4X8OA

Crystal structure of e. coli adenylate kinase y171w mutant in complex with inhibitor ap5a
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
214
structure length
214
Chain Sequence
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEWHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase
publication title Structural basis for catalytically restrictive dynamics of a high-energy enzyme state.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
A PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4x8oA00
3TVTA 3MG9A 1E9CA 3PG5A 4JZKA 4FINA 5F98A 3AEZA 3F5FA 4JL5A 1P61B 3CRVA 1L4YA 1GL7A 1KSJA 2MMGA 2VHCA 2B21A 1ESNA 2WKRA 2ZVPX 3H2YA 4QHTA 2IWRA 4G0NA 1W36B 4OJQA 2IUSA 3VTKA 4B3BA 2WWIA 1X1SA 2R6GA 3AVQA 3CM0A 3E70C 4B3DA 2J41A 1MR3F 2MSDB 5AUPB 5FL7A 3QUSA 3M4YA 3T15A 3ZZTA 1OH8A 3OEHA 4QC2A 1P75A 1Q1ZA 1EX6A 1AGPA 3KJIA 1GILA 1U81A 4EJSA 2ECKA 1KNQA 5L8VA 5FOWA 3AUYA 2OCAA 3TJZA 4LV5B 1XPUA 1W4BA 2ZRKA 3PUXA 1G21E 3K0CC 4P3YA 1OT3A 5CJ2A 2GCOB 1M8PA 1W0KD 2RHDA 2ZREA 1UBGA 1ZUNB 3AKCA 4DLWA 4A4DA 2ATXA 2V3CC 3HPRA 1FOEB 5TXGA 3W8RA 1M74A 3FFAA 3B1ZA 4M53A 3VR5A 1JALA 2OXRA 4LX0A 4N0EA 4QRHA 5FTLA 3FMPB 1HURA 3MLEA 2IYLD 3RWMB 2CXXA 5CDFA 2VP9A 3DL0A 2OCYC 1LTQA 4C0QC 4JLOA 4UXJA 5EE0A 3I72A 1Q21A 4QM6A 3C16C 3LX5A 2WMNB 1KMHB 2IYVA 3K09A 3B1WA 2HUPA 4GSYA 2P3SA 4E22A 2P0EA 3MAAC 3ZH9B 1FP6A 3LBNA 3P32A 2PT7A 1G20E 1OHHA 3Q85A 3ZLJA 4C7OB 2PLRA 1E98A 1DELA 2PJZA 1DO2A 2G83A 3NG1A 1Q1BA 2PBRA 3PXGA 2B8WA 1CJTC 1E2IA 1KKMA 1ONBA 1W44A 3K0FB 4R2HA 4TLEA 4B2PA 4C9BA 4AYTA 1KK2A 2BM1A 1N5IA 2D62A 2YINC 4Q7KA 2GEUA 4TYQA 1Z6GA 1X8LA 4AURA 2PX0A 3SC3A 4HUTA 2PX3A 4A0HA 1XJCA 4OQXA 2VBCA 4TN1A 3NBYC 1Q22A 3RLFA 2D3WA 4GI7A 1KMQA 3JVUA 4G5QA 4LHWA 2GJSA 1OYYA 4RY2A 2D2EA 4NYJR 2ORVA 2VSOA 1DS6A 1CJKC 4QGHA 1NJGA 1R7RA 5HZKA 5KSPA 3KKQA 3SNHA 3DEFA 5D3MB 1KI6A 2Z43A 5P21A 1N0WA 5AUQA 2IS1A 4CRWB 4QBIA 3QKRA 2IYQA 3HWSA 4LWZA 3MGCA 2X2EA 2Y8EA 4Q1AA 1T5LA 3VR4A 4I1UA 5EP1A 2XNDD 4NE2A 5FUVA 1II8B 2D7CA 5J4YA 1P2VA 1SKYE 1N6IA 5C1BA 1ZNWA 1Z47A 3UG6A 3BH0A 2V7QA 1JEEA 5HR5A 1E2PA 4BE7B 2I4IA 4YMUA 4CEHA 4BFUA 1DAGA 2ZJBA 1FL9A 3CNNA 3KXLA 2QSZA 1I4LD 4ZKEA 4C30A 1GKIA 3DMNA 4AI6A 2V54A 1J8YF 2XITA 2FN4A 2G9NA 1SVIA 3CB4A 2YC4C 2FFAA 3GLGA 3MUFA 3U61B 1CTQA 2IW3A 2HV8A 1RPZA 5JZVA 2FX3A 2ZJZA 2C98A 1FUKA 1KDTA 4UNSA 1X86B 3RS2A 1LS6A 1XP8A 1EWQA 4RZ2A 4M1YA 3BXZA 4FI3C 5FTNA 5L3QB 2X19A 2PEYA 4LCBA 3TGPA 1E9EA 1MKYA 3QVUA 1DTSA 3MWYW 3GJ6A 3P26A 4OK3A 1EFHA 1XXHB 5HCIA 3QENA 1E1QA 2R6CA 3U44A 4A15A 3TBKA 5LD2B 3L8ZA 2QT0A 3U3OA 4C0SA 3D8BA 1XTIA 2EFHB 4OHVA 2VHQA 4PC3A 3IQWA 1KO7A 1LFDB 4JKIA 4B35A 1LY1A 3SFZA 4UKDA 1TF7A 2BWJA 1XEWX 4DB2A 4XOIA 3WP0A 3KQKA 4AY2A 1DAMA 2HLDD 3K0EA 1YZGA 2GETA 2QQ0A 2VLIA 3NHAA 4Q01A 1UBEA 1VKJA 1N6HA 3EARA 2ZU6A 2OFWA 3EZFA 3KQLA 1EK0A 3N2IA 1Q1EA 2FNAA 2IT1A 1ZNXA 4Z1MD 4BFYA 1R5NA 2PH1A 2O5VA 4R71A 4ZIRA 1P73A 1II9A 1NMXA 3ZS9A 2WSSD 1P2UA 2FEOA 2FGKA 3GLIA 4RCZA 2VF7A 1RJ9A 4TQ9A 4Q9IA 3T06B 5F9FA 4Q4LA 3LO5A 1G8YA 3KKNA 2FH5B 2O8DA 3GCGA 2ZJYA 2JLQA 4M9QA 2GCNA 4PSKA 1VHTA 4FMBB 4W9MC 4Q1FA 4TL8A 5EZ6B 2H16A 3AM1A 4GOKA 1D2MA 2A3RA 1QVRA 4W5WA 4WBSA 1GNQA 2ZRJA 4XJXA 2F43A 1U8AA 4HEJA 1E9BA 3W5JA 1J7KA 4DHEA 2NO6A 1MO5A 2VSFA 1R10A 1G8FA 3GLGE 1ZM7A 5K8IA 3EG5A 3GFPA 3GLHA 1T4GA 4BRUA 4JL8A 2QPAA 3WBJA 1NVWQ 2BMEA 1M7GA 3KUDA 4K81B 1E2HA 3TW4A 4HUQA 4TL6A 1KO1A 5FI0B 1FMJA 3T61A 2QZ4A 2JLXA 1MABB 2R44A 5DNYB 4Q9KA 3EZ6A 2CDNA 4LYAA 4TMXA 5E7MA 2IYYA 3V9PA 4YXWA 4QKQA 2P6UA 4Q48A 2K5UA 2GAOA 5GJVC 2O8FA 2E9SA 4UJ3A 2WJJA 3MFYA 3AVTA 1W48A 2WJGA 1XZPA 4LI0A 1Z5ZA 1P6XA 2RGGA 1UBCA 4ARZA 1JR3A 3U6KA 5KPDA 2R8RA 2XOKD 3CF0A 1YQTA 4I1SA 3K0CA 2JLZA 3T35A 5G41A 1O87A 4LC1A 4RFSA 5DI9A 1OFUX 3WY9A 1F3OA 3U7EB 1WQ1R 3KFXA 1W1WA 4BPBA 1HUQA 2QA5A 2JLVA 4DDUA 2W6JD 1DADA 2YNMA 3R7WA 2CVHA 1Q12A 3GJ7A 4MH0R 3CR8A 4LGMA 2QPOA 1UM8A 1CU1A 2IA5A 3L8YA 4Z8XA 1QHGA 4BLSA 1NL3A 3WMGA 4BLRA 5BN3A 4DDVA 3GEIA 3AVUA 3SBEA 1E2QA 3KB2A 1SVOA 1NIJA 3KQUA 3T5GA 4QNRA 1E2MA 4TMKA 3V4RA 5HE9A 2IYSA 1SZPA 4QBGB 5L3VA 3MWLA 4IRUB 3FWYA 3THWA 1EESA 2QM7A 4PPFA 2YOFA 1G3MA 2EFDB 1XWIA 2P6RA 2B7BA 2GF0A 3DZ8A 1NN5A 3SI7A 1R6BX 2ZUBA 1FNNA 2WKPA 3LQQA 3LNCA 1GAJA 3KTAA 1NMZA 4LBZA 2O52A 4MUBA 5AWFC 5KU1A 4B43A 2CLCX 1G3UA 1YZNA 4Q4JB 4M1OA 1QHHB 1ZM4A 2CVFA 4TTQA 121PA 4BFZA 4ZV4A 2A78A 2G88A 4DC9A 3OEED 4WVFA 4PR0A 1Z22A 1G6OA 2V8OA 5ELXA 1BIFA 2J7PA 4KVGA 2FMXA 2J0VA 3AF0A 4OKSA 3I62A 2V7QD 1GDDA 3PITA 4O2LA 2ASEA 2Z4RA 4CEJB 1UF9A 2EQBA 4O25A 3A1VA 4JMPA 4RZXA 5E4FA 3TIFA 1AJEA 4HZUB 2VRWA 1OIWA 1TEVA 1G3QA 2ZROA 4KFTA 4L16A 1G8HA 1QHNA 2QENA 3NTUA 3OFND 1E99A 1VPLA 3ZVMA 2ZE5A 5EUMA 5B2ZA 3AF1A 1TPZA 3HU1A 4Y0AA 2KJQA 2JLSA 4D4KA 4IXMA 4KXFB 4B32A 2P67A 5AR1A 1UEJA 2ZR7A 2ZYVX 3BS4A 2V1UA 2PLFA 2RGAA 1N5LA 4GZLA 1IY2A 4CT4B 3X1DA 2OFOA 1N6LA 3D3QA 2PMDA 2QBYA 2OESA 3ADBA 3SN6A 1D6JA 3QQ5A 3QBTA 4BZPA 5FL3A 1N6NA 3QPUA 1OKKD 1SHZA 3RDPA 1GRRA 1E2GA 5FPYA 1BMFA 1Z0DA 3AGQA 1DARA 1G16A 2GVDC 5BW8A 3DM9B 1XEXA 1AN0A 2CCGA 5KDLA 1BKDR 3C8UA 2QAGA 5JI3E 2XSZA 1NJFA 2ZRAA 2UZ3A 1CR1A 2GZAA 2ZRFA 4PC2A 5EXSA 1CS4C 4ESHA 1UAAA 1N0UA 2WIBA 2AK2A 1OLOA 3RANA 1CR2A 4WXRA 1KY2A 2BVNA 2CHGA 1DVRA 1WXQA 4AKIA 2F1HA 5G53C 1CULC 3PFIA 2DY1A 1CEEA 4NCIA 4V0LA 1KI8A 4EDHA 4JBWA 4Z51A 2BIFA 2GJ8A 3RRMA 5L3RA 4Q1BA 4URXR 1GWNA 1NKTA 4OQNA 2XTNA 2NO9A 3RC3A 5DO9A 4WAUA 2FPKA 2YWHA 4MKFA 3GJXC 3DMDA 4M4SA 1IY0A 1IONA 3IEVA 2QTHA 4PSAA 4V0NA 3X1XA 2G1JA 3L0IB 3TMKA 2EFGA 4D25A 2QROA 1SKYB 1HEIA 2WV9A 3AKYA 4NCKA 2F7SA 1OJLA 1R8SA 3O8CA 1US8B 2AX4A 521PA 2GXSA 1XD9A 4CDGA 1E4VA 2OBMA 3V4FA 4BUJA 4F92B 2OAP1 1F2UA 2Q9BA 5KNCA 3GLFA 4PPGA 1IBRA 3S1AA 1P62B 1Q20A 4C0LA 4RJLA 4TZ6A 3K09C 3VR6A 4EQ6A 1T0HB 2HCJB 5IT5A 1F60A 1SGWA 1LVGA 2G3YA 1XB2A 1A2KC 3CLVA 1XPRA 2ZI3A 5FTJA 4ZI2A 1KKLA 1XZQA 1AM4D 1E1RD 4US2R 4QGFA 4P4UA 4RD1A 4TLCA 2QGZA 2XZLA 4M1TA 2HEIA 1GFIA 5JHGB 5TMPA 2DPXA 2TMKA 2DB3A 3CBQA 1SKQA 2F6RA 1JAHA 2G0TA 2ZS7A 4CEIA 1HE8B 2NTYC 2WWWA 2ZRCA 5BXQC 3BRWD 1COWD 4MYHA 4A9AA 2RGEA 3PR1A 4LV8B 1HQCA 1LW7A 2KBFA 4URWR 1BS1A 4GOXA 3VX4A 4TL7A 2XTMA 2G77B 4N0DA 2UKDA 1UBFA 1VIYA 1YJ5A 5K8TA 4L15A 2P5TB 2VTKA 1II0A 2V1XA 3HYTA 3GJ8A 2J5XA 2C03A 3SYKA 3FDIA 3K1JA 1OB5A 4TT3A 3ZGXA 4LBYA 3NH9A 1FX0B 2OCPA 1HYQA 1HE1C 2I3BA 1KO5A 2WAXA 1BO6A 2AD1A 4ZCMA 1XD2A 1GVNB 2YKGA 8OHMA 4LPSA 5E7IA 3KXIA 4JSYA 3ZZUA 1KI6B 4HDQB 1OF1A 2QE7A 4QBHA 2JJ2D 3K9NA 5EP3A 3QKRB 3LVRE 3U2QA 1PUJA 1EG7A 4TQUS 4BEBA 3BIFA 3TE6A 4WIAA 4B75A 3ADKA 5SZIA 3NVAA 2QEQA 5GVSA 3IKJA 2YZ2A 4FWIB 2E87A 2WWXA 2QAJA 3DZDA 3MMPA 2FG5A 4W7SA 1G7RA 4UQOA 2EFCB 5KSOA 2ZYTX 1ZIOA 4EPXA 2VPPA 5CJPA 2JLUA 5DHAA 2JIZA 3BB1A 3VU9B 4GP7A 4EKDA 4TYYA 4PAQA 4AG6A 4LJ5A 3UWOA 3G5UA 4Q7JB 2HJGA 5IF9A 3GLGB 2QU8A 1FZQA 4D82A 1NLYA 3THXA 3OAAA 1PLKA 4A92A 4H9GA 2PZEA 3EXAA 3AP1A 3QKSB 2ZXUA 2GTPA 3CNLA 4Z54A 3BAFA 1E4YA 4PHFA 3RNLA 3RS7A 4Q00A 3EZ2A 1XNJA 4I99A 3U44B 1Z8FA 2OUKA 1Q3TA 3FHOA 1UJ2A 2Q0HA 1DEKA 2GCPA 2OV2A 4Q4HA 1IJEA 2HT6A 3CF2A 1GKUB 1N25A 5TB5A 2FGJA 2IYXA 3M6AA 1M1YE 2AKYA 2FSFA 1E6CA 2FF7A 3B9QA 3LBHA 3TAHA 4QJ3A 1E79D 2ZRBA 5DYIA 1RC8A 4DCVA 2GEVA 3IPYA 2JDIA 1H8HD 3ZD7A 4L5BA 3K0AB 3WYGA 2JLRA 4R7ZA 3KKOA 2AXPA 4HLUA 3FOZA 2QY9A 1AKYA 1MO3A 1KNXA 2ONJA 4FIDA 2OILA 3EIHA 2XZPA 2WWFA 2EU8A 4NU0A 5BN5A 1KDRA 5JEDA 1SVMA 5KYKA 5DISB 2IEYA 2PCLA 4BZQA 1P60A 2IWHA 4B3XA 1BMFD 1F5NA 2A7QA 1G3RA 2N46A 4QJ5A 4F4CA 4EFLA 1K5GA 4E07A 2VHTA 1EFUA 3TNFA 1JQJC 1D8TA 2A5GA 2W2VA 3K53A 4JVSB 1CJVC 2A5YB 4I81A 4V02A 3NKVA 3EPLA 1DG1G 1MV5A 3B9PA 4NCJA 3M0EA 4KU4A 2ODEA 3RRZA 2QRZA 2ZPTX 4MGYR 4BZXA 3WMEA 4PTLA 2F43B 2YYZA 2VL7A 1JXOA 2RCNA 4HB4A 2F1JA 4DDTA 4XVUA 1GOTA 1XMIA 1TQ6A 3KKPA 5B58C 4WOPA 5AUOB 3NXSA 2JJ1A 3GFOA 1EFRD 2BV3A 2ZYUX 1KIMA 1GL9B 1U0JA 3DHWC 2R2AA 1DAIA 2D4HA 3A4MA 4TLDA 2HJVA 3IGFA 4OQFA 3SJZA 1DE0A 3CZQA 4URUR 4DT1A 2MSEB 2PJRA 5KO2A 2WWHA 4ZDKA 2BJVA 2C77A 1ESMA 2QRNA 1CLUA 3LXXA 4AK9A 2GZDA 3Q9LA 2CK3D 4XTCS 4US1R 5CLQA 1XTQA 4AWXA 4C0JA 1KJWA 1OW3B 2CHVA 4LJAA 1MO6A 4O0MA 1KK1A 4S35A 3TSZA 3I73A 1M2OB 2ZRGA 2DFTA 2GXUA 1H65A 4K46A 1IOZA 1G3IA 1Q44A 3I32A 1E2EA 5IK2D 4YQFA 4DSOA 1Z07A 3NIBA 4NPHA 5BYJA 3CRRA 4BEJA 1XBTA 2O0KA 1W5SA 2FFQA 2IHYA 2CCKA 4BLQA 1Z0IA 3AVPA 2XNSA 1E0KA 721PA 2G0NA 1G41A 2WPDD 4DWJA 4BGDA 4IXNA 3PV0A 3SEAA 3X1YA 2LKCA 1XF9A 2GNOA 3A36A 3L43A 1HT2E 2VP0A 1RRPA 3UIEA 4LYHA 1XFAA 1WF3A 2GVZC 2XXAB 3ICEA 1KDOA 2J0UB 1YRAA 3K9HA 2OT3B 4DEXA 1AQYA 2ZE8A 4GNKA 3T1VA 4LJ9A 3TKLA 2QG6A 3EASA 1G5TA 2B92A 6Q21A 4A8JA 4KVAA 1C4OA 5JECA 3THWB 1ZBDA 3C14C 3SYNA 3CUEF 3MD0A 2OBNA 5DLQC 5FBVB 3DKVA 4TL9A 2O8CA 2A5JA 1WMSA 4JS0A 1YZLA 4Q4AB 5FOXA 2BC9A 5KPJA 3SZRA 2VEDA 1JNYA 2AFHE 1Q3HA 5J47A 5EE3A 2CL6X 4TSFA 1YR9A 4QGAA 1Z2AA 3ICQB 4LV6A 3THYA 3KFVA 3L82B 4IW3B 3UWKA 3EC1A 2YV5A 1DG3A 1CP2A 5EXPA 5JSZB 2ZRPA 4KAXA 1WDTA 2H17A 4P4SA 5KHOC 3TQCA 1F6BA 4B2LA 4LC0A 4KBFA 1W0JA 4FMCF 3NWJA 1VDZA 3P20A 1QG2A 1NY5A 2B7CA 4OQLA 1HTWA 3U4QA 4WZBE 4NYMQ 5LPNA 4ITRC 2CJWA 1HT1E 5EE5B 1CJMA 1PUIA 1MO4A 3BB4A 4JVMA 4A2PA 1F2TB 3I61A 4K8OA 2GWHA 4PPNA 3RRNA 1A1VA 1F48A 4DLZA 4GDFA 2J0QA 2JLYA 3O8DA 5BYKA 1A5TA 3RAPR 5CDFE 2GILA 3B82A 4HAUA 1E2LA 1ZP6A 3IILA 4B3FX 2C78A 1NG9A 1M7HA 2OG2A 4AYWA 1CRQA 1OXSC 3BFVA 4IFBA 4YLGA 1GRQA 4KFSA 4YMSA 1DAFA 1N6KA 2F9LA 2CCJA 1IN7A 3AVOA 1JI0A 4DIDA 4P31A 4QHYA 3EPJA 3KX2A 3P1JA 3ONWA 1I4DD 4PPQA 3NHBA 1VYTA 4IDQA 4L8GA 4FCWA 2ZE6A 2V9PA 2ZI4A 4LHXA 2PT5A 2F3RA 2YVUA 3AKEA 2ZR0A 1N2CE 2JDID 3HJNA 2QAGC 1WBDA 1P5ZB 1ZM9A 1ZM2A 5CM9C 5AJZA 4A6XA 4BFSA 5DI3B 2GEDA 1DAHA 2ZSFA 4RD3A 2H5EA 2AL7A 1KZ7B 1G5RA 3SJBA 4HAYA 1OB2A 2ZI5A 3HP1A 4QBFA 2F1RA 1JQLB 1HV8A 2WOJA 2VP4A 1GRNA 4HYYA 1G7CA 4Q5IA 5HZHA 5JBQA 3SR0A 3AP2A 3AVYA 3WXMA 5EXXA 4A0FA 4RD0A 4BFVA 1VYVA 2IUUA 3KJGA 1WA5A 1RYFA 5TY0A 2O8EB 1I4TD 2F9MA 4DSTA 3OIUA 3PEUA 3EPKA 4IHQA 5FPTA 1JR6A 2Q6TA 3D31A 4CVNA 3G0HA 4GOJA 1SXJA 3B8HA 5CB6A 4ILEA 4S2EA 1R5OA 4TZ0A 3B6EA 3W3ZB 3QE0A 4MGKR 5FOVA 1FQJA 1GKYA 1AZSC 4PQYA 1ZJ6A 1U8ZA 3NBXX 4IKEA 2QT1A 2R62A 4YMTA 3T1OA 2PZGA 1G64A 1YR8A 3LLUA 3U3JA 5JS8A 2J1LA 1N6PA 4ZO4A 3KL4A 1VCOA 4ZCLA 2FDCA 2QPTA 4JLJA 1TADA 1ZAKA 5FL7D 3A6PC 2FFBA 2WJVA 1TU4A 3OEHD 1VG9B 3QJYA 2KSQA 1DPFA 5GJWC 4NYMR 4KFUA 5HKKA 4XD7A 3QEJA 5IHPA 4FCTA 4FMCB 3MWJA 4AKGA 3QF7A 4ERNA 3FKSA 3UMSA 4KLNA 5CK4A 5FBRB 4LDJA 1GUAA 3DOEA 3Q5EA 3ZIAA 1QBKC 3LV8A 4FXPA 1E0SA 3BH6A 3RWOA 5KSZA 2BEKA 4KYUA 2C9CA 2BHRA 1JJ7A 1K6MA 1DAKA 4LPKA 4EPRA 1JJVA 3AVWA 5FTMA 1E9RA 1E9FA 3BFKA 4Q02A 2CLDX 4JLAA 2OE2A 1LNZA 2C99A 3B78A 3KKMA 4RD4A 4B44A 4EFMA 5JLJA 1TUIA 2QGNA 3MRSA 5JMTA 3C5HA 4CEIB 1OE0A 3TW8B 2VF8A 3ASYA 4XSGA 5HE8A 4ABYA 2WHXA 4B74A 3CWQA 3SHWA 1KGDA 2CNWA 2OFXA 1DBSA 1OPXA 5C4MA 5UKDA 3W34A 1I2MA 4HAVA 1Z08A 3HPQA 1OIVA 2QNRA 4P32A 2HXYA 3W6OA 1IHUA 3TUJC 2ZS9A 3VMFA 2Q21A 4Q21A 1T9HA 2V55B 1OHHD 1G4AE 1PLLA 2OLJA 4YDSA 3D7MA 3EX7C 2BEJA 2QI9C 5TVKA 2FZLA 3R9IA 2WIAA 5E3HA 2B6HA 2JCSA 2ATVA 1XTKA 2GCOA 1EXMA 4XSHA 4L4UA 4DLSA 1J8MF 3GLIE 2FPMA 1ZVQA 1AK2A 3A4LA 4PX9A 1G17A 3T5DA 3E5HA 2IX3A 3NEYA 1ETUA 1J2JA 4WW0A 3PUWA 3CWZA 1B0UA 4OI1A 1XRJA 4US0R 3FHTA 2BM0A 2CEAA 1VCMA 4TSFD 4OI2A 1ANKA 4KODA 1CBUA 1KMHA 2RB4A 4Q66C 5LBIA 3WBKA 2O8BB 2GHIA 5FBLB 3UG7A 3NC1C 4AIIA 2QM8A 1Q1QA 4NONA 3K70C 2V6IA 3L0PA 4JYBA 3NH6A 1GITA 2XB4A 4C7OA 4Q18A 2YWGA 3GLHE 4C0AC 4YC7A 4R9UC 2RAPA 5K8LA 3AKDA 3UANA 1VG8A 4URVR 4PO8A 1UKYA 1IM2A 2XGJA 5AK0A 4LJYA 2PMKA 4PAMA 3AF2A 4JBXA 2ODWA 1XEFA 4DSNA 4F7WA 4OL0A 5KSYA 1E32A 2ZRMA 3NEJA 4GZMA 1NN1A 4ASUA 1WCV1 1YRBA 3FMFA 4NCHA 3TK1A 4BFTA 1KJYA 4DB4A 4M9XA 1XEWY 4HDOB 3TR0A 5J4KA 3EA0A 5DH9A 2ZRIA 5DIFA 3MSXA 3Q8XB 4PQFA 1G5PA 1P4SA 4OHXA 4LRWA 4Q03A 5JRJA 3X1WA 1JR3E 4NDZA 3VNVA 4IEEA 2FZ4A 4MKGA 3FB4A 5A4JA 5B30A 1ZU5A 2ZE7A 5D3MA 1RRCA 4IOLA 3TAUA 4HLUC 5KNDA 4NL4H 3P4YA 3CPJB 4DZZA 2MSCB 4MGZR 1AA9A 4ESVA 1V5WA 1P7CA 3QF4B 1NN3A 2OHFA 1T3LA 5TV2A 1SHKA 3GPLA 1II8A 2DWPA 1BYUA 4JKYA 2JAQA 3E1SA 3KQHA 3LX8A 1E1QD 2AWOA 4EFNA 2Q9AA 4HB0A 1FNMA 3CX6A 3LDAA 4M8NE 1SVLA 1HY3A 2L0XA 1NP6A 2GRJA 1Z0FA 4MKIA 5GVRA 4OI0A 5CYOA 2ZSAA 3BB3A 3AQ4A 4JIMA 4D0NA 1U8YA 2GF9A 2P6NA 4X8LA 3OF5A 4OHZA 2DYKA 4Q1DA 2OXCA 4DCTA 1NBMA 1X1RA 2IHBA 2ZAMA 1OFHA 1NI3A 4OK6A 5J40A 3THOA 5C2JB 5L3QA 4EPTA 1T8TA 4NBSA 3ADCA 2GAAA 4TWZA 3BWDD 2W6IA 2D06A 4IDNA 4L9WA 2IS4A 1XXHA 2C2HA 3IO3A 1D5CA 821PA 2WZQA 2GJKA 5EQTA 4C0HA 3F8TA 3SJCA 3VHLB 3FTQA 3TR5A 3M1IA 2RMKA 4GRAA 1Z28A 1G9XA 3Q7QA 4XIGS 5FUXA 3FMOB 2DHRA 1ODFA 4KO8A 1XMVA 1OXTA 4D80A 5E95A 4V0KA 2ZRHA 4WA7A 2X1VA 2QORA 1Q0UA 4EJSB 2IYUA 1IN8A 3RYTC 4D81A 1FTSA 3QXCA 2JGNA 3CPHA 2FEMA 3NDPA 3SBDA 4PZLA 4B48A 2Z6VA 4A1FA 4FMDF 2ZVQX 4IOKA 4PQRA 4GBMA 4PXAA 4TTRA 1KSGA 4LBVA 1XTSA 5SZHB 3GQBA 1KI2A 5J5CA 5EUQB 3LXRA 2QP3A 1GZSA 2WWYA 4DCUA 1Z83A 2DWQA 2GK7A 5EJEA 4PZYA 2OEPA 4LY6A 2WJYA 4XTRA 5E7JA 3UPUA 1ZNYA 3CH5A 4D4MA 2G6BA 5JFGA 2J87A 2LKDA 3UMFA 3WMFA 1JB1A 2XJ4A 4YXWD 1B23P 1IN4A 4DBLC 4XWKA 2Q3HA 5A5GA 2RKOA 2WSMA 3IHWA 2MMCA 1TEXA 3BH7A 3OE7A 4JT4A 3BOSA 4E09A 2C8VA 1JR3D 1T3SA 1MRSA 1W49A 5GJCA 2A5DA 2XB2A 1KI1A 1RE0A 4A8JC 1W0KA 1ZUHA 2I1QA 4B2IA 2ODBA 4MYTA 2NZ8A 4AYXA 2BCGY 5BWMA 5HPYB 1NVUQ 3P4XA 1T0JB 2FFHA 3EIQA 1NBME 3EAQA 2ONKA 1OIXA 5KOYA 1WRBA 4PAOA 1S1MA 1NVVQ 1MABA 2QTFA 2VSXA 4KV9A 1L8QA 2FE4A 3SJAA 5C18A 4G3XA 3WP1B 5L3SA 4TQAA 4EPVA 2IF0A 4FWTA 1XCGB 1CXZA 2UVQA 2WMOB 2CBZA 1E94E 1W2HA 5JEEA 1ZW6A 2VIIA 3DO6A 4EPYA 3FE2A 1BYIA 1P9NA 2ZANA 5HTKA 1N5KA 4AKHA 1QHXA 4V0MA 2RH5A 3LD9A 3QXHA 5JRZA 1LB1B 2CLSA 3PEYA 4QGGA 1YU9A 3MJHA 5AUNB 1ZC3A 1ZM3A 2IL1A 2AK3A 3I1FA 4JSTA 3OIVA 4HAZA 1ZC4A 3CX7A 2J59A 1GIAA 1GNRA 2YWEA 4PZZA 1Z6YA 3ZD6A 2QP4A 1D9ZA 1KZGB 3IIJA 4DLUA 3N2EA 2RGCA 4OHYA 2OCBA 5JJKA 2ZSBA 1UEIA 3I3SR 1YZUA 1JPJA 3BBPA 3KDSE 4JVLA 4Q9HA 3EC2A 4II7A 4U5XA 4CEHB 2OLKA 1XMSA 3REFA 4A0RA 2BKEA 3BE4A 1E69A 3EZ7A 3GLFE 1JEDA 2EWVA 3CNOA 1EFTA 4M1SA 1P2SA 1W46A 3LBIA 5EP2A 2HF8A 1ZINA 2DFNA 1R0YA 4IDOA 4ASUD 2J7PD 1J99A 4IFEA 1TX4B 1AKEA 1PJRA 4PFSA 4ON9A 4OJKA 4RFVA 3JZAA 1U0HC 3R8FA 3GJ4A 4FMDB 4FW9A 1G1MA 3QG1A 4ZDWA 2GA8A 1Z06A 2FSIA 3D6TB 3PIRA 4TMVA 2XNDA 1TQ2A 2H7VA 5B64A 5H1YA 3OESA 1QF9A 2VQSA 2JJ8A 1FTNA 1KAOA 2VO1A 2DR3A 2ZUCA 3HDTA 1G19A 3RS3A 3ZJYA 4KSBA 2R6DA 4RVCA 3HU2A 3R9WA 3HU3A 4DXAA 2CE2X 4Q4JA 1QHHA 3CONA 3CW2A 2WOOA 4KYIB 2OO7A 1U94A 4QG7A 3O8BA 4X8MA 5ANRB 3GP8A 1P9WA 3N70A 4QHSA 4CEJA 2W00A 4BFXA 1GNPA 3AGPA 3C4JA 4RKFA 4A6PA 2F55A 1JXMA 1WB9A 2JLWA 4ZI3A 4HAWA 4HZUA 4IVQA 3FMIA 1SXJC 1SVSA 2RHMA 3FFBA 3PUVA 1ZCAA 4Q19A 4R98A 2BMDA 4ZIRB 1YHNA 2ZI7A 3ECCA 5CK5A 3VQTA 1NVVR 2BCJQ 1W4AA 2ZETA 2HYIC 3GLIB 1M34E 2ZI9A 4V0ME 1AS0A 3P27A 1KY3A 1NLFA 2ERYA 1ELOA 1KOFA 5F2EA 1RJ9B 4IDHA 1YZKA 5C4GB 2I1VB 4HB3A 5KUTA 3U7GA 3RC8A 3LQRA 1OYWA 3SHFA 2XSZD 3SQXA 2O8DB 1KDPA 5TARA 1VHLA 5EE1A 4E03A 2W0MA 2GESA 2W6ID 5LB4A 3AF3A 1ZMXA 2HLDA 2QP9X 5DGXA 5IRCD 1NG1A 3QXJA 1OSNA 3Q72A 3IDQA 1SVKA 3LW7A 4RKEA 2HDNB 221PA 3UXMA 4MDFA 4RD6A 2A9KA 3I8SA 3ZZ0A 3EWAA 3GEEA 4W5HA 3SYLA 3B1VA 4YMWA 1UKVY 5H68A 5FPKA 4Z1MA 3A1TA 3GLHB 4DJTA 2GXAA 3QXSA 1GM5A 2X8AA 5AJVB 5CIWA 3RS4A 3ZVLA 3VFDA 1UKEA 3CIOA 4HUQB 2QUZA 3EA5A 3J81k 1W36C 3BGWA 3GFTA 1PVOA 4KJZA 1KYIA 1NRJB 4PANA 3AP3A 4LYFA 1N6RA 4TMZA 3ND8A 1RRFA 2ZUDA 5HCNA 4MRVA 3QXXA 4ZCIA 3IIKA 1Y63A 4MRRA 3W8NA 1U90A 1KAGA 2O8FB 3VAAA 2OM2A 4R2IA 2VP2A 1E2KA 3BJIC 3IHLA 2KWIA 2O0HA 3CRW1 4TLAA 2GXQA 4ARZB 1Z6TA 2DBYA 1D2EA 1QHIA 3C5CA 3TQFA 4KCGA 2IC5A 4NP6A 5A0FA 4IDPA 4O3MA 1XTRA 4RFSB 2FU5C 1S9DA 2H8KA 1T8UA 2QMHA 4LYJA 4POAA 3C15C 1AGRA 3CRQA 1N3BA 4EIWA 3OE7D 1ZD9A 3U5ZB 3PQCA 3KJHA 1R8QA 2W2TA 3U3MA 2ZAOA 3QEOA 3R7WB 3OZXA 2QTVB 3RHFA 2ZI6A 4LHVA 2Q3FA 2XAUA 2G1KA 4ZDIA 4UXHA 1US8A 1QDEA 1Z2CA 2WJHA 3CKLA 1NNEA 5FOTA 3VKGA 4NHOA 1CF4A 2BKUA 1G291 1W47A 5KTYA 1YZTA 3AUXA 3LW8A 1KI9A 4FCVA 5DHFA 3SFVA 4Z8YA 2XOKA 2ZRNA 2RGXA 3W3AA 4DLVA 5GJBA 2VH5R 4TT3D 3C41J 2ODNA 1XJ0A 4N1AA 3PUZA 4MKHA 2AXNA 2X77A 3KUCA 3I8XA 4Q9LA 2IXEA 3PENA 3K0SA 1YR7A 4BASA 3H1TA 2CE7A 2W6JA 3U3KA 2C9YA 2FSHA 2QE7D 2KBEA 4TTPA 3PEWA 1RIFA 2F3TA 3SS8A 3KTAB 4X8OA 2WTUA 4A2QA 3WNCA 2PZFA 4D0LB 4MYCA 4HI0E 3JZMA 1NN0A 1XJQA 4QOSA 4XWOA 2H92A 4CGZA 2IS2A 1RYHA 1LS1A 3LY5A 4OBEA 4C3ZA 1R2QA 3DKPA 1U2RA 2IYWA 3U60B 3EPHA 2OBLA 4LJ8A 5H8WA 3VR1A 4GFDA 2OAQ1 4M0LA 4LZZA 4BLTA 4DUGA 5H70A 1S3SA 1W4CA 2VHUA 4ZKDA 1ZD1A 2BBSA 3IO5A 5FPHA 3VX3A 5FH9A 2A5FA 1ZU4A 5CYPA 4HDCA 4MRSA 2JIZD 3QNUA 1FX0A 2FV8A 2J3EA 3HR8A 2ZS8A 3PEVA 2QQEA 3GEHA 2ORWA 3GJ3A 5JJLA 3K70D 3ADDA 5M04A 4A0GA 4D6PA 2GBLA 3ETLA 4MQBA 5LB2A 3OAAD 4KLZA 3O8RA 1CJUC 1AIPA 1M7BA 3LFUA 5AJXA 1TNDA 2ZJ8A 3CF6R 5FPSA 5CIQA 4WZAE 3AVXA 1KHTA 4IEIA 3SE0A 3W90A 1G6HA 5FBWB 3AV0B 4HZIA 1IAQA 3OEEA 2FSGA 3U7FB 4C2UA 1FUUA 2P2LA 1GL6A 3QVVA 3QI2A 3L2OB 1IXZA 4U00A 3SOPA 1AZTA 1BOFA 4LHZA 1RFLA 1C9KA 3TUIC 2QBYB 4JT2A 2D7DA 3MCAA 2ERXA 3TSOA 3VU9A 2IEZA 3I92A 3R20A 1Z63A 4ACBA 1MT0A 3WYAA 3QPVA 1QHYA 3W6NA 3PVSA 1P72A 5FOSA 2C5LA 2ZQ5A 1EWRA 3OFNA 2ZSDA 4GMDA 4MYUA 2GJ9A 3WRXC 1XEXB 4G5GA 2AN9A 4MDEA 2JASA 3RSLA 1UADA 2EWWA 3QKSA 4IVPA 2HXSA 3X2SA 1TAGA 4DDWA 2QAGB 5DYGA 2YJTD 1ZIPA 4M2LA 1LV7A 2XZOA 5DN6A 4Q1EA 5LD2C 2LCFA 5CM8B 4C0KA 5KDDA 4MGIR 1U0LA 1XCMA 1VECA 1RZ3A 4CIDA 2P65A 3B1XA 5JCZA 5SZJA 5BN4A 1TQDA 5JJIA 1X3SA 2KI5A 4JJZA 4XVRA 4QM7A 2BBOA 4DKXA 1T91A 3QG5A 3T1TA 1OH5A 4EUNA 3ZQJA 3FVQA 1OKKA 1NKSA 3K9GA 4TLBA 1E2FA 3K0AA 4B47A 1S0UA 4I1VA 2EYUA 2VP6A 3FPAA 5JWOA 1D9XA 2VHJA 2NPFA 1E2JA 5AJWA 3TLXA 2IF2A 4PC7A 3X1ZA 3KXKA 4YONB 1CRPA 3DM5A 4H1UA 2VA8A 2YOHA 1Z0AA 3B85A 1Z6XA 1W5TA 2REBA 2NMVA 1UPTA 4U7DA 1JPNA 1NVXQ 1E0JA 1KO4A 2IYRA 2JJ1D 3WRYC 5J4HA 2AD5A 3AB3A 4HLQB 3U6BA 5LDDC 2VP5A 2W83A 4GT1A 1F2UB 3REGA 4YMVA 4OHWA 3GLFB 2EVWX 3S1AB 1TTTA 4LSGA 1QRAA 3GJ5A 4M1WA 2BBWA 1K8RA 2AWNA 4EQ6B 3U7HB 4DLYA 3A1SA 3A37A 5CLLA 3VR2A 1VCNA 3G82C 3WHLA 1S1CA 1Z3IX 2EFEB 2YC2C 4IOJA 1DO0A 4MA4A 1E9SA 1CIPA 1KSHA 1NIPA 2NIPA 3B5JA 4JLDA 1FFHA 2QL6A 2IBMA 4NYIQ 5EP4A 1XX6A 3RSOA 3AH8A 3H4MA 3I5YA 1QHSA 4PC6A 3KZ1E 1PLJA 2BMJA 4DEYA 1C1YA 3Q3JB 3ZYCA 3ZQ6A 1TF2A 2ZRLA 2ZJOA 1XU4A 1OFTA 2C04A 5FBQB 4JVNA 2NOAA 5FUYA 3UATA 3LA6A 1XD8A 1Z29A 2AFIE 2ZJ5A 4N3NA 4W5JA 4IOMA 5KNBA 1IXSB 2R65A 4OQMA 3LRPA 4F38A 2Z5FA 3U3RA 4QFMA 2WM9B 3ZDQA 2N42A 1G7SA 5FI1B 5L3SB 1R5BA 2CMKA 4RCYA 3JVVA 2J0SA 1FP7A 2EW1A 2DFLA 4NCNA 1E1RA 2ZJ2A 1XD2B 3RABA 1KI4A 3E2IA 4IJMA 4LOAA 2Z4SA 3IUYA 1P3JA 3VKWA 5CITA 1SXJE 5EE9A 5FFMA 2O0JA 1R4AA 4JLBA 4NKRA 4TYNA 3O47A 3IQXA 4F91B 1IN6A 621PA 1Y3AA 1COWA 2CL7X 2PEZA 1GSIA 2KE5A 1OXXK 3UK6A 1GTVA 1RRGA 1GG2A 2AKAB 3IIMA 4A2WA 4QL3A 3QKUA 2J46A 2CL0X 5GADl 4Q47A 5JS7A 2W2XA 3CR7A 1X8KA 4A82A 2J45A 3L0SA 2A2ZA 3CH4B 1ZYUA 1TMKA 2R6AA 3OIWA 2REOA 4CW7A 4G1UC 1TU3A 4GPTA 1SVWA 1AQUA 1BH2A 1OH6A 2XXAA 2J0UA 4C2TA 1V43A 2HYDA 3K70B 4D26A 3QSYA 1W0JD 1MOZA 1SQ5A 4DUGD 3THXB 1QG4A 3K0FA 3WNDA 1FPMA 1OXVA 4LHYA 3RVBA 1XPOA 1EGAA 4BECA 5F9HA 1HA3A 2NGRA 3RS0A 5TDHA 5JHHB 2JJ2A 1J70A 2IYTA 2J9RA 3NBZC 3T34A 3NC0C 4LJ4A 1DAEA 4PHHA 4D4LA 3VKHA 5EXTA 3ASZA 1SULA 2ZSEA 4AKEA 1Z0JA 4Q4AA 2C96A 2ZU0C 2ORIA 3B2EA 3I5XA 1VIAA 1T3HA 4HLDA 2ZYWX 2V4ZA 4B3CA 1W4RA 3HR7A 1A7JA 4ZDJA 4Q4HB 3QKTA 1OXUA 1U9IC 2PCJA 3BFXA 4Y0VA 1G8PA 5DE3A 2N1BA 3OHMA 5JSZA 2YWFA 1X6VA 3NBFA 3FYHA 3B13B 4OYHA 4NYIR 4JJKA 421PA 1ZNZA 5B57C 1GP2A 1HH4A 3N5CA 1KTVA 1PZNA 3VHXA 3Q5DA 1KK3A 3B60A 4UXIA 4D4JA 2RGDA 2QSYA 4I4LA 3W9YA 2Q9CA 1OFIA 4OK5A 4F4IA 3CZPA 1TUEA 2DWOA 3F3YA 3PCRB 1F2TA 4CF7A 2H18A 2EYQA 1N5JA 4FN5A 5JWHA 4L9SA 2ANCA 4RZUA 4KHZA 3Q7PA 1P9RA 5FUWA 1CKEA 1YVDA 1IXRC 2JATA 4JLPA 1MRNA 2ZM5A 1E3MA 2A30A 1AS3A 3CRMA 3LWNA 1H8EA 4M21A 5DN6D 2IUTA 2XX3A 4NH0A 3WYFA 4BRWA 4ZPXA 1RW4A 3MWKA 4QXAA 4U02A 1VG1A 3TH5A 4PHGA 1E79A 2RGNC 3TUZC 1IJFA 4WXPA 1W7AA 1AS2A 4Q7LA 1H8HA 3EIEA 4TMTA 1A82A 2PL3A 1IY1A 4JLNA 4NTZA 4EAQA 2NQ2C 4X8HA 4PO1A 2REXB 3R8CA 4M9ZA 4JLVA 3BD9A 5BQ5A 4I1OA 1VYUA 1X8JA 1HQYE 4O2RA 4XWAA 4G5OA 3PJRA 1M6NA 2KB0A 4MRNA 1UKZA 1SXJD 5FR2A 1VTKA 4P33A 5G40A 1I2DA 3AF4A 1EFCA 3LAWA 4YDHB 4CYMA 1L2TA 4JLMA 2W0SA 3EW9A 5JCPA 2NO1A 1Q57A 1OH7A 3TVDA 4UNPA 5DI3A 3H86A 1O3YA 5KDOA 1E0AA 2C9OA 4BQSA 4F93B 2RGBA 4DT1B 4GMXA 1P2TA 1TQ4A 3VNUA 4LBWA 4TMWA 4OI4A 2NO0A 1NSFA 4XVQA 1S9HA 1XCPA 3V00A 3IBYA 5JWRA 3ZS8A 1FQKA 3OIYA 5HKKD 4XD7D 3QIAA 2H1LA 2O8EA 1NLZA 5J4LA 2YOGA 3FKSD 4URZR 3KQNA 4UNRA 3QPWA 4KITB 4EJSC 1XMJA 1D2NA 3ZIAD 5SZKB 1RVDA 3A58B 2FOLA 2ZIAA 2NPIA 2R6FA 2FA9A 1DOAA 2ZITA 1G18A 2DFKB 3FHCB 3IPXA 5FR1A 2Z83A 1G7TA 3CPEA 2FPLA 1KI7A 3LVQE 4P0TA 1EFRA 2H57A 4HATA 1XTJA 2BOVA 2W58A 2WBLC 4BLPA 2FJUA 4QNMA 1W36D 2WKQA 1KI3A 4DSUA 4LK2A 2OSBA 2GZHA 1YE8A 4DCNA 1ZRHA 4M22A 1S8FA 4URYR 2CHQA 3BORA 4WZ6A 2WJIA 3K9LA 2CNWD 3GD7A 1T6NA 4G01B 2CK3A 2QMOA 3R9XA 3NDBB 1OV4A 1J90A 4Q7MB 4HAXA 4LJ7A 1K5DA 1T5IA 2QMEA 4NZYA 1KSFX 3DVLA 1R0XA 2D74A 2ZEJA 4Q9JA 5AJYA 2GKSA 4JBYA 4V03A 5IK2A 4GL2A 2NO7A 3A1UA 5G3YA 1YR6A 4A8JB 4G5RA 5FOUA 3KB1A 2JA1A 1QZXA 2O8CB 3ZVRA 1S2MA 4J0QA 1E9DA 1XXHE 4EPWA 1IN5A 1E2DA 1TF5A 2WPDA 1UDXA 2XJ9A 3DOFA 2Z0MA 3MJRA 2GDJA 3CO5A 3QY0A 4RZ3A 4IVRA 4H1VA 4FD2A 1R0WA 1W2GA 3THYB 1PV4A 4HSEA 4DVGA 3VR3A 5DSZA 1KK0A 3SDZA 2BJWA 1E96A 2F1IA 4P4SB 4RD2A 1UDWA 4CT5A 1G8GA 1LF5A 4AG5A 1YZQA 4PSVA 1Z6AA 4PO9A 2R9VA 2IXFA 3U4QB 5FTKA 4B33A 1WP9A 1S96A 1ZCBA 2C95A 2JEOA 1NMYA 1NSTA 2FWRA 1KO8A 1N6OA 2CJWB 2GBLC 3A1WA 3FKQA 4G5SA 4C4PA 2ZJAA 4NMMA 3H84A 4KFRA 3RRYA 4JLKA 1Z0KA 2NG1A 5CB8A 5EZ5A 1L4UA 3H0KA 1JAIA 2UZIR 3GJ0A 4A36A 1JECA 4B6EA 2Q3MA 4CZ2A 4B3GA 2AR7A 2IXGA 2YHSA 3QBVA 1L7VC 3K8YA 1FMLA 4KI0A 1N0VC 1VMAA 2AHOA 4DLTA 2VYFA 4M1KA 5F3WB 2D2FA 2P5SA 2SHKA 4BLOA 3UKDA 4M1MA 2ZR9A 2E1RA 4KSCA 2BBTA 3EWSA 4QJ4A 2O8BA 4UJ5A 4TYPA 1A2BA 2WICA 5K8UA 1LF0A 4P4TA 4PHTA 2WVJA 4HLCA 4F4JA 3PUYA 4RSGA 4DCSA 3BC1A 4GP6A 1A4RA 4B34A 4DRZA 3IBGA 1FW6A 1VCIA 3WNBA 1MH1A 2HT1A 2OZEA 4Q1CA 1WBBA 4AD8A 3W5IA 2GK6A 3B7GA 4E5UA 1ZD8A 4PC1A 2X2FA 1NY6A 1JBKA 2HF9A 3I4LA 4LUCA 2XTZA 3LH5A 5D3QA 3SU8A 1U9IA 2IYZA 2J7KA 4AC9A 2V6JA 4JL6A 3SQWA 3B1YA 1QVAA 1XDBA 4M9SA 4XH9B 2BDTA 1U99A 2DCUA 1E9AA 3UMRA 3T1QA 3CX8A 1E2NA 3T12A 1KJZA 3QOFA 4B6FA 4MRPA 3ND9A 3L0OA 4DLRA 2ANBA 5IDVA 1CR4A 4MUAA 3BERA 2ZTSA 3TRFA 5C46F 4D0GA 1U98A 3DDCA 2IS6A 1YKSA 3A8TA 3WHKA 3W6PA 1CR0A 1H8ED 1S3GA 2LWIA 1IQPA 4B71A 4V0OA 3F0TA 4C0BA 1SXJB 3C7KA 4KBGA 2BMFA 1NBMD 4DLXA 2QMUA 1VG0B 4UNQA 4BFWA 3TSWA 3QF4A 4DIEA 3HYRA 3IEUA 4MITA 2IK8A 1G4UR 2NZJA 3EZ9A 2WAYA 4HB2A 2QN6A 4BWYA 3ZVNA 4JYCA 3GMTA 4UNNA 3BK7A 2HCBA 1NF3A 3FGNA 1EX7A 2B8TA 2RGNA 1ZUIA 3DPUA 4LJ6A 1R0ZA 5JI2E 3AVVA 1WE2A 2XEXA 4B76A 2GJAA 4TYWA 4D2IA 1RKBA 1UFQA 3KJEA 3LLMA 2WSSA 5G3ZA 1TL7C 5J4VA 2WWGA 3RS5A 2ZRDA 1S4QA 4B73A 4NYJQ 3A4NA 4ACAA
chains in the Genus database with same CATH superfamily
2VAVA 1N0HA 2AYZA 2ZBFA 1PL8A 4I5GA 4A03A 4XVHA 4BO7A 4JZKA 4FINA 1BGXT 1FYEA 5ITSA 3DE3X 1KRWA 3VI3B 3RYCB 2P2NA 3F67A 4K28A 1EVEA 4PX5A 4ZI7A 2ZIEA 1GL7A 2IRWA 2MMGA 2IWRA 2WKRA 1BS2A 3WV4A 3PX7A 1AHHA 4ENPA 2PKCA 3LCCA 2IPOA 4MLCA 1AKNA 1EM8B 2AFHA 4FX5A 3VISA 4PLHA 3VVLA 2YH2A 4CIVA 3EWNA 8MHTA 4D46A 4L3OA 1D6NA 4O4LB 2FSUA 2YV2A 3E70C 2J41A 3GMDA 2E85A 4BNYA 3SY8A 5AVWA 4DV6B 3D6JA 1W88B 3DXZA 3T15A 3ZZTA 5JJBA 3K5WA 3ZTYA 1U2GA 1XVUA 2I3GA 2I67A 3OEHA 2IHZA 1LPNA 3OG9A 2QTMA 3ERCA 1H85A 1NUQA 1EX6A 1Q0LA 2XDQB 4PM4A 1GFSA 3NJ4A 1M54A 4IIJA 1DXHA 3P2OA 2IU0A 3EXHA 1Z4IA 5BUCA 4PYRA 1YS7A 5FOWA 3AUYA 2L19A 2OCAA 3KOZA 1KEEA 3TJZA 3GGSA 3FPCA 3QP9A 4N3GA 4E13A 3R74A 3NVMB 4BUCA 4AMBA 4CMBA 5CA0F 4QSMA 3B36A 4QXRA 2A9QA 1KH2A 1MBZA 3L7CA 3PGVA 1OT3A 5CJ2A 1U1CA 4DJDC 4EW2A 1PNOA 1UBGA 3D43A 4DLWA 4I4TA 2V3CC 5JCOC 3HPRA 5TXGA 3O74A 3FFAA 4YRDA 5FKJA 2W2MA 3VR5A 1JALA 5LA6A 1UC4B 1SB8A 1F9EA 1OC4A 3A31A 3ABQB 4QRHA 4F3NA 5FTLA 2QVZX 1QC5B 3HRKA 1DFGA 1L8AA 3MLEA 4MZXA 3RH0A 5TPWA 2O2GA 5CDFA 2VJPA 5C8YB 1ZCJA 1W6UA 5EGNA 5FEUA 4C0QC 4QM6A 3V80A 3I72A 5DW3A 2NUAB 3F6EX 4QEDA 1ECPA 3Q12A 5IFLA 1EDBA 2P3SA 2QLLA 2QMZA 3O4HA 2P0EA 3ZH9B 3ZK7A 3EIUA 4C7MA 4AY3A 3Q85A 3N7UA 3BEOA 2PZBA 4MWGA 6YASA 4GEKA 3AOGA 3EIXA 1Z2EA 1IMJA 2DPHA 1MQ8B 3AK4A 1SBCA 1SUDA 2PU5A 2XE4A 3K1AA 3T6KA 4DVJA 4DYDA 2PH3A 4EGAA 2PBRA 4Q7QA 3G68A 1UC5B 2CDBA 1CJTC 3N39C 2XT9A 3AI1A 1S2DA 1R18A 9MHTA 1KK2A 4OGGA 3HDGA 4RLHA 2BM1A 5A04A 1NW4A 1O6ZA 3IVGA 4JFAA 1N5IA 1FCJA 3ROTA 4UHKA 4TYQA 2PX0A 4MWZA 1MGPA 4ND8A 4LOJA 4A0HA 1SPXA 2QV7A 4YI3A 3DFIA 2NU8B 1BX1A 1DFHA 1IM8A 1SY7A 3E9EA 4DIMA 5A62A 3CH6A 4TN1A 4B3RB 3LZDA 4O4HB 3MYYA 1NC3A 3QELA 2Q4EA 3E9ZA 4RIHA 2HDWA 3RFUA 4LHWA 4TVSA 4NYJR 1T36B 2VSOA 5J2UA 3L1KA 2QLFA 3IAHA 2NM0A 4C7VA 1G63A 3KAKA 1Z33A 3E8SA 4IIEA 4NBUA 1J97A 2HHHB 5KSPA 1H9BA 1WV1A 1WB6A 3KKQA 2QTNA 3PTLA 1K06A 1U7HA 2ADFA 4DCPA 4LCEA 1N0WA 4WPGA 1PP4A 5BMVA 2QJWA 1F8YA 1S8NA 3QKRA 5EWMA 1MA3A 3GNSA 3MGCA 2X2EA 1TTQB 4GP9A 4KXXA 4RHTA 4Q1AA 4YHBA 1K89A 6NULA 3N8GA 4QPZA 4I1UA 1II8B 2D7CA 2HJRA 4MPJA 1P2VA 4R9VA 2B36A 3AY0A 4TUYB 3U3DA 1NHWA 2JBHA 5ADUS 5CNJA 1ZNWA 4DQVA 1Q1AA 1JEEA 4C4XA 5EI5A 3T54A 2I4IA 5BVHA 1QFYA 4BMNA 2Z6QA 1DAGA 1JBEA 1FL9A 1NAIA 3DHYA 3T3PB 2QSZA 1GKIA 2DPGA 4P5EA 3A3KA 3OZEA 1LKZA 1TCBA 2PBFA 3TMAA 3KSZO 3GLGA 2JNWA 4DV7B 2O2YA 2QRKA 2YASA 3BSYA 5TMEA 4CL2A 1NMQA 2VF2A 1EE2A 1X86B 3DKKA 5JCJA 3F5DA 2V03A 1J56A 5JBIA 3BJZA 3H2KA 4GC9A 4MW9A 4YRPA 1EWQA 3WO0A 3GEBA 4R3WA 4X1KB 1O94D 3TQIA 3A11A 3TGPA 1H1DA 1MKYA 5J3JA 2IZ6A 3MWYW 1ZD2P 3ML1A 4WL0A 2QD5A 4ATNA 3ZWAA 3KTFA 4DR5B 4UW9A 4GQBA 1DDOA 3A2KA 4H6VA 5CTJA 2WJAA 3ENNA 3FYCA 1BG6A 1JMVA 2OZVA 2GM9A 1F38A 4UU8A 1PR2A 3ELUA 2ZYRA 3BCSA 4C0SA 3HKCB 2EFHB 1ULBA 3ZDCA 2VHQA 1UMDA 4PC3A 4PVCA 3H2JA 2W93A 4QOIA 4B35A 2BELA 1TF7A 1XQXA 2BWJA 2ODAA 3HMKA 4UKDA 1L5YA 1DV1A 3WP0A 2ONZA 2X86A 1YFLA 2HLDD 1R4NB 1USGA 4FQ8A 5KYNA 1HF3A 3NHAA 4Q01A 4CHGA 1U0SY 5CBKA 2FZKA 1TQHA 4M8IA 1CEXA 2C2BA 2OFWA 2ZU6A 1E1NA 3LVBA 3LWBA 3KQLA 3ESCA 1Q1EA 4MKRA 2F4VB 2Z5VA 2FNAA 5AKLA 1IZ9A 4H1HA 4CKWB 1UZLA 2PH1A 4F3KA 1RWWA 1DV2A 1H6DA 4NZZA 4FE3A 2O0MA 4OSPA 2VZ0A 3TEMA 2WTMA 3PHLA 3GLIA 3D5QA 4M38A 1TO6A 1X1AA 4I55B 4A16A 1OX6A 2G4LA 2VF7A 5DYWA 4IZHA 3AKZA 5ARBA 4TQ9A 1DT3A 3IURA 3T06B 1G8YA 4UCQA 3KKNA 5IN4A 1NBIA 4DY4A 4B45A 1DXOA 2ZJYA 3WFIA 3WJ7A 2QUBA 1D2HA 1O5IA 2O50A 3NHUA 2BT4A 4W9MC 2ZZKA 1AK9A 2FOXA 3AUKA 4C87A 1I7NA 3Q0IA 5CW1A 3AM1A 1IK4A 2OHIA 4GXNA 3EISA 2KYRA 1W8IA 4BNKA 1QVRA 5BOSA 1M2NA 4G1FA 3HO8A 2E4WA 4F96A 5ISMA 4RQBA 1QQBA 1U8AA 2ZT5A 2PVCA 3JYOA 3LGAA 5CCXA 1MO5A 1RAFA 2XMQA 3EN0A 1Y3DE 4X92A 2C42A 4GPZA 1HT3A 2J6HA 3L0BA 3GMSA 3ZWKA 1G8FA 5JUWA 2P9TA 1LSSA 4MYSA 2HA6A 2GVNA 1T4GA 3NV7A 4AQDA 3HRHA 1VSUA 4QQKA 2MHCA 3W2TA 1W52X 2QPAA 3GL9A 4NLLA 1VJGA 3LRXA 3U1BA 4P3PA 3BSFA 3E58A 4J1TA 4GMGA 1TJ4A 1WF6A 1Y7TA 3HVJA 2VPIA 5H02A 4ARUA 4PN3A 1KO1A 3KVRA 1Z45A 3QMWA 2QZ4A 3QUCA 1MABB 3T61A 2R44A 2JLXA 1HDIA 2IGBA 4Q9KA 3ROMA 5EYPA 2YIVX 3PC7A 2IY7A 4Y2XA 4KH1A 1AV7A 5E7MA 1ILWA 4HX9A 4IHKA 4G0UA 4CLOB 2GAOA 3JASB 4M54A 1Z7GA 4MWBA 5FHRA 4DGSA 1W48A 2WJGA 2P3LA 4UUPA 1Z5ZA 4HK4A 4O5AA 4GLFA 3U6KA 3K6KA 1UFOA 2HWYA 2NYAA 2XOKD 5HK8A 1YQTA 1V71A 3O9MA 3TW0A 2OGSA 2JLZA 1JYFA 2EJWA 2R1VB 2XCIA 2WSIA 4RFSA 3HXQA 4NE7A 5FUMA 3KFXA 3KSDO 2CFOA 1TVKB 4CEHB 4QGBA 1A9XA 3EDYA 1UOEA 1A9RA 4TWAA 1HUQA 4HKTA 4IZOA 3NJRA 1IDOA 4B7CA 2JLVA 2GZRA 2RHWA 3BDVA 3DONA 1VIDA 3A1DA 2NUPB 3T9EA 1DADA 4KR0A 2Z95A 1Q12A 3GJ7A 4CUKA 3PWKA 4LGMA 3NFRA 2E5LB 1KZ4A 3R5SA 1QV9A 1HDGO 1E2BA 1L6RA 5I7EA 1TECE 2A0UA 1Q16A 4J1SA 1NL3A 4BLRA 1YULA 3L6BA 8ADHA 1LBEA 5IASA 3GEIA 3IEKA 5CTAA 5IBPA 2ID9A 3AEQA 4RF5A 1ZRNA 3ET4A 4KWIA 1XDDA 3KK0A 1E92A 5LZ5A 1NDQA 3TKAA 1DKMA 3GGCA 5EIAA 1AUXA 4FFBA 5B1IA 3U4HA 2PNFA 4QYXA 4L5AA 2HIGA 3OM0A 1TRHA 3DZHA 3L5OA 4ZVUA 4HH3C 4QBGB 3S27A 4AS2A 4EEKA 5FWNA 5L3VA 3M4NA 3IALA 3MWLA 3FWYA 2UZ4A 3THWA 1FF9A 1CERA 3QWBA 2VVTA 1EFDN 5ITZA 2Q50A 1UPAA 4L4YA 1G3MA 3ZY5A 2EFDB 5HFJA 2PJUA 2ZATA 1L0BA 4P2BA 4QFDA 4PX2A 4CM9A 3OZRA 1VE9A 2WKPA 3HB4X 4KSCA 5KKNB 3HJGA 2VJNA 3SBXA 4FN4A 1T8PA 3DZIA 1D5WA 1RP7A 2Q0QA 4LBZA 2BSAA 2O52A 1GT6A 1KFCB 4KG7A 4Q4JB 1QHHB 1ZM4A 2CVFA 5DTIA 121PA 3A6LA 5CB4A 2G88A 3TYXA 4DC9A 1EUYA 1Z0ZA 3KAQA 4YJ3F 2GZ1A 2NUBA 1AGYA 4HVTA 4M6WB 1IULA 2XA9A 3PITA 1T9GS 2XHEA 4AZ3A 1Z88A 4O25A 2XUKA 3A1VA 1U2QA 2RONA 3FNRA 3DZCA 4UFOA 4BWFB 1B74A 1EXWA 1H6CA 4HZUB 3AHCA 4C0XA 3VDNB 2WYHA 2VRWA 3EVAA 1PR3A 3OPYI 4ZVRA 3RLIA 1P7WA 1KRXA 1QHNA 5DIZA 4FR2A 4HGOA 5THXA 4QU0A 1TMGE 3KE8A 4I1IA 1V1JA 1VPLA 5ENZA 1FB5A 4RLFA 5AT1A 4J03A 1RMTA 5EUMA 2RARA 3AF1A 1TPZA 4BNWA 1O58A 3CKKA 4OQ4A 1P9OA 4NOJA 4Y0AA 5DEOA 1M72A 3G85A 4KZPA 2KJQA 3LM8A 1JJFA 5CH5A 4ZT6A 2IV2X 4B32A 4R2KA 1U2DA 2XB6A 3CLRC 1UEJA 3HEBA 2IKQA 3BS4A 4DJ5X 3QFCA 3NR2A 4KNYA 2RGAA 4IDBA 1N5LA 1T29A 4GZLA 4D44A 3H75A 2J6IA 2HWKA 5EIXA 3X2FA 1U3UA 2PUDA 4M9UA 1OOEA 3ZHRA 1T3TA 1Z73A 1GCGA 3S99A 3SN6A 1D6JA 1QMGA 3OIGA 3QBTA 2PZMA 3DV0B 4GYKA 4KYTA 4Y2SA 1WABA 2WTNA 1OKKD 3SF8A 3DBHA 1ZXXA 1E2GA 5FPYA 4ZHQB 3H8SA 1T4MA 1Z0DA 3AGQA 3F4KA 1YVEI 2GVDC 4J0DA 5LQMA 1AZLA 1XEXA 4M99A 2QN7A 3TRIA 1KBQA 3REQB 4EHHA 1DRWA 4QULA 3H1BA 3LLVA 3CLUC 2I0FA 2NWQA 1RHRA 2HHLA 2KMLA 2XSZA 1I3CA 2WZDA 1QQ7A 3Q6NA 4ND2A 3RVDA 3TZCA 3UMGA 2RIRA 4PIMA 2UZ3A 2ZVJA 1RZRD 1RLOA 2GZAA 4K6MA 2ZLBA 4ESHA 3Q10A 4XB1A 1N0UA 2SKDA 4AMYA 1K7CA 3OQHA 3C3WA 4TVOA 2YUIA 4UM5A 4UTZA 1PG0A 1DBQA 1H4VB 1DVRA 1VB5A 1WXQA 2ACEA 4B8WA 5G53C 3AM5A 3OH8A 5EKSA 2DY1A 1ORVA 4DQ0A 2C2KA 5HA5A 4D9BA 4PYMA 4HGPA 1JG3A 4HWGA 3L7AA 4V0LA 1KI8A 3ZNNA 3NKLA 2P3OA 1UM9A 3OA2A 3MSCA 3OCWA 2B4TO 4LZLA 3RRMA 3RU7A 3V1NA 2P1RA 1GWNA 1U3DA 3I9MA 4ZD6A 4F46A 5KJ6A 2ZTUA 4WAUA 4ZI5A 2V6MA 3GWZA 2EX4A 4MI9A 5FV7A 3ASUA 3O3CA 2IDMA 1JV2B 3FWKA 3FOAA 3DMDA 1RTTA 2VI5A 3IEVA 2YZ7A 2R6ZA 1HRDA 4KQEA 3X1XA 1L7NA 2CXRA 2J9YB 2VH2A 4NF2A 2YY5A 1GA6A 2A57A 3C3AA 3G0CA 3P9KA 2QROA 1CWUA 1SKYB 1HEIA 2BFDB 3O2NA 4G86A 2AOVA 2X2PA 3AKYA 3D64A 4JEIA 4IJ6A 4KR6A 3PZRA 2J3QA 3BGIA 521PA 1RR6A 5DCUA 1AQNA 3D0KA 4DG9A 4CDGA 1JFRA 2JHAA 2OBMA 5F51A 3WGZA 2HKIA 5JALA 1ADYA 2BFCB 4F92B 4R2XA 2C3UA 3HG7A 4ETIA 1SUEA 2EZ4A 1P62B 3F6BX 3R6DA 3W4KA 1UBRS 4EQ6A 4X6XA 1PAUA 4ZQFA 3S5JA 3HNPA 1JRLA 1IUNA 3TJMA 1KWKA 3DEHA 3ZWYA 2G3YA 2BFBA 1ONNA 3C74A 5FTJA 4EX6A 4BNTA 1AM4D 1E1RD 3MRVA 1U1EA 1YOVB 2TMGA 4TLCA 2CDRA 4H0NA 4IV0A 1GFIA 4NE9A 1UJ4A 2X23A 2ATIA 3BIOA 1QIJA 1YBHA 2DPXA 2ZT8A 2CMFA 3FM9A 1W4ZA 2QGFA 4EG6A 1JAHA 2G0TA 5A7FA 3CN7A 3FWPA 3IB3A 3IV7A 3KYIB 1U0RA 2NTYC 4OP3A 4AM8A 1F8FA 3BRWD 2FTKE 5SYMA 4YQYA 3QMMA 1HQCA 4LV8B 5AXAA 1XLVA 3UMMA 4KSYA 5C80A 1WPGA 2L18A 2G77B 2G5CA 4N0DA 2UKDA 2VATA 4E3WA 1GGVA 2BCEA 3SP1A 2HL6A 4EKIA 5K8TA 3L6CA 2OCLA 5I7VA 2VTKA 3I42A 5ER9A 1IB0A 1DHTA 3DZKA 5I7FA 4K03A 5FPPA 5DT2A 1GKKA 1Y8CA 5FQOA 2DUMA 3FDIA 1OB5A 4JD5A 3ZGXA 3S4YA 4LBYA 2IOQA 2AI3A 4WXYB 1HE1C 2C4WA 4JIGA 1NJ6A 3FUTA 5ESXA 3UJCA 1GVNB 2NTEA 1J49A 4TMFA 3W78A 4X66B 8OHMA 5EQJB 3P0EA 4RL6A 4NJEB 4WT7A 1REQB 2YKGA 2QQGA 5LZ9A 3O9VA 1SR8A 1USIA 1WTAA 2JHPA 3PIDA 5JE8A 2IQ5A 3C5VA 3WLQA 1P7ZA 3WXBA 7AT1A 4P9NA 3I2YX 1K6EA 1LC0A 1QV6A 2QSJA 3LVRE 3DWIA 5JY6A 1ZH6A 3MS7A 1QP4A 2VJLA 2GPJA 3A3YA 3LUBA 4RV9A 3SZMA 4WIAA 3TE6A 4BQRA 4JFRA 1LPSA 4IXTA 2DHEA 4K3UA 3EDMA 2QEQA 1PT8A 2AMFA 2QTCA 4I4NA 4MV9A 3TLAA 2VAPA 4BEVA 1E5DA 3FUWA 4RY0A 2GTIA 3COZA 1F8GA 3GFRA 1WHTB 3LQ1A 3QTTA 4J1NA 1G5HA 3R77A 3E3AA 4GNRA 1Y5MA 1XTZA 5IVIA 1MP0A 1G7RA 4GD3Q 4J16C 4XVCA 2JG3A 3O26A 2JAHA 1JQEA 2I29A 3A9SA 4QPNA 3BB1A 4K0RA 4GP7A 4M0PA 2WJ4A 4EKDA 5DFAA 3ZHXA 2BONA 3NHKA 1W29A 4HMOA 4G0WA 1LUAA 2HJGA 5IF9A 4TM8A 3MOSA 4WJKB 1M2JA 4BNDB 1ORIA 5EJFA 3LYLA 3N05A 4WJLA 5J9FA 4OYLA 1KQPA 3H5LA 4MVCA 3G8DA 1DWQA 2QZZA 3EVEA 3ZKAA 2OM6A 5B58T 4G5FA 4F3YA 4HZGA 4IS2A 5JLAA 3KO8A 4U6NA 1S2NA 2ZIFA 5JATA 2ABWA 3ZOKA 3EZ2A 5LQKA 2UUCB 1KC1A 3RYIA 3UWMA 1USWA 1YAHA 1GAWA 2W90A 3V5NA 4NEQA 4IDDA 2OUKA 1UJ2A 1DEKA 5LU8A 4O2AB 2HQBA 2GUGA 4NDAA 4Q4HA 5FA5A 3SDSA 4AF6A 3BT7A 2PRIA 4EYQA 3RFTA 2YYYA 3MFQA 2I1LA 3GFSA 3ZY3A 4E4RA 5KOJA 2FGJA 3QH4A 2YWJA 4ZU6X 1V11A 4PVDA 2XHZA 4H18A 3UFBA 3D7KA 1PZEA 3KCQA 2FF7A 3LBHA 4DUYB 4LGVA 3HQ4O 4M3NA 3S28A 4QJ3A 2ZRBA 3HXPA 4MGEA 2H2AA 3I39X 4FFWA 2JDIA 3D5EA 2PLWA 1GNLA 3IOCA 1I36A 4L5BA 5ICGA 3ZD7A 1EIZA 4R7ZA 1QOQB 4X6UA 2HA3A 3WB0A 2AXPA 4BU1A 4PXSA 1C0KA 3FOZA 3QLEA 1MO3A 2ONJA 1DQSA 2WM8A 4PEVA 5FNVB 4FIDA 4M36A 4OQYA 3EIHA 4LIPD 2EU8A 2G5PA 4NU0A 5BN5A 1SVMA 1WUTA 3LJKA 3PP8A 3ZHTA 1P60A 2IU3A 2XA1A 2IWHA 5LZ7A 1BMFD 5K4HA 1G3RA 1XCJA 3I34X 4I36A 2YHIA 5EESA 3U4CA 4R0MA 3KVVA 2XZLA 1RQ2A 3E81A 1K5GA 4LXHA 2VHTA 4RC9A 1JQJC 5CNIA 4YJHB 1Q0ZA 3K53A 4CF5A 5EIOA 5I7UA 4W7HA 4UMVA 4D9MA 1CJVC 1MJNA 1YKFA 4I81A 3NKVA 4X24A 1W1UA 4MSUA 3AFOA 1DG1G 3B9PA 3M0EA 4O2BB 2FSPA 4JEUA 1WNFA 1C7JA 4WLOA 3WSVA 5CW2A 1DOHA 3IPAA 4BZXA 1T6YA 1Z7EA 4HFNA 5EFOA 3ACCA 2PS9A 3WMEA 1YDWA 2F43B 1CD5A 2J3DA 4TS3A 1SHUX 2BFFB 2C3PA 3JWGA 3OEWA 4CIYA 4RKQA 4HVLA 2F1JA 3LG2A 3ZHCA 3QMVA 3G9QA 3K6JA 2E37A 2V7VA 3MGKA 4NMXB 2B1QA 2UYHA 5C4IA 4G41A 4XB2A 3TLZA 4CL3A 2FX2A 2XUAA 1BNCA 3GFOA 3D59A 3L3BA 3GDFA 4PNEA 1U8FO 3OJEA 5AW1A 4XE5A 1GYPA 1GL9B 4CCWA 5CB0A 2I4OA 2XBLA 4TLDA 4L8LA 4DT1A 1P74A 1XCOA 3CZQA 4URUR 2QTTA 2V0NA 2MSEB 5DKFA 3ZLTA 2PJRA 1JHXA 3IKVA 4FC6A 4ZDKA 1OLSB 3P0IA 4UCFA 1JTFA 3UV7A 3ZV4A 4BMZA 2P5YA 1ESMA 4AZWA 2BI8A 3LXXA 1KY4A 1C50A 4LYGA 2GZDA 4MO9A 2PWBA 4TXNA 2ZCJA 1J20A 1ZWLA 4UMEA 4MWSA 3S2FA 4MUXA 4BKPA 4X20B 3RTGA 4AB1A 2JPDA 3WIUA 2CHVA 4LJAA 4XPIA 2P2SA 3RK4A 1EM6A 1LTHR 2Z2KA 4R9NA 4ZT2A 4K46A 5I45A 1SA0A 2I66A 1OXBB 1Q44A 3I32A 4P5DA 1NQTA 1VSQA 1ZGZA 3JD2A 4DSOA 3NIBA 5BYJA 5IK2D 2B9EA 2ZVDA 3GCXA 4B3IA 3OLCX 4WACA 1OBCA 2ECQA 4QT0A 1XKQA 1VC2A 4IJUA 1QK5A 4HEHA 3FVRA 4BLQA 4JMLA 3LZCA 2QSUA 4E7OA 2NAFA 3GPDG 4U63A 4D4GA 3OPNA 1DEXA 5IZCC 4DWJA 3E5RA 5LP6F 3PV0A 2FP4B 2DQSA 1QM5A 1Z3CA 4FCCA 5DU2A 4C6TB 3ZVKA 5BQOA 1QZUA 1EGMB 1JS1X 5AQ1A 3JAWB 3L43A 1NT2A 3IQDB 3JCZA 1Z7BA 2WILA 1V5FA 2HDHA 2PNJA 3PI7A 4DPLA 2IIVA 1GY8A 3LGXA 4YYZA 4Z1OA 4LYHA 6AT1A 1JZSA 1UBKS 1XFAA 4FT2A 1DIBA 3AUJB 1YR3A 3K9HA 2OT3B 4Z3KA 1AQYA 4GNKA 3Q6MA 3T1VA 1KYVA 1W85B 4Y2JA 3EIWA 2BUAA 5IJZA 1IDN1 1G5TA 3BF7A 4HX2A 4RZSA 1XAIA 3CRNA 1Q0RA 4A8JA 3UJ7A 5JECA 3C14C 1Z8HA 3E2PA 4H3KB 5FBVB 3B1FA 1AKRA 2A5JA 1L5HA 1UJCA 2O2CA 3M3PA 4AY4A 1KEKA 1RWVA 4G65A 2DHDA 3FA2A 4EF5A 1I9GA 3AIMA 3NWOA 4GM1A 4YMIA 1QGAA 2IQIA 3G17A 1X7ZA 1YDEA 4PZAA 1JDTA 1WSAA 3HSSA 3R3JA 1PFWA 5CXQA 3ICQB 1R74A 3WNQA 1LZLA 3SZGA 3AUTA 5K5EA 2VNJA 4B6SA 3EC1A 3EF1A 2Y92A 3C6YA 1U5AA 1WDTA 4G5HA 2H17A 5DCLA 3VPXA 4AG3A 4DWOA 1E59A 2QM0A 1OX4A 4DMCA 3Q2IA 2IOFK 4KXLA 4B2LA 4DEVA 2BGNA 3AY7A 1SUPA 2BSXA 1W0JA 4FMCF 3OO1A 1H5UA 1KJ8A 1B43A 4OQLA 2B7CA 1PGQA 4XX0A 1K0UA 5B4UA 5GGXA 2EFJA 4DF3A 4G8BA 2IP1A 1EVIA 1JFFA 1HT1E 3I9JA 4PLTA 1XQVA 1PUIA 3WB1A 4KIWA 3JZIA 4A2PA 4RNDB 4R01A 3V1LA 3HC7A 3D3WA 2CHFA 2J5RA 4YO7A 4YT8A 1H94A 2Q6IA 3AI7A 3SQNA 2QX8A 1N78A 1J39A 3O8DA 3FTFA 3H04A 3CE6A 3RAPR 2BEVA 3O0DA 2O5EA 2GILA 3B82A 5PNTA 4GBGA 2AR9A 2NXCA 3G0BA 1QIEA 2C78A 4B3FX 5F35A 1CRQA 2A84A 2W9XA 3I6MA 4YLGA 2E18A 3OO0A 1UBTS 2DCMA 1DAFA 4FZRA 3H4IA 1IQRA 1N6KA 3BRQA 2VKTA 4RBNA 1CYDA 1L4MA 2QK4A 1JI0A 4M9RA 1E7MA 1DTWA 2F67A 3F6CA 3HJHA 2Z2JA 1U4SA 3Q7TA 3EPJA 2GBPA 3JR7A 4CMJA 1OAOC 2JFGA 1EPUA 3JVIA 4Y1EA 5M5BA 1YBAA 1N7IA 3TZBA 2ZI4A 4LHXA 4RZHA 2F3RA 2YVUA 4PY2A 3AKEA 3FOEC 1N2CE 3QX9A 4UEOA 3ETNA 4W5NA 2QAGC 4W5RA 2OGZA 1KU6A 1YMUA 1FNDA 3OX1A 3ANNA 3QUTA 4DA6A 4JP8A 1HC7A 1NE2A 1UPCA 4M1EA 5AJZA 1I7SB 4ENVA 4GWKA 1T35A 1T0PA 4RD3A 2FUKA 2H5EA 3I52A 2WIFA 1KZ7B 4R5HA 4Y2QA 4HAYA 5REQB 3UY4A 4E2YA 1OB2A 2Q5CA 1MJ5A 2CDAA 3ISTA 4U2CA 3TOSA 1ESZA 3N0WA 2F1RA 3KLBA 1PJBA 3RJTA 1HV8A 2WOJA 1SUWA 1UZUA 2GD1O 4HYYA 4F6CA 5JBQA 5A7GA 2O8EB 4PSDA 4BJ5A 2G36A 2GN8A 4K9OA 3WXMA 4PSCA 4U2FA 1VYVA 1U9JA 1V9CA 1SUIA 2FMIA 3I4CA 4ILKA 5TF0A 2F9MA 2WDPA 3GGPA 5CT8A 2HMVA 3HCCA 4DSTA 5B37A 2OMKA 4ZTBA 1QYCA 1DKRA 3FOCA 1N2IA 3UJ8A 2HO4A 4Y6PA 4AJ9A 2BEWB 4X63A 4TLLB 1JR6A 4LHEA 3G0HA 3NBAA 2X6QA 1XU9A 2ZT7A 4ILEA 3SIWA 3H5NA 3B6EA 3GN1A 2VOJA 4OM8A 1JFSA 1J9ZA 4MGKR 4R6XA 1VSTA 4S1OA 4PQYA 1ZJ6A 1U8ZA 2G09A 3LMKA 1GHTA 5MGBA 2DAPA 1RYNA 4MUMA 3SXUB 1YR8A 5IVPA 2XMDA 2J1LA 4TV9A 2R96A 1N0IA 3AFGA 3KL4A 4HFMA 4ZO4A 1UP4A 4HVAA 4ZGWA 1ZOSA 3L7YA 4KMOA 4ZCLA 1FY2A 4REMA 4CMGA 3O3OB 1GYQA 2QPTA 2W6MA 2A0FA 1TADA 3PDJA 3PQEA 4JSRA 4XWGA 2UYCA 2FFBA 1JLLB 1JMKC 4Y9UA 3PNQA 3OEHD 4G1VA 3QJYA 3KT0A 2GYVA 5T8KA 3RYFA 4FKBA 5HKKA 3NI2A 4FCTA 1KAMA 2X8LA 2QN1A 3EQ6A 1O6CA 2VAWA 2BGLA 2GERA 2HI0A 3Q5EA 5KQSA 1QBKC 3GW8A 3HP4A 3CZ4A 3LV8A 4G0QA 4WLFA 2QD4A 2CLMB 2NACA 3LQYA 2Q1UA 4KQHA 1QP7A 1JDUA 3SC2B 1ZBQA 4MEAA 1B7GO 3EGIA 3RKSA 2BEKA 5LYJB 1PX2A 1XZBA 2EATA 2J08A 4FM9A 2BHRA 1JJ7A 2Q45A 1IFXA 3AVWA 1MFPA 1E9FA 5BPFA 1D4FA 1SRQA 4LXXA 4Q02A 2JH9A 3OCZA 4QOHA 4YMHA 3T5BA 3UENA 4EFMA 5BSEA 4BC0A 1JXAA 3GC6A 5E38A 4QFBA 4UHDA 2VF8A 1RQPA 1XKXA 1A9YA 2WYWA 1KAHA 2FQYA 3CWQA 5HHTA 5IDQA 4QG3A 3CZ5A 5ENDA 1DBSA 2C57A 3WGLA 1M1YB 4G0YA 1RP1A 4N5LA 3W34A 2Q2QA 3SFTA 1JWBB 2Q8PA 2YN0A 4L3WA 2H5IA 3QITA 4YUWA 3NHZA 1JA1A 3WK7A 1RM5A 3W6OA 4IIFA 3L4KA 4G97A 3V4VB 2Q21A 1IHXA 1ONPA 2V55B 3OWXA 2C00A 2OLJA 1G4AE 3MBIA 4EY8A 4DV1B 2QI9C 4EL0A 1FFSA 1EDEA 2X22A 4UHHA 3R9IA 7REQB 3P0FA 2EWMA 4IJ5A 3VSCA 1JHZA 3EQ9A 3WS7A 1YZVA 2G1PA 5CVVA 1CT9A 4N8EA 3WL8A 4DLSA 3KT3A 5GY7A 2MR5A 2FSVA 2V7WA 4J0FA 4ZAGA 1E1MA 3I2JA 1ZVQA 2KPOA 3NP7A 3C3EA 4ZO7A 1ZEJA 1NYLA 5CLGA 3MB8A 4G0PA 4HDAA 1BWQA 1J2JA 4V3BA 1Y6GA 4WW0A 3IESA 1D7OA 3CWZA 3HUDA 3TFQA 5AVZA 2NZVG 2V7EA 1CZOA 2O5CA 1W30A 1TYBE 2BM0A 2ST1A 4TSFD 2DTXA 2WP8J 4OI2A 2C9MA 3TE7A 1KYXA 1CBUA 2O1WA 4Q66C 2O8BB 4G5XA 1C30B 1TM5E 5JADA 3H5TA 3ZE2B 4O29A 4AIIA 2QM8A 3V1YA 5A02A 2GDZA 5ECYA 1EI9A 1F0KA 3NBUA 2XB4A 3INGA 5AVOA 2QLTA 1JVNA 2TMDA 1BDBA 4H1WA 1JAXA 3W7BA 1LDEA 4JDUA 4MV3A 3ZJVA 2R97A 4QLAA 1PG2A 2Y1GA 3DDSA 4R9UC 1VG8A 5BSRA 2CC2A 3BMOA 3VDQA 4IJQA 3IC5A 2XGJA 5AVRA 3R0XA 5K1ZA 1NJSA 2FMKA 2XT6A 1UMBB 3DEAA 4F7WA 2PYIA 4OL0A 2GK4A 3ZHZA 2I2BA 1E32A 2ZRMA 3C7CB 1NN1A 2IEAA 1O7JA 2HADA 5DPMA 3CTPA 2X2OA 3MINA 3N2KA 1EJBA 4F3RA 4M9XA 3TR0A 3GZNA 3FXAA 3VNQA 5DH9A 1PQYA 3GHYA 3PQ5A 1GGMA 1S5PA 1SD5A 4HYTA 4LHSA 4D9EA 1C5KA 3EH2A 1V4VA 3OICA 1Z2DA 5JQGB 4LOIA 4PBRA 3QW4B 3BKXA 2BR4A 1K6JA 3M49A 4RE6A 2YUTA 4IICA 4KFCA 3JAKA 1KQFA 2AS0A 2PMCA 1K4KA 1CZHA 4FEGA 1AUQA 4NDZA 1LBHA 2FZ4A 5SYAA 4MKGA 3FB4A 3VNVA 3DBVO 1UMKA 1Y3IA 2JB9A 4P3XA 5I5GA 3H1AA 1VZ2A 2Q2VA 4ALKA 5JCJD 5KNDA 1ESCA 3JVDA 3B12A 4DZZA 3AI3A 1JIVA 1NXPA 4OH7A 4MKZA 3BVPA 4HRYA 1NN3A 3OZVA 3D6MA 3DZBA 1Y3BE 5TV2A 4OP2A 1SHKA 4J3NA 3TJRA 1NLUA 4KNVA 3R76A 3FHLA 2JAQA 4GX5A 1TO2E 3EYWA 3O82A 4EA6A 3KQHA 1B00A 1S7GA 3IQZA 4F1JA 1FSPA 4H3VA 3DE4X 2EIXA 3BIJA 1UMCB 2W6PA 3ILXA 3E7XA 4M8NE 1SVLA 1YRYE 4E15A 5DTMA 3RM3A 4YBZA 1NP6A 4YVFA 5ALMA 3SYMA 3P0HA 2M2IA 2HEGA 2YS6A 1Q6YA 1RHUA 1ZOLA 3QEKA 4JUBA 2ZSAA 5GVRA 4OI0A 4AROA 2DMRA 3C8ZA 2ODTX 5BR4A 4JIMA 4X85A 3MCZA 1U8YA 2Z04A 3DMHA 4OHZA 4COKA 2FCRA 3WGNA 5MFZA 4N03A 5CFQA 1OLUA 2C5GA 1ISSA 4DCTA 3PFCA 1A27A 2AF3C 1KIFA 1R0RE 2Z5GA 2RDMA 3G2JA 1BMQA 1SJ9A 2WAAA 2REQA 3WRXA 4ZI7B 2CF6A 2HY7A 2IS4A 1ZOPA 1EHYA 2AFHB 4FFOA 1S3FA 1E7SA 3IO3A 3I2KA 5DCWA 1XMOB 1UXOA 1PQWA 1GAXA 1SUBA 2FHSA 5EQTA 3E3NA 3V1KA 3F8TA 5BURA 1GQRA 3HEAA 3P0RA 1IWBB 2RMKA 4ZXFA 1UCFA 1G9XA 3IOYA 3FLMA 2RGRA 5A5EA 3S2SA 3ZDXB 2DHRA 4ZZIA 1VPVA 2XB9A 4GE0A 5B3KA 4I2NA 4D80A 5E95A 4V0KA 3T5MA 5G02A 4L1KA 5AW0A 4WA7A 4BQNA 2OSVA 2Z5LA 4IIJB 1Q0UA 2FG6C 4RMIA 1TU0A 2XR1A 2IYUA 3CGWA 3EXHB 1MQAA 2X1MA 3F46A 4DMRA 1KEEB 1LPAB 1SBZA 4UOEA 2V6BA 3T7KA 1AGNA 1FTSA 3VUEA 1A8IA 4L57A 4XQGA 3M9WA 1TYDE 3NDPA 2YVKA 3WKAA 4DJEC 3R23A 3M6LA 3SE7A 4A1FA 4RDXA 1OD6A 5JBNA 5JR3A 1WB4A 4CLHA 4L9AA 4EY5A 4PQRA 4I4TB 4X00A 1SOVA 2VPXA 4DBVO 5IUKC 5ITVA 4LBVA 1XTSA 5SZHB 2WRZA 3GQBA 5J5CA 3TWOA 5TC4A 5LA6B 4EQ6B 3DR3A 3D0OA 5EL0A 2WUEA 2DWQA 2VHYA 1FYFA 4GX1A 1C8KA 4QXOA 1ECBA 5TPWB 4LY6A 1E3JA 3JD4A 5CR9A 4OFXA 4MX8A 1CQPA 4XTRA 3D2LA 5F76A 3CH5A 3TX6A 2VQEB 3UPUA 1Q0PA 3UMFA 2LKDA 2X3FA 3KR2A 3N8IA 3OZIA 4B2YA 5JNRA 3H4TA 2GM4A 3LHDA 3F4BA 3N3AC 3LF2A 1WKVA 4GRDA 5BNZA 2WU3A 4HXEB 1TEXA 3BH7A 3EGCA 2EIHA 3OE7A 4WLVA 1NBHA 2AJLI 3N0RA 3H05A 3SX4A 3C48A 3K0BA 2XDAA 2BGUA 2BFEA 3AL3A 1MRSA 1WLYA 2DRIA 3MWEA 3OC6A 3QYFA 5GJCA 3K1AB 2WUFA 1RWQA 5CT5A 4BAGA 5KTMA 5C53B 3T3EA 3T7IA 1DJPA 1E4EA 3OCCA 2ODBA 1JQBA 1E3EA 2CXNA 3A2MA 3CSDA 2FUCA 3NOOA 3RC9A 3QI7A 5BWMA 5I4CA 3QWIA 3H0EA 3KV3O 1Z12A 3EAQA 3EQ2A 3ICWA 4DQUA 4R6WA