4X8OA

Crystal structure of e. coli adenylate kinase y171w mutant in complex with inhibitor ap5a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Adenylate kinase
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8oA00
4TT3D 5G40A 2ZM5A 1FMLA 3L0PA 4TT3A 4KSBA 3CH4B 3N5CA 3VR4A 4BZPA 3CRVA 2O8BA 4C30A 1NG9A 3ADKA 5JJIA 3T06B 4QG7A 2GWHA 5IHPA 2QROA 3AUYA 1W47A 4V0MA 4AKGA 4Q1BA 3IIKA 2ZRMA 4DCSA 3ZD6A 2FMXA 2J59A 3U44A 1SVKA 1P6XA 1GNQA 3R9XA 4TYWA 4AG5A 4EFNA 4P4TA 1QRAA 1ZUHA 3Q5DA 5J4YA 1E2GA 2A9KA 3D3QA 1OIVA 1ZAKA 1I4LD 4D4KA 2VF7A 3EA0A 1HE8B 1E2KA 1Z8FA 1DAGA 2N46A 2I1QA 1G8GA 1U94A 1U98A 3K0SA 1Z0DA 1E1QA 2GVZC 2F43A 1DVRA 3KQNA 4QGAA 1YJ5A 1XCPA 3OAAD 5EXTA 3R7WA 1W0KD 1XZPA 5GADl 4G5QA 2A5DA 3U3JA 2OUKA 1NBMA 4URYR 1W0KA 1P62B 2IYWA 1XTRA 3K0CA 5DH9A 2RH5A 3SBDA 1EXMA 2H8KA 2GXUA 1E96A 2WJYA 4QRHA 6Q21A 3B13B 4HDOB 4E22A 2Q3FA 4I81A 4QJ3A 2VSXA 4Q00A 5BN4A 2OCBA 3RWMB 3UMRA 4CEIA 1DELA 3V00A 4HZUB 3L0OA 2ZJ5A 4P4SB 2R9VA 1FW6A 1US8B 1X8JA 2BVNA 3E2IA 4G01B 1P7CA 3EPKA 1TQ4A 2ZRHA 3AM1A 4PC3A 4RVCA 3KKNA 3EZFA 3Q72A 2IYRA 4KI0A 2WIBA 4YMSA 3SS8A 1T6NA 2V6JA 3P4YA 4WZBE 4U02A 3RS4A 3UMSA 2QPAA 2NZJA 5CB6A 1SKYB 1H8HD 4OYHA 3RYTC 4Q02A 2JLQA 2IA5A 3VFDA 1II9A 3LLMA 4H1VA 1IN7A 3FYHA 4TMWA 1KSFX 2V55B 2DFNA 1DS6A 3UIEA 4QM7A 1U0LA 2PX3A 1WMSA 4PQRA 1YQTA 1T3LA 1Q21A 2Q6TA 1IJFA 1DE0A 2WJJA 3CPHA 4PSAA 3V4RA 3AEZA 1WXQA 3QVUA 2B21A 4BFYA 3CRRA 4C0KA 1KMHA 1VG9B 5HKKA 1AKEA 1DAKA 1MR3F 1ZCAA 4HAVA 3BRWD 4DEYA 1TL7C 1AN0A 5E3HA 4MDEA 4NCIA 4KLNA 5B64A 2X19A 2KJQA 4FCTA 1SKQA 2IYSA 2IT1A 1GL7A 1G8PA 1XTQA 1ZUNB 4XWKA 1Z0FA 1E9DA 3KXIA 4NCNA 5FBQB 3O8BA 1QDEA 5KNBA 1PVOA 1ZU4A 2MSEB 3I73A 4PAQA 4C0HA 1R10A 2WMOB 4BRWA 2NG1A 3X1WA 1OHHA 2O0KA 2FGKA 4XTRA 4DSNA 3C16C 4Q9JA 2DWOA 1KYIA 4MRPA 4B73A 4C0LA 2WOJA 1CJKC 1QG4A 3PG5A 3GLIE 4MDFA 5KU1A 3AVQA 1TNDA 2RGNA 1P73A 1HA3A 1KIMA 3KKPA 3KTAB 3UANA 5H8WA 2WJGA 1X8LA 5ELXA 4DZZA 1KY3A 1KKMA 4Q48A 1NN0A 3PJRA 2DFKB 2GTPA 4URXR 1XTKA 3ZIAD 2XSZD 4JVNA 2ZJOA 2ZROA 2IYZA 2VP6A 4RD3A 4P4UA 4P31A 2QUZA 2Y8EA 4JIMA 2JJ1D 4WBSA 3C14C 1AJEA 2OZEA 1E2LA 4M1KA 1U9IC 1ZW6A 1HT1E 2CHGA 1N6LA 4Q7KA 4DCVA 4PAMA 4XD7A 2UZ3A 1N6IA 5BW8A 4KXFB 2W6IA 2XZOA 3DM5A 5C4MA 1OFUX 3SOPA 3RS2A 1L4UA 3T1QA 3D7MA 1NNEA 4QGHA 3V4FA 3SQXA 5FFMA 3LH5A 1UBEA 3K09A 1O87A 3B1VA 3CX7A 1ZM2A 4Q1FA 4CT4B 1IN8A 2QMUA 4JLOA 4BLRA 2GJSA 1SXJA 1MRSA 2VHQA 3IPYA 2YNMA 3LX5A 2QE7D 2AKAB 4JLJA 4QNRA 5K8TA 5F3WB 2IWRA 3W8NA 2XITA 2YV5A 3A4LA 4G5GA 2UKDA 3TH5A 3K1JA 4H9GA 5J47A 1E6CA 4HUTA 4TL7A 3JVUA 1CR4A 4MRSA 1TUEA 5G53C 1KI1A 4M9SA 4LYFA 5DLQC 1FPMA 2J0SA 5CLQA 5HE8A 4B76A 4RFVA 2AD1A 4CYMA 4XIGS 3AF1A 4IJMA 4MGIR 4XVQA 1UKZA 1D2NA 2V54A 2PMKA 3MAAC 5CM9C 4RZ2A 4KYUA 3FKSA 2A3RA 2ZE7A 3K0AB 3BS4A 3K9NA 3QI2A 4B35A 4UJ5A 2ZI5A 5CIQA 4DLYA 3MJRA 1XMVA 4RZ3A 3FKSD 2R8RA 4QKQA 4MYCA 1HUQA 3GMTA 3LY5A 2P2LA 1CTQA 4IHQA 4TQAA 1FMJA 2HXSA 2YINC 3FB4A 4JVSB 2WJVA 4GP6A 4R2IA 5TV2A 3UMFA 3OIUA 3GFTA 2CLCX 3AVWA 1N6PA 5BN3A 5KYKA 4Q19A 5EP3A 4A6PA 2IYUA 4Q4HB 2WWYA 1LB1B 3Q7PA 1JJ7A 1FX0B 4JLVA 2QG6A 3TBKA 4Z8YA 1OYWA 1P61B 4L15A 1S0UA 1ZD8A 3GLFB 2F1IA 4M1MA 3THYB 3S1AB 1N5KA 1JQJC 2MSDB 5JBQA 2YWGA 3A1TA 3U6KA 1XTIA 3B7GA 3WP0A 2OLKA 3CPJB 2HUPA 4PZLA 1BOFA 3HR8A 1KTVA 4FIDA 4FINA 1VCOA 3IBGA 5CLLA 3B9PA 1KSGA 4A9AA 2ZRCA 3GEIA 1P3JA 2WVJA 2PCLA 2VA8A 1GRRA 2GZDA 3K0EA 4PPGA 2G77B 3CW2A 4G5OA 1E2PA 3RC8A 4AY2A 1OFHA 4BEBA 1ZM4A 5TXGA 3ADDA 2MMCA 3Q5EA 3B1WA 2FNAA 3LXXA 4YDHB 2Q3HA 5DI3B 2W83A 1M8PA 4PHFA 2V7QA 3U7EB 1TAGA 1E99A 3GLHE 4BLQA 4Z1MD 1GTVA 2V7QD 3KQLA 4YC7A 5FUVA 2OFXA 1U8AA 3EG5A 3DEFA 1NKSA 3KKOA 1U8ZA 2GJAA 3T1OA 4OHYA 3QKSB 3QXHA 4Z51A 5TB5A 3W5JA 4IXMA 1C9KA 2F1HA 1GP2A 2ZJAA 4IDHA 4P0TA 3AGPA 5JI3E 2JLWA 1UAAA 3ETLA 2B8WA 4EPWA 3QUSA 2XB2A 4FCVA 4I1UA 2WOOA 3AVOA 4DLSA 1L4YA 5KSZA 5GVSA 1G20E 3K0CC 1VTKA 1CLUA 1NG1A 5FI0B 2P5SA 3I8SA 2NTYC 1U90A 4BEJA 3KZ1E 2IYQA 3ZZUA 3H1TA 2AN9A 4OHZA 1KK2A 4US0R 1P72A 3WHLA 3WYAA 3LQQA 5JHHB 5B57C 2NZ8A 5GJWC 4B3GA 5KSPA 3BXZA 3U3MA 4GOXA 2ZYWX 2OESA 5EE9A 1Z5ZA 1LF5A 1KHTA 2QQEA 2J46A 1S1MA 1UBGA 2CLSA 4IOJA 2IS6A 2O0HA 2JDIA 2DWPA 4FN5A 4GBMA 3K70D 4CRWB 2A2ZA 2ZU0C 1QHGA 1RW4A 3E5HA 5FTJA 5HZKA 4MKFA 2DY1A 4R2HA 4IKEA 4NTZA 3TNFA 1T0HB 4ARZA 3QJYA 1NSFA 1SQ5A 4LC0A 5A0FA 721PA 3KQUA 1A1VA 1BYIA 1UPTA 2JLRA 2R6DA 3MRSA 4TSFD 1SVMA 2IYYA 2REOA 2DWQA 4IFEA 1B0UA 4JJZA 1GWNA 1XEXA 1UJ2A 3WP1B 4D0GA 4OQLA 1UADA 1G41A 1EFTA 1W36D 3WMFA 2F3RA 4V0LA 4ZDJA 2ZRIA 3DDCA 1HYQA 2KSQA 3ZQJA 3PEWA 1QHXA 2R6AA 2CVHA 1LNZA 3B85A 4B2PA 1ZNXA 2VHCA 5DYIA 1K5DA 4TN1A 2W0MA 1CULC 4XVUA 1DTSA 1XP8A 4OI1A 4DKXA 5FI1B 1OKKD 1TU3A 3GFPA 2G6BA 3AKYA 4LPKA 4EUNA 1R4AA 4ZV4A 5CDFE 4TWZA 1ESNA 5E4FA 2P67A 4L9SA 4PQFA 2ZJ2A 1Q57A 3P26A 1LS1A 4MYHA 2CBZA 3HR7A 1P5ZB 3OEEA 1E2DA 1E1QD 3SFZA 4B3XA 4QJ4A 2EW1A 4TMTA 2JATA 4B2LA 1XMSA 3THYA 2QBYB 3H2YA 2CHQA 2JCSA 3IEUA 1NBMD 4AKHA 2EFEB 1NN1A 1XDBA 3TQCA 3ND9A 3QEJA 2C5LA 3FE2A 4ITRC 2OO7A 1N6OA 4M21A 2HT1A 4MITA 2ERYA 1M6NA 2JLXA 4B75A 1G4UR 5H70A 4RFSA 3DOEA 2GZHA 5BYJA 4A0FA 3W6NA 1WBDA 3OFND 1KI2A 4Q1AA 2WJIA 3PEVA 3EZ6A 3NXSA 2PCJA 4PC1A 3AKDA 4QBIA 4OK5A 4B6FA 2G0NA 3IGFA 2J9RA 4Y0VA 4HEJA 4TYNA 2GEUA 1T9HA 2C8VA 4NP6A 5HCIA 3EXAA 2GXQA 2WKRA 2BMJA 4MYTA 4NYIR 2ZI6A 3QKSA 3QOFA 4RFSB 1S8FA 4F93B 5JFGA 3TW4A 1BMFD 1A5TA 2BCGY 1JEEA 1VECA 1W49A 4HB4A 3W3ZB 3ZDQA 4BFWA 1SXJC 2CNWA 2TMKA 3AVYA 2D62A 2IEYA 3FFBA 2HYDA 4MQBA 2JLZA 2FX3A 1ZD1A 3NC1C 1I4DD 1LF0A 1QBKC 5EUMA 4BLTA 3QKRA 2H16A 1G291 3RS0A 4CGZA 1KO5A 1IONA 1BH2A 4FMBB 4EPTA 3DKPA 4QXAA 3A8TA 4P3YA 4HLUC 3T61A 2OAP1 1WE2A 1EWQA 4WAUA 3GJ5A 4ZO4A 1XD8A 3UATA 5HR5A 2QGNA 4TTPA 1J99A 1XD2B 2A78A 3DMNA 4F4CA 2HV8A 4DBLC 1YE8A 4O0MA 2IXFA 4KHZA 3BJIC 3P27A 2FE4A 2FFQA 2NIPA 4TLBA 3NDPA 4A8JB 3I5XA 4CDGA 1ETUA 1Q0UA 3VKWA 2PEYA 3BERA 2CHVA 1I2DA 2QNRA 2ODWA 4PO8A 1XPOA 4DXAA 3LAWA 4KFSA 1IN5A 4HUQA 1ZM3A 3RDPA 5LPNA 3LW7A 5BWMA 5EUQB 4AC9A 4N3NA 2GESA 2O8EB 3NTUA 1CR1A 1JEDA 2BV3A 2CEAA 2DFLA 4M1TA 4NPHA 5G41A 4QM6A 4Q7LA 4ESHA 3QEOA 1ZC3A 4URUR 4O2RA 4JKIA 1JR3D 1DOAA 1FQKA 4LCBA 3W8RA 4LJYA 1D8TA 2NO0A 2RCNA 4MRVA 4E07A 5LD2B 5DSZA 1NMYA 1TEVA 3B78A 2IS2A 1P60A 2AHOA 1NRJB 1AZSC 4KSCA 3RS7A 3BK7A 5BQ5A 2WICA 3E1SA 4JSTA 4PR0A 3Q8XB 1N6HA 3BWDD 3ZZ0A 1N5LA 5GJVC 1FQJA 4XWOA 3T34A 4EPXA 3GJ7A 2BMEA 3HU1A 1SXJD 5KSOA 3U6BA 2V3CC 4P32A 2CE2X 4DDTA 3J81k 3ADBA 1WBBA 2XNSA 1GOTA 4MRNA 4TLDA 3FHOA 1OFTA 4F4JA 3S1AA 2OG2A 2BM0A 1WB9A 2UVQA 4C7OB 2VEDA 5K8LA 1EFRA 1L2TA 1MKYA 1AS0A 2QQ0A 3TW8B 2FN4A 2G1JA 5KNCA 2BM1A 2GILA 2HXYA 2ZR9A 1G21E 5CDFA 1FUUA 3X1XA 3KKQA 4IFBA 1ZYUA 2VP5A 4TL6A 4HSEA 1W46A 3QY0A 3MLEA 5C46F 3I8XA 4NYJR 1IHUA 2ZETA 1EFCA 1T5IA 2EU8A 3PENA 1G7TA 4URZR 3VX3A 1OLOA 3BIFA 5EXPA 3MMPA 4OK3A 5F9FA 4FMDB 5KOYA 5TMPA 1E9BA 1N2CE 1SGWA 4B3BA 1TU4A 3DHWC 5DI3A 2GBLA 3KXLA 1YVDA 1GDDA 2QI9C 4XJXA 3ZVLA 1L7VC 3ZS9A 4EFLA 4PTLA 4DUGA 4HAZA 4DDWA 1GVNB 4IOMA 2WWFA 4Q9KA 3NBXX 1VCIA 2XXAB 1NP6A 3GEHA 4Q21A 1OH6A 3D8BA 4Q66C 5JJKA 4D25A 4GP7A 1QHSA 1E2HA 3U3KA 1CS4C 3A36A 4HDQB 1R6BX 4LDJA 1YR8A 4MUBA 3A37A 4MRRA 3FGNA 1VIYA 1JI0A 3UG7A 4BFUA 2YYZA 4UNQA 2PBRA 1C4OA 1PUIA 3KUCA 5E7IA 2J0UB 4ARZB 3BH6A 4DLTA 5HE9A 2VQSA 1H65A 3PUVA 3WXMA 4KVAA 4C0AC 3THWB 3F8TA 2JAQA 1XU4A 5TY0A 1KO8A 5FPSA 1TTTA 2HF8A 4HATA 2REXB 1AKYA 2ZJZA 4A4DA 4D4JA 621PA 2IS4A 3TR0A 5TARA 3PUYA 4XD7D 4TMZA 3IDQA 4UNSA 4I99A 4YQFA 4PHTA 2YC2C 1I4TD 2ZRAA 1FUKA 1S3GA 2ASEA 4WZAE 3QPUA 3O8RA 1K5GA 3KJEA 5FTKA 4DWJA 2GEDA 2NO9A 2UZIR 3LX8A 1II8A 4WVFA 5HCNA 4DSOA 3NBZC 2ODEA 4W5HA 1EGAA 4LWZA 4Z1MA 2Q9CA 4C0JA 1ZIPA 2NOAA 5L3SA 2IUUA 2D06A 5UKDA 1MT0A 1US8A 5JLJA 1HE1C 2BC9A 4PZYA 4KODA 4Q7JB 1DARA 1Z0JA 3EWAA 2ZYVX 2C99A 1DEKA 1IXRC 1E98A 4NL4H 1WCV1 2NO7A 1KSHA 1XJQA 3UPUA 4RD6A 2C03A 3AUXA 3CIOA 4RD4A 2YKGA 2J0QA 2BCJQ 4OHWA 3DKVA 2YOFA 2NGRA 3LFUA 2AK3A 3ZJYA 1VYUA 1D2EA 4LBZA 2REBA 3AGQA 3L8YA 1E9EA 4MA4A 4Q4JA 3I5YA 3KFVA 3LV8A 3TLXA 4M9ZA 4KV9A 4A92A 1QVRA 3B6EA 4PAOA 3DPUA 5D3QA 2FOLA 5IK2A 1QZXA 1K8RA 1XNJA 2G0TA 4JYBA 5KO2A 2O8CB 1VG1A 4LYJA 3DL0A 1SVWA 1F3OA 1OH5A 2A30A 4C3ZA 1G6HA 3MJHA 2J87A 4M1SA 3GCGA 5EZ5A 1RYHA 4QGGA 4EFMA 3CRMA 4GMXA 1ZM7A 3AVPA 5FBRB 4EJSB 3IIJA 3CRQA 3K0FA 3NEYA 1Q1ZA 3SFVA 3SYLA 3VR2A 4BWYA 3TSWA 3UWKA 1FNMA 1NVWQ 1EK0A 2D74A 2JGNA 2ZRNA 4DHEA 3ZZTA 3FMFA 4XSGA 3SC3A 3SJBA 4ZI3A 2FZ4A 3X2SA 4JLBA 2ZREA 4F92B 1OW3B 2QA5A 1FP7A 3VAAA 5E7JA 2W6JA 4DLXA 1N5IA 1Z6YA 2CK3A 2EFCB 2GJ8A 1W36C 4M53A 1SHKA 3N70A 4JLNA 1JPJA 1KDOA 1E9AA 5FTMA 4QGFA 3WNCA 5JRZA 5AWFC 3OE7A 3RSLA 4B74A 1OXSC 2DCUA 3TE6A 3VR3A 2IYXA 3CPEA 1PUJA 3HU3A 2XNDA 3I3SR 4KVGA 2QGZA 1L8QA 5CJ2A 4FWTA 2FDCA 2VF8A 4I4LA 1P2TA 2XJ4A 4D6PA 3AVUA 4DT1B 4AURA 4XTCS 2QENA 2JJ2D 4LSGA 1R8SA 5F9HA 1XTSA 4HLUA 2V4ZA 4HAUA 2JJ2A 3VHLB 5KDLA 3K8YA 2WV9A 1S2MA 2PLFA 5DN6A 3VMFA 2BMFA 3AB3A 4FMCF 2FF7A 4D26A 5B58C 3K9LA 4QL3A 1JB1A 1TADA 1TQDA 2BKEA 2ORVA 3PVSA 3BBPA 3L82B 3V9PA 3PUZA 1Z6XA 2CDNA 2WHXA 2GCOB 2QEQA 4TMVA 2JIZA 1UDWA 2KWIA 4KCGA 3W90A 4DVGA 4U7DA 4K46A 1N5JA 3FFAA 1YR6A 1ZUIA 2GZAA 3THXB 2OFOA 4PO9A 1XD2A 4OQXA 2FPKA 1JR6A 1RRFA 2WWIA 3K9GA 3LO5A 3PUXA 1X6VA 2NO1A 4LYHA 3AP1A 3ZVNA 1OV4A 4V0OA 4ZDWA 3TSOA 2FV8A 4V03A 4NU0A 1UKEA 2J7PD 4Q47A 4Q4AA 5G3ZA 4JLAA 5D3MB 1QHHB 2CL0X 1KO4A 1OT3A 1UBCA 1YRBA 3AKEA 3QXSA 2GXSA 1Z28A 2QE7A 4RZUA 2FU5C 3RAPR 1NKTA 4K8OA 4JL6A 1RKBA 2J3EA 1FTNA 4R71A 1ESMA 2VHJA 2RKOA 4C4PA 4NYMQ 1F2UB 1Q3HA 2J5XA 3VKGA 4PSVA 1ZC4A 2ZYTX 1DAIA 5EE3A 5E95A 1ONBA 2YJTD 4F91B 5L3QB 4MYUA 1S96A 2FPMA 2ZE8A 3D31A 1OIXA 1Z83A 4FCWA 3C7KA 3A4MA 2ZRGA 4PANA 4R9UC 3NIBA 3CRW1 4TYYA 3I1FA 1FP6A 1T5LA 5KPJA 1DO2A 3BC1A 2VPPA 4LJAA 2IXGA 3W3AA 3WBKA 2QTHA 3EAQA 4IDQA 5FOWA 3TUIC 3WMGA 4ZDIA 4B3CA 2ONKA 1G7CA 2OE2A 2IHYA 5K8UA 4P4SA 3BORA 4TLCA 4UNNA 5EQTA 2O8FB 4QBGB 3DZDA 4D82A 4B2IA 2HF9A 1X3SA 2H92A 4IW3B 5HPYB 2E1RA 2C9OA 2GAOA 2O5VA 2R6GA 1T4GA 4NDZA 4NMMA 4DEXA 2ZI3A 2O8DA 5C4GB 3CUEF 1E0AA 1E32A 4WOPA 5JCPA 4B6EA 3AVVA 2V1UA 1F60A 4D4MA 4CEJB 3ICQB 1GNRA 4AWXA 1OXXK 1SKYE 5ANRB 3ZQ6A 3DMDA 4AG6A 1VG8A 1KZ7B 1W2GA 4NBSA 4QBHA 1E0SA 4YMWA 4LJ8A 4LK2A 1SVOA 1VIAA 1YR7A 1ZVQA 3GLFA 4DLWA 5JECA 4TL8A 1P2SA 3BFKA 3WYGA 4BLPA 3VR5A 1FFHA 3TKLA 4RSGA 2X2FA 1XXHA 1YZKA 5DHFA 4XVRA 3OF5A 3MUFA 3WYFA 2HDNB 1UKVY 1IN6A 1UFQA 3KJGA 3U44B 3WRYC 4X8LA 3NHAA 3IPXA 4NE2A 2EFDB 4D4LA 3EARA 5JJLA 1CBUA 4E5UA 4OHVA 2XXAA 5EP1A 4M2LA 3EIQA 4A6XA 5JHGB 2V1XA 5FTLA 5JRJA 2CMKA 2YWHA 2O8BB 1G5PA 1TQ2A 5DO9A 4TQ9A 1ZINA 2FZLA 5GJCA 4LBVA 2AL7A 1XBTA 5H68A 1OIWA 4DRZA 3KJHA 3B60A 3LQRA 2WTUA 1R2QA 3OIVA 5AR1A 4XOIA 2ZQ5A 3QPWA 5J4LA 4DC9A 1R5NA 3EIEA 2CJWB 2XEXA 5KUTA 1W44A 5JEDA 4NONA 4RD0A 3EC2A 1GAJA 3B1ZA 2QTVB 1NJGA 4DLVA 2VRWA 4ZIRB 1RC8A 2FG5A 2CE7A 3PCRB 2ODBA 3CR7A 3QG1A 4DSUA 1Q1QA 1J70A 5FBLB 1NSTA 2ZS8A 5L3SB 2CCJA 3RS5A 4NYMR 2GKSA 3VTKA 1CF4A 4EPRA 1EFRD 2HCJB 3SBEA 4GI7A 2LWIA 4YXWA 2I1VB 3C8UA 4DB4A 1EX6A 1LFDB 4CVNA 1DG1G 2AK2A 1OH8A 3MWKA 5C2JB 1XMJA 2RGCA 2O8DB 4CW7A 1BYUA 3QG5A 1KGDA 5KDDA 4MGZR 4GDFA 3VX4A 1E2NA 3MWLA 4L8GA 1CJTC 4N1AA 1ZRHA 1ZD9A 4B48A 3PEUA 1G1MA 2OXCA 3MGCA 3LDAA 3TSZA 5FPKA 5JEEA 4HAWA 5JI2E 2GA8A 1JR3E 3THXA 3FMOB 3NC0C 1XCGB 4K81B 5CYPA 3C15C 3ZD7A 5AUNB 2HJGA 2XX3A 4HAYA 2J0UA 4QHTA 5SZHB 5JS8A 1VDZA 4Q9HA 3EW9A 3GLHB 4M4SA 2QAGC 4JS0A 4FMCB 1ZP6A 1A2BA 3SHFA 3W6PA 2VYFA 4UXIA 1OXUA 1MH1A 3UKDA 2YWFA 2X8AA 3TIFA 5GVRA 4EPVA 1P9NA 2ZI7A 4BPBA 5CM8B 1D2MA 1HH4A 2QT1A 2YZ2A 3WBJA 5FOTA 4QNMA 3FKQA 1Q12A 5EXXA 2GJKA 2PL3A 4GRAA 2F7SA 1JNYA 2XB4A 1JBKA 2RGEA 1MO5A 4A1FA 1GNPA 2ZRFA 2WPDD 1GRQA 4QC2A 4ZCMA 1GZSA 1Q3TA 3ASYA 1HQYE 2B6HA 3EPLA 4JSYA 2G9NA 1W5SA 2P3SA 4PPNA 4LV8B 2ANCA 4OBEA 4EAQA 3ECCA 5FUYA 4IEIA 2EWWA 2Z6VA 1ZBDA 4JLKA 2ZSBA 5FUWA 5FPHA 1WRBA 4HI0E 4EQ6A 3BH7A 3TVDA 4ERNA 2P6RA 1IXSB 1G64A 3OIYA 1IJEA 1G5TA 4LJ5A 2PEZA 1G3IA 1KNQA 4KBGA 3TK1A 3C4JA 2QRNA 2LKCA 2O8FA 2ZUCA 1R5OA 1X1SA 4RZXA 3NH6A 3M4YA 2PT7A 2VO1A 1KY2A 3WY9A 2J7PA 5AUQA 1J2JA 5TVKA 3KKMA 2PZEA 2QP9X 2XAUA 3CLVA 3KTAA 3GEEA 3TR5A 2PX0A 2A5FA 3BH0A 2KB0A 5AJXA 3GLGE 1LTQA 2KE5A 3H84A 2H1LA 4CEHB 1KI7A 3P20A 4YMUA 3NKVA 2DYKA 3QE0A 1KO1A 1IM2A 3ADCA 1EWRA 1TEXA 4AKIA 4KBFA 3ZIAA 1OXVA 1OJLA 5CJPA 5JSZA 2IEZA 2HCBA 1XEFA 5EP2A 1YZUA 3RRNA 4OQFA 3CF0A 1CU1A 1XEWY 2VSFA 4BLSA 1ZJ6A 4HZUA 5DE3A 3GLGA 3CM0A 4YMVA 5IF9A 1NMZA 3TUZC 1B23P 3QBTA 2RGBA 1Z07A 4D80A 2AD5A 1QHHA 2A5YB 1VHLA 1N6RA 5HZHA 5CB8A 3C5CA 4UKDA 5FPYA 4GZLA 4WA7A 1NN5A 3FVQA 1SULA 2C96A 4CF7A 1OB2A 5L3RA 3CO5A 2AKYA 4PC6A 4MH0R 5FL7A 4Q1DA 1P2UA 3LBIA 4YONB 4OJKA 4HYYA 2QSZA 2LKDA 4LJ9A 5FUXA 4IVRA 8OHMA 3EZ9A 4TTRA 1CP2A 4AI6A 4PFSA 4LRWA 3AH8A 1NI3A 2IWHA 1M7HA 2ZUBA 3KQKA 3K0FB 3OZXA 2MMGA 2DB3A 3GFOA 3ZLJA 2VP4A 1F48A 2HYIC 4MUAA 4C9BA 2EYUA 2IS1A 2JA1A 1VYTA 4JT2A 2GRJA 4LPSA 3LXRA 2C95A 4M22A 2GAAA 4PZZA 3KXKA 2WJHA 4GL2A 4Q7MB 1G9XA 4WIAA 2X77A 2ZEJA 5DN6D 2QRZA 2OEPA 3U7HB 1OH7A 2BBTA 1E9CA 4US2R 4M1OA 3BD9A 3WHKA 1KJWA 4D81A 4FD2A 3E70C 3O8DA 4OQMA 1FTSA 3K0AA 4M9XA 4TYPA 1IXZA 2D3WA 2F9LA 2J41A 2BEJA 3FWYA 3QIAA 5AUOB 5JS7A 5KDOA 1SHZA 1U0JA 4D2IA 2P5TB 4X8MA 4ASUA 1RVDA 1Z3IX 2IHBA 4ASUD 4JBYA 3CKLA 1JR3A 1J7KA 3MD0A 1SVSA 1BO6A 1HY3A 1MO3A 4ZI2A 4C7OA 3MWJA 4G1UC 2ATVA 2VBCA 5F2EA 3MSXA 4I1OA 1DAEA 1X1RA 1S1CA 1YRAA 3CB4A 1MABA 3DVLA 3VNUA 2DR3A 2BBOA 2MSCB 2P6NA 3L0IB 1W5TA 4LJ7A 4BRUA 1E79D 3HU2A 4PPQA 2EWVA 2CLDX 1E79A 1NLYA 1U81A 1EFHA 1UEIA 2V9PA 4P33A 5AJYA 2AXNA 4G3XA 3FPAA 2OBMA 3B1YA 3U3OA 4ZCIA 5BN5A 3LVRE 4H1UA 1KMHB 5LBIA 4RD2A 2QT0A 3GJ8A 2GDJA 4LUCA 4KU4A 4URVR 3SI7A 1E3MA 2BIFA 2D7DA 2W2VA 4LHWA 1AQYA 5SZIA 1XEWX 3RVBA 2JDID 2IUTA 1RRCA 3VNVA 3HWSA 1KSJA 2R62A 2ZTSA 3B8HA 4EJSA 3W6OA 3X1DA 5JCZA 1U2RA 4GFDA 4LC1A 4DCNA 1UF9A 1XTJA 3B5JA 3CNNA 2OAQ1 2JLVA 1ZNWA 3EWSA 1JAIA 2F9MA 2WSSA 4OI4A 4PHGA 3GLIB 3TJZA 4YLGA 3IHWA 1T3SA 3O8CA 2F6RA 4CIDA 2OLJA 3IEVA 4YDSA 1ZCBA 3RRMA 3RRYA 1CR2A 1D6JA 2OXRA 1E2JA 4RY2A 5JWRA 1OHHD 4A0HA 3F0TA 2B8TA 2IW3A 4X8HA 2GK6A 2PT5A 3RRZA 5C1BA 2L0XA 4A8JA 1KK3A 4C2UA 1AIPA 2GEVA 2CXXA 3ZGXA 2QORA 4CEIB 821PA 3EASA 1XRJA 4L16A 2ODNA 3H86A 4HUQB 4Q4AB 2O0JA 5FOXA 3Q85A 3RHFA 1LV7A 1M7GA 2XSZA 4YMTA 4KLZA 3TAUA 2QTFA 5KTYA 4Q01A 3PIRA 4HB0A 3WNBA 5KSYA 1OF1A 4PSKA 2W00A 4BLOA 3I61A 5K8IA 1Q22A 2ZAMA 3NEJA 2WPDA 2F43B 1E0KA 2NQ2C 1E1RD 2SHKA 4A36A 3EA5A 4D0LB 2XZPA 1E9SA 3FDIA 1S3SA 2QAGA 4IOLA 2GETA 1E94E 1A4RA 1RZ3A 2HT6A 4ESVA 1W4AA 2YOHA 4IEEA 4PO1A 4V02A 5FR2A 4PC2A 3ZYCA 2YOGA 3OESA 1P75A 5DI9A 3ZVMA 1JXOA 1MO6A 3KB1A 1XJCA 2VP9A 1Y63A 2QPTA 4LX0A 1WP9A 1DAHA 2E87A 4D0NA 4KYIB 3CZPA 1E0JA 3THWA 1GKUB 2G3YA 1DPFA 1OXTA 2OHFA 4PC7A 4R98A 1P9RA 3OIWA 4AYWA 2XOKD 1W0JA 1D9ZA 1V5WA 1GSIA 1FL9A 1NMXA 4PPFA 3NH9A 2KI5A 3H4MA 3P4XA 1COWD 2QSYA 3SEAA 1CRPA 1I2MA 1HT2E 3QF4A 2FPLA 4AIIA 1COWA 2D7CA 4AKEA 5FBVB 4DLUA 2ZSEA 4N0EA 1YHNA 5LB2A 2ATXA 4CT5A 3IBYA 2ZSAA 2ZI4A 4JLPA 1VCMA 2I4IA 4OJQA 5CITA 1KO7A 5IRCD 2QL6A 4W5WA 1CRQA 1T0JB 1ODFA 3WMEA 4EKDA 4HB3A 3AF4A 1KNXA 1H8ED 1FZQA 1E9RA 4LZZA 2BBWA 5SZKB 1F2TA 1GIAA 2ZPTX 1BIFA 2N1BA 4XWAA 5IK2D 3PEYA 3HPQA 4ON9A 2RHDA 1ZNZA 4JVMA 2GVDC 4ABYA 1AGPA 3TUJC 2QBYA 4HLCA 2NPFA 4BZQA 3RNLA 2GBLC 4TTQA 3TMKA 2GJ9A 4IVQA 4NYIQ 1Z6TA 5DGXA 3O47A 2WBLC 1G3RA 4UXJA 4A0GA 1EG7A 3P1JA 5TDHA 2PZGA 1Z0KA 4U00A 3LNCA 2GXAA 3EC1A 3CWQA 4ZCLA 1Z2CA 1Q20A 3LRPA 3BFXA 1GKIA 2ZIAA 1MABB 4IRUB 1M7BA 2VH5R 2NPIA 2PMDA 1FOEB 4PQYA 3LA6A 4TYQA 3ZVRA 5EJEA 3F3YA 4PXAA 2ERXA 3TQFA 1NVVR 2LCFA 5L8VA 2ZU6A 2DBYA 1TPZA 2ZE5A 2RGGA 3AF3A 1QG2A 1U0HC 4EPYA 2F1JA 3OE7D 4NHOA 4ZIRA 2EVWX 2GNOA 3A4NA 3EZ2A 1IY2A 2XNDD 3REFA 3ZS8A 1NVUQ 1SVLA 1PV4A 3WRXC 4HB2A 3KQHA 3RC3A 2H18A 1P4SA 2B7BA 4LHVA 4L4UA 2ZVPX 4DDVA 2H7VA 3TGPA 3MFYA 4DLRA 5FTNA 1GILA 1NN3A 2CVFA 3T15A 2BOVA 1JALA 4IVPA 1M34E 1T8UA 1OYYA 2YWEA 2IUSA 3K53A 1WA5A 2KBFA 3SNHA 1MV5A 2G83A 3NBYC 1R0YA 2ZRDA 4QHSA 3IHLA 3A58B 3M0EA 3THOA 1IN4A 1KDTA 2OBNA 5J4HA 1J8YF 1DG3A 3U60B 4NCHA 5LB4A 2D4HA 2B92A 5KNDA 4BZXA 4LYAA 3JVVA 1KJZA 1KI6A 3TVTA 2FSFA 2RAPA 4HDCA 4LI0A 3BB4A 3SJAA 4S2EA 4XSHA 1XJ0A 3EIHA 3G5UA 1VCNA 4MKHA 4JKYA 5FPTA 2J45A 2WWXA 2ZAOA 2FFBA 4MKGA 4TL9A 2HEIA 4RKEA 3UK6A 2EQBA 3K9HA 4GPTA 3NWJA 3R7WB 1SXJB 2GK7A 3R20A 3BFVA 1TQ6A 3AV0B 5AJZA 3U4QA 2IYTA 1KI6B 4JL5A 1W4BA 3VKHA 1YZNA 4A2PA 3BB3A 2HJVA 4M9QA 4CZ2A 1W48A 4IXNA 2AX4A 3ICEA 5FR1A 2OFWA 2R6CA 2ZS7A 4Z8XA 1IOZA 1ZM9A 3UG6A 4WXRA 4O3MA 1R0XA 3L43A 4JBXA 1YZGA 3QKRB 1XZQA 3WNDA 2YVUA 4MGYR 3FHCB 4NKRA 4IDOA 4AK9A 3SYNA 3GQBA 4M0LA 3I92A 1LS6A 1XFAA 3T12A 1AA9A 4Q9LA 5EE0A 4C0SA 2E9SA 4BGDA 1CXZA 2B7CA 3B2EA 1IY0A 3OEHD 2WSSD 2I3BA 1JXMA 2R65A 3K09C 2O52A 5C18A 5DISB 2IX3A 1Q44A 4BASA 4B3DA 4BUJA 4A0RA 2ZSFA 4RJLA 2R2AA 3NG1A 1XEXB 4GNKA 1H8HA 1JQLB 2P6UA 4DJTA 5B30A 1YZLA 2W0SA 3R8FA 2W2XA 3QF4B 1G8HA 4LBYA 3K70C 1G6OA 4MGKR 4V0NA 3X1YA 4EJSC 3HYTA 2FSIA 1XB2A 2QAGB 2C9YA 1NVVQ 3JZAA 2KBEA 1VMAA 2AWOA 4LJ4A 3SHWA 1RRPA 1Y3AA 2WWWA 4I1SA 4ILEA 3MWYW 3R9IA 2JLYA 5GJBA 1DAFA 1E9FA 1KI9A 1YZQA 1Z47A 2RGAA 3UXMA 5FBWB 1G7SA 3QQ5A 4EQ6B 3BE4A 1GRNA 1IQPA 2ZRBA 3W34A 1KAOA 5HKKD 4OL0A 3CF2A 3L0SA 4F7WA 1TF5A 3HDTA 4W7SA 5FOUA 3Q7QA 2O8CA 1Z29A 2VHTA 1E1RA 1G8YA 1GM5A 4A8JC 3NDBB 4QOSA 3SU8A 4HAXA 3HP1A 2CCGA 3A1SA 3QVVA 4GSYA 4Q18A 1G8FA 4KAXA 2FA9A 1YR9A 2BJWA 2ZSDA 2JLSA 1N25A 2BDTA 2Q3MA 3I4LA 1G3QA 3ASZA 1JAHA 4DUGD 5SZJA 1RYFA 2EFGA 3SR0A 2ZYUX 4UJ3A 1F5NA 4KFRA 5DIFA 3SE0A 3Q9LA 5BXQC 3IO3A 4Q1EA 1XPUA 3F5FA 3VR1A 4JJKA 5J40A 2A5JA 1GG2A 1ELOA 1AK2A 3CBQA 3QKUA 5EP4A 4LBWA 2ZXUA 4ACBA 2PH1A 3VR6A 2Z0MA 4UXHA 5AJVB 2PJZA 1II8B 2A5GA 4DT1A 4AYTA 1KAGA 1R0WA 5JSZB 1YKSA 1G7RA 2IL1A 3HYRA 4NZYA 3IILA 1CIPA 3LW8A 4FMDF 4US1R 3M6AA 1BKDR 4A82A 2ZUDA 2VL7A 3OEED 121PA 4W9MC 2CNWD 2CL7X 2R44A 3FTQA 1LW7A 2BKUA 4TLAA 1C1YA 1A7JA 1RIFA 3U4QB 5EXSA 1KK0A 1TF2A 2QM8A 3KB2A 3SJCA 3A1WA 3AVXA 1CJMA 2RGXA 2ZJYA 1DAMA 2HLDA 4GZMA 2Z5FA 4IOKA 3NVAA 1N0VC 4DLZA 1E2MA 4JT4A 2A7QA 2VLIA 2IBMA 2HLDD 3HJNA 3GD7A 3R8CA 1KMQA 1JJVA 4KITB 1UEJA 1KI4A 4JMPA 2W6JD 1XD9A 1WF3A 2CK3D 2QM7A 2RGDA 1E2EA 3T5DA 1NIPA 3LD9A 1Z2AA 4JLMA 1Z0IA 3SZRA 2IF2A 3EX7C 3AVTA 2VP2A 2YC4C 1GL9B 1O3YA 3GPLA 3Q3JB 2ANBA 5FOVA 2RMKA 3CF6R 3VQTA 4JLDA 2QN6A 3KX2A 4FXPA 1QHIA 3QKTA 3G82C 2WAYA 4B3FX 4B44A 3I72A 1XMIA 3SJZA 1NY6A 2RB4A 2QU8A 3PXGA 2BBSA 2C9CA 5J5CA 2Q9BA 3FHTA 1PLKA 1V43A 1ZU5A 4Q03A 1NVXQ 1QHNA 2OCYC 4FW9A 2QMOA 4M1YA 1NLFA 5KPDA 4BFVA 4GMDA 5DNYB 1QHYA 2GCNA 3IKJA 1W1WA 1R7RA 2GHIA 3X1ZA 2BHRA 1K6MA 2IYLD 3A6PC 5J4VA 1AGRA 3ND8A 1NBME 1XXHE 3RWOA 1N6KA 3K70B 1X86B 4QFMA 1N6NA 3W9YA 4RKFA 2ZRPA 2JASA 2XGJA 2ZI9A 1GL6A 3CX6A 5JZVA 5E7MA 2FFAA 3LBNA 4NCJA 1J90A 1W2HA 1AS3A 3VU9A 2V8OA 3GLFE 1RPZA 1VHTA 2VTKA 1P9WA 4A15A 2ZANA 4Y0AA 2DHRA 1M74A 4JBWA 1RJ9A 1AZTA 3AP2A 1W4RA 3FOZA 2R6FA 4CEJA 1S9DA 3GP8A 2XOKA 2ZE6A 3AP3A 4FI3C 2Z4SA 1D9XA 2BWJA 3FMPB 2FSHA 4KJZA 3T1VA 1NL3A 2AXPA 2QP4A 3KJIA 3CR8A 3P32A 2QPOA 4V0ME 1ANKA 2H17A 3CONA 1G4AE 1HV8A 5EE5B 3RSOA 4BECA 2X1VA 4FWIB 3OAAA 3UWOA 4OKSA 4DCTA 1G19A 1N3BA 1Q1BA 4UNRA 1AS2A 2C98A 3REGA 1IY1A 2F3TA 2OSBA 5JWHA 1QVAA 1KOFA 2WSMA 4B71A 1HEIA 3BB1A 4G5SA 4Q5IA 4R7ZA 1G18A 2CJWA 2J7KA 2AFHE 4KFTA 3OHMA 1PJRA 3SYKA 2ZJ8A 4ZPXA 2VHUA 3MCAA 4TMKA 3OEHA 2J0VA 1F2UA 1CJUC 4UQOA 1R8QA 3B9QA 4RD1A 5P21A 1KI8A 1T8TA 2H5EA 3FMIA 3KUDA 1PZNA 2ZJBA 4ACAA 4EDHA 4BFSA 5M04A 2CCKA 3ONWA 1IAQA 2EYQA 5BYKA 3AF0A 1FNNA 2ZS9A 1PLJA 4M1WA 1UKYA 1ZNYA 4JZKA 4NYJQ 3N2EA 4LGMA 4J0QA 2BMDA 2W2TA 1E2FA 2FWRA 3IIMA 2DFTA 2OT3B 3LBHA 4BFZA 5JMTA 3PFIA 4WW0A 1OFIA 5DHAA 4II7A 2ORWA 4GOJA 1TUIA 4DIEA 4BFTA 1T3HA 1Z08A 2GF0A 1G5RA 3IQWA 3ZH9B 4B34A 2FGJA 4NH0A 4DSTA 4C2TA 1RE0A 4BQSA 3U7GA 3GJXC 3BOSA 1SZPA 5LDDC 4DIDA 421PA 2JEOA 3G0HA 1DBSA 4OQNA 1Z06A 1HURA 4RCZA 1VYVA 4POAA 4C0QC 4F38A 3QXCA 5G3YA 1Z22A 3DO6A 2Z83A 5FOSA 1D5CA 2K5UA 3AQ4A 2ZRKA 3SDZA 1P2VA 1LVGA 1W0JD 4LV5B 3L8ZA 3KDSE 4B47A 3LWNA 2IC5A 5B2ZA 1HTWA 5CK5A 2VP0A 4Q4JB 1NY5A 4JYCA 2FH5B 1OKKA 4GT1A 4LOAA 2YHSA 3RLFA 2BJVA 1KJYA 4CEHA 5IT5A 4G0NA 1MOZA 3CNLA 2RHMA 5LD2C 4OI2A 5H1YA 3SN6A 3TAHA 2IF0A 1XF9A 1G16A 2WKQA 1NIJA 2JJ8A 1VG0B 2D2EA 3L2OB 3T5GA 5FL3A 4PHHA 4DB2A 4QHYA 4B33A 3U3RA 4TMXA 4IDPA 521PA 1GITA 1FX0A 5CK4A 5A5GA 4I1VA 5J4KA 2F55A 4YXWD 4IDNA 3QF7A 2NMVA 2C2HA 5CYOA 5AK0A 4E09A 3U7FB 3RANA 1T91A 5KHOC 3QXJA 1TMKA 4EIWA 1KDPA 2W58A 3U61B 2PZFA 4G5RA 4QJ5A 1R0ZA 2OM2A 2XTZA 1X8KA 4B43A 1XPRA 2H57A 2C77A 1F6BA 4LV6A 5AUPB 1CEEA 1VKJA 3TRFA 5FH9A 4JVLA 1QF9A 4ZKDA 2C04A 1ZMXA 4TZ0A 1F2TB 4OI0A 1N0UA 4RCYA 4TSFA 4TQUS 5EZ6B 1M1YE 2ZR0A 4O2LA 1UDXA 3JZMA 4UNPA 2FEMA 1YU9A 4TZ6A 2ZVQX 1N0WA 3GLHA 1OE0A 3PR1A 2OCPA 3IO5A 1VPLA 1BS1A 2WAXA 4LHZA 3GLGB 5L3QA 4Z54A 3GJ3A 2Q9AA 1SVIA 1R5BA 4B32A 3A1UA 3B82A 2D2FA 3R9WA 2WMNB 2IYVA 3CWZA 4LHYA 1G17A 2OV2A 4XH9B 1S9HA 1KZGB 2PLRA 1XCMA 2VSOA 2Z4RA 5AJWA 4C0BA 4E03A 3KL4A 4O25A 3D6TB 2XZLA 1E4VA 1AQUA 1PLLA 1OSNA 3H0KA 1XWIA 2QMHA 3DOFA 4QBFA 2JIZD 2RGNC 3NBFA 3GJ6A 3LVQE 2DPXA 1CR0A 1CKEA 3SQWA 1U8YA 5F98A 1RFLA 1W4CA 2QP3A 4A2WA 1Q1EA 1CJVC 1G3UA 3NHBA 4KFUA 1EX7A 2IK8A 2Z43A 1E69A 3B1XA 2IXEA 4KO8A 3T1TA 2F1RA 3DM9B 4HLQB 1U9IA 4OHXA 3LLUA 3QSYA 2WWHA 2G1KA 3A1VA 1EESA 4WXPA 1E2QA 3QBVA 3W5IA 1JPNA 4A2QA 5L3VA 4AD8A 2EFHB 1E4YA 3DZ8A 2FFHA 1OPXA 3BAFA 3C5HA 3EZ7A 3CNOA 3RABA 3EPJA 3EPHA 2QAJA 1II0A 2WIAA 1GKYA 1RRGA 2G88A 1UM8A 2AFIE 1KI3A 4LJ6A 4Q9IA 2Q0HA 4ZDKA 1WDTA 4BE7B 5CIWA 3MG9A 3PITA 3T35A 2JJ1A 4S35A 4U5XA 2OILA 1E2IA 1DO0A 1G3MA 2P65A 2ZRJA 2QY9A 3PV0A 2N42A 5EE1A 3CH5A 1BMFA 1JECA 2ZRLA 3U5ZB 5A4JA 3IUYA 4N0DA 2O8EA 1H8EA 5D3MA 4MKIA 2FJUA 2WWGA 2ZR7A 2W6ID 2FSGA 3QPVA 1LY1A 4JL8A 1GUAA 3N2IA 3PQCA 1Z63A 2VIIA 3GJ4A 1SXJE 3PUWA 2OBLA 5IDVA 1NF3A 2BEKA 1A2KC 2J1LA 1XX6A 1XXHB 2XJ9A 1AM4D 1W7AA 3QXXA 2XTNA 2V6IA 1J8MF 2C78A 1U99A 1NLZA 2WM9B 1MO4A 3HPRA 2ONJA 1S4QA 2WKPA 1Z6GA 4LY6A 5FL7D 4V0KA 2AR7A 1Z0AA 2QMEA 1UBFA 2GF9A 1MRNA 3CZQA 3QENA 2ZITA 4HZIA 4Q4HA 4F4IA 2NO6A 4DCUA 2P0EA 1WQ1R 2GCPA 5DYGA 3AF2A 1RJ9B 4URWR 3OFNA 1KK1A 4ZKEA 2CL6X 3RS3A 3GJ0A 3IQXA 1KKLA 1DADA 1NJFA 4W5JA 2ECKA 3I62A 3VU9B 2JLUA 4BFXA 2X2EA 3C41J 3KFXA 2PJRA 5HTKA 5JWOA 4OK6A 2OCAA 2WZQA 3AKCA 2AWNA 3M1IA 4M8NE 4WZ6A 4NCKA 4X8OA 1M2OB 2GCOA 4PX9A 1GFIA 1TX4B 4Q4LA 4TLEA 2FEOA 3QNUA 1ZIOA 1IBRA 3CX8A 2Q21A 1A82A 4Q1CA 3GLIA 1OB5A 3I32A 4LHXA 1HQCA 2ORIA 4HLDA 4DDUA 1TF7A 2QZ4A 1YZTA 2XTMA 221PA 3U2QA 1EFUA 4AYXA 3VHXA 4L9WA 4GOKA 1Z6AA 1W36B 4L5BA 3BGWA 1KDRA
chains in the Genus database with same CATH superfamily
3CCBA 3P0HA 1CNMA 1X0VA 2ZM5A 2FJ0A 4QOGA 3FZNA 3CLRC 2G76A 4UU8A 2GGSA 3A9SA 3CW9A 2P79A 4G1MB 4KSBA 4OLJA 5T3YA 5IX8A 1NG9A 4LI3X 4YTEA 3S2IA 1E5XA 2R68A 3L1UA 5CFNA 1Z0UA 1EBUA 1RZRD 3KAQA 1T9ZA 4LXIA 1V5GA 4WI1A 5EIBC 2I87A 4AQ7A 1UBKS 3CUKA 4IEFB 1LV8A 3ICOA 1X15A 2GLTA 2ZOSA 1X7YB 5KJCA 3HCFA 4S0ZA 6ADHA 2QX8A 4KI7A 3CN9A 3RVQA 3O21A 3UYLA 3D81A 4TYWA 2ACEA 4AG5A 3ZJ5A 4YP6A 4MP8A 4EFNA 1FVFA 2V3VA 4FJ1A 4O8CA 1U0GA 3SSOA 1E2GA 2A9KA 1QGOA 3D3QA 1I4LD 1EFLA 1PGOA 3QUQA 4EGCB 1SUPA 3TVYA 4I6JA 1KOGA 1HE8B 1AZWA 2E5LB 2XB8A 4C89A 1E2KA 3W5DA 3C7DB 1DAGA 2N46A 2C84A 1G8GA 1U94A 2I1QA 4NJMA 1U98A 3TAXA 1Z0DA 1BMDA 1E7MA 1C8BA 3DV2A 3R3XA 2F43A 3JTMA 4RDHA 3TZEA 3VGPA 3WBFA 4ZHQB 4MGEA 3OAAD 3PIIA 4CI0B 4QDTA 4G5QA 2A5DA 3T3EA 4EY8A 1ZL2A 5CEJA 3WRWA 3G9UA 2IIQA 3O7MA 1W0KA 5CRIA 1C1XB 5LA6F 5IJ0B 2Y1CA 1U9ZA 1XTRA 4KQJA 2IZ6A 4O59O 5DH9A 3SBDA 2GXUA 2E4ZA 5JALA 5GONA 1FMFA 1E0DA 1MC5A 4H7DA 2Q3FA 1I8TA 3HYSA 1UFOA 3PEEA 3RWMB 3KHTA 3ZWOA 3G88A 3HADA 1FDVA 1YBFA 5AM2A 3LO8A 3UMMA 3GLRA 1G55A 1X7ZA 2DKOA 4PBTA 5AVTA 3FSEA 1H4SA 4KIJA 5JMPA 2OAGA 2BVNA 2AOUB 1P7CA 2EBHX 3EXHA 4KPGA 4MS3A 3EPKA 1B73A 1ZJJA 5IMBA 2Z8XA 5G1OA 2M6KA 5BRJA 2Z8ZA 1N8TA 3EZFA 4FZ5A 4J76A 3Q72A 2IKQA 3LHSA 4KI0A 4LG1A 1JG7A 1KVRA 2TMYA 4HQ6A 4MOWA 3OOHA 4ZP1A 3UMSA 1L5SA 1S3IA 2XRMA 4UM7A 3DT8A 1WABA 3V2HA 1ZK2A 2QRMA 5JS1A 1Q0LA 1U3DA 3SFTA 3VFDA 3VYWA 3LPLA 2RHJA 5K2OA 1OD6A 1Z7BA 2WR8A 1B3RA 5DM70 3BEDA 4B9EA 5E6RA 2DFNA 1DS6A 4QPJC 3T3GA 5AHKA 2QF7A 4DSAA 1O0CA 3QLVA 1JG3A 2C2XA 5H3LA 1A2QA 3Q15C 3EVEA 2PVPA 2F59A 3RK1A 1Q21A 2PGLA 5CVUA 2HMWA 1R3DA 2OB2A 3BGIA 3FNGA 1O1YA 3ODPA 4KDRA 3ESBA 4AKTA 2O8VA 4A91A 1WXQA 4BFYA 1CY1A 4AO8A 5L7TA 3G7UA 3L7AA 1GKLA 4JQOA 1K3TA 3UT5B 1ISJA 1VG9B 3ZOZA 1T5HX 3RTDA 1H94A 3M89A 1Z2PX 4J1SA 1AKEA 1MR3F 4I66A 4RTRA 3RKUA 1TK2A 1AN0A 3ZLUA 3FBGA 4B4WA 1SKQA 1G8PA 1GL7A 1X1BA 1ZUNB 3PHCA 4CODB 1Z0FA 2HDHA 3GN2A 5FBQB 3TTXA 3UJ6A 4ZVSA 3O8BA 3R0XA 2GN4A 4IUBS 5KNBA 4ZV7A 4JJ7A 1PVOA 1ZU4A 2KX7A 3T0IA 3R7LA 4DV4B 1DV1A 1VE5A 2ZQYA 5GPBA 1R10A 5FA6A 3TFQA 2NG1A 2QD2A 3O9VA 4FBMA 4B7AA 3BE8A 1W9HA 3BSFA 1OHHA 2O0KA 3KOOA 3Q2KA 4NK4A 2W8BB 3C16C 4YRAA 4Q9JA 2DWOA 2EKLA 4MRPA 4B73A 1C14A 1ODCA 2GARA 3INGA 2JHPA 3LYUA 4C0LA 5D1HA 1QG4A 5KMGA 1RI4A 5EIEA 3F98A 3VPSA 1H1LA 2C7QA 4WNCA 4MDFA 4EO7A 1TNDA 4Z9BA 1FSPA 1KIMA 3UMCA 4BQNA 4EYEA 5AUOB 1PK9A 4K6MA 2ZZMA 4YJ2F 3NVKI 3V34A 2EG9A 3PJRA 2VBIA 2GPNA 2GTPA 1XTKA 1L7NA 4XQ9A 1R37A 3OLZA 6YASA 2QVYX 1V6AA 1NURA 2IYZA 4RD3A 4YFYA 3Q0EA 4P4UA 2H1IA 1B6RA 4WBSA 1YVEI 2ZIXB 3PDIA 1QIEA 4DVJA 1W25A 3CIFA 2ZSUA 3OPYA 1AJEA 4UPDA 4K03A 3K9BA 2ATCA 5TIIA 2PL5A 5DV9A 4CF3A 5H9VA 1T36A 5HQJA 1N2IA 1Q7GA 2JVKA 3AR2A 2Q7DA 1L5HA 2X23A 4GMHA 4XD7A 2P9QA 5BW8A 5L51A 1GT6A 4ZAWA 1O95D 2G6TA 4JNKA 5CT6A 3H05A 3D6AA 1X77A 1GADO 4ZI7F 4RM3A 3DM5A 3BQNB 4RFLA 4N7MA 3T1QA 1NF9A 4ZT5A 3RVSA 1V71A 1GTG1 3V4FA 5KWJA 2YMPA 1YMQA 2QV0A 1BMTA 2I03A 3JALB 1M0SA 2EJBA 3JVEA 1UFRA 4YAIA 4PYMA 3QE4A 2XEDA 3WLRA 4WXEA 1L4FA 4JLOA 3VVBA 4HWOA 4BLRA 5AVQA 1U5AA 3TL3A 5H80A 2GJSA 5LU8A 1SXJA 2VHQA 2WYHA 5A3VA 5A05A 3TTTA 2QE7D 3QX9A 4YCSA 5K8TA 1U4NA 2IWRA 2Y67A 2YV5A 1S2OA 2X1MA 2HMUA 3A3OA 2YL2A 3DO5A 3K8OE 4DILA 1JEJA 1IHPA 2PMCA 4YT8A 4H9GA 1BFDA 2BW0A 2GASA 4WACA 1C3JA 5CG2A 4MRSA 3W9SA 3LKBA 3L4KA 1SCAA 3IURA 2C1XA 2PT6A 1P3Y1 2AR9A 3MJ4A 1S5PA 3I2IA 2XIQA 4LYFA 5G53C 3SQOA 1FPMA 2B4TO 2CJXA 4I08A 4K9PA 4YV2A 5CLQA 1L7XA 1ZXBA 3WA6A 2QRPA 2AD1A 4FYXA 4JFRA 5EIFA 3AF1A 4CYMA 3PXUA 1XEAA 1VPTA 2C3PA 2WA2A 3EAGA 5AK5A 1TW2A 4KR3A 2P2CA 2PZAA 2GPJA 1OTYA 2PMKA 5HMMA 2OWEA 4RZ2A 2AEEA 3MS4A 4XLZA 3V7NA 3FKSA 3EZLA 3WS7A 4RQTA 1Y4DE 2V97A 3NETA 4L3WA 2V5VA 1AXRA 3M4NA 3DVRX 2FG7C 1X74A 4KAJA 1HUQA 2IEGA 4BAUA 2DUMA 4BLWA 4QKQA 5FD8A 3G2OA 4TQAA 3Q1KA 1R8YA 1UWLA 3FB4A 3NRCA 4KTVE 4QDJA 4YRDA 2PRKA 4GP6A 1GNTA 4L5JA 2EKZA 4R2IA 3OIUA 2D0IA 2CLCX 2EKPA 5GGYA 3SC4A 3TEFA 3OX4A 1RTKA 1SHTX 2UVPB 2OD9A 3FVVA 2ZT6A 1NQTA 4K6CA 3NNNA 5CNIA 5ARBA 3EPPA 2AC4A 2JH3A 3VTZA 4RQUA 1XQ9A 2IYUA 4J1TC 4Q4HB 3GMDA 4I1IA 1B00A 1K2VN 4AUNA 4CQJA 4RTJA 1JJ7A 5FT9A 3ZXYA 4JLVA 4WECA 1LA2A 3TBKA 4EG1A 3M49A 4F9TA 3EH2A 4KO4S 4ZWNA 2IY9A 3BJRA 3HCBA 3OP4A 4C7KA 1OYWA 3KD3A 1JIKA 1S0UA 2OK8A 1ZD8A 5ALIA 4BKPA 4M1MA 3N86A 1W85A 1JQJC 3ROKA 1PZMA 5FLEX 2C5SA 4I6GA 2D54A 2RGYA 4KX5A 2VDVE 3U6KA 4ZC8A 2OLKA 2OYRA 2A4MA 4PZLA 2CD9A 1BOFA 2R79A 5F23A 4UTNA 4FIDA 4Q39A 5CM2Z 2X22A 3EFOA 1KSGA 4TX1A 2JG3A 2C94A 1SZJG 3PD0A 2ZRCA 4KVFA 2R4QA 3WGZA 2QL5A 1RWPA 4M1EA 2D4AA 2UUCB 2PCLA 3K0EA 4JASB 2GZDA 4PPGA 2VA9A 2VH2A 1XV5A 4G5OA 1E2PA 3KSZO 4CLRA 1SUCA 4J29A 3GT7A 4KN6A 1I4EB 2PXHA 3ERCA 3AJ8A 3ADDA 4DY6A 3T1YB 3IULA 3ANLA 2FNAA 3VH4A 3BQMB 4FWBA 3ZGLA 2V7QA 2AH5A 4TKUA 5CB4F 3RC1A 3DBIA 4GOLD 1AX9A 4KE9A 4WESA 3LBFA 5CHYA 4WBXC 1GTVA 5FQOA 3U48A 2B69A 4YJFA 3AF5A 4GR4A 4D3YA 5ILGA 2OFXA 1MEOA 1YBAA 1NULA 4LF9B 2ZYDA 3DEIA 3W8DA 3D3NA 4XR9A 1O94C 3QKSB 3QVTA 5DYNA 4AS2A 1QYIA 3W4IA 4Z51A 3IT3A 4RKQA 4CI9A 2F1HA 4X44A 1UPBA 4O4IB 5EPEA 2OFFA 4U0JA 5JVDF 1CY2A 3OJ0A 4P0TA 2JLWA 2C61A 3KETA 2HK8A 1RC0A 2O2IA 3WQSB 3WLMA 1TYCA 3QUSA 4U2GA 3M6MD 4QTUB 4DLSA 4Z86A 3DMRA 1DAPA 3IMCA 3WGIA 4MUJA 3DMHA 3K0CC 3V2GA 1VTKA 1CLUA 3MGAA 2P5SA 3BG5A 2NTYC 3LXMA 4BNIA 1DEAA 4JA0A 4J3JA 4LS3A 3NP7A 1ZA1A 1A96A 3B7WA 4RHUA 1KK2A 4AN1A 5K6AC 3LQQA 5JHHB 2A86A 2XVAA 4FGWA 3HKCA 4KGDA 2WIGA 4QATA 4XQGA 4COOA 3JASA 3BXZA 3ZU2A 5HRCA 1O5TA 3WK6A 4URHA 4F4HA 2GFQA 3F1LA 3M34A 1AGNA 5ALYA 5EE9A 1KHTA 1SNYA 2QQEA 2Y0EA 2XYPA 4Z4FA 4P0QB 2EDAA 1S1MA 2IS6A 3ZZ1A 3HSYA 1K27A 2O0HA 4ZOQI 4JWTA 2ZUTA 3VR2D 8ADHA 3PP8A 4GMGA 3K70D 3TXYA 3HC7A 4CRWB 5HZKA 2ID8A 1RW4A 1QG6A 5FTJA 4AL4A 3ENNA 3FW1A 3P19A 2OA0A 3UGJA 3IOCA 3ZYZA 1DEXA 2O3JA 1U31A 3ETJA 2Q5FA 2X58A 4CM5A 5EHXA 4E2WA 4H0NA 1SQ5A 4LC0A 1QVZA 5B1IA 4U3JB 5IN5A 3T38A 1HT3A 4U2FA 1RMQA 1Q92A 3JQ9C 4XGRA 4AF7A 1UIRA 2EP5A 1I9CA 4GP9A 5K03A 1IRIA 4IFEA 2OO5C 3EY9A 3O1HB 4IIGA 4P82A 1QGED 5LQRA 4OQLA 4RSMA 1PQWA 1TJPB 1JQ5A 1UADA 3JAWA 2DQSA 4JD5A 3QRWA 5CGZA 4H1TA 5F78A 3G2HA 4ZDJA 2ZRIA 1Q14A 1KEEA 2KSQA 5FLXA 4DM3A 3AUKA 2R6AA 4TUYF 4UEKA 3UXHA 4TKVB 3B85A 3PR2B 3Q98A 2GBGA 2VHCA 3FSRA 3GP5A 4IMJB 4NOJA 4OH7A 2B98A 3CG0A 2W0MA 4GEKA 2IOFK 1XP8A 1GQFA 1TU0A 2DBRA 3MLAA 3O4RA 4JUDX 4WLFA 2BGMA 3A6DA 4HQRA 3E9DA 3WV4A 3BILA 1R4AA 1XVLA 3O93A 4NEGA 1G21A 5CDFE 1QZ3A 1M8KA 3WLJA 5E4FA 4ZYTA 2Q28A 2V6FA 3F96A 4BATA 1DBPA 4DY4A 4L9SA 4LTMA 4PQFA 4WXYB 4X84A 1AMUA 3FNHA 4OA8A 1LI5A 3P26A 1LS1A 3E2PA 4TRJA 1Q0RA 1IUOA 1ENYA 3D2CA 3G1UA 2OGUA 3OEEA 3NORA 3SFZA 1E1QD 2DH6A 4JC5A 4KXVA 2Y27A 1BDHA 2JATA 1IXYA 1JHMA 1MJ5A 2HU8A 1CIVA 3WB9A 4OKNA 3H2YA 5FRDA 4E0BA 1S2DA 2HMTA 1W5AA 1X7WA 2EFEB 4EKNB 1QGDA 1KC1A 4UOEA 4FX5A 3TQCA 1L5KA 6ABPA 1NQWA 3UXYA 1N6OA 4QOFA 2C42A 1NW6A 3PBKA 4NK5A 4JXJA 1M6NA 1TVKB 3ZI4A 4E5SA 3J7TA 3QNMA 5DTJA 2AZDA 1ZG3A 1FYDA 2WZDA 4XLTA 2QZJA 4L9AA 5H70A 1FMCA 1QKKA 3DOEA 3RGGA 4ZI7A 1HFEL 1PFUA 2WVAA 1RYDA 4RPGA 3U80A 1WBDA 2R25B 1KY4A 1WLYA 3EISA 4QRIA 2HEGA 2GN2A 3IKTA 2GPYA 2E5FA 4KVZA 4LXHA 5HFJA 3TE6A 3EZ6A 2AFHA 1DEOA 2IYPA 2OHJA 4TRRA 2PCJA 4TS9A 1SQSA 2A6PA 5DLDA 4ESOA 3LT4A 1JL3A 4LXGA 4OPMA 5LOVF 3S2ZA 3ITDA 1XQWA 4L50A 2CNNA 1SU8A 2LP4Y 2QJOA 3CFYA 3Q0TA 2NUPA 2ZI6A 3RIGA 3QOFA 4RFSB 1JYSA 1GXSA 3S0JA 1P1CA 2QDKA 3NANA 4I4IA 1BMFD 2ILTA 4HB4A 3GRVA 3W3ZB 1R0LA 2O2ZA 4BX0A 5JS6A 4J0HA 4L5AA 3AVYA 4HNQA 2IEYA 1J49A 3QU4A 5IG2A 1A72A 4YV7A 1U3TA 1DT5A 2FX3A 3KR1A 3IP6A 3S70A 1LF0A 2JGMA 4UBLA 3D4LA 4J6FA 3I9KA 4ZFNA 4YRZA 5K3OA 4C04A 1GSAA 4Y2GA 4YXFA 1UXOA 1KO5A 4D8WA 2PNFA 5KVAA 4MVJD 1BH2A 4EPTA 4I55A 1JT9A 4P3YA 4I4CA 1MDFA 2H5JA 2V65A 1DZ3A 4AMVA 4EB3A 5AW8A 5HZMA 1EWQA 1EDOA 2PMBA 2VJPA 3Q9UA 2PD3A 4QEDA 5JC8A 4IY1A 1LC3A 2PRSA 1OAOA 2I29A 5DNUA 1C4WA 5ECDA 2D1YA 1LGYA 1AOXA 4QXRA 3NYWA 3CUSA 1BG6A 5DF1A 4GI3A 1YE8A 1KOJA 4O0MA 3LQ2A 2IXFA 3AFOA 4KHZA 3TSAA 1PI3A 1JT2A 3CVJA 2FFQA 4TLBA 4G0VA 3NDPA 1I33A 4A8JB 3RO7A 3SYTA 1G5FA 1L7BA 4P5EA 1IZZA 3HHEA 2VXCA 4A3SA 1ETUA 1Q0UA 4QLAA 4NATA 3VKWA 1H42A 1M0TA 2PEYA 5CLHA 1ECGA 3VTFA 1I6KA 4OSEA 3ZHUA 1JU9A 4U6SA 6REQA 2A0KA 1HDCA 3L7BA 2ZTVA 1QYDA 4MPPA 4PO8A 4IKOA 4CDMA 4DXAA 2R85A 1IN5A 4IVNA 4WLNA 4AJOA 3K16A 4F0JA 3LW7A 1DLJA 3PK0A 1IJKA 3OLXA 3WGJA 4AC9A 3A0RB 1T5BA 4H6XA 4N3NA 4WT7A 2V8BA 2YWDA 3P96A 5EWLB 1SCUB 1XZ8A 1CR1A 2BV3A 4GBGA 3QP9A 4M1TA 4WMLA 4CMJA 1RHRA 4L74A 2FW1A 2JAWA 2XBMA 2FR8C 4J03A 3TQOA 4URUR 4EHDA 4GX0A 3H5WA 1UZMA 3ROTA 4BVAA 5SICE 2E4YA 5HW0A 2BP7B 1FQKA 3TNJA 4LJYA 3A2NA 3W8RA 4RVDA 1T3TA 5KTNA 4EUHA 5DSZA 2XZTA 5LP6C 3T3MB 3KEMA 2R8BA 2NYUA 3H8SA 3RS7A 1ARZA 3MCTA 1BWRA 3DC2A 3MHPA 1DC4A 2WICA 2O8FB 4JSTA 4PR0A 3CJQA 1T0BA 5AIAA 1N6HA 2GD0A 2WWRA 1N5LA 1FQJA 5DM4A 5HS6A 5K3CA 4ZEMA 3H5VA 1A5SB 3E9EA 4DR2B 4BMNA 2EGGA 4KQ2A 3T9BA 3TMAA 3JSXA 2DSNA 1GZ4A 1BD4A 2OZLB 1E1MA 3AJAA 3QZUA 4BJ3A 5LYYA 1AO0A 5ETJA 4GG1A 4IJ5A 1DJNA 2HO4A 2I22A 4KQIA 4TLDA 3BIWA 3QVWA 1ORTA 4OXIA 2OG2A 3HS3A 3HB9A 1SIOA 4LA4A 3T4EA 2Y0CA 1AKWA 4EAAA 4KR9A 5KIAA 2OQVA 4TPKA 5K8LA 1EFRA 3FOWA 5JFOA 2J30A 4L6IA 1W30A 1DQSA 1HE5A 2G1JA 3W04A 1XZGA 4HNVA 1HG0A 4LNUB 2E5WA 4OVKA 5FB3A 3ESCA 2R1VA 5FO0A 1UQUA 1XZDA 4RCVA 4TL6A 3V2UA 3QY0A 5G1NA 1FP4A 3C3WA 4O6VA 1UK9A 1JTFA 1TRHA 1Y9ZA 4JYZA 2EU8A 3H2GA 3Q3VA 1G7TA 3FZYA 4YECA 2NVUA 4QYWA 1URPA 2I8CA 1KYQA 1X3LA 1JSLA 3MMPA 2FOXA 5EXPA 3S99A 1XVAA 4GVLA 5FFNA 2CNLA 2YUIA 3L6CA 1N2CE 3D54D 3G0GA 1TU4A 3L6DA 4ROSA 5DI3A 3TSCA 4B3BA 3HO1A 1PQ4A 2GZ2A 3OF3A 3SX0A 4B85A 4F9GA 4H1WA 4DUGA 4KPUA 4HAZA 1NAHA 1GVNB 2D5CA 2NUAA 4FHEA 2HRCA 4HVAA 1FF9A 2YJ6A 1JU3A 1HYBA 1NT4A 1Y7HA 1IB6A 2FPOA 1FK8A 4G0PA 2HREA 2W48A 3ED1A 1V16A 2DPGA 2ID9A 4Q66C 4KMOA 4TXMA 1JHAA 4V1CB 1FU4A 1OH6A 2FG6C 4HXGA 1QHSA 4YJGB 2DUUA 5CDHA 1E2HA 3KYCB 3U3KA 3I76A 1WW3A 3QYAA 1CS4C 4DV1B 4LDJA 1BTOA 3FGNA 4RVFA 2AVNA 1VIYA 3MJEA 3KAKA 4BNVA 2OHGA 4N0MA 4EBFA 1KWKA 2OBFA 2AC7A 4UNQA 1FJXA 2XPCA 2PBRA 3KUCA 2XOXA 3BGDA 4IFTA 2X1HA 4ARZB 2DX7A 3G8CA 1A4UA 4DLTA 2OY0A 3MRTA 1XDSA 2ZSHA 3LUCA 2VYCA 4K40A 5EERA 3TTSA 4QVIA 4M7WA 1C8LA 1OC2A 4XIJA 3LDFA 5U1PA 1EINA 1PP4A 4R2WA 4FYPA 1DJOA 1PFKA 5FPSA 1U8EA 2HF8A 4RV4A 4WNIA 1H2BA 1XF1A 1Y1TA 3U3ZA 4D4JA 4E08A 4RK5A 2VPQA 3K2EA 1D4OA 2C9BA 3I6ZA 3TR0A 3PUYA 4XD7D 1XCLA 3E84A 4UNSA 4CTKA 4EMSA 4I99A 3O31A 2IOQA 1X7DA 2GEJA 3UJ9A 1I4TD 3DFZA 3JQCA 3BDIA 2JRLA 1FYWA 4BTLA 1WV1A 5JXWA 5FTKA 2AVDA 1NP7A 2OC4A 4G5FA 2R8YA 4ALKA 1W94A 3V1UA 1E4EB 1ZJYA 4DSOA 3UVEA 4B8ZA 5EIAA 2ODEA 3BTOA 3IX7A 3SVZA 1OZHA 2Q9CA 4C0JA 1Z6QA 2NOAA 3BDAA 1RWMA 2AR0A 3FUCA 5F7ZA 3KDAA 4KDEA 3ZDZB 3II6X 1MT0A 3FETA 2B30A 3PU6A 1DARA 4Q7JB 1J9EA 2GO1A 3N8DA 3OBBA 4L78A 1NJSA 2C5GA 2E89A 2VHEA 1GLVA 2ZYVX 3JD2A 3U44A 4X9XA 3VBEA 2VAWA 3GFRA 4HFMA 2ZBQA 1SUSA 3DSRA 1P1JA 2DTDA 4PVCA 1AURA 1N2HA 3AUXA 4RD6A 4XIFA 4D3FA 2YKGA 2J0QA 2I33A 1PJ2A 3MRXA 3LFUA 1QTIA 2NGRA 4MVJF 4OHWA 3THRA 4LBZA 5CDUA 4LDAA 1USIA 2I8LA 3AGQA 3P97A 3TPCA 4MA4A 3I6BA 4QAJA 3WLEA 2Z30A 4DFDA 4KV9A 5A5DA 3V7FA 1QVRA 1CQJB 3DPUA 4CLHA 4E7PA 1XNJA 2QLLA 2G9ZA 2PS1A 1VG1A 2C5AA 3DL0A 4AUKA 1UOPA 5HKAA 1OH5A 3U19A 1G6HA 5BSGA 1QIGA 2MOKA 5TGDA 2J87A 4WK2B 4M1SA 1JHQA 1JQBA 1LQUA 3W9BA 2QRQA 3HRIA 1P5HA 1X7GA 1XNHA 4OB8A 2P9BA 2PJUA 5CNMA 3IIJA 5CW1A 3CRQA 3SFVA 1BVYF 4B3RB 1NBAA 4GYJA 2I54A 2ZRNA 3ZZTA 3GZ4A 3FMFA 5EOVA 1X9HA 1C50A 2H85A 2HSDA 4JJ6A 3C48A 4JROA 5EKTA 3F5SA 3ZZMA 4ZI3A 1YC5A 2O2YA 2NACA 2TRSB 4JLBA 3RSGA 5K3BA 3X2SA 2XUFA 3FF4A 3TTVA 3HGTA 4RVNA 5B7NA 2FR0A 2A14A 2F90A 2MYNA 2QA5A 3BTVA 4QU8A 5E7JA 3VAAA 3VVCA 3K72B 1DIOB 1N5IA 5LMNB 3ABQB 1C3LA 5CHEA 1KF0A 1TYEB 2D6FA 3RC2A 4HEHA 1JWLA 3PGA1 4M53A 3K35A 4AO6A 5KOHA 4JLNA 1JPJA 3IQHX 2XUOA 3GPBA 3MEQA 3KCQA 4KQFA 1R4NA 5ADWA 4KWIA 2IBTA 5AWFC 3OE7A 1KIFA 3S2GA 4JUIA 1OXSC 4ZU3A 2JFQA 1SOUA 2IYXA 1V1MB 3CPEA 2HU2A 4KACA 4DBLE 4POOA 2FPGA 3KZNA 4PV7A 1CRLA 4I4LA 2CBXA 2XJ4A 4FT2A 4D9MA 2FR1A 4CHTA 1TPYA 5AK4A 4K8RB 2CV0A 4C43A 4F3CA 3F7MA 2PKXA 4RIGA 3S3TA 4EKYA 2Z6UA 1HDIA 2W93A 4LSGA 3TRKA 1V8FA 2AUNA 4WN9A 1REQB 2P3OA 3HU5A 5DN6A 5KDLA 1S2MA 4RDCA 4GGPA 2D1FA 4OQQA 4YR7A 3N3AC 1DGQA 4FMCF 5ILQA 1OWOA 2R47A 1J2RA 2FF7A 3L7DA 3MAJA 4IQ0A 3SEQA 4TWRA 3VHXB 5C5IA 1FZTA 3X1JA 5B58C 3MXOA 3EYAA 3BCUA 2PWBA 2A67A 2BKEA 2Z5VA 3PVCA 4MQEB 1VLZA 1OI2A 3BBPA 3FTNA 3L6OO 3L82B 1P7ZA 4O4LB 5KKCA 3IMKA 3STYA 2ZBPA 4KWEA 4L2IB 3QV1A 3ES9A 2P2NA 4INJA 1LSOA 4BNFA 4LVOA 4K46A 3CURA 3SY8A 4F6CA 2PYDA 5I8ZA 3DOCA 4ME6A 2ZWOA 2VPWA 1DZIA 3R6DA 3FTCA 4CQLA 1RRFA 4A26A 4Q6BA 4B2YA 2ST1A 3EXHC 3K9GA 3PUXA 4UU1A 1U3FA 3RYIB 4ZVVA 4LYHA 2G5GX 2J9ZB 3AP1A 3HJBA 3V1YA 3ZVNA 3NWEA 4TXJA 4ZDWA 3IJRA 2FV8A 3RTCA 1G5HA 2X4DA 3L1VA 2YZGA 4R8LA 2ZIWB 1PK8A 2XUZA 1UBCA 3AKEA 4GBED 4GZ5A 3V33A 4DZTA 2QN9A 3UK7A 3G5AA 4BOYA 1XALA 4LDQA 4CV2A 2A94A 1NKTA 3RFUA 4GYKA 2X6RA 3QKWA 3IDOA 2LD4A 2VHJA 2RKOA 2QRHA 3ILVA 1F2UB 4C4PA 1JTEA 3VKGA 1E3WB 4AP9A 1WCXA 4PSVA 4ZQIA 4UM9B 3L7NA 3QVLA 1E7WA 1TLTA 1WUHS 2IY8A 3OFKA 4TTJA 5EJFA 3D31A 1OIXA 3STHA 3A4MA 4PANA 1M2WA 3EXFB 1TJNA 1YSCA 3LF2A 1FP6A 3QWIA 1DO2A 1OPRA 2VPPA 2H2GA 2XUJA 3HB4X 2IXGA 1CUWA 3MINA 3NOXA 3W3AA 3PNQA 3TUIC 1MJNA 3BX1A 4ZDIA 3LC2O 4B3CA 2V6MA 5FPQA 5CVTA 1YO6A 3EQ8A 5G0SA 5T6MA 4HL6A 5BVGA 1X94A 2OE2A 4XUGB 1D8AA 3EUEA 4WKBA 3ZU4A 2NAFA 5K8UA 3LYAA 4X1OA 4MKRA 5AQ1A 3PPWA 5AW0A 4QBGB 4MW6A 2WJ4A 2AQIA 1HTBA 2HF9A 3DMYA 2H92A 4NECA 4LWQA 4V0RA 3OCUA 1RM0A 1KMNA 2I3GA 4CG3A 1NE7A 2FZEA 4NMMA 2BEUB 4YAJA 1L8OA 3FRJA 3JQ8A 4DEXA 3U9SA 4Y7CA 2CYAA 3CUEF 3V46A 1XA3A 4F3YA 5KNDD 5ICEA 1OBOA 3LRTA 2HJWA 3F5DA 5PNTA 2D1TA 1F60A 4AWXA 3EFOB 3WJ1A 3ZQ6A 1LTKA 1BA3A 5BWBA 1VG8A 3DB1A 3O3CA 2BGKA 4RELA 3CLTD 3OFJA 5KB3A 1CUYA 3B20A 2H6EA 1YFZA 3KZKA 1WNTA 1W2GA 1ZISA 2CMHA 3OY7A 4PYOA 4QBHA 3LPDA 3PJFA 2HWXA 2V6BA 1L9XA 1VJTA 4LK2A 1HE4A 1SVOA 3TXAA 4M8SA 1P2SA 5CFZA 3S2YA 5JIBA 3BMOB 3U13A 4OHUA 5IJWA 4Q7QA 4JP1A 4LRQA 4TGLA 1FFHA 4TS4A 1BC5A 4YREA 3ZH2A 3TKLA 3EUWA 5DHFA 1JFVA 2Y1EA 4XVRA 3DXFA 4C1BA 3D8RA 5KTTA 2P77A 3RVLA 2WT4A 4WJZA 3U44B 2C2WA 4UDNA 1XCBA 2E85A 4QE3A 3AEKA 3W79A 3B89A 2A9RA 3I0MA 1ZMRA 1RWBA 1CBUA 4E5UA 2BKAA 2XXAA 4CMHA 1H6CA 1ICEA 1T10A 3JARB 1JE0A 1B43A 3N8GA 4M2LA 3MD9A 4O2BB 4EB0A 1GPJA 2PQ2A 4X7BA 3FNQA 1A95A 5FTLA 2KLBA 2HNAA 2YWHA 4CMIA 1G5PA 1TQ2A 5DO9A 4TQ9A 5GJCA 5KYWA 3EEQA 3HQ4O 2AL7A 1XBTA 2FK8A 1OIWA 3DW1X 1GTMA 1VRVA 3OECA 3QHQA 5E4TA 5CLGA 2Q3BA 4UZEA 2WTUA 1UZUA 2IPOA 3RSHA 4RTQA 3PCXA 5GV7A 3OT4A 4X64B 3NXKA 2ZQ5A 5J4LA 1MTOA 3QFSA 4DC9A 4AY4A 1W44A 1XMOB 3EC2A 4R2XA 1KFCB 1LJUA 4MINA 4CXMA 4DGQA 2W4MA 3U1BA 2QTVB 4DLVA 3RYCB 4OHFA 4TMYA 2JK1A 1N4AA 2P4UA 4ZT6A 4QQFA 5EZYB 2Q7OE 3DQQA 3OOEA 5FBLB 5GM2A 4PYJA 3DD1A 3HEMA 4PNHA 5DGTA 2GKSA 4EPRA 5F33A 4MVWA 4KGVA 3TCNA 1IQ0A 4HFJA 4PS0A 4B5LA 4YXWA 4QU5A 3I6IA 3A2MA 1E2BA 3C8UA 1NWCA 2O2XA 2WFMA 2XWJI 1LFDB 2Z3VA 3TLEA 1XMXA 3UGQA 3JRWA 4QEZA 1ZVKA 1FFXB 1TGVA 2AK2A 2QR2A 3TIFA 3RYCA 3U4MA 5JVDA 1XMJA 5DHUA 1VGQA 2O8DB 4CW7A 1UZNA 4BLVA 3QG5A 3OPMA 3C85A 1EAMA 4GDFA 1GGMA 1E2NA 4BCCA 4G1FA 2QK4A 4N1AA 3NAGA 4P4GA 3KO8A 1BXGA 1A77A 4C0XA 4GC9A 3DE6X 1DWUA 5BWOA 3NHZA 5I9NA 1MQAA 2HIMA 3O4IA 3WAKA 2ADMA 4PNEA 1E6WA 5LZ8A 5AUNB 2HJGA 4Z0TA 4OJYA 3ZNOA 2KM1A 2J0UA 4CLDA 1K8XB 3R6LA 1GV1A 2O5CA 3WRVA 2VYVD 2QJRA 1YAJA 3CEAA 4L0MA 3DMFA 1H5NA 1TYDE 4YAGA 3PNBA 3UFXA 4XVCA 2YXBA 4M4SA 2J4CA 4MQEA 1SBTA 5EJGA 4F6LA 5IKMA 3EEYA 5LUAA 4MR9B 5C7OO 2B2CA 1E1KA 5EKDA 3VC1A 2BDUA 4R1LA 3DR5A 2V4MA 3K05A 4WASA 1OVMA 2ZI7A 3OU6A 1D2MA 1U8UA 3DEYX 3SM3A 3Q11A 4EUSA 2YDYA 1T6ZA 1Q12A 3OCJA 1LK5A 1JW9B 1UJBA 1A50B 1JQ3A 2C2ZA 4FNGA 5L4NA 3QFTA 1PJSA 2WYIA 1D4AA 1J97A 1M1UA 3IEKA 4P5PA 4EX7A 3A06A 4ZCMA 1YWGO 2ZB7A 1Q3TA 3LUDA 3JWIA 4IAOA 4CKEB 1L3BA 1UJ6A 3V6MA 3WYBA 4J75A 4KIGA 2CC2A 1RAGA 4BLUA 2CUNA 3HN2A 3O84A 4IJ6A 4CF7A 4H6VA 4MVYA 5HKLA 1ZRMA 2JLCA 3W6UA 4A73A 2ZKIA 1ZBDA 1SD1A 4J9VA 4NS1A 4DA6A 5FUWA 3BA6A 5BOVA 4QTZA 2AN4A 3L41A 3UGKA 3TVDA 2HWKA 5KKNB 1G64A 1F9AA 2BI8A 2BGIA 4LJ5A 4ZCTA 1G3IA 1IHDA 4KBGA 4TZTA 3TK1A 3H7AA 4XYGA 2O8FA 1KDZA 2RK6A 1R5OA 1T5SA 2L17A 3NH6A 1Z5VA 3AOGA 2R96A 3M4YA 4R9SA 2QTTA 3PB3A 1BEUB 3QSGA 3WY9A 1ST3A 5TVKA 2MINB 4RULA 1KQOA 4L8YA 3TOVA 4UMFA 3UOAB 5H9WA 1EEXB 3D02A 3JAMA 4EJFA 1SWVA 3BH0A 1YR2A 2FN8A 1RI2A 1YFLA 4DMHA 1PJ8A 3H84A 2OV3A 1OC4A 2H1LA 3ONDA 5ARCA 1OOEA 1ML3A 1OUMA 1EUYA 3ADCA 1D3AA 1EWRA 3N28A 3ZIAA 3ZV6A 4ZK2A 3FNBA 3MQ2A 4OOFA 5CJPA 1YFJA 1XELA 2JFOA 3KLPX 5C1IA 2IEZA 3HHPA 1CDEA 1M2VA 5EP2A 5K6TA 3CF0A 3PFWO 1XEWY 5G0VA 1ZGZA 1Z45A 3B9RA 3WLTA 3I1YA 4PN3A 2WTXA 3BK2A 4PLCA 5T67A 5KTMA 5MN4A 1H5QA 5JDIC 3AHJA 3CM0A 3UJAA 3H13A 2ZUSA 4ZCPA 3TUZC 4NJEB 5LVAA 1B23P 1USWA 5K20A 4BMOB 1DQYA 4L95C 2VQFB 2JIDA 1UJ5A 4X45A 2AD5A 4WFQA 1F0YA 2A5YB 4KO1S 4X6YA 4EZEA 3PC8C 1VHLA 5AW2A 1TDJA 4S04A 3UFBA 5CB8A 3HCAA 3QUAA 4I19A 5FPYA 4GZLA 3CMCO 3VPGA 2OO5A 3B52X 3AERB 2FWNA 3E9CA 5THQA 1RC1A 3WRXA 4X41A 4E5VA 3V8NA 1C3EA 3E3LA 3TZHA 4KQCA 2VUSA 3Q6IA 4F5ZA 1TM5E 3M9LA 3AKZA 2I4NA 4EMUA 4E13A 4OO3A 4X95A 1MENA 1DLIA 3TLYA 4OHPA 2WHPB 2QTNA 1A04A 5G4KA 3BRQA 2JGFA 3IOBA 4C0WA 2EX4A 4W8GA 1TIBA 1EUZA 1SOWA 1WMBA 2A57A 3ODGA 3MLBA 4PFSA 4TTRA 4WD3A 4WLVA 4EHAA 1O96A 5BWLA 3KZCA 3KQKA 1IY9A 5LNK6 3T3DA 5FFFA 5HGJA 3ZK8A 1UCFA 4LFCB 3DV9A 3NM6B 2Z2IA 2WG2A 2WIDA 3GFOA 4X62B 1VMDA 3ZLJA 3S68A 3CEPB 4CCAA 3IEPA 1EE9A 4C9BA 2EYUA 1CP3A 5DT2A 4JT2A 4ZO8A 2XGMA 1XK6A 1Y1QA 4M22A 1EXDA 5LBUA 3C43A 3RFXA 4GL2A 2LXNA 1KVSA 2Y71A 3CX4A 3VDQA 1WQ3A 3OI7A 2WA1A 4X3CA 5SYNA 4XRGA 4DUYB 4AJIA 3U7HB 3JQPA 1B8UA 1OI4A 2GTHA 5I7OA 4US2R 3IB3A 1RABA 2B4AA 3NOQA 3R24A 4D81A 4FD2A 3E70C 2EERA 3O8DA 3IOYA 4W5NA 3LLCA 3RW9A 2C2KA 2F9LA 5FI5A