4X8OA

Crystal structure of e. coli adenylate kinase y171w mutant in complex with inhibitor ap5a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8oA00
3I32A 3L0OA 3OHMA 2IYXA 2BJWA 4DRZA 3B78A 3E1SA 4AURA 1U0HC 1GNPA 1T91A 2B92A 1PVOA 5B58C 1C4OA 2JJ2D 1XX6A 3K0FB 5BXQC 3O8BA 2QUZA 4G5RA 4G1UC 3TBKA 2QAGC 3REGA 1W48A 2MMCA 4XOIA 3QE0A 1VYVA 1VPLA 1W4BA 4Q66C 3SQWA 4D6PA 2QI9C 3AVYA 4RZ3A 3PR1A 3K09A 4GP7A 5HPYB 5EUQB 4Q4AB 1E94E 4JIMA 1UKYA 4JL5A 5KYKA 4LUCA 2QPOA 5BW8A 4RFSB 4V0OA 1LFDB 1OE0A 2RAPA 2V6JA 3FHOA 3KKOA 4Z1MD 5JRJA 3CKLA 5J4YA 2JLXA 1BYUA 5HKKD 1S4QA 2TMKA 4AC9A 1GKIA 1JECA 5F9FA 1E0JA 2FGKA 4F38A 1II9A 3O8DA 1PZNA 2FPMA 2ZRNA 3CR7A 3CX8A 1RC8A 3V4FA 3SZRA 2UKDA 1JJVA 2WVJA 1NVWQ 1YRBA 4BFSA 3C4JA 3GLFE 3TGPA 3GP8A 2J0UB 1KSFX 5E7MA 4M0LA 3B1XA 1YQTA 1E2GA 3FMIA 2K5UA 2LKCA 1ZMXA 1TADA 3X1XA 2W6JA 4Q9KA 2FSHA 5LB4A 2BM1A 4TSFD 5F98A 1S0UA 1W0KD 4Q1FA 3RANA 2ZI9A 3GLHB 2MSDB 1N6NA 1TUIA 4YONB 4G01B 1YHNA 4ZDJA 4DSTA 1UJ2A 4MYHA 3RC3A 2QSZA 3AF1A 3QKSB 5JS7A 1E9RA 4BUJA 2F9LA 1LS1A 3LW8A 1J99A 4OHYA 4ZO4A 4BFVA 5JZVA 2AFHE 1KKMA 3ND9A 2NZ8A 1HTWA 3AUXA 4HSEA 2CXXA 3F5FA 4IEIA 4NMMA 4GP6A 2C5LA 4OK5A 2OG2A 4FMCF 3RNLA 1XFAA 2RGAA 2GETA 4M21A 2A5YB 1NLZA 3N5CA 1UADA 3LX8A 3ZYCA 1QVAA 1N25A 3AGQA 4PSAA 4IKEA 5BWMA 1OXSC 3P4YA 3KDSE 2F43A 3CM0A 4CEJB 2FFHA 2BM0A 3EZ2A 4NE2A 2ZUCA 4NYMQ 4A15A 4LC0A 4B6FA 1YVDA 3NC1C 4BWYA 1MO5A 4KYIB 5TY0A 2ZREA 3AKYA 3VKGA 1UFQA 1VHLA 2OSBA 2BWJA 2MSCB 4QG7A 4ERNA 3AB3A 1R0YA 4MH0R 1E2FA 4W5WA 1XD2A 2WKQA 2QPTA 2JAQA 2PT5A 4TYNA 2ODBA 5LD2C 1P9NA 1OH7A 1KSGA 2JIZD 1KNXA 4B71A 3ADCA 1ZM4A 1BO6A 3MWJA 2O5VA 3BC1A 2KJQA 3HYTA 4OYHA 3VAAA 3K70C 4E22A 2NPIA 3DOEA 4OJKA 1R5BA 1KDRA 5L8VA 2FX3A 1KMHA 1L8QA 4ESVA 3EWSA 4WZAE 3C15C 3DMNA 1RJ9A 4E07A 2ZVQX 3IIKA 4KFUA 4HUTA 2ZJAA 4Y0VA 5J40A 2AD1A 3RWMB 2ZUBA 2D4HA 4B35A 2GJSA 2ZI3A 1A82A 4TL6A 1E79D 3PEUA 1NF3A 1A5TA 4JBYA 3I92A 1M74A 1NY6A 3MWKA 5FOTA 3U4QA 3HU2A 5DI9A 2HUPA 1W4CA 4KLZA 4BRWA 2QGZA 3W5JA 2F55A 3Q85A 5FFMA 4EJSC 1G7SA 3R7WA 4TZ0A 1Z6GA 3KQKA 2N46A 4OJQA 3DEFA 1V43A 1T3HA 1KI4A 1ZNYA 1JXOA 4D4MA 5HCIA 2CEAA 4UNRA 4HAWA 4BFUA 2ZRDA 1E32A 4X8LA 4BLOA 2A5DA 2BMFA 1U98A 3FYHA 3BAFA 1CR2A 2F43B 3JZMA 4JLOA 2XB4A 3DO6A 3BK7A 3CIOA 3TVTA 4WVFA 2J45A 5JWHA 3NTUA 4PC3A 2E1RA 1TX4B 1DADA 2ZSDA 3OFNA 2Q3HA 1XPRA 3AF0A 2REBA 2HV8A 3QPUA 5TARA 4UXHA 4JT2A 1NJGA 3U3MA 4AWXA 1QZXA 2GKSA 5SZKB 1TF2A 2BV3A 1YU9A 2PLRA 1UM8A 2VRWA 3THYA 3FDIA 2WZQA 1IXZA 4LV5B 3BFVA 4II7A 3NDPA 1W5TA 3EIHA 3GJ6A 4XJXA 1U0JA 3NEJA 4GNKA 2A3RA 2VA8A 1JB1A 2G0TA 1ZU5A 4KODA 1R0XA 4FW9A 2XXAA 1L7VC 2ZPTX 4C0SA 1EX7A 2E9SA 2NIPA 3VNVA 2ZJBA 3KFVA 4GOJA 4IOMA 4KV9A 2XZOA 5ANRB 2IYSA 5KHOC 2XJ4A 2ZRMA 3IEUA 3AVWA 4BRUA 3T35A 2O52A 2FOLA 1QF9A 5IK2D 1RYHA 1W0JD 3TK1A 1QHSA 2J41A 4B3FX 4IHQA 1R4AA 4EIWA 4DLVA 3P1JA 2B6HA 2V9PA 1JR3E 4IDOA 4GDFA 3DMDA 3NG1A 2X77A 2IHBA 4PPQA 4IEEA 2HLDA 3EC1A 1YZTA 3LXRA 2Q9CA 5JS8A 4Q1AA 4US2R 3U6KA 6Q21A 4R2HA 5CYOA 1GG2A 1FX0A 3QEJA 4NH0A 3KUDA 4WAUA 4AI6A 2ZYVX 3ZVMA 2D06A 2GAAA 2YWFA 1JAIA 3EIQA 1G64A 1Z0FA 1NVVR 1IN5A 1JEEA 4GPTA 4ABYA 3CPJB 4AK9A 3TAUA 4MDFA 4N1AA 2F7SA 1U9IA 1I4LD 4N3NA 3ICEA 1KOFA 4ARZB 3PG5A 4LCBA 4YMSA 3GLFA 1VECA 4Q7LA 2BBTA 4IFBA 4N0DA 3KKQA 1OV4A 2NG1A 1JNYA 2B21A 3PUVA 1NL3A 3L8ZA 4Z8XA 1T3SA 2Q6TA 1G17A 1ZC3A 3ASYA 3THWA 1P9RA 5DHFA 3KX2A 4HZUA 4JYCA 1UDWA 1QHIA 1GRRA 2X1VA 2CE7A 2GILA 4D26A 4BLRA 4HAVA 4LPSA 5JJKA 1T0HB 2CE2X 1GZSA 5FR1A 2XXAB 721PA 5J4KA 3KKMA 1BKDR 1KSJA 3SYNA 4DUGD 1KDOA 4FMCB 4G5GA 3C5CA 1KO7A 2J46A 5HE8A 1C1YA 2IUTA 4P4UA 2OFOA 2GK7A 4XTCS 1G8PA 2IT1A 3GLIE 1E9EA 1SXJE 4B3GA 2WOJA 2R6GA 3PITA 4EFNA 1LNZA 1BMFD 2F3TA 3BXZA 2V7QA 1C9KA 1E9BA 2I1QA 1PJRA 4MGIR 4PXAA 2GAOA 2GK6A 2QP3A 1D9ZA 1P2SA 4GOKA 5DO9A 2WJYA 3RS3A 4ZDKA 1AKEA 4ZIRA 2IL1A 1E96A 1N6LA 1NVUQ 2F1IA 4C2TA 2EWVA 2GCPA 3AVTA 1P2TA 2C78A 3U6BA 5DE3A 2BBOA 1G19A 3VFDA 3OE7D 1LVGA 2DR3A 2PX0A 4Q1DA 4TQUS 2OAQ1 4RVCA 2H1LA 1E2IA 1E69A 1TF5A 3GQBA 2OFWA 1U0LA 2UZIR 2P67A 1E9FA 1AS3A 5B57C 4QJ5A 5E7IA 1TU4A 3GJ3A 4TYYA 1E2MA 2CNWA 3QOFA 3GLFB 2CLSA 2QY9A 1NSTA 2F3RA 5BN4A 4QKQA 2AL7A 2IYRA 3PUYA 1ZAKA 4BLTA 3QEOA 1T6NA 1SVIA 1FTNA 2HXYA 3RWOA 2QM7A 5DNYB 2GNOA 4D81A 1GKUB 1OYWA 3LBNA 2O8DB 3IGFA 3SOPA 5J4HA 4F91B 2W0MA 2YNMA 3W5IA 4OK3A 3VHLB 2G1JA 1ZNXA 3MCAA 4YDSA 5E95A 1E9SA 1VDZA 2GEUA 3LA6A 2CHVA 3GEEA 4LHVA 3KJGA 1DPFA 3KFXA 5FI1B 2HF8A 3SHWA 5K8UA 2ZRBA 4M1TA 2WKRA 4KSBA 4OQFA 1LTQA 1NI3A 2YWGA 4ITRC 1OT3A 5AWFC 5IDVA 4XVUA 4R2IA 1Y63A 2GBLA 2WTUA 1U94A 5HZHA 2NGRA 4LBVA 4JSTA 4CRWB 5C1BA 3KQNA 4HI0E 1E3MA 2ZJ8A 3SHFA 3U3RA 4ZIRB 2YYZA 1NVXQ 1Z8FA 1X8JA 1N0UA 4JLDA 4JKYA 4ZCLA 4PC7A 2ZI7A 2R6DA 2GRJA 5CM9C 1XTKA 3G82C 1TU3A 3U3KA 3B85A 5KNCA 2IUUA 5CDFA 3FMFA 4QHSA 3PVSA 4HB2A 3UANA 2P6NA 2OAP1 3GCGA 4C7OA 1KJZA 4JBXA 821PA 1OH6A 3LW7A 3K0CC 3ZVNA 1GTVA 2XZLA 4D4JA 1E9DA 3UWKA 2JATA 4FCVA 4PHGA 1S96A 2YOHA 2GF9A 4I1UA 4JJKA 1U8YA 3B5JA 2RB4A 1OXUA 4A6PA 4LJ6A 3EZ7A 5AJWA 1R7RA 3D7MA 5DHAA 1Q12A 4IDNA 1LF0A 4HLDA 2AWNA 2ZU0C 4PZLA 4PHTA 4A36A 5KUTA 4KVGA 1Q44A 1CF4A 4RD2A 1V5WA 4LDJA 5K8TA 1XEWY 5B2ZA 1OYYA 4P4SA 4L8GA 1XF9A 5CLLA 1JR3A 1OKKD 4YXWA 1UAAA 2ZROA 3LY5A 4GRAA 3IEVA 1HV8A 3PCRB 3TW4A 1DARA 4KCGA 2HCBA 3A1UA 4A0GA 1CLUA 2V8OA 4TL9A 2J0QA 1D2MA 2C9OA 3IBYA 3QKTA 3TW8B 2ZI5A 4LI0A 4B47A 4K46A 3RVBA 2RHMA 3M1IA 4BZPA 3CF6R 3LLUA 4JJZA 4PO9A 1WB9A 3MSXA 2A9KA 1OB5A 5FUXA 3KQUA 3HDTA 4XSGA 2OBMA 3UK6A 4CIDA 4HDQB 1N5JA 4O25A 5EE0A 1Z0AA 4LHWA 4WXPA 3TSWA 2QT0A 2C8VA 2CL0X 2FJUA 4PO1A 3FTQA 1S3SA 2LKDA 4Q4LA 5FBVB 1RZ3A 2ZI4A 5EP2A 3AUYA 1Z29A 5AJVB 1XJQA 5E3HA 3K0SA 2FH5B 3ZS8A 1JALA 3W90A 4AKIA 5JWRA 3B1WA 3ZLJA 4ZPXA 3R9XA 2GEVA 2PZFA 2ANCA 3Q9LA 3OEED 3L2OB 4JS0A 4OI4A 2VHQA 2WJGA 3B8HA 3ZD7A 2BMEA 1E6CA 1Z5ZA 2YWHA 1ZM7A 4YMWA 1M8PA 2KE5A 4M4SA 1X8LA 4M1KA 2GVDC 3RYTC 1GITA 1GKYA 4TLCA 1G8GA 2NO9A 4A2QA 4DB2A 3FPAA 3NC0C 1BS1A 3RS4A 1ZD8A 3CRRA 3EPLA 3SJCA 3VX3A 3RS2A 2ZS8A 2WMOB 1HEIA 1TMKA 3W3ZB 1SXJA 3D31A 5KNBA 4JZKA 4I1VA 2VL7A 4YMVA 2UZ3A 4PX9A 1FMJA 5JWOA 3KKNA 5KSZA 4CEHB 4L9WA 2ZM5A 4TMXA 3WNDA 4ZKDA 3A4LA 4P4SB 5C18A 3UPUA 3WXMA 2CL7X 4JVNA 3L82B 3U44B 2FZLA 2OCPA 3U7FB 4XWKA 1J7KA 1P2UA 1P4SA 1P72A 5HE9A 2IXFA 2VP5A 1AQUA 4OQLA 1D5CA 2BKEA 3E2IA 1YKSA 2F9MA 2O8BB 3N70A 1G8YA 2NO7A 4QJ4A 5TB5A 2ODWA 3W34A 5BYJA 2WAXA 1R6BX 1ZM9A 5H70A 4D25A 1Q21A 3CR8A 1IHUA 4MQBA 2ATXA 1A1VA 1VIYA 1NY5A 4K81B 2A7QA 2GDJA 3PUWA 2VP0A 4KYUA 5FUVA 1HQCA 4EQ6A 1YE8A 1R8QA 2V1XA 3OF5A 3WMGA 5GADl 1T3LA 2Y8EA 1AZSC 1AK2A 3ZDQA 1Z83A 2QTFA 3WRYC 5J47A 5JMTA 4RD4A 2GESA 3IILA 3QF4A 1NVVQ 1Z07A 4RD3A 1QHGA 2ORWA 4DVGA 3RHFA 2J7PA 1GL7A 2P5TB 5AK0A 3IDQA 4V0ME 1P2VA 3FMOB 2BCJQ 2PH1A 3K9NA 2G83A 1K8RA 4KHZA 1IN6A 1HA3A 2O8CB 3QNUA 3RS7A 3OAAA 1TF7A 2V54A 4FN5A 221PA 2QT1A 1ELOA 3K9GA 3MMPA 3QY0A 4HLCA 1E1RA 3A1SA 4Q4HA 5DYGA 5JJLA 4URXR 3PV0A 3GLIB 2ZR9A 1SXJB 4IOLA 5CK4A 2QAJA 4B3CA 2CVFA 3C5HA 3RSOA 4G5OA 4AYWA 1VCOA 4CEIA 4Q4JB 3GFPA 3PIRA 2YWEA 2OCYC 4POAA 1J8YF 3TUIC 1RRFA 2ZS9A 4Q7MB 4DB4A 2ZYTX 1SKQA 4UXJA 3MLEA 1KO8A 1G3UA 2OLKA 5AJXA 3BD9A 1EFUA 5P21A 2QL6A 4FI3C 1Z28A 3DZDA 1D9XA 4JLJA 4L5BA 4P32A 1XEXA 2ZJ2A 1H8EA 2D62A 2XEXA 4M8NE 2L0XA 1UKZA 5DN6D 4D4KA 3IHLA 1T8UA 4YC7A 3UWOA 3ADKA 1CEEA 4DDTA 4KSCA 3NHAA 4EQ6B 3CRQA 3VNUA 1PUJA 3A36A 4A9AA 1YJ5A 3TH5A 4YMTA 4LV8B 4IOKA 2FDCA 2FZ4A 1I4TD 1KI6B 2H57A 4V0KA 4QM7A 3IQWA 3N2IA 4NHOA 3LRPA 3B2EA 5HCNA 1W1WA 2C99A 5IT5A 2GVZC 1MH1A 1F2UB 4HAUA 5JI2E 1P61B 1E2HA 2OBLA 5FUYA 3RC8A 1W36D 3I3SR 3JZAA 1CR1A 2JLVA 3RRZA 1XMJA 1XB2A 3X2SA 2AKYA 4TMVA 4ASUD 3U60B 1NBME 2EQBA 4PC2A 1S3GA 4Q4HB 3EA5A 4UNQA 4DT1A 2P3SA 1E1QD 2OE2A 3UG7A 2CBZA 4PSVA 1NN0A 2YJTD 3K9HA 3EZ6A 4CEIB 1L4YA 1YR9A 2WPDA 4RCZA 1P5ZB 1DG1G 1II0A 5J4LA 1RVDA 3WHLA 1CJKC 2KBEA 4P0TA 4YMUA 1E2QA 4QGHA 3TRFA 2WWXA 2DHRA 4L9SA 1KI8A 2D3WA 4M53A 4TSFA 1W0KA 1G3RA 4GFDA 4JVLA 1U8ZA 4U7DA 1KZ7B 1D6JA 4UXIA 1XEXB 2I3BA 3UG6A 2W2XA 4GMDA 4US1R 3L0SA 2HF9A 1W36B 2GA8A 4MA4A 1WP9A 2BMDA 2JEOA 5EE9A 3U5ZB 4NCJA 1D8TA 5FPHA 1XDBA 1T0JB 2DWOA 5FPYA 2QMOA 4HLUA 1WE2A 2QBYA 4Q18A 5EE1A 1G21E 2IYLD 2CHGA 4JLPA 3ZQ6A 4C0LA 3I8XA 3MG9A 4BASA 3DHWC 4LC1A 5DGXA 5G3YA 1YRAA 3LVRE 1N6OA 2F1JA 2WJJA 8OHMA 2DWPA 1IJEA 2VP4A 3FWYA 2RMKA 3A4MA 1CJTC 4TMKA 2PCJA 1JR6A 1F2TA 2C9YA 3K0EA 1RFLA 1QHNA 3FE2A 2ZRPA 1R2QA 2FSIA 4JMPA 1R8SA 1XZQA 1NJFA 2UVQA 1I2DA 3E5HA 3IIMA 5E7JA 5EXTA 3T1QA 1Y3AA 4A1FA 4DZZA 3DVLA 5G40A 1GFIA 4LHYA 1KY2A 4M9QA 1VG9B 1OSNA 1NRJB 3M4YA 2XTNA 4DCTA 3ZD6A 1HH4A 2PZGA 1AA9A 3NEYA 4ZDWA 3I5YA 3D8BA 3QQ5A 1EX6A 4LYJA 4IVPA 2CLCX 2CDNA 4QOSA 2JIZA 3VR3A 5JRZA 4BEBA 3T5DA 4HDCA 1SULA 1YZNA 4I1OA 5BN3A 1QHYA 2WJVA 2FPLA 2BBSA 4XSHA 4RY2A 1XPOA 1NLYA 2JLQA 4U02A 4TT3D 2XSZD 2N42A 2IYZA 3C16C 3P4XA 4E5UA 2VIIA 3WP0A 2ZEJA 4ZCMA 1OB2A 5FOUA 3TKLA 1DELA 4QBGB 2WOOA 3HWSA 2QENA 3VR4A 1ANKA 2ATVA 2IEZA 3AF4A 2G9NA 4BE7B 1E4YA 4JLBA 4OQMA 2QP4A 1Z06A 2NO6A 3WMEA 3I72A 2GCNA 4JLVA 2BEJA 2PZEA 3SE0A 2ZI6A 4V0MA 3BRWD 4RSGA 5G41A 3IPXA 1OHHA 3MWYW 3DM9B 5C4GB 4EPTA 2FFAA 2QBYB 1DO2A 1Z6XA 1QVRA 2R65A 5K8IA 1MKYA 2EVWX 2QE7A 2DFNA 1CRPA 3QG1A 2AWOA 3QXCA 4GI7A 2HDNB 4Q1EA 4F7WA 1ZVQA 4DLRA 1O3YA 1B0UA 3FHCB 2ZR0A 3QXJA 1OFIA 2DB3A 3KZ1E 3VU9A 1PUIA 1ZUIA 3W8RA 4NONA 3LAWA 1DTSA 1XMVA 3H86A 3MJHA 3A1VA 1Q1QA 2BIFA 3SJAA 4F4IA 2VP6A 2FFQA 2JASA 5L3QA 2X2EA 3RRYA 5K8LA 2PT7A 1XTRA 1ZM2A 2G0NA 5CB6A 2ZSBA 1GNRA 4TLBA 2OM2A 2ZRFA 2ZTSA 4LYHA 4Z51A 4L15A 4OQXA 3PUXA 1OFHA 1XD2B 5CDFE 3KJIA 1GIAA 4FCWA 5IF9A 2A5FA 3IUYA 3L0PA 1VMAA 3WP1B 4A8JA 1KZGB 4FINA 1YZGA 3QUSA 4KBFA 2QGNA 3BBPA 4EFMA 4FWTA 2QORA 2QNRA 2RGDA 4RKEA 2AD5A 1YZKA 4OI2A 3J81k 2DWQA 4QGFA 4DSNA 1F3OA 1KMHB 1SKYE 2OXCA 4Q5IA 1SZPA 5CYPA 3VTKA 1RJ9B 1F5NA 3CUEF 1DBSA 3NIBA 4UJ5A 2A5JA 2ONKA 2HJGA 2ZU6A 3OFND 1KK3A 2ZSEA 1NNEA 1MR3F 1D2NA 1XWIA 3CNOA 1UBFA 4MDEA 4DHEA 2AR7A 2QA5A 2Z6VA 2QN6A 3BWDD 1AZTA 3IQXA 1NN1A 3U4QB 4EPYA 1IAQA 1U99A 2FWRA 3T1VA 5EP1A 4Q7JB 3R7WB 1NBMA 1H8HA 3HR7A 3Q72A 1X1SA 4B48A 3NH9A 3TLXA 2QU8A 3VU9B 4BQSA 2P0EA 3FKSA 1FQKA 1OIXA 2REOA 5A5GA 4URWR 1AS2A 5G53C 3SS8A 3QBVA 1NP6A 4RZ2A 5KPJA 4GSYA 4OL0A 2FA9A 1EG7A 4GOXA 3SQXA 2OCAA 3BB1A 4A82A 3R20A 3EW9A 4Y0AA 4B33A 4MYCA 3TAHA 3AVVA 3BFXA 4A4DA 2FV8A 4LHZA 4DLWA 3SFZA 1EFRA 2ZRKA 1XMIA 5FPKA 5CJ2A 1UF9A 2HCJB 5FTJA 1G8FA 3CX6A 2IS1A 1WRBA 1DAFA 3B9QA 4AYTA 4IW3B 2HLDD 1G291 1Q0UA 2C03A 2VBCA 5JEDA 3THYB 3NDBB 4QBFA 1IY0A 2DFKB 2NO0A 2Z0MA 4Q7KA 2H92A 3T34A 2AFIE 4LK2A 4XWAA 2ZJ5A 2R44A 2ZYUX 2JDID 2JCSA 3QIAA 4OHXA 3GJ8A 4I1SA 1VYUA 3KJHA 2EYUA 1FOEB 1F6BA 1M2OB 3IIJA 4ACBA 3W6NA 1UBCA 1XZPA 1PLKA 1VG1A 3THXA 1E0KA 4BLSA 1BMFA 4TLDA 1S2MA 1XJ0A 1WCV1 1DAIA 4L16A 1IOZA 3TR0A 2J0SA 3B1VA 1TQ4A 1BIFA 3KJEA 2QAGA 1E2NA 1YR7A 2HT1A 1UBGA 3B6EA 3QBTA 3ADBA 2PCLA 1KJYA 1G5TA 4M1OA 2FN4A 2RGNC 3CBQA 2WICA 4OHWA 3LQQA 1G7CA 3BB3A 5CK5A 4E09A 2Z4SA 1XP8A 4M9SA 1IN4A 2J1LA 621PA 1IN7A 1FX0B 2D74A 2VP9A 2W00A 4A2WA 3SBEA 1RE0A 3BH6A 4BFYA 1P7CA 3PENA 3G5UA 3GPLA 4LJAA 1BYIA 1KK0A 4LJ7A 1YZQA 3OESA 4TTRA 3QVVA 3EZFA 4GZMA 4ZKEA 3IHWA 3HYRA 3JVUA 4URYR 2V7QD 2HEIA 5EP3A 2B7BA 4RFVA 4XD7A 4IRUB 4R7ZA 4P3YA 2ODNA 2V3CC 4LBZA 4A6XA 1XCGB 4JLNA 3THWB 1JAHA 1K5DA 3CPHA 5TVKA 5EE3A 4QRHA 4JYBA 4JT4A 4HZUB 1N2CE 3IKJA 1GL9B 4C9BA 2YKGA 1W36C 2FSGA 3S1AA 5L3VA 2BKUA 3WY9A 2W83A 2BOVA 2GJAA 3NBFA 1OW3B 4OK6A 3TE6A 5AUOB 2IXGA 4QM6A 1WBBA 1II8A 5FOVA 4IOJA 1KYIA 1TQ6A 5FL7D 2IWHA 1CULC 1X3SA 2I1VB 1IY1A 2VTKA 2CNWD 3A8TA 3FFBA 4FXPA 1FNNA 5CJPA 1L2TA 3ZVLA 3X1DA 2FF7A 3NVAA 3QKUA 3LXXA 2ZRHA 1IN8A 1Z2AA 5F9HA 1WQ1R 4NYJR 4QNRA 3FVQA 3UKDA 3D3QA 1ZCAA 4X8OA 5L3SA 4C0JA 2HXSA 5B30A 1CJMA 2EYQA 1F48A 3K53A 1MT0A 2ERYA 1KGDA 3LBIA 4DC9A 3QSYA 3PEYA 2WWHA 1E9CA 4IDHA 1IXRC 4B76A 3K09C 4NP6A 2P5SA 4MGYR 4Q00A 4X8MA 1IBRA 3RS0A 4W5JA 3SNHA 1ZCBA 1ZD9A 3DDCA 4ZV4A 5KSOA 1G4AE 4C3ZA 1HT1E 2C96A 2BJVA 3ZIAA 3F0TA 1MOZA 1Z47A 5H68A 4MKIA 1XTJA 3U2QA 5EQTA 2Q3MA 4KITB 5H1YA 3WBJA 2D7DA 4ACAA 1S9DA 2OCBA 2P65A 4HDOB 1XEWX 2DYKA 4B43A 4AKGA 4OKSA 4DKXA 1CR0A 2GZAA 2QTHA 3L0IB 4Q9HA 4M1MA 2VYFA 4PAMA 3HJNA 4HB3A 1NG9A 1S1MA 4M1SA 3QKRA 2A78A 1ZUHA 2QRNA 5EZ5A 2OHFA 1E0SA 5H8WA 4BECA 4DJTA 1R10A 2CJWA 5JECA 2GF0A 1G1MA 3OIWA 1DVRA 4LBYA 1UPTA 2YINC 4IXNA 3WYGA 1II8B 3EXAA 3GEIA 5AUQA 1DAHA 5FBQB 1X8KA 1ZINA 4DWJA 4WOPA 421PA 4B6EA 4KU4A 5LPNA 4A0RA 4EJSA 2PMKA 3ICQB 1IONA 1UEJA 4YQFA 4IFEA 4AY2A 1VG8A 2WIBA 3DPUA 4CT4B 1DS6A 1N0VC 2CCGA 2C04A 2OZEA 4O2LA 3WYAA 4GL2A 2F6RA 1FNMA 1MRSA 1FFHA 3W3AA 3VMFA 1TPZA 5DISB 5KDLA 1WA5A 1GM5A 1CKEA 1RRPA 4RD1A 2R6CA 2OFXA 2XNDA 4KXFB 3PEVA 1NIJA 1SVOA 3U7EB 3P26A 1E2LA 4JLKA 4PSKA 2J87A 4QNMA 1QDEA 3CO5A 4ON9A 4TMWA 4C0BA 3I62A 2D7CA 121PA 2ORVA 1QHXA 2ZAMA 4LHXA 1MO3A 4RCYA 1KHTA 2ZE7A 2ZRCA 4Q1CA 4QL3A 3CRMA 1KTVA 3EA0A 3THOA 4B74A 2GWHA 1A2KC 1KK2A 2XITA 5FL3A 3A37A 4C7OB 5GVRA 4HAZA 3AF3A 3L43A 1XD9A 4DLZA 3CNNA 3I1FA 3H4MA 5FI0B 2VSOA 2Q9BA 2REXB 2VP2A 1Q20A 2IEYA 3K70B 1SKYB 1W2HA 3CWQA 1GL6A 1B23P 2ZRIA 3HU1A 4MUBA 1Z6AA 2WSSA 4NCHA 5JI3E 1UDXA 4MYTA 1HE1C 1ZM3A 5F2EA 3FKQA 3EWAA 2QTVB 4PC6A 2CJWB 1Q1ZA 2ZS7A 2D2FA 4HLQB 3HPQA 4EDHA 4P33A 1KAOA 4PPFA 1TQDA 3TQCA 2W6IA 1FTSA 1T8TA 3G0HA 2FEOA 2Q3FA 3EC2A 1N6IA 2JLRA 4TLEA 3ZZTA 2FE4A 2QPAA 3IO5A 4EJSB 2XOKD 2QM8A 4HB4A 2VHJA 1FW6A 4MRRA 3HU3A 4ZCIA 2IF2A 4DIEA 4ESHA 1CTQA 1G41A 2QQ0A 2WWIA 4EAQA 3KL4A 4PQFA 3KQLA 1KO4A 1OJLA 2Q0HA 4WZBE 4JLMA 3WNCA 3V00A 4BLPA 2R6FA 4B2LA 1COWD 2IBMA 2R2AA 1SXJD 3QVUA 1KMQA 5KSPA 5TMPA 4PAOA 3OEHA 2IS2A 3EASA 2QSYA 2WBLC 3T61A 1IM2A 4ZDIA 2QRZA 2IYVA 2R6AA 1EESA 4DBLC 4M1WA 4QXAA 3ECCA 1DO0A 1KNQA 1KI2A 5DI3A 3T15A 4G0NA 4WA7A 1VCIA 5C4MA 1U90A 2BEKA 2FMXA 3B9PA 3FMPB 4AYXA 1WMSA 2PL3A 2W2VA 2Z43A 2O8EA 3KQHA 3CWZA 1YR8A 1AGRA 4S35A 4JBWA 4UNNA 1KI1A 2GJ9A 2G77B 4RZUA 1W7AA 3NKVA 1VHTA 1JPNA 1T4GA 3GJ4A 1XCMA 1TUEA 3MGCA 4GZLA 4XWOA 3HPRA 3E70C 5FPTA 4CVNA 3VKHA 2ANBA 1G4UR 2CK3A 4TQ9A 2MSEB 2IF0A 1KI3A 4XIGS 4B3BA 1SVMA 1XEFA 3QXSA 2NOAA 2AKAB 2VF7A 3NBZC 3V4RA 4TL8A 1N6KA 2P6RA 3ZZUA 5JCZA 3DM5A 1OH5A 4O0MA 2LCFA 2PEYA 1VG0B 3T1TA 1E2DA 1OFTA 2GHIA 5AR1A 5FR2A 3LX5A 1CJVC 4TMZA 2H8KA 4NDZA 3PXGA 2OLJA 4Q4AA 2WIAA 4BZQA 4DLXA 4MGKR 1LW7A 2VLIA 3SBDA 2OXRA 3FOZA 2C98A 4QC2A 2OILA 4YDHB 1LV7A 4RKFA 1L4UA 3AEZA 5DH9A 3PJRA 3X1WA 4V03A 1PLJA 2HT6A 5AJYA 1U9IC 1Q3TA 2E87A 3U61B 2ERXA 4KLNA 4P4TA 1ONBA 2NZJA 1X86B 2J59A 3SYKA 2GCOA 2J0UA 4TTQA 1G20E 1K5GA 1JQLB 4FIDA 1EWQA 2XZPA 3GFTA 2WV9A 4LOAA 3QF4B 5D3MA 1YZUA 4PZZA 3TUJC 4YLGA 2JJ2A 2RGGA 2WWGA 3BOSA 3AKDA 3Q3JB 4KFRA 4Q9JA 3MRSA 4BPBA 3UMRA 1XTIA 3LD9A 3ZH9B 1ZYUA 2BDTA 2H7VA 2WJHA 5J4VA 2C95A 1H8ED 3B1YA 4BLQA 1EGAA 3CRW1 2YOFA 2ZSFA 4M9XA 1LY1A 2JJ1D 4Z8YA 4F4CA 1OH8A 5IHPA 5FBLB 1E9AA 1AGPA 1G5PA 3SI7A 4Z1MA 1Z0DA 1ZC4A 3BFKA 1E1QA 1EFTA 4LGMA 2GXSA 4MUAA 4TYPA 1IXSB 1MABA 5HKKA 3GEHA 1KY3A 3PUZA 3FHTA 1NKTA 3BORA 3FGNA 4Q19A 4DSOA 2KSQA 1RIFA 4DSUA 1F60A 2BVNA 4G5SA 1SVSA 4ZI3A 4AD8A 1Z0KA 4AG6A 2RKOA 4QFMA 2YC4C 2RGCA 4B75A 2OT3B 5GJCA 5JSZA 2KWIA 1KKLA 1ZD1A 2J3EA 4GBMA 3R8CA 4CEJA 4C0QC 3WMFA 2WWYA 1N6RA 2B8WA 1J70A 3QG5A 3I8SA 4H1UA 5D3QA 4NYJQ 3CZPA 1ODFA 3FFAA 3B1ZA 4QBHA 2YHSA 4LPKA 2YC2C 3C8UA 1M7GA 3BIFA 2ONJA 1OFUX 2ZQ5A 3D6TB 2O8FA 2V55B 3PFIA 4P31A 2IX3A 3VKWA 3K0CA 4URZR 2MMGA 1R5OA 1W5SA 2YVUA 2DFTA 2FGJA 2WAYA 2GEDA 1W4AA 2WPDD 2GZHA 1CU1A 1TQ2A 2GCOB 1DAEA 2GZDA 4DLUA 4NCIA 4NL4H 4Q02A 4US0R 521PA 4AIIA 4KJZA 1NLFA 4OBEA 3AP3A 2IYQA 2QP9X 4IDPA 2BHRA 5D3MB 3T06B 2IS4A 5TDHA 4UKDA 3CF0A 5BN5A 1ZW6A 3K8YA 3LWNA 1N0WA 3O47A 2ZSAA 1U2RA 3Q7PA 2W6JD 4QGAA 2NTYC 3DKPA 2JGNA 4KBGA 1ESMA 4I81A 4LRWA 1JQJC 2NQ2C 4PR0A 2V4ZA 4DDWA 2AX4A 2EFDB 2X2FA 3A4NA 3WHKA 3BH7A 3NBYC 4D0GA 3AVXA 1CRQA 1MABB 1ZNWA 4DT1B 5FTKA 1GAJA 4BFXA 1G3MA 2A2ZA 1S8FA 3BJIC 4OHZA 4TT3A 1G8HA 2GBLC 2XSZA 4B3XA 4C0AC 1MO4A 1SVKA 4KVAA 3UMSA 3C14C 4NYIR 4KAXA 4W9MC 5DLQC 2WHXA 3UXMA 2WWWA 1MRNA 5DYIA 5JSZB 3RSLA 1VYTA 2F1RA 5EXSA 4M2LA 1FL9A 4NZYA 2R8RA 1TTTA 3CONA 4PPNA 5KO2A 1NN3A 4EPXA 1KDPA 1IQPA 3SJZA 1JJ7A 4OI1A 1HT2E 1E79A 4JVMA 5JJIA 2O8FB 4UNPA 3DZ8A 1NMXA 5EXPA 5EUMA 1BH2A 2ZYWX 3GJXC 1M7HA 1EFHA 1BOFA 1ZNZA 4UJ3A 4A2PA 4DLYA 1XTQA 2ODEA 1FP7A 2PMDA 2VHCA 3R8FA 3SJBA 4QGGA 4JVSB 5FTLA 1F2TB 1ZBDA 1KJWA 2BMJA 4EFLA 4QJ3A 3OIYA 3HR8A 2LWIA 2CVHA 3QI2A 3OIVA 5L3RA 3R9WA 1LS6A 5EJEA 4TQAA 4TYQA 4RD6A 4XTRA 3AKEA 2FPKA 3CW2A 1J90A 4UQOA 2CCJA 1XD8A 2O0HA 1OHHD 3LQRA 5CITA 1X1RA 4C4PA 3QPVA 2IXEA 4CZ2A 4LSGA 3I5XA 4A92A 3EX7C 4C30A 2QE7D 4KFSA 4KO8A 1KI7A 3JVVA 4I4LA 4GMXA 1NG1A 2P6UA 2PEZA 4CDGA 3UMFA 1EK0A 1FZQA 3AVPA 1Z6TA 4LJ5A 5JHHB 1O87A 2OESA 3P32A 2JLYA 4D0LB 4WW0A 4RZXA 2KB0A 4MKFA 3REFA 1KIMA 2ZR7A 1ZJ6A 3EAQA 3NXSA 1VTKA 3RABA 2EU8A 3MD0A 2VF8A 1KO1A 3WNBA 1XBTA 1Z6YA 3QXHA 4ARZA 2CL6X 1G3IA 4ZI2A 4IJMA 4ILEA 3L8YA 2IW3A 5TXGA 4O3MA 4U00A 5SZIA 3TSZA 3T5GA 1KI9A 5SZJA 5IK2A 3I61A 1W0JA 3CB4A 2HYDA 3CX7A 3OIUA 4CT5A 4D82A 2J7KA 1A7JA 2QROA 1LF5A 3W9YA 1EWRA 4LYFA 3FB4A 3F8TA 3TMKA 1KDTA 3AVQA 4E03A 1P62B 1OXVA 2IK8A 4L4UA 2WSMA 3MWLA 3TR5A 3AP1A 2ZE8A 5F3WB 4KI0A 1ESNA 5EE5B 4DCVA 1RRCA 4DCUA 3QF7A 1PV4A 1XRJA 4G5QA 4QHYA 3M6AA 3ZZ0A 3MUFA 2J0VA 4DEYA 3BB4A 4OHVA 2ZJZA 2QEQA 3GD7A 5CLQA 2DY1A 3PEWA 3LNCA 3EPKA 2CMKA 2EWWA 3KXIA 1AM4D 1SXJC 2WJIA 4Q9IA 3LVQE 3M0EA 1D2EA 4MITA 4IDQA 4XVQA 5L3QB 3B13B 1S9HA 3CRVA 1NSFA 1MV5A 2YV5A 2DPXA 2A5GA 2H5EA 3B60A 1N5IA 2BC9A 1G6HA 5FBRB 4DDUA 1WF3A 2WM9B 2RCNA 2VSFA 3AM1A 3TVDA 3AH8A 5LB2A 2X8AA 1UKEA 1W49A 1Z2CA 4Q47A 1CIPA 2P2LA 4TYWA 1OIWA 5HZKA 4RJLA 2G6BA 3KUCA 1FUUA 1TEXA 4LZZA 4B34A 4A8JB 1ZIPA 1HUQA 1H8HD 1NBMD 2WWFA 3LO5A 2EW1A 2RHDA 2H16A 1XPUA 2ZRJA 2JDIA 4NCKA 5BQ5A 3A6PC 1P75A 3VR5A 4DUGA 4XH9B 1P3JA 1Q57A 3FKSD 3RS5A 4AG5A 1W4RA 1JBKA 2QG6A 2XAUA 3CH4B 5E4FA 1WBDA 3GLGE 1QG4A 4Q1BA 4DLSA 5CM8B 4OQNA 2N1BA 1G9XA 1HE8B 1HY3A 3ZJYA 2B8TA 1UBEA 1E2EA 3U7HB 1P6XA 1AKYA 4LJYA 5KPDA 2W0SA 3I73A 5SZHB 3DKVA 1YR6A 3NH6A 1EFRD 2AK3A 2AXPA 1CJUC 2RH5A 4S2EA 5JCPA 3H2YA 2QMEA 4NCNA 2KBFA 2J9RA 2FSFA 3K0AA 4FWIB 1I4DD 1GWNA 2ZJYA 1S1CA 2O8DA 1E4VA 1ZUNB 1HURA 4FCTA 2GXUA 2IYTA 4NTZA 2JJ8A 2AN9A 3GJ7A 3AGPA 3OE7A 2NO1A 5AJZA 3ZS9A 3VR1A 4MGZR 2XGJA 3AVUA 5HR5A 1ZU4A 3CH5A 4LJ9A 3BS4A 1QBKC 3ND8A 3QENA 1G3QA 2G88A 4PHHA 2DCUA 2H17A 1Z3IX 4TTPA 5AUNB 4QHTA 5IRCD 4B3DA 2PJZA 3EG5A 3RRMA 4TZ6A 1N6HA 2FU5C 3DOFA 1R0ZA 5KTYA 1LB1B 2ZE6A 2W58A 4IVQA 1G16A 3A58B 3W6OA 1ZRHA 3IO3A 1US8A 3U3OA 2Z83A 2R62A 1RW4A 1HQYE 2YZ2A 3AF2A 5UKDA 4LV6A 3H84A 1NN5A 1T5IA 1GSIA 1XXHE 2OO7A 4BFWA 4PC1A 3Q5DA 2NPFA 4CGZA 3U3JA 5BYKA 5J5CA 1GP2A 1W46A 4D80A 4M9ZA 4IXMA 3GFOA 5FL7A 1I2MA 3Q8XB 3OZXA 4C2UA 1XMSA 3TSOA 1NIPA 5JEEA 3R9IA 1FQJA 3BE4A 3KB1A 2JLWA 3AVOA 4JL6A 2PBRA 1W44A 3SU8A 1J8MF 5DIFA 3THXB 5KDDA 1DAKA 4X8HA 1IJFA 1VCMA 2JLUA 1M1YE 1KK1A 1Z22A 4LY6A 2IHYA 3AV0B 4XD7D 1DG3A 2F1HA 2V1UA 1CS4C 3K0AB 5CIQA 5M04A 4RD0A 2KI5A 3WBKA 4BGDA 4PHFA 4DLTA 1M7BA 1GILA 2QAGB 4FD2A 3ETLA 2V6IA 3LBHA 3ZGXA 1OLOA 3O8RA 1N3BA 3TJZA 4PFSA 1Q3HA 1Z08A 3IBGA 4MRNA 5KOYA 4UNSA 3PQCA 5LDDC 4MKHA 3ZVRA 4EKDA 1JPJA 3CZQA 4I99A 5JBQA 5G3ZA 1E2PA 4B32A 1KAGA 1GRNA 1SHKA 2ZRLA 1OXXK 4R9UC 4B2IA 4V02A 3UATA 4HYYA 3B82A 5FH9A 1J2JA 1DEKA 1GNQA 1G7TA 1QRAA 1GRQA 4DCSA 4F92B 1E0AA 1US8B 3WRXC 2VHUA 3SYLA 4HUQA 2Z5FA 1ZIOA 4Z54A 5KDOA 2I4IA 4V0NA 4AKEA 1GOTA 4CW7A 2IS6A 2GJ8A 1T5LA 4B2PA 5GJWC 4WBSA 4HB0A 4NYIQ 4D2IA 1K6MA 1XTSA 1RYFA 2IA5A 2WMNB 1JXMA 2XTZA 4M22A 3WYFA 1E2KA 1JI0A 4MRPA 3S1AB 1OIVA 5EZ6B 4LBWA 4WXRA 4WIAA 5C46F 5CIWA 4Q21A 3T1OA 1N5KA 1DAMA 1OKKA 2CHQA 1VCNA 3QJYA 2ZRAA 3GLHE 4O2RA 5KSYA 3TUZC 3AKCA 4AKHA 1Q1EA 4HLUC 3ZIAD 4EPVA 1UKVY 4CYMA 4H1VA 1SGWA 3W8NA 4FMDF 2VPPA 3NWJA 1NKSA 3SR0A 5FOSA 3K70D 4NYMR 3NHBA 2FEMA 3B7GA 4F93B 2EFHB 3MJRA 1XNJA 1DAGA 4JL8A 2SHKA 3IPYA 3X1YA 2WKPA 1UEIA 5A0FA 4N0EA 5L3SB 1Z63A 1IY2A 4PAQA 3KXLA 3MFYA 4PO8A 2XTMA 5A4JA 4HEJA 2C2HA 2ECKA 3EARA 5GVSA 1RPZA 1EFCA 4M1YA 4CEHA 3GMTA 3I4LA 2C9CA 2ZUDA 2RGXA 2ZETA 2VO1A 3GJ0A 4B44A 3H1TA 3U44A 3K1JA 3N2EA 1R5NA 3ADDA 3C41J 4MYUA 4PTLA 3ZQJA 1JR3D 4DXAA 2ZJOA 5FOWA 1N5LA 2H18A 3OEEA 4YXWD 4NKRA 1W2GA 3TIFA 4A0FA 2O8BA 5LD2B 4JLAA 1OPXA 2EFGA 1CP2A 2AXNA 3BH0A 2JLSA 4GT1A 1AJEA 3VQTA 4PPGA 2XNDD 2CLDX 5FTMA 4HUQB 3GLGA 1DOAA 5KU1A 5GJBA 2X19A 3EIEA 1T9HA 3SEAA 1OF1A 4WZ6A 3QKRB 3VR6A 4U5XA 3KKPA 2G3YA 3K9LA 4MKGA 3VR2A 4W7SA 4MRSA 4KFTA 4V0LA 2BBWA 4J0QA 1CBUA 1N6PA 2OEPA 4BZXA 2EFEB 1CXZA 5LBIA 2XOKA 3MAAC 2Q9AA 1WDTA 3SDZA 5ELXA 2EFCB 5C2JB 2FFBA 1KSHA 4TL7A 4G3XA 1FUKA 1G7RA 4IVRA 2QMHA 4C0HA 4DCNA 1HYQA 2W2TA 1U8AA 2OUKA 5HTKA 2O8CA 1A2BA 2IYUA 2GTPA 1KO5A 2FG5A 2GXAA 1RKBA 1XCPA 3VHXA 4QBIA 2WSSD 1QHHA 3HP1A 1COWA 1SQ5A 4LWZA 1X6VA 3GLIA 4D4LA 2OBNA 4K8OA 4CF7A 1GVNB 2ZVPX 2HYIC 1AQYA 3RRNA 2Q21A 4Q4JA 1AS0A 3P27A 4H9GA 4URUR 5FUWA 3EPJA 4EPRA 1DE0A 1AN0A 1R0WA 2QMUA 2W6ID 3CNLA 1P9WA 4PZYA 4DIDA 4URVR 5B64A 2XB2A 1G6OA 2PX3A 4BFZA 1NMZA 2AK2A 2ORIA 4OI0A 3Q5EA 4C0KA 3CF2A 2IUSA 1XXHA 1TEVA 3X1ZA 4DEXA 2O0JA 3EPHA 3CLVA 4JSYA 5FOXA 3VX4A 4PQRA 2JA1A 4A8JC 4R98A 1E99A 1JEDA 4LYAA 4HAYA 2ZE5A 4F4JA 1E98A 3RAPR 5TV2A 2VHTA 3AP2A 4TLAA 2J5XA 1YZLA 2CCKA 2FNAA 1XJCA 3CPEA 3O8CA 2Z4RA 2ZIAA 3GLGB 2IC5A 1E2JA 3T12A 4HATA 1FP6A 1P60A 5KNDA 3NBXX 4HZIA 1KI6A 4XVRA 3A1TA 3KB2A 4Q48A 3OEHD 4A0HA 4TWZA 3KTAA 4MRVA 3ASZA 2XX3A 5FBWB 3LFUA 1SVLA 4PANA 1NMYA 2HJVA 4JKIA 1F2UA 3AQ4A 2OV2A 5FPSA 1A4RA 5GJVC 4EUNA 4FMBB 3K0FA 2IWRA 3RDPA 1M6NA 2J7PD 2QQEA 1ETUA 4LX0A 4NU0A 2G1KA 2RGEA 2XNSA 3U7GA 5FTNA 1SVWA 4W5HA 2RGNA 3A1WA 1SHZA 2VEDA 4NPHA 5JFGA 4HAXA 1Q1BA 3BGWA 2C77A 1Z0JA 4B73A 3KXKA 3V9PA 1VIAA 1QHHB 5DN6A 3OAAD 2IYYA 2VSXA 4NBSA 1GDDA 1QG2A 4LJ8A 1GUAA 4Q01A 4RFSA 2AHOA 3TQFA 1EXMA 3EZ9A 2RGBA 3Q7QA 4TMTA 1E1RD 3LV8A 2QZ4A 5JLJA 2CK3D 2VQSA 3DL0A 5EP4A 1FPMA 2VH5R 5EXXA 1MO6A 2NMVA 2XJ9A 1RRGA 2PLFA 3UIEA 1XU4A 2B7CA 1XXHB 1P73A 2ZAOA 3TNFA 2GJKA 1OXTA 3LH5A 4BFTA 4Q03A 1H65A 1U81A 1Z0IA 3F3YA 3SN6A 5AUPB 1G18A 1FMLA 1W47A 5DI3B 5DSZA 3SC3A 3LLMA 2R9VA 3H0KA 2ZANA 2ZXUA 2IYWA 4FMDB 1M34E 1TNDA 1ZP6A 3P20A 3QXXA 5CB8A 2O8EB 1TL7C 2JJ1A 4R71A 2GXQA 1G5RA 1TAGA 3QPWA 3RLFA 3GLHA 2O0KA 1CR4A 2ZITA 4TN1A 3W6PA 4D0NA 4ASUA 2DBYA 4DDVA 2JLZA 1PLLA 1WXQA 1Q22A 1AIPA 2D2EA 3BERA 2A30A 3ONWA 4LJ4A 2ZRGA 2PJRA 1VKJA 4Q9LA 4EPWA 3LDAA 2ASEA 3C7KA 2YOGA 3QKSA 4PQYA 4BEJA 2DFLA 5JHGB 3SFVA 3GJ5A 3KTAB 2BCGY
chains in the Genus database with same CATH superfamily
3L0OA 2FTKE 2IYXA 4XYLA 1YQXA 3E1SA 3H2ZA 4D96A 4XPIA 4COOA 5IM4F 2JZCA 2CNDA 4C76A 3UBTA 3K15A 2B92A 3D3NA 1MDFA 1TCAA 1UL1X 4C06A 4MIKA 4QLAA 2IQ5A 1UBUS 1XX6A 3K0FB 4IIUA 3O8BA 3D6FA 5AFSA 5BXQC 3EC7A 2QAGC 1BDJA 1SBZA 2MMCA 4F0JA 3QE0A 4PXYA 1ECBA 3QNWA 5F77A 4D6PA 4LC9A 4RZ3A 5DWDA 4OB6A 4O4HA 4RY8A 3PD0A 3D0KA 4P82A 1E94E 5JMWA 4A6EA 4JIMA 1UKYA 3E7FA 5KYKA 1M3SA 4LUCA 1YGPA 1MPXA 1X0XA 1M76A 3UK7A 4ZYUA 2YWJA 3ETGA 1T8PA 3DAYA 3WLAA 4BV3A 4N5DA 1OX4B 5J4YA 1VJCA 1L7RA 4COKA 1BYUA 3AMVA 3EMKA 3UXYA 1DQZA 2GPBA 1UXHA 2BKVA 4R0NA 2FGKA 3BF7A 3WK9A 1II9A 2PN1A 2AYXA 2ZRNA 1ECCA 3CR7A 2I4MA 3CX8A 2XUPA 3REQA 3SF0A 2UKDA 1TA9A 2J32A 1JJVA 2G8NA 3PD7A 2WVJA 3K2IA 3PGKA 1YRBA 4UHHA 1O95A 2Q0SA 3AUKA 1DP4A 2OOKA 4QYTA 1Z4JA 2EL7A 3DG9A 5E7MA 2ZIXB 1FFCA 1Y48E 5ALFA 1RWVA 4OREX 2DZDA 5DX1A 3ROGA 4AXXA 1GFZA 1D0VA 4QYXA 2W6JA 3PI6A 4OSPA 5LB4A 4MQLA 4TSFD 4TN5A 5KOJB 2ZGVA 4P8RA 4TSKA 1LPBB 1SK9A 1BTOA 3R3YA 3RO7A 4A91A 4P36A 2NU6A 5AK4A 5EIBD 5M7EA 4ROSA 2UYOA 2ZI9A 3GFFA 1A2OA 2FWIA 4I1YA 1BKSB 2ILTA 2MU1A 3DTVA 3GH1A 1YHNA 1FFDA 4G01B 4HAOA 2RBEA 1EX1A 1FIUA 3P97A 3RC3A 1BE1A 4HXEB 1L8XA 1LC3A 3AF1A 4OAOA 3R3VA 3SHVA 1NQ5A 1AUOA 1O5TA 3RSFA 3ZD9A 4MAMA 3E18A 4ZO4A 5AI4A 4J0EA 3ZWYA 2D0PB 2Q5FA 5CX4A 1V8DA 2AFHE 3A1NA 2P9YA 4DREA 3ND9A 4G5FA 4XDGA 1ZI6A 4OK5A 3JQRA 1OX5A 4FMCF 4JGIA 1CVLA 4RK6A 1NLZA 5SV2A 1SC9A 1DUVG 5BWMA 4GLFA 2J3MA 4XUGB 1GCGA 4QTXA 2DLNA 1A9XA 1LNQA 4NE2A 4FKZA 4LJRA 2A5LA 2G1UA 1XZFA 4B6FA 3Q8WA 1YVDA 2X14A 3NC1C 3QPAA 4L75A 3SNKA 4BWYA 3AKYA 1XRNA 4V0SA 5AW3A 2J48A 2BWJA 2OSBA 4HY3A 2MSCB 1C0PA 1NQOA 2ZB7A 1E3WB 3K2BA 3RUFA 3KDPA 4FGZA 1S5PA 2QPTA 2JD0A 2X7JA 3BRWA 2PT5A 1F17A 2CNOA 2NQ8A 2AOTA 1KPHA 4EI7A 1SU6A 3IEKA 1KNXA 3FUVA 4PIMA 1BJRE 3H1FA 4NS4A 4QEDA 1ZM4A 2JGMA 3MWJA 4OQ4A 3BC1A 3VAAA 3ORHA 3IOYA 1ODKA 1P1RA 3DOEA 4F04A 1LVHA 1R5BA 2BP7A 1ZK0A 3I2GA 3LO8A 4L4ZA 1CIVA 1EPUA 1L8QA 2FX3A 3HUEA 4XM2A 4TRMA 2AI3A 5H3CA 2JARA 1X77A 3I01M 4JB8A 4H6VA 3DMNA 3O94A 4QOJA 4YBZA 4GYWA 3IIKA 4YAFA 4DIUA 4HUTA 1RWKA 2B61A 2AD1A 1G9TA 2ECPA 3R5KA 2GHQA 2ZUBA 3N3BC 4K28A 3RWMB 1VJTA 2O2GA 4GC9A 1J07A 1VMDA 2GJSA 2WG1A 4MQ4A 4P54A 3LTNC 4RPCA 5I6DA 4OX9Y 2IYEA 4ITVA 4TL6A 1NF3A 2FW6A 4TUYF 4MR7B 5FOTA 5JSKA 4JI7B 3F7OA 3GARA 4UVHA 2YDYA 4IIBA 2DUWA 2HUPA 4WNAA 5THXA 4GOOD 1SU8A 1E1DA 1W4CA 1G7SA 5EPUA 3R7WA 3BL8A 1XNGA 3EXHC 1GZDA 4TZ0A 1F2VA 3EXIA 4EK9A 3I23A 2OC4A 4OJQA 4D98A 3HKEA 4X54A 2VJMA 5LQDA 1ZNYA 1ADBA 3RIGA 1Q1GA 4Q6BA 4U7JA 5HCIA 4G56A 2CEAA 2G80A 3E5NA 2AG5A 2AOWA 2ZIWB 4HAWA 3Q7SA 4P7JA 3MBIA 4X8LA 3KOMA 3H9EO 1GFSA 5DLPA 1NI4A 3FYHA 3PR2B 2Q5EA 1SO8A 3BAFA 1CR2A 2CYAA 1BWPA 4NAHA 2XB4A 4RDHA 4ZOLA 2BMWA 5IWCA 3DD5A 4PC3A 3H04A 1TX4B 3DWFA 5J58A 1DADA 2E18A 2ZSDA 3OFNA 5EIOA 3DXFA 4BIMA 3PB3A 4ENUA 1XPRA 2KLBA 4IF4A 2BMAA 4UOQA 2A88A 5TARA 3WL4A 1X13A 3F7TA 4QE3A 4QDUA 5TF4A 1NJGA 3U3MA 3R6GA 4X91A 4AWXA 3ZCUA 4PXSA 1QZXA 5I7WA 2IH5A 3LKBA 3CLUD 1SWVA 3CEHA 3OCXA 2PLRA 3HZRA 3MTBA 2YYAA 5ICSA 2WZQA 3I83A 4BJ5A 4RTJA 3FZEA 1RP1A 3SKXA 1W5TA 2BFMA 5AXAA 1KEZA 3EIHA 5DW3A 4GNKA 2A3RA 3H5VA 2HRCA 3GHHA 3LCUA 2H63A 1R0XA 3QM1A 1F6DA 1L7VC 4D79A 3UAGA 3W7AA 1EX7A 2YXEA 3DVQX 2E9SA 3PQ6A 2TSYB 4H16A 3ZJTA 5FKJA 4H3KB 5DXFA 5C7IO 3MIIA 1DDGA 3KFVA 1VHDA 4IOMA 5KYUB 2XZOA 1WDMA 3TIVA 3OEYA 2ZRMA 1XLTC 2ZBPA 3IEUA 2VRNA 4BRUA 2GD1O 1ZOOA 3IPAA 3S7TA 4DANA 1QF9A 5G4KB 2H5JA 2WSIA 4KUGA 1I3MA 1TVMA 4M0MA 1QHSA 3LQ4A 3TTYA 3ZDXB 4B3FX 1FRZA 4EYSA 1OLXB 4PZ9A 1E9VA 2B6HA 4LEIA 3HKDA 4IDOA 3NG1A 2IHBA 5J2TB 1KJNA 4NEGA 2ZUUA 4UEOA 4MS3A 2AJDA 2PX4A 1H2HA 1RNLA 4D3ZA 1U11A 1GQRA 2R8BA 5A2GA 1QOZA 2HGZA 3AEUA 3FY4A 3LPCA 6Q21A 4US2R 1FX0A 3U3ZA 3WS7A 3KUDA 4V1CI 1YE5A 2JAXA 6YASA 5IXSA 2GAAA 1JXAA 1BWSA 1NVVR 1IN5A 4RMGA 1JEEA 4GPTA 4DY4A 1LEHA 2IDZA 4IZHA 2Q0QA 4O4LF 3CLTD 3IJRA 3TM5A 3EH1A 3Q3VA 1I4LD 1L8OA 4K9PA 4N3NA 1KRXA 1KOFA 4TTTS 2X86A 1G63A 3LCVB 1I2CA 3TIGA 1CUWA 3GLFA 3J7AC 1OAAA 1P9OA 1NRIA 1UM9B 3OE4A 2FPUA 2VTEA 4EX6A 5JY1A 4J8PA 1GAQA 3V8BA 1NL3A 1CPYA 2EERA 3OKPA 5HK9A 2DXIA 2I22A 1XNQB 4DRXB 1KRWA 3AETB 1G17A 1J25A 1ZC3A 3ASYA 2Y1XA 1EDZA 3E9EA 4BVHA 3E9YA 7ADHA 3RUPA 3U56A 3AG6A 1M34B 3KX2A 3OQBA 4FZJA 3RAJA 3D4IA 1G5QA 4HZUA 3DTNA 2IDKA 3WIOA 1QHIA 1GRRA 3EUFA 2WY2D 3RVQA 1M2VA 3E15A 3TPCA 2WNSA 4HAVA 1V3VA 5JJKA 2J31A 2CE2X 1GZSA 2VFAA 1GA6A 4FP9A 4DPLA 3C0KA 1CVIA 3UGQA 2WUEA 1PFYA 1S4MA 3VNRA 4FMCB 4MNTA 5G0WA 4R1OA 1LBTA 1M10A 3AIOA 2J46A 5HE8A 3K2QA 2HZBA 2VK8A 2JVIA 1C14A 1CQJB 4XGKA 3WOHA 2A1TS 4S1NA 2OFOA 5HF5A 3DE0X 2R11A 1E9EA 2IODA 4Y2PA 2FPWA 1LNZA 5GQSA 5K3BA 2F3TA 3PHHA 4G63A 1E9BA 3GZ4A 1PJRA 4XYBA 1NWCA 4Q7EA 2XVXA 3RS3A 1C9DB 3M1LA 4FYXA 1WOYA 4MDYA 3HXTA 5HBRA 3RGGA 1JTVA 1NVUQ 2F1IA 3PYMA 2NXNA 4ZN6A 1VE3A 2C78A 5DE3A 2BBOA 5BNWA 4AF6A 2WP8J 1LPOA 4B3SB 1XCBA 2DR3A 4TQUS 3L05A 4HDSA 5DFAA 4HNVA 3IQDB 3M8KA 4RVCA 4IHJA 1FSFA 1E69A 3GQBA 4OHMA 4QUDA 4J6EA 4AY5A 4E88A 1U0LA 1JIKA 2UZIR 1G6Q1 1NBEA 1VI2A 1V3UA 5D85A 2JFHA 5HFJA 2G9RA 1E6UA 4KPUA 1E9FA 1RLUA 5CBPB 3DKIA 1W85B 3WG9A 4TYYA 2B83A 5TPZD 3G1WA 3VRHA 1QPZA 1KDZA 3R6TA 2XKBA 4WFKA 3N53A 1NUAA 3NOOA 2PY6A 1QRTA 4AULA 1NSTA 2F3RA 2Z6UA 3UMYA 1NVFA 3DAFA 3MJSA 3C1TA 4QPJC 3EHEA 4C0XA 3I5MA 1PJZA 2IPLA 1UXKA 3QEOA 2EFYA 4O2BF 1SOMA 2CJYA 1E0DA 4PPYA 4I4CA 1U3UA 1Y9ZA 3RWOA 3ZWNA 2QM7A 4YV2A 4B4WA 1U2ZA 2QR2A 1KY4A 3LXMA 2GNOA 2Q3BA 2ZSHA 4TMFA 1VHWA 3Q7RA 3CVYA 2O8DB 2QPLA 2XQGA 1XLWA 4MSUA 3VOBA 5J4HA 1XHFA 3ZCVA 1QK4A 5ADWA 5D7NA 2G1JA 1E7QA 2P9QA 3C3MA 3MCAA 4L6CA 2NUAB 4QIHA 3LA6A 3NEAA 5J1SB 1DPFA 4HQRA 5FI1B 2HF8A 3SHWA 4BWFB 1YMQA 5K8UA 1C0LA 4W82A 5LCXA 2DR2A 2WKRA 1CHDA 1LTQA 2YWGA 3I09A 4ITRC 5AWFC 5AHXA 2ARKA 1CEXA 2Q8QA 4FOOA 3VPDA 4ESOA 4XVUA 2F1OA 3SHQA 2WTUA 2VYND 1U94A 2GZRA 3IVMA 4LBVA 3V80A 3R09A 4F2HA 1QIEA 4JSTA 4Q93A 4ZT7A 3WIDA 5C1BA 3EOZA 1X7YB 1DLJA 4QUGA 3U3RA 3T7SA 4ZIRB 1NVXQ 4JLDA 2PUEA 1N8NA 1N0UA 2FZEA 3CC8A 2GRJA 3EFEA 5CM9C 1AMOA 4F3KA 3BFJA 3LQ1A 1QGUA 3A31A 3PWTA 4G36A 1DTWB 3VC3A 3S29A 3G0DA 1B2LA 4U2KA 5CDFA 5HHTA 2ZAGA 4RGQA 1O7JA 1RPJA 2CJFA 4HB2A 2FJPA 3UANA 2EF1A 3LUAA 3GCGA 1RI4A 4FLMA 1YBFA 4MMXB 2PXXA 1J8VA 821PA 2G8LA 3W9UA 3LS2A 1TC1A 1UT8A 3DZIA 4D4JA 5H80A 5LZ5A 4R81A 4D3DA 3UWKA 1GY8A 2JATA 4YROA 4JJKA 4P5EA 5K8JB 1GGJA 3LXUX 2WYUA 2ZYAA 3PX3A 2OGTA 1JDBC 2XGSA 1YACA 4DLPA 4PLHA 1OXUA 1FX1A 4LJ6A 4CFSA 1NONA 3KPWA 4LY9A 5EJ6A 2Z3WA 2PU5A 4IDNA 4HFNA 3IBSA 2ZULA 3EW7A 2ZJFA 3NRBA 2IKSA 2AWNA 3W2GA 4TQGA 3I9FA 1PF7E 3VBCA 7REQA 4PHTA 2ZWIA 4YAWA 5KUTA 3RYCB 1QJ4A 1JLKA 1WXIA 2OG1A 3NVDA 1IWPB 3I4CA 4D4GA 1GUZA 5JC8A 2REQB 1E63A 4GWLA 3WO1A 3D6UA 4GUAA 4N7RA 5AVRA 1P7WA 1UKBA 3K9BA 5CLLA 4CTNA 1WZCA 4UOEA 5C51B 4G0VA 1RYNA 2H54A 4O4JA 2XMQA 2ZROA 2R79A 2XUZA 3TL3A 4RESA 1HV8A 1FA9A 2CL5A 1VHQA 3TOZA 4MP3A 1AURA 3NV7A 2CDAA 1KR5A 2V8OA 3G2IA 2H4YA 2HBZA 1F7UA 1DL5A 4B47A 4PBTA 1EFPB 4RF5A 4ZQBA 1EWKA 3KCQA 3L6RA 3M1IA 1FP4A 1LDNA 3VDRA 4BZPA 3CF6R 4JJZA 4PO9A 4TS4A 1RHKA 3CU5A 4MX8A 1YULA 1TUBA 1OB5A 4Q3KA 5F7ZA 3LYAA 3HDTA 3GDGA 3WLMA 4K26A 1DWUA 3HCRA 3EZYA 4WJLA 1RVV1 4HDQB 3M82A 3BG5A 1Z0AA 2JD1A 3MF4A 4LHWA 2Q8NA 3AERB 4WXPA 1QAMA 3NAMA 1XHEA 4KE9A 4LRTB 1B1AA 1QYDA 2FJUA 3ICVA 4PO1A 2VC2B 2DU8A 1GU0A 1TT7A 2YVQA 1I10A 4KG7A 4MXDA 4MROA 5E3HA 4JI4B 4KN9S 3ZS8A 1JALA 4AKIA 2HADA 4CCWA 1GZVA 3R9XA 2B94A 2QYSA 4B46A 1XVTA 2GEVA 1I1NA 4GPZA 1ZJWA 4AJIA 3E81A 5CCEA 3KPVA 4JS0A 1ESZA 3S2YA 4LVUA 2YZNA 4RVOA 2GQ0A 5GONF 5I3CA 2M32A 3QEMB 4EVRA 1JLLA 2OXFA 3DDUA 3ZY5A 2GVDC 1AD2A 3GJQA 1URPA 2JGEA 4X6UA 4NNPA 5BP7A 3JALB 3FPAA 3NC0C 4HSGA 4PINA 3FNRA 4K6MA 5MDHA 3CRRA 3F71A 4C4AA 3NETA 2I9KA 1AUPA 1M9NA 4GGOA 1Y0BA 3DCIA 1GPMA 3RS2A 1TMKA 5KNBA 3ACCA 1SXJA 3D31A 3UAZA 4JZKA 3HM9A 4PX9A 4XWWA 4CEHB 1U28A 4L9WA 4ZOAA 4ZKDA 4L6IA 5D2CA 5C18A 3U4MA 2GPWA 3FGZA 3WXMA 4CETA 1E1LA 1TGVA 4Z3OA 1LV8A 1O6FA 2DSNA 3N76A 3U44B 2K7ZA 5CPFA 1FE8A 5B4TA 5HIAA 1N4DA 4XWKA 3I37X 2VP5A 5FV7A 2RIPA 1AQUA 4F71A 4OQLA 3RIYA 2HRRA 5AKKA 1JQBA 4QRDA 5BSGA 2O8BB 4KR2A 2NO7A 3JARA 5BYJA 1I94B 1R6BX 4J29A 4D25A 4CR8A 1Q21A 5CAEB 1IHUA 1R4ZA 4U2GA 3U4GA 1NY5A 4CMEC 2DKFA 3DYIA 4ZJZA 2BD0A 1NRWA 1FDRA 1RC0A 2A7QA 1U7UA 2CD9A 2ODAA 2ZSJA 1MTZA 3KC2A 4KYUA 3RF6A 1HNZB 2C82A 4O2BB 4FSDA 2AFVA 2X5JO 3V7WA 3PFNA 2R0QC 3JQGA 1AZSC 1G0NA 1P4JA 5KX5F 1MAUA 1EXDA 3WYCA 3OQNA 1G8SA 2O05A 3GRCA 3H5RA 5C3UA 5G1OA 4RD3A 5FJIA 1QHGA 5GP1A 3ZGOA 3ZWMA 4OXRA 4X0EA 4A73A 5IZCA 1CIJA 5FWDA 4NBKA 3UK2A 5G2OA 3CB2A 3ZTTA 1U4OA 1JB9A 5AKZA 1LWOA 2BCJQ 3TTWA 1QRDA 4JWKA 1N0HA 1V4BA 2WTAA 2GD2A 5K1ZA 5KNCH 1UOEA 3H5AA 1GXSA 2WIGA 5H81A 2WG2A 1H3FA 5F78A 3JD3A 5EIEA 3SYRA 1I01A 2ZWVA 5E2IA 1YCDA 4W8GA 2CXUA 5TR9A 1A9RA 2Z8YM 1DJMA 1H6AA 3A1SA 3COPA 3ORYA 2WSLA 3BICA 3KOZA 3ABSB 5JJLA 3DE6X 1TMYA 4L2IB 3OY2A 5KVQA 3U5TA 2IY9A 2ZW9A 4IJQA 2ZR9A 4Y2RA 3AY3A 2MCFA 4GXQA 4B3CA 4OOEA 2VYVA 3DR3A 3EPPA 2J4CA 3A6LA 1QK3A 1Z13A 1NAIA 2QDXA 3ESZA 4G5OA 1U9ZA 2H2DA 4IQ8A 3VZDA 1E61A 1QTQA 1U5BB 1XZIA 2P40A 3QBJA 2OCYC 2OGZA 3TUIC 1RWBA 3F5QA 2C61A 3ZBTA 3D8SA 4OBXA 4MR9A 5I9LA 1G3UA 4EG5A 2C57A 2OLKA 1RHQA 3OTHA 5HDBB 2C8JA 4UASA 1H5NA 3OUTA 1GO2A 3BD9A 1EFUA 2GN9A 1K7XB 3PQ7A 1Z28A 3WGVA 1WY5A 2XHEA 2FP4B 3O4IA 3A14A 4P92A 4RHXA 3NCTA 3Q9UA 1XQWA 4YCDA 3NKFA 5ARCA 1Y1KE 3IHLA 2QB5A 3WSTA 1E6LA 1YRLA 2AOUB 1QTRA 1R00A 1T9CA 3ADKA 3FUXA 3FVTA 3KZMA 1L5NA 4DDTA 1Q5PA 1RMQA 3C39A 1SXHA 5IAAA 1YJ5A 3FPCA 1J20A 2C4KA 4LV8B 2EBHX 1BXRA 3DEKA 4OCZA 2H57A 5NULA 5CDUA 5A4MS 4AF7A 4OB7A 3HDJA 1CEQA 3N2IA 1C8BA 3K1AB 4UARA 4MV9A 4MULA 4C43A 2HDHA 1PDVA 5EWLB 2HNKA 1PNOA 2OGWA 2XUQA 1JDNA 3O3MB 3QYFA 4AP6A 3OG9A 3D4BA 2GVZC 4KBYA 2VBGA 3SPXA 3UUFA 1P61B 3HJRA 3GB9A 3NOXA 1E2HA 1Q2XA 1YE3A 5GV7A 1KEWA 3OT5A 3EFHA 1PSDA 3GI1A 1R74A 2FP3A 2O6HA 3W2HA 4CLDA 4Y2QA 1XMJA 4GI5A 1I14A 4HTFB 1HQKA 3QFCA 4EI9A 2E0IA 3JYQA 4GEKA 1A8PA 4XDHA 1Y6GA 5K09A 4PC2A 1Q2UA 1S3GA 3QWHA 4E21A 1JH9A 4DT1A 2P3SA 3HBFA 1SXIA 2EXXA 4CI0B 5AVYA 4RK7A 2A0WA 5LQMA 4AY3A 4X1IA 1GPNA 5DCLA 4V1CA 4B40A 1H4VB 3K9HA 3EZ6A 1KY5A 2YIDA 1YHYA 3G89A 3TRJA 1XYGA 3ETDA 2UXDB 3I2JA 1N8SA 1YR9A 4RCZA 2OGUA 1E4OA 1H2WA 4DNOA 1DG1G 4DILA 3NS7A 4IDBA 2KBEA 4P0TA 1E2QA 1RBQA 1WV1A 1ODTC 1XZLA 1YIOA 3I04A 4RMJA 3WGOA 4FFNA 2AE2A 4JJAA 4TRJA 3TRHA 4U7FA 4ND8A 4IJVA 1USGA 2HMYB 4EG4A 1AF4A 4YB8A 4LXHA 5J63A 2W90A 4XFDA 3F96A 2EBUA 2FI1A 4JI6B 3SIPA 3VV3A 4YUWA 4E5YA 4E2ZA 4WASA 5CCDA 5T4EA 1XEXB 2WMDA 4PZDA 3STYA 2XCIA 3L7DA 4GMDA 5TQ0A 3ROFA 3QTTA 2BMDA 5GONB 3KWLA 1V2HE 2VDOB 3LLCA 4CCYA 5K6AA 2CVZA 1E58A 2TMYA 2W5UA 3GBPA 2IU4A 3AX6A 1D8TA 1XDBA 2DWOA 1KQPA 5HGJA 3ZY6A 4CLOA 4F3YA 4HLUA 4EGQA 3ZN2A 2QBYA 1JWBB 2OHJA 2HQOA 2P3LA 3ADPA 2CHGA 4JLPA 4NWIA 4PONA 4ZCPA 4C3OB 5ISMA 3R9KA 1AQLA 4IYRA 4EY5A 5KJ1A 1PFQA 5JAHA 4R2WA 13PKA 1QDLB 4M8IA 2ZSIA 4PNPA 1K4MA 1N6OA 2F1JA 3P9QA 1IZ7A 1PGOA 2WDPA 3TNJA 4A7PA 3A4MA 4R6XA 5ALYA 5ALDA 1C1DB 2P2SA 2YN2A 1F2TA 4OP3A 4URFA 3TCXB 4JLUA 2DKOA 4ZEOA 3TCNA 3RFVA 5A62A 2ZRPA 1EINA 1R2QA 1PR5A 1A8HA 4YV1A 4NARA 5EXTA 3UC9A 3L4KA 5ALHA 2ACKA 3S2ZA 1VYHA 1KY2A 4M9QA 3ZD6A 3ZNPA 3M4NA 4DA6A 1RAFA 3PDIA 3UA4A 5IYZF 4ZDWA 3NEYA 2VPYA 4Y2HA 2WFMA 2QVBA 3G5MA 4WRRA 3UMCA 4Q4DA 1K06A 1BHJA 3EFOB 5DGIA 2CLCX 2WHPB 1T35A 4ZQFA 3GA7A 1KH3A 3L7MA 3VR3A 3D0OA 2IP2A 4UMVA 5BR1A 1E3DA 1LI4A 5FOQA 4TKLA 4O2AB 2BBSA 4XSHA 3TE7A 1XPOA 3S81A 3C1OA 2JCBA 5C7YA 4U02A 1HDRA 2BI7A 2HRZA 5KX5B 2XSZD 2N42A 3C16C 3UOAB 3P4XA 3DLTA 5CXUA 2VIIA 4DGQA 3F7NA 1DJOA 1IHDA 1OB2A 1W5AA 5FOUA 3R74A 3O8OA 4BP9A 3UT0A 3SLGA 4QBGB 1T2VA 5JVDF 4OJTA 5B53A 4YRCA 1ANKA 2A67A 2NQTA 1ISFA 4R2MA 4BE7B 3OA0A 1H4SA 5KYNA 5DBOA 1XWWA 2LIVA 1M2JA 3FSGD 3KSZO 2P77A 3QLVC 3UENA 1JDTA 1T5BA 2FEWB 2GCNA 3PPIA 5CNKA 2EP8A 3WKDA 4FTWA 2Y66A 2ZWMA 3KUUA 1AXGA 4B84A 3DM9B 4EPTA 4U7HA 3WLQA 5LMUB 1ESEA 1J0XO 3S2GA 2G9VA 5JY6A 2EVWX 4M9UA 4EQZA 2I0FA 1CRPA 1GG9A 3X2FA 3RB8A 1QYRA 4HFJA 5ADUS 5A3QA 2EGUA 3KHUA 1ZVQA 1B0UA 1AX9A 3FHCB 1E6WA 2PQ6A 4CTKA 3KV1A 2JS7A 3L3BA 1ZUIA 1USWA 3QUAA 2P4HX 2VJLA 2WTXA 2OO5C 1RXEA 1XMVA 1L0BA 3LAWA 2VF2A 4NFHA 4XX1A 4GWKA 4IFIA 3IPRA 3EMDA 3ITNA 1XPJA 2QTZA 2BIFA 4HC4A 4KEAA 2COUA 2G17A 4ZAFA 5TX7A 2VP6A 1OYOA 2FFQA 2JASA 3GRVA 3L18A 3UMMA 1T9DA 1JYFA 4EBFA 1N5OX 2G72A 2PKEA 4LWQA 5K8LA 1YGYA 3QZUA 1XTRA 1ZM2A 3Q5GA 3GJYA 1N2XA 1HFEL 3BWVA 2B3DA 4Y2GA 2H4WA 2OM2A 1ECJA 2ZRFA 1EVEA 4X1YB 2QZPA 3EVZA 2RK6A 1TOAA 2IHJA 4C22A 5C8DA 5JCJA 2ACWA 1L8AA 5CDFE 1YBMA 1PSWA 1GIAA 4J0IA 5IF9A 3IUYA 4UMDA 2QI9F 1M2WA 2EWMA 2CMDA 3B3FA 4EJ6A 2K87A 3WJ2A 4AS1A 1EQUA 4UCFA 5GIPE 4RQTA 4FINA 1YIDA 2QR5A 4AY4A 1U1GA 4LNHA 2XCTB 3ZHTA 3FD8A 3BBPA 5IJAA 1CQXA 1YRYE 5G0SA 3SDBA 3W6UA 4HDRB 4ALKA 3N8DA 3J81k 4QGFA 4DSNA 1F3OA 1KMHB 2OXCA 1KQGA 2AG0A 3HHEA 5JYBA 1SZPA 5CYPA 5LLSA 3V2HA 1O5OA 1DBSA 4C4OA 1Z6ZA 2E3JA 1M2OA 4UJ5A 5A7HA 3S70A 4JT9A 2ONKA 4WCFC 2ZU6A 1A3CA 4G5XA 1KK3A 1LCIA 3PRKE 3VZPA 4ZCRA 2QA5A 4EEXA 5K0NA 4INZA 2QN1A 4NQZA 1SD1A 3HB9A 1ZOIA 2D0OB 3C3DA 1U8CB 3HCEA 5JJCA 4CG2A 4AQ7A 3NT2A 4EPYA 1OWMA 2JCGA 1IAQA 2ZTUA 3GFBA 2V0NA 2ZTVA 3C70A 4YJGA 2FLKA 4NVRA 3RCBA 4P3XA 4A27A 2DPYA 4NV3A 1XCLA 3AR6A 2QZJA 4Q7JB 3SQOA 3TI9A 1NBMA 4G4SP 2UAGA 3HR7A 3RD5A 4WLOA 2H11A 2Q1YA 2VJCA 1UDRA 4G07A 2I2AA 5EY5B 4B48A 3NYRA 3VU9B 1EXVA 1QBGA 3J7TA 2P0EA 5LFAA 2IEGA 1OIXA 1QIMA 2A9PA 2YV3A 4RV5A 3ROQA 3GDFA 3H11A 2OECA 4NAUA 4RANA 5HIIA 1SIOA 4CF3A 1YQGA 3A3PA 2CMGA 2B98A 5DHSA 4Y1GA 5DEIA 1SRQA 4BGIA 2FPPA 5GIOE 4GOXA 5JNLA 1T4DA 3SQXA 1ZEMA 4JXJA 2OCAA 4DB2A 3ZV4A 3R20A 3WGIA 2NP6A 1Z37A 3FVVA 1YWGO 4PNZA 2Q7DA 3SS7X 1FXSA 4MEJA 3BFXA 5A4DA 2FV8A 5A4AA 2B4TO 4LHZA 4ND1A 1EFRA 3AU8A 1XMIA 3O1LA 5CJ2A 1DQPA 4CKWB 1WRBA 1AUQA 4BEBA 1V11A 5DKFA 4KJXA 2AN5A 4AYTA 2GM3A 4IW3B 3WAKA 1IXKA 2HLDD 3PFHA 2C03A 1G8JA 1KIFA 3EVBA 3L8CA 4QBFA 4ZGGA 1IY0A 4WLVA 2NO0A 3T34A 1YQQA 5B58T 2AFIE 2UDPA 2A33A 3QUQA 4Z4QA 3PQDA 2EP7A 5JD4A 1V47A 1EBFA 2BEUA 1YVPA 5J3JA 3CFYA 3HXLA 2ZJ5A 2R44A 2W93A 4D5EA 3Q2OA 1KJQA 1Y5LA 1OZAA 3FLMA 3OUZA 1J5XA 5IJXA 4ACBA 3IIJA 2PG3A 1Y6JA 2F64A 5B6PA 2ZBQA 3IE0A 3A4IA 4KXXA 1VG1A 1E0KA 1TK2A 1GPWB 1RRKA 1JHVA 3GRKA 4OAPA 4ZJYA 4JI8B 2EF0A 1JU9A 3OTGA 1M2NA 4CTMA 5IASA 5IYZB 2CMHA 2GRUA 1W6UA 1EJBA 1B43A 3KJEA 4HYTA 2QAGA 1K92A 4IX9A 2W2KB 3F7MA 3KQVA 3PHGA 3QBTA 3WSVA 4AXBA 3ADBA 2YJNA 1A76A 4M1OA 4UU1A 1T2AA 1O6CA 1L3CA 4HH4A 3HUDA 1H2AS 1ODLA 3NB0A 3OJCA 4M7RA 2J30A 4RXTA 4XR9A 3BB3A 4OFZA 4ZVNA 2Z4SA 4M9SA 1IN4A 2Q49A 3WNZA 3OKCA 4RDIA 5EJFA 3UJCA 4RPGA 1PZMA 1U2DC 2EZ4A 3R5JA 1WUKS 2WF8A 2OK8A 4QUBA 5ARDA 2BGLA 5E6UA 4B3RB 1D0SA 2B6NA 3SBEA 5K20A 1RE0A 4CV1A 1C9MA 2N3ZA 2EJVA 4WUTA 4BFYA 1P7CA 1TD9A 5JVDB 1NYRA 4JUFA 4EYQA 3RSHA 1KK0A 4LZAA 1A8SA 2WF6A 1TW3A 2B1GA 2FDXA 4JLWA 4FHEA 1MF7A 4RM2A 2DG2A 3AEKB 3CA8A 4ZKEA 1WTAA 3B6IA 1P19A 4URYR 3KALA 3QK7A 4RPLA 2HEIA 4DNQA 4D41A 3KEMA 2C3MA 2IGTA 4P3YA 1AH2A 1MJ5A 4F3CA 4A6XA 2GK4A 5AIBA 5TVKA 5EE3A 4KAFA 1QWOA 3BKXA 5FI3A 3F98A 3I1YA 5REQA 3IKJA 1KYTA 3GG9A 2YKGA 4PFJA 4N03A 2O9JA 1KTIA 4ENWA 1ZA1A 1K3TA 1WZNA 3AR9A 3ZBQA 2DJ5A 4JB0A 1OW3B 4WXEA 3GRZA 3RKRA 1T5TA 2IXGA 5FTWA 4QM6A 2HD4A 1II8A 1ZCJA 4IDCA 4LMBA 2A4KA 5EHZA 4MLZA 1KVQA 2F4VB 3UQYS 1J00A 2VTKA 2CNWD 3FFBA 4FXPA 5FWXA 1DRWA 2VH2A 3FTFA 4QU9A 4I9HA 2PU7A 3TLGB 4TT8A 4TMYA 1FNSA 4CUJA 4FGKA 1ULUA 4H18A 2B36A 4OIFA 4GPAA 2XY4A 1QGAA 2BFFA 4C5CA 1QTNA 2ZRHA 1IIBA 3LXXA 1B16A 1FUYB 3HGMA 4L5YA 4E5PA 3S8YA 4AM8A 3BXXA 3IOBA 4GMGA 4X44A 1NP3A 5TMEA 3DA8A 2HXSA 4GXNA 1CJMA 3A2NA 4RNCA 3ZE6A 5B30A 3K53A 1QZ3A 3EVFA 3PXEA 3QV1A 3W4IA 4FEGA 2ERYA 1B14A 3W2TA 3ZHCA 3PEYA 3WAJA 3RBZA 3FYUB 3VKVA 2WHYA 2DFVA 3HLKA 4FOTA 4KE6A 1E7YA 4NP6A 1D3AA 3G68A 4TXNA 1IDN1 1P33A 1Q0HA 2IXDA 4W5JA 3RS0A 2VZEA 4Y18A 4E14A 4YT8A 5T7BA 2C4NA 4ZV4A 1KOJA 5FD8A 2EKZA 1TEZA 4MW6A 1I4OA 2GYYA 3GMIA 1C7ZA 3V4LA 1HT1E 2XLCA 3WYBA 2C96A 2BJVA 4XYMA 3K9QO 5AW0A 1V71A 1Z47A 3B53X 1UOPA 2B5WA 2ZATA 1OV6A 1D6NA 2J07A 1P7YA 3BREA 5EQTA 2Q3MA 3U2QA 3JWPA 1DFGA 1TK9A 1S9DA 4ACAA 2QX4A 1IVNA 2HJRA 5EQFA 1XEWX 2ADFA 2K6GA 2VH1A 3DLPX 4CU2A 2GB4A 3GRUA 4DKXA 4AKGA 1CR0A 3DMRA 1DWPA 2OPBA 3NBMA 4GMHA 2NV0A 4M1MA 1ZUD1 1ORIA 4HB3A 5GZ3A 2C0PA 2VWHA 2XNCA 1RQ7A 4TZKA 5EZ5A 1QQAA 2IQIA 3V4OA 2WPNA 4BECA 3L8FA 4OOFA 1TKCA 3CS3A 4X90A 1YFLA 4DCPA 2YINC 3WYGA 1S3IA 1P7ZA 1PJ2A 1VL2A 3F6YA 3OOWA 3TM4A 3AF5A 5AUQA 1DAHA 5FBQB 1PL8A 1ZINA 2IUYA 5A5EA 3PTAA 4B6EA 2AMYA 4NK4A 2Q62A 2HNAA 3OM8A 3IODA 1IN1A 1TKBA 4QO7A 1UEJA 4LE2A 4IFEA 3SE7A 4NU6A 1NNI1 2IU0A 2WIBA 3DPUA 3EXHA 4CT4B 1BGXT 1DS6A 2OZEA 2C04A 1O94C 2F6RA 4M8SA 1SKMA 1RYZA 1FFHA 2BE9A 2I7TA 2IIBA 3M81A 3GWGA 4E11A 5KTTA 2X7XA 1CKEA 1XI2A 2VRCD 3KKKA 1QVZA 1ORTA 1WD7A 2OFXA 5JAMA 3LYHA 1TTQB 3WAGA 1E1NA 3OFJA 5CLIA 1WZIA 4F6RB 2QLFA 4DV7B 4FHCA 1QDEA 1QG6A 3CO5A 3EWIA 2YQ4A 5AVSA 2D7CA 4XUDA 1FU4A 121PA 3ORFA 1LPMA 4GGPA 2J3DA 2JRLA 4LHXA 4LQ4A 4AMYA 2BEWA 1DO8A 2O6LA 3PLRA 3UFBA 1NW7A 2ZB8A 4Q1CA 1E4EA 2W6CX 2O48X 1P4RA 3CRMA 3LP6A 4MB0A 2JKZA 4CM4A 1IY9A 3FCOA 3RROA 1E7MA 1KTVA 4RQAA 3RRFA 2AT1A 3VHRA 1A2KC 2XITA 4FFRA 3ZHYA 3CTPA 4DR2B 4B0PA 2MYPA 3EEBA 2OUIA 3VPHA 3L07A 3SBXA 4DLZA 1ZS9A 2XODA 1SUCA 3F6SA 4L8FA 4ZOCA 3IOMA 3L8GA 1VLMA 2OL4A 3I1FA 4FLFA 4NMWA 2G7MC 2VSOA 2REXB 2VP2A 3E9CA 1SKYB 1W2HA 3CWQA 3TLJA 1KYZA 1GL6A 2J3QA 4RF3A 2XCQA 3B9RA 1B23P 4EO9A 3HU1A 2R60A 4FK8A 4J1NA 2FN3A 2I4RA 1Z6AA 5ELLA 1DEXA 4RK0A 4PX3A 3GELA 4MYTA 4TXHA 1MIOB 2PZAA 3MOGA 3D6MA 5DZSA 3D3WA 3BGDA 3SZGA 3PD1A 4EHIA 1M83A 3PE6A 3FKQA 3DQZA 2JI8A 2QTVB 1J2UA 2GM4A 1XIVA 2CJWB 3OTIA 2XKAA 1KVTA 1Q1ZA 2EC5A 3NTRA 1XLTA 4NHEA 4QUIA 4UZEA 4XVCA 4PPFA 1GDHA 4BJ1A 4PIPA 2AJBA 3TQCA 3PC2A 4QUJA 3KE8A 5ABPA 3IAS1 3G0HA 1SBTA 2Q3FA 4TLEA 1MAWA 1DDOA 4P2BA 5ALXA 2GFIA