1PEKE

Structure of the complex of proteinase k with a substrate-analogue hexa-peptide inhibitor at 2.2 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PROTEINASE K
publication title Structure of the complex of proteinase K with a substrate analogue hexapeptide inhibitor at 2.2-A resolution.
pubmed rcsb
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pekE00
2X8JB 1CSEE 3LPCA 3DE0X 3ZXXA 1KDYA 4LVOA 1KE2A 3H42B 5ARCA 5B1DA 3DE5X 3F7OA 1EA7A 1P7WA 1UBNA 4I0WB 1S02A 4H6XA 1WSDA 4Z2AA 3BX1A 1Y4AE 3SQOA 1SIOA 2PWBA 4AKSA 1GNVA 2SBTA 3D9QX 1Y1KE 1TM7E 3WIUA 5AVKA 1PTKA 3CO0S 1YU6A 2ZWPA 1YJAA 1SELA 3ZXYA 5I9SA 1T1GA 3DDZX 4ZOQI 1BFUA 1SCJA 1WMFA 2PYZA 5ARDA 3GCXA 2IY9A 2XTJA 5FAXA 2Z2ZA 1S2NA 2Z57A 1SIUA 5SICE 1P7VA 2E1PA 1GA1A 3GT3A 3BPSA 1SCNE 1YJBA 5FBZA 1Y3DE 1SCAA 3DW3X 1GTG1 1AH2A 2PRKA 2ZRQA 1WMEA 2SECE 2SNIE 1SUEA 1DBIA 1ZVKA 4GI3A 3VSBA 3CNQS 5K7SA 2X8JA 1KE1A 2PQ2A 1EGQA 2ID4A 1GA4A 2PKCA 5JXJA 4ZARA 1SUDA 1YJCA 1NDQA 3GCWA 1SCBA 1SUBA 4OV6B 3I37X 1GA6A 1PFGA 2ST1A 5JMOA 1TK2A 1HT3A 4C3VA 1SBHA 4WOBA 4K8RB 2W2NA 1OT5A 1SH7A 1ZVJA 1SVNA 1AF4A 3DE1X 1BE8A 2TECE 1NLUA 1SPBS 1Y34E 1NDUA 2Z30A 3VTAA 3TI9A 1TMGE 1IAVA 1OYOA 5JXIA 4NE7A 1BFKA 1Y48E 4H6VA 4NE9A 1ST2A 2SICE 3PTLA 1T1EA 1Y3BE 1SUAA 3L1KA 1R0RE 2HD4A 1GCIA 2ZWOA 3AJ9A 2WV7A 1MEEA 1WVMA 1AV7A 3VV2A 1S01A 3I30X 1BH6A 2XRMA 3EE6A 2PMWB 2GKOA 3VHQA 4KG7A 1TM1E 1WMDA 4AKTA 1SIBE 3DE4X 1GT91 3P5BA 1C9MA 4KB5A 4FONA 3UNXA 4CFYA 3D43A 2Z2YA 4HVLA 5B1EA 1AU9A 1XF1A 3AJ8A 3Q40A 2ID8A 1SUPA 3A3OA 1V5IA 1SCDA 4CFZA 2P4EA 1C3LA 1GNSA 2W2OA 3LPAA 3PRKE 3DE6X 4DZTA 1TM5E 2WWTA 1Y33E 3TECE 1TECE 4JP8A 4B5LA 2G4VA 1THMA 1PJ8A 3QFHA 1TO1E 1SBNE 2DQKA 3DE2X 1PEKE 3SICE 2W2MA 4NMXB 3LXUX 3VYVA 1LW6E 2QTWB 4KPGA 1SBTA 5AQEA 1ST3A 5JXHA 3QMPA 2HPZA 1BE6A 3F49S 1VSBA 1AVTA 3HJRA 2W2QA 3DE3X 1AQNA 3Q5GA 3DWEX 4OMDA 3I34X 1Y9ZA 4M1ZA 3DVQX 2B6NA 1SUCA 1R6VA 1TM3E 1KDZA 2Z56A 2WUVA 5AMXA 4CG0A 1TO2E 2PWAA 4RYDA 2DP4E 2IXTA 4LVNA 5JXGA 3A3NA 3AFGA 3VV3A 2WUWE 2V8BA 1BJRE 1V6CA 1Y3FE 4J94A 1TM4E 1A2QA 1IC6A 3BGOS 1GTJ1 3WIVA 1AK9A 3I2YX 1OYVA 4H6WA 4DWWA 1Y3CE 3DE7X 4C3UA 5FFNA 3DYBA 1T1IA 4YN3A 3GT4A 3A3PA 3EDYA 3DW1X 3TI7A 2DUJA 2Z2XA 1DUIA 1KDVA 4DJ5X 1P8JA 4HX2A 3DVRX 1C9NA 5AVJA 3F7MA 2W2PA 3LPDA 1SBIA 1SBCA 1SN7A 3DVSX 4MZDA 3WHIA 1GTL1 1JEAA 4BWGA 2Z58A 1C9JA 3EIFA 1Y4DE 3WQBA 1R64A 3QTLA 1Q5PA 4OMCA 1CNMA 5CW1A 5ARBA 4WOCA 3T41A 3OSZA 1MPTA
chains in the Genus database with same CATH superfamily
2DU8A 1U28C 3N70A 4IRUB 4ER7A 2P79A 3IELA 1L8XA 3UV3A 4YJHB 2C9BA 3DE0X 2AMVA 3LPCA 2XXJA 4LAFA 5E95A 3U3OA 3V8MA 3HFSA 1IMJA 1RBZA 4BCCA 2Q5FA 4DDMA 3RYCA 1C5KA 4LVOA 5ER9A 5IN5A 1YS6A 1TW2A 2QS9A 1N7JA 1Z45A 3B3JA 1L5QA 1W19A 2JB9A 2R1UA 4K2HA 4F8JA 4V1CI 3BRSA 2W0MA 1GGJA 1R37A 4QU8A 3Q8WA 1RJDA 2J5XA 1WEHA 3VDXA 3AFHA 3FI9A 1NBWB 3W6ZA 1UBCA 3E2MA 3KQWA 3B89A 3M3HA 2CLEB 2YY6A 4JLAA 1GN9A 3BYZA 5H83A 1XVAA 1EP9A 1ZLXA 3OPVA 2H1LA 2IODA 2UV8A 3SMQA 3C4QA 3WJ1A 1RWVA 4XB1A 4IJMA 2XZDA 5T4HA 1JZTA 5I8PA 2M6KA 2V5AA 4G86A 2BE9A 3KP1A 1MAAA 1SUFA 2D0PB 5JFTA 1MX9A 2Y1DA 3D2LA 1EFVB 4GW3A 3TN7A 4NTZA 3KSBC 4LHSA 2V7GA 1RKXA 1PFQA 2F3PA 2XMSA 2W9XA 3F0TA 2ZUWA 3I01A 2CXOA 4YMSA 1XDGA 2J5BA 4IYJA 4M88A 1WVIA 2DKFA 4M83A 3M33A 4KO8A 1QXSA 2Z04A 3U7HB 4XOIA 1Q44A 1N6IA 2CNKA 1SHKA 2PWPA 3F6RA 3KJNA 1P2FA 3N59A 1NM5C 1PTJA 2FNAA 3TPZA 5C81A 1O94D 3A6LA 1ZIOA 3WL7A 3S2SA 4JBLA 4FKBA 4PSDA 2JDIA 2JIMA 2NXEA 4GMFA 4D26A 3OZGA 1KO1A 3SIXA 2C31A 1J8DA 3GLGE 4HVTA 1S2GA 3HSYA 3QPVA 3ZE9A 4GNRA 4MV6A 5HILA 4HRXA 2I6TA 3C6QA 5HQ3B 3X1KA 3ANXA 4FYWA 4NCHA 4Q7JB 2DBQA 4D9NA 3DBLB 4WNYA 3PC4A 3GJRA 1WPGA 1Z37A 2C2MA 2N1BA 2NV2B 3OCUA 4W6QA 3L4JA 3ZH9B 4EL5A 4GZMA 5GIOE 3I73A 4RE6A 5J40A 2BL4A 2Q5CA 1UPAA 1KEKA 3H3JA 5A9TA 1SQ0A 1TCUA 2R60A 3BOSA 3NT4A 4FSHA 4X61A 1KAEA 1JQJC 2HU7A 3KQSA 5J2UB 4HGQA 3BGVA 4HVAA 3JVIA 3IQWA 4KV9A 1OWPA 3DL2A 1Y37A 3KQPA 4R9UC 4A4DA 2I76A 3K6JA 2AYYA 3VMFA 3K1TA 2ZB2A 1UK9A 2Z4SA 1XTSA 4WUVA 1N9GB 4MAAA 3FWNA 4BLOA 5BSVA 1TJNA 3A05A 3LK7A 4TLBA 2A1UA 2IIVA 3WNCA 4C0AC 1DAEA 5IFKA 1C14A 3EX7C 4R31A 3I61A 3NUZA 1P7PA 4RLQA 2Z43A 4CMKA 3ABRB 2J3KA 4ZFNA 3M6LA 2O8FB 1SVMA 2PUEA 1G21B 1XVUA 3UHAA 1ZWKA 2QLJA 5DT9A 4PPYA 1K3UB 4P8RA 4A16A 3G2HA 4GI3A 4KLNA 5KOYA 3PC7A 3VTZA 4RTNA 3FWZA 1VCMA 5LXTB 5CDFA 1GITA 1MC5A 3P9QA 3BZWA 1KMHA 1SEVA 1T24A 5AHOA 3R1IA 5CGZA 2XW6A 2BMEA 3KWLA 1ONOA 3P97A 1XIVA 3DL0A 2IHVA 4DNOA 2ZJ2A 3W90A 3K5IA 4F84A 1ZN9A 2H1FA 5C7OO 4O1HA 5TLSA 4PYLA 4IHQA 2CF5A 2PFGA 3D6NB 2R4TA 1PL6A 3CHYA 3L18A 1WSBA 1XCOA 2ZVPX 4OOEA 5A3JA 1M6VB 2I62A 2VAWA 5GPBA 3ZK7A 4UVEA 2AZ4A 4MLPA 3CZCA 3PB3A 4NFHA 4M98A 5ITWA 5AVXA 1HG1A 3PWSA 3N7TA 4L6IA 1P0QA 2G1AA 3IE0A 1JW9B 3TXXA 1VIDA 1W73A 3I4FA 4PIVA 2O3JA 4FXOA 2IL1A 4HDMB 4R0MA 4LZPA 3DBVO 3QV2A 3EDCA 5IXSA 1J5EB 1Z5WA 3V4FA 3GR6A 4PGFA 2X9LA 4Y1RA 1YCGA 3GLVA 1SVNA 2HBRA 1Z6QA 2EJWA 4I6EA 4MVJM 4FFSA 1JFFB 3MFYA 2QG4A 4BMNA 1X92A 5IWAB 4ZQGA 5CTAA 1G2PA 1N7IA 4F38A 2C7BA 3OECA 4U00A 2YHUA 1EGVB 1V9CA 3A31A 3ZWNA 2ZT6A 3PNSA 3QU5A 3T7TA 2JFQA 1O2DA 4XTRA 4I6JA 4BFCA 1QB8A 4BVGA 1VL0A 3R41A 4FJ1A 3I12A 2RJOA 3OQBA 4V03A 5JCJD 4KN6A 4TLAA 4WY2A 3LZCA 4AY2A 1J0CA 2ZIXA 3R09A 2H59A 5AW7A 1QTNA 1QX3A 3I83A 2G0NA 2JGMA 2UVDA 3PEYA 4IS2A 2XOXA 4U6SA 1MDFA 1IAVA 1JYEA 1OYOA 4FNMA 2VXYA 1WF3A 2R1TB 5CNKA 2Q29A 2GAIA 3W3AA 1DXQA 1CQPA 1G6KA 2BLLA 4QECA 4AQ7A 4BEWA 1Y3BE 3MCZA 2Q5EA 5EE1A 1YMUA 2IDKA 2XOEA 1SUAA 3ETCA 3HE3A 4CIAA 3LY5A 2VHYA 3T7JA 3ESXA 4OKSA 2J3DA 3P9CA 2V6BA 2LRHA 2GJ8A 2OQVA 4C4SA 1W46A 4PX2A 4CV2A 2ZWOA 5JATA 3AJ9A 3BG5A 1P6QA 4E1VA 4ESHA 2WM9B 4IKPA 3SXPA 4KE8A 2R79A 4IGAA 2CV0A 4RS3A 1KSGA 1ESNA 2WA2A 3GFRA 2H52A 1TPZA 2Z6VA 2W8ZA 2A5FA 2PKRA 3ZGYA 3MT8A 1C7RA 1LVGA 3B13B 4ID3A 2AEFA 2PKWA 2WPDA 4L3VA 4IIUA 4MB0A 2GKOA 2HU5A 5M7EA 1D7OA 2GB4A 2OO7A 3RT7A 1AMNA 5AQ1A 5ESRA 3DHEA 1U65A 3V9PA 3FPHA 4HQNA 4HUQB 3T6KA 4ZCSA 3DPUA 1J8MF 4K6HA 5JY1A 1U1CA 2F4NA 1MOPA 2H7XA 3GMTA 2ONZA 2QQ5A 1XAHA 3SC3A 1KYTA 3WDLA 1FJXA 1O4VA 2QZZA 2XD4A 3AWDA 3OPNA 4WTOA 2GI4A 4YRQA 3CH6A 3D02A 2Q62A 9MHTA 2OPBA 3BIOA 1HETA 1RWQA 3T3OA 3QPAA 4IKEA 2I7VA 4FHDA 1GTMA 3LDHA 1RWMA 4DMKA 4ZIRB 1ZJ5A 5JADA 3T5AA 4L9SA 3COYA 3KVRA 4Q7EA 1HQDA 2BWJA 2J3MA 3FDZA 3GDHA 3OFKA 4WKGA 5CX1A 1RTKA 4HNAB 2ZRLA 1I7LA 5TQVA 3UMMA 1RIIA 2Y6VA 3S6JA 3OM1A 4MWDA 3A2LA 1TJ3A 2OB2A 3OU2A 2IITA 2QJRA 5KI6A 1YK0A 3G13A 1C9YA 1RI1A 3ZDEA 2I34A 1ACJA 3MJHA 4FHFA 3Q6NA 4PO9A 1RRKA 5J47A 1WLSA 5I4CA 1TYCA 3WK6A 1PGNA 4YY3B 2MSKA 4DCCA 3JQGA 3VR0A 1A9TA 4KBYA 4ZGGA 4M54A 1E1MA 1YJXA 2JPDA 5L3QB 2PH3A 3V7UA 3WLJA 3MD0A 1Q20A 2QZPA 2V4UA 4N5DA 3HB0A 4WY8A 4Q1CA 3HLTA 2E0IA 1SXIA 4WE3A 3ROQA 3CLKA 5C18A 4RDXA 1MB3A 1CLEA 4EGFA 1S7GA 2IPAB 5GADl 4R40A 1I94B 4MVWA 1KI9A 4C22A 5AESA 5I5EA 1KRWA 2IZ0A 3IBSA 1NV8A 4QYIB 4YFVA 5TS3A 2NZUG 3HY4A 2GN8A 1T6ZA 5TGDA 2CJYA 4EG7A 2B5VA 1CJMA 2V7EA 4YP7A 4JYCA 3TGLA 4RENA 4A8JC 5CCXA 2QY9A 2ZBGA 4IIJF 2O3RA 5DCWA 2DUWA 4HTFB 3G9XA 7ABPA 1ORTA 3PUVA 3VR6A 2H0RA 5AW8A 1CR1A 4P58A 1ZRNA 2VJNA 4UC0A 1FS6A 1IYZA 4N9WA 2ZS9A 2PJZA 1OI2A 3BTOA 5E0OA 4X60A 2RDMA 3FMOB 1GN8A 1XFAA 3IJ5A 2NVUA 2BJHA 2OXRA 2P1RA 3AEKB 1CUXA 2NUBA 3O3NB 1XAIA 1KVTA 3OF3A 3DE2X 4ZOLA 5BQPA 4MR7B 4COOA 4LOJA 1RHQA 2YY5A 4D41A 4CKEA 2YV1A 3WYEA 1P9OA 4ZC8A 3LD9A 3MTDA 1C81A 1UCFA 3GO4A 3G2PA 5H70A 3NV9A 1R16A 1KJNA 1JB1A 3W78A 3WSWA 2Q4TA 2PX6A 1JR3E 2FZKA 4QTXA 4BQPA 4EPXA 1K2WA 1T25A 4W5RA 3ESCA 2VPZA 4QTZA 4A6DA 3L8GA 4ZJPA 3HPQA 4IG4A 1H1DA 3MJRA 3LFTA 4UHCA 4WD3A 4IEIA 2H2AA 4IL5A 4YJGA 4EPTA 4WDQA 1LFDB 1NU6A 1U28A 3DOCA 3HU1A 1I33A 1ZJYA 1K8RA 2CY0A 3MMZA 4NOKA 5JMPA 3VZRA 1G7CA 1G6OA 4EL0A 1D5WA 4RD4A 2HGSA 5TQJA 4R81A 4YMGA 2PQ6A 2Q9AA 1MO2A 3SXJA 5SYNA 2LDXA 4RUKA 3CB4A 4YWHA 4QQRA 4L4UA 3NI2A 5H3HA 5I7HA 2NSHA 1KARA 3FNQA 4G36A 3LKDA 4DLNA 1CF9A 2YVUA 3V4ZA 1GG8A 3EHDA 4Y2QA 5T3YA 4HLUC 1Q91A 4QE3A 3W8NA 3ANMA 2VN8A 3HDHA 2W71A 1V48A 3WLFA 3OZIA 3AHDA 3FYTA 1V41E 1YDEA 5CG1A 1Z4MA 4Q01A 3FB4A 3HUDA 3EUAA 3DS8A 2P9ZA 3ENQA 7YASA 2ZRHA 4PRKA 2ATVA 2Y1XA 3SZMA 3ZBPA 2X7XA 4BZXA 5A06A 2CLLB 1E1LA 4Q3DA 3EARA 3MHPA 1NPTO 4IHJF 2NW6A 3IVGA 3R0IA 1BKDR 3DMTA 3ZDDA 3PEVA 1LF5A 3BJZA 4I55A 2EHJA 4LIPD 5C7LO 1ULAA 3AFGA 2VTDA 1RXSA 3EVBA 4MVJA 3M2TA 1QRUA 5TMBA 3D5QA 4L75A 1RWBA 1QC5B 5CVDA 4UOZA 2QT9A 2F1RA 2IDMA 4K87A 5ITZB 4GL2A 1G21E 4BPRA 2R7KA 4F5WA 1ZN8A 2PGLA 4K6KA 4PN7A 1PO7A 2AKYA 2HJHA 4DBVO 1SCKA 2I3AA 5DXJA 4XVUA 4TVOA 3RS0A 1SQGA 2FPSA 1H4TA 3QBTA 5T7BA 1DOHA 2I3DA 2DCUA 4PLWA 5AW3A 3WVNA 3IS3A 1OLXA 5EFOA 1DKOA 4G8CA 4E21A 3QE4A 3AGQA 4OHKA 2QQGA 4N65A 4P3KA 1NM5A 3VU9B 5DFAA 5HZKA 4JA0A 3B3AA 3DL4A 3WNDA 4C4RA 1ZCFA 1R5NA 2PLWA 3V2UA 4AMVA 1EE9A 5FWXA 6AT1A 2X4GA 1M1NA 4NOLA 1XALA 1RZVA 2NTYC 1XXHB 3TZLA 3K70B 4Y6OA 5DEOA 3UV6A 5FFNA 1NX6A 3FSJX 4Q05A 1KJ8A 5E1DA 1VI6A 3T3MB 2P5UA 2C7OA 2H06A 2EGGA 3R0ZA 1JG2A 1PGJA 3MS7A 3UT6A 4C08A 4P5DA 3BUSA 3GGSA 2QYSA 4UAGA 2OD9A 1GPNA 3B2NA 3ICWA 1ADFA 4TLMB 4D3XA 4ZAGA 5HWSA 1QGZA 3ZWAA 2BMVA 3B1YA 1ODCA 4I2NA 1PHRA 2X2FA 2HGZA 4DLSA 5KYWA 4TZ6A 2X0DA 3ILXA 4J76A 4LGMA 5KTKA 1FFYA 4PXYA 1EVIA 4YRSA 5F2OA 2G4LA 1QIKA 3L40A 3Q7QA 1GZ7A 3R7WA 1WMBA 1T15A 2ANBA 3TIGA 3H65A 4MS3B 1TPYA 3IAHA 1D04A 2WILA 4DIOA 3DVRX 1IUPA 4HYEA 2BRUC 1U7ZA 4P1ZA 1Y1PA 4B3GA 3H1AA 3FVWA 1BMFA 2P9YA 2G8NA 1R8JA 1Z5UA 3IODA 4FGLA 3LG2A 3RTBA 2EFHB 4QDOA 3E82A 1DVRA 2ATXA 3AKDA 3H5WA 1E69A 2W6MA 2XQKA 4I8XA 3TCXB 3BF8A 1ODJA 3THWA 5YASA 2Z58A 3TMYA 3HXTA 3C1UA 3AEQA 2AE2A 2CB0A 4MUMA 3G0HA 3RB8A 3AJDA 1NVXQ 1TQ6A 2W2LA 1D3AA 3RASA 3TLCA 2D4HA 4BNDB 4NARA 4QEKA 1VPLA 2ZYUX 4EA9A 2FN9A 1FMJA 1GAQA 2A5GA 2VP6A 3CNEA 3E53A 5KNCA 5AJUA 2GARA 4DJAA 4CQMB 2VDQB 3DDWA 3HCNA 1BH2A 2ACKA 2BGJA 4XW2A 2P3SA 3OM0A 2V4ZA 2HLHA 2WUDA 3LRPA 3KVOA 2O3SA 4QX6A 4S12A 4BYMA 5BSGA 1QK3A 2C03A 3D7SA 4IG9A 2RKWA 1CNEA 4URZR 2IJGX 1ZJZA 4I1RA 5E9JA 3EH2A 3B1WA 2QTZA 3A7DA 3E9QA 1GILA 1JJIA 1AK2A 4AJHA 3AM4A 3AHJA 4FHZA 1XTZA 2PZLA 1RRGA 4JAVC 5AXAA 1ISHA 1WP4A 1VDMA 3S1AB 3FKSD 4W1PA 4YGYA 2Q2VA 1KO7A 3ND6A 4HAXA 1SNYA 4I08A 4R9SA 3KKPA 4UDYX 1OGJA 4RZQA 1YHYA 4FPXA 1I7PA 1WV1A 3NTOA 4GYYA 3BD9A 3JQAD 4UATA 2X5XA 4L4YA 3G0CA 2HJGA 4Q5IA 3TTTA 2GEBA 4RJKA 3V3TA 3CA8A 4CMCA 4PFSA 5BV2P 5HUJA 4JBXA 4FHGA 3FAKA 3HYTA 1XZNA 2GN0A 2ZS7A 2OHGA 5DTRA 4AW9A 1E2GA 4TV8B 5DEIA 1NLMA 1N2GA 1ODTC 2FWMX 3GROA 1Y4AE 1ZC4A 5K3CA 3IMKA 3DDOA 5HR5A 1G3RA 3MC1A 1F38A 3GBPA 1NVVR 1QSGA 4L1KA 5KVQA 3TTWA 4OX9B 4YLYA 4JGGA 3Q8MA 4YBZA 5I6DA 1FLNA 2SBTA 3IKMB 1P44A 4F72A 4K86A 3VOAA 4XGKA 4PC2A 5LCXA 1PGPA 1TM7E 1YJ5A 2AJLI 5DGIA 3ZCTA 5CB4A 1YU6A 1N8TA 3OZEA 4NZPA 2PWZA 2FXVA 2EIHA 4NYJQ 1PFYA 3COWA 3G0GA 1JG6A 1F1BA 3N0XA 5FBQB 1GUFA 5BY2A 4M46A 3ROFA 5EHNA 1VLZA 3LGAA 3QIVA 1CEQA 4NENA 4YMWA 3WV4A 4D96A 1DZ3A 3MCTA 4UBMA 2QTBA 2A0YA 2OWEA 2J85A 3FGPA 5H81A 3TZ6A 4BV2A 3D4PA 4DR3B 5KYTA 1E6UA 1KS2A 1N7GA 2I7CA 1T8RA 3FF4A 2G08A 4N8SA 3CNNA 3ROXA 1C1XB 4LXHA 4OSOA 1BXRB 3T4EA 4RLFA 1ADBA 1X9IA 2G04A 5FWYB 4PICA 2P91A 2R8BA 1HE2A 4J07A 2J3JA 4JLOA 4FR5A 3MJCA 5AW1A 1N32B 2I9KA 4QSHA 3PICA 3ESBA 3VPFA 1J1UA 2VCHA 3IAXA 2C5GA 3LFUA 4YASA 2QVLA 2CLMB 2E37A 2XTJA 1J0DA 2P6OA 3CG0A 4BMOB 5JALA 3UB3A 1TZCA 3RGWS 1YL7A 1XL0A 2NVBA 2PSFA 4EFDA 2D59A 4Q4DA 4YMHA 1SIUA 2OBLA 2NM0A 3I0NA 5E1MA 1DX4A 3EGWA 4KO3S 2BKEA 3A37A 5EE3A 4TM7A 4KX5A 1WCIA 3U3DA 4GRAA 1YA8A 1VRCA 4YO7A 1V35A 5L3SA 1TGVA 1MTZA 4N12A 5JSZA 3GT7A 3HVJA 3EUWA 1I6KA 2HJSA 3R7DA 5MN6A 4N49A 1XOIA 5A4JA 4EGSA 1VECA 1DCFA 2PH5A 4TOIA 4E1BA 3PIDA 3GZJA 3PE4A 2CDCA 4IDQA 4LY6A 4A8TA 1YOVB 1BDHA 1PYGA 4G9BA 3LT2A 2C3MA 3CUSA 1SMKA 2Z8ZA 4KQMA 4MW4A 1WMEA 4ON9A 4P98A 3QFRA 3AB8A 1KSFX 1JEEA 1JP7A 1M6VA 1JQDA 3DFIA 3OBIA 1NE2A 1ZVKA 4ML3A 4LF9B 2IPNA 2QL9A 3ZDZB 3IVRA 1QRRA 2Z1NA 3A6KA 5JWRA 2H4JA 4GPAA 3QVOA 1XJCA 4O1IA 5ICSA 3O0TA 2DMRA 5A6SB 1GA4A 2PKCA 2C82A 2X42A 4K3VA 4I3GA 1DADA 1QV7A 1ILEA 3BILA 2J3EA 4H0CA 1N25A 3L6OO 3T38A 2VRWA 5G3YA 2XWQA 3OA2A 2EZ9A 1TF5A 4DLYA 5IYZB 4ESOA 1XNQB 3C5EA 4FTWA 2H8GA 1NHWA 5CBPB 1DT3A 5DNDA 4CL3A 4B31A 4EY4A 5KS2A 5J1SB 4PONA 4ZRNA 4FXPA 2Q6LA 5GZ3A 2OZLB 3WGIA 2P2ZA 2REQB 2V4MA 2WU1A 3GU3A 4REQA 2R8OA 3PRJA 4DABA 4PZDA 4UTZA 4A8JA 4DV5B 4AX4A 2IPXA 1GPYA 3L79A 3PDHA 3R75A 3WB0A 1WO8A 2BI7A 3AY0A 2DHRA 4A36A 4CMBA 2O7VA 4QXQA 2G71A 5H8WA 1DT5A 1QO0A 1Z4NA 4HEHA 4EEZA 4QGHA 1E3TA 2HC9A 2VJMA 1TCBA 2FPIB 1RKUA 5C2JB 4TKUB 1J4AA 3PD7A 4I1SA 3O4GA 2HREA 4MICA 3CNOA 3GJSA 6REQA 2A4KA 3FRJA 1Z9BA 3EVGA 1ESMA 3L0IB 5SY9A 5HZMA 2Q99A 1A7KA 2IBSA 4PAGA 5KOHB 3WNBA 1OTXA 3C2QA 5F9FA 3IPCA 4XLLA 1OBHA 4RD2A 2JIZA 3IJRA 3GA7A 4DLUA 3OICA 2BGLA 2ZYTX 3WLPA 2V7QA 3EA4A 3LLSA 3A14A 1FDSA 2UKDA 1EX9A 1Y8QB 3CZ4A 3USZA 5KAPA 2LCQA 4I5DA 1Z7YA 3RS4A 5HJEA 2WQ6A 1XXHE 3IT1A 3M3DA 2GZHA 1EVLA 5LPNA 2P5SA 1HT2E 1QZUA 4MQBA 3U1BA 5C8DA 2C94A 3BIWA 4INZA 5DNAA 3KZMA 3WWOA 1GGNA 3OZUA 3TGPA 1R0WA 4M89A 4FW8A 5C4IA 2WJYA 2AOTB 2P75A 1KEUA 4WOPA 3NZEA 2YXDA 3I05A 1B8OA 1JI0A 2GDZA 5HG0A 3UYKA 1M0SA 3Q3IA 4PG4A 1RQ7A 3EAFA 4GQBA 2M9MA 1ZGHA 3H13A 5DBFA 4X90A 5D51S 2IHKA 4FW9A 5DYTA 4BL5A 1D7AA 5IF9A 1UF9A 2R1VB 4QUHA 1OGYA 4HLUA 3VR2D 4IQ0A 2ASEA 3K2EA 3DXFA 3R7LA 3GJQA 5BOVA 3VR1A 4DAEA 4OLAA 3PYXA 5G4LA 2ANCA 2NO0A 3IP7A 1U3UA 4JLVA 3ED5A 4J7AA 1IJKA 2GH1A 2NG1A 3RU9A 3VO1A 2ODNA 3LXRA 4NBWA 1D2MA 1O97D 4TQUS 1JA9A 3N86A 3M82A 4AB1A 1PS8A 2H5IA 2YJ6A 4CKBA 3P5BA 3NBMA 1IU9A 3N2NA 2YJGA 3UHFA 4G8DA 1UPTA 2EW8A 3BMNA 4UHHA 1U9CA 4X44A 4YPVA 2C7PA 1ND5A 3A2KA 4RAOA 1JRLA 5F73A 4ITVA 1TB4A 2QLNA 3FDFA 5EXEA 2Q3MA 3D3KA 4YUVA 3TEFA 2QN2A 3VC7A 4OQFA 1ZFNA 2QLMA 1KH1A 2IYWA 1DARA 1B3BA 1SEPA 1U99A 1SAYA 5D1NA 5AKZA 1SC3A 1SUPA 3FJYA 3FR7A 1CJVC 1A8UA 4TLDA 1RCUA 4AO8A 2OHHA 1BWSA 3WB9A 2ONYA 1JKIA 5C8YB 1FFEA 3AEUA 2X1HA 3DULA 4MCAA 5FV4A 3OOSA 4JLNA 2EC5A 1OYWA 2QVZX 3EASA 4QGBA 2Y1EA 3LQFA 1Q3TA 3TWOA 1ZR2A 1U4OA 1A8PA 3P2YA 1WAMA 1BFDA 2DX7A 5FL3A 5I9BA 4WT7A 4O4LF 1GCUA 2J07A 3OJWA 1FFDA 1NVKA 3C74A 3KR2A 4BECA 2IZ1A 1EWTA 1IY0A 4TX1A 2DSNA 2HJWA 3LCMA 5D01A 5JD6A 4RTMA 4YALA 2WE7A 1H8HA 1XMPA 4HNHA 2K5UA 4JP1A 3NTUA 1S2LA 3D6UA 4DZTA 1GPKA 2WWTA 2Z0MA 4QQNA 2I2DA 4PG7A 5EHQA 3BIFA 4C7JA 4IZIA 3MF4A 2FSIA 4CR7A 5AW0A 5LP6C 3F5FA 3CLUD 1GL6A 1R6TA 1JAXA 1TAHA 4IDPA 1TT5B 2CVPA 3NETA 1HEIA 2J6IA 4E5SA 5C1BA 2PXXA 2CZCA 1GEGA 3NIDB 1W6RA 4RVCA 5H82A 2E5WA 3LQ4A 1ZH0A 2B4AA 1P5ZB 1LNQA 4L28A 1NT4A 3DEIA 3QM1A 4KIUA 3RC2A 3GH1A 4YCMA 2H29A 4AULA 2BRUA 3IILA 3WBJA 2ZGVA 1W96A 2E1RA 2QNBA 1S5PA 2PMBA 1LJUA 2DB3A 3PWTA 1N2ZA 2AC7A 3L1IA 4D5EA 2EKLA 2AA3A 2QROA 3W5UA 3ORHA 3ZX4A 3ZHVA 1U2DA 3DKRA 2H5EA 4Y9SA 4CM8A 1V3UA 4WADA 5DTMA 5HKAA 1CEYA 1XEWY 3JQ6A 1SKUA 2FN8A 3QVVA 3WYGA 1YV9A 1ZC3A 2VHQA 3OEHD 3QHQA 4W1RA 3SQDA 1IOZA 1B43A 1SC1A 4RHXA 3H11A 5FIUA 2PT5A 2C4HA 4QEDA 1RI5A 3PQ4A 2W70A 1A95A 5KWSA 3C8DA 1NRIA 3N39C 1V9SA 2WIJA 3KQMA 3R6DA 4AU1A 3B20A 4DLPA 2RH5A 2XE8A 1N5DA 5FEMA 5A04A 4E09A 4PZYA 5EWLA 3A6HA 1AKUA 3IR5A 5NULA 4XQ0A 3Q5GA 4YEDA 2AXEA 1KJQA 5KQRA 3PQ6A 5CT9A 3WADA 1QHSA 1QV6A 2G77B 5KNBA 2UZ1A 1SK9A 1EFLA 2ID7A 2KBFA 1RACA 5C53B 3CXUA 1IIBA 1UWVA 3QUAA 1RXWA 4MMXB 3KS9A 5ICEA 4AO7A 3L5KA 3TCNA 2A0FA 3FPCA 1QC5A 5KDDA 1SUCA 1AN0A 1TM3E 4ZK6A 1AN9A 4QUAA 2WUVA 5GV8A 2WY2D 3I6IA 4P2BA 1NXSA 4XM2A 1XUOA 2PIAA 4QYTA 3M4XA 1VI2A 3E7PA 4IO0A 4ALKA 4BNWA 1H5UA 3CV3A 1RVV1 4QARA 4FOPA 5AI9A 3OF5A 4YT4A 3AR7A 1KAOA 2QTFA 5IAGA 4EI8A 1HYGA 2W4IA 2UXCB 2DHDA 1JPJA 3FMVA 5LR6A 4Z4FA 2ODPA 3TL2A 4EENA 1M1UA 2XDAA 4EKNB 3IBFA 5AM0A 3S2YA 4CEHA 4L6AA 3WNVA 4KXFB 3AW9A 4LK3A 1CD5A 3K96A 3E1GA 3FR8A 3PXDA 3DMDA 4ZXPA 1P39A 1TK9A 5K3OA 3P0FA 3S44A 2JI4A 4NJEA 1IPFA 3JPYA 4E31A 4ISCA 4WWHA 4E33A 2ZYDA 2H08A 4RF3A 2YX1A 3A9VA 4LECA 4LXIA 2L69A 4EB6B 5AJHA 3NPMA 2PLAA 3BJEA 4ZU6X 4LRWA 1O6BA 3SYNA 3MPOA 4BE7B 1RSZA 4U2FA 4JASB 1QFXA 4QDUA 4CM1A 4E12A 2GCOB 3S8YA 3DKKA 2JLXA 4OMUA 5JV5A 1I4WA 2CLKB 4PX3A 4Q82A 2VP3A 3BGOS 2D7CA 4TWBA 3VKVA 5IEBA 4GX0A 1PT6A 3OIWA 4KZPA 5AVYA 1VFNA 2IH4A 4K1LA 5B5SA 3QKIA 1W49A 5EHGA 4ZJYA 3O8QA 1W36C 1ZNZA 2Z95A 4FDLA 2AFHB 1YQUA 2J0UB 2PE5A 5HKLA 2OCKA 3G89A 3BREA 1T1IA 3R3JA 1AQJA 1G38A 3LVQE 1TUIA 3KJXA 2GCPA 4RGQA 4MYSA 4TXMA 4AS2A 1RWXA 3PX3A 5KTMA 1D2EA 4AZVA 3O1HB 4G67A 4RH1A 3IE1A 4KFRA 1O96A 5HIMA 1XSEA 1Q77A 3HV0A 4FFBB 1RJGA 3HNOA 4QTYA 1T1RA 2R97A 2WEKA 1IXKA 3UW1A 4QSMA 4URFA 1ZG3A 3QNUA 4FFPA 5JROA 3SF8A 5CFRA 3B3GA 1CQWA 1INLA 2BOVA 2VPYA 4LJRA 2IXGA 2NSLA 3TGWA 3OPYI 4PHTA 4HUTA 1DEOA 2I87A 3QU9A 1KPHA 4R51A 3GJ6A 5HF6A 1V6AA 2NZVG 1R50A 4UUPA 2I55A 1E2HA 1S3GA 3AHGA 4GSKA 2QF7A 4WXPA 4E22A 4CIVA 1PR4A 1YTLA 3OD1A 1FNMA 4TL7A 1L5FA 4PC6A 1JEQB 4NBUA 4WCFB 1KA9H 4BVBA 2A0KA 4LPKA 2I1VB 1W2GA 2XQFA 3E1SA 4LE1A 3KB8A 3OKFA 4LY0A 2OV1A 4BNDA 2JLAA 2I80A 2B83A 5ESWA 3T9EA 5HJ7A 5J23A 3EEIA 5F9HA 3Q3HA 5BNTA 1PV1A 4JR0A 4ETMA 3PFIA 1NUUA 4OQXA 1SN7A 1SOVA 2FEXA 4EGQA 4B75A 1QP8A 3R6TA 1GG2A 3T61A 3GPIA 3PX2A 4TVSA 3ODGA 3VPBA 4PG5A 5KYYB 4U2GA 4EA8A 1DJPA 1DBRA 2I4TA 3K2QA 1GZHB 3HVKA 4OSPA 1FS5A 4OHMA 4QODA 4DCPA 3TL6A 3IB3A 5IJWA 5KJ6A 1GU7A 1KOJA 2B8EA 4Z4QA 2O2YA 3BSWA 4W5NA 3BMOB 1E64A 2C07A 3SSNA 5FLXA 3DUFA 3QVJA 2NUPA 2DETA 1E3SA 4OK3A 1YGPA 4BKUA 4AJ1A 4QT0A 3OSZA 3WZ2A 1A1VA 3I5XA 5LYJB 3D64A 3FCYA 1GYRA 1XA0A 3NC1C 4BEJA 2Q45A 2YWFA 3R3YA 3KVVA 1QHHB 3DPSA 1GGHA 3TUIC 1DL5A 1U31A 2NU6B 3WGOA 1M8PA 3NDRA 2A3RA 2ECOA 5DPMA 4Z2YA 3OM8A 1NBAA 3AJEA 4KXVA 3UO8B 3X43A 4TYMA 1L4MA 2AQKA 2NV6A 1KY3A 4EQ6B 4LGVA 3A2NA 2FQ1A 2OHJA 1E2DA 4MQFA 4ID9A 4BNFA 2ZAMA 1QRSA 4K9DA 2PKQP 4C7BA 2KLHA 4GE0A 5AOBA 2AKEA 5MFPA 4GWGA 3PJDA 3ET5A 3VC1A 2O50A 4CLRA 4QC2A 2WYIA 3LHDA 4G81A 3HJHA 4I0WB 3TXYA 2R44A 2V03A 4Z1MA 5K3FA 2HADA 1JLLB 3DEKA 3OQIA 2HMSA 1T36B 3ECAA 3GG2A 4MCJA 4OGFA 3UGKA 2GT1A 3N0WA 1E6WA 2H9YA 1CWUA 1PSWA 1CZOA 2E6KA 1WHSB 2KW5A 3FNGA 3DV0B 3PHJA 4GGPA 5B2ZA 2O8BA 2AV6A 5EL0A 4HDNB 4GBED 2ZCVA 4WZ6A 4N5HX 4Y30A 2BD0A 3L8ZA 1XKQA 1SVKA 2BDUA 4E07A 3JWIA 2FWNA 3TFWA 4XB6B 4O29A 1HQYE 1L5LA 3H17A 1GCGA 2CLSA 5GV7A 1IHPA 1M2GA 1N2CA 1UM8A 2FPKA 2R8RA 1TCVA 3KLNA 4X8LA 4DC9A 5JD5A 5K3EA 2I2CA 3GRKA 2W58A 4CM7A 1U1EA 2G8LA 2YQZA 3RK4A 2QG9A 4I3FA 3SGLA 1FX1A 4E2ZA 3M81A 2RHDA 3JWJA 3P2IA 8ADHA 1OVGA 1L7NA 1PS9A 2BFPA 3RFCA 3RS3A 1JPVA 4MQ6A 1DB3A 2CXPA 2YXPX 4YTEA 1YTUA 3MT7A 2QW0X 3ZWOA 1MV8A 2H92A 2AKAB 5ALYA 3VDNB 2BFWA 2A35A 5BXQC 3CPHA 3L8EA 4CCWA 2FTKE 1KXZA 4P7KA 4M1MA 4CL0A 3AY3A 2PT7A 1NF8A 4XQEA 2G28A 4RETA 3NVKI 2O3QA 1H6AA 4RDIA 4V0QA 4Y6LA 1QHYA 1CY1A 4I1PA 1PJAA 4Q1DA 1WMFA 2PYZA 4Q3OA 3ZKWB 4X8HA 3VU8A 1GCAA 1LY1A 1ACLA 1MC4A 2IY9A 3IPYA 4NC9A 5F4ZA 4IWYA 4AX8A 1V1JA 1H0SA 2QXYA 1HOXA 1JQAA 1N1EA 2CHUA 5FAXA 3B9PA 5AICA 2QNIA 2HZBA 4I6GA 1U8CB 4E5MA 2B3DA 4DUYB 2VT2A 5DBIA 3VQTA 2IHUA 2ACVA 4GXNA 4ZP1A 2I4IA 3X1YA 2E21A 4ZZ0A 5BQXA 1GUYA 1V16A 1MCZA 1QGUA 1S3FA 3DDSA 3CCFA 3CE6A 4DA4A 3I62A 1CIJA 2XJ9A 2G6TA 4WBSA 5KOJB 1G6HA 1Y8CA 4BO5A 2O05A 2UZIR 2VJKA 3IVMA 4DZZA 4W5HA 4JDUA 2ACWA 1WNTA 2ZTLA 3FUTA 4DSAA 1E3QA 3S2ZA 2SHKA 3K9NA 1PSDA 2JBAA 1HLFA 3I4CA 5B4VA 3OUZA 3UW3A 5B1YA 3FUWA 1H2HA 3M1LA 3UA3A 3TYXA 3VZBA 1JAIA 3DH0A 8OHMA 3BAFA 3H7AA 1HUQA 2XMGA 4R2JA 2RBGA 5EMJA 3L9XA 2X3UA 2Z5LA 1VDZA 5EP1A 4AJPA 4KV7A 1RXVA 1E4EA 1ZXXA 2QORA 4HWOA 4HXFB 3WWPA 2IT1A 4V2UA 3LGXA 1OYYA 1U0TA 1XPRA 4XOUA 2A5LA 3FCEA 4YP0A 1RADA 5AD1A 1STOA 3T94A 4DXAA 4TMYA 3G59A 4X97A 3HYCA 4TMWA 3V34A 2XGGA 3G8YA 2Q1XA 1RRPA 3WTCA 2WWYA 4FLMA 4ENTA 2ZRPA 4KFUA 4PFQA 2ABWA 4LY9A 3K09C 3D4BA 4BFWA 5CVCA 1Q7RA 3EQ9A 1YRHA 1PZNA 1KQNA 3URMA 3B1JA 2QX9A 1RABA 1JEYA 1ZZGA 4LJLA 1MVLA 3AFIA 3ZBUA 4BFSA 4MRNA 3STTA 5HFAA 2UZ0A 1FNDA 5LP6A 2GO7A 3WRVA 2C9ZA 3IR7A 5A05A 3MW8A 1MW8X 2QTTA 3K0FA 4HH3C 2W2NA 3VPDA 4CQNA 5K4HA 2G9NA 3VNQA 1Q0HA 2VXCA 1G59A 3KTAA 3KR1A 2H9AA 2YN2A 4YRDA 2W6NA 5ALSA 3WDSA 2HYIC 1P0CA 4JI6B 5MHTA 3GLHA 3TLEA 4MTCA 1AUOA 1NLUA 1RBQA 3PUIA 2OP0A 2QN9A 3Q3VA 4BU1A 1JIUA 2FY8A 3SC2A 4EF6A 1PSZA 4ZTUB 2QT1A 3O4IA 2V65A 3UT5A 3I9V6 4HXGA 1YE3A 1E3WB 1QHGA 1R88A 4FD3A 4KE6A 2Z30A 4RMNA 3EXFB 2QRHA 1CDOA 4V38A 3DC2A 1ECJA 1DTEA 2HSWA 2Z2JA 4P32A 4HWPA 5AKHA 2J5QA 3PNKA 1PR1A 4MKZA 4CUJA 3ST7A 1LJ8A 1UKCA 5LQDA 3T1YB 1L5HA 3WL6A 1E61A 3J7TA 2C5SA 4H7KA 4I4TF 4WX2B 4RKQA 2ONKA 1DIAA 2AFHE 1LKZA 2H00A 2XIQA 4MNTA 1J6UA 5ALJA 3ABSB 1RT9A 1RZRA 3OOJA 4JJ7A 3UJNA 3AEZA 4YCSA 3SBEA 4QYSA 1P29A 1YRAA 2QW8A 2R1VA 1ORDA 3QJ5A 4FINA 4GE3A 4LC0A 3V7NA 4B44A 1QH8B 1E0SA 2GYVA 3FPSA 1VLMA 3AT1A 1DEXA 1N5KA 3FMGA 1UWCA 3HS3A 4MP6A 3T9DA 4EPYA 1YFJA 2IHNA 2CCJA 2XX3A 3H19A 3AP1A 3EIHA 4HX5A 4KP7A 2DQYA 3L41A 1Z5GA 4XYMA 3OP4A 1GR0A 1Z8FA 3B78A 2QYTA 1ABFA 3PNQA 1U7UA 4YLGA 1LFAA 2C7VA 2NSJA 2WM8A 1Z26A 1GCIA 2RGYA 3WSTA 4B09A 3B3QA 5EGNA 4CJXA 2XY4A 3OEED 4R68A 4HS4A 2MSDB 3O7WA 5DULA 2ZIUB 1Y6ZA 2MT9A 4M2LA 1V3QE 3V1MA 1L4YA 3QA3E 4HDQB 3FBTA 4GICA 3I30X 2NPFA 2UYQA 4YXFA 2AXNA 1WXGA 1RHMA 4W5WA 5CT4A 3L0ZA 1JKJB 3TVTA 3KJHA 2ZAOA 5HE9A 2IXBA 2IP4A 2Y9PB 4NAVA 2XMBA 3IXMA 1UUFA 2DFNA 3TBFA 4P0TA 5HNKA 2PGAA 3PI6A 4M86A 1N2IA 4AROA 3VH2A 2BCJQ 4DV2B 2Q5HA 1CX9B 2DKNA 4RK7A 3T5TA 1VBKA 3UKDA 3HH8A 3GZTB 5CLGA 4MRSA 4ZPXA 5AUOB 5ECWA 1P1IA 4D57A 1EVYA 3B52X 4CU5A 1W48A 4M87A 5TY0A 1PQ4A 2FCAA 3TIFA 5DX1A 4OYHA 1IOWA 3CPEA 1FW8A 1OU0A 4HVLA 2ZWVA 3L4EA 4HJRA 1O9GA 3LP5A 1R7RA 3H2YA 1Z2EA 4LSWA 2XMZA 1GNRA 4IBOA 1ZJWA 3F47A 4G1EB 5LMNB 3OQJA 3ABIA 1QRDA 3N8DA 3SNHA 1G60A 4DM3A 2ZIVB 4TTIA 3TPFA 3TR6A 2VI5A 1EEXB 1V5EA 1O7JA 1JJAA 3F46A 4ZCRA 3RPEA 2E2WA 2P2GA 1XZAA 1KP2A 4O4JB 5E4FA 2PRYA 1X7XA 1WCWA 2PSEA 3X44A 4J3NA 1NF9A 3V5NA 3VZSA 3B36A 1P4JA 2D8AA 4MYDA 3U37A 2ZRGA 4B0PA 1E8DA 2P3QA 2IK8A 5KTRA 4E2WA 2X77A 1S2IA 2P62A 5EIHA 5JO9A 2O7SA 2R6HA 3KYIB 3ANTA 5JJBA 4QA9A 1GNSA 5K0LA 3UMBA 4U8GA 1KAGA 3O8LA 2GEUA 2JGAA 2O07A 5INTA 3M6FA 5KU1A 4JXKA 3OU6A 4LMPA 1NXTA 2ZWIA 1CUBA 1VG9B 5E9WA 2ZRFA 1E1NA 3J80A 3KSAC 1NFRA 2GBLC 2YHBA 4DQLA 1GPUA 2WTBA 1KYYA 4FDVA 5CTJA 2GBPA 4WXMA 4CM6A 2BFOA 1EE2A 1U98A 2DTXA 3EVZA 2HJRA 1Z73A 4OBXA 1HBJA 1Y0BA 3U7QB 2XNHA 1ZD8A 3NUQA 1NNI1 1W76A 5G0UA 4Q0MA 2V0NA 1MG0A 5EKSA 4X66B 1TAUA 4ITRC 2W6CX 2Y76A 1OH7A 1KETA 4RV9A 4ZOBA 4QDXA 3UK1A 2YZGA 2ZYGA 2CXXA 3KWFA 3W6PA 3WB2A 5FLYA 1ICEA 3A1UA 2NU7B 5G0SA 2B8TA 4W4TA 4F9EA 3AETA 4D92A 1URPA 4CNBA 5AOCA 5A5DA 5IANA 4X00A 1C30B 4B6QA 2ONJA 2BHTA 3OUUA 4QUJA 2CN1A 3LW8A 1FZQA 4E03A 1TLLA 4DXHA 2C5EA 3E5NA 3KFXA 3K1AA 4OK5A 4NZYA 4YAWA 16PKA 1DC4A 1XZCA 4B80A 1GSHA 4XWYA 1SBTA 1A9YA 1WW3A 2BCEA 1E8MA 1MX1A 1G9XA 2BKVA 2EZ4A 2I0FA 3HDGA 3SXUA 3WQQA 5BSKA 2YH2A 4Q7KA 1BXZA 1ISRA 2JCXA 1TZJA 4UNSA 2CF6A 5LLTA 3NHBA 4DLXA 4FM9A 5FHRA 4U9IS 2OUKA 3AG5A 2PD3A 3AM5A 3PXXA 4E7OA 3UGTA 1P7YA 1UZLA 5FR1A 1PQUA 5DI3A 4RY9A 5TEVA 4PG8A 2VAPA 2ZOSA 1GLGA 4UAJA 1NA5A 3IA7A 3K15A 4ZU3A 1D0SA 1PZFA 1CZNA 2WG0A 1SULA 5FJIA 4IH4A 4CLHA 3UWMA 4TMTA 1CTQA 2HHAA 1DJMA 4M1ZA 3ACBA 4KQWA 1II0A 1QMGA 3FNBA 1VB3A 4UXHA 3I2FA 3EW9A 3V46A 4O4LA 3RAEC 4DR4B 4BC0A 1Q0ZA 2D74A 3E22B 3ZLBA 4R5HA 2DFPA 4KNVA 4JP5A 4C7KA 3T5CA 3WHPA 4DXDA 2LKCA 1FDIA 1UQTA 3L92A 3NHAA 1ES9A 4MIYA 4WGGA 5EOVA 3P9KA 2H1CA 4LKRA 4GUAA 4J6EA 4LZZA 3D4LA 4LVNA 2VDRB 4KQ2A 1A9SA 5FB3A 3VO8A 3HJFA 2X4LA 5C8VA 1VGQA 1O3YA 3R9KA 3AFMA 3JATB 3MYRA 1Z35A 2OZEA 3UCEA 1JQLB 1U6KA 2V45A 5JC8A 2H4HA 3Q3JB 3AR6A 4IO1A 5ULLA 4KQFA 1Y3FE 4A5SA 1X7WA 2FHPA 2OHVA 2P8JA 5I8WA 2O8CA 3K7EA 4RW0A 2CJWA 3F6CA 1TM4E 5EJFA 4S1WA 3ESRA 3F4BA 3GB9A 2EKPA 1KO5A 2VLBA 4YP6A 3LBHA 2Y2VA 1H85A 1YI8A 3RTAA 4ZJUA 2IX3A 1XAJA 1NUTA 2GD0A 3O95A 4A5OA 2IYQA 5EZYA 1PLKA 4A9AA 5J43A 1Q14A 4WVFA 2VYVD 4BB0A 4ER0A 3QWAA 3BE6A 1U9YA 2QV0A 3QY0A 4A0FA 3ZG6A 1K92A 2W2KB 4Q4JB 5KJEA 4CT5A 1UBLS 3PZBA 3QUTA 4IZHA 4KLCA 1YGYA 2XTMA 3C41J 4JX9A 1SBYA 2L19A 3ROKA 4BNXA 4C5CA 5KJ1A 4E6PA 2EJBA 2C3PA 4OYYA 2F1IA 2JGIA 2P69A 3F3MA 3SM3A 1CYEA 5LOVF 5LKRA 3HACA 3I9KA 5FFMA 4IOMA 4ZEWA 3W8RA 3OU7A 2J30A 2WTEA 1F5NA 3I9V1 3LUFA 4ZVPA 4HGOA 4QPZA 1WXQA 2YRXA 3MQ4A 1GKLA 2EL9A 2O06A 1A96A 3BXHA 3H5AA 4QOEA 4ZAYA 3ZI0A 4URXR 4RTOA 1AUPA 1X1TA 1NT2A 2I1QA 2Q5LA 3NS7A 3QLVC 4YAKA 2V7TA 4PQGA 3GFGA 1K2VN 5DRTA 1N6HA 2A7QA 1EFPB 2J4DA 3PYLA 4OGLA 4OHCA 3Q15C 3M9LA 1NVTA 2VJLA 3EDYA 2JLWA 3W5DA 4RHEA 5HX7A 3MOSA 1EWQA 4L50A 2OT3B 1ZUNB 1D07A 5ALEA 1OB5A 1X74A 2X0IA 3ESZA 4NSNA 1RMQA 4HB3A 4YAJA 4P7GA 3ZDBA 5KYNA 3KOWA 1KDVA 2CV2A 2VL7A 1RHRA 4K81B 3F8SA 1L4UA 1Y9JA 2Z5FA 3QVMA 2MYUA 2I1WA 2JFBA 1PK8A 3HMKA 4XGIA 4E70A 2HK9A 3WX0A 2DLNA 1OLUB 2HMTA 4HGRA 4LXXA 1Y1QA 4IDFA 1SBCA 1KFBB 1ZLYA 2WTMA 4XE5A 5H4GA 2CXNA 2WSSD 3R0JA 4TRNA 4IVQA 2DHEA 4JIGA 1B6GA 4NHOA 4S24A 1E2UA 3B51X 3JD0A 2AL7A 2VPTA 2BFEA 4D7AA 2IHZA 4JR2A 4ZK2A 1UP7A 2MSEB 2OFWA 1DQRA 3ZDYB 3BICA 1T6BY 1QLWA 2IXFA 1R0BA 1YB5A 2EQAA 3EDOA 3GUUA 4H15A 1BKSB 2GEVA 3A25A 3GBVA 4NP6A 4PQRA 4QXRA 4GP6A 4LJAA 2ZXEA 4OG2A 4A3SA 1E32A 4QPPA 4QFDA 1XD9A 3K0CC 1WSWA 2HNAA 2BHNA 3C3BA 4XPIB 3A4IA 3C39A 1V3VA 2FLWA 1EVKA 2R5NA 2WSYB 3HCWA 3K8QA 3PV0A 3VPSA 3ELWA 4M1KA 1RBYA 5LQSA 3COVA 3N2IA 3SZOA 3ZVMA 1Y6GA 1MPTA 2I65A 3ABOB 2J5RA 3EXIB 4RF4A 5E1OA 5KWVA 3ITDA 5L7WA 3ULKA 2JLYA 1C3OB 2G36A 3I6YA 3K09A 1DRUA 1T9ZA 2MMGA 4FEEA 4FMCB 4J6FA 4RK5A 2ZJZA 3VSDA 4CCYA 1H0RA 2VR1A 2Y6UA 4ZT2A 2Y1CA 4XWGA 3IIJA 1CEEA 1Q1GA 2HXYA 1BWRA 3TW8B 3BA1A 4MA5A 5FOSA 3LXXA 1ARZA 1QH1B 3RK0A 1XX6A 1YB7A 5AHXA 3IUNA 3W79A 3LTEA 3RV4A 2BTEA 2Q1SA 2UVPA 4GMKA 3DBRB 1NXOA 1DDOA 3LL7A 4E2FA 2C57A 2A9VA 1F0YA 1C0PA 1UBOS 5HKKD 2VUUA 4MWSA 4O8CA 1H05A 3JQFC 4L8LA 3OPYB 3WYCA 4EUFA 1L7BA 4HNUA 2QMEA 2APJA 3EK2A 4EAAA 4FE7A 3S1SA 4P7FA 2YQ4A 3LDUA 5THQA 1OH8A 1N0WA 4TTRA 3I04M 1H1LB 3LKZA 4BLPA 5JDCA 1LPNA 2BONA 2NZ8A 1OFVA 1N5LA 1NFFA 2BMDA 2YJNA 1GL7A 3OHPA 4JU9A 3PUZA 4NPCA 5G2OA 5CNIA 4OKNA 4DBLE 2QSYA 4UBLA 4JK3A 1BS1A 5IH3A 3FVQA 4MUHA 4JDPA 3BEDA 3H2SA 1YRWA 2R4QA 4W7IA 3H2ZA 1RW4A 3C8ZA 1RRMA 3LYHA 3HLKA 1B73A 3JW8A 4IGEA 4WXYB 4D4IA 1AMUA 3OPQA 2I67A 4HTAA 4EG6A 3QOYA 3BC1A 4MRMB 4NCNA 1GO2A 4OOFA 2ZSKA 1ILWA 3DLIA 3IEXA 4TVBA 4YQFA 2OV4A 1N2JA 1GLVA 3FYHA 4JJ4A 3E7DA 3CJQA 3WNQA 1EJ6A 2IZ7A 3DTNA 3L06A 3FUUA 4TPKA 3BWBA 4EF4A 2QP4A 4BNKA 1XLVA 3E2IA 2WD7B 2B4YA 5I7WA 3RFTA 3OFSA 2VWHA 1XNGA 2I7XA 3G9UA 1WTAA 4BNHA 3H3FA 2HA4A 3PQ3A 3H0CA 1GYQA 1V8DA 2YMMA 4QHTA 3G8DA 1SM4A 4JSYA 2ZE5A 3ZZTA 5JQWA 1W2WB 3FN4A 5CIQA 4LF8B 1JALA 1NOJA 4KUGA 4V39A 1BFUA 5LLSA 1RAHA 5ADUS 4NR0A 5JZBA 5J5CA 2FW0A 2FX3A 4L5AA 3BEOA 4DR5B 4X85A 5J4LA 1KKLA 4MUBA 4PZZA 4OHFA 5D3MB 3RCBA 4ZREA 1T35A 2YDXA 4Z0HO 3FGNA 3K31A 1DV1A 4W6ZA 1L7VC 1E5QA 4C01A 4NMWA 1U0LA 4EEKA 2EX1A 1NHGA 1PNOA 3QVXA 4G2NA 4JP3A 4CODB 3KYCB 3WLIA 1Z16A 1IN8A 1RI2A 1P33A 2R85A 5JNVA 1KOGA 3KE9A 1ZU5A 3N1UA 4LX0A 4DA0A 5F7JA 1KHHA 4PU0A 1XRPA 2HEGA 2JJ1A 3LQ1A 4X8MA 1M73E 2ZJ8A 3GT3A 4BCDA 3KSUA 4I8DA 2JCVA 1COWA 4AO6A 3HEAA 4D02A 2JLUA 2AG6A 3RRXA 5HIJA 3UWPA 3CEHA 3KBBA 4ADSG 1N6PA 4L7QA 2QUZA 5C1DA 1JN0A 3OSUA 4QM6A 3DW3X 3GYBA 3EVAA 4HI0E 3OX4A 4LHEA 1BEZA 2WT4A 4NCXA 4ALJA 2PRKA 1Q12A 4RSMA 3MGBA 1HYQA 2Y0BA 3ZS8A 5L9AA 2GESA 4XCQA 2ZT5A 4C4AA 3IC5A 1MTOA 4M99A 1XEAA 2SECE 4QQFA 1E2EA 3QNWA 4RTQA 2SNIE 1RJFA 3F90A 2BELA 3M70A 3BWDD 2XE6A 4Z9XA 5BSRA 1QBKC 4AZ3A 4UHKA 1RRVA 5AXDA 3TTXA 4HDOB 2FUNB 4MKFA 2VSXA 1UT6A 4QELA 1Z0DA 1OI4A 1UC4B 4BYGA 5KQPA 3K0AA 1XEXB 1KE1A 4ZOEA 2NWQA 4B17A 4GKAA 1NIPA 2JGDB 3D6VA 2AR7A 2QR3A 5EP4A 2O8DA 4DKJA 4NV3A 2VT6A 2C7RA 1QE5A 1XZGA 2YVKA 3DBOB 3QI2A 2WABA 1YZ3A 5DSTA 3WB1A 4BNGA 1YS1X 4AXXA 4AY4A 2QAJA 1KYIA 2O6HA 4K9OA 4EHFA 3KVNA 2I54A 1P31A 3ZS9A 2Y1FA 2XGMA 4L8WB 1VHDA 1A0OA 3LX4A 5IJ0B 3NTVA 1HYBA 2VNIA 1FTGA 2I78A 4OV6B 4B45A 1CYDA 1KP9A 1ZCAA 2YV3A 4G4SP 3RHTA 3MT9A 4G5QA 4RPHA 5K4AA 3C3YA 6YASA 5CCBA 5JMOA 2GBLA 3EWNA 3M6UA 5JAPA 1TK2A 1U3GA 1O94C 4Q3NA 3ODPA 2IUUA 3TR5A 4C5BA 1JHPA 2Y67A 4BMYA 2UVQA 3G79A 1RE0A 2Z5GA 4QXPA 4OHBA 4ND5A 3KR0A 3TNDA 4ZV4A 2Z6QA 2I7TA 3G7UA 5AM2A 3UKJA 4RX1A 3FTCA 1UAGA 5FA8A 4BCBA 3I52A 1CP2A 3D81A 2G9ZA 1SPBS 1QCZA 4HDRA 1GSAA 4TUYF 1CVLA 3H9UA 4PW0A 3W1WA 1DO8A 4LQCA 3RS7A 1AG9A 3DDNA 3NHMA 4ZOAA 1JMVA 3U62A 4DEXA 1G20B 2FVYA 3JVUA 3NGLA 4MW6A 3TNLA 1RQGA 1EFCA 5DHUA 3AXSA 1M5UA 2OFXA 1H65A 4JWKA 3UT0A 2B7CA 3PSAA 1NR5A 3WMEA 4TRMA 1NXQA 1U4NA 1HLGA 4IV5A 4X7RA 2CFCA 4GPBA 1E3DA 4M37A 2GS9A 2OGTA 3EULA 1E0DA 2ZPTX 3SZLA 3IPRA 2IZ6A 1VKOA 3H2JA 3R5HA 5CAEB 3JRNA 4QDKA 3CIFA 4H6VA 5E8RA 1NKSA 3W34A 2Y4OA 1ZKDA 4QXMA 3FTEA 3W2HA 4TQ9A 1YKSA 1D0IA 3SU8A 3O8CA 4GOND 4RV4A 4YCBA 3LZDA 3U16A 4W5QA 5JMWA 2YYAA 4I50F 1W0JD 2BI4A 1J20A 3L77A 4U7WA 1R0RE 2PYIA 3C0KA 3GLSA 5I51A 1KNXA 1QIDA 1SHUX 2D5LA 4B6GA 3TBKA 4IFIA 1OKKD 2PZ8A 4IICA 1ZA2A 2JIQA 2OVFA 2X1VA 4Y9RA 2H1RA 2WUFA 4JJAA 4BO6A 1QGDA 5ED4A 4MGEA 3KJGA 4GS5A 4UHJA 1AV7A 1LI7A 1EQUA 1I4DD 1SXHA 4OXXA 1BYIA 1T5TA 2Q3FA 3SQNA 3O1IC 1S01A 5DHAA 1KDOA 4MPRA 5IVPA 3AL0C 4RZ2A 4U2EA 2WWVD 2ORWA 2D1TA 4EQZA 5HKBA 3ZV6A 4JEIA 3N05A 2AXPA 3OCVA 4M0PA 2MWMA 1NBMD 4R7ZA 2G7ZA 3HVHA 1XDSA 2FJUA 3U4AA 4L2IA 4M8SA 1L5MA 4TWRA 5EQJB 5TPWA 5CCDA 3RYTC 2RHLA 1A76A 2C8KA 2IU6A 2XNKA 3S55A 5HJ5A 1ZQ9A 3C45A 3DL7A 2VRCD 3AVTA 4Z9AA 2FPLA 2R6DA 4DNFA 1S2MA 4R8MA 8GPBA 1P1HA 2PKQO 4BKPA 3IEVA 4WMLA 3UNXA 1AZLA 1I80A 1QG2A 2EQBA 3WBBA 1QHEA 4ZVSA 4DQ0A 1FYVA 2Z2YA 4MCHA 1K6XA 1OWMA 3FH0A 1SU4A 4OXYA 2WF8A 2E4ZA 4Y6PA 2JARA 4ZAVA 3L0PA 4DJDC 1IBLB 3KKKA 4P33A 2I9PA 2XUFA 2CXTA 2D0IA 2FKAA 2V6JA 5D00A 4PLZA 4WZBB 3G82C 4GZ3A 2VYNA 5KPJA 4PF1A 3A3OA 1V5IA 2PRSA 4LTNA 1XMXA 1QE3A 3AKEA 4UOEA 3KQVA 2PGOA 1DC6A 4HXEB 4Q4HB 3HJCA 3LC0A 3QLTA 5DSZA 4KWEA 1U1DA 4C03A 1E1RD 3HL0A 3A6JA 3U7QA 3DOIA 3M6VA 3V48A 1DBSA 4TZKA 1LH0A 2AFIB 4MVJG 4DLZA 3SEZA 2GHTA 2WKRA 1KYWA 4Y8VA 5AJXA 4CWAA 1YT5A 5IT0A 4L16A 2NAPA 5DH9A 4US2R 3R9IA 1U0BB 2IUEA 5GAJA 3HDQA 3UJ7A 8LDHA 4N4AA 2Q49A 2GSDA 3KV1A 1AQIA 4V0SA 1HLPA 4L07A 3TW4A 3WSVA 3QLVA 5BSEA 1H2RS 3TK1A 3K0EA 5ALMA 1X80B 1KORA 1MT0A 3LLUA 3SM9A 4Z9FA 4M9UA 5J59A 1JKXA 1VL6A 3RUCA 1P5FA 3BS4A 5IKXA 5AVZA 4OU4A 3TD2A 2O2ZA 3ZNPA 2VZEA 1L8OA 1P9RA 5EAIA 3TLMA 1VI5A 4BXOB 3HZRA 4AURA 3E35A 3U0BA 1LDMA 2BI8A 2G4VA 4PSVA 2OGZA 1EFRD 1NAHA 4TSFA 1TO1E 1Z0AA 4B85A 1JA0A 1PT8A 2AZDA 1C9DB 1WCXA 3MRSA 3OTIA 5FL7D 3TE7A 3EWIA 4D9MA 4V3CA 4MK4A 1X1CA 3K0KA 1WPQA 1E8NA 1WBJB 2QD5A 2YOHA 1XZKA 4WJKB 4ZQBA 3ROGA 4N7RA 4CQLB 5CDGA 3M1YA 1U3FA 4EAQA 1NU8A 2Z1DA 3O1JC 3FNHA 1U2SA 4JHLA 3T0IA 3FOCA 1GZUA 3MQFA 4JCCA 3VYVA 3HN7A 2VG8A 2HHJA 2IIBA 2YOFA 2PO7A 1WLYA 2DKOA 1IN6A 3OOEA 1Z0UA 4LXYA 3T1HB 3ZD7A 5FDFA 4FS3A 2G6BA 3K0CA 2DPLA 4L22A 4W5TA 1ZK1A 5BVGA 2Y2UA 4B2IA 4YCCA 3J7AC 1E6EA 4DUZB 2IYPA 5I3ZA 1CDZA 1RXUA 2GLXA 2PMDA 1VE1A 3QPBA 4O4HF 4X6UA 5G3ZA 1DWUA 1X7ZA 1FFXA 2WM2A 3LVRE 1RKVA 4Q9LA 1X7GA 2ZJ0A 5L40A 1NVDA 2CL5A 3C5CA 2IYVA 2QJTA 3P2OA 3EZ7A 1ZD9A 4MI1A 4ND7A 4QULA 2BGIA 5KMGA 4JQYA 1HNNA 1P0MA 1LBHA 3QX9A 1HMPA 1DDGA 3GVHA 1TD1A 2W90A 1M2HA 1MFPA 3NH6A 4FYHA 4ZTBA 5K3DA 2Z6AA 4XQCA 5FADA 2HIMA 1Y8RB 2KLBA 2O1EA 2R25B 1QVVA 2XH8A 3F1KA 5SV2A 4CKXA 4E5NA 3QFTA 4EI7A 1HT0A 1XTPA 3LCVB 2Z56A 3D0QA 1HQCA 3K9QO 3W05A 1YFKA 4LOIA 3FVRA 2QGFA 3GH3A 4GKJB 4X3CA 4BUCA 4A8PA 5A1JA 4L08A 3ZTYA 3A32A 2UDPA 1ZGBA 2H8KA 5AM1A 1KO4A 1PNRA 2Z5VA 2BISA 3JQFA 4MUNA 5JZVA 3GEBA 1QIHA 4BV8A 2FDCA 4I3HA 1RKQA 5LZ9A 2GCIA 3G5LA 4QQKA 4BP3A 5FI0B 4ZYUA 5DW3A 2EIXA 4ZCTA 4KIWA 1DG9A 4KNYA 2IYXA 4GBJA 2BGUA 1VOTA 2GUWA 3L8DA 2BM1A 1PR0A 4I4IA 3H8SA 5EMHA 5IPFA 3PKJA 4BS9A 3WKDA 5C7IO 2UXDB 3NRBA 3BHMA 2PKEA 2WJVA 3BF7A 4D8TA 1E4YA 1ZI8A 4EH1A 4S2UA 2F48A 2NSYA 4LBWA 1M2EA 4N3AA 4R16A 2FGKA 2XMDA 5AJZA 4ZA2A 1NVGA 1OXTA 2ZSEA 4K88A 1UZAA 3KWJA 3RKSA 5KKAA 4ALLA 1HL7A 4BUJA 4YT2A 5EJ5A 4RPIA 4C05A 1GTJ1 1AO3A 1XEWX 4J91A 4B5KA 4DRXB 2I99A 3QLUC 2VTVA 2YY7A 2YHSA 2D8MA 3BORA 4P84A 2OFFA 3NALA 4JKIA 2X4IA 1Y7PA 1F8YA 1Y1LA 3G0DA 1GAJA 2GRUA 4H08A 4FGWA 1UT8A 2FEPA 1ZMOA 2J0SA 3I1JA 1NKVA 1ZJ6A 5BR1A 1IXSB 4WA8A 1RYNA 2QYHA 4KXQA 1BS9A 3PE6A 3PENA 3GW8A 3I8SA 1B6RA 3UMRA 1ESDA 2ZJ3A 4NBKA 3LT0A 3JARA 3AKYA 1DDIA 1UWKA 5KSWB 3OY7A 3SSAA 1XK7A 5FI5A 3RRBA 3WLQA 4WBNB 2QIOA 3V8QA 1YS2X 1V3TA 1XKTA 1TUBA 2O7NA 2ZRKA 1XTTA 3CRVA 3DW1X 3H4MA 3MWDA 3R20A 1JFLA 2J7PD 4R01A 4Q24A 4R3NA 2IE8A 1GG5A 3ZLVA 1ZNWA 2JFYA 1SB9A 2C4NA 2Z2XA 4D3YA 2QQ0A 3PQEA 5CU7A 4BATA 3DWGA 5EGSA 1OPXA 5K3SA 4QQ8A 1G20E 3W7VA 4IM7A 2RD2A 3CX6A 1UQRA 2W6ID 3AI1A 4LE0A 1N5RA 4QAQA 3ZD9A 3N75A 4DDWA 1JXMA 4P2GA 4F21A 4L15A 3C3XA 4BMCA 2G5PA 3B6KA 3ME5A 4HWSA 2JHAA 1Z2AA 3FCOA 3AXTA 2COEA 2AMJA 3TKLA 5HSGA 1C3OA 1OBVA 4L3WA 3FWYA 2GM4A 2EW2A 1MQAA 1UBJS 4EY6A 4EUKA 1V71A 1X19A 1CJBA 1H2BA 3I6BA 1RAFA 1OIVA 3T1NA 3UFXA 1IL0A 1K9VF 3I1YA 4BNJA 3R4VA 1XDDA 4NYIR 5HM8A 2C99A 3O84A 5LQAA 1V6SA 4IRXA 3RIGA 3UG6A 1JDTA 2UUOA 5F52A 1ZUIA 4WOCA 4J2OA 4UXJA 5AUQA 2G5GX 1LZLA 2OBNA 3DBRA 3T41A 4DJEC 5A1TA 3TFOA 4O2AB 3RYIB 1UJMA 3L8CA 1K7CA 1VJGA 2FN3A 3OIYA 4R6XA 2X8JB 2AMFA 4J4TA 1XVIA 3LVFO 3CURA 1DTWA 1QKIA 3BZBA 2CE2X 1JIXA 3KYDB 4KH0A 2RGWA 1TYBE 3UH0A 1FDRA 2HFKA 3JQAB 1AK1A 1KI8A 2DHCA 3K53A 1OVMA 2CZQA 4O0LA 1AZWA 5TJHA 2V3CC 3U3ZA 2C2GA 1H1LA 2FLVA 2W6PA 2Q0SA 3RUIA 2QVXX 5LOVA 3HTXA 1U7HA 2IGBA 4TRRA 1T5OA 2ONCA 4ZT5A 5C52B 1CV2A 1O94A 3CE9A 1EA7A 3D6TB 3I6QA 4NDZA 4A73A 4QGAA 3CKLA 1JHDA 4OLBA 1WUKS 5EP2A 3W9SA 3ASVA 3JYOA 4FE4A 3BCHA 4LBZA 1K27A 1VG1A 1E9VA 1IE3A 1V96A 2FMFA 3FROA 3ZDFA 4G0QA 2VF2A 4Y2SA 3ETEA 3ESYA 2XVAA 3KDAA 1EUDB 1EFHA 2B35A 2ZAGA 3HC7A 2AVDA 1KFKB 4JJGA 4RSRA 2H1IA 3AVWA 3SYKA 2WWIA 4DV1B 3EZFA 4BE9A 4XD7D 1RWOA 1V1MA 1LWNA 2HW8A 5EJ9A 2JFOA 5DGCA 4WZBE 3RJMA 5J2TF 1BD4A 1Y89A 1R4MA 2LWIA 2ISCA 1MMFB 2DTDA 4UHEA 1HRKA 2PWBA 1I4LD 1L0BA 3EZ6A 3VGPA 3FRHA 1R5JA 1NLFA 4B8WA 4JEMA 3U49A 5LDHA 1W5AA 1C41A 2WG2A 3R0XA 3AX6A 1CG6A 1R4AA 4DHWA 4KO2S 1Y1KE 2BSQA 4ZD6A 4GU5A 3TLBA 5JQGB 2VSYA 4ZO8A 3C3PA 5AVKA 3GJYA 3I8OA 5A3RA 2AFIE 4X64B 2GZMA 3WZLA 4ALIA 1LW7A 1NWCA 2GGSA 1O77A 2VNKA 2DT8A 3G0OA 3DQQA 3U81A 2VC2B 4D4GA 2VWGA 5F7OA 3EZLA 1P1RA 1SC6A 3F5MA 4TTTS 3SC6A 1ESCA 2HK8A 1OH6A 3F1LA 3PUKA 4LN1A 4N3NA 1KU0A 3BRCA 2R4UA 4TVKA 2X0EA 2AEJA 1Z39A 2PS3A 3DYIA 3OAAD 3RLFA 2RJNA 5DLEA 4KPEC 3GL9A 1KHTA 1F5SA 3MT0A 4QVKA 2HF9A 1KZ9A 3UAYA 3QKRA 4D45A 2WYWA 1SVWA 1MJGM 4KN9S 4EO7A 4FNOA 4JL6A 4POOA 2X23A 4CMIB 1FFBA 1EBUA 1U0EA 1ENYA 2GEFA 2JGLA 3B8HA 3WWEA 1X2BA 3HABA 4S1PA 5KYGA 2QGZA 3K8OE 4KUHA 4QHSA 5JAIA 1VSTA 2CVFA 4TMXA 4IFTA 4CDMA 1SXJA 2YV5A 1RJWA 2GVDC 1I1QB 1V2HE 1XCMA 2GZRA 2OESA 2QLLA 4FVTA 4N40A 4UMDA 3ERCA 3RHSA 2DF8A 2OXIA 4YAIA 2VTBB 4HQLA 1X94A 2IS6A 3HJNA 3WKCA 1P7VA 3B6MA 3ISJA 2GBCA 3SJCA 3DXYA 1LLUA 3PFNA 2JJ2D 3JZDA 3QUSA 5ECYA 4D81A 5IKMA 4RTJA 5AVWA 2GN1A 2P9TA 4JEHA 3G85A 1NJFA 4XIGS 1NF2A 4JOSA 3M6IA 5TMDA 2OZVA 4M38A 1ZW6A 1WOMA 1JG4A 2FZ5A 4R1OA 2Y1KA 1FRNA 4RY0A 4YI3A 2E85A 1VKRA 2FZWA 4B33A 5JVDF 4R1TA 2CNNA 1QRTA 1YXMA 4JKYA 1NG9A 1OAAA 1PW5A 2H2IA 2NO4A 4FNGA 2HSJA 3MSCA 1MU0A 2C9MA 2ZBUA 3OFVA 2HXGA 1I2AA 1PJ2A 2HZ7A 5AXCA 5HBRA 3DZBA 1II9A 1LDNA 3ZCVA 3WA7A 2Y0EA 1I3LA 2BKXA 4JI0B 3TFQA 2VA8A 1PUXA 1U5BB 3I5UA 4MS1B 5TT1A 3WMWA 2PNFA 1LBSA 4G5HA 1BRTA 2HCTA 3Q3CA 2XA9A 4K05A 3THYA 2GVNA 2IDZA 1L6IA 3PHLA 4II2A 4O59O 1XVLA 2C96A 4UJ5A 1JBKA 5JCJA 1UMBA 4R7GA 1ULHA 4MUEA 2WAOA 3IV9A 2CDBA 4YQYA 2F1HA 4G1CA 1Z88A 3PNMA 1VJTA 1WG8A 2ADFA 2WKPA 1HDGO 3I37X 5REQA 1FXWF 2JVKA 2Q6TA 721PA 3HXLA 1S3SA 1KI1A 5EWJB 3ZHSA 1BAPA 2R6R1 3TDMA 5LU8A 1Y6FA 4NMLA 4QTTB 4GOKA 4QU9A 5EJGA 3GAZA 4ZC1A 4YC7A 3NEYA 1IBRA 3AVXA 1GKYA 3RVQA 2H31A 4X6LA 4P3OA 5D3KA 2AH5A 2ETXA 2HPAA 3O9ZA 4ZVQA 1G3QA 2VJOA 4FFLA 4MP3A 3DFZA 1Q16A 1NQVA 5EERA 3SOZA 1OAKA 4P86A 3E4CA 2REBA 2OAGA 1U3WA 2DSTA 3DBIA 2VSFA 3G2KA 2IYAA 4K9QA 5JEEA 3WGVA 2DBYA 3A4MA 2X14A 4B32A 4Q4CA 5ELLA 5K4GA 4ROSA 3R7AA 3H5LA 3LWNA 4GWLA 1F4VA 5CNMA 3DBHB 4IXDA 3KM0A 1VL5A 5BSTA 1IONA 2HSEA 4LPSA 1AKQA 1WUIS 2Q4OA 4OFBA 4U5XA 3G9ZA 4UEKA 4F12A 1QNFA 4B7UA 3FCSB 3ZQJA 4X7BA 1FU7A 4WACA 3NYWA 3IAUA 2WB2A 4IJ6A 1MT3A 1XRSB 5JJ5A 4KOEC 1XR3A 2VJPA 2X40A 3TQSA 4YLEA 2FSUA 4NK5A 1JDSA 5K3BA 3F74A 1JQ3A 2GLUA 4IIFA 3BJRA 4WGFA 3KQQA 1D6JA 3HGTA 1QWSA 3G88A 5EZSA 1Z56C 1E9DA 2KPOA 3LHSA 3RFUA 1A4UA 4GXQA 3MGKA 3NGMA 4PANA 3E5MA 4XX0A 2E18A 2X13A 5ALNA 1CDDA 1GPH1 4Z4CA 4JODA 5TV2A 4KGDA 4EUSA 1EHYA 1N0HA 2VYFA 2OM2A 2WWGA 5F3DA 2F9FA 4AZWA 1PV4A 1TU0A 4TLLB 3AUFA 5AVOA 1U2RA 5HYVA 1FLVA 3KIPA 4D0LB 2MYNA 5AHKA 2RE8A 1L8LA 3AVUA 2J41A 3KQNA 1K8QA 1MIOB 3HA3A 2YJTD 4KW7A 9LDTA 3JQ7A 3OJEA 4B2PA 1R1DA 4ZEOA 4UE2A 1UJ4A 3EE6A 2JI6A 1JQKA 3K20A 1UFOA 1W2HA 2ZBFA 4RJIA 1J23A 1TIPA 1GWNA 1CY2A 1YVEI 3OPXA 2JFPA 3ICCA 3T5DA 1Z5VA 2QMYA 7MDHA 4DV7B 4PTZA 5SZHB 3V2IA 2NU9B 4EB0A 1M34B 3O8RA 4RA9B 5I7OA 3EODA 4C0KA 2YW2A 3UXYA 3ILSA 1L2TA 2GM3A 3Q7IA 1ICIA 3VJKA 3WZMA 1P4RA 1USUA 3QPUA 1FSFA 4YYZA 2AVNA 3E6AA 3ZCSA 4D4HA 1SKYB 4PLPA 2P9GA 1DC5A 1EDDA 1ZNYA 1CY4A 2XE4A 5DBEX 5DM2A 2JANA 3CUYA 2V5VA 1GRQA 2BUCA 5J3JA 4D0SA 3DOHA 1V8OA 4KQIA 4WZZA 1SQSA 3NOOA 1W44A 3NHKA 3P45A 1X7YB 4TUYA 3NHSA 4GX1A 1RYHA 4P35A 4ROTA 3FSRA 3S7TA 5IT4A 2F4VB 4CEJB 2BGMA 4PZ9A 4KVAA 4QL3A 5CVVA 5DHFA 2BM0A 1PD1A 4V02A 2FQYA 1NYLA 4PR0A 1FQOA 2VPWA 1YB2A 4TMVA 4X7PA 5L53A 3WIEA 3JTEA 4LYAA 3QLUA 4MPTA 3WDKA 4KL8S 3HJBA 3C1OA 1GUDA 3PC8C 4WKPA 3W2TA 2HK6A 1QS0A 4EIWA 1E2NA 2PA3A 1QG6A 2GTIA 4QREA 1KYZA 1L3BA 2X8BA 1FPMA 5JHHB 1Z0ZA 1FRFS 2M1XA 1LQUA 4LDJA 2W2OA 1UBRS 3K0SA 2UZAA 3L7IA 4FEYA 3AGPA 1D4ZA 3GN2A 3IOYA 4RKFA 4TYPA 5IUKC 1SXGA 1OR8A 3U4CA 1AQ6A 1Q6ZA 4Y2YA 1VCNA 4I50A 2P0AA 1AUXA 2ECQA 3T9CA 8MHTA 1TM5E 1G41A 4LWPA 1H2AS 5P21A 4YCNA 3JQ8B 2WI8A 2C4VA 2WMDA 4ARCA 2NYRA 2XODA 3RSFA 4XM1A 3GEGA 1NMXA 2EGHA 1J0EA 3ABQB 1JFTA 3C8HA 1LI4A 4MQEB 3HXOA 1M2OB 1PL8A 4X1IB 2RCYA 3PUYA 4KH1A 2R47A 2R7AA 1GPMA 2HKIA 4HKTA 5D6OA 3C14C 2PRIA 3GLTA 3EQ8A 4JYBA 2PX0A 2ZIWB 2EVWX 3ANNA 3H0KA 4WESB 4DLBA 3E0QA 4HMOA 2JGKA 4AS1A 3ACCA 3DV9A 2FPPA 4NYMR 3W9YA 1HEUA 1MGPA 2XMPA 1GQRA 1XFDA 4FFWA 3ZXSA 2A9OA 4DIKA 3A1NA 3SICE 5LWHA 1PR6A 3LSYA 1M6NA 1PBNA 2QUJA 1RQXA 3I72A 1RJ9B 3W5SA 1LW6E 5BMVB 5L8VA 4IGIA 5DK6A 1HE1C 1OILA 2JVIA 2WMNB 5FD8A 3SR0A 4G0YA 4J1TC 1NSYA 5CYOA 2A92A 3MG9A 4V0MA 2DOKA 4XQGA 1O97C 4ATNA 4EY3A 2J0EA 2RHTA 3QJGA 1VRWA 5E6RA 1U7DA 1VSBA 3NM5A 1DBQA 3PBKA 5K45A 1RM5A 1CRZA 1FNBA 1C8BA 2E48A 3A9WA 4J3JA 2PSSA 1B8UA 3IAM1 2Y27A 5EPUA 3SR4A 4ZICA 5C1PA 1D2RA 3ROZA 1WHTB 2BE7A 1JJ7A 2VHTA 3DV2A 1AKEA 5CYGA 1UXHA 1ORIA 4Q15A 4C76A 2XUPA 4F11A 4GOOD 1R6XA 4UBIA 2ZJBA 1YL6A 2ZJAA 4YA6A 3KSMA 4KLRA 3KZOA 4PEVA 3CW8X 4HFNA 4E6EA 2C61A 3DR3A 4LYDA 3WA6A 4ZCIA 5L95A 1YDFA 3QVWA 1JU3A 5TGZA 1K89A 1NRJB 2ZTUA 4FDMA 5KCZA 1R6VA 1E18A 2Y71A 4U5QA 4AJKA 1Q7GA 2FPGA 3BSSA 4WFIA 3ZHQA 1TO2E 4DMFA 2LNDA 2X8AA 3H83A 4HGZA 1GZ6A 1T5LA 2HO4A 5AOVA 5EWMB 1ZSYA 2MINB 1V7CA 1CUCA 2AI3A 2QX6A 4PYOA 5BV1A 3GP3A 1EU1A 1UIMA 1NUPA 3O8BA 4NATA 4X93A 4BBPA 2RHRA 5K0ZA 1Z8DA 5K3AA 1KEWA 4QOHA 1XU7A 3A3NA 3GUYA 4JXXA 1QBGA 4BX2A 1ZESA 1H0KA 4DRXA 1QTIA 4OA8A 3MD9A 3QKSA 4GBGA 1CS0B 1G5HA 1O8CA 3E4DA 3B82A 4P5PA 5BSWA 5AH0A 5GGXA 4DB4A 1TAGA 4OIFA 1UKZA 4DLLA 1VQ1A 5FCDA 3CLUC 4JI4B 1JT2A 2P2SA 3JYQA 4B46A 4HSEA 2DVMA 1KYQA 4R4JA 1QYVA 4X63A 1M7BA 4OVKA 4MAFA 2Z3VA 2L17A 2Z9DA 1WCYA 1ZIXA 4E5KA 3KQKA 2RG7A 2YC2C 2RGUA 2ESRA 2B8JA 4ILEA 1LC0A 1MX5A 1ZWLA 2QBYA 5K6AC 2PLRA 2AR9A 3IIMA 1ZH2A 1OYVA 2GA9A 3VYUB 3W2IA 1Y4SA 3IPAA 4H6WA 4YDSA 1DP4A 3FHCB 5EE5B 3TO5A 3DE7X 2NU8A 2ON6A 4CF4A 4UHDA 1L4EA 2HU8A 3CGWA 3FLMA 1P45A 3HKBB 1E2QA 1P72A 1WW2A 1ZW1A 3KQYA 4M4SA 4Q34A 3VISA 4Y6QA 3UAGA 3ASYA 5TMPA 1GKKA 2EW1A 4PWZA 4HQ0A 3TINA 3PFGA 3LO5A 3BWMA 2QP9X 4CTNA 2GEJA 3A3PA 4KIFA 4ZVVA 1TTTA 2VNHA 5GTDA 1K4YA 1SA0B 1B4DA 2BDEA 2FMKA 4KTVE 4W8OA 1J09A 3QBDA 4K03A 1K5HA 1B0UA 2OBYA 3C7DB 2QQFA 3E58A 3OZBA 5SZIA 2YWHA 1SKMA 1JDNA 1GKIA 2R5WA 1MBZA 2WA1A 4YAFA 2CHGA 1QWOA 5BMOA 5JPCA 1GQFA 3RYFB 3MXOA 5FH9A 4E13A 1SR8A 4RVNA 4MLCA 5EJ7A 2RC5A 4HHEA 5AVJA 2H7CA 2HWUA 4EJSB 4KEAA 4Q3KA 4MW7A 4ZZ1A 5AI8A 3SLRA 1ONPA 3ADCA 1CUZA 3D1LA 1B6SA 4ABTA 1HR0B 3RVJA 3FKSA 3IDQA 4RXUA 4GEKA 1M2FA 3DO8A 1YB6A 1TGYA 3PVZA 4PAWA 2P65A 1UXKA 2IYEA 3ACDA 3OX2A 3F7TA 2WV9A 4TMZA 2IXEA 3KYDA 1I2DA 3R0QA 4YJ3F 3T5BA 1EXNA 2ASVA 1MQ9A 1N78A 1EBFA 4QBKA 3WDMA 5TXGA 1QKKA 5IH7A 1BROA 1AKNA 1E9BA 2EP7A 5K2MA 4RMIA 3Q8LA 3R9WA 3WQBA 1C2YA 3Q7TA 1ZCJA 4Q9JA 3ZCQA 4TKZA 4KVZA 4CTMA 2VHXA 3ECCA 1EKXA 4C4OA 1OOEA 3OCCA 1S9HA 1OZAA 1YZLA 1CPYA 1MO3A 3AB7A 1NVAA 4CEIB 3JQ9C 1G42A 1HPLA 2HA7A 2IEAA 2BJVA 1XRMA 2GCNA 4R8LA 5EEHA 3ZEAA 2EYUA 4YREA 3UBTA 4EVSA 4UUAA 2FJ0A 3FDIA 4AY6A 5BSHA 1FFGA 1JVNA 4MRAA 2C5AA