4X8OA

Crystal structure of e. coli adenylate kinase y171w mutant in complex with inhibitor ap5a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
b'MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8oA00
1TUEA 2RH5A 1Q0UA 1ZCAA 1P7CA 4GRAA 1VHLA 1CP2A 4KXFB 2O8EA 3WYGA 5JECA 1FX0B 1IOZA 1GVNB 2WKQA 1QHNA 4HAXA 4TTQA 3OEEA 4FMBB 4B3GA 1E2MA 1E4VA 4RKFA 1RIFA 2JLWA 2WZQA 2OZEA 3R8CA 5LB2A 1CKEA 1XTJA 2Z6VA 1AGRA 3WXMA 1Q1ZA 4BEJA 4LBYA 2QPTA 3IGFA 2YWEA 3L82B 1FTSA 1HEIA 1FNNA 2FMXA 5J5CA 1LF5A 2IYLD 4BZXA 1G21E 1XF9A 2A3RA 4MGZR 1J7KA 1Q1QA 1D8TA 5FR1A 3BS4A 2KSQA 1PJRA 4AYWA 4GL2A 4JLJA 5TV2A 1CR0A 1E79A 1XJ0A 1NVXQ 2IHYA 4DDWA 3EC2A 1KSJA 3KB1A 2IT1A 4PC3A 3GJ6A 4KCGA 2BMDA 1DAMA 4F7WA 4I1UA 1NIPA 2A5GA 4DLYA 1G17A 2P5SA 4BLPA 4A9AA 4DLXA 4KYIB 3UKDA 3H0KA 3TSZA 3LQRA 4UKDA 4CVNA 4PPQA 1ZRHA 3EARA 1AS0A 3DOEA 2GHIA 4B3CA 4HAVA 2NQ2C 3SE0A 2F55A 1Q1BA 2AK3A 1DAKA 4FN5A 4Q9JA 5BW8A 5HE8A 4G1UC 3EC1A 2ZI3A 4DLUA 3Q5DA 5J40A 5JJKA 2HLDD 2F1HA 4PANA 4A2PA 3QPVA 1EWRA 2GTPA 2BJVA 2HJGA 5E7MA 4M1WA 1Z07A 3FGNA 2FFBA 2IUTA 4ABYA 2VA8A 3T12A 2Q9AA 2IA5A 1ZBDA 2XGJA 4PAOA 1TQ4A 4URUR 1OYWA 2I4IA 3CO5A 2JDIA 1CJUC 1Q22A 1KO8A 1TADA 2FF7A 4PSVA 1OKKA 1KI6B 1Z6XA 3FKQA 3ZVNA 2OESA 1TL7C 1AS2A 2DWPA 4DCTA 2XJ9A 3ASYA 1YJ5A 4BZQA 1KO4A 5G3ZA 1WQ1R 3W34A 4ZDIA 2QMOA 2AD1A 3CX6A 2R8RA 1TF2A 5G41A 3OIWA 4KFUA 1R5OA 3SN6A 1VCMA 4JT4A 4XWOA 1II9A 2AWOA 3D8BA 1SZPA 1ZM3A 2DFKB 3KUDA 1MR3F 3WP1B 2A78A 4BECA 4W5WA 3SYKA 3AF0A 1MABB 2JJ2A 3FPAA 1ANKA 1XEWX 2QMEA 3DL0A 1TTTA 1HQYE 3SHWA 2ZPTX 3GEIA 3KUCA 2IYSA 3TJZA 3ZZTA 1CXZA 2RGCA 1Z2AA 2FSFA 2FSHA 5IK2D 4A8JA 4LWZA 2ZR7A 1ZD9A 2X2FA 1U8ZA 1JB1A 1F60A 2C9YA 5FPSA 2YC2C 1LFDB 4A8JC 2XNDA 4PHTA 3BE4A 2C98A 2JIZA 4V0LA 1QVRA 4LUCA 2Q9CA 3SJAA 4A1FA 1A7JA 2AHOA 1YVDA 4NP6A 5DNYB 1N6PA 3PFIA 2IBMA 2BV3A 2ZR9A 2D2EA 1ZNWA 1EFUA 3LX5A 4PX9A 1ELOA 1ZNYA 2QG6A 2ZJ8A 1XEXB 2G77B 4H1VA 5TVKA 1NJFA 1YQTA 4UJ3A 5C46F 3THWB 2JEOA 4JJKA 1E9AA 3VKWA 3SBEA 1Z6TA 5L3QB 2W2VA 4I4LA 3W5IA 4C0AC 2ZU6A 4MKIA 2B8WA 2AXPA 5K8UA 4D25A 3AP2A 4L5BA 4Z1MA 3QBVA 2O8EB 1AJEA 2EYUA 1OIXA 3ZZUA 5L3VA 1C1YA 4A2WA 2XJ4A 5HZKA 3ZD7A 4AY2A 2OUKA 3Q5EA 4HLQB 3B1VA 3X1ZA 2VP9A 4PQFA 3W5JA 2YNMA 3DO6A 1N6NA 4QBIA 1E1QA 4UNRA 1YZLA 3NBXX 4KVGA 3M6AA 1SXJD 1J99A 1LNZA 4Q1DA 2RCNA 1JBKA 1OH5A 1MH1A 1OV4A 2YOFA 2OAQ1 4B76A 4OHYA 2EFHB 1CR4A 4TT3A 4B3DA 3RWOA 1W4BA 3KQKA 2W6ID 4AG5A 2WTUA 3AKYA 3P27A 1NL3A 1GAJA 4JSTA 2J46A 4KAXA 3UMSA 3KJGA 5BXQC 5FUYA 3RS4A 3CUEF 5CDFA 4CGZA 3U2QA 3KKMA 1OPXA 1FFHA 5IDVA 5KUTA 1VECA 1D9XA 3ZIAD 3T34A 3GLHA 2B8TA 5FTNA 1HT1E 1RJ9A 4MGKR 1NI3A 3B2EA 2BKEA 3CF0A 4KFRA 2ZYVX 3RS0A 4GPTA 1GILA 1GIAA 1UBGA 1YU9A 3QOFA 4D81A 2J9RA 4NCHA 2NTYC 1H8ED 4DLTA 1UM8A 4JJZA 2GBLA 1ZU5A 3WBKA 3VU9A 2NO6A 4HLCA 1BMFA 2ZU0C 3OEHA 4KVAA 4ESVA 2GBLC 1W4RA 1IHUA 4GP6A 4BFXA 3CPEA 5DHAA 4W5JA 4F4CA 1J90A 5DLQC 5TXGA 4TYNA 3NXSA 1QZXA 2GAOA 3H1TA 1YHNA 3K0CC 4K8OA 4AWXA 4CIDA 1CBUA 1HUQA 3ONWA 3VQTA 4PFSA 4GOKA 4KODA 2DPXA 4K81B 2CHGA 1SHKA 1XJQA 3VNVA 2BBSA 1NMXA 2CLCX 1GRRA 1TNDA 4QHSA 5KHOC 1NVVR 1WF3A 2RGEA 3UWOA 1YZUA 1G20E 1V5WA 1JEDA 3PVSA 5JBQA 1N0UA 2PT5A 4Q19A 3LNCA 1KNQA 4XH9B 1AK2A 1W0KA 2CDNA 2PJZA 3NWJA 4U00A 5DSZA 1B23P 1MKYA 2ZITA 4V0KA 1LV7A 4JSYA 1T5IA 3SZRA 1XNJA 1TMKA 1RE0A 2ZJZA 1ZP6A 1UKZA 1XD9A 4A8JB 3VR6A 2RHDA 3U3MA 2ERXA 4IHQA 3RSLA 3IO5A 2R44A 2FN4A 2OSBA 1SVMA 4HUQB 4JMPA 4B71A 4FMDB 4IOMA 1W49A 1QHGA 5FTJA 4DCNA 1E1RD 1XMIA 2ZSEA 2JCSA 1CIPA 1KIMA 1N2CE 4C2UA 3FFBA 1J8YF 1NN3A 3DHWC 1E9RA 2KB0A 3DKPA 4MUAA 2J7KA 2G0TA 3EAQA 5C1BA 4II7A 2BMJA 2AFHE 4TSFA 3G82C 1QBKC 2D3WA 4DZZA 5JRZA 1XPUA 3IPYA 3FOZA 3K9NA 3JZMA 3ASZA 1M1YE 2QE7A 4S35A 5SZKB 3CH4B 1RC8A 4EKDA 2Z4SA 5JRJA 1S0UA 4DSUA 4E22A 2C2HA 4R2IA 3LA6A 4AK9A 3NC1C 4MGYR 2Q3MA 3I8XA 1JEEA 3GMTA 5C18A 2BCGY 3OEED 2YJTD 3LX8A 1XEWY 1OLOA 4U02A 4L8GA 4PO1A 2V1UA 1XTRA 2PLFA 1CR1A 2VF8A 2RMKA 2EFGA 3TUZC 2RGDA 3R7WA 1UKEA 3QSYA 1VYVA 4CZ2A 4HAYA 4QJ4A 1W2HA 1FNMA 1IY0A 3T5DA 5JI2E 3EIQA 1G8GA 3K0FA 3ND8A 3W90A 4FWIB 1ZD8A 4EUNA 3TH5A 2BMEA 3W6NA 1ZUHA 4NYJR 1W0JD 3I92A 2WOOA 4OQMA 2VSFA 4D82A 2BHRA 4KSBA 1G7SA 5B58C 5HE9A 2ZE6A 3AP3A 5FOVA 1OIWA 1NN0A 1XP8A 4C9BA 4U5XA 4XOIA 2FGKA 5FOUA 2YHSA 2YVUA 4TLBA 2FZLA 3QE0A 4BUJA 3N5CA 4C0JA 2CL0X 4C3ZA 4MRNA 1Q1EA 4CEIA 4B74A 2X8AA 1PV4A 3WRYC 2PLRA 5HCIA 4N1AA 3GLHB 2MMGA 4BEBA 1ZIOA 4MUBA 1RJ9B 4IDNA 1II0A 5E7IA 4FWTA 4FIDA 5JCPA 2IYRA 4QHYA 1OSNA 5AWFC 1S9DA 1NMYA 3FHOA 5KSZA 3L0OA 4DVGA 2JDID 3VU9B 1HY3A 2C5LA 2YC4C 3SI7A 3KB2A 1Z0AA 5KSYA 3HU3A 4BFSA 3R9WA 2GRJA 1E69A 4TTPA 3Q72A 5EE1A 5KYKA 3AQ4A 1N6KA 2CK3D 5KPDA 3W3AA 3TKLA 1NRJB 4X8HA 1KAGA 3VR2A 4O0MA 1ESNA 1II8A 3PQCA 4B33A 3LFUA 1Z2CA 4MDEA 2QPOA 4IVQA 3P32A 2CEAA 2DFLA 4DSTA 5HZHA 1VYTA 2VHUA 4LOAA 1KK3A 4MYTA 3C8UA 3KDSE 2PZFA 4Q1EA 4ZI2A 3UPUA 2D74A 2YZ2A 1KK1A 5H68A 3DM9B 3AH8A 3GJ0A 2PJRA 3L43A 5EP2A 1P2SA 8OHMA 2IEYA 1CS4C 2D7DA 4RD4A 4B34A 1NVVQ 2FU5C 2LKDA 2AK2A 2QI9C 2QU8A 3MJRA 2AWNA 3T35A 1XZPA 1KNXA 1M7BA 3N70A 4TLDA 1GKYA 2BBOA 4M9SA 5E3HA 2XNDD 2ATXA 3R9IA 1YKSA 1IY2A 2CMKA 2QP3A 3B13B 3PUXA 4GSYA 1KDTA 2YV5A 2H7VA 4PR0A 4CYMA 4XVRA 4CDGA 3K70D 2V3CC 4Q66C 1G3IA 1NKTA 3K1JA 1WBBA 2O52A 2NO0A 3RDPA 4QJ5A 3BGWA 4X8MA 5FTLA 3KXIA 1W5TA 1PLLA 2VIIA 421PA 2L0XA 3DZDA 4DIEA 3K53A 1S8FA 4OYHA 3TR0A 3WMEA 4A6PA 5EUQB 1OXTA 3OESA 4LYAA 2CL6X 3U3RA 1OXXK 3LAWA 3RLFA 1L4UA 1OE0A 1FMJA 3EG5A 1OH7A 2OCPA 4BFVA 4URVR 4LX0A 4Z1MD 3IQWA 1T3SA 3SEAA 3ZVLA 3ZYCA 1OXSC 4KI0A 2WM9B 3QNUA 4LHZA 1MV5A 4LJ8A 4M22A 5CM9C 1VG1A 4OL0A 4G01B 3UG6A 4ZCMA 4HATA 1OFHA 3FVQA 5J4YA 4MKHA 4RD1A 1DADA 3R7WB 1VG8A 1WRBA 2QAJA 1GNPA 2GXUA 5KPJA 2IS4A 3CW2A 1E2PA 5DH9A 5FR2A 2NO9A 2WWYA 1E3MA 2HYDA 2ZJ2A 3K0FB 3AKDA 4AIIA 1HE8B 2XOKA 3MWKA 1IN8A 2J1LA 3NEYA 4JLMA 1WBDA 521PA 4V0NA 4N3NA 3L8YA 2CLDX 1KYIA 2H16A 3MUFA 4C30A 3I4LA 1NG1A 1QHYA 4IEEA 2JGNA 2X19A 2VP0A 5H70A 4IDPA 1W1WA 1XD8A 3KFXA 4TWZA 2IHBA 4B35A 1ZCBA 5EUMA 4Q4HA 5AJXA 3KTAA 1G64A 4JLOA 1XJCA 2V55B 2RGNC 1CRQA 2XAUA 1P4SA 1S3GA 4CEIB 4PC7A 5DGXA 3TAHA 1ZD1A 1U0LA 1B0UA 1NKSA 1M7HA 5L3SA 2I1QA 4GOJA 4A92A 4RZ3A 4ERNA 2C78A 2FSIA 4UXJA 2ZSDA 4ZI3A 3FHCB 1GITA 3QKTA 3EXAA 3LO5A 3KQHA 2LKCA 2OFWA 4TYWA 3AEZA 1E94E 1RZ3A 3B7GA 1BOFA 5FOXA 2MSEB 1BMFD 1P75A 4I81A 4XTCS 1E99A 4M1YA 1OYYA 2D4HA 1MRSA 5DN6D 3KQLA 3FWYA 5EP1A 5P21A 4A15A 3IIMA 3FMFA 2YINC 4OQNA 5EXPA 2OM2A 4YMWA 1GKUB 3SBDA 1VIAA 1II8B 4WVFA 1UKYA 5E95A 4RJLA 4JLPA 3TSWA 1FQJA 1BYUA 1G41A 1KTVA 3WRXC 2F3RA 2YKGA 3CNOA 1F6BA 4EPVA 3OFND 1Z6GA 721PA 1KK0A 2O8CA 1S3SA 1T3LA 1P5ZB 3MJHA 5JLJA 4NCKA 3W8NA 1E2GA 3F3YA 1DEKA 2G1KA 2Q0HA 2J87A 4QC2A 4LJYA 4Q18A 2QEQA 2R6DA 4NZYA 1E9BA 4D4MA 4KFTA 4C0HA 1QG4A 3TVTA 1ZVQA 1SKQA 3AGPA 1N6HA 1XPRA 2F9LA 1G6HA 2ZJBA 1TEXA 4QJ3A 1JQLB 3IBGA 1E2DA 5JEDA 3U7HB 1G5PA 1NF3A 2EFEB 1Z8FA 4I1VA 3X1DA 3EWSA 3CNLA 4S2EA 3NBFA 2IYWA 4URWR 4AKEA 4Z51A 3P4YA 2W2XA 3HYRA 2F7SA 2ZQ5A 5CDFE 2FGJA 2WAYA 4Q03A 2QPAA 3TVDA 1PZNA 3ETLA 5HKKA 3WP0A 3X1YA 1UJ2A 4MDFA 1KK2A 1MO3A 1N5JA 2FSGA 4B44A 4TSFD 2BJWA 4BLSA 2N42A 1VCOA 1XMJA 5KSOA 3GLHE 1DARA 1NLZA 5E7JA 2G9NA 1EK0A 3FMIA 1HH4A 1LS6A 4UQOA 3WYAA 4EAQA 2ZUBA 1XCPA 3EZ7A 3QXCA 4YMTA 4LJ7A 4TQAA 2CXXA 3HPRA 3TUIC 5AJYA 2QMUA 1AQUA 3A1WA 3KKPA 4IDQA 2OAP1 3C5CA 1N5IA 1NN1A 2IXEA 2H1LA 3BH6A 4JKYA 1E9EA 1CRPA 5EXXA 3A1SA 4QBGB 1E9SA 4QGHA 4IRUB 1VG0B 3P1JA 5HTKA 3B1WA 3K0AA 1KI8A 2QM8A 3HDTA 5GJVC 2PL3A 2R6CA 3MWYW 4GP7A 4HEJA 4LBWA 2ZAOA 3CF2A 1G5TA 3V4FA 1KKMA 2ONKA 5L8VA 1E0AA 2G0NA 1LB1B 2C04A 1N3BA 3R8FA 4M1SA 2X1VA 3B60A 4KBFA 1OB5A 1AQYA 4MITA 2XXAA 4DIDA 1XX6A 2TMKA 1OF1A 5H8WA 2OCBA 2PMKA 3A1VA 3SJZA 3D31A 1I4DD 1P62B 4KBGA 4M9ZA 4IXNA 1U98A 4PPFA 3LY5A 4NU0A 4B75A 2XZPA 1IM2A 2ZRGA 3B1XA 5FPYA 1IJFA 4B2IA 4DCVA 1GOTA 3T61A 2GAAA 3OIUA 2JASA 2HUPA 2P2LA 5B64A 3E5HA 4HAZA 4RD6A 1WXQA 2WMNB 1NG9A 2H17A 4Q4HB 3TE6A 221PA 1FQKA 2XSZD 1E2HA 3LBIA 4QGGA 1XZQA 4PZLA 4EFNA 3BOSA 1R4AA 5FTKA 4QOSA 3MD0A 5JWHA 3GEHA 3QXSA 3ICQB 1SVOA 1YR9A 4LY6A 1F5NA 4R71A 2RKOA 3VHXA 4M21A 5CIQA 4YLGA 2C03A 2OLKA 1MO4A 2WWIA 2F43A 3CRW1 5HPYB 1N6RA 1NSTA 2FEMA 3WNBA 3WMGA 1Y3AA 2YWGA 4JLNA 1DAIA 5DHFA 1YR6A 3B6EA 3RC3A 1JR3A 1T8TA 3A4LA 3I3SR 3QJYA 4U7DA 3GJ8A 1XMSA 4A36A 1N0VC 1Z0DA 1I2DA 1NN5A 3SYNA 3M1IA 1COWD 4BFZA 2V4ZA 3LBHA 1GRQA 2GETA 4PHFA 2GXSA 4PC1A 5F98A 1JJVA 1FTNA 1FUKA 4H1UA 4PQRA 4LV5B 4CEHA 3QXHA 1Z22A 4DKXA 1JPJA 4C0BA 2H5EA 2HXYA 2P67A 2REOA 4I1OA 5JHHB 3QUSA 2WJIA 3A8TA 1VPLA 1GRNA 4TQ9A 4M2LA 2DFNA 3OAAD 2J45A 4DB4A 2F9MA 5KSPA 1R10A 3IEUA 1HURA 4NPHA 2ZREA 4PAMA 1ZM4A 4G5GA 3GJ3A 2ERYA 1R8SA 2ZYUX 4TMVA 1NVWQ 2QMHA 1E4YA 3L0PA 1AS3A 2ZEJA 3DM5A 3PEYA 3VFDA 4IVRA 3U61B 3B5JA 1P60A 4LV6A 3TAUA 4QG7A 2HT1A 1T0HB 2GJ8A 1GL6A 4LPSA 5ELXA 1Z28A 3C41J 2O8BA 3ZVMA 5DYGA 2CVHA 2V6IA 4LSGA 3OHMA 2D62A 1Z6YA 3MMPA 4Q47A 4EQ6B 2CNWA 1TQ6A 1KI9A 3KFVA 4C2TA 4B2LA 3MFYA 5EZ5A 2XZOA 2V7QD 3DKVA 4OQFA 2UKDA 1E2QA 1ZAKA 5DI9A 1LTQA 5JHGB 3A1UA 2WJYA 1ZU4A 4MYHA 4D2IA 4DSOA 3FTQA 1G7TA 3IEVA 1YZTA 1U90A 3RRNA 2J7PD 4DHEA 4IDHA 3AVVA 3QI2A 3W3ZB 3U7GA 2R6GA 4UNSA 3K0AB 4V0MA 5EXTA 2REBA 2O5VA 3B9QA 4GI7A 5KNCA 1OH8A 5KTYA 3U3OA 2ZRCA 3PXGA 2PEYA 3RRYA 4AKHA 3GD7A 2FDCA 1O3YA 3MGCA 4IOKA 4TMKA 3THXA 1CJTC 1H8HD 2G88A 1A4RA 2Z4RA 3IKJA 1P2VA 1R0WA 4GBMA 1VMAA 2XXAB 3E2IA 1E0JA 1WE2A 2O0JA 4LZZA 1MOZA 5JWRA 5FOWA 4PZZA 1G4AE 2GK7A 4RD2A 1FZQA 1R2QA 1Q12A 3U3JA 3KL4A 5F3WB 1YRBA 3BXZA 4D4JA 3GPLA 2GVZC 2NPFA 3BRWD 4G5RA 3NH6A 2Z43A 1RFLA 1YR8A 3Q85A 1X6VA 5E4FA 2ZRBA 1TQDA 1T4GA 3IHLA 5J4LA 2VF7A 3AUXA 1XBTA 3CRVA 4E5UA 1M8PA 4LYJA 2XB2A 3CM0A 1N6LA 3K9GA 2WWXA 2IF2A 3GJ5A 2ONJA 1UBEA 1PLKA 5FBQB 3VKHA 3LVQE 3TK1A 1Q57A 3SHFA 4Q48A 3FYHA 3H84A 4OJQA 1YZKA 2ZSFA 3C16C 1FP6A 2DHRA 2VL7A 4BASA 4P33A 2F43B 2OCAA 2KWIA 4DLWA 1L2TA 5GJBA 4JIMA 3RWMB 3PIRA 5FUXA 4ZKEA 2GJAA 4KHZA 3Q9LA 3AVYA 1A2BA 2G1JA 3V4RA 4QBHA 4M9XA 1HV8A 1OFUX 2O0HA 2XNSA 3SR0A 4DWJA 1P73A 3S1AA 4D26A 4Q02A 2H18A 1W4AA 3NDPA 3ZQJA 5JSZA 1KDOA 2WHXA 1IN7A 2QM7A 1KZGB 5CK5A 4R9UC 2RB4A 2NO1A 3QG1A 4WXPA 4XWKA 4E03A 4CEHB 1NBME 4WW0A 3CRMA 1CEEA 4ON9A 3WBJA 3QEOA 4TYYA 3CR7A 5GJCA 5KDDA 3E1SA 3T06B 2FX3A 2GXQA 1Z63A 3KZ1E 4OJKA 4KV9A 2ZETA 1XXHA 4TMWA 2IYUA 5AK0A 3U7EB 2FE4A 2ZRNA 3GEEA 5CYPA 2CE2X 4WXRA 5TMPA 4V03A 4MH0R 3TW4A 3GLGE 1S1MA 3IIJA 4Q7MB 3BD9A 2H8KA 3CIOA 1EGAA 3U7FB 1VG9B 4TL7A 4FMDF 2FV8A 3LWNA 3GLIA 1M6NA 2VPPA 1DAHA 4O3MA 2CHQA 3I72A 4Q4JA 4US2R 1BO6A 3LXRA 5FBLB 1EESA 2JJ1A 1ZM7A 2ZRFA 621PA 3BC1A 1F2TA 1ETUA 5G3YA 3UMRA 4ILEA 1GM5A 4TLCA 1G4UR 4WZAE 1OHHA 5DYIA 3NBYC 3T1QA 1A1VA 1QHSA 5GVRA 4WIAA 4JYBA 1KJZA 2W00A 4OI1A 1TU4A 1SHZA 1UDWA 2CBZA 3B1YA 3H2YA 3LLUA 2A5YB 3PUYA 4NTZA 4DUGA 3MCAA 3MG9A 1EWQA 4AI6A 1RYHA 4F92B 3QBTA 3REGA 1WMSA 1D2MA 2BIFA 5JS7A 4JLDA 4WZ6A 2IW3A 3LW8A 1N5KA 4O25A 5KDLA 3QXJA 4Q01A 1AM4D 1GL7A 1CF4A 2OEPA 2C8VA 5DI3A 2C96A 2JLYA 1R5BA 5DIFA 1VKJA 4YDSA 2MSDB 4PC6A 1YRAA 2IK8A 4FINA 4IKEA 2ODWA 4JS0A 4WA7A 3U44A 3L2OB 4MYUA 4BRUA 1OB2A 3SU8A 4CT4B 1UEIA 4F38A 1P9RA 1Z0FA 2OBLA 1XU4A 1OIVA 3HP1A 4EFMA 3F0TA 1EG7A 4F91B 3NG1A 3SQWA 5LDDC 3K9HA 4JBWA 1G7CA 1LS1A 2R6FA 5CLQA 2J59A 1NLFA 1Z3IX 2QY9A 4Z54A 1VYUA 3C7KA 2IWHA 4CEJA 3W8RA 3L0SA 1RPZA 4MRRA 1PUIA 4KSCA 2GNOA 5F2EA 4TZ0A 4POAA 3EPLA 3FHTA 4B48A 2GVDC 3G0HA 2A5JA 1QHHA 2B7BA 4URXR 2GILA 2ZIAA 4IDOA 4AG6A 1KI1A 2EQBA 1KJWA 3B9PA 4BLRA 3R9XA 1E79D 3UXMA 2JLSA 2P5TB 2VYFA 4URZR 2RGBA 4XD7A 4JLAA 1P9WA 2VP5A 5FL3A 3BFKA 4WBSA 3EA5A 1XD2A 3CH5A 3D3QA 4L9SA 5FBRB 3T1TA 1ZC4A 2ZS8A 3MSXA 4OK6A 3K9LA 3GQBA 4HZUA 4TL6A 3RYTC 2J41A 3SC3A 2ZANA 1IN5A 2JLQA 4DRZA 2NPIA 4JL8A 2WSSA 4BLOA 2GJKA 2I3BA 4C0KA 1CJKC 3EX7C 1OH6A 1BKDR 1KI7A 4TMTA 4X8OA 4M1OA 4JYCA 3S1AB 1E2FA 3O8DA 4YXWA 2QBYA 4TL9A 2Q3HA 5JSZB 1AA9A 4DEXA 2UVQA 1G1MA 4YQFA 1KDRA 1NP6A 1GTVA 1E98A 2OE2A 2AFIE 4IFEA 4JBYA 2HJVA 2YOHA 4M1KA 5IT5A 4BFWA 2IXGA 3AVXA 2VLIA 1U8YA 3I8SA 2ZXUA 1XTKA 1UFQA 1Z08A 2QENA 1OKKD 1YZQA 4QGFA 4RZUA 4ARZA 2PX0A 3JZAA 5TARA 5F9FA 5BYJA 1SGWA 3RSOA 2OT3B 2V6JA 1EXMA 5IF9A 3SFVA 1XXHB 2F3TA 2EFDB 2ZROA 3CZPA 3DOFA 4FI3C 5EP3A 2CCJA 1ZNZA 2CCGA 3AKEA 3RS3A 3WNCA 3JVUA 4J0QA 5G40A 3SDZA 4NYMQ 3N2IA 1CU1A 1W36B 4NBSA 1GFIA 2WPDA 5HCNA 4BLQA 2QT0A 1PLJA 1G3UA 2BC9A 4OHWA 3IILA 2CE7A 3GLIB 2JJ2D 1C4OA 1TX4B 2IEZA 1RRPA 1JNYA 1Q44A 4L4UA 1Q21A 3IQXA 3P4XA 1UDXA 2ZRLA 3R20A 4Q4JB 4QXAA 2BEKA 2CNWD 2WWGA 4IOLA 5FBWB 1F2TB 1G8HA 2PBRA 4TMXA 1YZGA 1KO5A 2ZJYA 4JLVA 2ANBA 4PQYA 1US8A 3QPUA 1R0ZA 1N0WA 2QQEA 1EX7A 1KY2A 2OBMA 2ORVA 2PCLA 4KU4A 2JIZD 5EE3A 3GLFA 5JJLA 4ZCLA 4DDTA 1MO6A 4MYCA 2GZDA 1IN4A 3LXXA 2Q21A 5C2JB 3SJBA 3VR5A 4LCBA 5BN3A 4B2PA 4GOXA 1VTKA 3J81k 2F1JA 1JR3E 4M4SA 4F4IA 2GEUA 5DI3B 3B8HA 3KJHA 4GMXA 3CRRA 4B47A 2CJWA 4TTRA 4D0GA 2NO7A 3GFTA 3BFVA 1U2RA 4LI0A 5M04A 2LCFA 2QGZA 4M53A 3U44B 2BDTA 2R9VA 3C4JA 1VCNA 3EPHA 1ONBA 3MLEA 4YONB 1D9ZA 3CLVA 1K6MA 2WWWA 2HCBA 4DCSA 4MKGA 1TF5A 2ZYTX 3SNHA 1NBMA 1RVDA 1W2GA 1G6OA 4A0FA 5K8LA 1M74A 3SOPA 5IK2A 4EJSA 4UXHA 4CEJB 3OZXA 4AKIA 5B57C 1E1QD 5CYOA 2WWHA 2C95A 2VTKA 5FOSA 4TMZA 2JATA 1UAAA 4C7OA 1QHHB 3VX3A 1KI3A 2QT1A 1ZM9A 4DSNA 1XEFA 2J0QA 4LHYA 2WIAA 2NZ8A 5A0FA 3C15C 4HYYA 1KAOA 3LD9A 1NNEA 4TT3D 4ZKDA 5GJWC 1E2LA 3GLGA 3RC8A 5BQ5A 1WDTA 2F1IA 1UF9A 2W2TA 2B7CA 3FFAA 3ZJYA 4RSGA 4JKIA 1BYIA 1XD2B 1I4TD 2DR3A 4GNKA 2DB3A 2G3YA 4PHHA 1DG3A 3K8YA 2JJ8A 4HZUB 4HUTA 1JQJC 3DPUA 4IEIA 2ZYWX 3IUYA 1TUIA 5SZHB 4OHVA 2DWOA 4Q4LA 1G7RA 3TLXA 4EPXA 4EPTA 2YWFA 3NDBB 4ZV4A 1Z0IA 3RABA 5JCZA 2ZVQX 4KO8A 4CF7A 1ZYUA 2VQSA 4PPGA 4DDVA 2QBYB 3KXKA 3ZZ0A 3LLMA 2ZM5A 4KFSA 1IN6A 4V0ME 1J70A 3KKOA 4XSGA 3ZS8A 4BWYA 2R65A 3OEHD 5DISB 1OXUA 1SXJA 5LB4A 5AUQA 4TYPA 4LHWA 3EZ9A 2XITA 3A4NA 4R7ZA 2AKAB 4XSHA 3U6BA 4OHXA 2ZJ5A 2VHJA 1E9DA 4RCYA 2FPMA 2W6IA 2BBWA 1GWNA 2IF0A 1UBFA 4ITRC 1PVOA 2BMFA 3AV0B 1BIFA 1F2UA 4AURA 1A82A 4B43A 2ZUCA 3CPHA 1EFHA 3THYA 3EZ6A 2ZRIA 3CWZA 2B21A 2WOJA 2GKSA 4OI0A 3HPQA 4E09A 4QGAA 1W0KD 2O8FA 2OBNA 2EYQA 1KO1A 3LBNA 1ZINA 4OI2A 2VO1A 1DOAA 2XX3A 3CONA 3DMDA 4LYFA 1H8EA 1KY3A 1US8B 4Q1CA 5D3MA 3BB4A 4HLUA 4DUGD 1GDDA 5JJIA 2N46A 3TGPA 3A1TA 1R5NA 1CULC 2A5FA 2C77A 3GLFB 2WKRA 1IXSB 4HLUC 1Q3TA 3PUZA 2WJHA 3QF7A 4Q00A 4HAWA 4FCVA 1YR7A 3I62A 1RRCA 3H4MA 3KKQA 3KXLA 2NGRA 4LK2A 4WAUA 4BFYA 5C4MA 4GZMA 3ZVRA 2AX4A 3TNFA 3PJRA 2JLZA 1RRFA 1ZUIA 2CJWB 1KDPA 2QE7D 3Q3JB 2F1RA 1KO7A 1K5DA 1U0JA 2D06A 2BEJA 3NHAA 3TBKA 3T5GA 1P72A 4JZKA 3EWAA 1KOFA 3EZFA 4TLEA 3UWKA 3CR8A 1ZUNB 2IYYA 4LJ5A 3I73A 2OHFA 3KJIA 4JLKA 2FWRA 3AKCA 2IS6A 3FE2A 4BRWA 4GT1A 5FUVA 4BFUA 2J0UA 4QM6A 3B82A 2FFAA 4LPKA 2QGNA 1D6JA 4LJ6A 3VR1A 3OIVA 1XPOA 2QL6A 4JVMA 1XCMA 1XXHE 1JXMA 2DY1A 2ZRAA 4FCWA 4NYIR 1SKYB 2GF0A 2WICA 3ZQ6A 2A7QA 1W47A 3QQ5A 4JVLA 5KNDA 1ZMXA 1I4LD 1KKLA 4C7OB 3RS5A 2HF9A 3M0EA 3QF4A 4AD8A 5D3QA 2ZI7A 3BAFA 1FOEB 1M34E 5C4GB 4ZCIA 1G3QA 4LGMA 5B30A 4TN1A 3D6TB 3ADCA 2W0MA 4LC1A 3EPJA 2VBCA 5JI3E 4NHOA 3AF3A 1SULA 4PPNA 3GLIE 3K09A 2O0KA 4UXIA 4YMVA 3DEFA 5J4KA 3FMPB 3GLGB 2OG2A 4A82A 3BB1A 2N1BA 4US1R 3K09C 1XWIA 2OILA 2DCUA 3QXXA 2VP2A 4KYUA 4QNRA 2E9SA 4XIGS 1KMHA 2BCJQ 5EZ6B 5CJ2A 2GZHA 1NVUQ 3KTAB 2VSXA 4HB4A 3Q8XB 3PEUA 3RHFA 2FFHA 1XTQA 2IL1A 2IWRA 2WSSD 3RAPR 5K8IA 3UMFA 2ZE5A 3PV0A 1EFRA 1E9CA 2QRZA 1C9KA 5AUOB 4TLAA 4DCUA 1Q3HA 2VRWA 4P31A 3W6PA 3I5XA 1IQPA 1U9IA 4Q9LA 5L3SB 2ORWA 2ANCA 2BKUA 4YXWD 5A4JA 1G16A 2IC5A 4Z8XA 4AKGA 1U9IC 3AGQA 2A5DA 3A4MA 1N6OA 1S1CA 4B6EA 2X2EA 1DAFA 4C4PA 3F5FA 2KJQA 3U4QA 1SVIA 2Y8EA 2GK6A 4A0HA 1SQ5A 1SXJB 4MRVA 3CWQA 1CJMA 1R0XA 4P3YA 4LC0A 3BERA 4Q9IA 1S4QA 1SVKA 5BWMA 1W0JA 2FZ4A 2HF8A 1MO5A 4ASUA 1DG1G 2OV2A 1GNQA 2CLSA 2IYVA 2Z0MA 3V9PA 4IFBA 4N0EA 1L4YA 2QN6A 4URYR 3AF4A 2ODNA 4XTRA 5IHPA 2ZS7A 2WPDD 3AF1A 2K5UA 4RZXA 1F2UB 1DVRA 3B85A 1E32A 1DPFA 3KX2A 1P9NA 3B1ZA 2QUZA 5LBIA 3THYB 5DE3A 2XTNA 2O8CB 2I1VB 3PEVA 3ZGXA 3QKRA 3TRFA 4MRPA 3AM1A 3KJEA 2HEIA 4ZDKA 1E2IA 1OFTA 4BFTA 4O2RA 4CT5A 2O8FB 1EFCA 3IO3A 1S2MA 2A9KA 1HE1C 4P4SA 2MSCB 2JLUA 1JR6A 1LF0A 2VP6A 4OKSA 4PAQA 4HDCA 3OE7A 4G5OA 3D7MA 2XZLA 2WIBA 2AL7A 4ZDJA 2ZUDA 5D3MB 1JECA 2GWHA 4HZIA 2WKPA 4MKFA 1Z06A 4PO8A 3CRQA 4QBFA 1GP2A 3CNNA 1R8QA 1WCV1 1Z0KA 1Z83A 2CK3A 3QG5A 2G83A 3UIEA 5H1YA 4PZYA 3X1WA 4DLZA 4HB3A 1DELA 2MMCA 3PUWA 3LW7A 2ATVA 4W7SA 1AZSC 1Z29A 5FI0B 1T0JB 4DT1A 4IOJA 5AUPB 4HSEA 2LWIA 3TIFA 3GFPA 3VAAA 4GZLA 4QFMA 1X8LA 2Z5FA 1JJ7A 2ZJAA 1G291 2OXCA 1HT2E 3I61A 3NVAA 1G9XA 4B32A 1WA5A 2W83A 2AN9A 1V43A 1JI0A 2FG5A 2P6NA 5CJPA 4HDQB 4Q1BA 3U3KA 2ECKA 3EA0A 4PTLA 5FBVB 4B3XA 1X8JA 3RS2A 4N0DA 1NBMD 2J0UB 2H92A 4GMDA 1CTQA 3BJIC 1P2UA 4JBXA 5F9HA 2EW1A 3REFA 1UPTA 3NEJA 1QRAA 2QORA 3DMNA 4HUQA 3JVVA 4FXPA 1WB9A 3TUJC 3P26A 2D7CA 5SZIA 3V00A 4RCZA 2ZJOA 5TDHA 3FKSA 1UADA 1FUUA 1D2EA 3QF4B 1X1SA 1RYFA 2P3SA 2XOKD 4O2LA 2FPKA 3TSOA 1LVGA 4B73A 5EJEA 4NYIQ 2C9OA 5GVSA 3O8RA 3T15A 821PA 3F8TA 2GJ9A 1GNRA 1S96A 3IIKA 3EASA 3K70C 4L16A 4D6PA 1AKYA 2FOLA 4B3BA 4C0SA 2PZGA 3N2EA 3ND9A 4XVUA 3QIAA 1NLYA 4UJ5A 3GJXC 1E9FA 2WMOB 3I1FA 5AUNB 4D80A 4Q7KA 3PUVA 4Q4AA 2FPLA 1KMHB 3SFZA 5J47A 2QZ4A 2D2FA 2ODEA 4LHXA 4Q5IA 2A30A 2JLVA 2BVNA 2XB4A 4P4UA 4I1SA 1F3OA 2NZJA 3RS7A 2C99A 5L3RA 3GLFE 2V1XA 4RFSA 3U5ZB 1T6NA 4KITB 4V02A 1TF7A 4OQLA 4V0OA 1F48A 3EPKA 4F4JA 2SHKA 2HYIC 2ZSBA 1L7VC 3BB3A 2FNAA 1JXOA 3LQQA 4TQUS 1AIPA 1OT3A 3HR8A 3LDAA 1KI4A 4Q21A 3ADDA 2UZ3A 4K46A 3X2SA 3IBYA 2PCJA 2ASEA 3I5YA 2IX3A 3CZQA 2PH1A 4HB0A 3ADKA 4DC9A 2P65A 3U4QB 4PSAA 4BPBA 2EWVA 5IRCD 2DYKA 4JLBA 1DE0A 1T91A 3FDIA 1G19A 1Z0JA 4LJ4A 2RGXA 4P32A 2O8DA 1T5LA 3LRPA 2FA9A 3AVOA 2E87A 3HU2A 3VHLB 1K8RA 1P2TA 1U81A 5CIWA 4TZ6A 4XVQA 2QP4A 2IUUA 1HQCA 3WNDA 4YMUA 1R0YA 5JFGA 3M4YA 3EZ2A 4LDJA 2W6JA 2ZS9A 1SKYE 2G6BA 1ZW6A 2GF9A 2KI5A 3HYTA 3PITA 4G3XA 5CK4A 5CB6A 3LH5A 3NHBA 4G0NA 3QKRB 4NYMR 1ZJ6A 3L8ZA 1U94A 4BGDA 5JWOA 3NIBA 3ZH9B 3CPJB 3GCGA 3HR7A 1KHTA 4M1TA 1E96A 4P4SB 5AJWA 3O8CA 3U60B 1XRJA 2V54A 2JAQA 3VNUA 1HYQA 4Y0AA 1OXVA 2KE5A 3CF6R 3AVQA 1XFAA 4NL4H 3GFOA 1QF9A 1XDBA 1GG2A 4EFLA 3A36A 2R2AA 1RKBA 1CJVC 3VMFA 2GCOA 1W36C 2NOAA 3QEJA 4WZBE 3PG5A 4IW3B 4M9QA 3BH0A 3K0CA 4HDOB 3VTKA 2O8BB 5DN6A 3ICEA 2PEZA 2QSZA 5UKDA 5HKKD 1ZNXA 4LHVA 3OF5A 4QNMA 2GXAA 1QVAA 3X1XA 4A4DA 5FL7A 4AYTA 3QVUA 1NIJA 2FFQA 1IBRA 4A0GA 4DT1B 3UG7A 1Z47A 1G8YA 2YOGA 3ADBA 2GJSA 2W0SA 2GZAA 1JAHA 5FOTA 4Y0VA 1ZM2A 5J4HA 4RZ2A 4AYXA 1NJGA 2HXSA 3OFNA 3O47A 1QHXA 4OHZA 1W7AA 4IJMA 4FMCF 2Q3FA 4KJZA 1M2OB 4DB2A 1JALA 4MA4A 4G5SA 1XTIA 2ZSAA 1SXJE 4ACAA 3B78A 1BS1A 4CW7A 3CB4A 3IPXA 3P20A 4Q9KA 1E2NA 2ZTSA 5LD2C 1VHTA 2OLJA 2OFOA 2QAGA 2VH5R 5CLLA 3BBPA 5AJZA 4Q1FA 3THXB 2WVJA 2IS1A 2GEDA 1TPZA 1ESMA 2QAGC 2WV9A 2BOVA 1N6IA 1WP9A 4FMCB 4D4KA 3RRMA 2CCKA 5FTMA 1QG2A 4TYQA 3K70B 1UKVY 4NCIA 4QL3A 2B6HA 3RNLA 1J2JA 2XEXA 4RFVA 1T3HA 5BN4A 2ZRPA 3WHKA 1Q20A 4QM7A 2QTFA 3FB4A 2P0EA 6Q21A 2QROA 2GEVA 2VP4A 4PSKA 5BYKA 4PHGA 4BE7B 2FJUA 1SVWA 3TW8B 4GFDA 2IYXA 4Q4AB 3TMKA 1A2KC 1D5CA 1S9HA 2NG1A 3BWDD 3WMFA 2WAXA 2AKYA 4RD0A 1EFRD 3T1VA 1IXZA 2ZI5A 4EPWA 1LW7A 2J0SA 3VX4A 2JA1A 4W5HA 1Y63A 1MT0A 4RFSB 5G53C 4YMSA 1FW6A 4DDUA 4F93B 2J0VA 4JVSB 2EU8A 5JZVA 1ODFA 2RGAA 4CRWB 4GDFA 3CX7A 1IJEA 4RVCA 1CR2A 3QY0A 3HWSA 1FPMA 5AJVB 5EE0A 3CBQA 3QVVA 4P0TA 3TR5A 4BLTA 2VHTA 1JR3D 1D2NA 2OXRA 5CB8A 1N25A 2OFXA 3T1OA 4OK5A 4M1MA 121PA 2ZI9A 1J8MF 4UNQA 3RANA 2DWQA 4NKRA 4ASUD 2OCYC 4C0QC 2YYZA 2O8DB 5FUWA 5FH9A 4ZDWA 2NIPA 4JL5A 5TY0A 1GUAA 1OW3B 4ZIRA 3G5UA 4XJXA 5KDOA 4NH0A 1Z5ZA 1UEJA 3LV8A 1K5GA 2VHCA 2QA5A 4XWAA 1DAGA 3UK6A 2XSZA 4LJAA 5EE5B 3KQNA 3AVWA 2IYZA 1LY1A 3HU1A 4RY2A 1KSFX 1R7RA 1DO0A 2ZI6A 3H86A 2IS2A 1W44A 3GP8A 3BORA 2HCJB 2QTHA 3IDQA 3IHWA 1U0HC 1E0KA 5FFMA 4OQXA 3OE7D 3VR4A 2H57A 3AUYA 4B6FA 1XCGB 2CL7X 2V9PA 2QNRA 1E2JA 5J4VA 5LPNA 1HA3A 4FW9A 1I2MA 1DTSA 5A5GA 3RRZA 4DJTA 2GCOB 2ODBA 2IUSA 2FH5B 4PC2A 1XTSA 3LVRE 4DBLC 4NE2A 3MWLA 2ZI4A 4EDHA 3C14C 4OK3A 3GJ7A 2F6RA 4MRSA 2RAPA 1UBCA 1COWA 1QHIA 2HLDA 2KBEA 3TQCA 4ACBA 2P6RA 3MRSA 3UANA 2QTVB 1P3JA 3RVBA 4ESHA 4BZPA 1G5RA 2IYQA 3A58B 4L15A 3OIYA 1SVLA 5KO2A 5EP4A 3SQXA 4HI0E 2ZE7A 5DO9A 3W9YA 5EE9A 4MGIR 3I32A 5K8TA 4JL6A 1X86B 4Q1AA 2ZR0A 2KBFA 5LD2B 3OAAA 5KNBA 3PCRB 2EWWA 2EVWX 1GL9B 4DEYA 4DLRA 5KU1A 1KJYA 3MAAC 4ZPXA 4E07A 3U6KA 2XTZA 2E1RA 3DDCA 4KLNA 4LYHA 3ECCA 1DAEA 2QAGB 1P6XA 2REXB 4QRHA 1W48A 3UATA 4DXAA 3FKSD 3NC0C 1JPNA 2WJGA 4AC9A 5EXSA 3BH7A 2J3EA 4YDHB 4G5QA 5HR5A 4Q7JB 1X1RA 1YE8A 2UZIR 2ORIA 3QKSA 5FPKA 3DZ8A 5CM8B 3C5HA 4RD3A 1KZ7B 4US0R 3QKUA 1PUJA 4OI4A 3FMOB 5ANRB 1L8QA 4IXMA 4TL8A 2V7QA 2VHQA 4IVPA 4MQBA 2VSOA 2QRNA 4OBEA 1FP7A 2HT6A 4EJSC 1AZTA 1Z6AA 3NBZC 3E70C 1E0SA 4D4LA 3ZD6A 1DS6A 2BBTA 5EQTA 1KSHA 3CKLA 4R2HA 2J7PA 3BIFA 1KI2A 1TEVA 2A2ZA 2QQ0A 3EIEA 2ZE8A 3EIHA 4WOPA 1G8FA 1E6CA 2GA8A 3QENA 5KOYA 1GZSA 4LJ9A 3AVUA 4NCNA 1W5SA 3VKGA 3K0SA 1AN0A 2W58A 1P61B 2PX3A 2YWHA 2ZRKA 2JLRA 3NKVA 1E2EA 3AP1A 4Q7LA 4A2QA 1MRNA 2R6AA 1H8HA 5B2ZA 3NH9A 4LBVA 4W9MC 1FX0A 2GDJA 2EFCB 3GJ4A 1VCIA 2B92A 2GESA 1NY6A 3TQFA 2PZEA 1NSFA 3HJNA 3AF2A 4Z8YA 1RW4A 3SYLA 2IXFA 2GCPA 4FD2A 2NMVA 4FCTA 1VDZA 3DVLA 2RGNA 4ZIRB 4NYJQ 4I99A 1U8AA 5CITA 3PEWA 3PR1A 2ZVPX 2W6JD 2WWFA 1TAGA 2VEDA 2BWJA 3BK7A 4PXAA 4D0LB 5JMTA 5FI1B 1R6BX 2CHVA 4UNNA 3SJCA 4M8NE 4C0LA 1XB2A 4JT2A 1OFIA 2ZRHA 2RGGA 4ARZB 1SXJC 1KSGA 1O87A 3WY9A 4A0RA 1H65A 2J5XA 3WHLA 5BN5A 1N5LA 4UNPA 2JLXA 4DLSA 4HAUA 2HV8A 1W36D 2PMDA 3AVTA 4X8LA 3KKNA 3PENA 3AVPA 2C9CA 1QDEA 3A6PC 1IXRC 1IY1A 1SVSA 1IONA 1AGPA 2ZRJA 2JJ1D 4QKQA 3ZIAA 3BFXA 4ZO4A 4KLZA 1A5TA 1G8PA 4JVNA 3VR3A 3K0EA 1OHHD 3A37A 3ZDQA 5FPTA 4NDZA 4B3FX 2DFTA 5FL7D 2CVFA 3MWJA 1OJLA 3NTUA 5AR1A 1GSIA 1RRGA 2Q9BA 4Q9HA 4EPYA 1KGDA 1HTWA 3Q7QA 3CX8A 5JEEA 1W46A 2WJJA 1KI6A 4PO9A 3KQUA 1T9HA 4QHTA 2RHMA 2ZAMA 1NMZA 1DBSA 1G3RA 1TQ2A 2WJVA 3AB3A 2DBYA 2AD5A 4L9WA 5JS8A 4EPRA 4NMMA 1ZC3A 1JAIA 2QP9X 1ZIPA 4H9GA 4HLDA 1U99A 1KMQA 1EX6A 1FMLA 2BM1A 2AR7A 4P4TA 3QPWA 4A6XA 4M0LA 4LRWA 1XMVA 5FPHA 4NONA 2Q6TA 2WBLC 1MABA 1G3MA 3O8BA 4D0NA 4LV8B 2P6UA 1TU3A 3ZS9A 2GCNA 4NCJA 1IAQA 4YC7A 4EQ6A 4LBZA 1FL9A 2WSMA 3Q7PA 3QKSB 2FEOA 1W4CA 1X8KA 4BQSA 3WYFA 2X77A 1X3SA 1CLUA 3L0IB 1NY5A 5TB5A 3W6OA 4RKEA 4EJSB 1M7GA 3THOA 1GKIA 2AXNA 1VIYA 2QSYA 3ZLJA 1T8UA 2Z83A 1YZNA 2ZRDA 4DLVA 1DO2A 1E2KA 2ZRMA 1E1RA 4R98A 2HDNB 3EW9A 2IYTA 5SZJA 1AKEA 3SS8A 4XD7D 2V8OA 2XTMA 2PT7A 1XEXA 3THWA 2R62A 1EFTA 1G18A 4EIWA 1BH2A 5L3QA 4HB2A 5GADl 2BM0A 2OO7A
chains in the Genus database with same CATH superfamily
1TUEA 5DHQA 4ZQHA 2RH5A 1ORWA 1ZCAA 5FHRA 1P7CA 4GVLA 3TLKA 3T7DA 3MQ4A 2O8EA 3FFTA 1WXIA 3WYGA 1P19A 4MAMA 2GCGA 1GVNB 1YKGA 3R6TA 3EZGA 4HAXA 3K71B 3AUJB 1RHKA 2AEJA 2ECOA 1RIFA 2OV1A 1EDEA 2PRKA 2WZQA 4AULA 3E7XA 5D8DA 2JBAB 4IIUA 3R8CA 4ID3A 1CKEA 2Z6VA 2YVQA 4FU0A 1GAEO 3RBAA 3G8YA 1AGRA 2M6KA 4Y9TA 4L74A 4K6MA 4LBYA 3WXMA 4BEJA 2Y2VA 3AL2A 1QP7A 2PKYX 1FTSA 2FMXA 1SELA 4G0OA 4TVOA 3D3JA 1VMEA 3T3EA 4ZZIA 1G21E 5A6SA 1XF9A 4IYJA 1D07A 5PNTA 2A94A 4XIJA 5FR1A 2P3LA 2PX5A 2NZ2A 1TJNA 2VZ0A 3I6YA 3D1VA 4N5HX 4AYWA 4ETWA 4JLJA 4QU5A 4C6RA 1EDZA 4Y2SA 3NHYA 2IHYA 2X0JA 4EHNA 4RLQA 1UOEA 3OZWA 3O8QA 4QVIA 1QP4A 4L57A 3GJ6A 4KCGA 1MD9A 2BMDA 3E9CA 2PV7A 4QYMA 5BN5B 2YHUA 3W4KA 4F7WA 4I1UA 4OVKA 4GDMA 5LZ5A 1WXFA 1NLMA 4LAFA 4YV7A 4A9AA 4O1IA 4DLXA 2UYGA 3VBCA 1E7YA 1GZ7A 2GT1A 3DLPX 3H0KA 3SC4A 3A6DA 1N2CB 1N8SA 2J3QA 3DTNA 4FONA 1JFFB 2BEUA 2E2WA 4HNAA 5LJIA 1AS0A 2VVTA 3JWPA 4IJ6A 4DNQA 2NQ2C 4EX7A 4HS4A 2F55A 5BR1A 1Q1BA 2QX8A 3DC7A 1U0EA 2L69A 4FZ3A 4PIPA 1CQZA 5HE8A 2E5LB 1UJMA 2O48X 2RJNA 3EC1A 4DLUA 3Q5DA 5J40A 4CL0A 2CNOA 4GYWA 1Y8AA 4OXRA 4GBGA 3TZHA 3JTEA 4PQEA 3UKOA 1EQ2A 2HJGA 5E7MA 1ONPA 3FGNA 2ZWVA 2IUTA 1SD5A 5CA1B 2VA8A 2ZBQA 3H5NA 3IXMA 2RAUA 3JSXA 1EXNA 5FWNA 3A6ZA 4R0MA 1TQ4A 2WQ7A 1G38A 4RQAA 2I4IA 4TOIA 5AHKA 2I6FA 1XZDA 1CJUC 1RZUA 4G1VA 4LMPA 3BJMA 5L3ZA 1UFOA 5L53A 5K1ZA 2E49A 1OKKA 1LJLA 1FUIA 3AIIA 1U9CA 3KDPA 3ZVNA 1TL7C 4A6EA 1BWQA 3FZGA 1AS2A 1E5LA 3LG2A 3U4CA 3ASYA 2O2HA 2AEMA 3E05A 3H8VA 3KPJA 2QMOA 2AD1A 2OZLA 1V8BA 1TJPB 2R8RA 1TF2A 3K1ZA 5DLDA 2C7PA 4KFUA 2AW5A 5HF5A 3KSUA 4D1YA 3GMDA 3N6RA 1FTWA 1II9A 4YJGB 3WGHA 3O9ZA 3U4IA 1KQNA 4ZO6A 3D8BA 4Y6LA 3FGOA 4MZXA 5K99A 2NO5A 1MR3F 2XA2A 3NTQA 4NZPA 4OKIA 2JIMA 2O57A 3L49A 1MABB 3U3DA 2DQYA 4TUYB 2BTQB 3DL0A 1IIRA 1UMBA 4QUIA 1U3UA 3RRJA 1Z6ZA 1TTTA 5IT0A 1JP7A 1U5BA 3KUCA 2CLFB 1R6VA 4UBMA 2D00A 5C51B 3BHIA 3OBIA 3M6VA 1KKUA 1Z2AA 4G8JA 2JFPA 4MQ4A 4LWZA 1SVNA 2GN6A 4X7BA 4D56A 4DPKA 4R05A 4FQ8A 1F60A 1ODTC 2YHIB 3IAS1 3Q98A 4EG1A 4QT4A 5K0TA 3TAXA 5ALKA 3SQNA 2E89A 5KYVA 4DV7B 3ZLTA 1SB8A 2O5CA 4JJGA 4V0LA 1BHQ1 2J9XB 5CB0A 1T1IA 2WT8A 3I4CA 4FW8A 1V3TA 1MPTA 1VBMA 1YVDA 4WCFA 3NT5A 3AFIA 4NP6A 2FUKA 1XALA 3UN1A 3HMKA 2D2EA 1ZNWA 2C2KA 4ZOCA 4BB5A 2HK9A 4FZRA 2XCRB 4G0PA 1RZRA 4Z5XA 2QG6A 3RSCA 4RTKA 2RK6A 1ZMOA 3BGOS 1WV0A 1O58A 2G77B 3C1OA 3N7UA 5T8KC 3T5TA 1NJFA 3EODA 2G36A 1ADCA 3GELA 1VPWA 3THWB 1NF2A 3M4XA 3SK0A 5A7FA 3SBEA 5L3QB 5I7RA 1AQNA 3GLTA 2LBPA 2XH8A 4RHEA 3ZV4A 2ZU6A 4MKIA 1YCFA 2B8WA 2OXIA 2AXPA 5K8UA 4D25A 3AP2A 1MIOB 4L5BA 1GUYA 3II6X 4OD0A 2EYUA 3ZDDA 3IIIA 5IF3A 4A2WA 5CVVA 2HK6A 5HZKA 2Q45A 2EV9A 3PNKA 4N41A 1RABA 3HE3A 4PPYA 2C9DA 3U80A 1FFXA 3CVVA 2CBGA 2H31A 1C0KA 2JVJA 3GL9A 3LC2O 4MVJM 1N6NA 2IE0A 4QBIA 4AY3A 5A06A 4UNRA 3MPUA 5EIHA 4LTMA 1YMVA 4KVGA 1SXJD 4PYMA 2I9KA 1LNZA 2Y9PB 1K7CA 3VZSA 4EB6B 6GPBA 2JIOA 1MH1A 4GZ6A 3KSMA 3KT0A 3F7OA 1T36B 2B94A 3HK2A 1FFGA 2AOVA 4UDXX 3K73O 4C76A 2J5RA 2QZJA 3O74A 4Y67A 4N3BA 1TYCA 4JX8A 4YWHA 3CN7A 4CG0A 5L7YA 1H2XA 2G71A 2PH7A 4RY8A 4X1OA 3BK1A 2XUIA 1QH0A 4FEAA 1CIVA 4JSTA 1S2NA 4XZ3A 5NLLA 1T5BA 1RCUA 5HIAA 1P6QA 1U7PA 3DE7X 4R7GA 5CDFA 1J2TA 3KLOA 4RADA 1JHAA 3FTEA 1C7RA 1GGHA 2G4VA 4YH1A 4OL9A 3D8HA 3NRBA 2B34A 3SZGA 1RM5A 3VR6H 1GKLA 2Z2JA 3D4BA 1RJ9A 3P0IA 1VRVA 1NI3A 1FFEA 1KYZA 2BKEA 3B2EA 4PW0A 3RUDA 2JI9A 1PT6A 3O8OA 3AOEA 4LYGA 4J94A 5IM4F 4EYEA 1VL2A 2FX5A 4MROA 1YU9A 5K3EA 5LDHA 4GR9A 3L18A 3CEPB 1H8ED 3CV3A 2FLVA 1UM8A 3DE0X 4GGMX 4ZT7A 2XVAA 3RHZA 3BJRA 1ZU5A 2VTDA 1GRCA 1I01A 3EGDA 3PRHA 1AQ6A 1ECBA 2NO6A 4PV7A 1BMFA 1PNRA 4ND2A 1AHIA 2OOKA 3BMNB 1FEZA 3IQIX 2ZVDA 4NJOA 4YPFA 5B2FA 3ZHUA 3WAJA 3GRYA 4K1XA 4DIFA 3CPEA 3ZHTA 1IK4A 3MTGA 4D8TA 5DLQC 4TYNA 3FOBA 4AO6A 1AZLA 4J7CA 3LCVB 4G8BA 1Q7EA 2XKAA 3WS7A 4EKIA 3C48A 4PZPA 1CBUA 1HUQA 2ZG6A 4YJ2F 1Q2UA 3NLLA 1UH5A 2ZYDA 1QGAA 3IHTA 4BNJA 2DPXA 4PBTA 2GPWA 2ZKLA 4G36A 2HZBA 3P9QA 1JJBA 1GXSB 3OZAA 4KQIA 3I01M 4J4BA 1L3CA 5A1JA 1A8IA 5KQRA 5AKZA 1DOHA 1M2VB 4BCDA 2JFWA 1VIMA 1JEDA 1GPWB 1M2WA 1N0UA 1QH1B 1Z8DA 2GPTA 1JHOA 2E18A 2HU7A 2HRBA 3I53A 1T6ZA 3QLEA 4TXNA 1PR9A 2G67A 3CLHA 1HFKA 1W0KA 3LY8A 2W2QA 4FLMA 4U00A 1N4DA 1Y1LA 4MPTA 5DSZA 4YQEA 5BW5A 4V0KA 2LIVA 1LV7A 4FEYA 1T5IA 5A2QA 2DTEA 3LY7A 4O4HB 2ZJZA 1RE0A 1H6BA 3QFFA 2UYCA 1ZP6A 1JKFA 2NZWA 4A8JB 1QV9A 4RMNA 4FCCA 1RWKA 4IHQA 1QFMA 5BSEA 1YQDA 1NXTA 1M2NA 2JH8A 4JHLA 3T7EA 2EBWA 2FN4A 1Q7TA 4WOJA 5FP0A 4ER7A 4R41A 2XTJA 3NTVA 1D6NA 3PC7A 4N5MA 3IJPA 4FMDB 3V1YA 1MAWA 4B6PA 1W49A 1C9YA 5ALIA 1ILEA 2VAXA 1HE3A 4U7GA 4PHCA 2ETXA 2JCSA 1ZNQO 1KIMA 4HYEA 1GNSA 5ICEA 3FFBA 1E9RA 1CZUA 1HRKA 2DHQA 2RDMA 3LI2A 5IUNC 1ZZEA 3GRZA 1WZCA 3BE8A 1NZDA 2R47A 3AEKB 2AFHE 3AUUA 1XPUA 2TRSB 1CFZA 2AOUB 3IPYA 5AI0A 3T9FA 3QEAZ 2IZZA 3K9NA 1SQSA 1O9HA 1JB9A 1P8JA 1PZMA 2IU3A 1ZRMA 2B5WA 2R751 2Z4SA 3UA3A 2QVXX 5JRJA 2A9VA 2C2HA 3GC6A 3UCFA 3DVAB 1W0CA 4CQMB 3BDIA 3EXG2 1FRZA 5B3LA 3RUIA 1VP3A 2X5KO 3UOGA 3GMTA 2C5HA 2QVLA 2SNIE 3K5PA 2BCGY 4K3UA 5DT2A 3UJCA 1VSTA 1Q14A 1U7ZA 4RJIA 2PZKA 4CLOB 3DSRA 5IJ0B 1ZA1A 1EZ1A 2YV1A 2Z30A 2QW0X 4Q6WA 5IX8A 4CZ2A 2CXSA 4R51A 2GHQA 2RAVA 3MWDB 1A9ZA 2AI3A 4OJNA 2AOXA 1E0DA 4HAYA 1K9VF 3NW9A 4QJ4A 1V5EA 4ARBA 4YUXA 4C0XA 4RVDA 2CVZA 5HIKA 4XDZA 5JI2E 2UZ1A 3EIQA 4M99A 4MUIA 2HLNA 4WLVA 4BL5A 1ZK0A 4EUNA 4PZUA 3UNXA 4ZV9A 4KQKA 4FNAA 3NORA 2BMEA 3NYRA 5K2OA 4QUKA 5G0SA 2JD1A 1ZUHA 3OTWA 4LISA 4NYJR 1QZTA 4JITA 3L1JA 4PLZA 3ZDFA 4FBLA 2WOOA 1G55A 2VSFA 1Q50A 3Q9UA 4D82A 4Z4FA 2YWBA 4KSBA 3NFYA 5B58C 2OXFA 1N1DA 3JQGB 1XP8A 1GR0A 4QDXA 5FOUA 4D79A 3AT1A 2OHJA 3SIRA 1L9KA 2FZLA 3N5CA 4Z0NA 1W34A 4AJ9A 4ZD6A 2ZAGA 1J07A 1W73A 4MRNA 5C8YF 3QLTA 4Y2YA 3DDHA 4MWBA 5IKOA 2E5FA 2X8AA 1TCVA 3A04A 3HEAA 5I9LA 2WWRA 5CYFA 3ANNA 4IPTA 3WRYC 4N1AA 5HBGA 3WGTA 5BUQA 4ZIRA 5JZ9A 3I83A 2BGTA 2FPSA 4MUBA 1IEXA 5ILQA 2QM3A 3W2EA 3W5UA 4E11A 1KBZA 1DDIA 1II0A 1P80A 3LDFA 5J2TA 3A1DA 4I4IA 4OHOA 4LXIA 3ZY6A 4BNMA 5AWFC 5A62A 4DLAA 2EP5A 1YOVA 5KYXB 4DVGA 4AVYA 1OC4A 5ESRA 4HRXA 5K2MA 3KB2A 2OCKA 4CG3A 4ER5A 2WIFA 4GE0A 4TTPA 2C3UA 1ACLA 4UMFA 2CK3D 2ZYSA 1YMUA 2C1ZA 4Z3DA 3TKLA 4UTRA 4AKSA 2Y71A 3VZQA 3WL7A 5JDIA 4S1NA 1Z12A 1VB5A 1DIAA 2KPOA 3PQCA 2YIVX 4RX1A 2JIBA 3ITDA 4H6WA 1NI5A 4L6AA 4BLWA 2QTZA 3B8EA 1EWYA 3ORYA 4XQ0A 3IELA 3U7QB 5CG2A 1WDLA 3ZQKA 1BWSA 3PQFA 2DFLA 4DSTA 5AVRA 4U4AA 3OLXA 5K4GA 5HZHA 4IO0A 3WSVA 4LOAA 1HYEA 4PBRA 3M6MD 3KDSE 4HGRA 1TFUA 2PZFA 1N75A 1IZ8A 4K40A 4Q1EA 4IF6A 3DR3A 2AMLA 3G13A 3GCWA 3UPUA 5FT9A 4EGSA 2HRCA 3CGGA 1Q92A 1XDUA 3FPLA 3SEQA 1UP4A 1T26A 2PJRA 3STWA 4CM1A 5EP2A 1P2SA 4Q7EA 8OHMA 2IEYA 4V1CI 16PKA 2VT3A 4PZ0A 4RD4A 5LYYA 3ONDA 3VO9A 1YIDA 2J5KA 4MV4A 2QU8A 5F33A 1IRIA 2AWNA 2WP8J 1Q91A 1XZPA 1KNXA 3DL2A 4MEBA 4X6YA 3T35A 3NPAA 3N70A 1GKYA 1PJTA 3QA3E 4B84A 3PXDA 3M5CA 1URPA 2CLOB 1V7CA 2ATXA 3K2IA 1YKSA 4GSYA 4R3UC 3QYPA 4QOHA 1QE3A 3F5SA 4MPDA 5CAEB 3SCZA 4DYHA 1ULBA 1A8PA 4KMRA 3FBWA 4HQLA 2EKPA 3UH0A 4CTNA 3K1JA 1WBBA 2C07A 2J33A 2O52A 3M9XA 3MAGA 4RIGA 5TT1A 3DAHA 2D3TA 5CURA 3ISJA 1RZRD 1I4EB 3L84A 3O38A 4MB2A 1YFLA 1W5TA 2VIIA 4IIEA 1JIKA 1ZGJA 3CG0A 4WBXC 3TR0A 2FZGA 4A6PA 1KPHA 4YT8A 2CL6X 1GD1O 2AFVA 3RLFA 1QFYA 2C2MA 3WKDA 3BMQA 6LDHA 4YJHB 3OPXA 4RTLA 3TTXA 5EZYA 1SXIA 2OD2A 3HCEA 2QXTA 3RJ5A 4UPDA 4DV5B 1BCRB 2CUKA 2H1IA 2ODAA 3IQWA 4HGPA 4UTOA 1A5BB 4Y0NA 2H4XA 1VSBA 3ND7A 1FNDA 2WM9B 3OPMA 3CCBA 2WM3A 5CM9C 5AVJA 4EMTA 3REQA 1NR7A 2WYWA 3KZXA 4HATA 1OFHA 4PRLA 4RH1A 5IULC 4Q3KA 1S2IA 3EW7A 5J4YA 5FRDA 2OYCA 1C1XB 2H08A 3R7WB 1DADA 2L17A 1VG8A 2PM8A 4U63A 4FYYA 3DFKA 3K9QO 3CW2A 3P0RA 2FUG6 3U16A 4M6WA 4NNPA 1E2PA 1OWNA 1A2OA 1T2DA 3D43A 2I1LA 1E3MA 4PYKA 1NAHA 1O95C 2PGOA 4UREA 1C8VB 1PS0A 1TPYA 2WQZA 5BMVB 3BCRA 1QFJA 3DMHA 4TV9B 2PXCA 2TECE 1U7TA 4LNUA 4WN3A 2AMJA 1Z6QA 4W7HA 2DHEA 4JLMA 5DN9A 4YAIA 5BSKA 1EM8A 2CLDX 2YR0A 4TXHA 1NG1A 1OY1A 1QHYA 4IEEA 1B74A 5B7QA 1P7PA 5J2TF 1LSSA 1W1WA 3MB8A 4I9GA 3IJRA 3ZWQA 2D1SA 2V6MA 2VT2A 5JY6A 2IHBA 1TTPB 2FPWA 5I7SA 5CIYA 4B35A 2R00C 4RJJA 1Z4JA 3RARA 1CEYA 4KH0A 1UC8A 2Q4EA 3TPZA 1G64A 3LUAA 4E6EA 4A8HA 2Q46A 3B3FA 1IHDA 2YIJA 3VPFA 2XAUA 4RKRA 1P4SA 4CEIB 1JAZA 1YI1A 2X1LA 3TAHA 1ZD1A 1UZNA 4JJFA 1B0UA 1NKSA 3PD1A 3TINA 1QGUA 1VL1A 2CLKB 3LUDA 4RZ3A 1NVEA 3M6UA 1S6YA 4UXJA 2Q5IA 4CIAA 3K5WA 4FOPA 1V47A 3EXAA 4RA6B 3KQHA 1KEWA 3RVLA 2AH5A 2VF2A 3MMSA 3U4DA 3GRAA 1BMFD 1P75A 2IPXA 4K9RA 3FPCA 4EW2A 1F9EA 2PWPA 2RHLA 4M1YA 1EBUA 3MWGA 4S2UA 1MW9X 4X0EA 5A3JA 1X1TA 3C98A 5EP1A 2JIPA 3UMYA 1AH2A 4B8ZA 1SR8A 2OVBA 3IIMA 5I7EA 3WQHA 2C7QA 3VOTA 3NUZA 1LGYA 4RDIA 2ZJ1A 3SBDA 3P9XA 3EY4A 4S04A 2BE7A 2WUWE 3G68A 4U8GA 1DKUA 3QGMA 3TSWA 4M0EA 4MQ6A 4UHHA 1G41A 3W78A 4YCDA 4OREX 2P9JA 4KQJA 1WBJB 2R1UA 2P0AA 3N2ZB 2HRQA 4HPXB 5BUSA 3IR5A 4QLAA 4B81A 5LKAA 3N0XA 2HPHA 5ER9A 3RF6A 5AI9A 1T3LA 1P5ZB 3VISA 1E2GA 2NYUA 4OU5A 4QGSA 1T9ZA 4LZNA 2VNHA 3HCOA 4CFYA 4Q18A 4UZFA 4OSPA 2QEQA 5DLEA 4IIDA 4UM9D 4BQQA 4X54A 3V4VB 3MUNA 3F4KA 3NHLA 1EJBA 1SKQA 3WKEA 1P91A 1J00A 1G6HA 1GSHA 4KI7A 4PG4A 5H83A 4QBKA 1K6EA 5GPBA 3BMOB 2VKTA 2EFEB 1Z8FA 3L1IA 3EWSA 1QJ4A 3NBFA 4URWR 3P96A 4Z51A 2OP0A 2QB5A 4IGEA 4OAPA 2ZQ5A 4WK0B 2JFYA 2WAYA 2VYNA 4Q03A 5ALOA 1PZNA 3ETLA 1EP1B 1O54A 4JYPA 3T3PB 2P30A 1KK2A 2JBHA 1QIMA 4EUKA 4BLSA 1SU6A 2AF3C 1VCOA 1WY5A 2I2DA 3GLHE 1KWGA 1DARA 1J9ZA 1NLZA 3I1JA 1YASA 2PQ2A 3FMIA 3K2EA 1LS6A 4UQOA 1GCIA 2DUJA 3WYAA 4O2AB 4RPGA 2NX2A 1X1BA 4YMTA 2D1YA 2JARA 1MB3A 2CXXA 1SD2A 2GSWA 3HPRA 2P2SA 3TUIC 4CV3A 3HJHA 4GF5A 4IDQA 2OAP1 5E9AA 1N5IA 3L7LA 4TLMB 4LJSA 4X1KB 3OX4A 5EXXA 1KAQA 1KJ9A 2XF2A 3E7PA 1E9SA 3KLNA 1Y37A 3QFSA 3NNDA 2J4CA 4ISBA 1OTHA 1QRUA 3N0RA 2QM8A 3KO8A 4JVOA 3MJVA 4K88A 2FMFA 4RF4A 4U2GA 1IG0A 2AFIA 3MWYW 4GP7A 4UUMA 4N5LA 4BKRA 3VJKA 1G5TA 1CYDA 3V4FA 1PK9A 2JVIA 1G2IA 3R7FA 5LJLA 4XWWA 2G0NA 4G4SP 1IC6A 1LB1B 2DE0X 1WMDA 1N3BA 4ZYTA 2B69A 1CUGA 4HTAA 4I0WB 4ND7A 3CVYA 3PK0A 2X1VA 4KBFA 4YROA 1SKMA 2ZIGA 4DIDA 4F2GA 2H4WA 1EFKA 3P9CA 5HOEA 2ZUFA 4D9JA 3SJZA 1NU8A 1WHTB 2FFJA 3TEJA 1M8JA 2Y27A 1HORA 3D31A 4I08A 4IXNA 1U98A 2X7JA 3U37A 3Q3EA 4PPFA 3JWIA 3LY5A 1KE1A 4N5NA 1QWSA 2GN9A 4I6JA 5FPYA 4QDZA 5HJ2A 2I99A 1P1KA 2JGJA 3EDOA 5FPQA 3T61A 4AMBA 5IJ9A 3OIUA 2HO5A 1XZ8A 2P2LA 2WUVA 5LQJA 5M2QA 3TRKA 3L6DA 1KARA 4TTTS 3UA4A 2H17A 2QWXA 2FN8A 1Y33E 1N57A 1FQKA 1JX6A 1VA4A 1XZQA 3OU7A 4B82A 4ODIA 4DR3B 3R23A 1AXEA 4GU5A 3U9LA 4EKGA 5JWHA 1QORA 1F6WA 3NOVA 3QXSA 4WHMA 4B71A 1SVOA 1UPUA 3TPFA 5CB6A 5JAIA 5ED4A 1F5NA 1T6BY 5ITSA 2JAPA 3AJ9A 4M21A 1ISRA 2C03A 1Y9DA 2OLKA 2WWIA 2FDRA 1B0AA 2XOXA 2Q7DA 3N87A 5HPYB 5LVAA 2FEMA 4CMJA 4U8HA 2I67A 2YWGA 2FMIA 4D3YA 3E2MA 1JR3A 4QOJA 4G0XA 1ZWKA 2PRJA 4R8VA 4BNKA 1KPGA 4O63O 5A9SB 3GJ8A 4X1IB 1XMSA 4A36A 1N0VC 2XWSA 1QCCA 3M1IA 2QIPA 2V4ZA 2J9FA 1WB6A 1E66A 4X20B 1DCKA 3Q0TA 3DZHA 5EJAA 5F98A 1KRXA 1JJVA 1N2GA 4MXDA 2PNJA 2GBIA 4LV5B 4P5EA 1BDBA 3D4LA 3F67A 4C0BA 4KZKA 3TCKA 2B7LA 2EF0A 3A7DA 2H5EA 3E22B 4I1OA 3DV0A 3OZEA 3ASUA 2P7HA 4A16A 2GFQA 2WJIA 3A2MA 2VDKB 4M2LA 4EECA 4O4IF 4ZVLA 3OAAD 5ETJA 3AX6A 4EHAA 2ARKA 4HCJA 5DRTA 3UW3A 3OMLA 1CG6A 1TW3A 4IFTA 4L72A 2AJTA 3IRUA 3REOA 1BJKA 2ERYA 4WLEA 2Q4RA 3FCEA 1NYTA 1I7QB 1S2DA 1DLJA 1E4YA 4FUQA 1AS3A 1NJ8A 3ZU3A 3AJRA 3I45A 1TMYA 3U61B 3B5JA 4HR7A 2HT1A 4LOIA 1OAOC 3OZCA 5MN6A 1IXYA 1L7AA 3U0BA 3ZVMA 4LSGA 3O21A 1JHMA 4Q47A 3MMPA 4EQ6B 2CXHA 1OGYA 5JAMA 2HSJA 2MYUA 3SR4A 4GQAA 4D5EA 4IXWA 1WCXA 2B1QA 3OZUA 3V1UA 1E8MA 2ZB4A 1Q7CA 2PU7A 2BR4A 1N77A 1UBJS 5CT5A 1ZAKA 1IM5A 4WUTA 4DBVO 3GPBA 1U65A 1KQFA 3S8MA 2WJYA 1U31A 1V41E 1SC6A 5IC4A 2EL7A 1U8EA 1ZVMA 4MHSA 3FTQA 3AHJA 1G7TA 3FOZA 1MV8A 2IOQA 2OK8A 4MVJG 5EIWA 3RRNA 1B7GO 1UMDA 3CLRC 1QO0A 3PYMA 1ZX1A 3HN2A 4D41A 2R6GA 2YFKA 4NQZA 4JA2A 4GM0A 4CIXA 1SK9A 3OETA 2O1XA 1G8AA 2ZT5A 2O5VA 3IAXA 4RE6A 4WCFC 3SZMA 3PPYA 1TVCA 4YCSA 1DC5A 5CLFA 5KNCA 5CB4B 3V32A 4TXMA 4H6VA 3U3OA 3J80A 1PS8A 2PEYA 4IIBA 4MGHA 4AKHA 1Z17A 1NJ6A 3E0QA 4IOKA 1YR2A 3THXA 4RCVA 1A4RA 1MAHA 2Q29A 4BNYA 1P2VA 1ZOOA 3K6KA 4GBMA 3VYWA 1DIHA 3QE3A 3EYWA 1E0JA 4LZZA 7ADHA 4OHUA 1T1JA 4RD2A 1F0NA 3PIIA 1FZQA 1OX6A 2IFTA 4ZZ0A 2YXNA 1IOWA 2DBZA 1JSXA 7ABPA 2C83A 3KS9A 4WESB 4Y2PA 2WM2A 2O6HA 1YRBA 4MVJE 4D4JA 1C80A 5HKLA 4CCYB 5HHTA 2NPFA 3E58A 5LXTA 4G5RA 2WPNA 3IUJA 4D9BA 3Q85A 4C3VA 3EMVA 2APJA 3ZBTA 4C7XA 1DIGA 4YAUA 2UUCB 1EQUA 1V16A 1CETA 3LUKA 5LYJF 3KVNA 4FGKA 3ZQUA 3AJ8A 1SQ0A 1ZUWA 3NDJA 3O92A 4BDSA 5EKDA 5CFQA 4P86A 2X41A 1N6LA 3WLAA 2WUGA 1XA3A 4YRJA 2VWPA 3CRNA 3ZI7A 1PQYA 5I7OA 1UBEA 4RTRA 2CNDA 1RWNA 1S7CA 1T9GS 4BMXA 4GI1A 4NU5A 3G5MA 3TQHA 3PE6A 1JQ5A 4Q48A 3FYHA 5EFZA 3VHXB 1ULTA 1H4QA 1SUEA 4OJQA 2ZSFA 2JB9A 5E4YA 2Q3BA 1FP6A 4KMOA 4BASA 4NXNB 2F43B 2HHLA 3GRKA 5B58T 4G1EB 2G08A 2CSUA 2ZBRA 3N39C 2G9ZA 4DLWA 4ZKEA 3AWDA 4O4LA 2GJAA 3AVYA 3Q9LA 4DWOA 3O73A 2G1JA 3D5QA 4BVLA 4UTVA 3G0GA 2RGYA 2EX0A 2PUWA 4F9TA 4MJXA 3FPKA 1HV8A 2MDTA 1DAOA 1I7LA 1YR1A 2O0HA 5BOSB 3HXKA 1LBEA 2PE5A 5G4KA 5BV0A 3J7TA 2FUEA 3I0MA 4U7PB 3OOSA 1KZGB 5CK5A 2HRRA 4BNUA 2IOHA 4WXPA 3QG1A 1XIVA 3WA7A 2IHNA 3Q9SA 4CEHB 3ABQB 2EZ4A 1PFGA 3OM8A 4XIYA 2IZ1A 4ON9A 3TZLA 1TUBB 4D9GA 3IMFA 3GJQA 2R8YA 3ZDZB 5GJCA 1KORA 2VPZA 4R1QA 5EIOA 3VKGA 3NM6B 2GXQA 1RWBA 3KZ1E 4FWBA 1NHGA 3N0VA 4OJKA 4CCSA 5C5IA 2ZETA 1MBZA 3Q11A 2X9NA 3T4XA 5HF8A 2OHXA 1XXHA 1B2LA 1X0VA 5CYPA 3T54A 3TNLA 3R6WA 4QYWA 3ZE8A 2G9UA 5JH7A 4WXRA 5D86A 5JVDB 1AN9A 3IIJA 2DY0A 3BD9A 4IJQA 3ZEAA 1LLQA 2P1DA 2WTEA 2Y66A 2QVGA 1XTZA 3VNQA 3V4SA 3D3EA 4CKXA 1DRKA 1M6NA 2NUPB 4M86A 2QVCA 2X8JB 3GUCA 4NLLA 1B8OA 5DHUA 3NETA 2VYND 3EXIB 1Q0ZA 3HYLA 1I6LA 1U28A 2P11A 3LXRA 4KGZA 5FBLB 2JJ1A 4HNUA 3H7AA 4JH0A 4Q34A 4UEQA 3BC1A 2QQ5A 1R0CA 2DH5A 3NXKA 3I34X 3LRTA 1GVHA 1CUAA 2G4CA 1RCTE 4QRIA 3T1QA 2WAAA 5GVRA 3WGOA 5H3CA 3MUOA 1OVMA 1K4MA 3IDZA 1ZH6A 1SHZA 2XAAA 3H2YA 2R1TA 4RLFA 5G0UA 3UENA 2A5YB 5LQNA 2VHWA 1TO6A 3IAFA 3PNVA 1BC5A 1EWQA 2OBBA 1ZGCA 4U6QA 4YQZA 4F92B 4D9MA 3IALA 4M54A 3N2KA 5JS7A 4JLDA 2IW3A 3LW8A 3GJRA 4KEAA 1EVYA 1NWHA 2SICE 4PSDA 4KXLA 3E2PA 5IFLA 5KDLA 1L5WA 1GTMA 1GL7A 1PBNA 1PDWA 2IIBA 2OEPA 4JQOA 4Q01A 3NOQA 1R5BA 3PQ2A 3UAZA 1E5QA 4XCQA 2ZWAA 4FUTA 1YRAA 3LQKA 4JS0A 4Q6BA 4LGYA 4WA7A 4CMEA 4HVLA 3P4UA 3CQ9A 2IV7A 2B3TA 1H69A 2Z5GA 4AZSA 1OB2A 4XFDA 8MHTA 1JHXA 1Z0FA 2NZUG 3IOCA 3OZFA 1LDMA 3NUGA 4FPXA 4UHKA 4ZQCB 4QIHA 3S8EA 2PXXA 2CYBA 3NG1A 1E7QA 1N0HA 4MI9A 1G0OA 5LQRA 3KEFA 1L5QA 4JQYA 3S3TA 4WTOA 3IFSA 4OYYA 4EB8A 1XDGA 3E3LA 3V3KA 1MG5A 1XDWA 3ET4A 1Z3IX 2QY9A 4G8DA 1R18A 1SZJG 2IWHA 3W8RA 1RPZA 3LC7O 4MRRA 1PUIA 3MTBA 5EKSA 1JE0A 2P2CA 1TVKA 3SSMA 4JEUA 1YE3A 5GINE 5ECYA 1ZL0A 1BDIA 3TIGA 2GVDC 2YL2A 2A5JA 2B25A 5HFAA 4IIYA 1E20A 4URXR 3DWGA 3C7DB 1IL0A 1RNLA 1KI1A 2BTEA 3D8RA 4BLRA 5LLDA 1TAUA 3R9XA 2RHRA 1E79D 2H7XA 3EQ8A 3QVSA 3I09A 4EI9A 3TD2A 2V59A 1XVIA 4WZZA 4EHKA 4URZR 4F3KA 5JATA 3BFKA 1JQAA 5KYYB 4O4JB 2V0NA 2X0IA 5DMHA 3D3QA 5FBRB 4L9SA 1ADBA 5I8PA 3T1TA 1ZPDA 1PWZA 2IYEA 3MSXA 5GZ6A 3JAKA 2PBLA 3GQBA 4HZUA 3ED1A 4J6EA 1O5OA 4KE7A 3T7RA 2FSPA 1GCOA 3TE7A 1A9RA 2ZANA 3ZBQA 6AT1A 2YTZA 4JJIA 1JPVA 1IN5A 1SC3A 2JLQA 4GYJA 1TVMA 3OJLA 4DRZA 4J2HA 1ESDA 3IA7A 3C3XA 1YB2A 2H06A 3SSOA 2W2OA 1EH5A 4XM0A 3JQRA 3ROGA 3AR8A 2BJHA 1SURA 3FAKA 1HNXB 4X8OA 1X7XB 1OA0A 3INYA 4TMTA 4RHYA 3S1AB 5J2UB 1E2FA 3NWEA 4L3OA 3A28A 3CH7A 2VEOA 3O8DA 4KYTA 2JAHA 2QBYA 3TTSA 5JH7F 4N12A 4QT0A 1V8DA 3A9CA 2UVQA 3HYCA 2NNLD 4Y1RA 3MINA 2PUGA 1GTVA 1E98A 1YD7A 4RULA 2I0FA 2OE2A 3AHIA 2YOHA 2AOTB 4GG1A 1MX3A 4M1KA 3WOVA 3BHMA 1I7SB 3VMMA 2OV6A 2A88A 5JBIA 3K6RA 4FD3A 1GT6A 2PX0A 3ELWA 3JZAA 5F9FA 3ELBA 2JZNA 2DTXA 3RSOA 3LECA 4DF3A 4ZN6A 1P33A 3P45A 5IF9A 2PVPA 4YJFB 3SFVA 2F3TA 1DG9A 2EFDB 3DOFA 3GRUA 4IWXA 1UMKA 2CCGA 5EIFA 3EISA 2B98A 3X3HA 4BU0A 2E3JA 2G5CA 1XU7A 1X1AA 3JVUA 3C7TA 4V38A 3SDZA 4NYMQ 3UM9A 3KV3O 3VZRA 2WPDA 1P81A 2E6KA 2QZSA 4BLQA 1R5JA 4WOBA 4E32A 4LE1A 1W94A 4ZHQB 2FZCA 2BC9A 2C94A 3IUSA 3IILA 4OHWA 4G67A 6PFKA 1H4SA 3FF1A 1C4OA 4Z4HA 2IEZA 2V3WA 1JNYA 3VI4B 3USZA 3SMVA 3GRRA 4L4UA 3IQXA 2W6CX 5IS2A 2HSZA 2RHHA 1IUOA 1FB5A 2BFAA 5FBWB 2RCYA 3PGA1 1P2DA 4TMXA 2I6TA 1YZGA 4NFSA 2ZJYA 4JLVA 3R9KA 3VHQA 2RGRA 4C87A 4FHFA 1NP7A 1GR1A 3SQOA 1E4EA 2NQTA 2GD1O 2UAGA 3H9CA 1JWLA 4NEHB 3F5QA 4MR9B 2CNLA 2I7DA 1LK7A 4P83A 3QPUA 1TA9A 3CPSA 3DT8A 5T8KA 1P45A 1KY2A 2GBFA 2DTDA 1J97A 2OBMA 2ORVA 3MVEA 2OO5A 1ZKMA 5TMDA 4DDTA 1MO6A 1WETA 1QP8A 2KS6A 4JLSA 3ZPXA 2C0PA 3VR5A 4B2PA 2OHHA 4R2XA 3K16A 4YK7A 2FPUA 3BXPA 5I4CA 2F1JA 2FQXA 3AC0A 2RH4A 4R3WA 4RK7A 3EH2A 3BXGA 2F00A 3C3EA 3FF4A 2GEUA 2IW1A 2Q1SA 3I2GA 3ICWA 1U0GA 5GZ1A 5AM4A 2CXNA 4B47A 2M1ZA 3CRRA 3DWEX 3F1LA 4Y2RA 4MGEA 1DT3A 5AP9A 3O2JA 4LRYA 1XUOA 3I9LA 2R2GA 4CUJA 3U44B 4WJLA 4AP5A 1NKVA 1X87A 1CC1S 1S4MA 2PO7A 1Y1SA 3C4JA 2UXCB 2IYPA 3DG9A 3RNOA 1ZMTA 4U6NA 4D8VA 3MLEA 2DX7A 3L8EA 5B3JA 1K6MA 2IUFA 1O08A 3DGFC 3M5WA 3V2IA 1C30B 4BB6A 1GGEA 5JALA 2GS9A 3B3GA 2YASA 3KUXA 4AJHA 1TF5A 2BKXA 1RVDA 1NXWA 3HNRA 3NDRA 2HGZA 5IWCA 1YVPA 1NW8A 3FLAA 3LVBA 4L07A 4WBNF 4YX9A 3CUWA 2Z5VA 1XTUA 3UCEA 2AUTA 1E1QD 1DRWA 4LQLA 2C95A 2HRZA 4K6OA 4IQFA 5AK6A 4D4HA 3FAZA 3I9V1 2PMEA 3BQNB 3VX3A 2C7VA 1ZM9A 4G81A 1Q7BA 2OC9A 4HN4B 3OJEA 3BRQA 2B30A 2BF4A 4G9GA 4NBWA 1PVVA 3PPWA 1XV5A 2AZMA 4M0MA 1WCIB 4DGQA 5GIPE 1Z7GA 4DUZB 4CR8A 3OIDA 4KNYA 3KQYA 2HIGA 2FOXA 1WDTA 1ZGAA 1UF9A 2F1IA 1X13A 1Y1TA 2W2TA 3VVMA 4BKPA 2JFUA 4WCDA 4DHWA 3A3KA 3A6FA 5TPWA 1XD2B 3SLGA 1NOJA 1Z4QA 8AT1A 2DR3A 4RGBA 1K9SA 4GNKA 4DJ5X 5JARA 2ATEA 5LFAA 4PHHA 1H0KA 3SNKA 2UYHA 1AHHA 3H2GA 2FF5A 3NRJA 1N9ZA 4OAOA 2B3DA 3WKAA 4GPAA 4IEIA 3W2IA 2D54A 5LOVA 1TUIA 2P4UA 3PYXA 5WRFA 4FQ7A 2B8EA 3AEQB 1CRZA 5SYMA 5MGNA 1P7YA 2J3IA 3RABA