1PEKE

Structure of the complex of proteinase k with a substrate-analogue hexa-peptide inhibitor at 2.2 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of proteinase K with a substrate analogue hexapeptide inhibitor at 2.2-A resolution.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE K
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pekE00
3VHQA 4DWWA 2SICE 3WIVA 1IC6A 1P8JA 2QTWB 1SCDA 1HT3A 3DW3X 3QTLA 1WVMA 3AFGA 3DVRX 1TM3E 2PYZA 3AJ9A 4HVLA 1R6VA 3D9QX 1SVNA 4I0WB 3A3PA 3SICE 3L1KA 4Z2AA 2WUVA 1SIUA 2HPZA 1GTJ1 4OV6B 3I30X 1SBIA 1T1EA 2XRMA 4KPGA 5ARCA 1T1GA 1SH7A 4MZDA 3VTAA 4DZTA 4C3UA 3DE1X 1LW6E 1V5IA 2PKCA 5ARBA 1SUBA 1SUAA 1TK2A 4M1ZA 5AQEA 1OYVA 4AKTA 2SNIE 3GCWA 1ST3A 3LPCA 1GA6A 3Q40A 1SUPA 1SBTA 5SICE 1C3LA 1GA1A 1NLUA 5JXIA 5AVKA 2DUJA 1DBIA 1C9MA 1SBHA 1BFUA 2E1PA 3DYBA 2IY9A 4NE7A 1AF4A 1Y9ZA 2WWTA 3A3NA 3F49S 4C3VA 2HD4A 1KDVA 2PQ2A 1GA4A 2Z2XA 1NDQA 3CO0S 3VV2A 1PFGA 2W2QA 1OYOA 2PWBA 2W2OA 3BPSA 3TI7A 1AV7A 4RYDA 1T1IA 2ST1A 1CNMA 1AQNA 2PRKA 1PTKA 3F7OA 3I34X 1P7WA 3H42B 1BH6A 1IAVA 1SPBS 3LPDA 2W2PA 4KB5A 3PTLA 4WOBA 2DP4E 1SELA 1KDYA 4FONA 3DVSX 1KE2A 3GT3A 3DE5X 1Y33E 1TECE 3ZXYA 4ZOQI 3LXUX 3UNXA 4OMCA 1KE1A 1MPTA 2ZWPA 5B1EA 1SCJA 1TM1E 1C9JA 5I9SA 1SUEA 5JXHA 1SBNE 3BX1A 1Y4DE 3DWEX 1GTL1 1SUCA 2Z2YA 3QMPA 5FBZA 3F7MA 1AVTA 5JXGA 5AVJA 5FFNA 1S02A 1TO2E 1UBNA 1WMFA 1YU6A 3DW1X 3VYVA 1BE6A 1TM4E 2W2NA 3CNQS 3WQBA 1TO1E 1BFKA 1EGQA 3GCXA 5AMXA 1ST2A 1AU9A 1AK9A 1WMEA 3DE4X 1SCBA 1R64A 1SIOA 2WV7A 3I37X 1TM7E 1Y48E 3AJ8A 1Y34E 4JP8A 1YJBA 2PWAA 4H6WA 1NDUA 3TI9A 3WHIA 1GTG1 1A2QA 2ZRQA 3BGOS 4YN3A 3DE2X 3VV3A 4BWGA 2SBTA 3SQOA 5B1DA 3DE6X 5JXJA 3HJRA 3EIFA 5ARDA 1SBCA 1P7VA 4AKSA 4NMXB 5K7SA 2GKOA 4LVNA 1GNVA 1SUDA 2ID4A 1THMA 3DE0X 2ID8A 3I2YX 3WIUA 4CFZA 2Z57A 1Y3DE 1ZVJA 1YJAA 1ZVKA 1S2NA 1C9NA 3A3OA 3TECE 1GCIA 1BJRE 2V8BA 3DDZX 3DE7X 3VSBA 4B5LA 2Z2ZA 1PJ8A 2DQKA 1OT5A 4K8RB 4ZARA 5FAXA 1MEEA 3ZXXA 1GNSA 3OSZA 2SECE 3QFHA 4NE9A 4GI3A 1Y4AE 4LVOA 1DUIA 3LPAA 1SIBE 2IXTA 2WUWE 2Z30A 1V6CA 4KG7A 1SN7A 1SCAA 1JEAA 1Y3FE 3T41A 3Q5GA 3GT4A 4CG0A 2ZWOA 1S01A 4WOCA 2B6NA 1AH2A 5CW1A 2X8JB 4DJ5X 4HX2A 2XTJA 3DVQX 3EE6A 4CFYA 4H6VA 2Z58A 2TECE 1XF1A 1TMGE 2PMWB 1Y1KE 2P4EA 3DE3X 1SCNE 4OMDA 2G4VA 2W2MA 1KDZA 1YJCA 1TM5E 2Z56A 1BE8A 1Y3CE 1WMDA 1GT91 3P5BA 3PRKE 4H6XA 4J94A 5JMOA 1R0RE 1VSBA 1Q5PA 1WSDA 3EDYA 1CSEE 2X8JA 1PEKE 1Y3BE 3D43A 1EA7A
chains in the Genus database with same CATH superfamily
3RYFA 3A4MA 1ZSYA 4F9GA 4IJ6A 4UW9A 3N05A 1I8TA 1VPWA 2QMYA 2WF6A 1RMQA 3ZJ4A 1I10A 1YIDA 5LU9A 3AF4A 4DOMA 3CC8A 4GSKA 3C6QA 4HDOB 4WCFA 3EWNA 5BMOA 4DIOA 4RV4A 5EHZA 2WTUA 4NYIR 3TIIA 2Z6VA 5IEBA 4JVNA 4BQNA 1HOTA 2W58A 2WNSA 3JQQA 4S0XA 4Z3OA 1HRKA 2BKXA 2VOEA 3AHJA 4KV7A 3W5IA 4L5YA 4BO6A 4C2TA 1NVMB 4Z4EA 4UCWA 4EVRA 2K7FA 4UDOA 3ROKA 1NDHA 3CE9A 2QDXA 2XQVA 3G2MA 1XU4A 3M0EA 3DAPA 4BWYA 3VXKA 1RD4A 4MYHA 2PJRA 4G56A 4F2WA 1N2CA 2VHCA 1O5OA 5JAOA 1G63A 1LJ8A 5ISMA 3RTAA 1RWOA 3LY9A 1XA4A 5DLEA 3RGGA 3A36A 1J7KA 1E1MA 2JLSA 3K35A 3O1JC 2LCIA 5DTMA 2UZAA 1QP4A 5JCOC 2PS3A 1EDDA 2ORVA 1YRLA 1H23A 2R8ZA 4L57A 3UMFA 4OX9Y 3G9QA 3RT9A 1QGAA 3W5UA 5LNK1 5JV5A 3CVWA 4OD0A 2V97A 3MIZA 3NFRA 3KKKA 3W9SA 4HWTA 4CG3A 3AVYA 4C76A 4AO7A 2PXCA 1TI7A 4CMBA 1OLSA 1F12A 1T26A 3LCMA 5I9SA 5JXHA 3V48A 1SBNE 4W8OA 13PKA 3U62A 3N8GA 4L1KA 5T8KA 1UC8A 3W1VA 3ZNPA 1RPJA 3A4IA 4G9GA 5AVJA 2GPTA 3S70A 3C3AA 4I55B 2JD2A 3Q8KA 1CUFA 3BGDA 3KJEA 5JAUA 2EYQA 3WK6A 3QE0A 1TAUA 1QG6A 4AP5A 4MUKA 1A2QA 2EF0A 3HMKA 3OHPA 1EJBA 1NZJA 1RJWA 4JELA 4JP3A 2A4MA 4X3OA 5ETJA 2ORIA 3E7FA 1MIHA 3D0KA 3I1YA 1KARA 1QOPB 1NVDA 4H59A 1DNPA 1K08A 3FNRA 5I7EA 5HIJA 2GB4A 4LSWA 1Y5IA 2AOTB 4OK6A 4D26A 2H48A 5DEOA 2OBFA 3AL0C 3LUDA 5EJIA 2C94A 3ZEAA 1FU7A 1TVCA 4G5QA 1R0CA 3RRMA 2FSPA 1OROA 1ZSNA 4GI3A 2PH5A 4FLMA 5DXFA 5JU6A 4IIJA 2C9CA 1U5AA 3R7NA 4G84A 1IQRA 1YVEI 5F73A 4TV9F 1U8EA 1N6RA 4G6ZA 3KJIA 1TZBA 3TTTA 1BWRA 1ISIA 2BTQB 1DP4A 1CC1S 2F9MA 1E6KA 3QF4A 1I4LD 3P5SA 1KH3A 3IKMB 3L0YA 5EKUA 5ALQA 7MDHA 4H17A 2J41A 2PT9A 5PNTA 1JLSA 2C5EA 3B6MA 3RVRA 1EJ2A 4G1CA 4UVEA 3ESCA 4ZTZB 1Y8QB 2YJNA 3BKWA 4JI7B 2AEFA 1DHTA 1YBVA 2LP4Y 2ZR7A 3PEFA 4R69A 1EINA 5HF5A 3MIIA 4W1QA 5J2UB 3U6BA 3DO8A 4LISA 4OHCA 3VPCA 4C4RA 4RULA 3TPFA 1JEJA 3ON5A 1R0RE 1PL7A 4KIFA 3VR5H 5JSZB 1IZ0A 1ZHOA 1C4WA 3GCDA 2JIPA 2QRVA 2AFHE 4K9OA 5KNDA 1G8HA 1ID1A 4K87A 4NOKA 5HK8A 1E79A 1Z2NX 4ASUD 3TQHA 4RYLA 3UQYS 5JY6A 5IN5A 1O54A 1HT0A 3JZIA 2BN4A 3D1LA 1IM8A 4FOLA 2AJCA 2QAGC 2XDQB 3O8OA 4FQ5A 4L85A 3U49A 3TNLA 2PBLA 3U3RA 5ITVA 4DV1B 2Y0PA 4INPA 4O2RA 4HPWA 1AURA 1XC7A 4FIZA 3V33A 2A59A 4PIPA 1LW6E 4CLRB 4RNCA 1LEHA 2A33A 3JAWA 3S81A 2QLBA 2YIMA 1E59A 2BFCA 2WDPA 2PGLA 1ZRMA 3UV7A 2YN0A 2H1FA 2IF2A 3DZIA 3KKMA 3ML1A 3K70C 1C7RA 4HWOA 4OP1A 3ZY4A 4KXFB 4CGYA 1GFIA 4BVFA 1U1EA 2IXDA 4QPPA 2HO5A 2YBEA 4ZT7A 1BDJA 5DYWA 3T3DA 4RF4A 1LJLA 3M6VA 5ALIA 1EBUA 1N2IA 3AJRA 1OAKA 2RARA 2ONKA 3LVRE 4RY0A 4A15A 2R8EA 2V1UA 3QMVA 3UBTA 1IB0A 5IT9A 4Q4DA 2OHJA 3LQYA 3G0BA 1JQKA 2PMFA 3FCXA 1B74A 4P3KA 1NXTA 4U7JA 1W4BA 2FQXA 5ECDA 3SR0A 5ADWA 1QHSA 4FEEA 1WBBA 4KQ1A 1ZOIA 4A2CA 3G8AA 3CPSA 4KQEA 3UNXA 1YQEA 4G07A 1N1GA 5IJWA 1ZOOA 2ZSIA 1H05A 4LF8B 3BMOB 2BBSA 5ALWA 2Q5FA 5IANA 4CYMA 3KIPA 2JHFA 2JCXA 1ZWKA 1GTVA 3I9OA 3BCHA 4RLFA 3H5OA 3LCUA 2OC4A 2Q0HA 2PMEA 5FWNA 3WRXC 4HAXA 3GEMA 3UCFA 1K5DA 3CH7A 4FZ3A 3U6KA 4F85A 1EHCA 6ADHA 2GM4A 5E4TA 3FR7A 4HFNA 5FUVA 3TMAA 5F3WB 3I92A 4MRAA 3G2PA 4DG9A 1FTGA 1SIOA 1W5FA 1XMXA 2XYGA 5LP6B 5IDVA 2JFQA 2P62A 4JP8A 3VR2D 4C4AA 1M8KA 1ZU4A 1ADCA 3WNVA 1ZD5A 4YAKA 1JEYA 2AFHB 2A7XA 2D0DA 5F5LA 2YVAA 5LA6B 3E3LA 1NR7A 1L1QA 3ANYB 1UBUS 2IK8A 2M9MA 2NO7A 3R44A 3PNSA 2O8BB 3LX8A 3R23A 4BYMA 4EPXA 4YUYA 1W36C 3AC0A 1W6UA 4N5DA 2QUHA 1YR6A 4BFVA 1TAGA 1P3DA 1IWBB 1SGWA 3IEUA 1TEXA 2WSMA 4LNHA 4YQEA 4BL5A 2VJOA 1HT2E 3AR3A 4PZ0A 4R9VA 1FU8A 1ONBA 1OGJA 1R5NA 3P0HA 3O8QA 4GP9A 4HNGA 4NZNA 4ZVRA 4F92B 1SCAA 3HYCA 3AVUA 4A9AA 5GJWC 4JZKA 2CSUA 4US2R 2IH5A 5IDQA 1SOWA 2IYEA 4HAIA 4CI0B 1R6XA 1YZNA 3IDZA 1AA6A 3HZRA 3MMZA 3NI2A 3UW1A 1ONOA 5HNKA 3RIXA 1GILA 3C2QA 3KKOA 3MINB 3EMDA 2H11A 4MI6A 2F9FA 1DAIA 1IXSB 2WFLB 3RE1A 821PA 2J09A 3BXPA 5EE5B 1RZRD 2FR8C 2X1MA 1LDEA 3QLUC 2VPXA 4RIGA 4RELA 2X0DA 1NYLA 3FW1A 2ZKIA 1WQ3A 3R3WA 2DWUA 2VYND 3PR2B 4NVRA 4RLQA 1VSBA 1QHFA 2HBRA 4EGCB 1JEDA 3J80A 1UWLA 3N07A 4GP6A 1G66A 2PIAA 3IE2A 4UQLA 3KOYA 4DIFA 3JV7A 3U4HA 2IDJA 2WM9B 2C2WA 2JIZD 2D54A 3BWDD 3L01A 4N3AA 2PD3A 2DERA 2J08A 4GMXA 1MTZA 4GXRA 4YJDA 2L18A 2H5EA 2PWZA 4ZRMA 2PNJA 3TQIA 4EMUA 4LHZA 5K0LA 2YBDA 2ZT5A 3NJ8A 3LP5A 1WUJS 1PBNA 4L9RA 4A16A 1AKVA 1ZK4A 1X87A 2WZBA 2WYUA 3BH6A 3GDHA 4M1ZA 4ALMA 4C0LA 4CL2A 2BGGA 2WYVA 4K6KA 4IILA 4NBVA 2QIOA 3QEOA 1HC7A 4L6IA 4B6PA 1U1GA 3A1SA 3HDHA 4PLTA 3ANTA 3V1YA 3WLRA 3RFCA 1VG8A 2XCRB 1TU0A 1RJFA 2NO4A 3LFTA 1CR4A 4KDFA 4EJSC 4ZREA 2DQSA 3F9CA 3ISTA 4P2BA 3K0CC 3TI7A 1ZN2A 2CE2X 4FLEA 4F2GA 3ZH2A 3FFXA 3HFGA 1PZEA 3C5HA 3HFSA 3TW8A 4BYGA 1KYVA 3L7YA 2V4UA 3UA3A 1VP9A 1KSJA 2BH9A 2O1XA 1LTKA 2Q4OA 3EFBA 3BCUA 4PZAA 3TLYA 3UHAA 4MV4A 2PKEA 3ANLA 1ODKA 2A78A 3D3WB 2JLCA 3U81A 3KT8A 4H27A 5UKDA 2DEUA 4PSDA 2X86A 1OOEA 1ZUNA 2H92A 4EEKA 4UD2A 1WDMA 2XQFA 2VHUA 1EQAA 2IHVA 1WMFA 2W2NA 5JYEA 1KMHB 1R4MA 3A9RA 2EDCA 3PX2A 2DJ5A 1UC4B 3TD9A 4A23A 1OI3A 4QPNA 1UDBA 3T5BA 1RHKA 4RNDB 1GNLA 3S44A 3DLHA 2AH5A 2M1XA 3JS5A 1NXSA 2V5AA 2GHTA 2BTOA 5P21A 4G8BA 3ICWA 2IPXA 4HUQA 3SSNA 2DHCA 3HN2A 4REMA 1IBKB 1JDNA 2BCEA 4IQ0A 1ZVJA 3MB8A 3UUGA 1HLFA 2B34A 1MB3A 3OF2A 3GY0A 4RFVA 3WQRA 1Y1SA 1KEVA 4MUJA 4GX5A 5G1NA 3VYSB 4TS9A 5IZ4A 3UOAB 1UUFA 2LNDA 1GNSA 5KYUB 4FYMA 2VZ9A 4YBRA 4DJDC 1PK9A 3BMQB 2OP0A 4QYSA 2AG6A 3P20A 4E5YA 2BSQA 3Q9NA 5KSYA 1MC1A 4E08A 2IOFA 5JYBA 3BK1A 1ELOA 4TTVA 2O8EA 2OV3A 2XGGA 2QSZA 3R76A 3H9BA 4GO1A 4IDCA 3NIBA 1U3GA 1PR5A 2OV8A 1P31A 1URPA 2B1JA 4IDOA 4JDPA 3TEFA 2G08A 3R0JA 4DJAA 3LRTA 2WYIA 2C78A 2FQWA 3S1AB 1WD7A 1DIGA 3PSHA 6CHYA 2A0WA 1OX5A 2Z5FA 3G7UA 3F3MA 4LXUA 2A0XA 3SBXA 1H6CA 1ACLA 3L93A 2IPAB 2XDQA 3O8OB 4G86A 1OF1A 4OATA 4PO3X 1QRRA 3CNEA 1JIQA 4E15A 2AFIA 1DAFA 2CLLB 2MJLA 1HNNA 3OM1A 5EFOA 2EBFX 2B4AA 2GMWA 5CH5A 4IDDA 5ES4B 1BOOA 1IVNA 2FPOA 4CFSA 1N9GA 1TTPB 4UATA 3H3XA 3L4BC 1Q7BA 3MCUA 3U7QA 4E1BA 2CCJA 2HQSA 1E99A 3KJHA 3PUJA 1EYZA 4GUDA 1JXQA 5YASA 2M98A 3OUZA 3ROGA 1TZKA 1JDJA 4D4JA 4OUDB 3O73A 3GLFA 2FG5A 5JPIA 1B8VA 1CD5A 4RCZA 1GRCA 3B5JA 3TLCA 3HLYA 1N1MA 3FNHA 3T7IA 3AF1A 2BI7A 3F7TA 5EP1A 5K0CA 2QRPA 1YS6A 2WE8A 4I3GA 2GD1O 1XZGA 2ZE8A 4PHGA 3SQWA 1EFVB 2WTNA 3O0DA 5IM5A 1F0PA 1N5MA 3KAPA 3T4EA 1E7SA 5FULA 3A2MA 3MCWA 4C3OB 2NVWA 5EMLA 1GKKA 3BIXA 1K1EA 1G20E 4ZQHA 3C3KA 4W5JA 1FA9A 1JHZA 2ODAA 3W6OA 2DR2A 2JIZA 4FEAA 3PQEA 2NTJA 1GDDA 4O4LB 2OO3A 5HHTA 3KSDO 4QE3A 1CP3A 3RC1A 2BGRA 5TDHA 4KQMA 4G2TA 1BQ4A 5JEEA 2WF7A 1Q74A 1MJFA 2GA8A 1S96A 2NYRA 4XRGA 4FOSA 3ZVKA 5JSKA 2I2WA 4AZ3A 3A0RB 1LJUA 1Z7BA 2IEZA 4PQGA 4YJGA 3T8YA 1ZK2A 2Z1NA 1PR4A 1BN7A 2ZW9A 3JR7A 3G49A 4KDEA 5PGMA 5MFZA 5F9HA 1P80A 1UCFA 1WO8A 3GCXA 2BCGY 3H04A 4GWLA 3P7MA 3TM5A 3B13B 2XBMA 3BTOA 3LBYA 1E2LA 1FSSA 2C7PA 2II6A 3A4NA 1U2DA 1QG0A 2BYTA 4KXMA 5D84A 1RWKA 3P9YA 2GN4A 4OIMA 1FVOA 2N46A 5HG0A 4BMZA 2IUTA 1A7AA 3PCXA 4Y3UA 2JAUA 3O8QB 1Y9AA 2XNSA 3TN7A 4PGHA 1IZZA 4CM7A 4XIFA 1LGYA 1QO7A 4WUTA 1HPLA 1XRRA 3U7JA 1C7IA 3DE7X 4F9FA 2D8MA 4IVQA 2DQKA 5EYPB 1DO0A 2XT6A 3KLMX 3GOHA 5J63A 1DJMA 3K73O 3V5NA 4BGIA 2UXDB 3WI7A 1U8AA 3R3JA 5I7UA 1H8HD 1EP3B 3IIKA 2NU9A 3DL2A 4TLAA 5TEVA 2TMKA 4KKXB 3VR2A 5IN4A 3K9GA 3KDAA 1S3FA 2R6HA 2R6DA 4JD5A 3LF1A 1OFTA 2D1QA 2RHBA 3I12A 3FDIA 1DTEA 1ZG3A 4TXJA 3KELA 5C9ZA 3MTDA 3H0KA 4UOQA 3VPFA 4ZYYA 3MEQA 1JHOA 2MT9A 5ALEA 4C29A 3UH1A 1L5GB 2OG2A 2AVNA 1SHJA 3AUUA 3SC2A 1O9GA 1A97A 2Q9CA 4C7JA 1U3TA 2PGJA 2X5JO 3GZTB 3UHFA 1OTHA 2XE4A 2XUFA 3R7WB 4YHHB 3O3CA 2C5LA 4EYEA 1FFBA 4FBLA 1HL3A 1ZIPA 4OBBA 2BDTA 3QYAA 2QVBA 5EVCA 3QEAZ 1OGYA 3FI0A 1ZRNA 1T3TA 2ZUSA 1JUDA 4MA4A 4PZEA 1YR8A 2PKYX 4F1WA 3U80A 2I4MA 4HDMA 4PC7A 4DSUA 1EXDA 3IPAA 1E1CB 3OM9A 3TBFA 3WIOA 1QFSA 1KH1A 4B6RA 5BSHA 3JASA 3R3VA 2JF0A 4KXYA 2GRUA 4COKA 1KZ4A 2BWJA 4YAJA 3ROQA 2J48A 2FGJA 4N01A 5FAKA 3BIJA 3O9VA 4JLBA 5LKAA 1TKAA 1M6VB 3LT5A 1Z4KA 4IMPA 4P4LA 2C2OA 3BJZA 1NM5C 3GEIA 3HI6A 4QXAA 5CMLA 1QGZA 3V7NA 1G8SA 3QPUA 3OCCA 5EWLA 1FUUA 5HRCA 4QATA 1HE2A 1MIOB 3VPSA 4UTNA 3JYNA 1GRRA 2AXEA 3JPYA 4LNUA 4ALJA 2BGIA 3OIFA 4K1LA 4O25A 1JR6A 1R0YA 2VK2A 1XCLA 1PWEA 1Z0ZA 3ECCA 1QXSA 4Y1RB 1SC4A 2A1TR 2O4CA 1FTNA 3JRNA 2EWMA 4R2KA 2PKQO 2REXB 2E4UA 5FF9A 3WIEA 3TAXA 2DBYA 3NV7A 4FC7A 3M5WA 2IFTA 3PUKA 4W7HA 4WZAE 3STHA 3U7EB 5K45A 4H31A 1AG9A 3A1NA 4IIDA 3T9BA 1IHXA 1P4SA 4DLXA 5KZMB 1LDNA 4WADA 2PT5A 5CJ2A 4KYIB 5LLDA 3ZI4A 1W34A 1I3CA 1JG2A 3HA3A 2GF0A 4LGVA 1KRXA 3GT3A 3Q7RA 3WYFA 1N2BA 3UWKA 3M1IA 3EZGA 4EUNA 2Q3EA 5FI1B 2A5DA 2R751 3BYZA 4NFYA 1KTVA 2Q41A 1XVVA 2GYUA 4Q4HA 1SR8A 121PA 2AC2A 4J16A 5I8ZA 4EJMA 2D1YA 2LBPA 2O6HA 3ZCSA 4LHEA 4LZZA 2FFRA 3SOPA 3QTBA 3I9LA 3JQRA 4BBPA 2A3NA 3JQ7A 2J3EA 4EDFA 1ST2A 4BMVA 1WMEA 4AF8A 3GBPA 4RGQA 5KTSA 1NW7A 2FJUA 1ATZA 1O4VA 2RI0A 1QR2A 1TIPA 5CU7A 2AJ8A 4XM0A 2O07A 5HQ3A 4RVOA 4NMXB 2D5BA 5LLTA 3MXTA 4YMHA 4CV2A 5AKYA 4LCBA 3BSWA 1QHNA 4JROA 3TRJA 3WGOA 5I8PA 1RZUA 5KAPA 3G8YA 5T67A 4CQMA 4J0QA 4KQJA 2DG2A 2ZU0C 3HNPA 2QR2A 2VP0A 1SY7A 3QRWA 1IWOA 1JMVA 1GQRA 4JLKA 5JSYA 5JIBA 2VZ0A 1WULS 5DNEA 5EJ5A 3UJAA 1G60A 4Y1GA 4D99A 1YK0A 5DTEA 1GG8A 2J0UB 1YI0A 2BAGA 4V1CA 1K7FB 2Z3ZA 4QU8A 1OTXA 3UAXA 2VDMB 3K9CA 1SXJE 2CFRA 3SQDA 3U16A 3PEEA 4GOOD 3BQNB 3KEFA 4JIGA 2QRKA 3F96A 4OBEA 5TARA 5K8VA 3PUXA 5KKCA 3RTGA 1ZEJA 4FSHA 2Q5CA 3FSGD 4WA8A 3UENA 2AKEA 3GJRA 5HDQA 1FNMA 3WLEA 9LDTA 4HQFA 4LQLA 4ZO4A 4FNGA 1BQEA 1MABB 4I8IA 5JS6A 2VTBA 4Q7MB 3A6GA 3V8QA 2CL6X 1MD9A 1PQWA 4DT1A 5J9FA 3VR0A 2QRUA 2QN6A 1VHJA 4DIEA 2NX2A 2ZRJA 5INTA 2W83A 2XPCA 4C7KA 3OF3A 1KHTA 1Z18A 1KIAA 3KCQA 4ROSA 1B6SA 2YYSA 1E92A 1TB4A 2P1DA 3GT7A 2ZIUB 3KEMA 1NWCA 3GVIA 1MAHA 3JY6A 4R2IA 3TEMA 4Q4CA 1K8ZB 4BCDA 4CCYB 3L7DA 1V5WA 3O26A 2A9QA 4YAEA 1ESNA 4URVR 4YRKA 1IN6A 5FWAA 2GCNA 4BNNA 2O2ZA 4FUQA 3Q8MA 1RHMA 4U7TB 3BRQA 3OKCA 1X38A 3SZ3A 4D0NA 3MJSA 3HB4X 4JT2A 4MIEA 3ZH9B 4CTOA 5CFQA 4F45A 5FPQA 2XJ4A 2QYTA 3SHVA 2CUZA 5ICCA 3CWQA 1S2LA 4CL3A 5DEIA 3TF5A 4PVDA 1VCOA 4DABA 5I9LA 5L45A 4JYBA 2R1ZA 3GDFA 1PEYA 2NUPB 3F6PA 4P35A 3N70A 4UPEA 4MVJP 2Q5OA 3B8HA 2NSDA 3BXGA 3QPDA 4ID3A 3TD6A 4B34A 3ED5A 4AQYB 1WF6A 4GYJA 3DLCA 3GQBB 4P53A 1ILEA 1GTZA 1OV4A 3E22B 4O4HA 3U3XA 5EIXA 2P6NA 1TOAA 5HBGA 5A05A 2GX6A 3NETA 4F4JA 3TVDA 1GU0A 2GETA 3OA2A 1O9BA 2GLXA 3CZ4A 4W7IA 3OJOA 2OWDA 1ULHA 2FKNA 2P65A 4W1SA 5TF0A 2WDZA 4QOHA 4DEVA 4YONB 1P5JA 4JJAA 2XGJA 1ID8A 1QX4A 1E3LA 2OM6A 2XITA 3D2CA 2Z95A 3ZDXB 3QKSB 4NSNA 2DFLA 3AQ4A 3B6ZA 5C8YB 3V2HA 3JU3A 1QVRA 1PWYE 5TQ0B 4QLOA 2CMFA 4Z8YA 1Z47A 4LJKA 4YREA 2V55B 3DDWA 5EYPA 2C1EA 2FAXA 3MGAA 4GR4A 5DCWA 1JEQB 1FUKA 5AXBA 2IW1A 2RJ3A 5A5GA 2JFPA 1N57A 4P3PA 5HFAA 2O5EA 1X7YA 3BN3A 1SG6A 3EHEA 2AR7A 3O4GA 2XD9A 4FMCB 4HGQA 3EIWA 1WB5A 5JPDA 2NU9B 2H63A 3IP7A 4FMBB 1PVDA 4QHYA 1JNXX 1RZ3A 2X1LA 4OGKA 3WWYA 5K8CA 4EY6A 5LMNB 4LXHA 4PLGA 3E9ZA 2WB2A 1Y7IA 2WVGA 3W6UA 4Y2HA 1X9IA 3O31A 5GONB 4NENB 3OMLA 3EA4A 4WCFC 4F6CA 3SC2B 2WIBA 4ZCPA 3G2NA 4Z0TA 2DHDA 3R8FA 1HORA 3MLAA 3N59A 4ZWNA 4M8KA 1ZJJA 2KSQA 3ZR4B 2O2CA 1S4QA 4M9ZA 2O8VA 4BB0A 2CMGA 3ICOA 4HF7A 5AVWA 4OHWA 1RPTA 4MPDA 3K15A 2XTJA 2BMFA 2H06A 3AT1A 5KWSA 4ZAYA 1H2HA 2VAWA 3Q2IA 3ASZA 1TMGE 2NNWB 1Y1KE 2P4EA 4KACA 1N2GA 3N5CA 4J1QA 3SD7A 3I42A 3O92A 4HLDA 5GM1A 5C4GB 4X6YA 2FW6A 4OL9A 3SPXA 2YS7A 3SY8A 2V6IA 4HQKA 3R7AA 4C3ZA 1GKYA 1BS2A 2RBKA 4OGGA 3FMOB 5HQTA 3LUKA 1SUIA 1BYIA 4NDZA 1SCDA 4TZKA 3EQZA 4JLOA 1F4LA 1GZ4A 3V4ZA 5J2UF 1J1UA 2XYHA 1RJ9A 4L5CA 4RY9A 1EVZA 1L5HB 1SCQA 4PR3A 721PA 1QYWA 2J45A 3JD4A 2ORYA 3GJQA 2IHTA 4P58A 3D7LA 3WGUA 4I1UA 1DEKA 4S1PA 1YNOA 5K8LA 1XTIA 1J8DA 3TNYA 2WWFA 1RXSA 3DWGA 2IXFA 1E9CA 2J32A 1YRHA 3GJ7A 2EW8A 3DM9B 3EIOA 2OXEA 2RIRA 3M4JA 4IZIA 4L3VA 5EZQA 5SICE 2DUJA 2IPLA 4MRNA 4TV9B 4HEA6 1DKOA 4MVWA 2WRZA 1PG2A 5E9QA 5EE3A 1QGUB 3TSZA 1R0SA 3HJGA 1CZHA 3IELA 5GP1A 2QW1A 5DP2A 4FCCA 2P9BA 1J49A 2UZ3A 3LXRA 2GUWA 1WOMA 2PWBA 2QHXA 1AQJA 1JKXA 1GYPA 1RE0A 1OWPA 3D5QA 2WWVD 3OLQA 1E9BA 1NMYA 3OJCA 4E46A 3T6KA 2RGRA 2QP4A 1I9CA 3OIVA 3COJA 3RVBA 3QMMA 4QJ3A 1X7WB 2VP5A 2C2KA 4MGZR 6GPBA 3UYKA 3HKEB 3HLKA 2LDXA 4E88A 3Q8LA 1N2SA 4OSOA 2HIHA 1TEZA 3SK0A 5IM4A 3KBBA 1VJTA 3NEAA 2MSCB 5EEHA 4Q3EA 2JJMA 2PWPA 5CX1B 4DQXA 2DFDA 1T24A 4LG1A 3OHMA 2CVQA 3ZXUB 1OU0A 1ZITA 2WHPB 2VJNA 4RTOA 2JLYA 3G68A 1DX6A 4MCIA 3HHEA 1NULA 1YWGO 4B4DA 1O95C 4OSEA 4GLFA 3L7KA 1WB4A 2AWNA 2Z83A 1C5KA 1NLMA 3D4NA 2WTAA 4KLAA 4MWTA 3UOWA 1KYWA 4D9EA 1GT6A 2A0UA 4HNVA 3NHUA 2OB2A 3KPVA 3PCTA 2FP3A 3EVTA 4X1KA 5DNDA 1L5KA 3RC2A 4JEMA 5H83A 3CBGA 1M2HA 5JSHA 3HJUA 4LOIA 5BV2P 1A1VA 2R96A 3SAJA 2GM9A 3NPMA 3FCAA 2J3DA 4WNIA 1GL3A 4YI5A 3HDTA 2JJ1D 1N0UA 4L28A 1B15A 6ABPA 3ONWA 3RS3A 3SQMA 3QF7A 1CE8A 2ALJA 1D1SA 1MOZA 4LDRA 3HR8A 3RC7A 4EMSA 2YKGA 1T35A 5AKKA 1M1NA 3KHSA 3RYHA 1E6LA 2I03A 5JSFA 4WCVA 4MYSA 4ZVMA 3TX2A 3EJWA 5JAHA 4TMWA 1XZIA 2HA6A 3V2IA 1Q11A 4EQ6B 2Q5IA 2D4HA 3WLFA 2AG8A 3DUFA 3RFUA 5HJEA 3G13A 4TRRA 1DPFA 4UE3S 2QI9F 1Q1ZA 2VNAA 3E9RA 1EP2B 4NYIQ 3E1GA 3NHMA 4TL8A 5CJPA 4DGQA 1AUQA 1M2OB 1U2RA 1LBIA 5JS8A 1FFXB 2FWRA 4TOIA 1D2NA 1T2FA 1YJXA 3RK1A 3AY3A 1KZ7B 1P73A 1U28C 2YWJA 3FJ1A 1YJCA 3MFYA 3PGXA 3T7JA 4BZWA 4Y6RA 5DX1A 5JLJA 4CBVA 3AERA 1FDSA 1X7ZA 4K81B 4K86A 1NQVA 2D5LA 1CR0A 3X2FA 2XE7A 5KS2A 4LF9B 2H4YA 4XR4A 4I1RA 1P1JA 3LWNA 4GNKA 2I99A 4QWWA 4MV3A 4Q9KA 1XRSB 2JIBA 1DDIA 1OVGA 5J4KA 1U3FA 2H7CA 3NVDA 1RKBA 2PAAA 2GHRA 1JU3A 2AK3A 2CMHA 2GEKA 3C43A 5F78A 2D2IA 3V97A 4DRXA 4B8WA 2AMFA 4X7RA 5LZ7A 3BWMA 3VOTA 4CKWB 1E7RA 1M1XB 2OO5C 1R7RA 2YMMA 2X5NA 2YL2A 5AQEA 3I9JA 5D3QA 2PSEA 1II0A 1NHGA 3TKLA 5B2EA 3OIGA 3KSMA 1PL6A 4MR7A 2NUPA 5KJCA 1DIAA 1Q0QA 2XUKA 4URUR 1CDEA 5JC1A 1A76A 2Y77A 3IUJA 2WKPA 4ZRDA 1P18A 2XMDA 1MCZA 4L4XA 2IH2A 1U0GA 4YMTA 4IVPA 4Z49A 5FTMA 3E22A 2EFEB 1S7CA 3FI9A 4AN4A 4LJYA 4BNXA 3GD5A 4I14A 2ST1A 3ORSA 4H7HA 2CKMA 4Y1FA 5AI9A 3RS5A 3EZLA 3SFZA 3IKJA 4I7EA 1E2KA 4JI4B 3VNRA 1CK4A 5ALJA 5K3FB 3TNJA 1A5ZA 3SN6A 3WLNA 3NKFA 4X1IA 3QKSA 3E2MA 1XLUA 1SCJA 1TM1E 2FW8A 4RZSA 1W2WB 1QV9A 2LTAA 1L5YA 4JL5A 4AI6A 4NULA 1EWVA 4QBHA 2IV7A 3AFIA 3SF8B 1M5RA 1OT3A 3SX2A 3H9EO 2X3UA 3WMRA 3GL9A 1C0PA 1QG4A 4EH1A 1DOZA 1RJGA 4M0UA 4R8KA 1BOFA 1Z4MA 2H9IA 3O3MB 1WMAA 1WXWA 1WZIA 1Z9BA 2RHGB 3E48A 4YJ3F 1TX4B 3TIGA 2Q46A 2FSVC 2QMOA 1GYRA 3IULA 2I2DA 2LIVA 2VQDA 4PFJA 5G0SA 4DE5A 5BPFA 2AZ4A 4MKRA 1B0ZA 1H8EA 2PXXA 2XUHA 1RI5A 3Q5EA 1VI2A 2OZLB 4EW1A 3ADBA 2RH9B 2XE8A 3VC3A 4EI8A 2UUOA 2NM0A 2YTZA 2GKOA 1NRWA 5L3QB 4RSHA 1W85B 2VT6A 2F1OA 1L5RA 3NDRA 4AXXA 2Q1WA 1QX3A 2ZG6A 3WAJA 4LY9A 3UGKA 3D8TA 4FOPA 3W5HA 1YSCA 1IN8A 3IT0A 4FIDA 2ZDQA 4DV3B 3GPIA 1Q91A 1TEHA 1V8FA 3K2BA 3L7CA 3C87A 4D9BA 1NOJA 4UU0A 2Z30A 5K6RA 1IHYA 4BX0A 3U5ZB 2PUFA 1ORTA 3MSXA 3PZBA 5EJ2A 1U2PA 1XN1A 2Y1CA 1S4MA 2ZIGA 2IHNA 1T4MA 1B8OA 1TIBA 1T9DA 1XNHA 3VDMA 1ADYA 3TR5A 5JDCA 2W6ZA 1QORA 1SRRA 3D6TB 3OA0A 3A6JA 2WILA 4J0JA 3C3PA 1DARA 5I47A 1NFRA 2CLSA 5C5EA 2GN1A 4F38A 3N0XA 3PQ6A 5JNRA 3AH8A 4JFRA 4NEQA 2JGIA 3SOZA 5KWEA 3RYFB 3AIMA 1JTFA 3S2ZA 5C35A 2BR3A 2X9NA 2V5UA 1MXHA 3HKCB 3NTVA 4UVIA 5K03A 1L7XA 4ABTA 3IXLA 3LYAA 4LCJA 1SJ9A 5BR7A 5LMUB 3S3TA 1GLVA 2CXQA 1H8ED 2ZIXB 2PSDA 1P29A 3I4CA 4Y6LA 3GP8A 3IHLA 1MJNA 2CD7A 5BMVA 2BKAA 3K0EA 4EJ2A 2I6SA 3WTBA 3L1UA 2BUBA 1M0TA 2A88A 1I1NA 3IAUA 4NS1A 4QGSA 3DZKA 3EFOB 2A7QA 2B69A 2MINA 3GNQA 3Q2OA 3NB0A 1PX2A 4MUMA 4UMDA 4BNHA 3NDJA 3LSYA 2R48A 3L4JA 1H5UA 2Q0XA 3WLHA 1GA1A 5JDIC 2YZGA 2GDJA 3K8YA 4AMUA 1RNLA 2DMRA 3BREA 1I6WA 1TC1A 3DAYA 4FCVA 4MULA 4BMCA 4CMAA 5JHHB 3MJEA 3ZJYA 1OKKA 3C6YA 3M7IA 3ZLUA 3T3MB 1GCGA 2CB9A 3BCSA 2Q27A 3NTUA 3LHKA 2PLAA 3AL3A 3OAAA 4RPJA 3BAFA 3HCBA 4E14A 3D0OA 3RVNA 1BDHA 1JKMA 5L4SA 3S8EA 1II8B 1N5DA 2R87A 4L5IA 4CF6A 2BFMA 1R50A 3OE1A 4WNYA 4DAOA 1MA3A 1TJYA 4E3ZA 1H4SA 1SB9A 4C22A 1MJ5A 1CCWA 4JBIA 1PR6A 3AVPA 3FPBA 3B82A 2H8KA 4E4YA 5BQ3A 2OVBA 2FZKA 2XSZA 4L8LA 4O02B 2FPIA 1QC5A 1SXPA 4LS3A 4CQJA 1J2YA 3FCCA 4BO5A 3VR6H 5A03A 2QX7A 3EXIA 3B9QA 4FCTA 2FSIA 5A2QA 2FN9A 1V1MA 5EKXA 4ZYWA 3ZDYB 2C5GA 2XUOA 3BHMA 1JECA 4ZICA 1EFPA 2QTHA 5DHSA 1YS2X 2IVZA 3RYCA 5D7NA 3WG9A 3CKYA 4NNOA 2CXUA 4BX9A 1ENZA 2PWAA 4JEUA 2ENUA 1YIOA 3EXEA 3RYHB 4CKBA 4WKGA 4NF2A 1KEPA 1J20A 1OB5A 1SQ0A 3EBOA 2YXBA 2EWVA 1FFAA 3CZRA 1FMCA 3I3SR 4EK9A 1HFJA 5DBGA 2PL1A 2VJAA 3RI3A 4YMSA 1IAQA 3RFXA 4PYLA 4IUBS 1BA3A 3KG2A 1T4BA 4MQ6A 2IW3A 2QRZA 4KP7A 2VJMA 1SXIA 4GMKA 1YZUA 5DMXA 2FJPA 4RKQA 4L76A 3IUNA 3H2JA 1VKHA 5C51B 3T12A 2ZRBA 1CY0A 4FFNA 4QBGB 4UBMA 3UK1A 1LPOA 1D4ZA 4NAUA 5IVPA 4B71A 4MI1A 4BCBA 3NOXA 4MS3A 3SF0A 3DDOA 4M83A 4BBJA 1QE3A 3F8TA 4D6PA 5BWLA 4ZYVA 4ZAXA 2KJQA 2WJ4A 5LYJF 1P6XA 4MQBA 4AJ1A 1MENA 1OLXB 4PX5A 3ILYA 2FP4A 4N5NA 3L8GA 4DSAA 2EGGA 5AM1A 4A6DA 4ACBA 4RTRA 1HURA 1SCUA 4AJNA 1E6EA 3EDRA 3MOIA 4F9EA 3IUYA 1TPYA 1YB1A 3LL7A 4DUGD 1QYVA 4B6EA 3F71A 2AKYA 2BEWB 2C92A 3T52A 4CKWA 4IEFB 3TR0A 1WU8A 3KB2A 3E7PA 4MQUA 4EAQA 3MQ4A 4X63A 4JLJA 4L95C 4CIYA 1J9GA 4LYEA 5FPHA 8ATCA 2FUKA 3NYIA 4UNSA 1TEVA 4B84A 4KXUA 3UO8B 1SVNA 1PL8A 1L5MA 4JLVA 1UPXA 3O3OB 3Q6IA 2BC9A 3MTAA 4LY6A 7GPBA 1GARA 5E95A 4HYQA 1V1RA 1Q0LA 3IQIX 3JYPA 4L4YA 2GZ3A 4DZTA 2RG7A 2JHPA 3DHEA 2ZRKA 1OI7A 4N9WA 4C3UA 1FW6A 4JL6A 1JT9A 1PT6A 1SUSA 1FYEA 5FTKA 5B3KA 1D2MA 2C5SA 4PTZA 1TF2A 4HVCA 3PR3A 5A7FA 3A28A 1MG5A 3LTEA 2P27A 2A86A 2H17A 4QM7A 3EARA 2FPUA 1SBHA 1YUBA 2X1HA 3NLLA 4MKGA 5IF3A 2VQ6A 3D4LA 4D46A 1WCIA 3AY6A 4OP2A 4EEXA 3ZQJA 1LFDB 4XGKA 3SCZA 3G59A 3L04A 3ZWWA 4POAA 2IYVA 1JT2A 1ITZA 2YN2A 2YW9A 5I3CA 1WXFA 3BTSA 5IHPA 4BNYA 5AHOA 2FWPA 2WPNA 5KNLA 3ACCA 4GPD1 1MVNA 3BE6A 5KUTA 1WY5A 1W5AA 4ISCA 4O2AF 5I9TA 5HMMA 1XJCA 5EIEA 1SZPA 2QT9A 3FPSA 1SU8A 2R1VA 2DFKB 1H9BA 1MPTA 3IUQA 3K1TA 4UQOA 2MSWA 2VRNA 4PZUA 3N87A 1F3OA 4D1YA 3H5LA 4P5PA 3LLMA 3DBRA 5CLFA 1XJ0A 4IV0A 3W8FA 3QJ5A 1XSEA 1NXOA 1U8UA 4HQ6A 4M98A 4BE4A 2O0JA 3AL2A 3P9SA 3R0ZA 4D45A 2ZBFA 3WISA 1GZVA 2JPDA 1QGOA 3FGPA 4QDJA 1XCJA 1U28A 1GPKA 3OKAA 5AMXA 4V1CI 4P34A 4E0BA 1PS9A 2G67A 3BB1A 3ETGA 3GLKA 1HTTA 3F90A 1M2VA 1WD5A 1BRTA 3F2IA 1NP7A 4RPKA 3L5OA 1UBHS 5AVOA 1O3YA 6PFKA 4HZGA 4YUAA 4CKCB 1Z88A 1FE8A 3MS4A 4I19A 4LOHA 4N1AA 2REQA 1JLLA 5M5BA 3LQ2A 1NIPA 4P33A 3EB9A 3W8EA 3A4VA 4R5HA 2J59A 2RH5A 2SKEA 1DIBA 5J2TA 2QR3A 5AI6A 2C98A 2H7YA 5ADUS 1TQ8A 2WE7A 1FF9A 1XZFA 1AZSC 1FS6A 2OCBA 3UKJA 4WBNF 5JALA 4K9QA 2CLKB 2Q3MA 3A0UA 2GAJA 2E18A 2VLIA 4J1NA 1VB3A 3T9DA 4DDVA 2IHBA 2IXTA 5ESWA 4MQFB 5LBUA 1FNDA 1P1RA 1Z5VA 4D57A 1TLTA 1OX4B 1FSGA 3DZCA 3K0BA 3ZKWB 1A72A 1KC3A 2YFQA 3L6UA 1G21E 3HMQA 4HPJB 1TZJA 2B2CA 4Q9JA 3V32A 2LKCA 5M29A 4QUGA 4OOFA 1PDWA 3PE4A 3RWOA 3KOUA 4RZQA 5LYYA 2YOHA 3O8NA 4BTLA 5CFOA 5LZ2A 3TPCA 4PLVA 4JBHA 4B73A 3C6XA 3BZUA 4HLQB 5H59A 2HHHB 3ODPA 1O9HA 4B31A 1XFDA 4GIBA 5KTTA 4ZVPA 3LCRA 5EJAA 1JU9A 4N03A 3CUSA 4BZQA 3MFQA 1DL5A 1VLVA 3W34A 3ELBA 1X13A 5GMOA 2PL5A 2PQMA 2C7GA 3JQ9A 4HWRA 1DKUA 1FFCA 3LOQA 3OEWA 3B5IA 4PWZA 1IBRA 4QOEA 1WDWB 1E3EA 4Q3CA 4UD6A 2CLOB 4UUOA 2R7KA 5C5DA 3CT6A 2I7XA 2QVYX 2O1SA 3D4BA 2VP4A 3GFVA 5GJCA 5JLAA 9ATCA 1FFDA 3ZS9A 2I9KA 1EK5A 1XVUA 4GI7A 2RH4A 1M7BA 3L8DA 1OFIA 4NJMA 4V0ME 5F33A 5K6AA 4Q9LA 1HDXA 1CDDA 5K0GA 3VPXA 2PFSA 4IHJF 1PO7A 4JJ4A 4PLYA 1YDWA 3SM9A 1RAEA 3TDNA 1QYDA 3W2FA 2XUZA 3ZHOA 3ZLTA 1XBTA 4FKMA 4JK3A 4BC1A 3RS2A 2ZRFA 1II8A 1UFOA 2HDNB 1E2FA 4PO8A 1T5BA 4Q12A 3EVZA 1A5TA 1T5OA 3DL4A 3U5TA 1GPNA 4LZWA 2HDWA 4BNJA 2F3UA 3H6GA 3WK7A 1QC5B 1XNJA 1CV2A 1I9GA 1J39A 3PYXA 5C3UA 4NX2A 1JFRA 1UPFA 3RVOA 3S29A 4A8JC 2VBCA 5JD3A 1R5BA 2JK0A 4D92A 4BVGA 4LMPA 5NLLA 4F6RA 5J4HA 4OXXA 4QLBA 3LQKA 3OU6A 2IBMA 3IA2A 1JDZA 4DQDA 1CUYA 2XVAA 4N8SA 2EHDA 5I7VA 5MFPA 3E9CA 4V02A 5CX4A 1B93A 3IEIA 1D1QA 3AEXA 3HJCA 1R8YA 4G63A 1UMDA 4DLAA 2M6KA 2MYUA 4JDUA 1HMYA 4FZ5A 4EX6A 4QQKA 1VHDA 3FOBA 3HE3A 2H2AA 3HBLA 1OPRA 2XWPA 4WCFB 1FDIA 5J47A 3PUVA 3W8NA 2WD9A 4ZP1A 1PT8A 2FWNA 4DC0A 1KO7A 2NYVA 2LRHA 4NCJA 1CJUC 1WP9A 2YXNA 3FPAA 3LF2A 3MRTA 1JHDA 5U4QA 2RGNA 3JCZA 1G8FA 2JLXA 3ZWPA 1H4TA 2NQ2C 1D9XA 1XZBA 1XZQA 3C8UA 4PXYA 5BVGA 2X7XA 4ODIA 3SJBA 3N76A 4JQSA 4JIMA 5ESRA 3P2IA 5JISA 5TIIA 2A9VA 1XXLA 3P9IA 4UZFA 4YDHB 2QD5A 3VO2A 5KJFA 4AQ7A 3UJ8A 1Y6RA 3OFJA 3ZDRA 1RYNA 4G4SP 4LF6B 1GAQA 3MSCA 1RQXA 2C7OA 4QOSA 4D4HA 1DUSA 3QSGA 4B3RB 4RVHA 4GPIB 5CVDA 4J0DA 3WX0A 1AKWA 2VAPA 4KDRA 4RF5A 3R09A 1YASA 3K0FB 4AO8A 3PB3A 3Q1KA 3TG2A 1KMIY 1C1XA 2R4QA 2EATA 2GPYA 5L3RA 3RJZA 3QVOA 4IS2A 3IEPA 3ILXA 5EKSA 4R01A 2ZETA 4PRKA 4KN5A 3SIPA 2QSUA 3AFMA 1UOQA 4IDBA 1HZZA 2XUQA 1N92A 4KO4S 4Y0AA 4UOEA 1E66A 1P39A 3QTTA 4LQ4A 2GI4A 3AG5A 4NBTA 4RHFA 5DLQC 4D41A 2FMFA 3M4ZA 3MMSA 4OF4A 4RTNA 4IV8A 4NZOA 4TTSA 2IUYA 1MVLA 4MRPA 3TB4A 5LOVA 4WKOA 5EXSA 1L5LA 3U7QB 3D8BA 1GGJA 4GLLA 4ZV7A 1E96A 1NUPA 3C15C 4DW8A 1J1IA 3CLRC 1P7YA 2BMJA 2L0XA 4H7KA 4M9XA 4E94A 2VHEA 4OUDA 3GLFB 2O2HA 1CS0B 1FP2A 1JLHA 2B5WA 3O8DA 5EERA 2FUG6 3TE6A 4DQKA 4XH9B 4K3UA 2C7RA 4CLEA 1L5WA 1U1IA 1GL9B 2WJAA 3GPDG 3OFKA 1VJGA 5FTJA 3QVGB 3RF7A 4UUPA 1I7DA 3BFPA 3CCBA 3WZMA 3CRQA 3W06A 4ENUA 5TQ2B 1VLLA 2QTCA 5AVQA 5LFAA 5LMCA 1TU3A 3ER8A 3N0VA 5IULC 3NDPA 3TIFA 4M9QA 1IZ7A 2HMVA 2IIVA 1EK0A 1U8CB 1W5EA 4PFKA 5JCJD 5E0OA 3E7WA 2C0CA 3DZHA 2CHEA 2W8ZA 4IDHA 1EK2A 4IMRA 1OI2A 1Z17A 2Z1MA 4WKNA 1Y3AA 3HCAA 3WK9A 4KJXA 4F1KA 2C5HA 4LRQA 3SYMA 1XAJA 3VZCA 1ISSA 3SG0A 4HVAA 3NKLA 1AV7A 5L8VA 1XEAA 2R62A 4Y0VA 5ESXA 2YMLA 3CEMA 4LV6A 2QY6A 4N40A 3I34X 3LQFA 5BXYA 4O0LA 5DBOA 2AOUA 5AQ1A 2YZNA 2CBGA 5AHWA 1W88A 2OENG 2OILA 3NUGA 1LPAB 1V9LA 3ZQ4A 4CLOA 3E58A 3S28A 4D8UA 4KPUB 4INOA 4R51A 1MO5A 2A1UB 3A1TA 5JI2E 1DCKA 1QANA 1ACMA 2PPVA 1Y5RA 4FFOA 4HEJA 2QG6A 1X8JA 4M7WA 5KCMA 5SYAA 4F56A 1GSHA 5BNIA 3GDOA 4J0FA 4P7FA 3BWXA 3E7DA 4TXLA 4TVOA 5GIOE 1F9AA 1T3GA 3GBVA 5EE9A 4A6PA 1AB6A 3IJEB 5EJFA 4PSUA 4R05A 3EG9A 3JQEA 4LYGA 2IYSA 3PFIA 2OK7A 1S02A 3DW1X 1D6SA 2Z1DA 2B2NA 4R1NA 5KSPA 4JT4A 3PXEA 4N49A 2BOVA 4MW6A 1JEEA 1CFZA 3GFFA 4P54A 3ZWKA 2OBNA 5CITA 4LZPA 3HY3A 1NURA 2OHGA 2BE7A 3AEKA 2PSSA 1EM8B 2FPXA 1ZD8A 4PM4A 5BSTA 3RFFA 4DLNA 5IZCC 3A04A 3IVRA 1TVEA 1OWLA 5DISB 2INGX 3SIXA 4POOA 1V5FA 2I5PO 4FJ1A 5ITZB 1PR1A 3NP9A 1GNVA 3AVXA 4RD1A 3V00A 1UFKA 4DUGA 3H17A 4PGAA 5CG1A 5E7JA 1RHJA 5A7GA 3FZQA 5JJ5A 1BGWA 2AMJA 4BMNA 4ZJZA 5JCXA 2G8LA 1T4GA 4ZQEA 6Q21A 1T2AA 2VNHA 3M3HA 4OAPA 1VYHA 4MKFA 4UTXA 5K4GA 1TD1A 5A4AA 1A96A 3WL4A 1D2RA 2IOFK 2OZKA 4EY3A 4BNIA 3O47A 1CEEA 3KKQA 3EXAA 4LWQA 4XCQA 3Q87B 3C8DA 3DBLB 3V8PA 1P9RA 4OXIA 4CF4A 2HA2A 3CEAA 1P60A 3HCPA 2AC4A 3EE6A 1GAXA 3CUEF 1KERA 4UHHA 3GHHA 4Q9AA 4WX2B 4DZRA 2A30A 4RO0A 1UZUA 2AMYA 1UKZA 2VZEA 5CNMA 4EVIA 8LDHA 1N0VC 1QMGA 2IYLD 3AP1A 1W1IA 4EJFA 1QS0B 5BV1A 3VHXA 2PANA 5KHAA 4L5BA 1LNZA 1NMQA 4KBYA 4CUKA 2O59A 1LPSA 4D3DA 4E70A 1YZVA 5IEJA 5F35A 1XZAA 2QGNA 2HV9A 3T3PB 1OMOA 2JGEA 2W48A 3LBIA 1VPEA 1INLA 1RR6A 1AKMA 1VKZA 2I2AA 3O4FA 4IQ8A 5LZ4A 3BF7A 3BXFA 4JJIA 4QDTA 4TUYF 3BG5A 1J99A 2A6PA 2IEDA 4IHKA 4RBNA 3QVWA 5K2MA 3ZNOA 4Q37A 4TL6A 4A92A 4LJRA 2FPLA 1UP4A 2FXVA 2FMTA 2I3DA 1L4FA 1V43A 1JJ7A 1V4VA 2TMYA 3IPLA 4AL4A 4ND1A 2HHAA 3D7NA 3WIBA 1A1SA 3ZWQA 4HXYA 1Z4LA 2KPOA 1LUAA 1J0DA 2VBFA 3OT1A 4OM8A 2P9GA 2UVQA 3UH0A 2P6RA 4GPEA 4QEKA 4XSVA 2J3HA 1V5EA 2QAIA 5IKXA 1YR9A 2QF7A 4M8IA 4QELA 1XKLA 2DH6A 4OKNA 1W2GA 1J56A 2GD0A 4FZJA 4QPJC 2XBUA 2OHIA 2H08A 3CLHA 3QX3A 1IWPB 1LPPA 2I1QA 3BJRA 3GMDA 4W9MC 1B0UA 1H2XA 2O5CA 1G16A 1X80B 3B2NA 3K32A 3LGSA 4KVFA 3BZWA 5BV0A 3KSUA 3O4HA 4ZEVA 2Y9MB 1EMDA 3UW3A 1XQYA 1NAIA 4MW9A 3WKBA 3BVPA 1IHPA 3M6UA 2XCIA 3B2QA 4KU4A 3H4VA 1C3VA 3ESRA 2Z09A 5IU6A 4X7PA 4YO8A 2ZB2A 4C2BA 1ISRA 3ET4A 4OHPA 2G72A 1OVMA 2P4UA 5KJEA 1SEVA 1ULTA 1AQUA 1XO1A 2PT6A 3D2LA 4WCDA 3CXUA 1L8OA 3KXLA 1Q22A 2RAFA 4FE4A 4JP1A 5AW3A 4FYHA 3KV3O 1DEOA 2JGFA 2V6JA 3QEMB 4I2VA 4KNWA 4CR8A 3MHPA 1QG2A 1JV2B 4M0DA 3WGVA 4YRZA 1BD4A 5DHAA 3LKBA 2C7QA 4F2PA 5A5FA 4H1HA 1LX7A 3SFTA 3QM1A 4KUEA 2F00A 3O4VA 2HIAA 3KOMA 5H9VA 4HUJA 2YWHA 5J2UA 4QQ8A 2B1IA 2BFOA 1KJZA 3FCUB 1FP6A 2AI3A 3H2YA 3PC7A 4RKFA 2IV3A 4AUKA 4E6PA 5LJLA 3EGDA 4LECA 1R0XA 4BBAA 3K0SA 2GXAA 2Z5GA 5E3IA 1XJQA 2OXRA 1YJAA 3PKJA 3W79A 1N6NA 4BX3A 5L3SA 4IFTA 2QRNA 1ORWA 1U90A 3BFKA 3K3PA 2XB8A 2WHQA 3E0QA 3FPJA 1KEUA 4DWOA 1GQQA 4MJLA 3RR2A 2P9TA 3OPVA 2YXDA 4LCEA 4V1CB 1KI3A 1LSJA 3GVCA 3OLZA 5I48A 5F2EA 1S01A 3Q3IA 4C4ZA 1OH6A 1N8TA 2QJRA 3QUCA 1CJCA 1BMDA 2O54A 4CL0A 3NFYA 3BHNA 3HI4A 1T4CA 2LD4A 1IG0A 3TQFA 3HABA 5A4KA 2WJ6A 3S1SA 3IBSA 5DYGA 1DG3A 5JVDF 1PKXA 1CETA 2XRFA 2EFHB 2E9SA 3B7GA 4DR5B 1RYDA 1UBMS 1H42A 3LW7A 4UQPA 2TYSB 1VJCA 1LDBA 4F0JA 2YVQA 2YOFA 5CH3A 3A25A 5K8JB 3NHLA 4JJGA 1Y1LA 2X0KA 2C4HA 3W8DA 2Q49A 1NY5A 2XWSA 5JQGA 5D6NA 1FYFA 4XIGS 2Y92A 4O8ZA 1ONNA 5FO0A 4D3YA 3EY9A 3G2IA 3ZZ1A 2OR3A 1HFEL 3GWGA 3QEKA 2GS9A 1S2MA 2Q4RA 3PDCA 4OFXA 1CJSA 1UMCB 4ZD6A 3KRTA 1Z16A 1ZHHA 2CJXA 3R8XA 2HA4A 5TGTA 2XYRA 3WJ1A 1W36D 4ZPJA 1WW2A 1JQ3A 3T3NA 3FG9A 1KPIA 4MW1A 3ORQA 1WSBA 2C1ZA 2EZ4A 2QUAA 3DHNA 3K9QO 4MHSA 3A3YA 4ZANA 3B3FA 3VYRB 4BU1A 1HG0A 3EBLA 4C89A 3TOZA 4JVSB 5BT8A 5CD9A 4WV3A 1YDGA 1L1RA 1R5OA 4ZK6A 1W88B 3EQ2A 2OD9A 4KE9A 1U0BB 3L05A 2DR3A 5DI3B 4MDHA 4PN3A 1UPBA 4UAVA 2SCUA 1NJ6A 2QTRA 3ABSB 1EFLA 2K4MA 1LX6A 1ZH6A 3DVLA 3E7XA 1NW5A 4B2LA 2F55A 4CLHA 2IBSA 1V9SA 3KPUA 1EUCA 5T41A 2FPSA 1SK9A 1E2GA 3MWGA 1EVIA 1CNMA 1E5DA 1PZXA 1Q84A 2OBYA 2PRKA 3GRFA 5REQB 3RIEA 1YQDA 2VQEB 1COWA 4JGGA 1RHUA 3VRHA 1VBNA 2X0EA 1P2TA 3OFVA 3QVVA 5KNCD 5I7HA 4IGFA 4XR9A 4E6EA 4KPEC 4CMGA 1HE5A 2G09A 1WTAA 4OMCA 3U7IA 1K3FA 1N3YA 3W6PA 3W4JA 2X42A 1BEEA 1A82A 1JDPA 3L3BA 3LLUA 4U1RA 2W70A 1PZMA 2D2VA 1ZGGA 2HMUA 4GZ3A 2VXYA 2QRLA 4J7UA 4MARA 3SHQA 5JT1A 4PZZA 1KRWA 1ATIA 2JI7A 3CLTC 3T15A 1DRJA 4XE5A 1PBTA 3RUAA 3JATA 1J9ZA 2QZPA 1KMNA 3OTQA 4MCAA 4UXIA 4CV3A 2COKA 4XFKA 3CRZA 1UPAA 4C2AA 3K09A 2RGGA 1JQLB 1G1AA 1XKQA 4TKLA 3SLKA 1L4MA 1D2AA 1WZCA 2KW5A 3N8HA 4JLMA 4GX2A 3U0VA 4KRGA 4WXYB 1UBLS 4JEIA 2CV1A 1BFDA 2G9UA 1O77A 1XQ6A 3HB7A 4UASA 1Z36A 3WHIA 1JI0A 2QTBA 1PRYA 2HRBA 2VF4X 2XXBA 3A9CA 2GKGA 1DG1G 3R0XA 1NKTA 1UKEA 1JA9A 1O6BA 1YS9A 5FRDA 3ESDA 2B9EA 1XTVA 1AKNA 3DYVA 2ORED 4NPAA 4Z1MD 5LPNA 1GL7A 5F77A 1D6MA 4B46A 2J9RA 3K2IA 3RQSA 1WB6A 2F1RA 3CH6A 5GONA 1BJRE 3I5YA 2P40A 2VFAA 3GJXC 3WZ2A 1K4KA 4RXMA 2HAEA 3ENVA 4YRMA 3DDCA 1J8FA 2QNBA 3H5AA 3IP9A 4V0LA 5FQOA 5I5EA 1JFTA 1N6PA 2UYQA 3Q88A 4BFCA 1YV9A 1P72A 4HOYA 1BTOA 3E4DA 5DTQA 3UHOA 3HU5A 1UZMA 4YDRA 4C04A 5ENVA 1RYFA 3GYBA 3LKDA 2XZPA 1B41A 4QFCA 3MOSA 4IG9A 3AOGA 4CMEA 1FP4B 4PPGA 1GAEO 4JZYA 4B2YA 2GLUA 3I9NA 4OY3A 4RADA 3T95A 4DZZA 1GG5A 2G0AA 3M1YA 4RVFA 2VHTA 3NHSA 4XJTA 2CDRA 1XHEA 1EGMB 4K6HA 4KQIA 5TY0A 2HCJB 1U0FA 2HLDA 2XTMA 4K28A 2EKLA 3FSJX 4LMBA 4ENVA 4ZQCB 2HCFA 2EX1A 1ZM2A 4CDMA 4E32A 4DR2B 4XIJA 5AFSA 2RHDA 2CN1A 1CFJA 1GD1O 3FKQA 2VXCA 3D7RA 3FWHA 2J5RA 4N76A 3NANA 2RE8A 4JI1B 3R5SA 3KXIA 2JCVA 4NU8X 5ABPA 4EG1A 2O50A 5THXA 1ZNWA 2OPBA 3O2SB 4K05A 2ZTVA 4TWJA 3KQUA 1TJ4A 2PUHA 2QOEA 4EBFA 4WVLA 5K0SA 2CJFA 3D7KA 2FPMA 3I4LA 3KJXA 5HOQA 1VL2A 3GH3A 2XUGA 1HDYA 4RK6A 3RARA 3VTAA 1P1BA 1T9ZA 5ALGA 4IJWA 3C7CB 3RS8A 2OVFA 2Z2IA 3WGHA 4GOXA 2EZ8A 3LJKA 5AICA 3LE8A 1C3LA 1NLUA 3AJEA 1Z07A 1E98A 2VHZA 5TMEA 1R9JA 1VE5A 5E1DA 3WL3A 1YZLA 4BIMA 1V71A 4IQFA 4EYQA 1PLJA 1L5OA 4KFUA 3QKRA 1YL7A 1XDBA 5CYPA 2WNIA 1JHUA 1NUSA 3PXBA 1JQ5A 3LQ4A 3CONA 2A5LA 4G1UC 4OQDA 1GM5A 1J24A 4LGYA 4RZXA 2I29A 5DP1A 4GT1A 2NG1A 4UNNA 4Y9RA 5DXAA 3RVDA 2NVUB 2ZJOA 3EG5A 4L9AA 4OHYA 2UUPA 5FOSA 2CBZA 4A73A 1NN5A 1KDYA 1N36B 2OXFA 4JB2A 4JSTA 4NQZA 1XZMA 4LRTB 4C20A 3LXUX 2ZWPA 4URZR 4XX0A 4J29A 2OO5A 4LRWA 3S1LA 3HC7A 2MIIA 2A14A 3RHZA 4W4TA 1QPBA 3BMQA 4FB5A 1MJHA 2ZT8A 3ODGA 3QBEA 4TKVA 5JRJA 5JHGB 1N7GA 3K72B 4XD7A 1QUFA 2R68A 5HMLA 1KAMA 1CY2A 1TADA 3D6HA 4FYVA 5JBIA 3HR7A 4ER7A 1E1NA 1SHZA 3CNQS 1H9AA 4J9VA 3ZX5A 1EVEA 1S8NA 2C04A 4HDMB 4EVSA 2HN9A 1Q0PA 5DVZA 1P19A 2CHQA 2NPIA 4DBLC 3IUBA 2CNNA 4H3SA 1G5RA 1OFHA 2PU7A 1JIJA 3LKZA 1DRVA 1DRKA 3NT5A 5LP1A 1RC8A 4JI8B 4ZALA 1X39A 2JIOA 1GZ3A 1W9HA 3GNTA 1FQKA 1V48A 1PQUA 3COWA 1FYVA 4IDQA 4JHLA 4TMKA 3CR8A 4AJEA 1VLMA 1C30B 3DE6X 4TZ0A 2R6CA 2HNAA 4GI5A 4GLBA 3HLTA 3P0JA 4WZBA 4I81A 1G2QA 3D54D 2R7NA 4HN2A 3KSAC 5FHRA 4Q3DA 1FNNA 1HH4A 3MJVA 4JHXA 4UM9B 5C5IA 2X23A 2CDCA 1L8QA 4R8SA 4GEKA 4W5TA 2VWPA 3EN0A 3FCYA 4GWKA 1S1CA 3REGA 3V3KA 2WZQA 3AQIA 3DHYA 1MEOA 4IZ6A 2WFMA 4KODA 1IJFA 1JXMA 3NAQA 3UWPA 1JHXA 2ZPTX 4QEDA 2XNDD 3NBUA 4BBZA 1TK3A 3IRVA 1MO4A 5ILOA 5M2QA 3OTGA 3WR5A 4PG5A 3K2QA 2WBLC 1O6FA 1HNWB 4K9DA 3AHDA 3JQGA 2Q9AA 3IXMA 2C61A 5FL3A 1KQ3A 3LD9A 3VH4A 4YEDA 3USES 1UIRA 2P3LA 2NPFA 4DCMA 4TWRA 3I8XA 3TTYA 2ONCA 2Y1WA 1Y8AA 3BA1A 1ESMA 1XLVA 2EQ5A 3BMNA 3LHDA 3NNDA 4HXGA 4OH7A 5BOSB 1XU9A 5F1KA 5B53A 3ZHSA 4Q4HB 3MYRA 3KKNA 4HTFA 1DX4A 3HJNA 2GTIA 3ZNNA 4ADSG 2I62A 5ECGC 5T64A 4MWBA 4MA5A 1NW9B 1PEDA 4GECA 4PNZA 2WZDA 3QXJA 1E1KA 2QLNA 1OI4A 4ND4A 4WXPA 4B3IA 5K0EA 2IODA 3LQRA 1NQOA 4QIHA 1C50A 3VOBA 1F2UB 4EHIA 3ASVA 2YICA 4OI0A 2C2HA 3F6RA 4B3SB 2YS6A 3I61A 5JDIA 4UVGA 2JBHA 1A9XA 4YMWA 1LK7A 5EOVA 3RSSA 2JANA 4P80A 2WFZA 4RX1A 1QNLA 1XTPA 1Z4JA 4AQDA 3EIUA 1R9MA 2CHGA 4J2HA 3C14C 3PUWA 2PD4A 4KQWA 5F3DA 2HH9A 1D2EA 3B85A 1Q1EA 2XMGA 5H02A 5H80A 1AXRA 3SYLA 5CHYA 4BRUA 1QIHA 1JYFA 4F3NA 3R0VA 3CNLA 5EXEA 1SA0B 1CJBA 1CW2B 3QVXA 1MC8A 2R60A 3WK5A 4QO7A 4ZCMA 3IE0A 4M49A 1EVLA 2VKTA 4X90A 2CEKA 4P31A 3GUZA 3U9SA 4B6FA 5A02A 4NU5A 3AR6A 5EP2A 1U9ZA 4XKJA 5CFMA 3HVIA 2B6HA 3DMHA 5TVKA 4MP8A 1LB1B 4UEJA 5F1OA 1C1DB 3PNVA 1GU1A 1XNGA 1ORDA 3I73A 4CIDA 2CYAA 3EFHA 3NRJA 1MV5A 1TGYA 2QU8A 2F1KA 3ITNA 3FWNA 3ZXSA 5ER6A 5B6PA 1E32A 3LDUA 1SC9A 2LIPA 2VUIB 5D86A 5KHOC 3E9MA 4RLHA 5GGXA 2P35A 3ILSA 1VG1A 4M46A 3VNSA 5C81A 1IMJA 3COSA 4IQ4A 5DN6D 2ZJBA 5I4CA 2J6IA 3FROA 2CLIB 1ECBA 3E5RA 4DYDA 3HCWA 2DKOA 4EHBA 1V3QE 4AJ9A 2PSHA 4ENWA 2HSJA 2ODBA 1GQ2A 1P7ZA 2ZBQA 1VMIA 1QDEA 2JKZA 3KE8A 2V59A 2VRCD 3UC9A 2CXRA 1L7MA 1KKLA 2Q5EA 3QVKA 1QIGA 4M53A 1RAHA 3WSWA 1ABEA 4JLWA 4S3MA 5EAIA 5FNZA 5A1TA 3QXHA 4IXTA 2GBCA 2PX3A 2WAOA 1SQSA 4W99A 5AOAA 1CJTC 2HLPA 4UBKA 2XUPA 4NR0A 3QKTA 4RVUA 2WK1A 4KLZA 2W37A 3BSSA 4RPIA 3PCRB 3W9BA 1M34A 1LBSA 1SIBE 2QSJA 1Z63A 1KMMA 2XBLA 3PA8A 2IEGA 1U99A 3T41A 1M6VA 3C6BA 3OETA 4D81A 3OZFA 1Z5UA 1MW9X 2J6CA 1YFJA 1ND5A 2O7VA 4MUEA 3KWMA 1SVWA 2C8LA 3N0RA 5K99A 3I6IA 3GH1A 1RXIA 1WMBA 10MHA 1ZXLA 1PSWA 2ZPUA 2JAQA 1KNXA 3PNYA 1L4NA 4DIDA 4YFYA 1FSFA 1NXQA 4GLOA 4B3HA 5FX2A 3ETHA 1C1HA 1T0HB 4F3CA 1E0DA 4O2AA 1M7GA 5CVCA 5EP4A 1YFLA 3QWAA 3FVWA 1LLDA 1FPQA 3MWDB 4MS1A 3EZNA 4UC0A 5EIFA 1U2GC 3Q1LA 2HW8A 4PC2A 1J1ZA 2QZ4A 4Q9NA 1ABFA 2ZSKA 3IOEA 4U9UA 4YS6A 1UBGA 1MMFB 1X1EA 2IYNA 5CFLA 5KOIA 2FEMA 1MQ8B 3GZNA 3BD6A 4IOLA 2PBZA 4QNMA 4D4MA 3I1FA 2AC7A 4XWKA 1U3VA 2WUFA 5COQA 5JANA 4EELA 2VDWB 4MR9B 1QE0A 2OT3B 5FIUA 5KSZA 1UL1X 4KAFA 3MUEA 3TNFA 5LQRA 3BQMB 4L22A 4ETMA 1IK6A 3GCWA 1ES9A 2WA1A 3Q40A 3TR6A 3TBKA 4A27A 4B3MB 3MRXA 1LWNA 1DKPA 1MT0A 1ODLA 3F8WA 3MMXA 1KSGA 4C0HA 2AR0A 4RIEA 3R7SA 1E9EA 3A6KA 3GZ4A 3PWTA 4YGXB 3WXMA 2HTFA 4RHYA 1KL7A 4J4BA 1E5LA 3PYMA 4M1WA 1Y8ZA 3PPWA 2YZKA 3VVBA 4O3MA 3JWGA 3P0IA 1R4AA 3H0CA 1E7MA 5HQ3B 3RADC 3T7EA 3VOSA 2HL6A 1AUXA 3KL4A 3NHPA 2DPLA 3VVLA 3SS9X 5KOJB 2CL0X 3CN9A 3NHYA 4FBGA 4CQMB 1KE1A 4PN7A 1QIDA 3KALA 1WU7A 2XB9A 4KXVA 1R16A 2R6R1 3A6LA 3IPXA 1U7DA 2FX3A 3EXIB 3HDYA 3R5TA 1WWKA 3QP9A 1X1AA 4FQ8A 3K9NA 1NTRA 2B7BA 4U4AA 1LZKA 3BMCA 4DSNA 1XTBA 2B20A 3RYCB 2X41A 4RJIA 1CUDA 2ZYUX 3DWFA 5MN4A 4AYTA 2VHWA 2ZJZA 3KTAA 4RS3A 4ZI5A 4YLGA 4MVJE 2JD1A 2JHCA 2Z4SA 2CJPA 2VL7A 4QUJA 4CDGA 3LKVA 1R6TA 2G6BA 4QPDA 1BQ3A 3KD3A 1VHQA 2PV7A 1QH1A 4PPFA 1X3LA 2EFCB 2IP1A 4ARBA 3RIHA 1IOWA 1P7VA 4O4JA 3U7GA 3RT1A 1EXWA 3RT7A 5HKAA 2A9FA 3EVEA 2VUHB 5CT6A 1MABA 4IBOA 2W6JD 3DGEC 1XL1A 4P08A 4CHTA 1YULA 4DT1B 6REQB 3K6SA 2R0QC 1J06A 4B32A 3FNQA 4K8RB 3IEXA 3QI2A 5HIKA 2ESRA 1V7PC 4YJ2F 4X3CA 4RVSA 4F5WA 4F46A 1PS0A 5TMBA 4KG7A 2BFBA 3N3AC 4IJMA 2ZRIA 3NYWA 1IBCA 4F84A 1CUZA 4LBZA 4F8YA 5MF6A 1PNRA 4EZEA 1C9EA 1ZLYA 3AVTA 4P4NA 2XODA 4R9NA 521PA 1QDLB 2OFPA 4RAQA 5B6JA 3GJSA 3HV0A 1MX5A 2TECE 4NABA 3RSCA 3MNFA 4X94A 2C3UA 2VHJA 5FA5A 3GLGA 1TT5B 4HD8A 5FLXA 1OLUA 2Z8YM 4PNHA 3CE6A 1LW7A 3QFTA 4P9NA 1I01A 1Z38A 1ZZEA 1O89A 3JVIA 4BFTA 3WRXA 3LT1A 2J1LA 3BSYA 3PPVA 4MKXA 4KCGA 2F1JA 1HXHA 2EU8A 2YDXA 4CR7A 2C8KA 1DIHA 4KZKA 3AHEA 3OURA 5FPSA 1QPGA 2I6GA 1TDJA 1PFQA 1FC0A 4WIAA 1Y6QA 2FX5A 4YRCA 5HKLA 3ZUGA 1RPZA 4TUYB 2GZ2A 4XM1A 1MXFA 2NO1A 1J33A 2P75A 2ES4A 2XRMA 1VPVA 2FB9A 4I99A 3FTEA 4BLQA 3IQXA 4MSUA 2JFHA 3HO8A 1Z25A 4F4UA 2WTBA 4P4TA 3WL6A 2HR1A 2W5UA 4BXOA 5HKKA 1DTWA 4AMYA 5HKBA 5E2AA 5B7QA 4TTQA 5BWOA 1TCUA 4WMLA 1WCIB 1E7WA 1Z4OA 3X1WA 2IQIA 1HTBA 1B26A 1FDOA 4LX8A 3OWHA 4YAIA 1H5NA 3OOJA 1DI0A 1ORIA 4X92A 4AICA 3HACA 2H1RA 2EP7A 5FNVA 2DY0A 2Y71A 2RC5A 5KJ6A 3I3OA 4RM3A 4CI9A 1NDQA 1NQ5A 1V26A 1WCYA 2OBLA 2VBIA 2P1RA 2QE6A 2VSXA 2W6IA 3DTVD 2P9FA 2W2OA 4PIMA 1KY2A 1E3WA 3A1CA 1Q0RA 4KO3S 5AK5A 5ED0A 3T9AA 5CDHA 1P9OA 3R4VA 4MPTA 3RV4A 4KIGA 4R40A 4BDTA 5B64A 2QRMA 5JJIA 2FPGB 3EXHA 2O7SA 1N6LA 3D8UA 3CWCA 1VPLA 4RVCA 4MB6A 4H0FA 1T36B 4XDHA 3U44A 4IFEA 1QP0A 3CW2A 3BL8A 3O82A 5K6AC 3T1YB 1CRPA 3KVYA 3HBFA 4YRQA 3B5EA 3IVCA 3JARA 4IDNA 4NCXA 4PAOA 1XMIA 1YONA 3ZN2A 4D3XA 4RE6A 4NENA 2IUFA 1NVTA 3A10A 3GJ8A 4DLLA 3IAM6 4FLFA 3M1AA 2B7CA 4OGFA 1OB2A 3G82C 3QKUA 1F4PA 1TKCA 3NBQA 3PQ7A 1XELA 3SEAA 5JTTA 3OIYA 3QYFA 4C0AC 4RJLA 4UHJA 1UKYA 3Q98A 4ARVA 1FVHA 2VT2A 1M2NA 3KWLA 2ZYDA 5LOVF 4Y2TA 3ZJVA 2ZJYA 1ONPA 2XDAA 3LP6A 5LMZA 4UE6A 3G5TA 3CUKA 4DMRA 3TQTA 1QFYA 3HUEA 2P2LA 4PGFA 3PRYA 3NS7A 1HDCA 4Q9HA 5LIRA 4OLBA 2NZYA 2Q9UA 3A05A 1W0CA 3TLAA 2RAPA 2QTGA 4AZ0B 2P6UA 3TL3A 4DQ0A 1IM5A 1Y3DE 4LSMA 3Q3CA 2VAMA 4JVMA 5E9JA 5JZOA 4XQGA 1CERA 1JB1A 2ZJAA 5KVQA 3RUCA 5K8TA 1GNTA 3QVTA 4JOSA 1MC4A 4FZRA 3EZ6A 3BS4A 3ZXXA 2XF2A 3ME5A 4DLPA 2WU1A 1RMYA 4KO2S 1B3BA 1C4KA 1L5HA 2W2VA 1UT5A 1QZTA 3KU1A 4Y9DA 5EZYB 1E89A 3D4PA 4MWSA 5IBQA 3W5SA 421PA 4DKXA 2VK8A 4HUTA 4PYNA 4WWHA 4Y6GB 3MWDA 3IBGA 4MS1B 3OZGA 3PNLA 4B3GA 3G3EA 1B1AA 1CY7A 3ZV4A 4LN1A 1OIXA 4GYKA 4QO8A 1RFGE 1AIPA 1N7JA 3C7TA 4WL0A 4YP9A 4QOGA 2QT1A 1PFVA 1I14A 1Z68A 2WQZA 4V0NA 3WGKA 4F21A 1JZSA 3U3OA 1JHMA 1E2IA 5T57A 4AY2A 1OH5A 2O3JA 1U8FO 2CUKA 4NU0A 2PTHA 1XZKA 3UC5A 3SKYA 2Q62A 3ZY5A 5GJVC 3V1UA 1D8TA 4Q1FA 3WRYC 4JJZA 2YV3A 1GCOA 4NMWA 4KXQA 1KJNA 4MR8B 1NL3A 3AEUB 1U9IA 1NF8A 3RBAA 1X7WA 3OP4A 3T1QA 3WMXA 2KYRA 2PUAA 2VF2A 4DV6B 1EVJA 4CKYA 1G38A 1AS2A 3PNKA 2PG3A 3IAXA 2WSYB 4TQUS 3MTQA 4PG4A 4I1OA 4Q34A 4DNOA 1NVWQ 5ESDA 1G3MA 1WLSA 3Q7SA 4M88A 3E23A 3D5EA 4UVHA 2PFGA 1TTHA 4W63A 3SBDA 5JXIA 2GERA 1L7BA 2FW9A 2GCIA 3ROXA 4Y2XA 3CNHA 4BNTA 4MRMA 1QBKC 2P3QA 4M38A 3F49S 3H5VA 4GFDA 4RH3A 5U4XA 1NBAA 2VH1A 4YJHA 4JLSA 3FOZA 4X7MA 3ZY6A 1PX0A 4B0OA 1PD1A 2D7CA 3FM9A 1RP1A 1E2NA 4FN4A 2GFQA 1ZLXA 3ROMA 1ZJ5A 3CEPB 3H42B 4OIFA 5H68A 3R3HA 1P0QA 3TZ6A 1MX9A 2Y67A 1M0SA 4MUAA 5A4MS 2FWIA 3EXFA 1SG0A 4R83A 1G59A 1UMKA 3NALA 4U2KA 5HYVA 2FW7A 2P5TB 3BGIA 4X61A 1R0KA 1OXXK 2HK8A 4TLCA 5HCNA 5C0OE 4TL7A 2J4DA 4RK4A 3NIGB 1E3TA 4ZVKA 3SJAA 5CFPA 5AVVA 1MNQA 3H2BA 2ZRNA 1K9SA 4PS1A 3REQB 4AMGA 4BVKA 3DEKA 3CLUC 3OJ0A 4UDYX 1CJVC 2GKSA 2VP9A 2ZUBA 1TJ5A 3DVAB 1FXWF 3F78A 1K7XB 1XOIA 1J09A 1JKIA 3MW8A 3U4IA 5BOVA 3ZD8A 2V45A 2DYKA 3QBDA 3ESZA 2E4WA 1XAGA 3ZDQA 2RCYA 4G25A 3VFDA 4JL8A 2FEAA 4K9MA 1CNFA 3P0FA 3VU1A 4EARA 1N33B 1CR6A 3KB1A 3U48A 1OXSC 2ZRQA 4A0GA 4CEIA 5BY2A 2VATA 3HEAA 5GAJA 2BFBB 4BB5A 1JWAB 4BNGA 2Y05A 3BIWA 5LN1A 1QQTA 2ECQA 4GGOA 4E09A 3V4SA 4WEOA 5L3VA 2P4QA 2R25B 4GVLA 3RANA 2GK7A 3I23A 2ZEJA 3KZKA 3LC1O 1ZGJA 1Z0UA 2FEOA 1HYHA 2VUTA 2XEDA 3DTVA 3K96A 1PHPA 1Y9JA 3L4SO 3NAZA 5DV9A 3ZIAA 3GRYA 2VP2A 3C4JA 1AUPA 2P9QA 1I24A 2AF4C 1VCIA 2YV1A 4Q1EA 2FQ1A 3WIDA 3W4IA 3H86A 1UEIA 1GG2A 1K63A 1EEXB 1YI8A 3D4IA 2DWPA 3QX8A 4V24A 2HY7A 3SNKA 1OZGA 1YE3A 3O38A 3II6X 4EWLA 3ZHUA 1I3OA 3UMSA 1I4WA 1JF8A 1NJFA 3HXKA 4MR7B 4P36A 3ILVA 1IULA 1CUBA 3P9QA 5AKEA 4YCMA 3AR8A 2B4RO 3EA0A 3OH8A 4HGNA 4Q3NA 3RAJA 4Y98A 5JI3E 2DLDA 1R12A 2KB0A 2OLJA 1YOVA 4UM7A 4QM6A 1N32B 2J4FA 2I7VA 2BHTA 2WQ6A 3UWSA 3K1ZA 4ZOLB 4NOLA 2IZ0A 3F1KA 1M1YE 1TQ6A 1UJ5A 3E2PA 4XA8A 2Y0EA 4K03A 4Z1MA 1UFQA 1KWKA 1YH3A 3LIIA 2O2JA 2EBHX 1K6EA 2VK1A 3C70A 3OEHD 5EJ4A 1BW9B 1LLUA 2IYPA 4WLEA 4L7QA 4CU2A 1JSLA 2QG9A 3QOXA 4URYR 5CM9C 2OORA 4C5CA 3NH9A 3UWOA 1GZSA 2P9YA 3HVKA 3QLVC 3QVGA 3KJZA 1DZ3A 3NBZC 2IGBA 4U7GA 5GM2A 3WWPA 2BM8A 1QYRA 2OZEA 3LX5A 4KNVA 5HJ2A 3RH0A 3SIRA 4I5IA 3PUHA 1SHLA 3TKYA 1EUZA 4NL4H 2B94A 1RRPA 2QQ0A 1K06A 2G0NA 2Q6OA 5CA1B 2GYYA 3IAFA 4G8JA 2AG5A 4ZEWA 3ZIDA 2JFUA 2FPGA 3I58A 2BGJA 1OC2A 2ZDHA 4BKOA 4C05A 2W2LA 4FCWA 1SVSA 1Z6ZA 4BNVA 5JQWA 1IU9A 2HLNA 1CUVA 4GZ5A 1AF4A 2KLHA 4EY7A 4DWJA 1GUZA 3M6AA 1RYMA 2AYZA 2FEKA 2FH5B 1D0VA 3EFEA 1PT5A 2GZSA 3NO4A 3G7NA 4C78A 1JAXA 1KC1A 2NTVA 1BYUA 4QBIA 1R74A 5EHXA 2J5BA 1H9CA 2H4XA 1P0MA 2MR6A 3FTPA 3IT2A 4TWBA 5LLSA 5GJBA 5DXJA 2A94A 2D2EA 2EQBA 1SQ5A 5E6UB 3MVEA 1FCJA 1ZINA 5FOVA 4UM5A 2G71A 3VR4A 1OLXA 3AZOA 3ZDAA 3IILA 3HGTA 3ND5A 3QFSA 4MV0A 5FR1A 3CVYA 4DMUB 3NVMB 1U0NA 2OLKA 1AUVA 1EM6A 1FYWA 1G3RA 1NOKA 2PMDA 3V9PA 5JVDA 3LVBA 5JFGA 1NG9A 4P2GA 2PWYA 1TW2A 2XA2A 3B48A 3PGJA 2K5UA 2VAXA 2VLBA 4M8NE 4ECAA 3HY6A 1JSCA 1Y89A 2D5IA 5TT1A 1T2CA 5JR3A 1ND6A 1NLZA 2AI1A 5IYZF 1CZOA 3VDNB 1EP1B 1G1MA 5C5CA 4RACA 1DO2A 4UXHA 3IV6A 4LJ4A 5KVVA 3JD1A 3PDJA 2P91A 1ESDA 2DKFA 4MV1A 3VM6A 4BO1A 4B5KA 2EKZA 3T5CA 4EKYA 3O91A 2ZSEA 4Z0HO 2GJAA 1XMQB 1OYYA 3D81A 4P4SA 4PFSA 4E5MA 3ORHA 2Y0BA 4WW0A 5BV8A 1I1HA 3DXFA 1IZYA 4P7GA 4AUEA 4F4HA 3Q72A 5KVCA 1RP7A 1QB8A 2JI8A 4X93A 3RM3A 4RIIA 1A04A 5FFMA 3VTZA 3KQKA 4QBTA 1V8OA 2O2XA 3KR0A 1RKQA 2X0IA 3DZBA 3LX4A 4MXDA 4X41A 1G64A 1E2QA 1RLUA 3OM8A 3WLKX 4N0PA 2JAHA 4KPYA 1JILA 3S8YA 3TTSA 4NBLA 1BWPA 1S6YA 1VXRA 3E27A 4KRXA 2DHRA 2R4UA 1YC2A 3V9AA 4EKDA 3DMTC 4FGUA 1P61B 1E4OA 2X8JB 2C99A 1DE0A 5C3MA 2PR2A 3U4QA 3CJRA 4B9AA 5KJ1A 3I5XA 2HJGA 1VA5A 1HBJA 3HM9A 1RHRA 2W9XA 1ULUA 1OA1A 4PSKA 2HYIC 2V4ZA 1YVPA 3WKEA 1KDZA 3PXCX 1DV2A 1NQUA 3KR9A 4K6MA 4R1MA 5JAPA