1R18A

Drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
b'IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
publication title Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 70
structure length 223
sequence length 223
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2003-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r18A00
2PT9A 5DWQA 1PRYA 2PX5A 4AUKA 4E33A 5DX1A 1EG2A 3R6TA 4GEKA 1N7JA 4F86A 4E31A 2O0LA 1G8AA 1D2GA 5EC8A 3JWJA 2I9KA 3TFWA 5DSTA 3M33A 5E1BA 2AOWA 2PLWA 1AV6A 2QM3A 4V0QA 1QANA 4YMGA 1Z3CA 5DM1A 1YUBA 4P58A 3C6MA 2ONZA 1L3BA 5FHRA 2CL5A 1NE2A 4PIMA 2ZIFA 5EMLA 4RTSA 1SUIA 1NKVA 1L3IA 10MHA 5EIFA 3A4TA 2GH1A 1DUSA 3EVFA 3DH0A 5GWXA 4R6WA 1X1BA 3TQSA 1G55A 3ER8A 3E05A 2CMGA 3HA5A 2OY0A 5LR6A 1JQDA 3EVAA 5DT2A 2C7QA 2ZWAA 2AR0A 4FGZA 1JG4A 1N2XA 2LD4A 5CVVA 4ER3A 5K0JA 3HVJA 3LSTA 4PYQA 4KRGA 2AN4A 4RSRA 4GUAA 4XUEA 1ZGAA 4L7VA 3FUWA 2NNWB 4E2YA 2GA9A 3KQWA 3OCJA 3QOXA 3HA3A 3P9CA 1YZHA 2EFJA 3P2KA 2IIPA 1SUSA 3G8BA 3GNLA 3NDJA 4RWZA 4V0RA 5DRTA 4DM3A 4YMHA 2OXTA 2ZLBA 3MGGA 3P9NA 3R3HA 5LQJA 3DULA 3KQOA 1IM8A 5E2BA 4F84A 3NMUF 4EKIA 3M6WA 3A25A 5DM4A 1SVUA 3JWIA 5H02A 5HIIA 3SSMA 3TM4A 2IDKA 3FYDA 4X1OA 4DKJA 2YXEA 5LQUA 4NECA 4CTJA 3LL7A 3BWMA 2FK8A 4C05A 2PV0A 2AOVA 3KQYA 5EQJB 4E30A 3R9XB 2ZBPA 5EMMA 3O7WA 5EEHA 2OPBA 4PYIA 3LGAA 3SR4A 4AZWA 1RI4A 4KDRA 5GOZA 2QY6A 3VC1A 5K01A 4GQBA 4PIPA 2AOTB 2VS1A 3HM2A 1G60A 3I53A 4PONA 4PYMA 5KVAA 5EMJA 2F8LA 1D2HA 2ORED 3P71T 4DQ0A 1JR4A 4HTFA 2YUIA 3AXTA 4RTOA 3LDFA 3CJQA 4IWNA 3OPNA 3P9KA 4ISCA 4FSDA 2PXCA 3M6XA 4UOEA 1FJXA 3EPPA 2JHPA 3HP7A 2WA2A 4O29A 3LX6A 2AZTA 4GC5A 3EVDA 4XUDA 5D1HA 2E5WA 4EKGA 4X41A 3B3GA 5HIKA 4BLWA 3TPZA 3BT7A 3CCFA 4BP3A 4WXHA 3KR2A 3UJAA 4C06A 1RJEA 1TPYA 2ZW9A 2UYOA 3H2BA 3QV2A 1EIZA 3GO4A 4BLVA 3RIEA 5ICEA 1TW2A 3FZGA 1ZKDA 1U2ZA 2GB4A 4WVLA 4DA4A 3DTNA 1QZZA 1WS6A 3DMFA 5FADA 5ICFA 2OKCA 3K0BA 3FUUA 1R8YA 3UJ7A 3B7PA 2FYTA 4M36A 4YUYA 3FPJA 2EX4A 3GGDA 3TLJA 3OZRA 2PXAA 3REOA 4G56A 3SM3A 1VP3A 3AXSA 4Z2YA 2VDUE 4XUCA 5CD1A 1KPIA 3TR6A 3DLCA 5U4XA 2AOXA 5DRYA 3BKWA 1PJZA 2P7IA 2PY6A 1I1NA 3BWCA 1HNNA 3GRRA 3KQVA 4RV9A 3UZUA 1KPGA 2XYQA 4OQEA 4QTUB 4AX8A 3B89A 3GRUA 4KIGA 4LWOA 5CM2Z 4HSGA 5KQSA 3DLIA 2YXDA 2HV9A 4RVDA 4HH4A 2OB2A 2Y1WA 3LCUA 3TKYA 2R6ZA 2G71A 5K8VA 2YX1A 1BKYA 3HVKA 4OQDA 3C3YA 5E8JA 4RTJA 2H1RA 1KIAA 5HZMA 4RVHA 3M70A 2OYRA 1ZGJA 1KR5A 1P39A 1QAQA 2I7CA 3LCCA 3P97A 5FWAA 3TOSA 2OO3A 3EVBA 1TW3A 4KVZA 5HOQA 1XCLA 2QRVB 3DMGA 3LKDA 5FHQA 3TMAA 2PXXA 3G2OA 4K6MA 1XJ5A 5E1OA 3SSNA 3I9FA 2G72A 4Y30A 1VQ1A 5DTQA 5GINE 4R8RA 2XBMA 3SGLA 2P35A 3HCAA 4LG1A 3M6VA 3GWZA 3MQ2A 4QPPA 4C07A 1M6YA 4GOMD 4OBWA 5DTMA 1QAMA 3LBFA 2OB1A 3DXXA 3HCBA 2ONYA 3OU2A 5GM1A 1N7IA 2ESRA 2NXNA 3R24A 5FCDA 4ER0A 3PX3A 2NXEA 2YXLA 4KW7A 3GDHA 3IYLW 1M0EA 5T67A 3DUWA 1R6AA 3OE4A 3LHDA 2CMHA 3P8ZA 5F2OA 2JH8A 4IV0A 5FQOA 4GOND 1NW6A 2K4MA 3G7UA 5LQAA 4RTKA 3HCFA 4LECA 1QAOA 1SKMA 3FPEA 9MHTA 3EVEA 4R8SA 5B1SA 3UFBA 4C4AA 1O54A 4QPNA 3P2EA 1L9KA 2GS9A 3MCZA 5HIJA 3KPUA 3BGIA 2H00A 2G1PA 1NT2A 5CCXA 2HWKA 3ER9A 5HIMA 1JTFA 3BGVA 2A14A 4HGYA 1X1AA 4A6DA 2HR1A 5DXAA 5FUBA 3HVIA 1F3LA 1P1BA 1JQEA 2UYQA 3OU6A 3IEIA 4BP1A 2ZFUA 4MWZA 3FYCA 3I64A 3OE5A 3DMHA 2YQZA 5T6BA 3RODA 1EQAA 1NBIA 2YTZA 3UJDA 3KR9A 4YUVA 4DCGA 5E1MA 2C7PA 2ZULA 5K0EA 4FSXA 1EAMA 2B9EA 5K0NA 3HTXA 1X1DA 3UBTA 1EJ6A 3HCEA 5DXJA 5GM2A 1YZ3A 5CVUA 4MHTA 2WK1A 5D1NA 3TM5A 1ORHA 4RVFA 5LSAA 2EJTA 5G02A 1JG2A 2G70A 1RI2A 2QE6A 1JSXA 2XYRA 1DCTA 3NVKI 1NW5A 1Q0SA 5LQKA 4QVKA 3TKAA 2KW5A 5LQNA 5LQCA 2P8JA 3BWYA 1BHJA 1O9HA 3AY0A 1R74A 3P2IA 5DM0A 2BM8A 1JG1A 4OX9Y 3FUTA 3R0QA 2IH5A 3U81A 2PGXA 3UJ8A 3M6UA 4QDKA 1HMYA 4MTLA 1YFLA 4GF5A 1X1CA 2VP3A 3PTAA 2ZCJA 3KPYA 1JQ3A 3UA3A 3JWGA 3BWBA 5CVJA 5KYGA 4CTKA 5DLYA 3K6RA 1XDSA 2ADMA 2JJQA 3KPWA 3FTDA 5HEKA 5GIOE 4RTNA 2PX2A 4BLUA 3D2LA 5HFJA 5ICGA 2AN3A 5EGSA 1ORIA 4CKBA 3CVOA 1JTEA 3UA4A 2ZIGA 3KR0A 3AJDA 3KU1A 3MB5A 5MHTA 5C0OE 2ZSUA 3FTCA 3MERA 3LBYA 1VIDA 1KYWA 3KQSA 4FZVA 4RYLA 1NV8A 5GIPE 2UZ4A 5BXYA 3Q7EA 3LDGA 1FBNA 4QDJA 3IHTA 2EG5A 2FCAA 4DF3A 1M6EX 1FPQA 2P3LA 2Y1XA 3NTVA 1VE3A 3P9IA 4HC4A 5IH3A 3UWPA 2PVCA 1MHTA 3CBGA 5F2KA 4FS8A 3FTFA 4RTRA 2P3QA 2B25A 1B42A 2VZ9A 3THSA 3M4XA 5KS2A 2B3TA 3FUXA 2PWPA 4DMGA 3HCDA 2HMYB 1SQGA 2AOUB 5FA5A 2PX8A 3LDUA 1T43A 4PYOA 1I4WA 1RJGA 3EGEA 3GCZA 1JSZA 2PKWA 4GC9A 2BR4A 2IH4A 2ZZNA 3FPHA 3PVCA 5EG5A 4CXMA 3NWBA 3DP7A 4RVGA 2ZZKA 4C03A 2EJUA 3EGVA 3KHKA 2G8NA 2R3SA 3FUVA 2VDWA 2FPOA 2BH2A 1KPHA 4HTFB 5F2NA 4MIKA 1OR8A 1ZQ9A 2H11A 2IDJA 1FP1D 1MJFA 3CKKA 3O4FA 3BKXA 4GBED 3VC2A 4X61A 4P7GA 5E1DA 1ZHFA 1L3CA 3GRZA 4HG2A 5FQNA 2DULA 5EZSA 2NXJA 3T7SA 7MHTA 1Q0TA 5K05A 1NW3A 1X19A 3OU7A 4EQZA 3BGDA 2AVNA 5EOVA 1INLA 4OA8A 5IKMA 4EVIA 2YVLA 4ZTBA 2AN5A 2YR0A 4PINA 5BP7A 3HNRA 1WZNA 3LCVB 5T64A 3AWIA 3V8VA 1Y8CA 5K0BA 3OZTA 2I62A 4PCLA 3EEYA 1AQJA 1BC5A 5K0CA 1YB2A 5E9WA 3E7PA 3F4KA 1RI5A 5FWDA 1RI3A 4E32A 4PNEA 5EMKA 3GJYA 3EEOA 2C7RA 3NDIA 2C7OA 3A26A 5P8WA 2PSSA 4PYJA 1NW7A 2B2CA 5C1IA 3HVHA 5EKXA 1R00A 4HRAA 1NW8A 1P91A 1WY7A 3VSEA 1JG3A 1R18A 2IPXA 3ELYA 2JHCA 1UWVA 3EVZA 4IKPA 4YV1A 4GOOD 1VP9A 2O05A 1AF7A 4CKCA 3DR5A 3SXJA 1VPTA 4QTTB 3E23A 3I5UA 2IP2A 5CCBA 1XDZA 3NW9A 3HCCA 4LWPA 4OBXA 1XXLA 4H0NA 4RTLA 2V7EA 2IH2A 5ERGB 4KWCA 3KQTA 3NVMB 4GOLD 1IXKA 3SMQA 4YUWA 3PS9A 1VLMA 2AOTA 2NXCA 2NP6A 3G89A 3A7EA 3BZBA 1EJ0A 2GPYA 5BW5A 5CIYA 2ZTHA 2PJDA 1WXWA 3BXOA 5EKUA 2OBFA 3MCTA 3CJTA 3EVGA 3JWHA 3LPMA 5EHGA 1F38A 2ZWVA 1KYZA 3KQPA 3T7TA 4F85A 1WG8A 2ZBQA 4AZSA 5K0GA 3EVCA 5GP1A 4BY9E 2HNKA 1RI1A 3EMDA 3QOWA 1SQFA 3A7DA 3KR1A 3KKZA 2BR3A 3T7RA 4ER7A 4PGGA 1FP2A 4QQNA 4P7JA 1VBFA 1XTPA 3KPVA 2FRXA 5FA8A 3SSOA 2XVAA 3FRHA 3L8DA 5E8RA 4AZVA 4PYNA 3S68A 3UJBA 3KQQA 5K03A 3B3JA 3WSTA 2N47A 3I58A 5DPMA 3UJCA 1UFKA 4PGHA 5JUWA 5C9ZA 1RJFA 5FTWA 4ER5A 4DZRA 2IGTA 5EPEA 2O06A 3E8SA 3DXZA 3NWEA 4CKEA 4C04A 2ZIEA 4YUZA 4U7TB 3FPFA 5DTRA 2PX4A 2P1DA 3OFJA 3OZSA 3DXYA 1H1DA 1L1EA 5M5BA 2AOUA 3GU3A 4FP9A 4B17A 4QVGA 3MTIA 3C3PA 4PWYA 3FTEA 2IBSA 3C6KA 5E9JA 2V74B 3ELDA 3HEMA 1YF3A 2VDVE 3PT9A 4M7RA 1WXXA 3IV6A 2PT6A 1I9GA 1P1CA 3ORHA 4OA5A 3PFHA 4MQ4A 3HA7A 3V97A 4E2ZA 3Q87B 4A6EA 5ICCA 2Z6UA 3GXOA 1D2CA 2P3OA 5EVJA 4FR0A 3OFKA 4C08A 2CKDA 3ME5A 2Q41A 3RW9A 4RTQA 4RTMA 4X60A 3VYWA 4EK9A 4YV0A 3FPGA 4EMSA 2AVDA 2WA1A 5LQRA 1G38A 8MHTA 3BUSA 3PX2A 2P41A 5DX8A 4KIFA 4JXJA 4P7FA 3GIWA 1VL5A 2CWWA 1KXZA 2QRVA 1DL5A 2P7HA 3UJ6A 4DCMA 3MHTA 3PLAE 3KQMA 4E70A 1IY9A 3EGIA 4IV8A 4PCAA 5DM2A 2FHPA 4R6XA 5HILA 3LECA 5DSXA 4HGZA 3G2PA 2OZVA 1UIRA 3G8AA 4ER6A 5CVDA 3GRYA 4M37A 5K0FA 4FT4A 3G88A 4YV2A 2NYUA 2JG3A 1O9GA 4E2WA 3EMBA 4R05A 5EHIA 3LKZA 2ZBRA 3ERCA 3KPJA 2GAFA 3GRVA 4RX1A 1NV9A 4X63A 1AQIA 4U7PB 2GLUA 3B3FA 2BM9A 4PYLA 5JR3A 2ZZMA 5CVEA 2B78A 5BW4A 4POOA 4P7KA 3DOUA 2IFTA 2XYVA 3A27A 3CJRA 4PYKA 5E2AA 2I6GA 4YUXA 3CC8A 1KHHA 2JHAA 3ELWA 3NJRA 2Z6AA 2ERCA 1KP9A 3ELUA 3TRKA 2P40A 1G6Q1 1XDUA 3T0IA 5KQRA 4FT2A 2Z6QA 2IBTA 2NP7A 1XCJA 1SG9A 3ID6C 3X0DA 4RTPA 3ANXA 1BOOA 5K0LA 2ZVJA 3G5LA 2O57A 2DPMA 2PBFA 2UYHA 3O31A 2HTEA 2FK7A 4Y2HA 5CUQA 3MTEA 2AS0A 4ATNA 2PWYA 3PB3A 3UJ9A 4AZTA 3C0KA 5EIWA 5E9QA 4XCXA 1NBHA 3G2QA 4E2XA 3SX0A 3FRIA 1R8XA 1XVAA 3B5IA 5EEGA 5FULA 2BR5A 3SVZA 1YFJA 4KDCA 4QQKA 3MAGA 1G8SA 4M38A 3CGGA 5EZQA 2XVMA 3THRA 1RJDA 1V39A 2BZGA 3G2MA 1ZG3A 5K09A 2JH9A 2O07A 4CWAA 5DX0A 3G5TA 2QYOA 1QYRA 2UYCA 3PFGA
chains in the Genus database with same CATH superfamily
6ADHA 5DWQA 2IU4A 1Y5MA 4KQGA 4AUKA 1JA9A 3ROGA 3LE8A 3IT3A 4II7A 1SRQA 3STXA 1G8AA 1Z45A 4HTAA 2B99A 1YC2A 3OPVA 3TZQA 3TSCA 3X44A 3NANA 3M33A 4QRIA 3I09A 2G9QA 3MXOA 2W2QA 5LBTA 5KNBH 2DUNA 3GR6A 3O4HA 1AK9A 1QH1A 2PX0A 3ZD8A 5JXHA 1HZZA 4C2BA 3CX6A 3P4XA 3QE2A 4UUAA 2HJWA 1NXQA 3N53A 3ODPA 4B09A 3RIHA 5JD4A 3MRSA 3QQ5A 2XQGA 2OOSA 3B5JA 2HQRA 2VCEA 1U8YA 2DTDA 3SJ7A 3U0BA 1ZMOA 3LDAA 5LR6A 2VAWA 1O08A 4B3HA 1FVXA 2ZRKA 4R40A 4L08A 5F7JA 3ED5A 1HDZA 2ZIZA 1YUNA 2LD4A 5CB6A 1PF7E 4ER3A 3LZ6A 1TTPB 2J3QA 3T9FA 2V1XA 1XTBA 1Y9DA 2VQEB 2WJ4A 5F5NA 4CZ2A 4CIAA 1TRHA 3MJDA 1J9ZA 4FW8A 2OUKA 1OLSB 4AS1A 2VK1A 4GMGA 1P2DA 4G01B 3P9CA 1YZHA 3LO5A 1ZK0A 4HATA 3U37A 5G41A 4JASB 1VZ2A 3B7GA 2QRMA 2QRGA 2OQRA 2XJ4A 1WV1A 5KTPA 3QUAA 5FPHA 1I0ZA 3Q1KA 3FHTA 1YACA 4Y1RB 2RGNA 1XKXA 3ML1A 1XVUA 3DV9A 2CXHA 1ZXXA 1E7SA 1FLAA 4MP6A 3SHQA 1SQSA 2R6CA 5JY1A 2XWBF 1YMVA 3IMKA 1E3SA 2C00A 2QLFA 1G21B 1VMKA 3OY2A 3UMJA 2I34A 1VL8A 2WSSA 1NAIA 2P9GA 2Q8PA 4B4DA 2W7TA 1N5OX 3O7MA 1Y7LA 2N75A 4WNAB 3A05A 4YT8A 1CUXA 1F5NA 4J07A 5B7GA 1U2QA 2PCJA 2E4AA 3N2YA 4GZ5A 5AVSA 3GMSA 3H9JA 4WBSA 3U4DA 1CLEA 1PUXA 2ZDHA 1A7UA 4RTOA 5BQPA 4BO3A 1IRXA 3M4YA 4DM4A 4ZVNA 1PX2A 4LZJA 2GVDC 2RHDA 2RGEA 1DFHA 3LX6A 5D1HA 4YMSA 5F98A 1B41A 1HOTA 1EYZA 1JJAA 3ADCA 3U4MA 1LA2A 1VSBA 4KN5A 2FW9A 3PD1A 2A94A 2O0MA 1C5KA 2BKEA 2ZRDA 1GTG1 2NO4A 2OHGA 3QUQA 4HGOA 2QMZA 4QNRA 4PR3A 1NW4A 1SBNE 1W0JD 2AUTA 2CLHB 2VRWA 2Z5FA 3F71A 3GBVA 5CHEA 3I4FA 3VZRA 4E5UA 1RRCA 5MGNA 5A4MS 1E5TA 1ZM4A 1GTRA 4BLRA 4TXMA 2VJQA 2YWCA 5A5EA 2WTUA 4Y9TA 4HQFA 4GI2A 2WQ7A 2EX4A 4QUDA 3CXRA 2ZBGA 1E3QA 4KACA 1ZINA 5CK5A 4CFZA 1A2BA 4XA8A 5B2EA 1FFXA 4KZPA 1M2JA 2YJ4A 4TYQA 4LXUA 5BSKA 5CD1A 4ACAA 2HHJA 2N9UA 4X20A 5REQB 4DNXA 1NONA 2WM3A 3UAOA 5EWMB 4F04A 2ECFA 1F17A 1KDPA 2C92A 3H2YA 4GSLA 3A6KA 1PFWA 3DB2A 4N47A 3FI9A 2DHEA 3UFXA 2Q9UA 4EJSA 1ONBA 1DXYA 3W5VA 4UFPA 2EBWA 2YX1A 1NR7A 2R7NA 2H1RA 3QVXA 1QZTA 5CIWA 5C4GB 3V8QA 5I7RA 3P0HA 4OD0A 4J2TA 4PGFA 4WXPA 4ZHQF 2NZYA 1XDGA 3HJCA 4KVZA 2ZRCA 4Z9FA 5A1TA 2WU8A 4EUEA 3H04A 3KXIA 4XWTA 1UK7A 1M34A 3B6IA 4HQLA 2RCYA 3KYCB 4DC1A 3UCXA 3A1DA 3L4BC 5HRUA 5SICE 4XW2A 1B0ZA 4WDRA 4X92A 3NM6B 2WSLA 4AT1A 2EFYA 3ACDA 2J41A 3NTLA 3QXCA 3R9KA 4B3BA 5LPNA 1SK9A 2D74A 3PPIA 2QGZA 3ZHRA 1X7ZA 5KNDA 3DBHB 3ZY5A 4QBKA 2ZRQA 2NXNA 4K3UA 3B1YA 4AF6A 3KOYA 3FH0A 4LISA 4X24A 2B6NA 5E3HA 2YXLA 5GVRA 2WHYA 5TT1A 2B4RO 1L5LA 2BGUA 3PGA1 1JVSA 3UUGA 2V54A 4AKSA 3QGMA 5AUPB 4QD3A 4HDCA 5CB4A 1CUUA 4GOND 2QUZA 1HLFA 1MOSA 4HUTA 2WVJA 1U0LA 1TUGA 1XZQA 4A6PA 5BV8A 1U2DA 4WT7A 1QHIA 1RBMA 3UFBA 2FFHA 4JQYA 3G8YA 4US1R 4KR9A 5JTTA 4PO8A 1D7OA 2FFAA 2FVYA 4LDPA 2CSXA 1VB3A 4R7GA 5JSQA 3IKJA 3S40A 1M0WA 5DXFA 1U1CA 4XI9A 3L7CA 2NO6A 2ZSDA 1N33B 1TU4A 2WW8A 2ZXUA 2NO9A 5IAKA 3T5TA 4BP1A 3ZHOA 1YDWA 1PIWA 4Q3KA 4RD1A 4GWLA 2VJYA 1T13A 1NBIA 3NHPA 4RY8A 2AUMA 4J3NA 1KNXA 1NPTO 1Z4JA 1JFVA 2HF2A 4G0QA 1AK2A 1BHSA 4ZV4A 4UUPA 2FPPB 2C4TA 1VE9A 2CY0A 2QGNA 1YHNA 3UBTA 3KYIB 1GL7A 1XKTA 2E6UX 5D1NA 1ZN8A 2Z5GA 1WF6A 3VJMA 3NHUA 4MGKR 3NHMA 4EB0A 4L72A 4NWIA 3OTOB 2VF8A 1G6HA 2WICA 1JDBB 2ZUBA 3JZFA 2C5GA 3HL4A 1K4KA 2P8JA 4DV1B 4BUJA 1O9HA 3M4JA 3BHJA 2O23A 2QJRA 4CMEA 4ZIRB 2XLCA 3VGJA 3C3DA 3FNIA 3GDGA 2O1XA 4AL4A 1EUCA 1EDEA 2QTFA 3RS8A 4B43A 4A5SA 4WLFA 2NX2A 3I8OA 3KOMA 3R40A 1IWOA 1KI2A 1ZO8A 4M55A 4UE3S 4M9UA 5DLEA 5DLYA 2PA0A 3Q6NA 1I3CA 4NDNE 2YIMA 2XW6A 1RPNA 5TEWA 3TLZA 4CTMA 3AR2A 5ICGA 3MYYA 1G7RA 3UJHA 3IOCA 4MIEA 3CVOA 1IM2A 3S5UA 2HT1A 2ZI3A 4JD5A 3SR3A 1KBZA 1MJHA 1SNYA 1Y1TA 4B3JA 1G7SA 1SVNA 3HB9A 4UJ5A 3U4IA 2D1RA 3LVQE 2E21A 1Y3AA 4N0DA 3DMDA 4XEUA 2BZ1A 3DKRA 2QEQA 5IKOA 3UQZA 2IV2X 4E6EA 4F4UA 4RYLA 5DCUA 3TE7A 3NAQA 5CD9A 4L5IA 3W78A 1EDZA 1TA4A 2I4IA 3D5TA 1A69A 1DTSA 4BVAA 2FCAA 1VRCA 3ESXA 1IG3A 2PUAA 1T6YA 2EZ4A 2XVZA 2BP7B 3SQLA 5LB4A 5IX8A 5EMNA 1U2TA 1R66A 4H7IA 4LRWA 5BR7A 3HY4A 4DHWA 4WESB 3ZHZA 1WPGA 2Y67A 5FFNA 1VHDA 3AVYA 1CY2A 2J9XB 4GR5A 3AKZA 3RVOA 4B4KA 1SHTX 4KMRA 4I9UA 4ZYLA 2FCRA 3EQ8A 4GYWA 5DGDA 2ZZNA 1FNMA 2ZI4A 1YZVA 3FPHA 3LWNA 4NI5A 1TF5A 5FXMA 1CU1A 1P62B 4CN8A 4YCMA 3DP7A 5AVUA 3ZDBA 2VAMA 4Q3OA 3UAWA 4B6OA 1UDCA 4FMDB 2EJUA 3I1FA 2VAXA 2VN8A 4HDKA 3SZRA 5LLDA 3THYA 2BTEA 2N42A 3O3NB 4EY5A 1YBMA 3QYPA 4XASA 2GBLC 2UV8A 4KJXA 1JEYB 1EWQA 2Q1WA 4XEHA 1GZ7A 4FLFA 1T1SA 4H16A 3AINA 4RA9A 4OV6B 1LSSA 5FB3A 5IW8A 4QGGA 4QT0A 3G1UA 3T7SA 3C39A 3RWOA 3UOWA 3QF7A 2FLVA 2RGXA 1FLNA 3I1JA 4JBNA 1INLA 3EZ6A 1CDOA 4Y1GA 1QRDA 2HC9A 3N6VA 3OT4A 2E89A 4LEIA 4G5HA 4IEFB 3C3CA 1M34E 1PCXA 2J59A 3D6AA 2R7KA 3RSFA 1LI5A 1ESZA 2FG6C 2F9LA 1EFPA 4G5FA 5IHXA 3OZTA 3ZQ4A 2SCUA 3OE7D 3U40A 1J49A 1JQLB 2G25A 1LV8A 1FX1A 2XECA 3M1LA 1W0KA 4FYIA 4R51A 3V3KA 1G3IA 1WZIA 3BRWA 4GRAA 2COEA 4FE4A 4N82A 4CI0B 3DYBA 2RBEA 3LW8A 1KE2A 1JZTA 1JF8A 1WQ4A 3FROA 1PBNA 3WOVA 5LOVB 2ZBDA 1J42A 5EP3A 1A9RA 5CFLA 1GPMA 1DRVA 1YKGA 1C8BA 4NOLA 1KXJA 3BD8A 3MLEA 5B7NA 3QYFA 1CR4A 1E3MA 5H9WA 4B34A 1JFFB 2XCLA 3ONVA 3VSEA 4JC4A 2HA3A 2OKGA 3UC5A 1VL1A 3IBYA 2D6FA 1OJLA 2VWHA 4D4GA 1HORA 1OXXK 2Y71A 1OA1A 4GKBA 1S3GA 2OM2A 2PMBA 1J90A 3AHIA 1QQAA 7MDHA 4YJFB 1GZ4A 1NYQA 1JLRA 3GQVA 3RAEC 3S7ZA 4LE0A 2G40A 2X8BA 4QL3A 4MUNA 2RI6A 2YVUA 4IMJB 4X1KB 4F1WA 1O5OA 4YJKA 3FOCA 4W1QA 3ICWA 2VYVD 4D0SA 3ETJA 2ZXEA 4RU1A 5EQFA 2WM2A 3WG9A 3A7EA 3FPLA 4Z7JA 3SEZA 1GRCA 1NMSA 4ARCA 4LF4B 5FWXA 5BSVA 2PCLA 2QE7A 4M7PA 2O8BA 3CJTA 2PO5A 3EIEA 3C6BA 3HU1A 3KOUA 1VLQA 1GEGA 2HPZA 2X7XA 2ZBQA 3A4YA 1P7YA 3EVCA 4NYIR 3CLUD 1RYFA 4IUCS 1XMXA 4RZQA 3O21A 4EABA 2VO1A 1UP4A 4TZTA 4XFKA 4ZAFA 4D6XA 2NG1A 1I2AA 1AUXA 1KI6A 4K88A 4LXHA 1Z6XA 2CJPA 4KQJA 4FLEA 3W2IA 2AZXA 5HFNA 2FRXA 4EYKA 1OX4A 5K03A 5E8RA 4B3DA 4MLPA 2VC2B 4DM7A 1P2UA 4OKIA 4ZI7F 3I1YA 2Q21A 3I58A 3NWPA 4NJMA 2ZRIA 5B5SA 3FHLA 4BMOB 1KYVA 4K05A 1O0SA 3OF2A 5EKTA 4HQOA 4JDUA 4R3WA 4X93A 3WYEA 4J6EA 5M5BA 1Y3HA 4QPZA 3L7KA 3IKTA 3Q85A 1VFPA 1JEOA 1YBAA 3FAZA 2Y0PA 1U90A 4HR7A 3DDNA 3QVJA 2YV5A 4PM4A 3TUZC 1JR6A 3AZOA 3SI7A 6LDHA 3CGWA 2VDVE 1LLFA 3KLOA 2QU8A 1ODLA 2P5SA 3AW8A 4CCSA 1RHJA 4FFOA 3U4CA 3E15A 3RGWS 1GOTA 2B61A 3AESA 1SGWA 1KO7A 3GRPA 1HT2E 1F6BA 1W8DA 1GA6A 2AWNA 2R2AA 4BV2A 2QUKA 5HJ5A 3GAFA 4L5YA 1GQQA 5JASA 1S8OA 2OBBA 1EFUA 3KBOA 3UOAB 3KTAA 1X3LA 4FR5A 4Y0VA 1F8XA 4C2AA 3BE4A 4XFJA 4BGVA 4CVNA 2I2WA 2J3MA 3ASUA 3G49A 3AIOA 5DK4A 2OUIA 3M1YA 3R76A 4DJFC 1MV5A 4U8HA 2UUCB 3R3UA 1SAYA 2PGAA 4HK4A 3VKWA 4YRGA 4HDSB 4TLEA 1F14A 3DC2A 4J9VA 4RHUA 2I03A 3IMEA 4TKVB 4MUFA 3W77A 1A97A 1CQJA 3R5JA 2CE7A 4KI7A 3B70A 4CF3A 5BN5A 1AKTA 3GZNB 3I6ZA 4E13A 3PUVA 4Z4QA 3L07A 2BPOA 4MYDA 3EC2A 1TA9A 1HSZA 1AQIA 1QIFA 3A4MA 4X6LA 4DLVA 1YL6A 2SECE 1QOQB 3K1ZA 1NBMA 2QMYA 5CAEB 4D9CA 5LP1A 3QKTA 1L5WA 3IALA 4MV4A 4BQSA 1F4LA 1RXCA 3DOUA 3ABQB 1BQ3A 2Q2QA 2FP4B 3GUZA 3L0IB 3MAJA 2AQ8A 3NYRA 1KKUA 3BCRA 4LGYA 5E38A 3U7RA 4YAOA 3ELWA 3DGEC 2H4YA 1QM5A 1L8OA 2B1RA 4A8JA 1CF4A 3CVXA 1MH1A 2GPAA 4BEWA 2YZ2A 2ZAMA 5K0LA 1ENOA 5IT5A 5FL3A 1TVKB 4HDOB 3VR1A 4RFSB 4KGDA 3NM4A 3VO1A 3JS5A 3TTWA 5L95A 1I6WA 1DIAA 2RGBA 3W2EA 2Z2JA 1FRNA 4G0PA 1Y5LA 3IIMA 1RJ9B 2A9OA 3KZMA 4YCDA 3WLTA 3TAHA 2P0AA 5JXGA 4WQMA 1I1HA 5CB4F 5LMNB 5FD8A 2RHCA 1AHHA 2FEPA 4TV8A 3U48A 4QM7A 3JD0A 2JJYA 3RIYA 2JFNA 2NU7B 4LMAA 1E2LA 1Z6AA 2HRZA 1RJDA 2P9QA 3DB1A 1LBIA 3ODGA 5ITVA 3D31A 4QATA 3ZY4A 1U2PA 3N3BC 2AB0A 3HACA 5K09A 4KN8A 3NEJA 2B83A 4NZYA 5ENVA 3OAAA 1R37A 1X1RA 2XTAA 4OP1A 4QA9A 3SDBA 2KSQA 2HIGA 4AZ0B 2AQHA 3BILA 3TAUA 5EHZA 1AQ6A 1MG5A 4DGSA 3DOJA 1AQNA 2REQA 1CUYA 1FNBA 1VG9B 1EG2A 2I7VA 3CT4A 4XD7D 4ZOBA 4DJTA 3HFGA 1Z63A 1MC1A 1D2GA 1NXPA 1SG6A 2ZJ0A 3H2KA 5KTSA 2CMKA 1TD1A 2WMDA 3GCXA 3OLQA 2EVWX 3QF4A 5D8DA 2BL4A 4IVQA 5LNK6 1RHRA 1HWYA 1O0BA 3WYCA 5B3AA 4G36A 3ROFA 2DPGA 1KERA 2G6BA 3RFUA 3U9SA 1W0CA 3GELA 1MV8A 1CQPA 3TB6A 3DOEA 3ZE8A 3MD9A 2W2VA 3NVAA 4QYTA 1VA4A 1QHXA 5FHRA 1EGQA 3CQ9A 4I4CA 1OILA 5TX7A 3LO8A 2R86A 5F52A 1KOFA 1DUSA 3UUEA 2ZAGA 1QS0A 7YASA 2GAIA 3M9XA 3ER8A 1M83A 3GN1A 1P9OA 1K68A 1JDUA 5A71A 1Y8ZA 3R6LA 1FNNA 2I65A 4MYHA 1LWNA 2JANA 1MQ8B 2YZ7A 4BFZA 1L7QA 3C98A 1JKFA 4NMMA 3WICA 2BE9A 3BIWA 1UAYA 2L42A 2P6UA 3QXHA 1EFRA 4XUEA 1ULBA 2FXIA 4FFSA 4MP3A 3PDIA 3V4VB 5AVQA 1HYQA 3JD3A 3TO5A 3AI3A 5KYUB 4X00A 3MELA 3PZRA 3QOXA 2O5EA 1GAXA 5JPCA 3GNLA 1MNAA 2R6FA 4FKZA 2ZUCA 1X74A 3HFRA 4BYMA 1R4MB 1H6CA 2EFHB 3OO1A 1CNMA 3V46A 3BD6A 1OWPA 5DF1A 4DMRA 4ZZ2A 5JS2A 1RBZA 1ZBDA 3H9UA 3HJUA 3DA8A 2CLCX 1Q15A 2AYYA 4JJ4A 2QX9A 5KB3A 3BK2A 5KOHA 3K53A 4W5WA 1XD2B 1QE0A 1R0CA 4KDRA 1AD2A 1U7DA 2Y3IA 3PENA 4UM5A 2F8SA 4F3YA 1C9DB 2H1WA 2SHKA 5A2GA 3QTBA 1CTQA 3WFIA 5F73A 3HP4A 2FRDA 2GZMA 3G9XA 4LDQA 1BU8A 4YXWD 1JHZA 1DC7A 3M4NA 4CETA 1QF9A 5ARDA 4IWNA 3K35A 5IVIA 2QVLA 1GRVA 2H5EA 2A1TS 3MWFA 3OPNA 4QOHA 4WY5A 3VO2A 1ZI6A 3Q8WA 1DAFA 2NWQA 2AZTA 2ZJ4A 3CX4A 1YVUA 3W5IA 2PZLA 3B3GA 3DAOA 4PCVA 3KOXA 4Z0HO 3TNJA 3W9SA 2EAUA 2Q0XA 1TVMA 1SHJA 4HZUA 1GG2A 1VHQA 3P2OA 3EGDA 2YH2A 1MC5A 1SCIA 3SK0A 1TECE 4MVJI 2QI9F 2ORYA 1E96A 1F0NA 1JNXX 2Y2UA 3OBIA 3QV2A 4FMBB 1CD5A 1LBSA 1TKCA 4WHMA 4D4LA 5AVXA 4X1YB 1ZGZA 4MEBA 4NCXA 5ENDA 1VXOA 3FLEA 1N9GA 3DZKA 1DQNA 3FB4A 4ME6A 5FIUA 3L0CA 5CDHA 1RJWA 3FFWA 2VLIA 3UJ7A 4Q4CA 3B7PA 4N6NA 5TVKA 3EC7A 1WHTA 3D6FA 3HZRA 2YINC 2ZUWA 3V7WA 5FBQB 2F1IA 1T2UA 2G6TA 1WB6A 2VKQA 1PJTA 3K9HA 3EJ6A 3REOA 1NBME 5CXQA 3LC7O 3VR2A 2RH8A 4NNJA 4W5NA 3LY7A 3F3KA 1X1EA 2AOXA 2XUAA 2JAHA 1NI4B 2TMKA 4DBLC 1COWA 2NLOA 5EIBC 5ENZA 3TLGB 3UZUA 5C1DA 4YMLA 4P6VF 1TZBA 3GRUA 3W8RA 1H9CA 3DLIA 1IHXA 1NVWQ 2QZ9A 5E7QA 5EHQA 5HF9A 1JQAA 1BKYA 1KA9H 2OAEA 4BC0A 2CL0X 3M5WA 3ZHVA 3VPGA 5E4FA 3BHIA 3L7JA 1T0JB 4PSDA 1HUQA 1TW3A 2QTTA 3Q6MA 2RGUA 3G0DA 2EX1A 1P5HA 4X45A 1HFWA 2ZYUX 4DV3B 5F7XA 2PXXA 4KLAA 4J0GA 3B38A 1W4BA 1SBYA 3R8FA 2YZGA 4BO7A 1PBTA 1NW9B 2CYCA 1TQ8A 1IXRC 2Q6KA 5I9SA 1QWOA 3TLYA 3UT0A 2FN8A 3F2IA 1F7UA 3EXIB 2QUBA 3A10A 2DPXA 2YICA 4DY4A 3DWIA 3CRVA 5DGXA 1HE3A 4HGNA 5H7XA 3JQBC 1YDGA 1S2LA 2ET6A 3UAZA 4C0BA 2OK8A 1M1ZA 4HKTA 1J25A 3EF3A 4E94A 1G3MA 1BDHA 1B2LA 4YP6A 1UM8A 3HKCA 4BX8A 4KITB 521PA 3B1ZA 5IULC 1JIUA 1HTBA 2B5VA 3IO3A 5HKOA 4IX1A 3EBLA 3NWJA 1T5DX 1NVDA 3ROTA 3U3KA 5C3MA 1HYGA 1QTRA 3ZZNA 4AY6A 3SBOA 2O6LA 1U3CA 3HNPA 3M2PA 4CKWB 4CEJA 2Z4RA 3OZWA 3LLVA 5HTOA 3VZQA 2CJYA 4QPNA 4ZZ3A 5HR5A 1L9KA 4CLHA 2LIPA 2F3QA 3OJLA 2BLLA 3GLHA 4KV9A 4Q9LA 3LFTA 4FGJA 2Y1CA 3MTJA 4OGFA 1CUFA 1VCNA 2BJVA 1MJNA 4DIMA 4P08A 1KEUA 2HAEA 4XDGA 2YFHA 4CM6A 5ESDA 3OIFA 1TDJA 3DJYA 5AI0A 1GLGA 4EHNA 3U56A 5T6BA 1OWOA 1JHQA 1B0UA 4IUBS 5BYKA 1XSEA 3CUSA 3FSJX 4DCGA 5JZBA 5B64A 1EAMA 1CY7A 1XHLA 3BGWA 1X1DA 3KT3A 3IUJA 2X5XA 1YZ3A 1UK8A 2XB8A 2YN2A 2ZWIA 1EA7A 1OXMA 3GGGA 5LSAA 1OAOC 2JIDA 3W6ZA 2H1SA 3A9VA 2B8TA 3SY8A 1JXAA 1Q0SA 1QMGA 1ORDA 2V96A 2NACA 4Z9BA 5JAIA 1HV8A 4XWOA 1ES9A 3GGCA 3JQRA 1H66A 1KMCA 2E1PA 3FUTA 1NATA 4RL6A 5CDUA 3FVQA 3HS3A 2IOFA 4MV9A 3WJ1A 1Z4PX 4UTXA 4GF5A 1Z9BA 3MGKA 1PWEA 3M9LA 4QTXA 1L4NA 2G17A 3BWBA 3GNTA 3KWFA 4QXQA 1KJIA 4UUOA 1SCAA 3QPAA 1JFLA 3E70C 4L8VA 5BVGB 4BE9A 2CJXA 4BXOA 1K08A 3L1VA 3ABSB 4RE6A 3TJZA 3EXFA 2XNSA 1QGED 3PUXA 3IDAA 5EGSA 4WH0A 3KAPA 4EVSA 5KSYA 1JTEA 4FJ2A 3HYTA 3U3JA 4KRXA 3PF8A 1Z5NA 4LC0A 1GD1O 3BL8A 2QBYA 1DKLA 3PC8C 1BDMA 3FTCA 2EG9A 1PJLA 3G79A 1CY4A 1VIDA 3MERA 2IJGX 1GLNA 1GR0A 3IP5A 3L8YA 3PXDA 4FCCA 5GOTA 1IUKA 4P35A 1BCRA 3ACCA 5DMXA 1UFVA 4RPGA 1JNYA 3VU0A 4J0EA 3BBPA 3TF5A 5TT0A 3LDGA 2XNCA 4MQEA 4FZJA 2X5OA 3B8EA 4O1IA 1M6HA 2IBMA 5ILQA 1GZVA 3CYFA 2JVIA 4RTRA 4LOAA 4EMBA 1Z0UA 1UF9A 4KBFA 2J5RA 2I76A 4KIWA 1NE7A 2XF8A 4IOLA 4EJ0A 4P31A 2GUWA 1RJGA 5LZ7A 1MDFA 4OUDB 5GVSA 1V5EA 1SB9A 2C4MA 4QPDA 4QO7A 3DVAB 2WAOA 4EPXA 4TKUB 4KQXA 2ZZKA 3RVJA 2C9OA 5JJ5A 5DOZA 5C8YB 2NUTA 5KYTA 3EGVA 3OFVA 5FUYA 1JV2B 1X8JA 1P29A 2PK3A 4ZALA 5B2ZA 3FDIA 4EKDA 1KSGA 3FMPB 1YCFA 3B51X 3K8OE 4D92A 2PUCA 1BJRE 3AHDA 2I7XA 4KEAA 1PNTA 4TV8F 4A5OA 4Z4CA 3RTDA 5J9FA 3MS7A 1X19A 4EQZA 3F3SA 2AC7A 2AXNA 1LF0A 3R5TA 1P31A 4PBRA 3V5NA 3E9CA 4V39A 2BSXA 1KEZA 3QLUA 4R9NA 3IQXA 5DFAA 3HNRA 2HHHB 2AEJA 4DUZB 2MMGA 5DZSA 3W3AA 5LBIA 5B55A 1U99A 3PNKA 3L84A 2BONA 2Q5IA 2Q5OA 4N3GA 1B14A 1W52X 4Z4EA 1KDRA 2RHTA 1E61A 3C3MA 1FBTA 3DWGA 3KDSE 4B7CA 5AFSA 2H4HA 2J32A 1AK1A 3I01M 3LKVA 1J99A 1MLDA 2P9JA 4D74A 3JQAA 4D0LB 3UMCA 1Y1PA 1RCTE 1EDBA 2P69A 4Y2TA 5JJLA 4QU5A 1KVRA 1YQWA 4G2TA 1YRYE 1W49A 3C41J 4XM1A 1R18A 1ZY2A 5HA5A 1UWVA 3D59A 1NOIA 3EVZA 5CT8A 1ESNA 3DTTA 3LX8A 1I4LD 1PR6A 2O7SA 1AF7A 3PRHA 1IEVA 4JYPA 5IM5A 4MWBA 3RT1A 4YRIA 5BV2P 3M34A 3NT2A 1FP7A 2CEAA 1J2RA 1JEQB 2YZNA 2HV8A 3F7TA 3VTFA 2QD2A 2OVBA 1MX9A 3GLHE 3LQ1A 4WZ6A 4ZK6A 5JNTA 4HBGA 4BAUA 2YNMC 5E6RA 1MRZA 3AQ4A 4R01A 4LGMA 1VIMA 3NVMB 3CU5A 4EHKA 5JFGA 3T5GA 1L4BA 2CLEB 2CUNA 4BO1A 1V3VA 3KAKA 3OM9A 3FIUA 4LCEA 1NFFA 4YUWA 3EZ2A 5BPFA 1FP4A 3LH5A 4MWDA 4QXMA 3N7AA 2X9NA 3QZUA 4KWHA 3ICPA 5AP9A 5BW5A 1H94A 4XX0B 3LBHA 5D5HA 3K0HA 1K2VN 3R3ZA 4EHLA 1EKXA 4ZVOA 4PG7A 2VH2A 1P7VA 2C2OA 1HG0A 4GM0A 5K0GA 2CDAA 1OFGA 3G5AA 4QLAA 2YQ5A 3BSYA 3EWIA 1SQFA 4MJ7A 3ZWMA 5AHOA 4GBJA 4E5PA 2B7BA 3ICOA 3QOYA 4MV8A 1O8CA 3AONB 2HA7A 2W11A 1R9GA 3E9ZA 5F5LA 3KPVA 3EMKA 4LOHA 4EG1A 1RWWA 5FA8A 3AB8A 1Y3FE 3N8KA 4OU4A 4EI2A 3WSTA 2F43B 1B0AA 1W4CA 3FYUC 1NJFA 1D4AA 4K3VA 4QOIA 2H8GA 3HB5X 2IY9A 2IXDA 4TTVA 4IX9A 1ODJA 3IQWA 3SS8A 5B4UA 4FDMA 4QDOA 3Q9UA 3S4YA 1CUDA 1U2GA 1V8PA 1I33A 1Z7BA 1ID1A 1NM5A 1NXTA 3ENVA 5DDIP 5FTWA 1YS6A 1T8TA 4C04A 4CFYA 2LV8A 3ECCA 1GPBA 1P1IA 1P4RA 4RK6A 4DCVA 2YJ5A 3HJGA 2VHTA 3C3PA 5H70A 4PZDA 4B84A 1N4DA 2W6CX 4DWOA 2ZUVA 3MWGA 1QWSA 4R3UC 3BXPA 4JZYA 4EVQA 1DQSA 1LBEA 1BQEA 4ECAA 1CRZA 4ZGWA 1U28C 2CXOA 1R88A 3G0CA 1WKVA 2ZRMA 4B6GA 5EUCA 4P0QB 1DBSA 1LPOA 2AW3A 2CXUA 3OP4A 4ID9A 3VNBA 2O2ZA 4YV0A 4G26A 1XNRB 8MHTA 1XZNA 4NBKA 3L02A 5DI9A 5DE3A 2R8ZA 4R54A 5KNCA 3AG5A 4GNKA 2J7PA 1X14A 3FBWA 4KIFA 5TQVA 1TQ4A 1E2HA 3F67A 3IUNA 1E2IA 3PUYA 1GA1A 1WPQA 2V8OA 3LC1O 4KR2A 4E70A 3N28A 5DM2A 5EVCA 2XCOA 2Y9MB 2ALJA 5HILA 3N2ZB 1JQKA 3EIWA 3NHKA 4GZ3A 4NJEA 4XB2A 1L8XA 1F20A 2ZIXA 3O91A 1FLDA 5EUMA 3AOEC 4LF6B 2FPLA 1NMXA 2GBIA 1T4DA 4BC1A 2PQ0A 4LNUB 3H9BA 3EEQA 4L95C 1WJGA 1Z0DA 5H3LA 3EASA 4BMXA 1Q57A 1N2GA 1TAHA 1XF1A 4R2WA 3SM9A 1EEXB 3T0GA 4POOA 1P4GA 1WXEA 2AFRA 5KOJB 1FIUA 4B2YA 3VPXA 2XTZA 4W5QA 3LSYA 3N5KA 3E82A 4RLFA 1L7PA 2VUHB 1CJTC 1RRMA 3HXLA 4FMCB 1R0WA 4PYKA 1E2GA 1Y7PA 4YJGA 4EY3A 4CEHB 2JHAA 3TZCA 4OJYA 3ELUA 3IAS1 3AK4A 4RAOA 3TRKA 5KQRA 2ZYWX 4R16A 3T0IA 2EDAA 2VHQA 3OZXA 4QLBA 2GHRA 4FOSA 4BKRA 3SXUB 1J2TA 1R10A 2IE0A 4TTQA 1LRLA 1VIVA 5IDVA 1ABBA 5T4HA 5AHKA 1A9PA 4MDYA 3D64A 1GGMA 2VDOB 3FRIA 3Q7SA 2H2DA 2R97A 1AVTA 4LJ8A 4PZYA 1JDTA 3KDAA 1ESMA 3KSRA 4I5EA 3RUPA 4A1OA 4PLHA 1S2OA 2JD1A 2QUJA 3EDRA 4WFIA 5ITWA 1J8DA 3A3PA 1P73A 1RKQA 3CS3A 3QX7A 4KUGA 4MHSA 3Q7RA 2GUGA 3HJHA 4I6JA 4MMXB 3M5DA 1M67A 1O87A 1ZEJA 3B12A 5AI6A 3Q7PA 1ISSA 2IEYA 3L1HA 3MUOA 4F1JA 1Z08A 1E9VA 2IUYA 3PXAA 4GEGA 4WLVA 4LTMA 1SUCA 1QLJA 3SZUA 3WV5A 2PG3A 4AWAA 4DNQA 1GM5A 4JYZA 1J21A 2VDWB 3TRJA 4QGSA 1WQ3A 4N3AA 2OFWA 3F6PA 3F96A 1EVEA 3OHMA 4MOWA 4C3VA 1VPWA 3AX6A 1F8YA 3OT5A 4I8XA 4UNQA 3VNAA 2IHTA 3CNEA 3QNMA 3D6TB 3SPXA 4BBAA 4DTIA 4ENPA 4Z51A 1T5OA 3OMLA 1OC4A 2J46A 2JGLA 1ESCA 1YUBA 2QN2A 3NEYA 4J16A 2IS4A 1ZUNB 3O1LA 4E21A 3O4JA 1NVVR 3D8HA 4DTCA 2J4CA 4MP8A 2RBKA 4F72A 1XQYA 3LK6A 3ZWYA 5F1KA 4IJWA 5CFZA 1TRKA 2FLKA 3Q9LA 3DBRA 2RHMA 5KQLA 3EDQA 5CB8A 5JNUA 2B5WA 1E94E 3CB2A 1OBVA 3BG5A 1G2QA 3K4HA 3IGFA 4FYXA 4OHRA 2V45A 4PNZA 3T06B 4WLNA 3WMFA 4JP8A 3UB4A 2GXAA 2F00A 4ZO7A 5DU2A 3ZGLA 3TZHA 1DLJA 3EBPA 3NHSA 2GF0A 2KMLA 2BTQB 3DTVD 4CKYA 5EI5A 1Z6ZA 2QN6A 2H0RA 3Q72A 5AKHA 1U7HA 3ROPA 3FA2A 1SUPA 3QFTA 1P1RA 4OX9B 5SV2A 2QIPA 3R0ZA 4FCWA 2DT5A 4CM4B 2IT1A 1ISJA 5DRTA 4NBNA 4NG5A 2AMJA 2MSEB 2FH5B 4OJTA 1PUIA 3LWBA 4GM4A 4PAOA 3IAXA 4DPLA 4ADSG 1AKWA 2V4MA 5LXTB 2ZTLA 4ZU6X 5LB2A 3U3DA 4EKIA 5L51A 1V3UA 4N48A 1E6MA 1H0KA 1LZKA 1TF7A 2OLKA 4HLCA 4X1OA 1ZM2A 4I9GA 1IG0A 1Z6GA 4RXMA 2W5UA 2XJ9A 3G7NA 4WGFA 4LZWA 1KTIA 3H1AA 4G89A 2QOEA 4O4LB 4PAMA 1XC7A 3SR4A 2HO5A 4AZWA 3O8OB 3OLCX 4M88A 1QHEA 1UZAA 2AN1A 2P6NA 2WD8A 3LUKA 4L74A 2JC3A 1QQ5A 2G28A 3BH0A 3JX9A 3Q3HA 1UBEA 3QG5A 4FK8A 1N5DA 3KYDB 4KXVA 5DEIA 3UMRA 1ZSYA 2V7QA 3O4IA 1L4UA 4EX6A 5KVAA 4M9CA 3VMFA 3OJEA 4MYRA 2XRFA 3ZLVA 2I99A 3O03A 4WOBA 3EPKA 3CVYA 3V1YA 5FUWA 1GU1A 2PLRA 2Y0CA 5ALTA 3W5UA 2C3MA 5TR9A 2W4IA 2HRQA 3K1AB 4BO8A 2BGIA 4FOTA 1LVHA 2RGDA 1T91A 2ZTMA 3NNSA 3C3AA 5F7ZA 1YRWA 4MAFA 5EXSA 5BT9A 4AZ3A 4DIBA 4PVCA 3EOAI 4YDRA 4C06A 5ADUS 4QAJA 1O9BA 3EHDA 4C21A 3UGKA 2MINB 4U9UA 1LK5A 1NUTA 5DNDA 3T1NA 1SUEA 3UG7A 1ULUA 2MWMA 2FY8A 5K2MA 1RLTA 1YBHA 3K0BA 1UAAA 4J75A 13PKA 1CUAA 3IILA 1GZUA 2E55A 1PQUA 3E18A 4V2IA 4O59O 4ARZB 3QLJA 4G09A 4JQSA 3JAWA 1ZJZA 3HUFA 2ZK7A 4REOA 4JB3A 1N4AA 1E9RA 2JZCA 4TMXA 1S4MA 5DYTA 4Z2YA 4IGFA 1QKJA 1T4CA 3L6DA 2PJUA 4M9XA 4D1YA 2AMLA 3E2IA 5C34B 3ILVA 2GJ9A 3MEQA 1X7GA 4GBMA 4JOCA 1DKOA 4RV9A 4BZZA 5C2JB 3L7AA 1J0EA 1K66A 2TS1A 2D62A 4RK7A 4LWOA 3H6KA 3O5AA 4UUNA 3U7GA 2PUGA 4KYUA 4EB8A 3G6KA 3AF2A 2FN3A 2HV9A 4ETMA 2BMJA 4MEAA 5ALVA 4GWGA 1WE2A 3C6XA 3EZ9A 3HVKA 3FTNA 4NE7A 1B6RA 3U7JA 1E1QA 1IB6A 1ICEA 3A6LA 3UHAA 4ANFA 1BFUA 5HZMA 3JSAA 3KJGA 4RJLA 3LCRA 4ZCMA 1E2NA 1JRLA 4H31A 1JZQA 4O2BA 4CIDA 1XCLA 4CGZA 3AF5A 5A4IS 2B1IA 1UZMA 2I78A 3L7OA 5CU7A 4OATA 4DEVA 1OBFO 3HB0A 4D02A 4RLHA 2QJOA 3TNYA 3X3HA 2ZT5A 4LZPA 4DQDA 4BB6A 4LUCA 1QVWA 1VZ3A 3GEPA 3W2FA 5AHWA 4X8HA 3TDNA 1DJLA 1G42A 1GA4A 2HT6A 4K81B 4YPFA 3UBMA 3FMGA 3MQ2A 5EJEA 4QUKA 4EB3A 1J8QA 3NHZA 5KHAA 1QUFA 1CFJA 2UVPB 4L6CA 1C9MA 4U9HS 2O3SA 1IHUA 1IDN1 3R24A 4AM8A 4ER0A 3EDOA 4UBIA 4FNAA 4E0BA 1QO7A 2ZSAA 3SBDA 3ADKA 2VI5A 1E5QA 4XGKA 3VNQA 2D0IA 3QVMA 1X80B 2CMHA 4D82A 2HX1A 1G8JA 5FBHA 3GVXA 1Z2NX 3OJOA 2GZSA 1DCKA 1E7QA 4EI9A 3I5YA 5F21A 1CDZA 2FUNB 4QEKA 4XYMA 1ISRA 4ND3A 4B71A 5IK2D 2I3GA 1UBFA 1LVGA 3EQ7A 5EWJB 5TJHA 3ROZA 3MCZA 2QM7A 4ZVQA 3O90A 1R0XA 2H2GA 5JSYA 2DFPA 2ZQ5A 4ITUA 2DFNA 2BVNA 2GCOB 4J1QA 4OP3A 3GT3A 4B5LA 2R8PA 4F56A 1VC2A 3T8YA 3VAAA 3KQKA 2PMDA 1ZK4A 3C7KA 2FQ1A 3OQPA 2H1OA 3ZDAA 3IEIA 1NBMD 3B1XA 3CEJA 3OE5A 3DMHA 3FSGA 2E4WA 1PJRA 4KZKA 4NU0A 1QZUA 1N6OA 1R5OA 2G06A 1RWKA 3I45A 1N0HA 4LRQA 4YI5A 1MX1A 2ZULA 5A0TA 1CYEA 4RMIA 3HXKA 1ZOLA 2I33A 3DKPA 3WFZA 2PT5A 2HUPA 2IUFA 5DXJA 3O8CA 4BGEA 3LVBA 2WK1A 2WAMA 3TM5A 3WI7A 1Z5GA 1H2EA 2HJHA 3DP9A 1WQ1R 4HO1X 1RI2A 2CV2A 2VKTA 4IMRA 4TMYA 1B43A 1Y34E 4BQFA 5D3QA 3UXMA 1YL7A 4BCDA 3E3AA 2WTMA 5KNDH 5BWBA 2KQUA 2PS3A 4HEQA 5GONF 5HMLA 1R74A 5DHSA 4DE5A 4H1VA 4Q9DA 2Q3MA 3C3JA 1QBGA 1WNTA 3D3NA 3HLTA 4HLQB 4KE8A 2W6JA 4ZANA 3WLRA 1PSZA 4DLYA 2AF3C 2QNRA 1QYIA 2HSEA 2YZKA 4P3NA 5HDQA 3UA3A 2VUIB 1XF9A 3RKSA 1N34B 3GXBA 2XDQB 3HYCA 2I2AA 5IUJC 3G2LA 1P45A 3JATB 2CJWB 3TD9A 3QVOA 4UHFA 2RIRA 3N0XA 4MVYA 3UKDA 4EX7A 1NYRA 3EOBI 3WGZA 4DXHA 3NPMA 4QSHA 2XOEA 3TEMA 3KETA 2P11A 2DGDA 3ZOZA 4EW1A 5C0OE 3HJAA 2A9KA 3B1WA 3D3JA 3FOWA 3D1LA 5KKAA 1APBA 5AM4A 2Q28A 4FZVA 3AY3A 3QIVA 1X86B 1T3TA 4JGIA 4UEQA 2BEUB 2EU8A 1E99A 3W05A 2HA0A 4IG4A 4DHEA 3O1HB 2ORVA 5IDYA 3VHXA 2C96A 1DDGA 5ARCA 1FPQA 3BAZA 1H1LA 2PXHA 1VE3A 3ZU4A 1KWGA 3FTFA 1M6VB 3BGOS 3CBGA 3K1JA 4NZZA 3U7QB 1EK1A 3ORQA 4AU1A 3B85A 4DLRA 4EB6A 2D2EA 5KU7A 1ZESA 3ZWDA 4DMGA 2HMYB 1V9SA 3QPCA 3RT9A 4ZRDA 3CRMA 5LYJB 3GCZA 4BOYA 3BDIA 3LUAA 2ZYRA 3A1NA 4BNVA 2C5BA 4C6RA 2BR4A 1QQ6A 1EXVA 2YKGA 1N9KA 2BH9A 4IXDA 3USCS 2BYTA 2NVUB 2AE2A 5EG5A 2R5NA 1CT9A 3HJFA 4TRMA 3KJEA 4LF7B 3MS2A 4O4HB 4AKGA 1KFKB 1T8PA 1ULHA 2XUHA 4QQFA 3TW8A 3O82A 4OL9A 4N40A 5J5CA 1EXMA 1V11B 4F2HA 4UPEA 3GJ3A 4L6IA 4YO7A 5CEEA 2HJRA 3AP2A 1UR5A 4HWSA 4H27A 5J4KA 2O3TA 1TE2A 4QU9A 2XODA 4PAQA 2J85A 4Q4JB 9LDTA 4FCVA 4HG2A 4UVGA 3DL0A 4XTRA 2NXJA 4XCQA 1V26A 3IUMA 3KHTA 1Q0TA 4QOJA 4YN3A 2ACKA 1UBSB 2IYEA 4BJ1A 4EUNA 4JJFA 2VTDA 4ROTA 3H18A 3KYJB 1Z56C 4V3BA 1WZNA 2JDID 3D8RA 3GMDA 4BNYA 5MDHA 4PZ0A 1MABB 4ITVA 1NL3A 3A36A 4TLAA 5CDTA 2C2HA 1DKQA 2W2MA 3REQA 5CBKA 1FFSA 2W42A 1MZVA 5EIHA 5C1OA 3DOIA 4HFRA 1G291 5T4FA 4OGGA 2Z6VA 1G20B 3V4PB 1BKSB 4NYJR 3HVHA 1QHHB 1T6XA 4FZ5A 4AJ1A 5HYVA 3GNQA 3ZNQA 5H4HA 4RK5A 1PTJC 2D3WA 2PL3A 2V59A 3I34X 2BFEA 4MV0A 5E2AA 3QE0A 2H1HA 1O94A 1XNHA 4XVUA 4IUYA 3WK7A 2WD7A 5B58T 4N0QA 1KK3A 1Z83A 3JQDA 1SU7A 3NLLA 1U6JA 1R4NA 1X1QA 5F51A 1PD1A 1QE3A 2QTBA 4QIHA 5CDGA 4M89A 1JR2A 2I9PA 3UMGA 4RM2A 1HGXA 1YDFA 3ZUPA 3U61B 1EINA 2R85A 4QTTB 1Y9EA 4MRMB 1X7XA 4M8NE 3T52A 2NM0A 2XA9A 2XSZA 3WGLA 5M29A 1Z4KA 1G66A 4OOEA 5BSRA 4TTAA 1JILA 5IZ4A 2PS1A 1O77A 3D54D 1IXKA 1CUZA 4G23A 2XD4A 1IJFA 1JKJB 1TVEA 3IC5A 5FLEX 4D0NA 1V5GA 1XP8A 5AK0A 4ZYWA 2DKNA 2ZSHA 5L7WA 2FP3A 3T4UA 4IOJA 3M7IA 3RO7A 3VR2D 5CIYA 2X15A 1D2MA 5JXIA 5KPJA 2XKKA 4K28A 3DOCA 1PL8A 3DD1A 3IIEA 5AOAA 3K94A 3EXHB 1I3NA 1YBFA 1OLXB 4A23A 2Z9DA 2JPDA 3TVYA 5JDCA 2PRJA 1ILEA 2IV3A 4N5NA 4ZU1X 3NHAA 2DTEA 4I50F 1ULAA 4HB2A 3ZVKA 4HXFB 1G3UA 1W8IA 1XVLA 1ITZA 2E87A 4LYFA 3KALA 4Y2VA 2RFLA 2P68A 4RNCA 3AT1A 4ERXA 5TMPA 2XEXA 5LJIA 2IS1A 3K0CA 3C2QA 2P4QA 4KLCA 4UE2A 5JNWA 4GL2A 1ZA1A 4A10A 1KH1A 1M8GA 4DRYA 2O06A 5F4BA 3AQIA 1W36C 4OQLA 3SOZA 1RPZA 3FPFA 5JAQA 5BPHA 2PX4A 2W6ZA 3LNCA 1Q95A 2ACWA 3KZXA 3QHQA 3K70D 4M86A 4CQNA 1DC8A 4B8WA 5ECDA 4ZDIA 3RUFA 3PHGA 3C6KA 2DR2A 1U0NA 5JJIA 4QDXA 4K6KA 5B3JC 1C8KA 3IEMA 3U0VA 1NLYA 2YMMA 2Z3ZA 2VNAA 5JC8A 4BEBA 5AVWA 3HL0A 2EGUA 4H7DA 1QKKA 2GM3A 4FR0A 4RHEA 4RVCA 4KOEC 5CP8A 2Q3CA 1QGYA 2JEZA 1CUSA 1LI7A 4ITRC 3I4CA 3FJ1A 4EJ2A 5E0KB 3V48A 1K5DA 3DZBA 5LDGA 1AF4A 1NJ2A 3MCVA 2Q0SA 2Z1DA 4K03A 3DM9B 4U2DA 1FRVA 4EUHA 3Q0EA 2BEJA 3D43A 2IY8A 1ZN9A 1GTL1 3T1HB 3C3WA 2CXRA 4EJ6A 4HT3B 3MHTA 1IN1A 3CY6A 1W93A 3DEIA 4Q16A 1T0BA 3UENA 4ZJYA 5TIIA 3CH7A 1QK4A 2YBEA 1F0YA 4MR9A 3RASA 4BLSA 4DAOA 3E9YA 1W7AA 4F3KA 2XXAB 1XR3A 1IPHA 1R6UA 1CEEA 2C58A 3TWOA 1BE8A 2H2IA 3AEZA 4FKMA 3DEFA 2D5CA 1M2KA 4WZBA 1O9GA 3AEQA 1O4WA 4DT1A 4YRNA 1T1EA 2B1GA 5SZKB 1TVCA 2H29A 4RMJA 3KIPA 3W6UA 2O2YA 5T41A 4QFMA 2Q5JA 4O2BF 3AHHA 4P34A 3JYOA 1TJNA 2OYSA 4PQYA 1W75A 1KSFX 3I2GA 5JO0A 1B23P 5FOVA 4ID3A 4YCNA 3LXXA 1DEHA 4HDMA 1ZU4A 1T2CA 3A27A 3GW8A 4B87A 3E35A 1SC6A 5TGTA 1IJKA 2YOGA 1O96A 1GITA 1Q1ZA 1N3IA 3NJRA 3EA5A 4Z99A 1J5EB 3ONDA 3ZE7A 3H1TA 1IVSA 5I9NA 1Z4LA 5EE1A 5M2QA 2BDUA 3JYPA 1WV0A 2FETA 1E9DA 2PUBA 2KS6A 1AXRA 1DIOB 1H5QA 4MKFA 4UW9A 4ATNA 2R7MA 5G1NA 1J4AA 2HRDA 1YI0A 3AUYA 1L5GB 3U6KA 1OZAA 1L4MA 1TJ4A 2J09A 1RHQA 4NXMB 4PZZA 4EPTA 3B48A 3K30A 4GICA 3N74A 4E46A 1BQ4A 1JBKA 4CEIB 3B53X 4JYBA 1AKEA 1F8FA 1P6XA 2PZAA 3RIXA 4BQQA 1YB6A 3TQFA 3KSAC 4EZIA 2EFGA 3H2HA 4RGVA 4LJRA 1A82A 3AHCA 2JLAA 1G1AA 2ZB8A 3OESA 4H59A 4HCJA 2XMRA 1XPRA 3RTBA 1UJ5A 4XD2A 2J6CA 3NJ8A 3G5TA 2GEBA 3JQ6A 4PZCA 2NTEA 4Q7KA 3DEZA 1M8PA 2NTNA 2MT9A 2X77A 4NV1A 5HMMA 2BT4A 3RYIA 4EGFA 3BHNA 3S2SA 5A03A 1U8ZA 3HYLA 2IZ0A 2V0GA 3JWJA 3IAFA 2G67A 2ZAYA 3EIOA 1K6EA 3PI6A 4MRNA 2E4ZA 3JARB 2I91A 2Y0EA 4YMGA 5DM1A 821PA 2WWXA 1EFKA 3AFHA 2VXOA 3FBGA 4MRAA 3N8HA 4DMMA 2XB9A 2GEUA 2VRBA 4NXNB 4HQRA 4G5SA 4HGPA 3QA9A 3SJBA 2XNDD 1SUIA 3B1JA 3FKSD 5LBUA 4E6PA 1E0DA 1TK2A 3TIIA 2BFNA 3KE9A 5CG2A 2VJMA 3U16A 4QU8A 3BQ9A 4F6LA 1U7ZA 1OSNA 2OORC 2QQ5A 4MW0A 3UK0A 4V1CB 3C14C 5MHTA 3BXXA 1HQKA 2XWSA 1OFIA 3JD4A 5EYPB 1YUMA 1N6IA 2GM9A 4KKVA 1JG4A 1N2XA 2ZWPA 3DDCA 3PFNA 3BMCB 1EVKA 5AH0A 2QRHA 1H1TA 2LPMA 3O8DA 3OHPA 5AJWA 4GT1A 5DIZA 2GESA 3QUCA 1CVRA 1L7RA 2OWEA 3M0EA 4E08A 4ZHQB 3KQWA 4IIBA 3KSZO 5EJ9A 5DBGA 5K4GA 4Q1CA 1VJGA 1Y6RA 3D7RA 3WLJA 4CG0A 3EXG1 4PSVA 4U00A 4MARA 1TFUA 5KWVA 2P6RA 3LQKA 1Y3DE 3EH2A 4AS2A 1YB4A 3U7IA 4R2KA 5ALRA 2OD7A 1AKYA 1CE8B 5LJLA 3SSMA 3LXRA 2X7JA 4P9NA 3W3AD 1Z22A 4IQ4A 4JA0A 2IDZA 3Q5GA 5BQOA 4ENWA 3BWMA 2QMUA 4KYVA 3WGTA 1CWUA 2BI7A 5EIBD 3ZVNA 3GPCA 1GRRA 1DZ3A 5EEHA 1ABEA 5KHLB 4RELA 4MI9A 5I5EA 3THWB 2ZKIA 1I94B 1KO1A 1UQUA 1EB9A 1G5QA 4GMXA 1SBCA 1R0RE 2OFFA 5B7QA 4WKOA 4MR8B 2PDAA 4BO6A 3I53A 3JQAD 2J08A 3C8HA 4YY3B 1JR4A 3AXTA 4I9FA 1O7JA 3K9CA 1L8QA 4ON9A 5EAIA 1U0TA 1A9SA 1KE1A 2CXQA 1QO9A 2BEWA 2CMDA 3HP7A 3I9V6 4UHJA 4GC5A 4QYMA 4U3JB 4XUDA 2P91A 2EV9A 5EWLB 4YA6A 1K1EA 3RC7A 1H2YA 2QTAA 4NIMA 4QGAA 3BFVA 2G9NA 1T5SA 4LSZA 4WXHA 1UBKS 4IDHA 3OQIA 3CEAA 1KJZA 3HJNA 3SBXA 3VJLA 4JI8B 1Z7WA 1G8GA 5FX2A 4MH0R 3LOUA 4WTOA 2L18A 1TAQA 1MW8X 4KAAA 4JELA 1BGWA 1JIXA 1WS6A 2AJDA 2PTGA 4LDJA 4HNTA 4WZBE 5A6VA 1BRMA 3OFNA 7REQA 3Q3JB 4Q4HB 1FVHA 4EG6A 1ATZA 1Y80A 4MV1A 4HEHA 4UCWA 1KRXA 1JVNA 4CKBB 4DGQA 2EGHA 5PNTA 1AQLA 1I2MA 1G5TA 2V98A 4X9XA 4YJ3A 4BASA 3USZA 4Y2JA 1BRTA 2LDXA 4DLBA 2BI4A 4EIWA 1ZCAA 2WD9A 3F98A 3PYLA 1CBUA 4CLRA 3OLVA 5JZ9A 2FOXA 4KQ1A 2O8VA 1X7WB 3ET4A 1ZN2A 2H06A 3B9PA 3HV0A 3K6JA 4JUFA 4Q00A 3BK7A 4WOJA 4UU1A 5FYQA 4C29A 4TWJA 1J00A 1D09A 2E49A 4KFSA 1TZ2A 3GT4A 1OZGA 2RI1A 3ABIA 3LCUA 2EBFX 1XVIA 2G71A 1NVBA 3GH3A 1RC1A 4OQDA 1EP1B 4RTJA 4DR4B 3SCZA 1PGPA 3EIHA 1KR5A 1MTZA 2I7CA 4L22A 1YZKA 5K0SA 4L27A 4D98A 5DIFA 3CWCA 1CUGA 4ARAA 4JVSB 3D1VA 3QV1A 4OI1A 3RU3A 5FOQA 1V35A 5AW3A 3ZWAA 3JCZA 3FOAA 1RQPA 1Y1LA 2XT0A 1DAGA 1K88A 5CT5A 3NBYC 5FWYA 4JI5B 1QHGA 3KJFA 1ZNQO 3IUEA 3OF3A 1JDBC 2PJRA 3DG9A 2B4QA 2WT4A 3GWZA 2VQDA 3RNLA 1XTKA 4H0FA 1MRNA 3TBKA 1V7CA 1TTTA 4UNPA 3OIDA 1C7RA 1D9ZA 5H83A 2R11A 2X0NA 2CLLB 3DCNA 3UO8B 2OQVA 4JB8A 2QMOA 1OVMA 5YASA 2PANA 4WCDA 1Q16A 5KNCD 1U9JA 2CFCA 1FNDA 4JIGA 1OZFA 5HCUA 1H0SA 1XEXA 3R4VA 1N32B 1X13A 2C7GA 3AUTA 3IIJA 5EIEA 1VFNA 2Q6OA 3GLIE 1VJCA 2YMLA 2PGIA 3LF1A 3FCXA 4FW9A 1EHYA 4ROSA 1EE1A 2OGWA 5LIRA 3R7BA 4AP6A 2FF7A 1O54A 3FN4A 4FZ3A 1FA9A 3VR5A 3RK1A 1NP3A 1A5BB 1DEKA 3GFOA 4CHTA 2G1PA 1PUJA 5EKSA 2C2MA 3W8DA 1W5FA 3FPSA 5FBRB 3ER9A 1NQUA 2VOEA 4RD6A 2A0WA 2A14A 2W6ID 2JBAB 1AGPA 2J1LA 2PFGA 3FTPA 3H99A 1ORRA 1B73A 1Y37A 4A6DA 4MA5A 1GDTA 2ZS8A 4J29A 3OZFA 4U63A 4DA7A 1C0PA 5IJ0A 1N0IA 3KQHA 1L5QA 4UHHA 4MUHA 1N3YA 1YIDA 2XZTA 1XCMA 4MMZB 2F1HA 3IQFA 4U0JA 1KIFA 3GLKA 5TLSA 3C1TA 1BTOA 1S2IA 3HCEA 3RAPR 2PO7A 3EA0A 1QYWA 3PC7A 4BFXA 5AVZA 1YAJA 1T6ZA 5DMHA 1DAKA 3EPLA 4TT3A 2QE6A 8ABPA 1NW5A 1KZYC 3SQWA 3GEEA 3R7SA 1V5WA 1KI3A 4RKRA 2CL7X 5KJEA 4MB2A 1D6MA 2OORA 1XNQB 3EHEA 5AK3A 1OYWA 3B6MA 1RWVA 5CYFA 4CIYA 3GI1A 2XBLA 1NNLA 4LXTA 2P78A 3DDOA 4R2XA 4KDFA 4FFNA 3KPYA 4LYYA 4D81A 4E7PA 1F51E 1LCIA 1GFZA 1U9ZA 1OA0A 2CXNA 2LKDA 3B2EA 5AKZA 4CTKA 1W1IA 3K6RA 4MRVA 5HBRA 4GMHA 3KPWA 4RLSA 4DIDA 5HRCA 3CZ5A 4S0ZA 1CZHA 3FDZA 2AN3A 2GGSA 4Y67A 5ETJA 2MJLA 1DG3A 2EQBA 2XMCA 4TLBA 5K3FB 5LMZA 2QZPA 5HK8A 1JLMA 3Q4GA 1RLOA 4B0OA 4H6PA 2LDBA 1OGYA 2QUIA 4NR0A 1F1JA 1Q83A 2QVXX 2C1ZA 4P83A 5KDLA 2VAVA 3FMVA 3NGLA 1RBYA 1Z34A 1FTGA 2CNDA 2WUWE 1YT5A 3HO6A 3NT4A 1NMQA 4ZYZA 3ISVA 4JJ8A 1LC3A 3CLTC 3II6X 4M1SA 1BXRA 2UVDA 3FLMA 2UZ4A 1SVIA 1VJ0A 1PVDA 5BXYA 3KZ1E 1Y9AA 3O8QA 3RU2A 4EQ6B 4UTVA 1BEZA 2LW7A 2XWPA 3NTVA 3RPEA 4YRFA 3AKCA 3JXEA 2FN4A 4ZDWA 3PFKA 4MULA 3HCWA 2ZSFA 4DPKA 1URPA 4TS9A 3THSA 1QG6A 2PRZA 4EFMA 2WUVA 3OOSA 4YQYA 1FXSA 4NS4A 4XJVA 2BBSA 3T15A 1DDIA 5IBCA 5K3OA 1JSZA 1WW3A 3KKQA 4JS0A 3QEAZ 3AWDA 3OQ1A 3TZEA 2M2IA 3CWZA 4KO3S 4UTPA 2ACVA 4CXMA 1YVRA 4M6WB 1FRFS 3K4QA 4BFLA 2X8WA 4I9HA 2OMKA 3TTVA 1WLSA 1SVOA 4AK9A 5I9LA 2PT7A 3IEUA 1CJUC 1XNJA 4ILEA 1W47A 4GBGA 4R84A 3AUKA 2YNMD 2FPOA 4YRTA 1KPHA 4NBRA 3DBHA 3EB9A 3FMOB 4ISBA 1VCHA 2V6JA 2H11A 3MJRA 4UPDA 2NQ8A 2JKVA 1MVOA 5T6MA 5THQA 3ZPXA 5BY2A 1Y6JA 1OAAA 3AR7A 3B6KA 4IXWA 3ITEA 2H3EA 4ESVA 1CW2B 3NNNA 1XAHA 2C2GA 1FFYA 2GCNA 1TEVA 2QPLA 4YJHA 1W5AA 4QGHA 2RAVA 5FKJA 1C3XA 1WWKA 4LXQA 4K9NA 3SJCA 2ZCVA 3AVOA 4LVNA 2JCSA 4WY8A 1KQFA 3WYAA 1MEJA 1H85A 3PFFA 4R8MA 5HJ2A 1QORA 3ETGA 4Q7QA 1YL5A 2A4MA 2HU7A 5FI5A 3A4IA 5J58A 4KXQA 4F93B 1CZKA 2R6AA 1LBQA 1GQ2A 1O2DA 4UQPA 4E32A 4R2JA 4PNEA 1L5KA 2QKYA 3NDIA 1Q1AA 3ZDXB 4B73A 2O2SA 3ISJA 1SKQA 1Z13A 5KJ1A 3G9TA 4FGUA 4FGSA 1DXQA 3FVVA 2EATA 1EK0A 2EJCA 1FFXB 4RY2A 2DP4E 3D6MA 1BEEA 3H0EA 1GQOA 1H3NA 3SDZA 5CX1A 4YIHA 2C4HA 4M8KA 4X20B 2FZCA 2IZ1A 1GARA 3DQQA 1P91A 1GFWA 4G1VA 5LKAA 2GOYA 4AKEA 1SOMA 1UKEA 3A3NA 2YJ3A 3AFIA 5AI4A 2PPLA 3FGNA 3O2JA 4JQOA 1J07A 3UFXB 4EJSB 2PKYX 1PJ4A 1GNTA 1X39A 3DR5A 4ZT7A 1I7DA 2X6RA 4Q3EA 1R9NA 3VAZA 5HUHA 4Y7CA 4EELA 1CR0A 4PRYA 4KE6A 4TWIA 5AW2A 4EG7A 1I36A 3UKOA 1VLVA 4DZZA 1Y1QA 2AR7A 4N3CA 1CUHA 5DBFA 5JQGF 3AG6A 3AHGA 3MT9A 4IDFA 4U9IS 3TB4A 4ZJUA 4XWWA 3I42A 5AW4A 3ABRB 4CV2A 4P3KA 2UUBB 2GYVA 3BD9A 3DE2X 1XJQA 5KKNB 1F38A 4G4GA 3GUUA 3LPLA 3W3AH 2VQ6A 1MOZA 2B4AA 1WG8A 1NRWA 3VYRB 4UQLA 1X7ZB 2QYHA 4RKEA 3UXHA 3T7RA 1ATIA 2W0SA 1RFLA 4JH0A 4BUZA 1NUPA 3DMYA 3QX8A 3RS4A 1I3MA 1IXZA 1FP2A 2A9PA 2I3BA 1AQYA 4RORA 5F2EA 1PL0A 2HWWA 2JZNA 3OWOA 3V3TA 5AJXA 5L7YA 5DBEX 2X0DA 2IHJA 2FTKE 1A96A 5CB4B 3VNSA 3P1JA 4BLPA 1NJ5A 1X87A 2OXEA 4B6JA 4UHKA 5DPMA 1SUAA 3IDQA 4BX0A 4DL9A 3GGOA 5B58C 5TNXA 2J9FA 1WU7A 1LS6A 1M2NA 4ND7A 4CMAA 4DRXA 2CLDX 1NZJA 3GT7A 1G3RA 2J0VA 5A3JA 4C20A 4D7AA 4WESA 1H8HA 5GV7A 1XZ8A 3A11A 3NQ41 1SCQA 3MFYA 4UFNA 3AUUA 2JF0A 4FP9A 4YRZA 1C0LA 3IT2A 4K8RB 3BTVA 1XN1A 3W5CA 3VH4A 3COWA 5IXJA 3LP5A 3B60A 4AVYA 1A0OA 1Z2OX 3S2ZA 2Y1OA 4YRAA 1TM3E 3SQXA 4HMPA 3HSSA 3ENZA 1E5XA 2RC5A 1H65A 3DEKA 1CCWA 2EQAA 2HJ9A 3RW9A 4DANA 3QUBA 4AQYB 1JEYA 1Y3IA 4K2HA 4AFNA 1U0JA 4PZPA 1QMPA 3NATA 2FPUA 4II2A 2Q5CA 1T25A 1W73A 4YJ3F 4UD2A 1KMIY 3ZDFA 4K1XA 3KZNA 2RDMA 4LJ6A 3QKUA 3OJCA 1KQGA 1E32A 2QRVA 4LY9A 4PBSA 2F8TA 4B5KA 2QTWB 2P5YA 2JIBA 1IY9A 4YYZA 5FEMA 4ICIA 3BFJA 1KO5A 1IOLA 2IVZA 2GD2A 3SHOA 2Y76A 1U94A 1JA0A 2A9JA 1UIRA 1V5IA 2C2BA 1FX0A 3FDJA 1MPTA 3IO5A 3PTLA 1GG9A 4Q0MA 5K1ZA 5DN6D 3I2JA 4FT4A 2Q4TA 5TS2A 1A04A 1V9CA 2NYUA 3F6CA 3JQGA 2IP4A 4PV7A 1B8UA 4ZREA 4IMPA 2EW8A 4JJEA 4BFYA 2AF4C 3PP8A 5IC5A 2VSFA 4JT9A 1NV9A 1B8PA 4M22A 4X3PA 3T3IA 4DLPA 1AB5A 2W71A 3PPVA 3QVSA 4K9RA 3IAM1 4KH1A 2H2HA 3W1VA 2W2LA 2GETA 1I8TA 1WEHA 2DQYA 2NTJA 1HRKA 2QD4A 3EODA 1A9XB 3GUHA 3OLWA 2ICAA 2X0KA 2IKSA 2GK7A 2QTCA 4L9RA 4RVSA 1D9XA 4C4PA 1J7KA 3NIGB 3ZYCA 4DCSA 5K8CA 2Z6AA 4XIFA 1JFFA 2HZBA 3ORFA 4RJTA 3KSDO 3N0TA 3WLPA 2R5FA 2QGFA 3G3EA 5JE8A 4EFKA 1Y6FA 4IM7A 3CUKA 3WNBA 1V6SA 1ODCA 5HSGA 3C0KA 1HYBA 3O83A 4DLUA 4HSEA 3G2QA 4INPA 4YJFA 4Z3DA 3WE7A 2CW5A 4E2XA 2EFCB 5KNCH 2QTRA 3ULKA 4BX2A 5EEGA 1YONA 3FAKA 3FYTA 5C8XA 3MJHA 4X1KA 3MAGA 3WGQA 5FTLA 4RULA 1R9MA 4YBZA 1E9SA 1JLSA 1ZD9A 1B1CA 4YS6A 2W6QA 3IB3A 3U1TA 2ZI6A 4TLLB 5G1OA 2JH9A 2YIDA 1A7JA 1E77A 3EG9B 4LC9A 3KWLA 1Z4OA 4HDKB 4QG3A 3ES9A 1LSOA 3CW9A 4LV8B 2PT9A 3THYB 2ONCA 4LRYA 2A6PA 5ELLA 5F9MA 4E33A 2QL5A 1OC2A 4NABA 1P18A 4F86A 1H93A 1ZRNA 4C0KA 3AUJB 3LHIA 3P2YA 5K6AA 2FSPA 2ZSIA 3VZSA 1BZYA 1BH6A 3WJ2A 4CUKA 4RA9B 3H75A 1O95C 3ANLA 3TX2A 4C4RA 1X9IA 3OCXA 5E1BA 4UU8A 2GPTA 1Y63A 1MGPA 2JFUA 3R7FA 1Q2UA 3D1JA 4DV5B 2A9RA 1BCSA 5DYYA 2J48A 1E4VA 3GJQA 1ZM9A 2P75A 4YT5A 4DJJA 5I7EA 4F9GA 3BE6A 4HOYA 4DBZA 2R44A 2WUEA 4K0RA 1HOXA 3HBLA 4YAGA 5LKRA 3B7WA 4RFLA 2Q1XA 1TZJA 1Y9ZA 2AJ8A 2F90A 4JL6A 3WGHA 4DWJA 5K6TA 3KJNA 3DHVA 5JALA 5T8KC 1XV5A 2SCUB 2YDYA 5K20A 3OTHA 5JVDA 3NEAA 4A0QA 3ILSA 3QE3A 3RFXA 1XRRA 4UFOA 1V71A 1FYFA 3T12A 1UFQA 1WMBA 1RQXA 4RIHA 1E6WA 1XOIA 2E4UA 2WSIA 3RJMA 3ZIDA 2DKOA 1JXOA 4L0CA 4B3SB 2DSTA 3ORYA 2C03A 4L50A 3B1FA 3GPLA 3DOHA 3G7SA 3PJDA 4DMHA 4C5AA 1WSDA 3K92A 3FJYA 4HYYA 2JH3A 1YJ8A 2YJGA 3JTMA 3HK2A 1N6PA 3L8HA 3SJUA 2ZLBA 1Z8FA 4DCTA 2H85A 1BS1A 3CX7A 4NYIQ 4EF4A 3L49A 1N2BA 2BZ0A 2XCSB 4OJKA 2CZGA 4J0JA 4OM7A 4ENUA 4M0MA 2IDKA 4EDHA 3VKVA 3L9WA 1VPDA 4JITA 4BP9A 3DEJA 1CP2A 2A5DA 5ESXA 1WBBA 1J0DA 4MRPA 5BW8A 4GMKA 4JK3A 4PYIA 1WSBA 1DKNA 2CBGA 5DV9A 2WIFA 3CW8X 2YS6A 3C5EA 4I3FA 4YAWA 3P5BA 1DHRA 3QBTA 3HM2A 1K5HA 1GU0A 2FUEA 3PWTA 4YX9A 3GZNA 5EMJA 3GCGA 1QF6A 3WJAA 4HX9A 1Q0ZA 3GZJA 4HTFA 4QJ5A 4KWTA 1HEYA 1IZ0A 5CIQA 3HJTA 1TOAA 4ISCA 3ASVA 2O8BB 5CAEA 5I9BA 1K2WA 4JBWA 4JLNA 3U4QA 2LIVA 2FEWB 2C5EA 2QT9A 4P98A 1GSIA 3NBKA 4TL9A 5JLAA 2Z43A 4F12A 2E5WA 1PT5A 1VB5A 4F6RA 1RAEA 1VECA 3WLSA 4HH3C 4OQFA 4E11A 5ELXA 1MENA 1XQ9A 4MWGA 4JFRA 2QNBA 1EFHA 1KI6B 1QV7A 1MFPA 3CCFA 4MI1A 3J81k 3UPUA 2XSZD 1CF2O 2YV2A 3N39C 1OX4B 2G09A 3CUTA 2R65A 2WFMA 3GN2A 3AETB 4WVLA 2HWXA 1ELOA 1MQAA 1WDMA 4MS4A 1WOMA 4NJMB 3RWMB 3BAFA 4M4SA 1U0SY 1QK5A 2W43A 5CXSA 4B3CA 4I8DA 2ZI9A 4FOLA 3AI2A 4DARA 4GX2A 1JE1A 4CIXA 3HCNA 4ASUD 2FYTA 3ZD7A 3S1LA 1AB6A 4Z0TA 1MRSA 5B7PA 2I7DA 3BCHA 1PI3A 2EFEB 2GI4A 1EWKA 3DCYA 4BCBA 2WT9A 3R23A 4YDSA 4KJZA 3AKDA 3SKXA 2QL6A 4L3VA 1FVOA 3GMIA 1F2VA 4Q9IA 1Y5NA 2E82A 3BKWA 2P7IA 3L6OO 2QX4A 4YJ2A 1NFQA 1RCUA 4PU0A 3SQMA 3GUCA 1CV2A 3I2HA 4TXJA 3PCXA 4ETIA 1WZEA 4MRRA 4Q3AA 1MA0A 3ANMA 3SFVA 1W581 4U2GA 5B1HA 4HSGA 1YVDA 4RC9A 5TMDA 1B15A 5KQSA 2F3PA 2X2FA 1P2FA 4OLJA 3V33A 3U1BA 3EUAA 3L8CA 2QNIA 1P5FA 3AIIA 2DUMA 1PZEA 2GERA 1EFDN 3B8HA 3QXGA 1LX7A 2ANBA 3CR7A 2GD6A 1IH8A 3H5OA 3TG8A 1C30A 1ZISA 1NY6A 1EAYA 3BIOA 3PG5A 1ENYA 4N03A 2J3IA 3OQVA 1YI1A 3ZE0B 1XZGA 3KJIA 5CEJA 1DDOA 1XZAA 3UH0A 3ZI0A 4DY6A 5B6IA 5GINE 2A0YA 2WZDA 3QE4A