1PEKE

Structure of the complex of proteinase k with a substrate-analogue hexa-peptide inhibitor at 2.2 angstroms resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Structure of the complex of proteinase K with a substrate analogue hexapeptide inhibitor at 2.2-A resolution.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 1993-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1pekE00
3F7OA 3DW3X 3DVQX 5FAXA 3DE4X 3I30X 1SVNA 2G4VA 1PTKA 1TM3E 2WUWE 2PWBA 3TI9A 4CFYA 1SBTA 1KDZA 1Y4DE 1C9NA 3DE0X 2SECE 2Z58A 1GTG1 4AKTA 1KDVA 3VV2A 1MEEA 1SUPA 4ZOQI 3DE3X 1BFKA 1GTJ1 1UBNA 1PEKE 1WMFA 3P5BA 1SUDA 3DE7X 1SIBE 3I2YX 1Y9ZA 1T1IA 1V6CA 4OMDA 2W2QA 2W2MA 1AV7A 2W2NA 1AK9A 1GA4A 1Y48E 1TMGE 1WMDA 3VHQA 3AJ9A 1AVTA 5B1EA 1PJ8A 2IXTA 1BH6A 3ZXYA 1T1EA 1SIUA 1R64A 2HPZA 1AF4A 5ARBA 1AH2A 1SELA 3VYVA 2WV7A 1SN7A 3TI7A 1NDUA 1IAVA 4M1ZA 1SCAA 1R6VA 1BE6A 2ZRQA 3VV3A 4DJ5X 1GNSA 1SBHA 5SICE 1SUAA 1S01A 1C9MA 1S02A 4H6VA 4DZTA 3QFHA 2WWTA 3QMPA 1VSBA 2Z2ZA 3GT4A 4MZDA 5AQEA 3DYBA 1YJBA 1OYOA 1Y34E 3A3OA 5ARDA 4LVNA 2Z2YA 3VSBA 1Y33E 1SBIA 1SIOA 1Y3CE 3LPDA 1SUBA 3Q40A 2SNIE 5JXJA 1SUEA 1TM7E 1SH7A 3CO0S 4KPGA 1SCBA 1P7VA 1EA7A 4LVOA 4OV6B 5CW1A 1MPTA 1OYVA 3LXUX 3TECE 3EE6A 3PTLA 3DE1X 1Y1KE 3BX1A 3WIVA 4B5LA 1AU9A 1THMA 4C3VA 3D9QX 1GNVA 2HD4A 3BPSA 3DVRX 1ZVKA 3F7MA 3H42B 4H6WA 3GCWA 1BE8A 2WUVA 4YN3A 4JP8A 1C3LA 4ZARA 2TECE 1TK2A 2XTJA 2PWAA 5JXIA 4H6XA 4I0WB 1BFUA 1YJCA 1EGQA 2DQKA 2PMWB 2QTWB 2SBTA 1WMEA 3EDYA 3WQBA 2E1PA 1GTL1 1SCNE 1SBNE 2W2PA 1TM5E 3A3PA 4NE7A 4K8RB 1TM4E 3D43A 4DWWA 2P4EA 3I37X 1YJAA 1KE2A 2ZWOA 3CNQS 1HT3A 1TECE 2ID4A 5JXGA 1A2QA 3F49S 5FBZA 4RYDA 3L1KA 1TM1E 1TO2E 1WSDA 1ST3A 3DVSX 3LPCA 1NLUA 5B1DA 2GKOA 4CG0A 1LW6E 4KB5A 3HJRA 1Y3FE 2X8JA 1P8JA 3GCXA 2X8JB 2ZWPA 3OSZA 5FFNA 3DE6X 1AQNA 1OT5A 3WIUA 1V5IA 1Q5PA 1SUCA 4HX2A 1S2NA 3SICE 1Y4AE 5AMXA 3UNXA 3AJ8A 2Z30A 3ZXXA 3EIFA 4WOBA 3PRKE 1XF1A 3DE2X 2PQ2A 1IC6A 3QTLA 3T41A 1CSEE 1ST2A 1KE1A 2IY9A 1YU6A 2B6NA 4FONA 3Q5GA 4HVLA 4OMCA 4BWGA 3SQOA 1SCDA 1WVMA 1T1GA 4GI3A 1GT91 2SICE 1DBIA 5ARCA 3GT3A 2ID8A 1KDYA 2PRKA 1C9JA 1GA1A 4Z2AA 1CNMA 1BJRE 1P7WA 1R0RE 1GCIA 1SPBS 2PKCA 5I9SA 1ZVJA 3DW1X 4KG7A 1SBCA 2ST1A 4C3UA 1Y3BE 2Z57A 4NE9A 3LPAA 1Y3DE 4CFZA 5K7SA 4J94A 3DE5X 2PYZA 5JXHA 5JMOA 1DUIA 1JEAA 5AVKA 1GA6A 2XRMA 3DWEX 4AKSA 4NMXB 3AFGA 2Z56A 2W2OA 3DDZX 3I34X 3A3NA 3VTAA 2Z2XA 1NDQA 2V8BA 1PFGA 1TO1E 2DP4E 5AVJA 3BGOS 3WHIA 1SCJA 4WOCA 2DUJA
chains in the Genus database with same CATH superfamily
2IUTA 3PNKA 1P18A 1I7LA 1XHEA 3LF1A 3LUGA 3TSZA 1X1SA 1ZFNA 3SEAA 2C7QA 1SVNA 5FTMA 3N2IA 2P1ZA 1ODJA 4HZIA 4I36A 1PTKA 1VKZA 2PFKA 1ZGAA 2GN9A 1FFDA 4BGEA 2PMFA 2ZIVB 5FBHA 2GCEA 2H3HA 2AFHB 3I62A 3TI9A 1N0HA 4Q48A 4CLOA 1I4OA 1CCWA 3QU2A 3VR5D 3FVQA 3LBYA 1G8AA 3F71A 3FYHA 3ME5A 3IQHX 3MCWA 4XQ9A 2H0RA 2Q3LA 4GAEA 1NP6A 3VPXA 2OXEA 4AKTA 1MF7A 2C82A 4ZALA 5FNZA 2AXQA 5EFOA 3SC2A 2VJNA 3UQYS 3HDQA 1KSGA 2VJKA 3ILHA 1E0SA 1WR8A 1LD3A 1MU0A 2ZBFA 4C05A 1WU8A 1AUQA 1ZL2A 2I78A 4UPDA 5LA6F 3SKXA 1A5SB 1ZD2P 5C18A 5CXQA 4CIYA 1G6HA 3DH0A 4DCTA 2X7HA 2HQSA 1O6FA 2GJ8A 4PTYA 5LLTA 1Y3IA 2FQWA 2QSZA 5TGDA 3EIOA 1UEIA 4WZ6A 2XMBA 4IIDA 4XQEA 4YXWA 1JLMA 1TTQB 1H0HA 4RACA 5KYXA 4D3DA 3RD5A 2VZLA 1SQGA 5ECDA 1QPZA 4ZZ0A 3A9CA 5EXSA 4DV7B 1GFZA 4MUBA 1HFEL 3ZZNA 3C8UA 2WHPA 2R4TA 4R9VA 4I9UA 2QVXX 3VZBA 2VDNB 3GGPA 5AM1A 3AV0B 4Q3BA 4GX0A 2FR0A 4BC0A 1ORVA 5DLYA 1B74A 4YHHB 1LCIA 4G0NA 3BE4A 2X8LA 5ESXA 5JVDB 1M83A 4MKFA 4AULA 4E70A 4M0CA 1HSZA 1TYZA 4MW0A 4P22A 2QY9A 3CSSA 1IVYA 3KB1A 2PFSA 2OK7A 4RZIA 4G23A 3OM9A 1OX4A 1S4QA 3HUFA 3PFGA 2JIDA 3Q88A 4FYXA 4ON9A 1CDOA 1II8A 4YAFA 2XPCA 1UKVY 3K31A 3S7ZA 1RPTA 1RSZA 1NQTA 3KSDO 3NO4A 1OU0A 3H0CA 5IJ9A 1I4LD 4A10A 4J1NA 2L18A 3MPOA 3UCEA 2IEBA 2D8AA 3E81A 3EEQA 2DWOA 3DV0B 4YCLA 1LPOA 1FLDA 1RKXA 3WTCA 4OB8A 2XUGA 2R00C 4HQFA 1Z06A 2HMSA 2HHAA 2RGEA 4DBLC 1GZ3A 3V8PA 3AMVA 3D64A 4RY0A 2AFIA 1G66A 4ABYA 3KD2A 3OKFA 4QJ4A 5BWBA 2AZ4A 1BVYF 4TKVA 4GBED 4FZ3A 3VYVA 5BORA 1WW8A 1UP6A 4Q1CA 5LOVF 1AA6A 4UXIA 2NQ8A 1ZC4A 4TXJA 2H5IA 3ZTYA 4G5QA 2NYAA 1DAHA 1OZAA 2EKLA 2WYUA 1AKYA 2ZIXA 1HG0A 3EQZA 3DMRA 3O4HA 5E3HA 2R66A 2Z5VA 5G3ZA 1PE0A 1Z0SA 3LVQE 4R0VA 3WGHA 4C2AA 3RC7A 5KNBA 1XK6A 1RWPA 4JJ6A 4L02A 3THOA 5AXAA 3TW8B 2A1TR 4B4DA 1C7RA 2P9CA 2ZRQA 2FEOA 5CLHA 4ZREA 1H5UA 1KMMA 1PG2A 4MDEA 2QN8A 5JCOC 3LUKA 3P2JA 1M6VA 3L8MA 2JI8A 3LLSA 3TAXA 4UTXA 3VA7A 2JI6A 3DKKA 3AEKB 2VL7A 2FDXA 2X7XA 3PQ2A 4GIBA 2WIFA 4L16A 1G9SA 2NO7A 2P79A 4H08A 4A92A 3BRWD 2OMKA 1HE8B 4M7OA 3IDAA 1ZW6A 2GD1O 4BMCA 2IHVA 3PU6A 4L8VA 3GDFA 1SXPA 4BE9A 5CJJA 4XI9A 4A03A 4BCBA 3EQ7A 2VCHA 4ZYWA 2FV8A 1X94A 5BQFA 4B46A 1G38A 4KQ2A 3WKDA 1KYYA 1Y0BA 3CLKA 4HBZA 1JWAB 4YCCA 5I7WA 3OU7A 2YVQA 3K1YA 1V8DA 2J9FB 3PCRB 3ISJA 4TL9A 1C4XA 4JBXA 4LY9A 2F1KA 1QK3A 3A7EA 3QU4A 4NCBA 2QVYX 3JQCA 4ETIA 1ZCJA 2QX6A 2OC9A 4C03A 3ABZA 3RT7A 4A5OA 1VSBA 3KCQA 4JK3A 3OUUA 2XXJA 3DDOA 1ORHA 2BCEA 2VYVA 2X58A 3M6UA 2CNWA 1U7ZA 1EDBA 4GYJA 3RSFA 3PQ5A 4G85A 4MYTA 4YRJA 3BK1A 4LRTB 1C14A 3BSFA 3UJCA 3FY4A 3GUCA 4D81A 4J4HA 2VDKB 1QGED 1CR6A 1AKRA 1UXHA 3NGXA 3TN7A 2IYZA 1X6VA 5BVGB 3AVQA 5M3BA 5BVHB 2DF8A 1U8UA 2G8NA 1M2FA 1ZK0A 2QD3A 1SFRA 4PONA 4KYTA 4Q4HA 4U7HA 5D6NA 4AUEA 5IG2A 1KHTA 1XJ5A 3F5DA 2ZYWX 3L7YA 3MQ4A 3DMFA 2REQA 4WNYA 4ZU6X 4JZKA 1SKYE 3PFNA 2V1XA 1T2UA 3NV9A 2AV6A 3KQOA 3OEHA 4HYEA 3IVCA 1YS4A 4L2IA 3SAJA 1KEEA 3NKFA 4EGAA 3MJVA 3Q8KA 1H1LA 5AHKA 5DT2A 5JAPA 5CNJA 1C80A 2F3QA 1XDGA 2BTQB 1NYLA 2WFLA 3AJRA 4QBTA 5I8WA 4OG2A 3UHPA 4WXEA 5JYEA 1GRQA 1MG5A 5G53C 1U5AA 2JLUA 3HO1A 1EVLA 1YJXA 3AY0A 5EUMA 4W9MC 3K05A 3NUQA 1OH7A 5LXTB 1HOTA 1P3DA 3RC1A 4EF5A 3MJDA 4I4TF 3AIOA 4EG5A 5LU9A 621PA 1I1QB 4Q93A 1JIUA 3ZU6A 3KVRA 4G4SP 5CG2A 3G9TA 3WB1A 1KZ1A 4M8IA 3UUWA 4C7BA 5AVTA 2O1XA 3VPSA 2RKWA 2O8NA 3H8JA 4GI5A 5IAJA 1Z7EA 1PSDA 3E35A 3FG9A 4BMYA 4FNGA 1NYQA 4NCKA 4JBGA 2BFBA 4LKOA 4BO1A 1E6LA 1T9HA 1G8FA 1NXPA 5EIEA 3ZDBA 3N2NA 3HGMA 1RP1A 2FOLA 4ETMA 1K88A 2Z8XA 1MNQA 2KBEA 1NLYA 2O3SA 4GPEA 4C04A 3HLYA 3HKCA 1QX3A 3C6QA 3TM4A 1OBHA 1T9ZA 1WNTA 2BWJA 2PIDA 2ZI7A 1IQRA 1A8PA 2YIDA 3M49A 4WXHA 1C7JA 1QHFA 1QQ5A 1QS0A 1YR2A 3P19A 1SHLA 3CG4A 3N2GA 1S2IA 3PD0A 4UQOA 2IS4A 1UJ4A 1WZEA 3PUYA 4BLSA 1HRDA 3FCAA 4G8JA 1QLHA 2CDBA 2GM3A 3ANLA 1W9MA 5K0BA 1EBUA 4YMTA 2HPAA 3KTFA 1EVQA 2AL7A 5K0NA 5A3SA 1PW5A 4XFJA 3E5RA 4JXJA 1OFHA 5I8ZA 3SDBA 5EP1A 1PYOA 1ZWLA 3DMGA 3KEGA 1T25A 4QQRA 1H93A 5H3HA 1EIWA 1HDGO 4JVLA 3LXRA 3K9CA 4LMRA 4PX5A 2IYLD 1A9YA 2I3GA 2PX6A 2AFVA 2GMWA 1WRBA 2ZRMA 3DQQA 1V5EA 5AJHA 2QUIA 4B0OA 4MVJH 1W44A 5J5AA 1TLFA 2PS1A 3V4FA 3K70C 1NNSA 4A1OA 3HYSA 2WFZA 5DP1A 1V37A 2HFJA 3FMIA 1AUPA 4NR0A 4CMHA 3H5LA 4MCAA 4UNPA 1KYQA 1VG1A 2H5JA 2HMWA 4CQNA 4MKGA 3W7BA 3FWHA 1J9ZA 4BFLA 5GOZA 2VQEB 1PR1A 1LWNA 1Q7GA 1NN5A 4Z0NA 2VF2A 1JQ3A 4X1KA 2L19A 5A7HA 5H1YA 5LNK6 1LH0A 3ROZA 3VZPA 3M83A 1DUSA 1SG6A 4Y2TA 3GPBA 2XT9A 4C43A 1LK7A 2JW5A 2UVDA 4ZAZA 2Z04A 1QO0D 2UUPA 4DUPA 5DNCA 1PEYA 2R87A 2FFQA 3HCBA 1XMQB 4DLZA 3WO0A 1XVIA 3R0JA 3FUUA 1TB4A 3V8NA 3DT8A 1L5MA 3DSRA 3PHIA 1VECA 1W73A 1XT6A 3HWSA 2VP9A 4UHBA 1DC8A 1PZMA 4EPWA 4A26A 2O48X 4IWYA 1UKAA 2L82A 2OCXA 3JQ9A 5CH8A 4ZRMA 1U5BB 3KZOA 2I0FA 1A9RA 2P8JA 1QGYA 2HK9A 1RAAA 2FZVA 4YNBA 1FFBA 5J2UB 5CD9A 3R44A 3HY6A 3VX4A 3QP9A 2JRCA 1G41A 3DKVA 2EKBA 1X7ZA 4Y9UA 2EEZA 3FYUB 3OPVA 1LBEA 3HJTA 4FOPA 1DAPA 2JDIA 3OZTA 3KXLA 4MRSA 4QYIA 5BYAA 3HJRA 4N3BA 1E9AA 3MT8A 3X2EA 1K0FA 5IC4A 1M0WA 2MIIA 3IX7A 3S28A 3UMCA 4EFMA 2X8JA 5EMLA 3OZXA 3ZNQA 1P2BA 1QPBA 1T3LA 1VG9B 2XRYA 3UT5A 4HGPA 1R4AA 4CIBA 2Q6TA 4NPAA 3TUZC 1I4TD 2XUPA 1X8JA 3INNA 4GPD1 4TYQA 2GO7A 1A9ZA 2BZGA 2FRXA 2JVKA 4JD5A 2XE7A 1DAEA 1FTSA 1Q3TA 2YASA 3DZFA 2DFTA 2R86A 3G6KA 4RLHA 3HYNA 4O6VA 2PT5A 4PPYA 2G9ZA 1V5IA 4Q1FA 5TPWB 2CJFA 4NBSA 3SKYA 1QYIA 1H66A 5JAOA 1GZ7A 3W5AA 2AZXA 1YJQA 1CJUC 3I12A 4DA8A 5J23A 3D6MA 3K1AA 1YT5A 4ZYUA 3EQ8A 2RK6A 4HTFA 4E1VA 5BQ3A 1HNWB 1DO2A 2E3JA 1T6XA 3BK7A 1Y8RA 3CXRA 4KLZA 4RGYA 4TL6A 2OWDA 2XIQA 4PSDA 4YJGA 1ISRA 4LKRA 1E5TA 2A67A 4DCPA 2B35A 1DQYA 1E6WA 2V7WA 4K26A 1U8EA 2J5BA 1N34B 1CS4C 4JJAA 3FLEA 3T61A 4B71A 4WJLA 3OSUA 1N2OA 1L4KA 3VO9A 1WPGA 1DHTA 1KARA 4Z9BA 1E2PA 1CUYA 2QT0A 3D8NA 4CM8A 2XB2A 1JEJA 2NO9A 2NVUA 5D6OA 2R97A 4GI2A 3RSZA 3BFJA 4JI2B 1EM8B 2LCIA 3PKIA 2AI1A 1K89A 3RRZA 5EJMA 4M1KA 4ENUA 5FUXA 4P4SB 4DY6A 2F8LA 2IY9A 2VR1A 3D3WB 2FPKA 4ER7A 3ST7A 2VTBA 3DVAA 1FF9A 2Q3MA 2VDLB 1JHOA 4P1ZA 1O97C 2SKCA 4P35A 4P3PA 2I2AA 5K0EA 4RTSA 5KKAA 1VSUA 5EI5A 3DP9A 1DX4A 5HIJA 1B00A 1C0IA 1NVXQ 1Q2UA 1YBVA 1VBKA 2PGNA 2YINC 4M9CA 4OLHA 4XR4A 4G0PA 5AKJA 4LZJA 1RAIA 2R6HA 4LWOA 3HCDA 4EL5A 2YWHA 3C6KA 4Q9HA 3JQAD 4S24A 3LQYA 3COVA 4ZEOA 3UW1A 5HM8A 1RHRA 1NXXA 4AG5A 5BWLA 4LOKA 4MB2A 5EIFA 4B09A 4DY4A 1JHMA 2X0IA 2E4UA 3G9UA 2A5DA 1FFEA 2IOHA 4BJ1A 4ESOA 1MOQA 2JFPA 4YUZA 2JBHA 3E3OA 1KKLA 3GY0A 4YTEA 1EVEA 2Y3IA 1OBCA 4IEIA 1UFKA 3BRQA 1ZWKA 4WFIA 4FFPA 1OE0A 2AUMA 6YASA 5KWJA 3DOIA 1KTVA 3C0KA 4ZZ3A 2HC9A 1E0JA 4BWFB 4UBKA 3FSGD 4O4LA 1U7DA 2VNJA 4OK6A 4GG1A 4G07A 1GG8A 1RACA 1IG3A 1E3EA 3FRIA 4DLRA 1T3GA 4OFZA 5JTTA 4N8DA 3CJTA 1Y9DA 5GIPE 3O8OB 5HRUA 2DCUA 5F3WB 2C5EA 4DBVO 3FDFA 3CVYA 3GN2A 4KQWA 3JYLA 3UB3A 1WXXA 2H2FA 3H11A 3JXEA 3WGNA 2C78A 3SJUA 1VIAA 1J06A 3EGCA 2ODBA 3L0SA 1WXFA 3NDPA 4GMXA 4N76A 2W11A 1QH1B 3N05A 5ES4B 2YRWA 3AVVA 3C8MA 3OOEA 2GLXA 2ZT6A 3LXXA 3UAOA 3VZCA 5BSKA 4Z3OA 5FL3A 2NSYA 5JOQA 1DUIA 3NC1C 3U9LA 1AD2A 1FB5A 4KR9A 3BWEA 1N2CA 1YACA 3B5EA 4J3NA 3KTDA 4J7CA 5AI6A 3T9EA 1PWXA 1E3QA 1HDXA 1Q11A 2C5BA 2VAPA 1HE5A 3MUFA 3FX2A 3R1IA 4FU0A 4K9QA 1LBSA 4ZANA 1CY8A 4MROA 5TR9A 3PUKA 3BJEA 4V03A 4TMYA 4D8TA 1DMRA 1ZJZA 5ELXA 3V1KA 3TMKA 4ER5A 4TYYA 3VAAA 1YFKA 1ZNXA 2CLEB 2FK8A 1FYFA 1KC1A 1LW7A 5AW6A 3OE1A 3GDHA 4O25A 1YQUA 1UJ2A 2IF0A 3UZUA 5A0VA 3E03A 3HO6A 3UTCA 1EVJA 4F46A 4M9XA 3FVWA 1SZCA 4DLSA 3K16A 2Z2XA 3RRNA 4O63O 2V8BA 5BW8A 4XUDA 3KXDA 4CMJA 3AEQA 4W1SA 2HKIA 1IN7A 2WZBA 4UCFA 3TE6A 3IRUA 3A0UA 3M89A 4N3NA 3E15A 2XUKA 3PHJA 2EJVA 2CVHA 1MO2A 2I2DA 3MIZA 4X41A 5U4XA 4EK9A 4MMYB 1HUQA 4F3CA 1JKXA 4YMIA 5B1IA 2JLSA 4GWKA 1BJKA 2EHJA 3CPJB 5K0JA 2J3JA 3RYCB 4B2IA 3FZYA 2PAAA 4XFDA 2QZSA 1NW7A 1P2VA 4WD3A 1A04A 2NSDA 2G06A 3Q4GA 4RETA 4DWOA 1D3AA 4AJKA 5K8TA 4OX9B 3DL0A 1PP4A 3V33A 1JSXA 1U8TA 3OO0A 3QVWA 4QAQA 4TXNA 5ENZA 2QU7A 4F2DA 5HIAA 3H5AA 1HC7A 1IHXA 3F47A 3DOHA 1XGKA 2W4MA 1YRYE 3PG5A 4IJMA 4IS3A 3ROEA 4MQMA 2IP2A 3I5AA 4IIXA 5BP7A 3C8DA 4XUCA 1KDZA 4LPSA 1Y4DE 5IYZA 3OTOB 5J63A 1EDDA 2PFGA 5EFZA 4NJOA 4GKKB 4L6IA 2C8JA 2AW5A 4QNMA 1X7YA 1YZTA 1N57A 1R0LA 1AN0A 4MUAA 4TVBA 1K8ZB 5IZCA 3O8RA 5H59A 2MU1A 7ABPA 5I7VA 5CLLA 2JLAA 2JCBA 5L3ZA 1ISSA 5L3SB 1XPOA 3O21A 4CQJA 4I3GA 4BZPA 4BNUA 1A4UA 3HJAA 3LX6A 3ZKWB 2ZBDA 3WGLA 1TPYA 2BEVB 2WAMA 3B6EA 4RD3A 3GJZA 4MRNA 2Z9CA 1IMOA 3KO8A 4ONEA 1UBNA 3DDCA 2D8MA 1AQYA 2R84A 4MDFA 4L0CA 1PGOA 3B7PA 3GD5A 1S96A 2MYNA 8GPBA 3D8RA 3W5DA 1UWLA 2WMDA 3UV6A 4FHGA 1XLVA 4S1NA 3UEOA 3OTWA 1KQFA 1C3OB 2BFFB 1LI7A 4G9BA 2Q41A 2P2GA 4O4JF 4TS1A 5JV5A 1ZRHA 2ZIFA 5DMXA 3BZBA 4AJ4A 1XTUA 4Q4JB 1MHTA 4TWAA 1JIKA 5LKAA 3KXKA 4CFSA 1I1OA 2W2NA 3PJFA 3GJ7A 3OIGA 3QXJA 4I55A 4KUHA 1NVVQ 3EHEA 3HL0A 3JRXA 4MIOA 2PX8A 2VRCA 2C8LA 3AHGA 3PC7A 4G65A 4NH4A 1JAHA 3QWBA 3DTTA 1CS0A 2D06A 1L5FA 5JBQA 1GKYA 2GUGA 5JZVA 1M8GA 3MGGA 4HCJA 3ITEA 1J07A 5ALDA 4OF4A 4FCTA 1N7IA 5JYBA 1J4AA 4QOHA 2IT1A 4L5CA 3ON5A 4PTZA 4X5OA 3CWQA 3HFGA 5TRTA 4GYWA 5B1EA 1W93A 1NT2A 2Q5EA 3DOFA 1CUJA 3CE6A 1BH6A 3BJMA 4DJTA 1TW2A 2HQOA 3ESRA 4L8WB 4LOJA 4KGVA 1USVA 4TXMA 2C7RA 2PK3A 2OSBA 1ZU4A 1J0DA 1I3NA 1PJBA 1X9GA 4FXPA 4ZT5A 5CYGA 1EFVA 1IZ9A 3P2EA 4H59A 4P7BA 4LJAA 4BNXA 1EJ2A 2FP4B 4UHFA 4IMIB 3G2PA 4RPGA 1XNGA 3FGOA 5JNVA 3L8ZA 2QB5A 1X38A 3HN2A 5JNRA 2I4IA 3WK5A 4TV8A 1KVSA 3PNSA 1JFSA 4ZV7A 1JV2B 4MYSA 1EJ0A 1XKLA 2WV7A 3JQEA 3WGVA 1N32B 3K9BA 2WIKA 2YJ6A 1Q0PA 1VL0A 2G04A 3OQPA 4UD6A 4K9SA 4NESA 4V02A 4BB0A 2QAGA 1BXRA 1GYQA 2L2QA 4LHVA 3TI7A 2CUKA 3SK0A 1EUDA 3I39X 2VLBA 2ZW9A 4UVEA 1I0LA 1SXJD 1BE6A 4TS9A 4MV4A 4P6VF 1AMNA 3ORFA 3UJDA 1Z5PA 2PX0A 3HK2A 2OHVA 1JB9A 2MINA 2Q1YA 3WZLA 4IBOA 2GI4A 2XBLA 5EIBC 5EHNA 4WVFA 3LX8A 1WTAA 4C0XA 5AUNB 5C32A 2C98A 3N0VA 2GBLC 4RH3A 4XZ3A 1YUNA 3V8MA 2XLCA 1TUIA 3NBZC 1TQHA 3ZY6A 2DBZA 5LVAA 1IY8A 1GZUA 2VBFA 1YNSA 2XA2A 3NBFA 1A7AA 4BNDB 3KE8A 5KTNA 1CRZA 2FEWB 2VQ3A 5CA0F 3S8YA 3ZCTA 2Y76A 2YFQA 3TYXA 1LSOA 2ZE8A 3TW6A 4J4BA 3OJCA 4WDQA 3RSCA 4CZ2A 5BV7A 4D46A 8AT1A 1FSFA 1H1DA 3NT5A 5M7EA 1YBAA 4Q1BA 1SC1A 4G1EB 3ZWWA 2CHVA 4WBNA 4OHZA 4L6AA 2O5CA 2DPXA 3HBAA 5TEWA 5DTJA 1F2UB 1XYGA 3W9SA 1UPFA 2Q2OA 3PRJA 2W6JD 4WBXC 2I87A 2VZ0A 4Z9FA 3WLKX 3JWPA 1U2QA 9LDTA 3UHFA 4DAEA 1BDIA 3KLMX 4D8WA 1N3YA 4C4TA 2HDOA 4DB2A 1BS9A 2H5LA 3JVEA 1TF5A 3SYMA 1YE3A 4KFRA 1JAXA 1M8FA 2B36A 2NWQA 3HB4X 4RHTA 3V7YA 3DULA 4E1AA 4RIFA 5MN6A 1TRKA 5C52B 3JARA 1Q77A 1Q21A 2C95A 4I5FA 2JAXA 2A1UA 1PWZA 4YT5A 3AEXA 2FPWA 4B3DA 2D1RA 1F06A 3TEJA 3VU9A 5EIXA 3TUIC 3OT1A 5KAMA 3BF7A 3CC8A 5JIBA 2ZR0A 2D54A 1PAUA 5D3MB 2HTFA 4W5HA 3A11A 5HZGA 3UA4A 3N0TA 1SBIA 4FHCA 3ZW9A 2A1IA 4B3TB 1NSYA 1IHUA 1X3LA 1AO0A 3Q40A 3VOBA 2GNPA 1XLUA 3UV7A 3WQQA 3ZWKA 2H4FA 4BWVA 1MT3A 1U6JA 1PK8A 2X6QA 3QG1A 3R0ZA 4XX1A 2FZ5A 2X5JO 2HDHA 1Y6GA 1RJFA 3BFPA 5HFNA 5JC1A 2CLCX 3DF9A 3I6ZA 5DCUA 4G0QA 3C7KA 3HY3A 4CV2A 3B9QA 1X8LA 2EKDA 3IDOA 3RIXA 2VEOA 3MRXA 2RAVA 5JRDS 5CIYA 2FWRA 3PUZA 3JD1A 4UBMA 4M1TA 3QX7A 3WJ2A 1E3MA 2J9GA 4DMHA 3TINA 4YCAA 3B1XA 3WLEA 2R1ZA 2YIJA 2E82A 4MYUA 4YRRA 4EHLA 4NMHA 1QDEA 4Q9NA 1AK1A 3CUSA 4N65A 4ZVSA 3WIVA 4ACBA 1DEAA 2DBRA 1ODSA 2AUTA 2NV0A 3AR5A 4IIHA 1N4AA 5ADUS 3WAGA 1W0CA 2HCFA 2ARKA 2MYPA 2PJUA 1W4ZA 1I2BA 3I3OA 1MFZA 3K7EA 4IVPA 4IX1A 1NE2A 4MIKA 2YICA 3ZQUA 2PR2A 4ESVA 1XE3A 1PWYE 1HZZA 1N25A 2IUEA 1E18A 2FPSA 2ZP1A 4NAVA 5EP4A 2D2EA 3CRZA 4NXNB 1H8ED 4W5JA 4W1QA 2O23A 2RBKA 1XCOA 3EC1A 4PPQA 2OQIA 1TXGA 4TLAA 3U7QB 2PWYA 1LUAA 2D5BA 1ESCA 3ELYA 1C3LA 3OLXA 5BUZA 5KKCA 2F43B 3OPNA 3ZLUA 3H2SA 4MQUA 2G9NA 4NEGA 3V34A 1EGVB 1QXSA 3M3DA 2Y1EA 4UPVA 4MKRA 1M6NA 2IH2A 4QOFA 4UASA 1NXSA 1YDGA 1Z6TA 2EFDB 2YIVX 3CVOA 3EULA 2QZZA 4LE2A 4LISA 3V7UA 4PCVA 4RESA 4M7WA 4QUEA 3D7KA 1YA6A 1JPVA 3I58A 2FN8A 2G09A 4DR7B 4HGQA 1ODFA 2PEYA 4IUBS 3E9QA 2IYAA 1XFAA 1SCNE 4BCCA 3GNQA 3IIKA 1ZJWA 3K6SA 4JHXA 4KWTA 3FOBA 1PR0A 4QT0A 1FDIA 2QNIA 8ADHA 1YDWA 3ZH9B 4PNPA 3IT0A 1TM4E 2I65A 4JDUA 2Q4DA 5G0UA 3TBKA 3A4MA 1PZXA 2YVLA 1GO2A 4NZZA 4U2EA 1SHKA 4F4UA 5EKXA 3GD7A 4LYYA 3PVSA 3ULKA 4BO6A 4ZHQB 3FIJA 4AC9A 1OF1A 1KETA 3IODA 1KEZA 1E2QA 4R81A 2EFCB 2R5FA 2P78A 2ZFUA 1E98A 1DNPA 1F3LA 1QZZA 3TTSA 4N0MA 2ES4A 3WC4A 1YA4A 1G20B 2GXSA 1U2DC 2Q5OA 1QFSA 4CBVA 1HGXA 1CK4A 1XEWY 2HIMA 4BVLA 1QVZA 5K3BA 5IJWA 3FYDA 4N5DA 3HB9A 3WK6A 3A4YA 2CHGA 3AB8A 4LRYA 1XZQA 5FNVB 1UDBA 4HG2A 4QVIA 3Q8MA 5I4BA 3BYZA 1DXQA 2B8NA 2YNMD 5ICMA 1LNSA 1WW3A 3Q72A 3L4KA 1NBWB 2W2LD 1F4LA 4UCXA 4XW2A 2A30A 2QVZX 4C0BA 5KBYA 3EAFA 5DLQC 4BMDA 3EW9A 2NPIA 3FGNA 3L93A 4R2HA 2V7PA 1IE3A 3CBQA 1WQ4A 1LLCA 3F8TA 4OM7A 5IVPA 2C97A 5KJCA 2YZGA 3IMCA 3R7BA 4KWEA 5EJ5A 2Q5QA 1H3EA 4J1TA 4EH1A 2YZ2A 1MJFA 4QEZA 1K3UB 3EDRA 5L95A 1SKMA 3KALA 2XE6A 2C2KA 4R69A 5KPJA 2HBQA 3DFIA 4BDSA 1EFCA 4YRNA 5D84A 3KWFA 1XQVA 4RSHA 3H86A 2BEKA 3HFJA 3S2YA 1J70A 5J43A 4ALLA 1HK7A 3QKSB 4LZPA 2AKAB 5GZ1A 2JCYA 2ZIUB 3UYLA 3R7WA 2ATIA 2XE4A 3EXEB 5GTDA 1P80A 3EFHA 4L28A 4Q01A 4RVOA 4F1KA 1SXQA 1FP1D 3OPYB 1RC0A 1XTBA 1ABFA 3OA2A 1M76A 1VCIA 4LSMA 4PSAA 4PSKA 4UEKA 4ARUA 5BV2P 3LQRA 4JUIA 3PRHA 4AO7A 4JYAB 4QWWA 3IUMA 1YKFA 5FFNA 4PO1A 4ZQHA 1RQ7A 3N0WA 4PYOA 1C1XB 3UXHA 3ZVRA 1I2ZA 4RKWA 3V3KA 2O0JA 3HM2A 1IQ0A 1JJAA 4QRIA 2O8EA 1DX9A 2Y1OA 2WJIA 3IJPA 4YASA 1CF9A 3QJYA 5FPTA 4K9MA 4IMJB 5AESA 1P9NA 1EZ4A 3IUSA 5EWJB 5FWDA 5I51A 4RDXA 1NT4A 2EGHA 1OWMA 1FW6A 3GLHA 1UJCA 4MVJA 3EZ7A 4EG4A 1FSPA 3D3EA 2KLBA 3WL6A 1IN6A 3EPHA 2A0XA 2DFKB 4BNIA 1JLLA 3R3JA 4L5YA 3G8DA 3FTPA 5B53A 2UYCA 1YAJA 1D09A 4R2MA 1QUEA 2C2BA 1EU1A 1PG5A 3TZ6A 5CBPA 3DWIA 4XDGA 1HL3A 4FZRA 2KSQA 3BWMA 3NJ8A 3T3EA 3PEEA 4LA4A 3B9PA 5SZIA 3PX2A 4BKPA 4LYFA 3R7AA 4Y6GB 1J23A 1HDEA 1EQUA 3IDQA 4NTZA 1O1YA 2O5RA 4LCEA 1D5CA 3Q2OA 5TX7A 4B0PA 3KSRA 1JTVA 3W2FA 3MM4A 1CQJA 1DQSA 4LXIA 1QDLB 4OHRA 3W9UA 1D6MA 4FI3C 1R66A 2HWKA 4CGZA 3ZIAA 2V7GA 3ENNA 5E1BA 1P2FA 4QARA 1DEHA 1W85B 3CH5A 3PQ8A 4UVDA 2H6EA 1PS8A 4AF8A 3ZCSA 3Q8WA 2JLCA 4AJPA 2AD5A 3C43A 4M8LA 5DPMA 1P6XA 2OCKA 3KJHA 1NUSA 5TQ2A 4BO8A 5DBFA 4QTZA 2CZCA 1PSZA 2REXB 4BN0A 9ATCA 4V0QA 4AQDA 3KAJA 1H9BA 1UZAA 4AWXA 2EZ8A 3D1LA 4MPPA 5E2BA 1LLDA 2IBTA 2WOJA 3M9WA 3WGYA 3LCJA 4MWBA 3RFCA 1UEJA 1EG2A 1YL5A 2KQUA 2ZR7A 3V2GA 1FTGA 3FN4A 4X54A 1EPUA 3O1HB 4HFNA 2MYTA 4KWCA 4DG5A 1RWXA 2XRZA 4INJA 2TYSB 1ULBA 2FWNA 3DW1X 3GJ5A 4D1YA 4YRSA 2B1GA 4FLEA 1ISFA 5EZYF 3I9JA 2ZSUA 1EWQA 1ONBA 3H2BA 5ALYA 1R8YA 1N5LA 2A5LA 2P4UA 4P4UA 4CEHA 3M9LA 2IHUA 5I7RA 1SKQA 2BI4A 3GFSA 1Z56C 5K7SA 1K08A 2XMQA 4R1LA 3F4LA 4YEDA 3R0XA 1OA0A 2Y0EA 4BRSA 5JRJA 3JZDA 1JEOA 2A0FA 3TQQA 3I4FA 2NZUG 2FE4A 1V1MB 2BHLA 4NVRA 5F73A 3DBHA 4DV6B 2Q2NA 1G4AE 1Y1PA 1QLJA 1NJ8A 3CM0A 4OQPA 1JG6A 5FFMA 5IDYA 1OT3A 2J30A 1K97A 2JVIA 1L7QA 2YW9A 3E1KA 4AICA 4JL6A 4WN9A 1M8JA 4KPYA 3IEVA 521PA 3WMEA 2H2WA 1X1AA 3NETA 1GOTA 3HBJA 1MO5A 2H65A 3Q7IA 4UMEA 3ZWOA 4EHBA 2F4NA 3IAS1 3O0TA 1K4YA 4F3TA 4EPXA 3X3HA 2FGJA 4IXNA 1ADYA 4M83A 1P75A 3LW7A 3IC5A 1BEUB 4ZPJA 4F5YA 1BWPA 4I9HA 3OZVA 3LQKA 1D2AA 4K2AA 3OIDA 2H8KA 1B6RA 1FTNA 2XNCA 3QOFA 2DPLA 2V7VA 3MQ2A 1RMQA 2RHOA 4MP8A 4ZOLB 1YZQA 5DYGA 3FFTA 1YIAA 1GCGA 4MRAA 3VYWA 2DETA 2I7DA 1E79A 4WFQA 3KPVA 3D8TA 5H8WA 4GVXA 1IXZA 1FYEA 1VPVA 4TKUB 5INTA 3PLNA 5JJ5A 2E49A 3VNAA 1N92A 1P33A 1TJ5A 1YMUA 2IEYA 3NCTA 4IAOA 3S27A 2BHTA 3WL7A 1L5QA 2AOUA 3MTQA 3CZPA 5G0TA 5A4IS 3KOUA 2R85A 2Z09A 1CR0A 2XKAA 3AUUA 4JI6B 1T2CA 3O4RA 1L4YA 3I30X 4V38A 3LI2A 2R0QC 4ERNA 3V3TA 4KFUA 1DFHA 3L7LA 1H2FA 4HK4A 4B6FA 1U3FA 3EA4A 1NG1A 2NXCA 3O82A 3M70A 4LSWA 2Z5LA 2QQEA 2PX3A 3ROXA 4NZPA 1DXHA 5KVCA 3QFSA 1N1DA 2N1BA 1NHGA 1QYVA 1U0EA 3ADOA 2BUAA 2FF5A 3D2CA 3FYSA 2WHYA 2H5EA 1Z4PX 3ECAA 4H3HB 5CNMA 3T1NA 1TW3A 1NM5A 1YXMA 1C9NA 1NVDA 2RJOA 3CZ9A 1EHIA 1DELA 5I9MA 1BQ3A 1RYZA 2P6OA 2HSZA 1GTG1 4M9QA 4KXYA 3HEAA 4BQRA 4MO2A 4RDHA 1PJ3A 4EKEA 3IELA 1MAWA 2DHQA 3ICOA 2JA1A 3AUSA 3ASYA 4RSRA 1I7PA 4U6NA 3HKDB 4Z8YA 5IKEA 1UBUS 3FWPA 2NZXA 4WINA 2AEMA 4DQUA 3SNKA 1SUPA 4TWBA 3MB8A 2OHJA 4X20B 1A98A 3OCZA 4KUGA 1RPNA 3OAAD 4RQAA 1JJ7A 3T95A 1E3WB 3N07A 3G7SA 1I3MA 2AK3A 2DRIA 3LVFO 1XDUA 4YAEA 3AJDA 3U44B 4LDQA 3KM0A 1KY3A 2WBLC 3R7NA 3BH0A 1NAHA 2W8BB 2B83A 2QR5A 3DTYA 3W1WA 4L57A 3H1AA 2OQ2A 3MINA 4DXAA 1GL6A 2NU6B 4BBJA 4GOOD 2FVYA 2W90A 2X8AA 2XDWA 2WU8A 2Z6VA 5A02A 2VPIA 4IPTA 4JX9A 1O7JA 5D7NA 1FVHA 1IATA 5JCZA 5CHEA 4TUYB 5MF6A 1K68A 3DMDA 4Z1MA 1MT0A 2CL6X 3HA7A 3ETCA 1QANA 1TJ4A 3HO8A 1F51E 3O74A 1V95A 4CTJA 3R8CA 3EBOA 2QLJA 4L78A 3GRVA 2ZJ0A 3HR4A 3I6MA 2WF8A 4KRYA 3TSOA 1NOIA 5HKBA 1EJ6A 3EC2A 3T7AA 4OP2A 1WOYA 1CPYA 3HI6A 3M9XA 3O03A 2IOYA 4JQOA 1VXRA 3TR0A 5IK2D 5G3YA 2ZUBA 1HF3A 5AUQA 2HMYB 4X63A 4PXAA 3WLOA 5F4BA 1YFLA 1VSQA 4KQGA 5HDQA 3CV3A 1HSOA 2CJWA 3VSAA 3NDJA 3C6XA 3F6YA 4UTZA 3IVGA 1Z2AA 3RTCA 1BFDA 4N39A 3A9VA 2A94A 4BLOA 3RSSA 3D81A 3GRFA 3DQPA 4G2NA 3WMXA 5LP6B 2QRQA 3C7TA 2PM8A 5EZQA 2AQKA 1AH2A 1S4MA 4PC3A 1M2HA 4GT1A 3DBRB 1SOAA 4PLYA 5KMGA 2YHAA 1APBA 3CUWA 2X4GA 1BMFD 2R96A 4EYQA 1F12A 4UUPA 4WKOA 5CT6A 3OCWA 1UXIA 4AMYA 4E12A 1AHHA 3HJHA 3GUVA 4ZZ2A 3TFQA 1Z38A 4QPPA 5DHSA 2QG6A 3R7DA 4BEBA 1P0CA 4EMSA 5A3VA 2WA2A 1FFYA 4Q02A 5KHOC 3T3DA 2KYRA 3GLHE 2D5CA 4PAOA 1ZUNA 3KXIA 5GONF 2BLNA 3LYUA 1E2EA 4TYNA 4KRFA 5D85A 3TG2A 3OC0A 1I4DD 2I1WA 4I9GA 5AUOB 1T9GS 1OA1A 4GLLA 4JYBA 4L0DA 2MSEB 2NACA 4C0HA 1KK1A 1Z28A 3F8WA 3VNSA 3PGLA 5HGJA 3E0QA 1J9GA 5J2TA 5A5VA 1XF9A 5DXAA 3C5VA 4LJ4A 1CJSA 4ARBA 4FJ2A 1FA9A 3MLBA 3KOYA 4JEMA 3LCMA 4OHWA 4P58A 1M7HA 4NCXA 1NBME 1PR9A 4MKXA 1YR1A 4MQLA 1J24A 1D1TA 2R4QA 4IMRA 3L2OB 4ND3A 3IE0A 4R1SA 1GFWA 1ODTC 4Q7LA 5H16A 3ROKA 3RUEA 4BX0A 2PPVA 3GPIA 5A5EA 1S01A 1XZGA 1YUMA 2WB2A 1ZMTA 2ZG6A 4DA6A 3T9FA 1HE2A 4CKBB 4XYLA 4JHLA 5DTRA 3W5UA 1WOMA 1KEVA 2ENUA 1HDOA 1YB4A 3H2ZA 4RDIA 2EJUA 3WLRA 5HR5A 1DDIA 1RU3A 3T7DA 1V11B 2B78A 4DUGA 1JDSA 3L0ZA 5F7XA 2XGOA 4MHTA 3NYWA 5CT4A 1X13A 4M0EA 4RFSA 4A2WA 1Z82A 3CKKA 4PXYA 4DLVA 1J2RA 3DYBA 1ACJA 3RSOA 4EB6B 1MD9A 2DWPA 5KVQA 3AHJA 4QOSA 3IHLA 1KKUA 2HRRA 1P91A 2O0MA 4HNHA 1XA0A 5A3RA 1LZKA 5B7GA 4BJ5A 2PJZA 3HXMA 1F6BA 2BL4A 4O1IA 3TR5A 2ZJ6A 1PZHA 5D7BA 2WPDD 1ESEA 4F9FA 3GLIE 4QODA 1PGQA 5DW0A 4S1TA 3B1WA 4WCFA 4NABA 5ADVA 5BNFA 2B4KA 1Y5IA 3F7TA 1GT6A 1X19A 3HSSA 2IODA 4YQZA 3PCXA 1RQPA 1Y42X 3EN0A 4LQDA 4G3XA 4JBWA 2AI3A 2H1IA 3L0CA 2GQ0A 2P9ZA 2QRPA 2Q99A 4PG7A 5CM9C 4BO4A 1U0NA 2JJ1D 4M6WB 2IHJA 1WU7A 5KTYA 2VNKA 4RD2A 3A6HA 4HEHA 2C5FA 4W5RA 1CV2A 3SF8A 1NUTA 4JR1A 3O4GA 1W5TA 3KLOA 3VPHA 3F46A 2G83A 4Q9KA 4UOZA 2VNAA 1QP7A 2E5FA 4Q4CA 2V58A 2Q6IA 3HVKA 5BW5A 5K4AA 4JQCA 3EXIA 3AG5A 3FOEC 2CLIB 2KWIA 4ZODA 3R6GA 2VBIA 3BZUA 4MUYA 5HNKA 3LLVA 1Z2CA 2R7LA 2B7LA 3DAOA 3ACDA 3FDZA 1WZNA 2WILA 1CJKC 1FDOA 3RUAA 1NPDA 4P31A 2NNWB 1YVEI 4RV9A 5C3UA 3CNNA 1SPXA 3ER6A 4YMWA 1TUBB 4N3CA 5DBIA 3SS8A 4OI0A 1WKBA 1GKUB 5EHXA 4R83A 4ZPXA 2PLAA 1EUCB 3H42B 2DM6A 2QMQA 2WQZA 4MCHA 4PYKA 2WWRA 5BN5B 4F04A 4L4RA 4YMGA 3ZQ4A 2MR5A 1K5HA 5HQ3A 4MEBA 4NNJA 4D7AA 1E4VA 1CB0A 1TA4A 2AH5A 1G8YA 1SURA 5B3LA 2OO5A 4UTOA 3FD8A 3VKVA 4ZU3A 4ICIA 2PA3A 4RKYA 3UXEA 2GKSA 3LG2A 5JXIA 5FPYA 1W87A 2QN9A 3Q7EA 1I51A 2AWOA 3FGPA 4Q66C 2BR3A 5F5NA 3AR7A 4BZWA 4YX9A 3SHOA 2ZS8A 1EP1B 4AK9A 2YZNA 1L8LA 4X3PA 4OK5A 1U9YA 3JAWA 1VP3A 2Z9DA 2E48A 5AKKA 1E2JA 1TM5E 1ZJYA 2ZJ7A 2YL2A 1WY7A 4JKIA 4NFSA 2P77A 1C7EA 1T8YA 2P6MA 4YMHA 1Z6GA 4IIJB 2JLBA 4Y7CA 1N9GA 2H1LA 4DWWA 2GZAA 3DAYA 3JQ6A 1BXZA 2JANA 1YJAA 1NPTO 1UPBA 4C89A 1CZNA 1GUAA 1Z4KA 4LX0A 1N0VC 4L0MA 1B3RA 2OSVA 4QSHA 1BU8A 1LLFA 2XUIA 2PSJA 3N7TA 4D4HA 1ZISA 3EARA 4KIWA 4OJNA 1ZLYA 4TWIA 4V39A 1AKNA 2G82A 1CT9A 2VWGA 2NQ2C 3NOXA 4AZ0A 3HCNA 5BSFA 2GF2A 2ID4A 3B3JA 4WNAA 5FUBA 2IE0A 4Q0MA 3ZWQA 2GYVA 2ZTVA 1TQ8A 4CM3A 4UTNA 2NV6A 3MRSA 3RIGA 3M34A 2Z6UA 3QXSA 1SU6A 4UJ5A 3FWNA 1PT7A 3D0RA 4N5IX 3SJAA 3ZGXA 5KNDD 3PYMA 1G17A 3EXFB 3L07A 2PZAA 4I2VA 4Q05A 3LF2A 5KSZA 3EWNA 1EVIA 4FWTA 1GSOA 2ATEA 3CZRA 2Y8EA 4D45A 4CDNA 3UMMA 1JTEA 3KWLA 1PGJA 1MHPA 2CV2A 1QTRA 4KJZA 4ETWA 5FUVA 1EXVA 4XTCS 2HRZA 3Q7QA 4D43A 4HXYA 4JBNA 1NYRA 5GJVC 4JU9A 3R9KA 1JYSA 1U4OA 1W2HA 3P9YA 4KVGA 4WK0B 4GP7A 1NLUA 3ILYA 2GKOA 2GASA 5B2EA 4JLSA 1GFSA 1XDZA 3EIHA 1UXJA 2CMKA 5F5XA 4CG0A 4YV2A 3PEYA 1ZH0A 4A0SA 1GQYA 3SIXA 3AVXA 1D04A 1U9IC 2RIPA 4PGFA 3OEED 2R8ZA 3A25A 3RCBA 1QV7A 5HKAA 4X44A 1JIVA 2BFPA 3SM9A 4Z0TA 10MHA 3OQIB 4OAPA 2FMKA 2E18A 5L6MB 3TSYA 5I4KA 1L5RA 3UC9A 3IQGX 2D3TA 3R6LA 4FOTA 4LHYA 4PV7A 5F35A 3OJXA 4AZSA 1KZ7B 4YROA 4K46A 4QYIB 4HLDA 5CMLA 1PR5A 3D6VA 3OKCA 3WIUA 4NBVA 4OYHA 4B3GA 3X1WA 1SUCA 2BT4A 1LV8A 2HF9A 1XRPA 4BFCA 1EQ2A 5IP5A 3IR5A 4CR7A 1RCUA 3SEZA 4I14A 2A9JA 3F74A 1FUUA 4NL4H 3LC7O 3WLSA 5BSEA 1QP4A 3NDIA 2QLFA 4ANFA 3NHPA 1NXTA 1PU2A 1FLAA 3HXLA 4G5RA 5SYMA 2PGLA 1SKAA 2XNDD 4L50A 4N0PA 2NU8A 3P9ZA 5AK4A 1XBTA 4G24A 1N2SA 4LXXA 2Z30A 2AYXA 4S1WA 5K3AA 5C4MA 3X2FA 3S68A 1XCBA 3W90A 5JMTA 2NW6A 2V4UA 3HCEA 1S6YA 4PYRA 4YRCA 3O4VA 1T6BY 1UIMA 1YQDA 1WIWA 3PDJA 5C5IA 3EDMA 1YU9A 3HGQA 2LCQA 4D8UA 3ZHRA 4JROA 2C9ZA 3B6KA 3T41A 1BQ4A 1FNSA 4OGLA 2ECPA 1R9NA 1ML4A 4EVIA 1J97A 1FFCA 1U7UA 3G8CA 3HJNA 4FQ7A 4AL4A 1VJ0A 1V96A 3AEZA 2HADA 3QLJA 3REOA 1FX0A 5T3UA 5CB4A 1P1KA 2J33A 5LB4A 1OROA 4H27A 4BVGA 2X86A 3AI2A 4DMLA 1K63A 4FONA 2XKKA 1OBFO 3GFVA 3E5MA 4HVLA 4QDKA 5LZ8A 1NF9A 2G9UA 1P1FA 3QUSA 4BO2A 4NFHA 1DG1G 3EIWA 5KWVA 4W82A 1ZVMA 4MVJG 5F98A 1LBTA 1H9AA 1RHQA 2GT1A 4KRGA 5EMKA 4EZIA 2WQ7A 1AJEA 2CEAA 3DVLA 4Q4HB 3RFXA 1I3LA 3RQIA 3OP4A 2VF5X 4NAUA 3F4BA 4C7XA 4OFWA 3O91A 5IKPA 1AS2A 1Z07A 1O54A 1E2MA 2IPAB 4MYDA 4RHYA 5ED0A 4JLPA 4K87A 5TB5A 3LK6A 1C9JA 4AJ2A 1DBWA 1VKNA 3MNFA 1CNMA 3PI6A 4YUAA 5FBRB 3KUKA 5EXXA 3VZQA 2X9QA 1BMDA 3HV0A 1A97A 4PC7A 2R65A 1IY2A 1XZJA 2GZMA 3OE7A 4FYJA 4IYRA 3V6LA 2CDCA 2EXXA 5ALLA 5C7OO 4WOPA 1P2UA 4TTQA 3WBBA 4U0KA 3EZYA 3VR4H 1ZVJA 2HA2A 4DNPA 3Q87B 1NBHA 2H4HA 2XWSA 3OEYA 1IWBB 5C1DA 4FYKA 4Y6RA 4DVGA 4Q4LA 2CFTA 4Q7QA 1QFYA 3CVUA 4COKA 1VC2A 5LP1A 2I71A 2QRHA 4NE9A 2HSDA 5HCIA 5JD6A 2QMZA 3DL2A 1XMPA 4QDUA 3OWHA 1MOPA 3UWPA 1Z3CA 4QELA 3TOXA 1RJDA 2AWNA 3LPMA 3ZBTA 4I81A 3UPUA 1LSUA 1TA9A 1R10A 1JG3A 3SG0A 3JD4A 4YRPA 3UTDA 3FJOA 1BCRA 2Q4TA 4J6EA 3JTMA 4WGGA 5CDFA 3RAGA 4FKZA 4ZGWA 1D4AA 5JXHA 4RKFA 4AJNA 4MW4A 3U3ZA 1CRQA 1O6CA 4HV4A 5A03A 3DKPA 5FTNA 5HKLA 1SU7A 2EEPA 2XUOA 2B99A 4TSFA 3QXHA 2CLLB 1QX4A 2YHIB 1EDEA 2ONYA 3OKPA 1GPDG 1QRDA 3GEIA 3E05A 3IFSA 3BXHA 4U3JA 2C9CA 3JQQA 1H8HA 4HR7A 4B2LA 4F85A 1P4HA 3VTZA 1BX1A 2X3UA 1G9XA 2FA9A 4LTMA 4YO7A 4M76B 3DZJA 2EQAA 3FXAA 3BGSA 4GSLA 1C0LA 1JR3E 1MMFB 1IB6A 3QUBA 3PXAA 4LI0A 2AEJA 4NYIR 4TZTA 2FPOA 3JR3A 2D5AA 4MIEA 3U7HB 1YCHA 1BKYA 1Z7BA 1RM5A 2RHCA 2OCDA 3BCHA 4P4LA 5EIWA 3RODA 4A1FA 2PA0A 3PR2B 4XEHA 5JY1A 3NTVA 3IHKA 2GPAA 2FMIA 3VVCA 3RRXA 2EOAA 2IDZA 4FILA 5GAJA 1OB5A 4L73A 4RY9A 3RYTC 1JH8A 1G7CA 2WUDA 2ZITA 3RYHA 4YJ3A 2HIAA 4EUKA 4OXKA 5IARA 5EGNA 1JEDA 4JLKA 3PITA 2GEVA 4PR0A 1XD2A 3HC7A 4MP3A 1FP2A 4UCWA 3CYFA 1ODCA 3PIDA 4J4TA 4NZNA 1RXCA 4B3XA 5KNCH 5ICFA 1UKEA 5EUQB 5T8KA 4GPBA 4D3FA 3IBSA 4M8KA 1M5TA 4CT0A 5J1SB 1NVKA 2HTEA 3A2KA 1SZDA 3BSSA 2OLEA 3CH6A 5JAMA 3W0LB 1HG1A 1PL6A 3B2NA 5DNEA 1TM3E 4XDZA 3ZJYA 1XNHA 4LVCA 4ZEMA 1J8DA 2O2XA 3U4GA 3R77A 3TRFA 2I4OA 3IQXA 4O59O 3A58B 4G0MA 3TR6A 4FCWA 3N6RA 1XAIA 2Y71A 3KL2A 2BISA 1UC9A 3IAFA 3KU4A 3PUXA 1E5QA 4HC4A 5CAEA 4QUAA 4RXUA 1OHHA 3S99A 3AIIA 3LPNA 3OWXA 4QWMA 3HP1A 2H29A 4KX3A 2XCQA 3DZGA 3K6JA 1AMOA 1NVBA 3JYQA 4YRGA 3OA0A 2QTTA 1J2EA 4CL3A 4E7PA 1IBRA 4ZIRB 1EZZA 3F8SA 3OQNA 3IEMA 5G1PA 3KK0A 3RKSA 2PL9A 2LUOA 4KE9A 1ZINA 3OY2A 5T7BA 3EX7C 4U0JA 1JDNA 1JPNA 3HRIA 5LOVB 3NHSA 4PGMA 1JR2A 5FBQB 3S6JA 2AXNA 4CMEC 1F0KA 3O7WA 1FMCA 1NF8A 2J4FA 2RKBA 4B4WA 1N1EA 1Y5RA 3GGSA 1E61A 2GUWA 3TQOA 5ALFA 1WB9A 4CCAA 3OKAA 1GTJ1 4FFBA 4TLEA 4FSDA 4HMOA 5CPBA 1IJEA 3EPJA 2JHFA 3GZTB 4MDHA 4MGEA 3C15C 5TMEA 3W78A 3TIIA 4C01A 4JI8B 3EXG2 1WMFA 3O9ZA 2FWBA 2IXGA 5FO0A 3OJWA 3VO1A 3NPAA 2AFRA 4AY4A 4ZDWA 2JRLA 4X62B 3KOZA 1EFRA 1PCXA 3F97A 2PUHA 2BV3A 2CXOA 2IHTA 3HDHA 1S5PA 3UGTA 4C14A 4EG0A 1N5KA 4MV8A 2H07A 4RGBA 3IP3A 2IIVA 4EATA 1C29B 1OASA 2J0UA 1K6XA 1TKAA 2FUG6 1MIOA 4ZJPA 1IUPA 3KUUA 3E48A 4MGHA 3V32A 4IG9A 1SU8A 2P30A 4KH1A 4QDXA 5A05A 2UXBB 3ETNA 1GLVA 4MW6A 5FL7D 3GZNA 1WZCA 3IP1A 3S2EA 3GMIA 2E21A 1ZK1A 1CXZA 4OA8A 1GGJA 4W8OA 4EUFA 1V3UA 2IXTA 2HMAA 4B85A 3L7KA 1Q0HA 4N48A 1QIEA 1M1NA 4JOBA 3SHTA 2I67A 1PK7A 5IBPA 4DXHA 1CR4A 1Z13A 1I6MA 3VHLB 1L8AA 1QGUB 2J9RA 4UAGA 2HHLA 2BM8A 1PF7E 1PD1A 2Z08A 1CHDA 2GDJA 4IF6A 5JS8A 3SC4A 4IH9A 3ZNNA 2CB0A 1R0XA 1QQTA 2GH1A 3HWX1 3X1ZA 1QH8B 4OJKA 4CIAA 2BMWA 3URKA 4V3CA 3GLFA 4GPTA 4H18A 4JSTA 2FWPA 4KSCA 3SXUA 5KB3A 4HATA 5JFGA 3QYJA 4EPYA 3GCZA 4XLTA 2ZE6A 3CNBA 3DTVD 4OY3A 3G1TA 2KI5A 4I50B 2H9IA 3OBBA 3FUTA 3IUNA 3U60B 3K9QO 4P2GA 4NOKA 3L0IB 4JY7A 2CXQA 5EOVA 1QC5A 3IV9A 5BQ5A 3R3SA 4J9UE 4L4XA 4YQFA 1BH2A 4P34A 5A5DA 2P5SA 1E2IA 1R6VA 2J6CA 3GEEA 4DWVA 4V24A 1XTIA 2HUPA 1ZMXA 2OBLA 4GM4A 2JHAA 4GX5A 3TXAA 1R5NA 4QPNA 2PXCA 3GRCA 3EOBI 1TCVA 3O2SB 8LDHA 3UT6A 3EB9A 4M54A 2CV0A 2HWWA 1KEUA 1OGJA 1P3JA 2PKWA 4G1VA 3QHAA 4DJ5X 2PSHA 1WSWA 1WB4A 4L9AA 1YDHA 4HWKA 4MZXA 3C7DB 4EKNB 5K0SA 1BTOA 3D7LA 4Z4CA 5KQPA 4CKEB 1UK6A 4KUEA 1MO6A 1QK4A 1I7QB 1HR0B 3RW9A 3E1SA 3ZWPA 2VDWB 4YR9A 4DILA 4YC7A 4ENQA 1RVV1 1Y5NA 1N0WA 1NQWA 3GLRA 3NUGA 3OQBA 1KIAA 3TQFA 1PUIA 2C7BA 1MXHA 4GUDA 3CHYA 1UBEA 4GVPA 2ZZKA 3ZCQA 4AW9A 4R2WA 1QF9A 5BSUA 4S1PA 1PT5A 2XB4A 4OPMA 1KI6A 3WLNA 1C9EA 3V7NA 1ZOOA 2DWQA 5ESWA 3JQBC 4YACA 3PJEA 1L5NA 3PXGA 3HSYA 3WDMA 4A2PA 4YMLA 4P80A 2ZUDA 1L5GB 3D6UA 1NIPA 3F5MA 3QKTA 5IUJC 2YQ5A 4RSMA 4E0BA 3Q7PA 2P4QA 5ARDA 4EHAA 2OP1A 1PQUA 4DA4A 1JGTA 3JTEA 1DKOA 4WUTA 1GPUA 1K8RA 2E87A 2EX0A 4LG1A 2WWHA 1ZESA 4UUQA 4X84A 4ZXPA 5IWAB 2HA7A 2ZUUA 1SUBA 3QF4B 1K7FB 1HV8A 4YYZA 5KTOA 3GZJA 2IKQA 4UUNA 3QVJA 1N7GA 3PR3A 3QWAA 1DTSA 4OAOA 2R3SA 4K7JA 1WUKS 3F0TA 3I6YA 3BEDA 5HP4A 1ZDMA 4Y18A 4M46A 2XQJA 3HE3A 3IQDB 1A50B 4MARA 3TNJA 1YQGA 3WGMA 5FV7A 3SKVA 4CKYA 4QGFA 3HSKA 1QM5A 2V97A 2G1PA 5CDFE 2MWMA 1QBKC 4QULA 1R6AA 3U3XA 4A0HA 2REOA 4MPRA 5JH7B 1QTNA 1OFUA 4TSRA 3VR2A 2WJWA 4CMAA 4C5AA 2NADA 4Q24A 5JNWA 5KNDH 1DG3A 1UKZA 3GRAA 4JBYA 2KHZA 2VH2A 1IULA 2W5UA 1U2TA 1CEQA 3HBMA 1WD5A 5HX7A 3P96A 3GROA 3IAXA 4AUMA 5JD4A 2GPWA 1RHMA 2X0FA 5DE3A 3VPAA 5K9ZA 2OOSA 5CA1F 1UXOA 3FDXA 3VR6H 3EFOA 4QU0A 4YJHB 4LQCA 2NTNA 3JD3A 4HUQA 1RZRA 1X74A 2PUDA 3SQDA 3LV8A 3GCWA 4ZI7A 1JKFA 3HA2A 3DAFA 4LJYA 4A6EA 3AVPA 2Z8ZA 2V6MA 1LC3A 2B6HA 4GZMA 2G7ZA 3ILSA 2M2IA 1MDFA 4K03A 4NPHA 4G0UA 4B3RB 4KO2S 4WXPA 1GGHA 3ZEIA 2VHVA 1MX3A 1V35A 3ONWA 1XZHA 3R3HA 4S12A 1PG0A 1BQEA 3P0EA 2BFEA 4TKMA 2PYDA 2B4AA 2DQSA 2C61A 4BFSA 4PG6A 5JASA 4Z0HO 5FOQA 1LQ2A 3WQBA 4G67A 2I4MA 3L0PA 1VXOA 3PFKA 2OENG 3ANTA 3M2TA 1LF0A 4CNQA 1R3UA 1VHLA 2N46A 3IAEA 1D2EA 3O3OB 3U31A 4X60A 4PANA 3GIWA 3PR1A 4LXQA 1M34E 1NBIA 3ETLA 4Q3CA 1GLNA 3K09C 2CSUA 4RBNA 1RJEA 1TZJA 2NXNA 2QTAA 3L1HA 3ZWYA 4IJ5A 2PYIA 2VJAA 4PFQA 1C0EA 3ZDQA 3RR2A 2W2KA 4KR7A 2NZJA 4QOEA 2AOTA 4MWCA 4G0VA 3GGDA 4H1TA 2GVDC 2RC6A 1K4MA 1T4GA 5AJZA 4NCJA 2IW1A 3IOCA 4Q3OA 5JDIA 1IPFA 2QN2A 3QIAA 3GMSA 4I1PA 2RHGB 1HA3A 1PUXA 3FW1A 4FMDF 4PBSA 3R9WA 2ZWOA 1DIOB 3BMQA 4LHZA 4NWIA 3TMYA 2ZDHA 2Q2QA 1PGPA 1HYQA 3V2HA 4LUCA 1DS6A 1JILA 4FSHA 1R4NB 3MWKA 1YFZA 1H22A 2D0DA 1DJMA 3ZLJA 2IS2A 4RVHA 1DE0A 3SPXA 4RA6A 4RYDA 3L1KA 3UUEA 1DMSA 1U0OC 1F4VA 4PVCA 4B47A 4Z5XA 4UAVA 4QG3A 2AG0A 7REQB 4M0UA 1KMHA 4CT4B 4GMGA 3V55A 1PLJA 3BXOA 1HFWA 2EJBA 5FI5A 4M4SA 3CE9A 4IRMA 4RKEA 2J3LA 2D7DA 2VUHB 7MDHA 5HZMA 2EDCA 1ZCFA 4L15A 1Y7TA 4GBJA 1N78A 1Y1TA 2XCIA 3IEPA 3MS4A 3OLVA 3HVJA 3MRVA 2F67A 2R1TB 4Z8XA 1ZN7A 3C3MA 4RHEA 4OQEA 5CDUA 4RL4A 2QENA 4YBRA 3FF4A 2W7TA 2EQ5A 1EEXB 2V5VA 4R8LA 4J0KA 2Z1NA 1ZG3A 1BZYA 2WAYA 3B7WA 3LQFA 4XVRA 2OB1A 1U8ZA 2WAXA 3P26A 3EMDA 5GJWC 3B13B 1EZ1A 4WESA 5EXDA 5FDFA 1UMKA 1EWVA 2O2IA 1Y3HA 2BJWA 1CC1S 3Q6IA 4OQFA 4WLEA 3E3AA 4H1WA 1YRQA 3IBGA 4GU5A 3CSUA 3FCYA 1T6ZA 5FPHA 5LMZA 1BC5A 1NXQA 1ZCAA 2AR0A 4EX7A 1AQNA 2Q4EA 3B36A 2QWXA 4OXYA 1AZWA 4EJ0A 3MW8A 2J5QA 4FGUA 2XY4A 4EB8A 1Q5PA 5KS2A 5CURA 1ND6A 1JIXA 5REQB 5HGXA 2F4VB 3NEPX 1Q14A 4D0SA 2FWJA 4A0RA 2P2ZA 4RTKA 1E1MA 3S1LA 2R6GA 2BGTA 1WB5A 4M1OA 3UPDA 4GGOA 1E94E 5K6AC 2HWXA 3JQAB 1QKJA 4KYUA 3D8HA 1D0VA 3WLPA 2Q0SA 3DG9A 3O1LA 2ESRA 2XEDA 1U2ZA 2YOHA 1FPQA 3AEUA 3CXUA 4GBGA 2XCSB 4G8CA 5BMOA 1UK7A 2VYCA 1XJQA 3EGIA 1V16A 4ES6A 3W8NA 5G1OA 1VCNA 5E7MA 3S2GA 1T9GR 3UK7A 1M73E 2AG5A 2GD0A 3E7XA 4W6QA 1RBZA 2OV1A 1J9EA 3PRKE 4ZO8A 4UEWA 5ALMA 3T9BA 3WRYA 4UNQA 2UZ3A 1AKUA 3GLKA 3DEAA 5JMPA 1H6DA 1FRQA 3IILA 5AI0A 4GLOA 3W6OA 1OV4A 5IAKA 3DD5A 4BVJA 3I01M 3L7OA 1VLMA 2OR3A 3FETA 3UIEA 2R8PA 4HZUB 2DC1A 2X2OA 3OWOA 5ETJA 1S9HA 3SDZA 3ZDYB 4BFUA 1MEOA 3NHRA 1EDOA 2JFXA 4BGVA 1GARA 3EF1A 4O08A 1IY0A 4J07A 1EX9A 1JHUA 3UENA 3UMBA 4ZCSA 4BMSA 4R1UA 1LDBA 4MLDA 3PWKA 4FINA 4AZ3B 4OGFA 3RUPA 4GI3A 1RRGA 3LFTA 2SICE 2HF8A 4AS1A 4D44A 4QZVA 2O8FA 3TEFA 1EP3B 1MXFA 3Q10A 5ADWA 4QFDA 1NI5A 4RW0A 4WPGA 5FP0A 4B80A 2GEDA 2NO5A 1U94A 1H2WA 3WICA 4QPDA 5JQGB 3NTXA 1T29A 4WZAA 3VOAA 3NHYA 4L4ZA 1BJRE 2MDTA 1E2BA 3B6JA 2NO1A 4KK4A 3WRWA 4D3ZA 1P7WA 1ZIOA 1RAEA 3WMWA 1MGPA 1U3DA 3K35A 2ODPA 3DBOB 5SZJA 1N2IA 2R48A 2X0DA 4ASUA 3K2BA 1E2FA 4URYR 721PA 4Z53A 3JU3A 3P9SA 1BG6A 1RI5A 2QPAA 4QHSA 5FYDA 4YUXA 3KQWA 3DV2A 2QW8A 5DZSA 2ZRIA 2IP1A 1TT5B 5ICSA 2EWWA 5IXYA 4M53A 4RD1A 4AECA 3AVTA 4TTIA 1NN3A 4BX3A 2HOQA 1JZTA 2HA0A 4BXOA 3LPAA 3ZEAA 4H4EA 5TVKA 2IEZA 1O2DA 3N2YA 5DHRA 3ZI7A 3C5EA 2YR0A 1J2TA 3PLAE 1KZGB 1X8KA 4PBTA 1H4QA 1L4GA 3U80A 2IYRA 6CHYA 1Z25A 4JQZA 3AH8A 1Y4ZA 2DG2A 3JAMA 4WWHA 2JBAA 1G7TA 1BU5A 3E22A 1KI1A 4ECAA 1HFKA 1FNBA 3KSBC 5K3CA 4Y2SA 3OZUA 3AY6A 3FVRA 4LK3A 1JUDA 4RPLA 2E89A 1K9VF 5LQDA 4HRVA 2BFNA 4F2GA 2X8WA 3UHOA 3ZYCA 1ZR2A 3LT2A 2YWDA 1MKYA 1VJTA 1CVRA 1Q0SA 3GJRA 3MSXA 4YWJA 1V47A 2IYWA 3GP3A 3L6OO 5DHFA 5IRCD 4WQMA 2WHEA 4CLRB 2WD7B 5KOJB 3MEQA 3DO6A 2G9RA 4MPTA 2IF2A 4HYYA 3PNOA 2NUAA 5COAA 4D02A 1OFTA 2PX5A 3LBIA 3VHXB 2DLCX 3PWSA 5JPIA 2YBDA 3I04M 3RSHA 3JQRA 3A0RB 3E4DA 1C8LA 5EQTA 5JVDF 3RVPA 1ND5A 1VQ1A 1ICEA 4XXHA 4EAAA 1E4EA 3NBUA 2QP9X 3IQFA 4QBFA 2KX7A 3ZV6A 1PT9A 4MRMA 2OLKA 3LT5A 5H81A 4XQGA 1JIJA 4KQEA 2IQIA 4EGCB 1EIZA 5T64A 1CBUA 2GD6A 5CFOA 1COWA 4OXQA 1UJBA 4BIIA 4DV0B 4JB3A 3NANA 2IYPA 1DV2A 2ZAGA 1BWQA 1KK0A 2QVCA 1P6UA 2IVFA 4RE6A 3BJIC 2GCIA 1XMXA 2O9JA 3B12A 3HKBB 4MVJP 1K86A 4WFKA 4P5EA 4FS3A 2OM6A 1I4WA 4UM5A 1NKVA 3IIJA 1LB1B 4LYAA 1TEZA 1IHDA 4BLQA 1YSCA 1U0GA 4G5XA 2AK2A 3H5RA 4WK6A 4JVSB 4FGWA 5HK8A 5A9RA 1SBTA 1OWNA 3D2AA 3KC2A 3GHYA 3SBOA 3BA1A 1ZU5A 5JANA 1NKSA 2FPIA 3AVWA 1II9A 2P6NA 3MGCA 3VR4A 2WLSA 2QL9A 4TM8A 3OQHA 2R6AA 2V0GA 2WPNA 4DOMA 3WA6A 4UTVA 5K0CA 2G76A 4W7HA 1KDVA 2ZREA 1W75A 3N86A 4J1SA 4MS4B 2HLDD 4TWJA 5G2OA 3IMEA 2A0WA 3NAQA 1F2TA 1ODLA 4MB0A 3RUIA 1Q6ZA 1B1CA 3OM8A 1NZJA 3GQBB 5E6UA 2BR5A 3KKQA 3DBVO 1ZM4A 2YZ7A 3QLTA 1PZFA 4B8YA 4F3NA 1EINA 1W4CA 2ZUCA 3CTMA 4Q4AB 4YREA 3CNOA 3DEKA 4KREA 1E1YA 5CYOA 5C8YB 2LRHA 3KJQA 4TT3D 1C7QA 2ORWA 4TQGA 5BRJA 5IFLA 3HN6A 1TTHA 2IUYA 3JQ8A 4JUFA 3RC8A 1A5ZA 3EPLA 1XNQB 3P5BA 3THRA 4PYNA 3EVCA 4BKMA 1E1DA 1G16A 3GHHA 1L7VC 2ZWVA 1A76A 1E9FA 3EEFA 4ENVA 3KPYA 3W7AA 3RWOA 4AY6A 4B32A 5L6LB 1B0AA 2BYTA 4INOA 4NCHA 2Z3ZA 2HV9A 4UARA 5AYVA 1EAYA 2QM8A 4JUDX 5JZSA 5TT1A 4CN9A 1AZSC 5CA0B 3FI9A 1CDEA 4PZLA 1GNLA 3NM4A 1RM4A 2DH5A 3TG8A 3FHCB 3G23A 4RULA 1SVMA 1G2PA 3ZHOA 4E22A 1WHSB 4OSPA 1M6WA 2QU8A 1L4MA 3VJMA 3UB4A 2JFFA 3GFPA 3ID6C 1VZ2A 1V6AA 3DV0A 1VIDA 2P0EA 1SMKA 2VZ8A 3OJOA 4P3YA 4Z9YA 2QBYB 4RZUA 3PFWO 4HDMA 3UMFA 1Y7IA 5CRIA 1J20A 5ITZA 5KNCA 2X1HA 2ZCUA 3N9IA 1ZR4A 2FPPA 1F7UA 4QOJA 4BNGA 5CH3A 3TVYA 2PJRA 3AEYA 5AXBA 2AG8A 2F1JA 1NBMD 4AQYB 2ZI4A 4MR8B 4N3AA 3TZHA 4BQSA 2P9QA 3RUCA 3D59A 3DHEA 3EH1A 3OF2A 3V42A 1Y6QA 5ILGA 1PJ2A 1AURA 1JE1A 1NN0A 3MAGA 2D2FA 3Q15C 1G21B 4ZAFA 3VVMA 4CF4A 4YY3B 4D82A 3GPCA 2QORA 3LCRA 2WMNB 2ZS9A 1W35A 3T5AA 1Q50A 5FI1B 3RAFC 3CW8X 2PY6A 1TZCA 3VC1A 3TW8A 1F48A 5FPQA 1I6KA 3V4RA 1ZA2A 3KYIB 4UZEA 5JCPA 3AY3A 1OILA 5DOZA 2PRJA 4EJSB 2C7VA 5IU6A 2ZBVA 1XIVA 3HTXA 1TU0A 1QIHA 2H8GA 3O90A 3CCCA 3KPJA 4NCNA 5LXTF 3TFWA 3Q6NA 3C4QA 2IK8A 3P9PA 4JIGA 4F71A 3BIWA 2YCBA 2N1MA 1EUZA 1J42A 1ADCA 4UBIA 1EP9A 2C5SA 2DSTA 2BC9A 4KQ9A 1YOVA 3H1GA 4BE7B 2GZSA 2R8YA 2QY6A 3CF2A 2B1JA 3FMPB 2O2CA 4Z0PA 4GMHA 1WE2A 3Q3HA 4BLVA 1JB1A 4PPFA 4DDUA 4BNHA 1E1NA 3LSYA 4WMLA 2WYIA 3B6ZA 4RHCA 4Z4QA 3L6CA 4HPJB 1P6QA 1RYDA 4PYIA 1JQLB 1W5EA 4H6VA 3Q3EA 2B8WA 1PJTA 1AQUA 1R0ZA 4QHYA 3UAZA 1FDVA 4BLUA 1RP7A 4B6JA 3SBEA 2Y6UA 3BIXA 2ZKIA 3RVRA 5TQ0A 1IXKA 4P9NA 4LF4B 4OIMA 1YVUA 2P4HX 3KKZA 1Z0JA 2WUEA 4LRQA 1QP8A 2JFZA 5IEBA 3WRXC 5FEMA 1KJ9A 3DEIA 5FF9A 1IN1A 4MR9B 4FDAA 2BZ1A 1D8AA 3C7CB 4WBSA 3TKLA 3USZA 5MN5A 2WJYA 4DIDA 5K4HA 3IEUA 1YQEA 2IXFA 3IXMA 4WZAE 3WL8A 3DT6A 3M3PA 5IXJA 5G4KB 3UYKA 3L9WA 3QPWA 4IUDS 1B8VA 5DNWA 1KYXA 2WFMA 5IC6A 2ZK7A 4RWZA 3A14A 4XRRA 3ES9A 2Z2YA 4IVQA 3TZKA 5MGNA 1OB2A 4YCDA 1GSAA 1PJ4A 4EKIA 2HNKA 2WU3A 4XWWA 3A2MA 1FFHA 2ZR9A 1G0NA 3JQPA 1J90A 3P20A 4GZ5A 3WSVA 5C3MA 2GCOB 2QPOA 3FWYA 3NRCA 5A2GA 5BNTA 3CTPA 2WP8J 3E70C 1RWKA 1T2NA 1TQDA 4QQKA 3S44A 3RKRA 5DMHA 5HPYB 2F64A 3Q5EA 2ZIGA 2BH2A 1ORRA 1LQTA 2ID7A 4CIXA 4TMZA 3SCZA 1YZUA 2VNIA 4OXNA 1SCBA 1UBGA 1GPJA 3BE6A 3UAYA 1P7VA 1K1EA 3LYAA 1S8FA 1XWFA 2WNSA 4IIVA 3MYRA 1JU9A 5F9MA 4N12A 3R8FA 3CINA 1VKRA 1XTVA 4CU2A 4YRFA 4RZSA 3VYRB 4HJXA 2PVCA 2QW1A 4HDOB 2HHCA 4DR5B 1JALA 1Y1KE 2V7TA 3BX1A 4BMXA 4X1IB 3A4TA 4IWNA 3LUBA 2GHRA 1XU7A 1G2IA 1D0IA 1NI4B 4YCJA 4B87A 1UODA 4B6RA 1NFQA 3KQVA 4E4YA 3I6IA 3L1JA 3H05A 4OL9A 3W34A 5IJ0B 1GNVA 1L1FA 2BKUA 3UGQA 2R11A 3MMPA 3UGJA 3HCWA 3EEYA 3MA0A 3NP7A 2QTVA 5J2UF 3F7MA 2H3EA 1QO7A 1ZIPA 1CUFA 1GZHB 1HH4A 2WHXA 5LZ7A 4PS0A 4EPTA 1RC1A 2H4WA 3NMUF 1USGA 2A59A 3G8AA 4YN3A 5TC4A 2XUQA 2BGJA 1VDMA 1K8QA 4II2A 4S1OA 3QPAA 1F0PA 5E8JA 1ZIDA 3MJEA 3Q0TA 2X3YA 1A3CA 1JT2A 4FP9A 3ETGA 4PGAA 5CB8A 5I5EA 5KSOA 4BZZA 1P1JA 2IY8A 2GLUA 2IW3A 1IZ7A 3NHWA 1H2EA 3O7MA 3PNPA 5THQA 1S2OA 3X2SA 4QTYA 3PE6A 2KS6A 4MSUA 4OYLA 2VP6A 1RXYA 3AUKA 4I0WB 3TL6A 3NONA 5B2ZA 3H1FA 5CX4A 5AWFC 4A8PA 1IZZA 2PL3A 1B6TA 1G0OA 1SAYA 2Q8QA 2D4AA 3K0EA 4KP7A 4AF7A 4CKWB 2UYHA 3DKRA 4HGNA 1Q3HA 3ORYA 5LQKA 2F90A 4A8HA 5H82A 2TMDA 4IX9A 2H08A 3B3GA 2I6XA 4X00A 2P9EA 1CE8A 3CONA 2WINI 3FNGA 3M4NA 5GWXA 4DB4A 1KOGA 4JOSA 1QG4A 4IGKA 4XJXA 5K3FA 4XWKA 4G97A 2V7QD 4E2XA 5IKXA 1GXSA 2VO1A 1CNEA 1Z8DA 3BULA 3NIWA 4Q7JB 5BV8A 4LAFA 4YRTA 4PSVA 1M72A 1FXUA 2VA8A 3GLVA 4TMVA 3IEKA 2O0KA 1EGAA 1A7JA 2Q5FA 4Q1DA 2PRSA 4FHZA 3DD1A 3QX8A 2IU6A 4AY5A 1PFVA 1RI3A 1GYPA 3X44A 4BLWA 4EFNA 5JSYA 3WV4A 4BP1A 2H06A 3EZFA 4AYTA 1WABA 5I3ZA 1TK3A 4M8NE 4QXRA 1TECE 4PQGA 1BA3A 5JJKA 3ROTA 4KE7A 1THGA 3MLAA 3QFRA 2QRZA 1XZAA 5JARA 1FNDA 2WLTA 3LOUA 4RDCA 3CGGA 2BFMA 1ZI6A 2LGJA 1E2HA 2PWPA 3ETEA 4HMPA 3U7JA 2O8DA 4FDUA 2QQ0A 2BMVA 3EOZA 1DC5A 3DMHA 3V9PA 1Z18A 3LT0A 3EVEA 2IOFA 3QEMA 2QL5A 5ICCA 1LTQA 1QYXA 2Z2JA 5BO5A 1R16A 2R62A 2XX3A 2C0PA 5KNDA 1VGQA 3FLMA 1I5EA 2QTCA 2X2PA 2J0VA 3TQRA 5ALPA 5K45A 1USIA 2XQIA 1HYEA 1LPSA 1S3FA 2XV1A 4J7AA 5HE9A 4CV3A 1BJTA 3VR6A 4AZTA 3ZLVA 1AZLA 2XR1A 3IH5A 3RTAA 4B81A 1WUHS 2Y92A 1FUKA 2BOVA 3BDAA 1XWIA 1RDFA 3WNDA 5KJFA 3LVBA 4IGEA 2NQTA 2RGNC 5LYJA 1PL0A 1OYWA 3WNZA 1T9CA 3KYJB 3QK7A 4U7PB 4XWAA 1CZRA 3JQDA 5H4GA 3M5WA 5I7HA 5FJJA 4EJ2A 4ZCIA 2OCGA 3HEBA 4IJ6A 4L51A 5EVJA 4LSZA 4HB0A 4IJKA 3P9KA 4N18A 2OTCA 4R84A 1HORA 2LE0A 4C2UA 4PX3A 1JXOA 3ICWA 1P4JA 4JV5B 3IIIA 3KPUA 1E59A 5IHPA 1HQCA 3IERA 2J7KA 4QUKA 3JSXA 1Q7RA 1W29A 2IS6A 1I01A 1M2OA 4QBKA 4BNMA 3NU1A 1QHYA 1U2DA 4H9GA 4J16C 3PXEA 1GUYA 2CFOA 3HA3A 1FBNA 2D3WA 4J0GA 4DQKA 4E5DA 1XVUA 1UKBA 3WNBA 5GVRA 1QAOA 4RF2A 2QP4A 1R2QA 3K9WA 2PCJA 2A9RA 2OBBA 3PVZA 4BAZA 4JJFA 4M1SA 3KOWA 1EBBA 4C7JA 2VH1A 3GARA 3SDSA 2XEXA 4F3RA 3UMRA 1KO1A 4MWDA 4NPCA 1FRVA 1OLXB 1X7DA 2COEA 1ZZGA 2YFYA 2V7QA 4K9NA 3RUFA 4PHFA 2YVAA 3LIIA 4REMA 3QVTA 3K9FC 2CW5A 1BIFA 2C4NA 2G6BA 3LQ1A 3OFKA 3WI7A 5AW2A 2QLTA 5LZ4A 5BMVA 3U17A 2GJSA 3WK7A 5KYUB 1TJ3A 3EGDA 3MWEB 4RQUA 5DM60 3NKLA 3T9DA 5C4IA 1VIMA 2EP7A 3GBVA 2O3TA 4OLAA 3MJ4A 3FHOA 5G41A 3BFVA 3C74A 5DWDA 3RRMA 3T6KA 5KQSA 3SXJA 4BCDA 4QFMA 2HB6A 4XJSA 1SKUA 2V9PA 3CPEA 4CTMA 1VMDA 2ETVA 4N7BA 1XZDA 4J91A 4KHZA 3LC2O 2H2HA 1Z7GA 5AJYA 3MMNA 4NBLA 4YCSA 1D1SA 1UBJS 2CNNA 2BI8A 4PHHA 4WGFA 3ZZTA 3UMYA 1GT91 4JFAA 1BS2A 1KJWA 4IS2A 5ARCA 3UFXB 1V26A 4UM9B 4W7SA 3B2EA 1NMQA 2X2EA 1JSCA 3K4QA 4V0KA 5HZHA 3DMTC 5KWIA 3QF7A 2PRKA 3BJZA 3G68A 1A82A 4BB5A 3NUZA 2RCNA 1W1WA 3RREA 2FPGB 2K2QB 5A71A 1R0RE 4KN6A 2X6TA 3V4OA 1SPBS 5DKFA 3OX4A 3PFCA 4M36A 2C2OA 1N9KA 1M7BA 4DBZA 1E5XA 4ENWA 1U0BB 3AF1A 5A5FA 1JR3D 2VWPA 4DCSA 4UUOA 5B30A 1ZOPA 4XLLA 1M2GA 4IO0A 1Y3BE 4Y98A 2IV7A 4B9AA 4KDFA 3MXTA 3RKUA 4BVEA 3FOFC 1LPPA 1O94A 1RRCA 3REQB 3S81A 4F91B 4ZWNA 1D2RA 1W9HA 2OUIA 3P2OA 5DLDA 5DT9A 5HHTA 1XR3A 4NYJQ 2JJYA 4Y6OA 5EMMA 3SFZA 1AQIA 4PPGA 1I7NA 4D9HA 2D5LA 2ZJ1A 4UU7A 3LKZA 3K0FB 5KDLA 1M0EA 1ZYUA 2W6ZA 3GDOA 3LHFA 5BN3B 4P3XA 2PRYA 4HB2A 4HVCA 4MQ5A 3IALA 2G40A 2BGGA 2AJBA 2CLFB 1UQRA 3CWZA 3HVIA 3VPDA 1FNMA 1HT0A 2PTHA 3MGKA 4O4HA 4D0GA 4DS3A 5FB3A 3LM8A 3WOHA 3TNLA 3WKEA 2AMVA 2WD8A 2WTXA 3FPHA 3P2MA 2RGWA 3D6TB 4GP6A 1OCEA 2JG3A 3D1VA 4RABA 2X14A 1D2MA 2ADFA 2C4KA 3BIOA 1P7ZA 4QGAA 4UEOA 1B23P 1ZM9A 5DH9A 3VKHA 4YJ2B 1I5OA 2XMRA 1U98A 4QFCA 3LT4A 4CIVA 4O4IB 3H0KA 3NEAA 1ENOA 4CEJB 1L5HB 1EYZA 3LPLA 4EMBA 4ZZ1A 1LY1A 2HGZA 2RDMA 3GFQA 3VTAA 1DKRA 2HLNA 1QFJA 2A0UA 4OBEA 4PM4A 2F59A 2V1UA 2XGSA 5JS7A 4GOLD 4MW2A 3VBCA 4RJKA 2IEIA 2IWHA 1OVMA 3GDGA 5K8JB 1XTPA 4NAHA 3WHIA 4KNWA 3TB6A 1RCFA 1RLOA 1I9GA 5LZ5A 1BHO1 1O8CA 3CNLA 1DHRA 3CLSC 2O2DA 3UG7A 4AJOA 5BWMA 1SWVA 4F86A 4WOCA 5KOIA 2DUJA 1U65A 3OM1A 3PUWA 4R31A 1AGYA 3TLEA 1H2XA 4F06A 1NTOA 3LHDA 3GBPA 2WWYA 2BF4A 2WV9A 1T2AA 2V59A 2G4VA 2W71A 4HXFB 5B36A 1CUHA 2IEAA 2X4LA 4MLPA 1KTIA 3T7KA 1ORIA