3U6BA 1W36D 3OMWA 2YXLA 1NC3A 1G98A 1US8A 4NJEA 3I9KA 3D6NB 4MYHA 2FW8A 1U1GA 5EZQA 5I7WA 1NQOA 1YSCA 1Y1SA 2P2CA 3ABIA 5ESRA 3S70A 3VTZA 3R0IA 1PK8A 4F1WA 1GU1A 2PUAA 4MQUA 4UHEA 2AL7A 3U9LA 3ILSA 4F46A 5IXSA 5FV4A 4DUPA 3ZWYA 1GG9A 3EXIB 5KINB 5J5VA 3SMQA 4D74A 5CM9C 1ZK4A 4J1NA 1SIBE 1HWYA 3GCGA 1Q22A 1REQA 4GBGA 5JNRA 2GD0A 1G5RA 4JC5A 4JLWA 4CL8A 4FWTA 1BVRA 4OATA 4L9WA 1DTWA 3A4MA 4O2BB 2FE1A 2YINC 2R9VA 4XQ9A 2IU3A 2P6OA 4CR8A 1FA9A 2FCRA 1LVGA 2ZCUA 3OO0A 3HVJA 5EWJA 3A58B 5E3IA 2FDXA 3D2CA 2VP4A 4LJ7A 4X1YA 2Z8YM 5D51S 1KE1A 3K0FA 2ODPA 2X6QA 4FR0A 1VHQA 1N4DA 3H87A 1P80A 4GR4A 4AWXA 1TKBA 2NNLD 5E3HA 1O03A 4ZVVA 1IWBB 2NZVG 2QNIA 4GLFA 4Q9JA 1AXGA 1NAIA 2MSWA 1BHO1 1IC6A 1TUGA 2JJ1D 2GSDA 3OLVA 2ZRMA 4IUCS 3I53A 1FRFS 4LRYA 5LA6B 4W8OA 2FWIA 3SJAA 1S2DA 1CUIA 1D2RA 2CFCA 3DM9B 3OQJA 2H4WA 3EXHA 1NJ8A 3FD8A 16PKA 2DFLA 2D54A 4FD3A 5FTJA 2P79A 4RZ3A 1UMDA 3AG6A 3UG6A 4BZPA 5HSGA 3EGEA 4ON9A 4QA9A 3U7FB 1QHEA 3NGXA 3OM1A 3OQHA 2BFAA 3BMQB 2XZOA 5EUMA 4MWZA 5CPFA 3OQPA 4AO7A 1AK9A 1DZIA 2GXAA 4ZP1A 1IEWA 2AXNA 3C5WP 1F7UA 3FUWA 4YJ3F 1FMFA 4OBEA 1O8BA 5HWSA 4O0MA 2WFAA 1KDTA 3E9RA 3MIZA 4XR4A 1T36B 2ARKA 2AH5A 3KLMX 3PC8A 1U3WA 5J2TB 3S8EA 4OQQA 1FLVA 2B3DA 3EEIA 5JARA 4KXVA 3T7TA 2O0HA 3JATB 3QPAA 4E1VA 1SKAA 1WPRA 4LHZA 1DCTA 3AEUB 4Y67A 3OEEA 1LSUA 1XG5A 4CT5A 2JLWA 1UFVA 4W1SA 5FNVF 3LK7A 3Q7IA 1N2IA 3REGA 1JR3E 2AV6A 2M6RA 2PFSA 3A0RB 2ZI3A 3KKKA 4NOLA 4BRWA 2QU7A 4EUNA 5E6UA 1GAEO 4Q00A 1GVNB 3ETJA 1GCIA 4GOKA 5FORA 4WXRA 1XD8A 2RK6A 2XUZA 3LUBA 4QGBA 1OLXB 3WSTA 4F06A 4P35A 2FHPA 4ZCMA 5MN5A 3VI3B 2PKCA 1B2RA 4NLLA 1MJNA 5HCUA 3F7NA 3MWFA 5CG2A 3F9IA 1N1DA 3PXEA 4L8WB 3OHSX 3IA2A 1YJ5A 3GBVA 4N4AA 1KS2A 1HY3A 2FLKA 1J5PA 1OCEA 1Z0JA 3HB1A 4NK4A 4PC1A 3SX4A 4D8VA 1P4HA 5JI2E 5ED4A 1V25A 1BU8A 2RHMA 1MC5A 2JLXA 5LDDC 3GC6A 1RWBA 4YRKA 5JDCC 1NQWA 4Q9NA 1QIFA 1ULTA 1P29A 5SZJA 2G63A 1O08A 1PS0A 1Z5ZA 1PNQA 2FJPA 1ITZA 1KPHA 3R40A 4B7ZA 1TDJA 2UUAB 1UKCA 1FZQA 4E0BA 2PYDA 1XZKA 2X5KO 3MCAA 1I8TA 1NYQA 3ROTA 4DR1B 3FHLA 1EUQA 2C4TA 1SXPA 2EF1A 4GPTA 3K6KA 3OE5A 2LE0A 2P3OA 1VE7A 2QQGA 4JVSB 3DQZA 3A3NA 3IVGA 4MKFA 4XQ0A 2CXSA 3OFSA 1P2UA 3D59A 3F6RA 5FB3A 5FHRA 1QUFA 1RXYA 3KAPA 1XCGB 2JLYA 3FYUC 4MGEA 3IRVA 4P08A 3WIVA 1YZKA 2LZ0A 2PWYA 4EGAA 1CP2A 1MNQA 5DBHX 1EZ4A 1R0WA 1R8QA 1T5DX 3G0OA 5DU2A 2K87A 4ZYLA 2J6IA 1APBA 3ZWQA 5K3SA 1Y9JA 3AVQA 4BO5A 1Y5LA 2H59A 2H85A 3IDSA 4CQMA 1SVKA 3W3AA 2NO1A 1A95A 4NX2A 1YBHA 1XMJA 3BSWA 3D02A 2LDXA 3VR1A 4QYXA 4CKBB 1DTWB 2P5TB 4CKEB 3GLHB 2NZUG 3R3HA 3W3AD 2BGGA 5FOXA 4Y2YA 2IHYA 3KZMA 3T1VA 1GKLA 5F1OA 4C7XA 1NNSA 3N0XA 4IMIB 5T8KC 1KSJA 2YKGA 2QJFA 4MP8A 4YQEA 2A59A 3D7NA 4GRAA 3SBDA 4DCNA 1E0AA 1YTLA 3Q8MA 3QVVA 2OV8A 4PQRA 1W59A 2XDWA 4KX5A 4M55A 3IIMA 1RTKA 3G0BA 3HRIA 3TTXA 4JT8A 4C1NA 4M9XA 1GL3A 3NW9A 4DSTA 2QBYA 1K0FA 3J7AC 2GZRA 4IDNA 3G2KA 3VU9A 2OVBA 3CEPB 4RQUA 1HDRA 1QVRA 2P3SA 2FW1A 2CN1A 3BQ9A 2OFXA 1FP4B 3W5IA 3PRKE 2WSLA 3DTVD 3FRIA 2ACVA 3EVDA 1NKVA 1JZSA 4ZRNA 3Q7QA 5BQOA 3LXXA 4INAA 3KOXA 1HRKA 1TC1A 4LVNA 3G2OA 2OHJA 4EI7A 5JCJD 2Q5LA 1CEXA 2XQFA 2H1FA 2VLIA 3PUYA 4O8CA 3GVIA 1KOLA 3ZCTA 4DABA 2HK8A 4ZTZB 3UJ8A 2QTVA 4I1UA 1UQRA 1QH1A 5AI0A 4MWGA 3SOPA 3DUFB 3PUVA 2QI9F 1ZMXA 4P7GA 4CMJA 2CLSA 3GZTB 1LFDB 1UR5A 1X7WA 3FJYA 3MCVA 3NKFA 2XMQA 3E7DA 3NS7A 3PR1A 3MWDB 4L4UA 5GJCA 4AU1A 5ARDA 5K2MA 4M89A 3Q41A 1W93A 2GCEA 4P4LA 4BNGA 2A5LA 1DHTA 1SXJD 1NBIA 3KTOA 3EQ9A 3NBXX 1QFZA 3OZVA 4KR0A 1WTCA 4LXUA 4JASB 3UPTA 1DO0A 2ZE5A 1CBUA 3F4LA 1POXA 1I7PA 5DJ5A 2QTTA 3OZCA 5FL3A 1Y1KE 4BIMA 5KC9A 2AE2A 4ZZ3A 1MQAA 1EM8A 2ZJ3A 3KWFA 2X13A 5EVJA 5EUBA 5FXMA 4NXNB 5LVAA 3DZ8A 3H9CA 1YBMA 1EVQA 1G7RA 3FWKA 3KEOA 2O59A 1U0JA 5BOSA 3BX1A 4KPYA 4L78A 4ZQBA 4TM8A 1JJIA 1YFZA 5E2BA 1H3NA 3QPUA 1CQIA 3H5LA 4JUDX 2G0AA 2CWWA 1I4LD 1OX4B 4RDXA 2GM9A 5C81A 5BRJA 2JATA 1O9BA 3EUFA 2F1RA 1BXGA 5DRYA 5EHXA 5C52B 1T9KA 1JHUA 2NO4A 5A9SA 4TWAA 3CRVA 4FBLA 3GRZA 2RGXA 4YAKA 1KZ9A 4B2YA 4LDPA 1S8OA 3Q12A 3QELB 3LVBA 3WLLA 2HA3A 3I58A 2QYHA 5DHQA 3PNYA 2PH3A 3OOYA 5HIAA 3OIVA 2C20A 3EBOA 3WLAA 3OLCX 2SCUA 4BJ5A 4BV3A 4AMUA 1V96A 1P0IA 1IE3A 1Y80A 3T4UA 1ZL0A 4WESA 2J59A 1M2HA 2CBZA 3NEYA 4MRSA 1YUNA 4UDYX 4ZPJA 3Q11A 3L2OB 4HG2A 4IDGA 4NMWA 3RVJA 4IH9A 3BHJA 3VC1A 2O3JA 3O2QB 2ERCA 2IDMA 1NVEA 4J3NA 3SNKA 4JQZA 4ZHQB 4R1NA 1VI6A 1J8MF 2C94A 4Q47A 3IA7A 1U0HC 4U7HA 5DM1A 1VMKA 2OXRA 5T6MA 5IKOA 4OG2A 2H65A 7GPBA 1AQ6A 2Y05A 3OM0A 4G37A 4GG1A 4DQDA 1U8XX 1KZ1A 1XQVA 2HQ1A 4LYHA 3T7IA 2AHRA 1VKOA 3PU6A 1HKUA 2Y0DA 1I32A 1HTWA 2WYHA 4BE7B 3ITEA 1CW2B 3KQVA 3HGQA 4YREA 4UATA 4UM9D 1X77A 3SSMA 1NHGA 2CHFA 2W4IA 1ECCA 1XN1A 1UODA 2HO5A 4X1IB 5DTRA 4D9GA 3DC7A 2GN0A 1ZN9A 1SBYA 1TIBA 2P40A 2REBA 2F4NA 2JVJA 3CYFA 3N59A 4KXXA 4DIDA 4CN8A 3B6ZA 3M89A 5K6RA 4QRIA 1JAZA 1R12A 2I22A 3AVOA 5LZ2A 1D6SA 5F4BA 4QBHA 2B1JA 1EESA 2ET6A 1BCSA 3ZV3A 4DM7A 2BP7B 4GGOA 4NYIR 2IZ6A 5IN4A 1EVZA 1F5SA 1TA9A 2WI8A 2ZYDA 3WK4A 4RPKA 2J30A 4LFAB 3IKVA 4QBFA 1A1VA 3V8NA 3BXGA 2P67A 3QMWA 1F2UB 1J20A 1UBUS 1MA3A 1S3SA 3BIFA 4NMLA 5IT5A 5LMUB 2LCQA 3UKDA 3RJTA 3FNQA 3DBLB 3L1KA 1D7AA 4KR9A 1TF5A 2FVYA 2GPNA 3GRCA 1SFRA 4KC0A 4YONB 3OIUA 1K89A 2C7VA 1ISJA 1MFZA 1ADJA 2QVCA 2JGKA 4WSOA 2OHIA 2HPVA 2GGSA 4G09A 3MJDA 1ZO8A 2D5CA 3B6KA 2Q1SA 2SKEA 4P5PA 2BEJA 1UBMS 3VR2D 2QTWB 4QTZA 3TE6A 2YWDA 5KSZA 4TYYA 2JJ2D 4QBKA 2DTDA 1CNEA 3RTCA 3Q3VA 3QKTA 3D7SA 1CG6A 3KOZA 2Z08A 4D0LB 1M0TA 1U1FA 3VTKA 4F5YA 3LIPA 3QZUA 1SCUB 3IHKA 2ZI7A 4KQ2A 1WV1A 5DHRA 1AQJA 1OZHA 1RSZA 3WE7A 3FF4A 1V16B 2WT8A 4FHDA 1VPWA 1MFPA 4ARCA 3W5HA 2AOUB 5BUCA 3TXYA 2EJWA 3MHPA 3L1IA 1ZK0A 4O4HA 1TYBE 2GEBA 4BXOA 1Z8FA 4OYLA 5JXIA 4Z5XA 1QFXA 3L1HA 4D25A 2WTMA 1ULSA 3GJ6A 3Q40A 3BFXA 4G0QA 1O0CA 4IDPA 3UK6A 2BF4A 5INTA 3ZS8A 2D74A 1HBJA 4BP1A 2YUIA 3L79A 4FHEA 1BG6A 3BXPA 3GIWA 4OKIA 2JGJA 1EUDA 4TV9F 2XSZA 3GFGA 1T43A 1RWNA 2I54A 3VVMA 1V8ZA 5L4NA 1K9VF 3IUPA 4P0PB 3U7HB 2NXEA 3I64A 4LOHA 1I51A 1QLWA 3RSOA 3DM5A 3WFIA 1UPAA 1D5WA 2XYVA 5CFMA 2KB0A 1HA3A 2QVZX 4PAOA 3HG7A 4XWTA 3RSHA 3ZJ5A 1IJFA 5CH3A 1YBAA 3SYKA 5AK3A 2YBEA 5LBUA 4IJQA 4PYJA 1XLVA 1EFTA 1MLDA 5CB0A 2PV7A 3WL4A 5EJMA 3X1KA 4BLWA 3ZD7A 2OILA 3SHFA 3MTQA 1C3LA 5A04A 5A05A 1NBME 4WK0B 2Z83A 4C78A 4U6NA 3ZDBA 2H52A 3WA7A 4LZJA 2QX6A 5CDUA 1IBRA 5T4EA 2FA9A 3HV0A 2G1JA 4PQGA 3WV4A 4ENVA 1VYUA 4WZBA 1I3MA 4LHYA 4N01A 4EJ6A 1X2BA 2P78A 4JLVA 2C7BA 3VTFA 1QZZA 621PA 2OQIA 2RCNA 3QEKA 4JEIA 1P74A 3IBSA 4EG0A 5TY0A 1NR1A 3LC0A 3EEOA 2R6AA 2GA9A 3TINA 2R85A 4GOLD 1GAXA 2B8EA 3QU5A 5FP0A 3UV3A 1H2FA 4DNFA 1PG5A 1QX4A 3N0WA 2MHCA 4G24A 4P4SB 4ZU6X 4CDRA 1L7BA 2V1XA 3NWEA 3QYJA 4KZKA 5H0IA 3GU3A 4N54A 4L9AA 5GONB 3BTUA 3PDHA 1JLHA 3SEQA 1IY1A 1P7PA 4AG5A 4O2LA 2OXTA 3AVWA 4IXMA 4RZXA 4DEXA 1KY2A 1NRJB 1XQ1A 3V00A 5IMSA 1PNRA 1TOAA 1WCIA 1IN7A 1X7YA 4CU5A 3RC1A 1XHEA 1UDXA 2DWCA 4PCLA 2O1EA 3HJRA 1C9JA 1E3SA 1DXHA 2G0NA 3GCDA 1F20A 2JARA 2R6DA 3LYUA 1OYVA 3MC1A 3PGXA 2J7KA 4RX1A 3OOEA 3SDSA 3ZCVA 4ERXA 2GD6A 1TCCA 4ZYWA 4B3FX 1UMCA 3V4LA 4HVLA 2WK1A 4OAPA 5LXTB 3AUSA 1TTPB 1Z7EA 4JZYA 2GEJA 2QIPA 2QL6A 1KOJA 4MV8A 5CYPA 1ULAA 2IS2A 3VPFA 2ASEA 2PD4A 1WUHS 3MJFA 1ZNQO 2WHYA 5EQJB 1ZIDA 4FFRA 1FLNA 2J9RA 3CRW1 4U2CA 4IOJA 3PX3A 3DE7X 3Q7PA 1DAPA 1W36C 3Q3JB 3TMKA 4OQLA 3DZJA 1PNOA 4AFNA 1VQ1A 1UBRS 1GQSA 3T95A 3C5EA 2OZPA 3UJ6A 2SKCA 3NT5A 2GESA 3T1OA 3B8HA 3HXLA 1R5NA 3EN0A 4WKCA 2QVXX 3BGSA 3TNDA 2W48A 5LOVF 1R4ZA 1QC5A 1LC0A 5LJLA 3RABA 3QLUC 3C6YA 2CNKA 3PRYA 2RDMA 1GGVA 3SHQA 3ZV6A 1UZMA 3PDJA 1QRRA 2J3HA 1IDN1 4MYRA 2QRUA 5EIOA 2RONA 5HTKA 4ZGWA 1Q1BA 2ZB7A 5BQFA 4BJ6A 3TPCA 1ZN7A 3EH2A 5CXQA 4HWGA 2HRQA 5I47A 4I6GA 2HO4A 4IIJB 3GVPA 1SVOA 2IYZA 1NP3A 1IN6A 1TM5E 2H5LA 3ZY4A 1SN7A 4XFKA 5LC1A 5DX8A 4NCIA 4BKOA 5JMOA 5C32A 4QEKA 3PQ3A 4U6QA 3KQTA 4QEZA 2QJRA 4YB8A 1JEQB 3L0OA 4CIYA 1X8XA 3AJEA 2VNAA 1RCTE 3EC2A 4JP2A 1F3OA 3EG9B 3NB0A 3P9XA 2ZWOA 1U8YA 1UKVY 1VP3A 2CJYA 3MS4A 4YUVA 4AKEA 3JYQA 2QKYA 5LP6B 3GFTA 4QWMA 2SBTA 1JDJA 3NHRA 5DXJA 4H1WA 1GCGA 3H84A 1T0HB 4IIEA 3C85A 3FUXA 2ODTX 3TDMA 2WDPA 2VQSA 1BAPA 2YVAA 3AB8A 3K4QA 1PR1A 1H5NA 1KGSA 1Q14A 4Q1FA 3W4IA 4Z7JA 5AXDA 1R3DA 1XLUA 5JIBA 3A4IA 3JZDA 2C5AA 1KL7A 2PS0A 2QD3A 2NPOA 1IRIA 3ZG6A 5AKLA 2F59A 1LQTA 3DCIA 5JAHA 2PE5A 4KO8A 3Q3CA 1KK0A 2JLRA 3EPKA 3C3DA 2R6ZA 4IOKA 3SEAA 4JJAA 1Y8ZA 5IJAA 3AR6A 4RS4A 4B6FA 4MA0A 2WJZB 1EE9A 4HDKB 1PQUA 3WIUA 4MRPA 3K8QA 1SZJG 2V7GA 3JQCA 3V8QA 1UDRA 2GYUA 4RL4A 5DYNA 2H9AA 1A9TA 2OORA 3EXG1 1TB4A 3F5FA 3FGZA 1NVFA 3PVCA 1P1HA 3PXGA 4E31A 3L7MA 1SCQA 2J3DA 3CW8X 5A3SA 4HH1A 5ALIA 4I8XA 4G1VA 3LC1O 1NJ1A 5JRZA 3UMYA 1CY8A 4MYSA 1DC5A 4IP0A 3VHQA 4HS4A 1N6LA 2OD7A 4RV5A 1JG7A 2P9FA 3UQZA 4TV8A 5BYJA 2OC9A 3MIIA 4Q02A 1XTUA 1BSVA 1DCFA 1KAHA 4P2GA 4D8WA 5EWMA 3WLNA 1DL5A 5MF6A 2G1KA 3A6JA 5IC4A 1GCOA 3GAZA 1Z75A 3LZDA 4URVR 3RUHA 4RVNA 3ONVA 3KNZA 3P2JA 1MHPA 5JJCA 2FFBA 3H8WA 2AWOA 3N07A 2ZVQX 5IDWA 3THWA 1KK3A 2JVKA 2II6A 4NPHA 3COPA 5MN6A 1W4RA 3PFCA 3IX7A 3EZGA 3ND8A 4FDVA 4U02A 5CLGA 1CUBA 3ZJYA 2OCGA 4D97A 4ITUA 3MJ4A 1PZGA 1ZGHA 1G6Q1 2OB2A 3A0UA 4OGFA 1OH8A 1I13A 2VF8A 4ZOAA 1LVHA 2NQ2C 2OSVA 3QV2A 2XZLA 1GV1A 3NVAA 2WU1A 5CJJA 2CFTA 3Q4GA 2VKTA 1HYHA 1YDEA 4YGYA 1EQUA 4QXMA 5BQXA 1N5LA 2BHNA 3P2YA 1QG0A 4ROTA 5A9RA 3LJKA 3QEMA 2EGGA 3OC6A 3PR3A 1U81A 4O4HB 4F8JA 1ZYUA 4EO4A 2FQYA 3OIFA 3D0RA 4MVJA 1SKQA 1U2QA 3C8HA 2WOOA 1KMHB 4D0GA 5IN5A 2BY4A 3IULA 2G28A 4XR9A 3R0JA 4RD6A 2H2WA 3HDTA 2G76A 2AX4A 4MWTA 4NNPA 2PKYX 3FPCA 2A9JA 2NSJA 3GH3A 3ZIDA 1GITA 1VGVA 4C1BA 221PA 2F7SA 2IYSA 1G8FA 1DCMA 2OM6A 3WB2A 4M9ZA 1ABBA 1M2GA 2FK7A 3UAZA 1MW8X 1ZUWA 5ADWA 4DA9A 1OJLA 2H16A 4HADA 4FCTA 3FFBA 2ZJBA 3PB3A 3LT0A 4JJFA 4NMXB 5JT1A 2YWFA 3H6KA 1TD9A 2EFEB 1XVIA 2H07A 2NM0A 4G97A 4OGKA 3A3PA 4U5QA 2W22A 5FWAA 5IAEA 4AG6A 1T2DA 2D8AA 2IYNA 2YXPX 4FUTA 5BV7A 4BAGA 3IEUA 4G9GA 3A2MA 5HQ3A 4B83A 5F9HA 2BBTA 4ZJZA 1MPXA 2Y9PB 3M4XA 2Z2IA 4GYYA 4DV4B 1TO1E 5SYAA 5TDHA 5JDIA 1XMQB 1Z17A 4TSRA 1XRLA 4IDFA 1MBZA 1XKXA 3GQVA 4OI2A 2QMYA 3B6JA 3DZGA 4G25A 2GCGA 1KE2A 2Y0CA 1X1CA 1WCWA 4D5GA 1KS9A 3KJQA 1XDWA 2GEDA 3AERB 4JT9A 3U1TA 4TVKA 1Y6JA 4AJHA 3ZVMA 2DFVA 5ALQA 5FKJA 1ISFA 1GU0A 1J23A 1EKXA 1P39A 2BMDA 4J75A 2VSQA 1P4SA 2VJBA 3QVMA 2A3RA 4KP7A 4O5OA 5A5VA 1LD3A 4NH0A 3U7EB 1WLYA 3BGWA 5AD1A 3G5AA 1GFZA 2VRCD 3JVDA 1YASA 5FWYB 4CG1A 1Z4PX 2G80A 4G0XA 4NJEB 5EZYB 1VPEA 1U0OC 4FX5A 4F91B 2P65A 2I34A 3R5KA 4JU9A 4KWEA 5H81A 4E1AA 1JEYA 1NUPA 3P2KA 5IAOA 3KZCA 1T4GA 2CMFA 1H4TA 4IFBA 3P19A 5K0ZA 3AB3A 5EESA 1O94D 1ZM2A 4EJFA 3NBZC 1Z37A 5L3SB 4X8MA 1JH8A 2EYUA 2YWBA 4NABA 5FEMA 3TEFA 5CFLA 1XEFA 2CHUA 2ODAA 5L3RA 1BN6A 2W2MA 2I76A 2XNCA 3NRJA 2NUAB 4X7PA 2WSIA 1JIVA 1AUVA 4UZEA 3RHFA 1ZI8A 2JB9A 4KVGA 3TPZA 5LXTA 3F49S 3HBJA 1KTVA 3ZU4A 5JFTA 1V47A 3K8ZA 4QSHA 5EQFA 1OFUA 4HXEB 4EFKA 1H1DA 2BTOA 1KXJA 1US8B 1TAQA 3CONA 3LWDA 3FJ1A 3WKCA 2QL5A 2ODEA 5AOVA 4C9BA 1E5VA 2BJHA 3GJ5A 4JC4A 1GL7A 2W83A 3ILXA 1A8SA 3ABOB 4TN1A 4X85A 3VDRA 3I34X 3EVZA 3K9HA 5KSWB 2OHOA 4WUTA 4YO8A 1U5AA 3AP3A 2O2SA 3VDNB 1K08A 1E2BA 1EVJA 1E2HA 1OHHD 3EB9A 1A9XB 1NW9B 2PVCA 4JD5A 4LDQA 3TZ6A 4DG5A 5DNEA 4X95A 5F2OA 3U7QB 4A91A 1JR3A 2IE8A 1C8VB 1T26A 3TZHA 1KYQA 1POWA 1RHJA 2ZIVB 4M8LA 3HDVA 3R6LA 1IJEA 5DF1A 1JQLB 1UF9A 3PDIA 1C9NA 1N92A 3ZWOA 1U7PA 3I09A 1XYGA 1JFSA 3IQZA 3FNHA 2G40A 1P5FA 4JUFA 2HXGA 3P5BA 1GA1A 3BE8A 2LV8A 2WG1A 4FT4A 5E1OA 1KI7A 2Q62A 4MMXB 4BFSA 4BQRA 3OCCA 4F97A 5LQAA 1BO6A 3H16A 3L84A 2P9GA 1CY6A 1JG3A 1YS1X 3KAQA 4GPIB 3WAGA 4GIBA 2AG6A 4LOLA 1S2IA 2FEOA 4EW1A 1YFJA 3B12A 2RH4A 3Q6MA 1XZBA 1OFVA 2HMVA 3M5DA 4A8JA 1WV0A 2H18A 5FWXA 3G2NA 4M83A 3U3KA 3VZRA 3NT2A 4M4SA 1EWQA 3P4YA 3ESRA 5CBPA 4EATA 3K4HA 4E5VA 3ZK9A 2X3FA 2F1HA 2JJ8A 1T6BY 2A2ZA 3HVRA 3RUDA 4HT3B 5HF8A 4D7AA 3ZZTA 4B5LA 3IPRA 4UE6A 1N5IA 4L7VA 2WAAA 1B3RA 1ULUA 3EVFA 2J7PA 1GTJ1 4KIFA 1Z5OA 2H08A 1WZNA 4LK2A 1E2QA 1LLQA 2JCBA 2O48X 2QX7A 4FIDA 1NF8A 3AKYA 1DEAA 3AGPA 4F5EA 4JJIA 3THXB 5LM3A 1JBKA 1L5WA 1VHDA 2JIPA 2NQ8A 2PRYA 3M4ZA 3PVZA 1IVSA 4ZVRA 3UAOA 2FSGA 3RC2A 2Z4TA 3E9ZA 1TT7A 3DT8A 4EY6A 4GVLA 1Y1TA 3ZR4B 1T9BA 1UM9B 2QVYX 4HLNA 1JNXX 4HH0A 3B1VA 4OHXA 5DSZA 4ZO4A 5CB4F 1JLMA 1J1IA 1QYRA 2WUEA 4U4AA 1RRCA 4N47A 2IXFA 1CY2A 1SD5A 2C5LA 3C3YA 1YR2A 4CMCA 5HQJA 3QVUA 4PC2A 2HYIC 1N2XA 2H29A 2DT8A 3ADPA 3BAZA 2RB5A 2AOXA 4IDAA 4FJ0A 3TKYA 3UAGA 5JMPA 5BRAA 3SIRA 2BONA 4WLEA 1J00A 2AEFA 5SYMA 1OFGA 3CLTD 5TB5A 1OUMA 4IIFA 3E7XA 1S3IA 3COZA 2ISQA 3KPUA 3AFMA 3N6XA 3UJNA 4JWKA 1Z4IA 1C1DA 2FWRA 2XIQA 4MUEA 4RH1A 2X8BA 1R4MB 2D1RA 1KZ7B 2HUNA 3A6DA 3HVKA 4PZCA 3W4KA 4BGIA 2GQ0A 1J8YF 3N2LA 2PT6A 1K5DA 1XPRA 5CW1A 2WZDA 3VC7A 1R0KA 1RIFA 1K4YA 4WOKA 3T1QA 1CE8A 3EQ2A 2EFGA 1XWIA 2W42A 2FEMA 3RC3A 4CXMA 2H8GA 3HO1A 1XTZA 5HNKA 1D6MA 1TQ2A 2WPDD 3GP8A 5EMNA 2E21A 1RYNA 2PXXA 2CC2A 5AUPB 3B8EA 3DOCA 2BFMA 3A28A 3I2JA 4WNIA 4TLMB 5IZCC 4EELA 5D1NA 3DHWC 2FF7A 3BL5A 3ELBA 2OT3B 3MFQA 4X7BA 2IOHA 1UZUA 3QOXA 5EE5B 4MW7A 2FN3A 1GTRA 5ITSA 1EMDA 2DY0A 2CE7A 1DBPA 5B1SA 3C3XA 4HOYA 3FYUA 3O38A 2FDCA 4JJZA 3LVQE 3BBPA 2GO1A 2HWWA 4RHYA 4NCHA 3KPVA 2DSNA 2XTAA 2ZUUA 4RL6A 2B7CA 4XD2A 3S27A 4ZYUA 4IV0A 1PYGA 2QV0A 2KLBA 4LOJA 4U2GA 4BQPA 3HN6A 2QSYA 3VNAA 4TMYA 4JOQA 4IX9A 3D64A 2ZSJA 3ONWA 1TJNA 1TMGE 3Q9UA 1VFPA 4DLSA 2YFHA 1J06A 1QIHA 1W85B 4YJ3A 4HGZA 4EJSC 2WE8A 2BFWA 1M7GA 1VSVA 2R7LA 3GLUA 3Q0TA 4IJMA 4M1QA 4Q4HB 2W9XA 4UCQA 3GRKA 2O07A 4J0QA 1RPAA 5ITVA 1G3QA 1S3FA 4E5YA 4EA6A 3GLTA 4WY5A 2QDXA 2FZCA 1COWA 1E2PA 1PZMA 3N8GA 2CL6X 4MWBA 2GETA 3NM6B 4R8SA 3AEKB 1HT1E 2ONYA 5BMVA 2CDRA 3MWKA 4OBBA 4MULA 4URHA 4EFMA 4N3CA 2B8TA 2NVUA 3KPYA 4Z3OA 3IUEA 1AGXA 4WZAE 4MO9A 4OXRA 4RKQA 1EFRD 2X0NA 4KEAA 5JBNA 1UC8A 1Y9AA 2P9QA 3A4YA 1EGAA 3QBDA 4KYVA 1WSAA 3ECAA 2XGMA 4W6QA 3TRHA 2AWNA 4B33A 4J07A 1O77A 4FPXA 1Z33A 3LIIA 4N18A 5L4SA 3OE1A 3CO0S 1TU4A 1JYSA 3LH5A 4R2XA 4OX9Y 1QCZA 1YBFA 2QM7A 3VDXA 4YYZA 3T7KA 3THXA 1Q7EA 4LYFA 2WAYA 2JNWA 3CIFA 1JI3A 4IWXA 4J2OA 4PC3A 4WXMA 1XTQA 5L3ZA 4E15A 4W5OA 4KGVA 3N7UA 1PT7A 2CXUA 2R4TA 4UBIA 4OI1A 3ZVNA 1DP4A 2YZ7A 2HQOA 2MYUA 3PGKA 4H31A 3EZFA 1X70A 4R8MA 1D2NA 2QTAA 4N5IX 2CXTA 2PKXA 1DKLA 4FKZA 4X20B 3V2GA 3SQLA 5FR2A 3RYIB 4AQYB 1HDCA 4XIYA 1Y1LA 3EZ6A 1CS4C 1LBHA 4DXDA 2XXJA 1NR5A 2JAPA 4B3HA 3FLEA 1AKWA 1TPZA 2COUA 1GGEA 5HBRA 2WB2A 4HXFB 3OZGA 3DZKA 2GUGA 3GV0A 2IUEA 4I0WB 4QDTA 5EZYA 5TEWA 4S1WA 5DWQA 2EL9A 2IPMA 1JKJB 3TSZA 1PZXA 4I3HA 3ZYZA 1M34E 1T2FA 3G79A 3FPKA 2HXSA 4HBZA 2I4LA 4OL0A 3NTQA 4TMFA 1FJGB 3BMOA 5DM70 3EVGA 1E6UA 1JDTA 4EFDA 1GZ6A 5LOVB 3H11A 1I80A 1KMCA 1OYWA 5F23A 4RTRA 1BROA 2IUTA 3TX2A 4OL9A 2XKAA 2ZWAA 4KHZA 4NBVA 2JDIA 2A78A 5H16A 3SF8A 4KVFA 2V74B 2J07A 3QOWA 3V1YA 4WCFC 2FOLA 3EPPA 3BXEA 3L0BA 2O7QA 1SKYE 1SBIA 3EEYA 5HUQA 3FUVA 2PMBA 2FZKA 4O2AF 4ZICA 5D2CA 1M34B 1TQDA 2F90A 1GRCA 5K0NA 1YACA 3RADC 4RK6A 2WIBA 3ASVA 4XI9A 2O2YA 4Z7NB 2B9EA 3B1FA 1FK8A 2WHQA 2ZM6B 2O8DA 3DZCA 2ID7A 3ZHSA 3CKYA 4R1TA 4NDZA 1E3IA 1ONBA 4K9QA 3O73A 1UAAA 4WNAA 5JSKA 2ZJ0A 4FHGA 1A9XA 1LQ2A 2B1IA 2FUG1 3GW8A 5F2NA 4YCBA 1NXQA 4EEZA 5BSWA 1V4BA 3CE9A 4BEBA 3B70A 4W9RA 1GUAA 1YRQA 1F1JA 1UC4B 3I37X 4LNUA 1NQTA 3LCVB 3QVTA 1AZSC 3C8DA 4S1OA 2ZBRA 4K7JA 5LYJF 8OHMA 2UZIR 4MR8B 3DO5A 4WK2B 1GNPA 3EUAA 4UD2A 4PSDA 4URZR 3NGLA 4Y6QA 2AFIB 3N1UA 3NCHA 2JGMA 2RGGA 3GFPA 3OPQA 4KREA 2O7VA 2BKVA 1YWGO 5E1BA 3RANA 4BPBA 2VHYA 1YQXA 1HT3A 1PUJA 3QTLA 4CG0A 1XZPA 5DMHA 3P7MA 4DZTA 2OPHA 4V0RA 3PTAA 2YZKA 2YV4A 4F2PA 3B2QA 5IM5A 2CV0A 1TTHA 3KDSE 4RC9A 4J91A 4J2HA 4MV5A 4RM3A 4S1VA 1S01A 2AB0A 3DAHA 2ZIEA 5AW5A 2WZQA 4HQFA 1DKRA 2I3BA 3RKRA 3T4EA 2AG8A 2HMTA 5TT1A 1E5XA 4IO0A 4K9NA 1I4DD 4OB6A 5HMMA 4UOZA 2HC9A 2VBCA 2O2HA 3L05A 3OT1B 4MHOA 3L43A 2HWUA 5E9QA 4JLAA 2BGIA 1Q77A 3F7OA 3LKDA 2QX9A 4WNYA 2GEFA 2QTNA 4D41A 3AEQA 3Q0EA 2OQ2A 3HR8A 4EYGA 1A5ZA 1SIUA 2QXYA 2QZ4A 3UOGA 1WSDA 4WZZA 4A3SA 2IQIA 5BN1A 1UZNA 1DRJA 2AF4C 1XRPA 4DCSA 4EY8A 5LDHA 1UAYA 4CM8A 4IJKA 1CETA 3USCS 1NTOA 2G6TA 3HV2A 3KG2A 3QJ5A 5IARA 1Q19A 5EKDA 3SHWA 2ZRFA 4DJFC 1YA8A 2BKEA 1PT5A 2WU4A 3P0IA 4LQCA 4KYTA 1NULA 1Z2DA 4OP2A 4EB0A 3ADDA 1NJ2A 1CUVA 4OUDB 5EJEA 2MU1A 4YAUA 4DSUA 1JFLA 4CG3A 5ICGA 1RRFA 3B2NA 1UIRA 2BM8A 3B85A 4ZYVA 5E4JA 4BWFB 3CUKA 4LPKA 3RIGA 3CUTA 4RJIA 4B87A 1RMTA