1PEKE

Structure of the complex of proteinase k with a substrate-analogue hexa-peptide inhibitor at 2.2 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Structure of the complex of proteinase K with a substrate analogue hexapeptide inhibitor at 2.2-A resolution.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pekE00
3T41A 1SVNA 3H42B 3PTLA 3DE3X 3WIUA 4OMDA 1XF1A 1AK9A 2DUJA 1SBTA 4C3VA 2Z2XA 1T1GA 3L1KA 3WQBA 1AH2A 3HJRA 5B1EA 1NDQA 4H6WA 5JMOA 4B5LA 2DP4E 1GNSA 3ZXYA 3LXUX 4WOCA 3I30X 1SCJA 1R64A 4C3UA 5FFNA 3Q40A 4MZDA 4LVNA 4AKTA 3DDZX 2B6NA 1WMEA 5K7SA 4H6XA 1EGQA 3GT4A 1PFGA 2XTJA 1GNVA 1GTJ1 4NE9A 1BFKA 1KE2A 1GA1A 1ZVKA 2W2MA 1THMA 2WUWE 2PMWB 4BWGA 2E1PA 5AQEA 1Y4DE 1TM3E 3DE2X 1BFUA 2G4VA 4I0WB 4KB5A 3Q5GA 1SIOA 1AVTA 1SUAA 2W2OA 4YN3A 5CW1A 3VYVA 3EDYA 1P7VA 1V6CA 1SH7A 1OYVA 1DUIA 2W2PA 4RYDA 5ARDA 3VSBA 1CSEE 1Y33E 2SECE 4DWWA 2GKOA 2Z30A 1OYOA 1TO1E 2HD4A 3SICE 1P7WA 3GCXA 1WMDA 1SUEA 1GTL1 1SBIA 3LPAA 2WWTA 4DZTA 4OMCA 1SCDA 2PYZA 1IC6A 5B1DA 1MPTA 4JP8A 1JEAA 3DYBA 2PWAA 1R0RE 1BE8A 5SICE 3OSZA 3AJ9A 5JXJA 1Y1KE 2ZRQA 3DVQX 3GT3A 1SPBS 1S02A 1PJ8A 5JXHA 3DE1X 3DWEX 3QMPA 2Z56A 4AKSA 2PRKA 3AFGA 1Y3CE 1BE6A 3I2YX 2P4EA 2V8BA 1ZVJA 4LVOA 3LPCA 1YU6A 3F7OA 3I37X 1T1IA 1TECE 3P5BA 3VV3A 1TK2A 1IAVA 2Z2ZA 1TM7E 1Y9ZA 3D9QX 4HX2A 1NLUA 1V5IA 1TM5E 3QFHA 1ST3A 4KG7A 1C9NA 1GCIA 3F7MA 1TO2E 1DBIA 1R6VA 1HT3A 1SCBA 2IXTA 3DE4X 3A3NA 4OV6B 2HPZA 1KDYA 1NDUA 1MEEA 1YJAA 1WVMA 2ZWOA 2W2NA 1A2QA 2SICE 1AF4A 1PTKA 3AJ8A 4FONA 5FBZA 3VTAA 4WOBA 3WHIA 3DVSX 4GI3A 4H6VA 1C3LA 1GA6A 1YJCA 1TMGE 4CG0A 1AU9A 3ZXXA 4CFZA 3SQOA 3I34X 1CNMA 1SUPA 2WUVA 5AMXA 2WV7A 3DE6X 3VHQA 5AVKA 4NMXB 4KPGA 3EIFA 2ID4A 1WMFA 2TECE 2X8JA 3F49S 1SUBA 3DVRX 2W2QA 3PRKE 3BGOS 2Z2YA 3DE7X 3VV2A 1SN7A 1LW6E 5JXGA 3UNXA 3D43A 3DW3X 1S2NA 1WSDA 3EE6A 1C9JA 1SELA 1T1EA 5FAXA 2PKCA 3DW1X 1SUCA 1SBCA 3QTLA 1Y3BE 1SUDA 4K8RB 2ZWPA 1BH6A 1YJBA 1Y3DE 5ARBA 4CFYA 3TI7A 1Y4AE 5JXIA 1GT91 2XRMA 2PQ2A 2X8JB 4ZOQI 1C9MA 3LPDA 5AVJA 5I9SA 1P8JA 1SCNE 1AV7A 1SBHA 1Q5PA 1GTG1 4M1ZA 1SBNE 3A3PA 3DE0X 2SBTA 5ARCA 1AQNA 4DJ5X 1TM4E 1ST2A 1KE1A 3WIVA 3TI9A 1SIUA 3A3OA 3CNQS 1KDVA 4J94A 1EA7A 1PEKE 4NE7A 1SCAA 3TECE 2DQKA 1S01A 1Y3FE 4HVLA 3GCWA 1SIBE 4ZARA 2IY9A 1TM1E 3DE5X 2PWBA 3BX1A 1BJRE 1VSBA 1UBNA 1Y48E 2Z58A 3CO0S 1KDZA 3BPSA 1OT5A 1Y34E 2SNIE 4Z2AA 2Z57A 2QTWB 2ID8A 2ST1A 1GA4A
chains in the Genus database with same CATH superfamily
3WICA 4ROTA 2QVGA 1VCMA 2WYHA 3W8NA 2R6ZA 3IUNA 2DSTA 1KPGA 1R9GA 5D5QA 5TB5A 4E2XA 1Y6FA 3GNQA 1Q1EA 2IHVA 1YI8A 4UHBA 4WE3A 2ZXUA 4RKQA 3FZGA 3VZBA 3AGPA 4ALIA 3V6MA 4DM4A 2TYSB 3LG2A 1E6UA 1XCPA 3KYCA 1CR0A 3CNEA 2FG6C 1VHTA 2K5UA 2YCBA 4MR7B 4BFUA 5IDXA 1U5CA 1PUIA 1Q3HA 1SVWA 4OQNA 1GTMA 5CA1A 1SVKA 5AUQA 1OHHA 4KIUA 4JSTA 4BQIA 4GOMD 1CZNA 1RXSA 2XODA 3SX2A 3F5DA 3OPXA 3VSAA 2ZRMA 2JD1A 1J23A 4K1LA 4ZHQF 2JLYA 1VHLA 2D3TA 4RZHA 2WRZA 3HKCA 2PS9A 4ESHA 2XB8A 5T6MA 1LK7A 1T9ZA 4YHHB 2NQTA 1NG1A 1E79A 2H7YA 5B7PA 3KSDO 2DY1A 3GJQA 2VSYA 4P54A 1Q44A 1KA9H 3HYNA 2CYBA 2DFDA 3I5AA 3RYHB 3TUIC 5HJ7A 3PQ8A 4JCCA 4LDPA 4NZYA 5JU6A 2VIIA 4ENTA 1CUJA 4EATA 4Z7JA 5CIYA 4EPWA 1YIOA 3G13A 3U7RA 5U4XA 1SCJA 1R64A 3CLRC 4HPJB 3ILSA 2NU6B 1SXQA 3IHTA 1RQ7A 2JCBA 3Q40A 3R1IA 4R3WA 5ENZA 3TLEA 2ZK7A 4M55A 3SFTA 2PXXA 2FZGA 2ZUVA 4HZIA 4W7SA 3U4GA 3QVGB 1TKCA 5FA5A 1JR3E 4NSNA 5A9RA 1X86B 4D3FA 1KO4A 4RU1A 5B3LA 1JIJA 1QO7A 2GYWA 3RS7A 4ZVSA 4GKKB 5U1PA 3A11A 3TEFA 1CS0A 2EFJA 3GVCA 1TVKB 1AHNA 2I80A 2JANA 3PQ7A 3QYJA 4NCNA 4WL0A 2GN2A 5CLQA 4J6EA 4AYTA 5JECA 1D6MA 2VAWA 2WJ3A 5LP6A 4IQGA 4TV9B 3LS2A 3U9SA 4O2BB 2UU9B 1AK1A 2VQDA 1ANKA 1ZUNA 1BX3A 5T57A 2RIRA 3UN1A 2Z1MA 6REQA 1CY1A 1D1PA 1I80A 5AI0A 4EZIA 4MOWA 2IF2A 1QJ4A 2AQ8A 4MQFB 2KMLA 5I5EA 3TNLA 3C3DA 2CVPA 3DZHA 5CT5A 3GDOA 1QIMA 3TSYA 1XDSA 2OC9A 4QXRA 1FFSA 2Q0HA 4PIMA 5B37A 4EA8A 4FIDA 4C6TA 4P92A 4LV6A 3EIUA 3CMCO 4TQ9A 3NBMA 2BELA 1QVZA 2QL7A 2Z09A 1ZL0A 4QYMA 4RE6A 3REGA 3MD9A 3CY6A 2AW5A 1NYLA 2CGEA 4FMCF 4XCVA 2DUUA 4QSMA 4C4AA 3EC1A 3P8ZA 4Q3DA 3CFYA 3CR3C 4ZN6A 2CEAA 2BGUA 2DKFA 4M9XA 4BO5A 5ITZB 3OX2A 2F7SA 3MS4A 1RJFA 4LE2A 4KR0A 3HXMA 3AEQB 3PS9A 3A6PC 3M2TA 3O3MB 2HADA 1Y4DE 4N5NA 4RADA 2CCGA 2IHJA 3SX0A 4BLRA 5AVWA 3M2PA 1J8MF 3A31A 2KS6A 4MGEA 3KU1A 4D80A 1NN5A 3FSRA 3HFJA 4MIOA 5THXA 3RUEA 5F9HA 1TLFA 1DZIA 3PKIA 4E5DA 2YMQA 2Q7OE 1OWOA 2L69A 2XNDA 3K9GA 3KQVA 1UXOA 3CVOA 5HTKA 2QMUA 5DXAA 5G0UA 5L3QA 1PR4A 3OQIA 3MLEA 1EG7A 2BFEA 2QV0A 4CV3A 3C1TA 3GLGE 3D8NA 5AIBA 3RYTC 3CJQA 4UUBA 5JRZA 3JTMA 1WHTA 1VLJA 4RYDA 5ARDA 2XUAA 1KS9A 4BB0A 4ALJA 1NF9A 4MVJM 1UKBA 3N53A 1PJSA 1Q21A 1UDCA 2YDYA 3GFSA 4PQGA 3TLAA 4F2DA 4AZSA 2YWGA 4KQGA 2BOVA 3W3AH 4KQJA 3TSAA 3WBJA 2VXYA 1KEVA 2NT4A 3ZCSA 5EZ6B 3CVXA 4ARVA 1JEOA 4EHDA 3EA4A 2PUAA 3A9RA 3UW3A 2ZRKA 3ZDFA 1JSCA 2SECE 4BB6A 5EE3A 1C4OA 4NJMB 3K9LA 4HNAB 2EDCA 4G3XA 4JLVA 4OOFA 3G3EA 4YUXA 1ZXBA 3DOEA 2PU5A 4R1MA 1HLFA 3BULA 3HE3A 1D0IA 3WOVA 5A5FA 1BEUB 4CKZA 2AJCA 4JDUA 5E7IA 4C0HA 4F45A 1U8AA 4JYZA 2M2IA 1YXMA 2ZR8A 2J3QA 4CHGA 4OVKA 3HO8A 4R0NA 5DT2A 2IX3A 4NCXA 3FDJA 2NO7A 4P3PA 1Q7GA 1Z6AA 1SK9A 3KYIB 3PBKA 2O1WA 1ATZA 2O6LA 2CYAA 2PL9A 1OE0A 4KK4A 3THXB 2O4CA 2Y8EA 4F8JA 4RA9B 1IY2A 2P30A 3IOBA 4YLEA 4XSHA 1P75A 2H4HA 2NAFA 5EJ4A 2PR7A 2REQA 1KZ7B 1ZD8A 3AXSA 2ATEA 1MGOA 3QYPA 4AN0A 2QTMA 3PCXA 4JSYA 1EXMA 2ZI5A 3BWDD 3GGCA 3O2QB 2QAJA 4RHTA 3LGXA 2ONKA 4MWDA 3DYBA 4IJKA 1OTHA 1OXBB 2Q3LA 3F6RA 3Q41A 4DA9A 4Z5XA 5BNTA 4C01A 2XKKA 2H0RA 1LRJA 1WV0A 1H4VB 1AM4D 4RZ3A 2OMEA 4PNPA 2PSDA 4EFLA 1FNBA 2EKQA 3P9RA 4EVSA 2CT8A 4O4JA 3WL8A 3ZE8A 1JDSA 2POQX 1SXHA 5ALZA 3R7LA 3BIFA 4J0GA 3GRKA 1M8KA 2GA8A 2HWKA 4RCVA 1ZUWA 5ETJA 2HB6A 2N47A 3LOQA 2VXBA 2WILA 1XPUA 1S02A 4BNIA 4ESVA 2EGHA 3PR3A 4DQLA 2QRQA 4R1TA 5K51A 5K3AA 4QJ4A 4ARAA 2OBNA 5BMOA 2WJPA 3NDIA 3THWB 4A5SA 2UDPA 4L2IA 5IVHA 2PUGA 2IBSA 1WTAA 3B13B 4R9RA 5E4FA 5LUAA 3V1UA 3M89A 4LHVA 1V3VA 2ICAA 1SRRA 5EGSA 3QPCA 3IR5A 3PA6A 3U7QA 5C3MA 4G4SP 3O8DA 3TTTA 1GZ3A 1ZISA 1X1CA 1Q7RA 3HACA 4XQGA 1M7BA 2V8BA 2W2VA 3CRVA 4ESEA 2UVDA 3CQ9A 3KPUA 3IE2A 2QR2A 4MJXA 1UBGA 1ULZA 2QRHA 2X4GA 1G64A 2F00A 3G9QA 2IHUA 4C1NA 2JGFA 3E9RA 3F6YA 2VHEA 4OHOA 2D4HA 1EM6A 2NZ8A 2X9VA 3EAFA 1E3EA 4UOQA 2I8LA 3K09A 2YV3A 1RW4A 1FFEA 2ZRIA 4WKCA 3PEEA 1U28C 2YBEA 1XCGB 4MUIA 3LQYA 3RTAA 3T9AA 1NOJA 1PR0A 4JUCA 4U7HA 3TRHA 1CUDA 4HX2A 3ZXSA 3I9JA 1JLLB 2DZDA 4GBJA 1E9FA 5E8RA 5CFMA 5LQNA 2I78A 1P3JA 4CHTA 2DU8A 1TM5E 2ZTUA 3R5JA 3RHFA 3JWPA 1QKIA 4BQNA 1WRBA 3JQPA 1E3TA 4MQ6A 1D09A 4WWHA 3JQ8A 1WTCA 2GZ3A 4OI0A 1GCIA 5IFLA 3AERA 1FFAA 2OCDA 3NG1A 2BZ0A 2GN6A 3TFOA 1V45E 4YJFA 3HXTA 121PA 2IXTA 3QKSB 3SHQA 2WJJA 3Q9LA 4BMSA 4JYPA 3L8DA 4Q1AA 1KVSA 5F9MA 4II2A 2QNBA 3NO4A 2HPZA 4RA9A 2D1QA 4IIYA 4KVGA 4JX9A 1G3UA 3OE4A 1YS9A 1RXWA 1UKVY 4ZAFA 1PTJC 2VNKA 4I5DA 3ZK9A 1L3BA 2B0JA 3ZVMA 4YP6A 4TTRA 2JGKA 2VDWA 2JRLA 2BFDA 3KJNA 4AP9A 2H4FA 4URVR 5ILOA 1KSGA 1IEQA 2YICA 3OX4A 1LQTA 4Q4JB 4C7JA 5FBZA 2EJBA 2FZKA 3CW9A 3IP3A 3TNDA 2BM0A 4C7BA 2JATA 5IKXA 1F6WA 3IMEA 3D81A 3CLVA 4P3YA 3CB4A 4M1SA 5JC1A 2XW6A 2R96A 3F9RA 4IDPA 4MWBA 4ZRMA 1K7FB 1GA6A 4UU0A 4ACAA 5K6AC 5JW6A 3DBIA 3UCXA 1EU1A 1SKQA 2A67A 3FXAA 2A78A 1X19A 4J4BA 1G3QA 3C43A 3RSGA 2FG5A 1WDLA 5AFSA 2W90A 3B6KA 1G7TA 3WNQA 3WGVA 2GA9A 1OTXA 2WUVA 3BIOA 3O4FA 3EXG1 3SZRA 3W5HA 4Z3KA 3ECAA 1AK2A 5CCDA 4G26A 3QIVA 4UAGA 4FT4A 4LG1A 2DPYA 4YASA 4NHEA 4OUDB 5L40A 3HN6A 4X6UA 4D98A 3GELA 4LQLA 3U9TA 2O3QA 3NNSA 3SS9X 1QH1A 1JDVA 2ZE6A 3N6XA 5JV5A 1T5BA 4MX8A 3HXKA 4ZCLA 4MS1A 3A1NA 2JGDB 2WZBA 3ZGXA 2R6R1 1Z2CA 3K0BA 1ZQ9A 2WFAA 1JQ3A 1O7JA 3CF2A 3GQVA 4KQWA 5CB6A 2WJ6A 3N0TA 2EBFX 4C0WA 3FTEA 4C0JA 2AJLI 2Z2YA 3AV0B 3O8OB 2XDWA 2OVBA 3NC0C 3NX4A 2GLUA 1Y7LA 4PQFA 2ZT7A 2VHUA 1Q3KA 4DV2B 1IZ8A 4MYSA 5I3CA 4JVOA 4GOND 3BVPA 1DCFA 3OAAD 5E6RB 1Z4KA 1Z0FA 3UNXA 4QBTA 5CX4A 4PTZA 4MMZB 4DDUA 4XA8A 3D7KA 5ESXA 4MV4A 3U19A 3C6QA 3M5CA 2HYDA 1SMKA 3U2QA 3ESQA 2ZBPA 3R76A 2D2VA 4KOEC 1ECJA 1HUQA 1XD9A 4M76B 3GI1A 3TOZA 1QH9A 5A9TA 1ZHHA 3OX3A 5IAAA 3DOCA 3ZHSA 1L5MA 3G8YA 2UZ1B 1G5QA 2TMKA 1ZH2A 2F6RA 2FMHA 3AIIA 2CMGA 1TUEA 1TTQB 2B61A 1V7PC 3VKVA 1M2HA 1K8ZB 3ONFA 3CNBA 4KLNA 1XPOA 3N2YA 5K0ZA 1P77A 1QGOA 5JAOA 3I64A 1UC8A 2PR2A 1O95D 2WYWA 4N0MA 3VPFA 3ZCPA 3KPVA 5IYZF 4G1EB 4D9EA 1RVDA 1Y4AE 4QECA 2O07A 1V1RA 2YZMA 1J56A 1FVOA 2Q9UA 5JO9A 4OHZA 2C1EA 2QUIA 1CVRA 4E88A 1HDIA 4KRGA 2YMMA 1MKYA 3LUGA 4HQRA 2G67A 4Y6RA 1P7ZA 4H7KA 4AY6A 2X8JB 3EZLA 4ZQGA 3LRXA 8LDHA 1XEAA 2IEZA 2FY8A 4DYVA 2YYSA 4I1PA 4LTNA 3HB4X 2QX9A 4ZOLB 4CJXA 1VE7A 3J7AC 3IBGA 3ZQ6A 2P6NA 4J03A 4UFOA 1GJRA 2NZUG 2ZM6B 4QUDA 3RM3A 5AM1A 3SX4A 3R6GA 1O6CA 4H3SA 2G70A 2ZR7A 3HMKA 2DJIA 1N1EA 5J2TB 2DKNA 2ZJOA 4DR5B 3I52A 1TX4B 4LZOA 1Z5PA 4JLKA 1Z25A 3NKVA 1J1IA 1T6ZA 4OUDA 4RFLA 3D6TB 4U8HA 3GA5A 1M2EA 3C4JA 5LKRA 2KM1A 1W49A 3R4VA 4U7JA 2H5JA 1JKXA 2RHLA 3PVSA 3HNOA 4N5MA 1PJRA 2AT1A 1KR5A 2B2CA 3UV7A 2IV2X 3ZV5A 4BBPA 3ICQB 2JGDA 3TIVA 3L5KA 1JLKA 5DHAA 2C99A 1O95C 4LX0A 5AK5A 2SBTA 5A62A 1HRKA 4YJ3B 3N2KB 2GHIA 3PT9A 4L5YA 4BQPA 1BGVA 4HGQA 3C6BA 2H2AA 1LQ2A 1R4NA 1AIPA 1R3UA 3NBQA 3O8OA 4NNPA 4OHCA 4PRLA 1ECCA 1KE1A 4PXAA 4EF4A 4Q3NA 5E0OA 4QXMA 2RHHA 5GONA 1C29B 2REXB 3EZ7A 3DWFA 3WWCA 5F78A 2D2EA 2OO3A 2XMDA 3TW4A 3V48A 1VA4A 4EABA 4AKGA 1SCKA 3HI6A 1FX0B 4PYQA 3H5WA 2WQ6A 2VPYA 1QVVA 2O0KA 3E1SA 3CG0A 5M04A 3EH1A 3G2MA 1DC6A 2QKYA 1RQ2A 2NUPB 2XUKA 1V3TA 2HJ9A 1QOPB 1YR2A 2AN5A 5CGZA 2DWUA 1F5NA 1TJPB 4B3MB 1WXWA 2V7WA 1IWPB 3ER8A 5DW3A 4UTXA 1JIUA 1NX9A 4K6HA 1KI1A 3M5WA 2PBLA 2FFAA 4KO8A 3HVKA 1NBEA 2OO5C 2IY9A 1NRJB 2R85A 2VBIA 3AP3A 3RR2A 2JFXA 1HE5A 5ECYA 3C6KA 1BJRE 1GPUA 2AK3A 1U04A 3PNYA 1Z0KA 1T4MA 3C3JA 4MYDA 4Q1DA 1YF3A 3N8GA 4LJSA 1KU6A 1OLSB 3DB1A 4FOPA 1L3IA 3N2GA 5AIAA 4D4HA 5IXSA 5KEIA 4IMRA 2C7OA 2HZ7A 3B6JA 4DLSA 3TSWA 1RHMA 4ICIA 3X2SA 2ZVQX 5DHRA 2V8OA 2A33A 2AGVA 2QRZA 2HIMA 5K0BA 4NAUA 1ULUA 2VT2A 3EW9A 2Q5JA 1RI4A 2EL7A 2F8MA 3CRRA 4JOSA 1JIXA 2EBHX 4KQHA 1T8UA 5ULLA 4LSWA 2Y0BA 2Z57A 2P6OA 4ZPJA 1NY6A 3HM9A 1LU9A 4JA2A 1CULC 1K7SN 1A97A 2A30A 2C4MA 3BD6A 3OOYA 2IZ0A 1M6YA 2XYPA 3MVEA 4DR6B 2PFGA 2OCYC 2D7JA 2G9ZA 2XIQA 3COSA 3JYNA 3LOPA 3PU6A 2K4MA 1LCIA 2HLHA 2XCUA 4UPVA 4PAOA 1XROA 1FZQA 4PG4A 1K5PA 3EULA 4ZMSA 2POCA 3VZCA 1E0SA 2EP5A 5A3JA 4Y6GB 5IT4A 1NSFA 1POWA 4GM4A 4JD5A 1E2EA 1E98A 4NMHA 2XE4A 1NJFA 3ELBA 2R86A 2JFUA 1HLPA 2VK8A 4TL7A 4Q01A 4U7PB 5DTQA 3BDIA 3E23A 3WLLA 1V8DA 2B3DA 3ZCQA 4C3VA 3LDFA 3F1KA 1GFIA 2FZCA 1ZJZA 2RHGB 3FDFA 5CLHA 1P73A 4GS5A 1V4NA 2VSQA 2H92A 2Z8ZA 3KXKA 3PX2A 1N78A 4H4CA 4CLOA 1U0JA 4CQJA 2PZEA 1XD2A 2XQJA 3C70A 1WCIB 2HK9A 3SAJA 3VGPA 1EFVA 4I19A 4NX2A 5EIBC 4URYR 3F8WA 3K0SA 4DR4B 3UFXB 4B5LA 2DP4E 1JHMA 1FX0A 3DKPA 5CW2A 4C0QC 2JLXA 4X0EA 3QE9Y 3EPRA 4FFWA 5FLXA 4KMOA 1QCDA 2OECA 1GCGA 3WWZA 1WG8A 3T3HA 3IV6A 4R5MA 4RKRA 3WFZA 1TEZA 5AI4A 2JIPA 5AJZA 3UZUA 4A91A 4BO6A 4YMGA 2FR0A 3D3WB 1W88A 3I0ZA 3PC7A 3FB1A 5HCNA 5JY6A 4RCZA 6AT1A 3TN7A 3UWOA 1Z5GA 3SE7A 2B4AA 3K2QA 2MSLA 4MZDA 4QRHA 4IHJB 2FK7A 4AWBA 4U7DA 2ZUFA 4JJFA 3A70A 2P2YA 5TQVA 5BSKA 1UFKA 4RHUA 5BMVB 3EZGA 4FDMA 4ZJZA 1TAGA 4M1YA 2H1HA 4IUCS 1PG2A 1NZDA 1XKQA 1MDFA 2FJ0A 3AW9A 3GEEA 1PR1A 3E6AA 1Z0DA 2BRUC 2YFHA 4RJ2A 2JHFA 1XELA 2B4RO 2IQ5A 3IKJA 4WZZA 3X1MA 1QGED 4EG8A 2QRKA 4Y1EA 1THTA 3CX6A 3OTWA 3O0TA 5CJJA 4RY0A 4ZAGA 3WIEA 4UHEA 4HBZA 1S2OA 4TKLA 3UG7A 2E4VA 4KITB 1FS4A 2I34A 3OHMA 4O1HA 2WEKA 3L8EA 1FIUA 3DVAB 1WSBA 2GETA 3C5HA 3IV7A 3R3VA 5JVDA 5FUQA 2C1ZA 3R5SA 2GRJA 5KVSA 4D4IA 1TGVA 5F1KA 1TB4A 1BWRA 1T3TA 4AXBA 5IAGA 4KWCA 3G17A 3L0OA 1Q7CA 2V96A 1QORA 3TRIA 5BSUA 2ZW9A 1Z8DA 1EZZA 2F67A 3S1LA 1NQUA 5EZ5A 2GCNA 4UNPA 1WUJS 5DNWA 1J8DA 5EINA 3WMGA 5JSZB 3F5MA 5FQNA 5GOZA 2JDID 2AN3A 4NXNB 2XZPA 3CINA 4XYGA 3DLTA 5LN1A 1VGVA 1BFUA 4P7BA 4YT5A 1XZCA 2Y68A 5FNVB 3Q1KA 3ZU2A 3UJ7A 3K4HA 3TJRA 3IOEA 1QFYA 2XCIA 1ZD2P 3E0XA 2B5VA 3BC1A 3H3FA 3JALA 3HUTA 1NQAO 4IDHA 4YN3A 2FV8A 4MQMA 1O96A 3DZIA 3RJ9A 5KSYA 2CV0A 2VDPB 3EDYA 5EZYF 4F5WA 5C53B 4EAAA 4HAOA 4J6FA 1ESCA 2VUSA 2GHQA 1E96A 1GY8A 4AWAA 1OXVA 2CCJA 4X7RA 2D7CA 5HFJA 4CDRA 1E1RA 1R3DA 2BKEA 5GAJA 3LHFA 2KJQA 4XYBA 3CZ9A 3PI6A 4U3JB 3RVSA 1MQSA 4WLOA 4XDZA 1KFKB 4LOIA 4UJ5A 3HR7A 1SXJD 3JR3A 4KVZA 1COWD 3ZG6A 5A4JA 2OYRA 3QNMA 3RSLA 3GLFE 1SQSA 1GGVA 2WSBA 1MB4A 3DJYA 1C1XA 1OMOA 3HA2A 4G07A 1UPXA 4E70A 2XYHA 1ZH4A 3SICE 1G4AE 3NWPA 1FQOA 2XDAA 4EP1A 4TKUB 1BMFA 3P32A 2HTEA 1K88A 4ZQHA 1SBIA 2PLFA 4YO7A 3OO0A 4HY3A 2BN4A 2VHJA 1PQUA 4U9UA 3T7AA 3ZGZA 3WYCA 1IG0A 1M72A 3ZIUA 2L0XA 4FSXA 1BWQA 3N8NA 3IEXA 3CRZA 1MC1A 1NJSA 2FEMA 4JEIA 4M83A 5TGTA 2Q7DA 2A57A 1X8LA 1OWLA 2Y05A 3ZK8A 1LPMA 3U5TA 1I94B 1EPUA 3GOQA 2BI8A 2JAQA 5THKA 4RBNA 4W5QA 4N82A 4UTNA 2PTGA 3R7WA 1Y5RA 3ND7A 5DFAA 3N28A 5EZQA 5IJ9A 1GPWB 4UULA 1T4DA 5A4IS 1HOXA 3L4KA 2PWAA 1XYGA 3NHLA 8ABPA 3JQ7B 4WZAB 1I6WA 2C3OA 1EM8B 3UV3A 3KJEA 2QZPA 5JCJD 1U31A 3UT5A 2JIMA 1TEXA 2VPZA 3IPCA 4F21A 3KR9A 3M81A 4JI7B 4RVUA 1AX9A 1RM5A 2VRWA 3LA8A 5ENDA 1MO3A 3IE1A 3EGEA 4FNGA 5DHTA 2G40A 1HH4A 4OA5A 1GRQA 3BMNA 3FPEA 2A5DA 5IN5A 4BN0A 4EAQA 5CM8B 1XWWA 5B4VA 3Q98A 1ACLA 2X1VA 4B2LA 4Q3EA 4RS4A 5DASA 3BQNB 1ABBA 1EA5A 1XLWA 1IPFA 2IVFA 2C31A 2L82A 3DAFA 4HAYA 4LISA 1BE0A 4R6XA 5JH7B 1H6DA 4EJ0A 5ICCA 2IU3A 5C8VA 3F4KA 5BN4B 3RVKA 3KFXA 3C6YA 3KCNA 4DMMA 1M1NB 4YJKA 4EPRA 5CG1A 4WY5A 1CB0A 4IHQA 3IHKA 4RTSA 3PC3A 1M0SA 4FWTA 2HF9A 3I2YX 2EZTA 1KI6A 3C7TA 1X9GA 2A4MA 2YOFA 4Q66C 3VNBA 3U49A 4EZBA 1JHAA 3B6MA 3TKYA 2FK8A 4BFXA 4BMNA 1TDJA 1D5WA 1JHYA 1W75A 3FPFA 2C2MA 4NU8X 4MVJG 3TF5A 4C0SA 1ETHA 4PHTA 4NS1A 4OQMA 5DNYB 2LCFA 4LTMA 4TS9A 5CVUA 1PR6A 5K2MA 1RHUA 2XVMA 4FZVA 4NU6A 5FO0A 3B1KA 3P0HA 4ABYA 1ULBA 4CT4B 3HB7A 3SYRA 4H7FA 4CDGA 1Y4ZA 5ELMA 2MINA 5LQKA 3OY2A 3D9QX 5I7UA 3PNPA 2NUTA 4COOA 1MRSA 2YXDA 2HSJA 2VUTA 1WULS 2E55A 3FUXA 3ITNA 2PKQP 4I08A 3WJ1A 3QFHA 4BNJA 2Y9PB 1GUBA 3DFFA 1YS1X 2VK2A 5CA0A 4TKUA 5L3VA 2CFOA 3VTAA 4DMCA 3S2UA 4HDNA 4G65A 4WESA 4ITVA 5KYXA 3U7GA 1D0VA 1VCNA 5IK2D 2PXAA 3U4QA 2BWJA 4MRVA 1E3JA 2HWWA 3JQRA 5DDIP 3C85A 1NBMD 2J6BA 4S1OA 3W6UA 3L82B 3KYJB 4MO2A 3R0JA 4MVJI 2WTXA 4YJ2B 1ZI6A 2DWOA 3S68A 3TMAA 1O94C 3WGUA 2XTZA 2IEBA 3KAPA 3LOUA 4YJGA 2IX9A 1A4IA 1G20E 5CVJA 4QXPA 4HO1X 2FDXA 1RYEA 3ICWA 2H06A 3PE4A 4GD3Q 3ZKWB 5I01A 5HTOA 2GPWA 1VKJA 1TZBA 2PKWA 4KWIA 2CFIA 2SICE 1S2IA 1WSWA 1INLA 3ZPXA 3GROA 2DWCA 3FVVA 2Q27A 3HCEA 3B12A 2IHYA 2XZLA 2YW2A 4L8WB 3VA7A 2EKDA 4DJFC 3OJFA 5KJCA 4PLFA 3IAM6 4R6WA 2VSNA 3FNEA 2JEYA 4JB0A 1W0JD 3CNHA 3NV7A 2HQ1A 2JGMA 2PX0A 4H6VA 3RSCA 1GHTA 3A7EA 1N92A 1KY2A 3CX4A 2QW0X 4K7JA 3FA2A 3PDIB 3TW8B 3ORYA 1DC7A 3S2GA 2Q1UA 3UMCA 3TPFA 1B0AA 1AU9A 2GFHA 1B8PA 1Z6QA 2RC5A 2WC1A 3HDQA 5B1HA 1BN7A 5IAKA 2GDZA 4UUAA 1KDPA 2XZOA 3H0CA 1YDFA 1XZLA 2BGTA 1G42A 4L50A 4KFCA 1LSOA 4YQYA 1E4VA 1XVTA 3I6ZA 4U2EA 4RGVA 4IOLA 5BRNA 4GM0A 3EIFA 3G5UA 4GP6A 3KWMA 4GP9A 2KBFA 3JWIA 4MMXB 5KVVA 5TS2A 5D87A 4HHEA 1ZCBA 2RGYA 3BCSA 3W9SA 3ZI4A 5I7FA 1TVMA 3ES9A 3AZPA 4CI0B 1S3FA 2X0JA 5D3KA 2VUIB 3FGZA 5JTUA 5CDFA 4BP1A 1VG8A 3JASB 5IVKA 4Q93A 2B37A 4F3RA 3NHFA 1W0KA 4KC0A 4C7XA 4F0JA 5IMSA 1X8XA 1OX6A 3IP6A 3L01A 2B83A 4YXWA 3HHPA 3BXOA 1F17A 5CHEA 2R47A 4KI0A 5D8DA 1DO0A 4AZ0A 2DUMA 1OOEA 3E5RA 5A0TA 1DPGA 3W4JA 2BEWA 1SVIA 2BAGA 4P36A 4PFJA 2R8RA 4BJHB 5KKCA 1TYZA 1M5RA 2QZZA 5JG7A 2PX2A 1PKXA 4D46A 4H77A 4LMAA 1Q0RA 4UHFA 4IIJF 3WLKX 4J1TA 2G8LA 2BHTA 4LQ4A 1URPA 3NS7A 4V0QA 1Y82A 3LUHA 3VR4A 1GGEA 4G1UC 4PC2A 1IXRC 3N86A 5TQ2B 1XNJA 4LV8B 1HE8B 2WABA 3KVOA 1KWKA 1YE3A 5IEJA 2PKQO 1OWNA 3I4FA 2JZNA 3JAWA 4S12A 4TUYA 3WADA 2Y93A 3PTZA 3VH2A 1WDMA 2YX1A 1OI2A 2PXCA 4DCMA 3HB1A 5CVDA 2Z5FA 4MPTA 1AHIA 3U4IA 1ONNA 4MS3B 1BXRA 1G5PA 2HWUA 5TGZA 2AX3A 2BDTA 2P9BA 3EF3A 3EZ2A 4YRGA 5AXCA 2GD2A 3C3AA 1SWWA 3PUVA 2N1MA 1ZOLA 5LBIA 1W36D 1IXZA 1GPYA 2YMPA 5G02A 2A5YB 1ESZA 3OAAA 2H8GA 4AJJA 2DR0A 4HOYA 5JS1A 1TEHA 4J3JA 1YUMA 1H2FA 2O8DB 3LPDA 1W1UA 2OVFA 2ZWIA 4U63A 3FPSA 5LP6C 4BBZA 3K6SA 1J97A 4E5PA 5HZHA 3TO5A 4N3NA 1FDIA 2I99A 4DC0A 3ROGA 4GZMA 1V9SA 3U1BA 1R4ZA 3MLAA 2WYOA 1NBAA 5A5VA 3U3RA 2ZITA 3PC6A 4YRMA 2BJHA 3WDMA 5F7XA 4GWGA 4JJGA 4Q34A 4OMFG 2FFQA 1EJ6A 1HTWA 3DO8A 4I9FA 1EUDB 1I7PA 4RJJA 1DJLA 5EXEA 5A3RA 4IX9A 3IAUA 2HRZA 1EGHA 4RK1A 1DOZA 4XWTA 2PH3A 4LJRA 1TKBA 1YB5A 4R0VA 5GZ6A 2V7TA 3NV9A 4YV2A 1MCZA 3TJMA 5JC8A 1DO8A 1L6RA 3PXXA 1S4MA 3PXBA 1WAMA 4Q9NA 3FDIA 1L5KA 4P80A 4DS3A 4MCIA 3FMIA 4F4HA 1UQTA 1XX6A 4FHCA 3VH4A 3AL3A 1W36C 1SZJG 1DX4A 1PHRA 1VMKA 4D3DA 3O8BA 5JAQA 1QU3A 2GHRA 1GEEA 2V9CA 1LPNA 1V3QE 4NBLA 5FPTA 3ZNQA 4C7VA 5JEDA 1O0BA 4L78A 2CNNA 2QK4A 4BVBA 3FH0A 2QRPA 2IYZA 2XUQA 2Z9CA 5IARA 3V7NA 2NO5A 1R6AA 2JH9A 4WH0A 1TRHA 3WRXA 1Y3IA 2Y76A 3V2UA 4XB2A 5CDGA 4JB2A 1ZCFA 1JDBC 3RC7A 1Z4NA 1DAMA 1RHQA 2J59A 3HDGA 3SGLA 3SLGA 4UBJA 4KFRA 3TQRA 4TMVA 4B87A 1IM8A 1CG6A 1KJWA 2C54A 3E7WA 3QU2A 4GLLA 4XCXA 4LFAB 3WIBA 4JLUA 2WHQA 1IBMB 7ABPA 2VQ6A 4BP8A 4Q9IA 3HCNA 4OJTA 4IKEA 4I5EA 2GJKA 4O4IA 5LCXA 2ZQZA 2WJAA 1GSOA 1KJYA 4UPEA 1F4VA 2QIOA 4ZARA 4ZD6A 5CD1A 5KHAA 3FPLA 1GR0A 3C8DA 1D8AA 4YWJA 1QG4A 2OPBA 1GG2A 1TC1A 1Y98A 4S0ZA 2NSDA 5E6SB 2V54A 4X64B 1QV7A 4MNTA 4X66B 1W76A 1E6WA 4HTFB 2JCXA 5TRTA 2PMDA 1I14A 4V1CA 3JD2A 3CO0S 4CLEA 2ZAMA 1FU4A 2EZ4A 4YACA 1MVLA 3GN1A 4RGYA 4CTMA 4B7UA 3IQZA 5DI3A 1IOVA 1P2SA 5AXDA 3EUWA 1V4VA 4Q7KA 1XXLA 1N2CE 2F64A 4HR7A 4TQGA 1LI7A 4EFDA 2NPFA 3FKSD 2ZI9A 4J76A 3FWYA 3AJRA 4OEHA 3SZOA 3K4QA 4UQPA 3G2LA 1JR6A 1X2BA 1DEOA 3Q12A 4JNCA 3RYIA 5DLYA 4IG9A 2J4DA 4OM8A 2B8WA 4RVNA 5JUWA 1P0QA 2E7ZA 4EKNB 4FZ5A 3I76A 4QEKA 3N0XA 4E2FA 1WQ1R 5C8XA 2CF5A 1KF0A 3GIWA 4YT8A 2WFLB 3PUHA 3QUSA 5I9TA 3ABIA 4RAQA 4HNUA 3SEZA 5LFAA 3BWXA 1ESNA 2BR4A 1AKTA 5GGXA 1MX9A 1QBKC 1WXGA 3C8UA 1MC4A 4QFMA 1E5DA 1UMCA 2VYVD 4X3CA 1QAQA 2Z2XA 4J07A 4Z2YA 2UV8A 3TH5A 2OO7A 3NIWA 3L1KA 5DTEA 3KJIA 1Y37A 4NEGA 3GFRA 3OM9A 3HJTA 5JANA 5KJ6A 3UPTA 3HJRA 3D0KA 4GBGA 4D3ZA 1CNEA 2BFPA 1VECA 3CKMA 1UC9A 3AI2A 5DN9A 2H3HA 1RQLA 2ZDGA 2EJCA 4F1KA 1T10A 1EX6A 2JIRA 3B60A 4CETA 3NALA 3DXYA 4MUEA 3KZ1E 1Z68A 4ALMA 1V1MB 3E82A 4LMBA 2EW8A 2Z4RA 4TS4A 4V24A 5LB2A 3UHFA 3ZE6A 4L5BA 4CR8A 5KZMB 1CR2A 5LU8A 1AQYA 5DTMA 2XVZA 3ZV3A 3ZWNA 2AKYA 2Q49A 1AC5A 3O9ZA 1MOSA 1U3DA 4YCNA 1N6IA 2VH2A 1JU3A 4XIFA 2O1SA 1T5IA 1MV5A 4JSRA 5T8KC 3KVNA 4GOJA 2QTBA 4BMYA 4D45A 1U1CA 1Y9JA 3WBBA 1MX1A 4AKTA 2YWXA 3A9CA 1GPNA 3H1TA 4MGHA 3M9WA 1M54A 3HBFA 4HF7A 3QE2A 2ZJ0A 1HBJA 3I05A 4DNPA 4ZV4A 3MWGA 2PD6A 4KZPA 5E2AA 5IJ0A 1KJQA 3Q2OA 3VNVA 1TJYA 3DONA 2B69A 3GT4A 3I04M 2JLRA 2RCNA 3HADA 2ZZKA 2BMWA 4IP0A 3KPWA 4H1HA 1HEUA 1GPH1 3WWYA 4D97A 1KOGA 5ADWA 3AFNA 4QQRA 4P3OA 1C3OB 1RHRA 3JD4A 4FINA 4JP3A 1TOAA 5E3HA 1DZ3A 5LYJB 1I01A 1OXMA 1WXHA 4X71A 5LOVB 2J4FA 2ODAA 4JP1A 2P78A 2R84A 2YYYA 3IBTA 1CUGA 3BWMA 4DNFA 1ODIA 3I6BA 3VPBA 1AA9A 2HU7A 2WWRA 4AM8A 4E4RA 1Y8ZA 5IF9A 4ND8B 2XMZA 4DMKA 3EODA 4EHJA 3DLCA 4WFQA 5J9FA 1N7HA 3D6NB 5C2JB 2J3IA 2VPWA 3EVBA 4OJQA 4PBSA 5EUCA 4E30A 5C1BA 3LBNA 1KI3A 1W4LA 2XADA 3RC1A 2X58A 4EECA 3WYGA 1JHRA 3TXAA 4ZOCA 2YV2A 1FRFS 1AGXA 2NTNA 2C4TA 2O14A 3C14C 1R0KA 2OWEA 3LBHA 4UMDA 5GM1A 3KOZA 4AB1A 3FKJA 3IALA 4FD2A 4HS9A 4KQCA 4LGMA 5ALPA 3RRJA 1LSJA 2R5FA 3ED1A 2IHKA 1H8HD 1TUIA 4Z9BA 2JLUA 1BEEA 1TYAE 1VDZA 5CW1A 3STTA 3DO6A 3TEMA 4EJSA 1L8LA 1XAIA 2ZREA 3MJRA 1DBRA 1G5IA 4HWGA 1T6XA 4LVUA 1EMDA 5F3RA 4EYQA 1SH7A 3MD0A 2XB4A 4F4FA 3GLVA 5K0TA 4RLHA 1DUIA 1XHFA 1BVYF 2WD7B 4JVLA 4MGZR 4M1QA 2GN9A 3OQHA 1CY6A 1GADO 1KQ3A 2DUWA 2B98A 1XU4A 3DLPX 1L5YA 1ZD4A 3H9EO 2O9JA 4ZVRA 4MDYA 3S7ZA 1JSZA 2E4YA 1N2GA 2J9FB 2NVUA 2ZJ7A 3D2CA 3KDSE 3LO8A 4IG4A 1E61A 1ZW6A 3LWDA 4HFRA 4CNQA 4E21A 2VHWA 1CSEE 2HNKA 1GLGA 5JZBA 1XMXA 2VWGA 4PCLA 5HVNA 4WK0B 2J5RA 5B2EA 1DJNA 4ENRA 3NIBA 3PHJA 4I36A 5NLLA 1CS4C 3BRWA 5JD4A 3AKCA 2JDIA 2PX3A 2GKOA 4RFSB 4TSRA 4DCUA 3WAKA 5LLDA 3PNLA 2YHIB 1GL7A 1F8UA 2GYYA 2PSHA 2FE1A 1LDBA 3LF2A 2DBVO 4L8YA 1QPZA 1HF3A 3LT1A 4JBIA 4A0QA 4XDGA 3BCUA 3LT4A 3ZCVA 1H1LB 1E5XA 4BO8A 3CEMA 3LPAA 3DHEA 3OZVA 2C88A 2HCTA 5BV1A 4KIFA 1U8YA 1DQPA 1KZ6A 4RXMA 2BEUA 4LXTA 4OMCA 4R1QA 3TZ6A 4ND6A 1YCFA 3DWGA 3T54A 2WTMA 3W5JA 4KBGA 2PO5A 3Q4GA 1ISPA 3OPNA 4J91A 1ZYUA 4LYHA 3UKDA 4LE1A 1OH8A 2NOAA 2P90A 3KYDB 4OHPA 3UGKA 1RBMA 4XIJA 3MSCA 4Y9TA 5KQMA 4YJDA 5GIOE 3H6GA 3L84A 2BMVA 3CZMA 3INGA 1C3OA 2WT9A 3B1JA 4XSVA 3LM8A 3RWBA 4BBAA 3E3MA 1SXJA 5TMDA 1NW4A 4R2HA 2XOKA 4NDZA 4XGQA 3RW9A 4YAUA 3EW7A 4JELA 4UHDA 4G5HA 3D6HA 2OXTA 5BORA 2H63A 1DUVG 5KU1A 2RMKA 4L5IA 4EUFA 1UH5A 2WUGA 2MSCB 2GPAA 3C7AA 3TSOA 1YDEA 3AKDA 3M3DA 3HFGA 2I6QA 2IC5A 4ND8A 1KU0A 1QHFA 1U3VA 2R79A 2V59A 2QAGA 3DVQX 3MWJA 2HRDA 1JT9A 1H3NA 3PNMA 3DF7A 4ND7A 4MIEA 2IWHA 4FYJA 1QDLB 3GD7A 4RIIA 3R3ZA 2O2JA 3K2EA 3JRXA 4TL6A 2FWIA 8GPBA 3G8AA 5JXHA 3WMRA 3GCDA 4F93B 2B0CA 3PUKA 5M34A 4QFCA 1PSWA 1FTWA 4J49A 4TXLA 3F5QA 4C0LA 5TIIA 5D5PA 1PYOA 4XGKA 3SBDA 2BTQA 4CKBB 1WMAA 3QTBA 2W42A 3KYBA 1S8FA 1WOMA 4ZVNA 1EXWA 1E1KA 2C9BA 4ZAXA 4DYHA 5KNBH 1YONA 5ESDA 3BE6A 2AG0A 2CNWA 1K0FA 4QHYA 3V1LA 4MDEA 4KREA 3GLUA 2QT9A 4AZVA 1E9AA 3LF1A 3ODGA 2P4EA 3GLQA 2CVQA 5BSVA 1KQNA 4L6IA 3ZD7A 4XXHA 5JCJA 1PO7A 1Z36A 1ZSYA 4INZA 5CB8A 4CV0A 1A9OA 2JZOA 4WFIA 3V32A 1LLUA 3HEBA 5AKYA 4B3XA 1MVNA 2HO5A 4EEZA 2W8ZA 4Y3UA 1YMQA 1FTYA 3DMTA 3SYMA 1GOTA 1PFKA 1KZ1A 4MPRA 1LVHA 4URFA 4IGFA 4LAFA 1BX1A 1V37A 1J70A 3PFFA 5CUQA 3HTXA 3ZS9A 4NEQA 2I9KA 2VRCD 3GOHA 4BCDA 3DGFC 4LWOA 1MZVA 1QFSA 1QVRA 3C3XA 1MQ8B 3G85A 4YMHA 1BYUA 3OLVA 4XQ9A 2R6HA 5EEGA 2R6FA 2DAPA 3D8TA 4KPUB 2AZMA 3NHRA 5DCLA 1SD2A 1PS8A 3K1YA 4AO6A 2IE0A 5TE9A 4RELA 3T1HB 5E38A 4B3DA 3FB4A 1Q0QA 4LWPA 4QYWA 1XCLA 1MAUA 1UBSB 3ZH2A 4ZTUB 2VEOA 2OXFA 5CTJA 3U4HA 1CW2B 1P17A 4YP7A 4BVKA 1WVMA 2ASEA 2XXAA 4MINA 3GFPA 1Q0LA 1UPAA 3JQEA 1NR7A 3X3HA 4IINA 3UICA 5HBGA 3VJMA 2XBMA 4TWIA 3NM4A 2XSZA 4MRAA 1NRWA 2D5CA 2PCLA 1QHSA 2WU1A 3QPDA 4NJEB 1YMVA 4QRDA 5DM0A 3P45A 2BMEA 5BT9A 3DQZA 1E4EB 1TEVA 5AKJA 4KQ1A 4TXJA 4RTLA 1XMVA 2UVPB 2QRGA 1T8SA 2WG2A 2WJVA 3DAGA 2X9NA 4NS4A 4B3FX 2AN9A 3GH1A 3IJEB 2AJTA 3K0FA 3GA7A 4HATA 4LHEA 4MV3A 4NFSA 5CRIA 4WXMA 5E95A 3DVSX 4MXDA 3LQ1A 3GCZA 2W2XA 3ROTA 1QC5B 1PUXA 1JB9A 1I4EB 4J0IA 5IK2A 2BCEA 1CIJA 1KC1A 3O1JC 1XMQB 1C2YA 1UJBA 2G9VA 1C4KA 1OFVA 3ZNPA 3FYSA 1IY9A 3PPYA 4KQMA 1NBMA 2BEJA 2WM9B 1BRTA 3I9NA 2AS0A 1U8CB 1AUVA 2AF4C 2VOEA 4GI1A 4QGHA 4ZCMA 2P7IA 2FEKA 5LUBA 3V7WA 4C5BA 4CKBA 4DLTA 2O5RA 1LXCA 3BD9A 3LDHA 5LQJA 3A27A 1ODFA 1T3GA 3B82A 1Z5VA 3BB4A 1CUVA 3LVQE 4FGWA 1RZVA 5AVKA 3L6OO 2ZJBA 4ENPA 2GJ4A 1PYGA 2JI8A 3HB9A 4Q15A 2HAEA 5H3LA 2GEDA 1GUFA 1L8AA 1V0JA 3U7JA 2FLWA 4P1ZA 4O63O 4HBGA 5BOSA 2OLKA 4DUZB 2O3UA 3DZDA 4NZZA 2Q62A 1W36B 2HIAA 2WJYA 1XRJA 1U0GA 4R9VA 1E2HA 2VUUA 2AI2A 1NP3A 3C4QA 3BFXA 2GK3A 4JJAA 3ABRB 1JHUA 1RHJA 1KYWA 1VOTA 2PGIA 1RMQA 2XNSA 3AEUB 3GLHA 3GUUA 4UBIA 2LDXA 4FYKA 4JLMA 1UEXC 1WJGA 3GRAA 4K87A 2GLXA 3IAHA 3Q9UA 1I2DA 4RZUA 5LZ7A 4IMIB 3UB3A 1ZL2A 2J3JA 3D3EA 4JR2A 1N8SA 1RABA 1E64A 4K6FA 4DDWA 3IQFA 3A6HA 2QOEA 1XVIA 2C3PA 2QAIA 2DX7A 4L27A 1PV2A 2A2ZA 1IONA 5JFGA 1EBFA 1P8AA 2FZEA 4UAUA 3HP1A 4BS9A 3OUZA 4MEAA 4QJ5A 3K9BA 4CT5A 4GBED 1RC8A 3WNCA 2VJNA 5PNTA 1JBKA 2JLAA 3GV0A 2XMPA 1A4RA 1SBZA 2P9QA 1J6UA 2ZAIA 4HQNA 4DA0A 1SU4A 3B5EA 1T0HB 4O4HB 3UXHA 2D13A 1YJBA 2VSOA 4DQ0A 5DPMA 4A8JB 5TF4A 5CCEA 3IHLA 1OX4A 1WB6A 1RWOA 3ICCA 3IRVA 5AVXA 4II3A 1SOUA 1Y3DE 1Z5UA 2Q2QA 3BEDA 3GLRA 3HU3A 2OQVA 4EW3A 4KRFA 1ZRNA 3BCRA 2YJ3A 2AZTA 3KTOA 1KJIA 1Z7GA 3FYUC 1W0CA 3K70D 1OXKB 1YZLA 5FBLB 4DWOA 5HFAA 1SIWA 1H5UA 2BKAA 4QQKA 2FFJA 5K3BA 1WU7A 2OZKA 2DCUA 5A3VA 1BX0A 5LSAA 1WZNA 2ZRLA 2D1TA 2O3TA 2OQ2A 2XH8A 3AKYA 5ALMA 4L8GA 4EYSA 1P33A 1A9PA 2CY0A 3BH7A 3HJFA 3O6VA 4D26A 4MQEA 4AS3A 3B9BA 4BEJA 4RX1A 3UK6A 1JDZA 3OZBA 2HRCA 2W8BA 4KXVA 3ZEAA 1DFHA 1TM2A 1YZVA 2JAUA 3RANA 4G5SA 4ZVOA 2PYDA 2HJHA 1P91A 3VPCA 1SBHA 3ZYCA 4DSAA 4HN4B 3WY9A 2YV4A 3DLIA 2CW5A 1VYTA 3WRYA 2GM5A 2RHMA 3X1KA 3EDOA 1T2CA 1T5HX 4QDKA 4IIVA 2A6PA 5I7RA 3OMWA 4YECA 3PC2A 3HWRA 3X0DA 4FJ1A 3QA9A 4QPCA 2F9MA 1JQEA 2HY7A 2BR5A 2I5PO 3V2GA 4H6PA 2ZRJA 4JFAA 4KIWA 5KYTA 3DBHA 3E1GA 4L9RA 1MABA 4FT2A 1O97D 2VP6A 4FD3A 4UHJA 2P40A 3K70C 3RT7A 5C1IA 1X9HA 3N1UA 3UJ8A 4C5AA 1O8CA 2J9XB 1FDRA 1LK5A 1I5OA 2JGRA 2QT1A 4QX6A 2GPTA 2KPOA 3WB1A 3PNVA 2DVMA 5DNAA 4IS2A 3FWHA 4JS0A 4QZVA 4L57A 2W98A 3ANSA 4N3CA 3WS7A 2P8SA 1EX1A 1DC3A 2HXGA 3LIIA 4J16C 3B1FA 1H4QA 4PC6A 3ZOKA 1LQUA 1EA7A 1K86A 4MULA 1WPGA 1QGUB 2PD3A 3AHEA 2H1FA 1XZPA 3GRYA 2W5UA 1JE0A 1OVMA 4ZEMA 4EBBA 2SKCA 4D96A 3RYFA 4C21A 3CB2A 4OFXA 4PYIA 3IP1A 3GLIA 4CTOA 3NDBB 3GBVA 4LYJA 3E8SA 3PF9A 2QVBA 3KDPA 1N4DA 3VR4H 3CZPA 5IC4A 4B3SB 1KXZA 3ZEIA 2GSWA 4M37A 4NCAA 1B0UA 1ORRA 2W58A 2BM8A 3F78A 1ZEJA 1TQDA 2GF2A 3ZDEA 1BVRA 1JG6A 2FG7C 5P8WA 3HVRA 5JCPA 3BHJA 4D02A 1XQXA 3OE7D 3ZZUA 2YASA 1VSBA 1ZGBA 1KAQA 3TOVA 2WF8A 4FFBB 1WL8A 3QPWA 4ZOAA 4DCOA 3RUIA 1E8DA 3PQ4A 4RW0A 3WB9A 4ESOA 1CC1S 3UC9A 4DGSA 2XDQA 3WLTA 3QBVA 2H9YA 1M0TA 4XGRA 1KFJB 1SUSA 5D2CA 7MHTA 5AJUA 5EKXA 2W0SA 2OHIA 1SCUB 4LYDA 1CHDA 3N8KA 1YI0A 1M3SA 1H93A 5KYWB 1AKQA 5CLLA 5FHRA 3VDNB 3U09A 4FHEA 2CFCA 1QQTA 2ZU6A 1O87A 1TL7C 4I14A 1Z7BA 4RK4A 3A6JA 3HO6A 3I0NA 4UCFA 1SC1A 4NJOA 1P0CA 5IJXA 3TBFA 4L15A 5LQMA 1XC7A 4CMIB 3OE1A 2CK3A 2NVWA 2V5UA 3JZFA 4G81A 3OJOA 4YGYA 1T9GR 5JYDA 2VDLB 3KAJA 4EG1A 3DL0A 2DQZA 5JNWA 5HJEA 1RYHA 4TSFD 2JJ1D 5LXTA 2FRDA 1IZYA 2GBIA 3DE3X 2CUTA 3A58B 3ORHA 4N5DA 3N05A 3E81A 4BVGA 3LCVB 4EY5A 1Z2DA 4EQ6A 2EWMA 1XDDA 4G8DA 3BREA 5DBGA 1AOXA 4PSUA 1FLNA 1K2VN 3L4BA 3WRVA 2AA3A 2GN1A 4GZ6A 4PYJA 2V0NA 3BDVA 2H51A 2X0NA 1NVKA 3L6EA 5ABPA 4DCTA 3AJAA 3GP5A 4JWKA 1YGYA 1ECBA 3DP7A 4GX2A 5KS2A 4O33A 3G2JA 3WMFA 3FCUB 2BIFA 3A8TA 3CVYA 1U0BB 4R2WA 2I65A 1WA5A 1U5AA 4DILA 3WK7A 1M6VB 1Y0BA 4FOSA 3FGPA 3JD3A 1SRQA 5CDYA 1XCMA 3RVJA 2B6HA 1CQWA 3W8RA 1Z74A 1AQ6A 4B31A 2CN1A 2OCLA 3EFBA 1FMCA 4BKRA 5E7JA 3GJYA 1R18A 1YS7A 1Z82A 3RRYA 4E2YA 1R9MA 3BT7A 3W5SA 1NSTA 3VNAA 1MUUA 2DPMA 1XLVA 4MVWA 1S2GA 4GX1A 1OFGA 5B1IA 1XRMA 1NVVR 2CLDX 2JHAA 4HGPA 3F71A 3JQAA 1KPHA 3CBGA 3MMPA 3BFVA 2ZPTX 4LVNA 4PO1A 3WGMA 3IKTA 4PRKA 3GGDA 4N6GA 4KV7A 3UWKA 1CETA 2QRMA 4ZHQA 2HHCA 5TEWA 4Z7QB 4E14A 1NLMA 4QUKA 5CNIA 2W70A 1P2BA 4ID9A 4U4AA 2CSXA 1O3YA 1NVXQ 2AOVA 5EXXA 1EFTA 4Y1RB 1JB1A 1HKHA 2RHBA 1E7MA 2G0NA 3LDGA 3VM6A 3REQA 5I4BA 3AUAA 2VBGA 2GUWA 3NHYA 3I6MA 4GF5A 3H75A 1BKSB 4P0TA 4XWAA 1DKNA 3PPXA 2PZBA 1YT5A 2B20A 5BP7A 5IFKA 1JNXX 3I2GA 1ZLXA 1T4GA 4BNLA 1PUJA 3AY0A 4Y30A 4P3KA 1EEXB 3BWVA 1M6NA 1BFKA 1G8PA 4K9KA 5KQRA 2PEYA 3MBOA 3C3MA 2H1IA 3DYVA 4LVCA 5CU7A 4ZRNA 4MEBA 1IQPA 2OL4A 3VNUA 1C7QA 4M0FA 2J5QA 3PRHA 1RCUA 5DGXA 1ABEA 4WDQA 3Q2IA 4O8ZA 2XT9A 4BP3A 1WXDA 4BZXA 3BE5A 3K6JA 3ECCA 2A9KA 1PFUA 2LBPA 1VSUA 2Q6VA 5JS2A 5CDUA 1PSDA 1AKUA 1DCMA 4QYIB 3KQUA 2I2BA 1NQVA 3UK7A 1BQEA 2C4WA 1IY8A 2O50A 1JQJC 2NAPA 1XRPA 3DE2X 1GZ7A 4ND2A 4TL8A 1VHQA 3GT7A 5JCOA 3RIMA 2QE6A 2EFDB 3IDQA 1KZYC 3WAJA 2HYIC 1KDRA 2B9EA 3P9KA 2WDZA 3E7DA 2MU1A 1PZGA 3IQEA 3K8QA 1BVUA 5EHNA 5B3JA 3RTBA 2JGJA 3K9QO 1RAAA 2VDQB 2NIPA 3JSXA 1VE5A 1Z2AA 5DHUA 4CUZA 5HKOA 1XMOB 4ZVPA 3Q8KA 1Q2XA 4JUFA 3KUCA 5TJ9A 4RA6B 1V2GA 4F7DA 4XQEA 1Z3CA 3D7MA 3HCBA 3RG8A 1F4PA 1ITZA 1RLMA 5DYGA 4C6HA 1OA0A 1X1QA 2HA0A 3DOOA 1IN6A 1PSZA 2WJWA 4PZDA 3AB7A 4AZ3A 4QVIA 2C3UA 3WB2A 3DXFA 5AKZA 2R8YA 4I1YA 4JVSB 1EAMA 3PXAA 5G41A 4F6CA 5F4BA 1PGQA 2GMWA 3OQJA 4O25A 3UO8B 2QB5A 3HYTA 2RIPA 1TTTA 4NONA 1LS6A 1E7RA 4KGXA 4FS8A 2VJAA 3JPYA 2HD4A 4H7PA 4MWGA 1FYVA 4RMIA 3A28A 2QSZA 4B6OA 4XPIA 2IH2A 2IPOA 2CMHA 3IIJA 3KZCA 3CZAA 3EMVA 1RCTE 2JG3A 2ADMA 4UEJA 1ZGZA 2X77A 5IDWA 3T6KA 4H0FA 1ZLYA 2F48A 4X44A 2HIHA 3FE2A 5TT1A 1U0EA 4RTRA 3LNTA 4A10A 5AW5A 4QUIA 2BISA 4RLSA 2C29D 3EVNA 1FFDA 2HDHA 4KNYA 4UVDA 4Y9DA 3K70B 1TPYA 1GL3A 1U0HC 5DU2A 5AJWA 1G3IA 3ZE7A 3AR8A 4FEAA 4L5CA 2W6ID 4P22A 1GZ6A 1V8OA 1VMAA 1DRUA 3IYLW 4RH3A 2QJFA 2HA2A 4LRXA 1U4SA 3WWPA 2FGKA 4QOSA 2PWPA 5EUBA 3W0LB 2I7TA 4B33A 3PJEA 1E60A 1JQ5A 2ZS9A 4AX4A 1YTLA 4IZIA 3PLAE 4OHMA 5TXGA 2OA0A 2RBEA 2HX1A 2GDJA 2YRXA 3A2LA 3CISA 4ZZIA 4PLTA 1Q22A 1QQ6A 3GT3A 4FHGA 4LSMA 1K4YA 5EHQA 3S1AB 4D5GA 3B53X 2V7QA 4Z99A 1OH6A 5K4GA 4G41A 4XR9A 1TZKA 5H80A 1WXEA 1RE0A 4PSAA 2DRIA 3IP5A 3HEMA 3P5SA 1Z38A 4D9IA 2Z8YM 1TKAA 4OQLA 4AKSA 4IIBA 3H17A 4F4DA 4LHXA 2GX6A 4NDAA 3ZHVA 1VB5A 2EX4A 1HL7A 1R0YA 2UYOA 3RE1A 1R8JA 4K03A 3ZE9A 4CT0A 1HYGA 2HLDD 4GW3A 3MC1A 3UKJA 1Y3CE 4R1OA 4EHNA 2JJ2D 3CWZA 1F0KA 3O8LA 1GSIA 1GGHA 2PLAA 1BKYA 2YV1A 2C2BA 4RD1A 4ZC8A 1R15A 2AXQA 5JAPA 3FNQA 4GC9A 3C4VA 4EVRA 1V48A 1XZAA 5A5GA 3L4JA 5JBQA 3IQDB 5BRJA 2ENUA 3K31A 4MITA 1J2JA 4JQOA 4U0JA 3QEKA 2Q3MA 4YCSA 1G6HA 1TECE 3GDWA 1BWSA 1VFNA 2C9MA 2VDNB 4WGFA 13PKA 2Z43A 3LMKA 1COZA 4XGIA 1SXGA 2QSJA 2ZSBA 2DC1A 5M29A 1VLMA 5KCZA 1RZRD 5EQTA 1EUYA 1OLUA 2O3JA 3CUKA 4AY3A 1E9SA 5B2FA 4DLVA 3L92A 4XFDA 5ITWA 4BNDA 3BFPA 1UKCA 2YYAA 5HKAA 2ODEA 1R37A 4GE3A 4MVXA 4II7A 3DZGA 1TO2E 4DV4B 4EGJA 2QVXX 3UJ9A 1X3LA 5C8ZA 4YAOA 1TQ4A 2SCUB 3N9IA 4UTRA 1Z75A 5I4KA 3E3AA 3OZXA 4AJ1A 3KVYA 1MAVA 1Y7IA 3SXUB 2H1OA 4UQLA 4P53A 2FSFA 2ZUBA 2CXXA 1U1EA 4YHBA 3TQCA 2PIDA 5ERXA 1SO8A 2X6TA 2JK1A 2YC2C 4MIKA 4BTEA 4KWEA 2ZUCA 1Z0ZA 1MEEA 3LCCA 2IOHA 3ED5A 4LYFA 3TUJC 1TCAA 3G0BA 1UDRA 3FYCA 5FKJA 2VDMB 1N2EA 4N9QA 1X74A 4NKRA 4GDMA 1U7PA 2V45A 5D85A 4AFNA 1NMYA 1PX0A 1LI4A 4XGNA 4FEEA 2GM3A 1Z13A 3VO8A 2CLHB 2DKOA 2HQBA 4JCOA 1VG9B 1JA0A 2PX5A 4KI7A 1TZMA 1OKKD 2AG6A 1QIFA 4Y2YA 1CJCA 1M6HA 4H3KB 4BGDA 3IB3A 2QN2A 2EATA 4MW2A 4MV0A 1P5RA 4EO7A 1P0MA 4CN9A 1WNFA 1JMKC 1QIHA 1A9RA 1HDRA 1R4MA 2AMYA 3ENWA 5FOTA 1I7DA 1TADA 4NCHA 3FJYA 3L6CA 5EKSA 4WJKB 4C2AA 1PT8A 1ZH0A 4KQ2A 4DMHA 5AW7A 3OM0A 4FUTA 2GD6A 3O4RA 4C0KA 2TS1A 4IYJA 3C87A 4JLDA 5AHWA 3R20A 4Y9UA 4WAUA 3RGWS 3FTQA 1VYHA 3UANA 3U56A 3AC0A 3PX7A 3VJRA 2B4QA 2P91A 3VYRB 4HAWA 1ZR4A 3A6KA 4C14A 2VR1A 4AXXA 4G8JA 1OC4A 4DUGA 1M2VA 2FFRA 3ASUA 1ICIA 4CM5A 2AZXA 1E2PA 3VZSA 3WL7A 1WE2A 2C77A 4B3BA 1ZC4A 5BSFA 5K0JA 4D4KA 1P2FA 2FPRA 2RARA 2TECE 4JYMA 1ADCA 2Q8NA 5A2QA 7REQA 3QW4B 4JJ7A 2C2OA 4UNIA 1SUBA 2WT8A 4KQFA 3NB0A 1XK6A 1MQAA 2GN0A 4K9DA 3GVXA 1U7XA 3IJPA 3D7SA 4IJUA 4XFJA 2JBAB 2R7AA 4IIGA 1N33B 4JBXA 2GK7A 2QMYA 2JKYA 4M9QA 3ZY5A 1C9KA 4NBKA 1P1KA 5F1YA 1AKYA 4F8YA 1ZRHA 2VJBA 5CXSA 4H60A 2RK3A 3OU6A 1YHNA 3AO0B 2IDKA 1E3QA 1B6RA 4YRJA 3C1UA 4YDQA 3OPYA 5JJLA 5JQGB 1B00A 3CKKA 3MMSA 4CM8A 1THGA 2CXTA 3KK0A 3SHTA 1RBQA 1IK4A 1UJ4A 2B78A 4XVUA 1LK0A 1OV6A 1YJXA 2G76A 3D43A 5FR2A 3GJ7A 3EWNA 4D5EA 3GP3A 2V98A 2ZTSA 1VMEA 4HI0E 2HMVA 1ZH6A 3PYLA 2F1JA 4GYJA 4OUKX 3N8HA 1K6EA 4X63A 5TARA 4BN5A 5HZGA 4J9VA 1G4UR 5L3SB 1M10A 1Z6YA 1SUCA 1PGOA 3E0QA 3OPMA 3GMDA 4BNNA 4L72A 3MCWA 5I9MA 3RQIA 1Y5MA 2FHPA 4BB9A 1Z2NX 2YUTA 3BKWA 4K8RB 2Y1KA 3PD1A 2I0FA 1UJ2A 4XB6B 1YBFA 1U2EA 3JR7A 3ZX5A 1N2JA 3OLYA 4QAQA 3UT6A 5DKFA 3IPAA 3WIOA 3DSRA 4TYYA 4C7OB 4XD7D 3ZWOA 2J7KA 2B1JA 5IH7A 1RYNA 2VNIA 1YBHA 4RPGA 1JF8A 2CMFA 1WLYA 1GT91 3UMBA 1DLIA 4B6JA 1I1NA 2VF8A 4TLEA 2WF9A 1ODCA 2V65A 5IZ4A 4LF7B 4G85A 3HUEA 3LUFA 1WDWB 3WTBA 1KRWA 4UNQA 2P0YA 3QH4A 1HZZA 4R3NA 5CX1A 4YJHA 1ZK1A 3R8XA 4WFJA 4B7CA 3A7DA 4M46A 3F3YA 4BVHA 2DH5A 3I9V1 1JBEA 3FETA 3NHKA 5DHQA 2DPLA 3ZH9B 3L8CA 4X90A 1GUDA 2HGZA 1AXEA 3T3IA 3CNLA 3FMGA 3T5DA 1SUWA 4C29A 1N75A 4JJKA 4CCSA 1QVWA 5EJ8A 3E3OA 3NOQA 4FGUA 2ZIGA 2BF7A 3DCJA 3LIPA 5FADA 3U7EB 3M4YA 3ZIAD 1CRQA 1VJDA 4DL9A 1P29A 1U4NA 1DL5A 3IT1A 3QVXA 1ORTA 2GCIA 3A6ZA 2CE2X 3OHPA 3HL4A 3S2ZA 2NSHA 4FQ8A 3WC4A 4BWFB 4DBVO 5KUTA 4ADSG 1YB7A 1M8GA 1SQGA 4DT1B 4Y9RA 5IYZA 3BRCA 4LI0A 4RDCA 5KTTA 3V4LA 4KFSA 1VSTA 3I09A 1L7AA 1CUHA 4EYOA 5KTSA 1NVVQ 3JQQA 4GI2A 5IDYA 5BNWA 4TTQA 1BKDR 1S9DA 4Z8YA 1IHUA 3LWBA 4OG2A 1FYWA 1LX6A 1MENA 2XQIA 4HXFB 5EERA 1NXWA 5J59A 3ZHCA 5CCBA 3IERA 1GITA 2IJGX 1UKYA 2YHBA 1YR6A 1OILA 4GPD1 3QHAA 3WL3A 1CJUC 2SKEA 4GYWA 2OSBA 4PM4A 3JARA 5KC9A 4OHVA 4EJ2A 1K1EA 4QREA 5IJAA 2B2XA 3RJMA 2H4WA 1JH9A 3AL0C 2R62A 4ZJYA 3H5IA 5BR7A 3OZRA 2P2ZA 4HDKB 4DCPA 4RORA 4BXOA 4UMFA 1NRIA 2D00A 1XZEA 4FFVA 4OPMA 3EGVA 2BFNA 3MTGA 3HBMA 5FBHA 1RZ3A 4EJSC 3UQZA 1XD8A 1N2XA 4QL3A 1K75A 2SHKA 1UR5A 2FZVA 1UZNA 2V9ZA 5EQDA 5G0SA 4ZVTA 4DC1A 1T2EA 1PNRA 1TAQA 1KNXA 4X85A 4YMLA 3GGJA 5L3SA 1G291 1HURA 4ZQCB 1TMOA 5IT0A 1B8NA 3ZZ0A 1UFRA 3BSFA 5ADUS 3FFWA 4JH0A 2IUFA 3ABSB 3GBSA 3G23A 3MHTA 3FMVA 1G21B 3L2OB 3FPKA 1K68A 4RV5A 2N9UA 3B3GA 4M6WB 3E1KA 3DULA 3D3KA 3H65A 2GB4A 3GZNB 2WNHA 3GU3A 3NR2A 2O2YA 3QBTA 4JLSA 3B78A 4GOLD 5FPHA 2PWBA 4TV9F 5KJ1A 4O2BF 3GEGA 1X8JA 5EJEA 1E8NA 3NOXA 1EVQA 1MGPA 2XNJA 1QHHB 1KARA 4MKGA 4RLQA 3B9QA 3L1HA 2EX0A 1KKMA 1DC8A 1HY3A 4H3HB 1U3GA 4HWRA 5LQCA 2V1UA 1ES9A 4PZ0A 5AKHA 3K1AA 2ODQA 3BTVA 4FM9A 3EXEA 4Y0AA 3R0VA 1VE6A 3IKMB 4OQDA 5FEUA 2L42A 4Z2AA 2ID8A 4FJ2A 1CP3A 3PSAA 2XV1A 1PJ3A 2IWRA 4CKWA 4MV8A 2YCLA 3LJKA 2PUTA 4W6ZA 3RCBA 1JL3A 2D8AA 1VJRA 4L0DA 3P96A 4GX5A 1U1FA 1HDEA 3VSDA 4YK7A 2PZMA 4YLYA 2P1DA 2Q0XA 5DSXA 4Q3CA 3RS8A 1UQRA 3PUIA 3ZJUA 4D44A 2QPAA 1HQYE 3H8WA 4BNKA 1XTJA 4J29A 3CXUA 4HADA 3RARA 1F20A 1CYDA 3E2PA 5K01A 3SIXA 3QRWA 5HNKA 1DRKA 1ULAA 1WHSA 3H0EA 1U7TA 3H2KA 2QAGC 3F8TA 4R2JA 5TY0A 3ZWCA 4Q4HA 1JIQA 2OEPA 4XI9A 2PBFA 3F9CA 4IQ0A 2D5BA 3L6BA 4I1UA 3GLKA 3QVUA 4E22A 1G9XA 4PX5A 4WV3A 1NVMB 3LVFO 1GV1A 3ETHA 5IBQA 3EEYA 4IYRA 5DM4A 3FCYA 3TZEA 4YP1A 3WDSA 1PQWA 4NDNE 4JI6B 1NDQA 2ZWAA 3PNSA 3H4MA 1TZ2A 2LXNA 3WDKA 4C89A 1DARA 1E8MA 1I51A 2I67A 2RGXA 3AR5A 3M70A 4LV5B 5TT0A 5DRTA 3WGOA 1ETUA 4AIRA 2WM2A 2X1MA 3PWTA 3O83A 2CLOB 2YWEA 3UAZA 3UHOA 1SAYA 1X13A 2G71A 2X7JA 3ASZA 1N9GB 5A03A 3WYNA 3O93A 3W8FA 3O9VA 1CUEA 5LDGA 4CQMA 1M5TA 1YFZA 4RQUA 5EOVA 3Q88A 4BJ6A 4TN5A 4GI7A 4QRIA 1PWXA 1Y8RB 3GF4A 1L5GB 3ROEA 1KO5A 4KXFB 3NJ4A 4QJIA 2K2QB 5DZSA 4BQRA 4RD4A 2CUZA 1K6IA 1YZNA 4UUOA 4YREA 3HR4A 2AXPA 2C96A 3MOIA 1DV1A 1EJ2A 1O58A 1WV1A 4QTZA 4RGQA 3DMTC 4TTAA 4YQFA 2YC4C 3JQ9C 2IHBA 4PONA 1QHHA 1O0SA 2AOXA 1BC5A 3TZCA 1XNGA 4DJEC 4CU5A 4IEIA 5HK9A 1Q20A 3UMSA 3V2HA 4RTJA 4F9GA 2KHZA 2PX4A 2DFLA 1KGDA 2CL0X 5AI8A 4EJ6A 2BDEA 4PLCA 5AXBA 4Z51A 1DTWA 1V11A 2D0PB 1G8YA 3KOOA 3OZUA 2GEFA 4N0EA 3QXJA 3RVOA 3UW1A 4R8LA 2R1TB 4M49A 4ZI5A 4EL5A 5T4HA 4ND1A 3AM3A 2A5GA 3C15C 5KTPA 1FK8A 2QV7A 1TD9A 3H9CA 3OCCA 2UUOA 5DO9A 2KLBA 2VJYA 1C0KA 2XKAA 4ZO7A 1PLJA 3ZCRA 5IT5A 5KDOA 1YJ8A 1FFXB 1NN0A 3CA8A 1CUAA 3I39X 1DE0A 2V6BA 4MGIR 3UAWA 4BRZA 1QB7A 3OE5A 4HV4A 4NPHA 4HH1A 1AV6A 2PIAA 3U40A 4R8SA 4QEZA 3ZD8A 1K66A 1NJ1A 5C0OE 1JJAA 5JEEA 2WD9A 3GUYA 3MS7A 3DQQA 4YV7A 3T5PA 5EWMB 4J1NA 1TFUA 5HS4A 4GHWA 4QLAA 3I1IA 1K9SA 3BL5A 1CRWG 1K63A 3OOJA 2FR1A 5H81A 3T5GA 4BNUA 4DYDA 1DCTA 1RRGA 3SSNA 4A0FA 4DPKA 4NU5A 3ILYA 3DPUA 4O0MA 1S3GA 4TXNA 4FHFA 1XEXA 3GO4A 4I0WB 1T9DA 3G5TA 1LBSA 2WHEA 2P77A 3QEJA 4JGGA 1V8FA 1RLTA 4RF4A 1FC0A 2C5SA 4WLFA 1NQWA 1JJFA 1SQ5A 2Q5QA 4C5CA 3QG5A 5EG5A 3USCS 1UJNA 2WU8A 4REQB 3NHAA 1NPDA 4DIOA 2B4KA 3TL3A 5BW8A 2CVHA 2QUBA 2AFVA 5EIAA 3N6RA 1QHYA 3IS3A 3ZW7A 1KRXA 3L43A 1V2HE 1V6CA 4IFBA 2ES4A 3KTAB 2FH5B 5CNKA 3KT3A 2QMZA 4DB4A 1PBNA 3QELB 4Z0PA 1R0SA 4N3GA 1S7CA 3I32A 2M9MA 5SY9A 1VLHA 3TLJA 5ICMA 5JASA 3O26A 1R6UA 1J5XA 1P1RA 2NZXA 3R6WA 1LF0A 2R7NA 2DFKB 2GEJA 3B7PA 3EQ2A 1ADFA 1SK8A 1DBWA 1J1ZA 1NZFA 5HF9A 3TCKA 3WWEA 5GJVC 2QM3A 3FLAA 1A0OA 5AJVB 1AKRA 2B3TA 4KNVA 2H17A 5FLKA 1GPDG 1R8XA 2COKA 3RUDA 1KVUA 1K9VF 1P2UA 1UODA 3AESA 3DBOB 3P9YA 5AHKA 1N57A 4WKNA 5CITA 1Y5IA 4IDNA 1JA1A 4RETA 1Y1PA 2H2GA 3B51X 3FBWA 3GCXA 5E6UA 4CU2A 4DQKA 4MB6A 1O89A 3WKBA 3CW2A 4AS2A 5EZYA 1KMQA 3PC4A 2EJWA 4I55B 2IUUA 1YC2A 1ABFA 1XKLA 3RJTA 3C1AA 3KBBA 1G0OA 3I8XA 4LRTB 4G6ZA 3II6X 5B1DA 4B4KA 3BIJA 3SQMA 1ZQ1A 4PXYA 1NQOA 3QQ5A 3EQ7A 5DVZA 3SOPA 3ORFA 3O9MA 3Q85A 1XVVA 3ACCA 4FLFA 2I6GA 3E9CA 3NHWA 1CUWA 3OKAA 2ACWA 2Q4OA 3Q15C 2P67A 3HWX1 1U2DA 5FOVA 5SZJA 5A5EA 1VJTA 2YHAA 3K5HA 2IEAA 4JEMA 4DPMA 4ZK2A 3MWEB 1E3DA 2C0QA 2ZUUA 2UXDB 4I1VA 1C80A 5BYKA 3MOGA 4BKPA 4ZYYA 1I7SB 2BFAA 3MQFA 2CC2A 1PKEA 4MV1A 3RF6A 4YUWA 1P5HA 1HE4A 3H3XA 4B09A 1DX9A 4YJ3A 1KJ8A 4YMVA 3LX6A 2PCJA 4NG4A 1JAZA 2P4SA 2GKSA 1NVUQ 5EWMA 1X7YA 1N7JA 2AEJA 2AOWA 2P62A 3C3PA 3K0AB 4X20A 3T7JA 4ZIRB 1A1SA 2P9CA 4ZI7B 2VWPA 4R7ZA 4ER0A 3AQ4A 3U3ZA 1MTOA 3DZ8A 3BSSA 2GO7A 5AVVA 1P2TA 2R8OA 3JQ6A 5CVVA 1V8BA 1YRQA 3CIOA 2O2SA 3AF0A 2IPNA 5K0EA 1X8KA 5B2ZA 3VAAA 2RAPA 1MOPA 4NZOA 4Q7QA 5JCZA 1KMMA 3CVWA 2YVUA 1ADGA 3AR3A 4UUNA 1HEIA 3PHCA 2LKDA 2GRAA 4PAWA 1U2TA 2GBPA 3R5KA 1QFMA 4Y2RA 2G36A 1GGJA 3RYCB 4R01A 4QC2A 1VP9A 1YACA 4IVPA 4I46A 4BTVA 1NXQA 4J7XA 1HG0A 1QHNA 3PG5A 4G63A 1PVDA 1TVEA 5A4MS 2J41A 2ATCA 2OY0A 1A7AA 3A26A 3I37X 3KV3O 1ISJA 1GKIA 3WP1B 3TZQA 4MQ5A 3VV3A 3QVSA 3HL0A 4GM1A 5AOCA 4DM3A 1PGPA 3SVLA 4Y6LA 3WRYC 3LBIA 2GEBA 4KXQA 4YMUA 2JLSA 5HF8A 4FMDB 5I9IA 1L0BA 1FRZA 1XWFA 2C2ZA 2EQAA 2LTAA 3UK2A 5SZHB 1G2IA 4WNIA 1J2EA 3PDHA 5IKMA 4RKEA 4RPIA 3F67A 3FI9A 3NH9A 4BO0A 3HK2A 4OU4A 1MO2A 4V1CI 1YA6A 2VZEA 3P20A 3W5UA 4JY7A 1I4DD 3FNHA 5FV7A 5T4EA 4ZDJA 5K09A 1IHPA 1QHXA 2OTCA 3AINA 3FFBA 4HVAA 3KKEA 3RAGA 3AFIA 1EVZA 4QXQA 4Q48A 3UCFA 2P9ZA 5DM2A 2GERA 4AN4A 4OV6B 3O5AA 2FUCA 2QS9A 4YQEA 3SK0A 4P0PB 1MX3A 5B3KA 4F2GA 1B73A 3WA6A 5IU6A 5AK0A 3WGQA 1EVYA 1XCOA 2J0UB 3KZMA 3MYRA 2JB9A 1BCSA 3RC2A 5IAEA 3X2FA 1AGNA 3RDPA 5G2OA 4RQTA 1U2PA 3WXBA 5DM1A 4ZHSA 3LHSA 3QJ5A 1ZNYA 3LX8A 4IW3B 4NBUA 2NXWA 5BNIA 3IA7A 4YT2A 5C18A 2IYQA 1SHJA 1TW2A 2WWXA 4J0FA 4Y0NA 5J2UA 3FJOA 1F8XA 2OZPA 1G18A 2OE2A 2W37A 1DXHA 2C78A 2XF8A 3KWLA 3MAGA 1VPEA 4HB2A 3TAXA 4LJ4A 3KXPA 3OJ0A 4EY8A 1WD5A 1WUHS 3H9BA 4C04A 2EF0A 4ZCRA 2FJPA 4FGJA 1C3LA 3FSJX 3K0AA 4ZOLF 4W5WA 3KNZA 2P5SA 4FUQA 3UJBA 1FVFA 3V8NA 1QTNA 4DWJA 4F2WA 4TYWA 2GZ2A 1JEJA 2VATA 3H13A 5J2TF 4EDFA 4GEKA 3FFAA 1Z2PX 2IDJA 1QBGA 3K20A 5JMWA 3LT5A 2J5BA 3TLCA 1QFXA 3BMOB 5KNDA 3EVFA 1YZGA 2ZB7A 1FDSA 1YASA 1LPPA 3DE6X 3NBZC 1R6TA 4DMGA 6LDHA 2OYSA 3IFSA 3KOWA 4QBFA 4IFEA 1KEWA 1L4BA 5FTNA 4ENWA 1QRTA 4TZ0A 1SEPA 4NNOA 2BFWA 3RYCA 2H52A 4LY0A 4LGCA 1CZOA 1UMDB 3CJTA 1JVSA 1L1EA 4HYTA 4PRYA 4RVGA 3AR6A 4X1KA 1M6WA 4JC4A 1E3IA 3FUUA 4CIYA 5IS2A 5KTOA 1XA0A 3NUQA 1J0XO 4XZ3A 3DVRX 2CDBA 2G9QA 3LGAA 4YJ3F 4CUJA 1Z34A 1C1DA 1VTKA 3M4XA 2PQ6A 4DRXA 1NXOA 1KS2A 3ECSA 3PUWA 1NE7A 1E6LA 1NW8A 3DKVA 3L3BA 4K2AA 5EMHA 2X0FA 4M9SA 4MV5A 2P3LA 2YZGA 3NXSA 4O59O 1EX9A 4CKCA 4A73A 4JK3A 4OGFA 3KC2A 1K8YB 4PCAA 4X5OA 4MZXA 3L4BC 4LNUA 5ALNA 3L1IA 3IAS1 2A9VA 2CD9A 2QJOA 4BAUA 2PBZA 5CPFA 2ORVA 2HNBA 5CVCA 5HR5A 3UUWA 1CR4A 1BN6A 3VU0A 3HS3A 2D2IA 3KWJA 3EARA 4NMWA 1D0SA 3GH3A 1RLOA 5D01A 3WSWA 4R05A 3T4XA 3T4PA 1H2XA 2J5KA 4I7EA 4LBVA 3UMMA 5DGTA 1PS9A 1XDWA 4EVQA 1PG0A 1N3YA 1OLXB 4DMLA 5BVGA 4Z4QA 1XXHB 4ZVVA 4AAYA 1GNLA 5FTLA 3QFSA 3JU3A 3OLZA 4M99A 4ARBA 5CEFA 4G4IA 4UTOA 2C42A 5CFNA 2JIZD 3ICOA 2AG1A 1YR1A 1YH3A 4Y18A 2Q8PA 3LUCA 2J30A 3DBLB 4PBRA 1GU1A 3CZ5A 4I8DA 2BVNA 3C5VA 5ALRA 4C2UA 1QGYA 1SB8A 4HEJA 4FNMA 1JWBB 2I66A 2FX5A 4E03A 1MP0A 3KVRA 4FGZA 2XE6A 1KK0A 5ES3A 4L0QA 5MF6A 1H2YA 3INNA 2R5WA 2ZVJA 2I9PA 3E9NA 4RPCA 1FUKA 2HSGA 2FWNA 2YTZA 3ZDAA 1ZAKA 1DAPA 1MJFA 1A5BB 1C9MA 3CPJB 3EEQA 3RH0A 1QS0B 1YFLA 4JMPA 3IKVA 3SLKA 1V5WA 4IIJA 5DB4A 4MO9A 3CV3A 2Q3DA 2BONA 4ND5A 2VHCA 1MXFA 4ES6A 1EVJA 4JITA 3TK1A 3RI3A 5CFZA 5JAHA 2FKAA 1WF3A 2QM0A 4WZBA 1X7XB 4G9GA 3SDBA 4CIVA 4JBHA 1B14A 3T95A 1JNYA 4I99A 1YV9A 3ISTA 3G9XA 3RGGA 3DZCA 3TSZA 2DWPA 4EG0A 4ABTA 2C2HA 1XZNA 1QZUA 2LNDA 3RSOA 2CXUA 3GQBA 3ME5A 4WLEA 1TI7A 3QFCA 1JEQB 4ZWNA 1Z6GA 3LDAA 1VIDA 2VK4A 4C0XA 5HGJA 1I6LA 4BUCA 1A8IA 1MG0A 4FP9A 3RT9A 4TMZA 3ROPA 1M67A 5DYYA 3LPLA 1GUYA 1RVV1 5KNCD 1TJNA 2HPVA 2XCOA 3RVDA 4PSVA 3HU2A 1XZIA 3BORA 3I42A 4FEGA 3S2FA 3G7NA 3JATB 3PB3A 5JO0A 3E70C 5L53A 2WSMA 3JXEA 3LZDA 4OYLA 3PQ5A 4B4OA 4TLDA 3TGPA 3MJVA 2XMGA 5I7OA 1X7ZB 4OQXA 3TI9A 3H9JA 1DTEA 1XDUA 5B6PA 5JCOC 3EEBA 1F48A 5BSGA 5FPQA 3ZIAA 3DOJA 1L5OA 2J9GA 3CG4A 1G8GA 4IDQA 4KO3S 2NMVA 2FQQA 1L5RA 3J81k 1WB4A 4UZSA 3AZOA 4V0MA 3R7AA 2CLFB 1JMYA 2AC7A 2VL7A 4P7FA 3M4NA 1OLXA 3CX3A 4CCYA 1G21E 1ZEMA 5DNUA 3KEQA 4IHJF 1C2TA 1JI0A 1Y3HA 2C7VA 1JR3D 2ORYA 2Q6TA 3IT0A 3PQ6A 4PX3A 3SM9A 5BMVF 4EM6A 1QRAA 1KJJA 4B2IA 3KE9A 2UXBB 4TT8A 2NSJA 4GMHA 3W2TA 4QOFA 1Q19A 3BD7A 5FYQA 5TC4A 5HUHA 3CEAA 3C6ZA 4LRYA 1AGPA 1EWKA 2ZI7A 5EWJB 3LY7A 1NW7A 1H85A 2Q1SA 3R5XA 1L4KA 1ZINA 2QD4A 1SOMA 3RSHA 4DXAA 8ATCA 1BDBA 4BMDA 3EG9B 2B8JA 5JDCA 3S81A 1F8GA 3U3OA