1R18A

Drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
total genus 70
structure length 223
sequence length 223
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2003-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r18A00
2R6ZA 1WY7A 1AF7A 5FA5A 5K01A 4GEKA 2Y1WA 2JHPA 3PX3A 1Z3CA 3KR9A 3PX2A 3SMQA 2AVNA 1VE3A 3C3PA 3OCJA 4GBED 5GM2A 4P7FA 2P7HA 5BXYA 2OZVA 3OU7A 4BLWA 4BY9E 1ZGAA 3IV6A 4PCAA 1G60A 4FP9A 4QTTB 3UJCA 3M70A 3BGVA 5DRYA 1AV6A 3A25A 4OA5A 1SG9A 3R24A 1IY9A 3DULA 3KR1A 4GC5A 1EIZA 4YUZA 3KQTA 3FPGA 3MCZA 1X19A 5HFJA 4P58A 3UA4A 5BP7A 2PXCA 3OE4A 3KQPA 3TKYA 4CTKA 5MHTA 1INLA 3DUWA 4FSDA 2ONZA 4NECA 3P2EA 2FRXA 3CC8A 4M38A 1U2ZA 1QZZA 5C9ZA 2BR5A 3TM4A 2P3LA 4R05A 2CMGA 2UYQA 1VIDA 3LKZA 4XUDA 1JTFA 4E70A 2IP2A 3CJRA 3MQ2A 2ZZNA 1IXKA 4QVGA 3ERCA 2EFJA 5CIYA 1UWVA 4MWZA 2C7OA 3P9IA 1NW7A 5D1NA 5K03A 1NKVA 1SVUA 3B3JA 5FHQA 3ELUA 3LSTA 3LKDA 2UYHA 4C05A 3E23A 4UOEA 5EKXA 4F85A 1VLMA 4F86A 2AN3A 5DSXA 5FULA 1M6YA 1YZHA 3DXZA 3T7RA 4E2XA 4YMHA 3THSA 5HIKA 5KVAA 3HCDA 3HVHA 2ZBPA 5FQNA 4BLUA 1N7JA 4V0RA 3HTXA 4YUXA 3DXXA 2EJUA 5DRTA 5K05A 1XCLA 3AWIA 3CJQA 3DR5A 3KR0A 3MERA 4FT2A 4M36A 3B3GA 4RVHA 2ZWAA 4HGZA 1O54A 1TW3A 4XUEA 4MQ4A 4QVKA 3EGVA 5E1BA 2IPXA 3ELDA 4ER5A 4RTLA 3G2MA 4RTJA 1XVAA 5CVEA 3NWBA 4FGZA 1P39A 3MCTA 1FJXA 2PGXA 3FUVA 3HA3A 4QQNA 4GOMD 3OFKA 4C4AA 3CVOA 5DWQA 5D1HA 2ZBQA 4R8SA 3EMDA 3G2QA 5EVJA 4R6XA 5E1MA 3T7SA 5K09A 4RX1A 1YFJA 2BM8A 1UIRA 5CM2Z 4CKBA 2NXJA 3LCVB 5EIWA 8MHTA 5EMLA 1XJ5A 1RJEA 4CTJA 3FUXA 1V39A 5K0LA 1TPYA 2PX8A 4RTNA 4PYLA 1RI5A 1X1AA 1X1BA 1BC5A 2K4MA 1I9GA 5EG5A 2H11A 3A26A 5CVDA 1RI3A 3DXYA 3OZTA 3SSOA 2BZGA 3C0KA 1JG2A 5DM4A 3NDIA 5IH3A 2F8LA 3D2LA 4RYLA 5CVJA 1G8SA 1SUSA 1YZ3A 2HWKA 3LBFA 4P7KA 4PYNA 4XCXA 1M0EA 3HCBA 4K6MA 5EGSA 2ONYA 4MTLA 3JWIA 2ADMA 2G1PA 3EVCA 3BWMA 3FRIA 5EOVA 5FTWA 2BM9A 3KQVA 3LDUA 4KVZA 4PYQA 3P9KA 3MHTA 3M6WA 1QAMA 1KP9A 4PYIA 3R0QA 5EQJB 1RI4A 1RJGA 5ERGB 3RODA 4RVGA 3K6RA 3AJDA 2JH8A 3KPJA 5DX8A 5LQJA 4DZRA 1F38A 3NW9A 5HEKA 4AZSA 2HTEA 5E8RA 3CGGA 3I53A 2LD4A 4C06A 4RTMA 2GPYA 2AVDA 2YXDA 3A27A 4YUWA 1JG1A 1NV9A 1QAQA 3HVIA 3KQYA 2P3OA 4FSXA 4GUAA 3ELWA 2NP7A 4OBXA 5FUBA 5CD1A 4CWAA 3FRHA 5LQAA 3PS9A 2AOWA 2O06A 1XXLA 2XYRA 5DX0A 1EG2A 4GF5A 2E5WA 2IGTA 5EC8A 3AY0A 1FP1D 3FUTA 2IIPA 3HVJA 2KW5A 2ZIGA 2BH2A 5E9WA 1YUBA 2C7RA 5IKMA 4EK9A 4HGYA 1NW8A 3C3YA 4ZTBA 5DXAA 1G6Q1 3NJRA 4LWOA 4ATNA 4BLVA 5DXJA 5GIOE 3EVDA 4X60A 5DM1A 2OXTA 3GNLA 2PX5A 1UFKA 3P8ZA 1NW6A 3T7TA 4LG1A 5B1SA 5HIJA 2CMHA 5ICFA 5LSAA 2ZW9A 4EQZA 1SKMA 4OX9Y 1KPGA 2GA9A 1JG4A 2EX4A 1IM8A 4X1OA 2EJTA 4HSGA 3UFBA 1PJZA 2GH1A 5EHGA 3DMHA 1DCTA 2Z6UA 1JTEA 1JQEA 3MGGA 3SGLA 1I1NA 3TKAA 3UJ9A 2YTZA 4HRAA 1JR4A 3UJAA 5HILA 2HR1A 2QY6A 3PFGA 2PWYA 4A6DA 2ZWVA 5HIMA 2BR3A 1XCJA 4HC4A 3GRRA 1AQJA 4C08A 3S68A 2QRVA 3L8DA 3RIEA 3HNRA 1KHHA 3BGIA 1RI1A 3FYDA 3HCFA 3Q87B 4HG2A 2PT6A 4U7PB 4GOND 5EMKA 3G2OA 4Z2YA 5LQKA 4H0NA 1MHTA 3FPFA 5GP1A 4JXJA 1D2GA 4GQBA 3G7UA 4E31A 4R6WA 1JQ3A 2NP6A 4PYMA 1OR8A 2O07A 3HA7A 3F4KA 3LHDA 4C04A 1L3CA 1XTPA 3E7PA 2XYQA 2ZBRA 5F2NA 2AOUB 1R6AA 1NV8A 3G88A 1D2HA 4POOA 2ZIFA 3SXJA 2VZ9A 5ICEA 1N2XA 2ZLBA 2B25A 4IV8A 5LQUA 3OPNA 3UBTA 1SQFA 4C07A 4P7GA 2R3SA 3TLJA 2FPOA 4E2WA 5HOQA 4FS8A 4YV0A 3WSTA 4DQ0A 3KQSA 4EKGA 2PLWA 3GRVA 3TR6A 4AX8A 2NXNA 4EVIA 5HZMA 3EGEA 3G5LA 2H00A 2AZTA 2PWPA 3OE5A 4ER0A 4RTRA 1R8YA 3QV2A 2AR0A 3KPWA 3KPYA 2EG5A 4DCGA 2G71A 3LDFA 3ER8A 3B3FA 3LGAA 4BP3A 3GJYA 1JG3A 5DPMA 2OBFA 4E30A 3OFJA 2ZFUA 2BR4A 2I62A 3B89A 4X63A 5DTQA 4BP1A 3KQWA 3GRUA 1AQIA 1DL5A 1M6EX 3ANXA 3P2IA 3GRZA 3KQMA 4X61A 2ZVJA 2ZZKA 5M5BA 2B9EA 4LECA 2YXEA 3EGIA 5KYGA 1JSXA 5GINE 3QOXA 5DTRA 1FP2A 2G8NA 3M4XA 3TOSA 2PXXA 3UJDA 2ZSUA 3HP7A 3VC2A 3NMUF 1P91A 1N7IA 1KYWA 5CVUA 4DCMA 2Y1XA 4EKIA 3OZRA 5EEHA 4PNEA 5ICGA 3LECA 3O7WA 3THRA 5ICCA 4RTPA 2IH2A 4QDKA 4RSRA 3OU2A 1XDUA 3B5IA 4PGGA 3HEMA 5F2OA 3EEYA 3EVGA 2IH4A 3HA5A 4L7VA 3TMAA 5FWAA 4FT4A 2B2CA 2PXAA 3EVBA 4RVDA 3UJ6A 2OY0A 2VDWA 5EMJA 3BT7A 3FPHA 2JH9A 5EPEA 2GS9A 3LX6A 3GO4A 1BHJA 1R18A 2XVMA 5DX1A 2YUIA 4R8RA 3PB3A 4QDJA 5EHIA 4CXMA 3DP7A 3OZSA 4M37A 3TRKA 5K0GA 5LQNA 3MB5A 5KQSA 1F3LA 1DUSA 1QAOA 1KIAA 1G55A 4E2ZA 9MHTA 5E8JA 3KQQA 4XUCA 2NYUA 3KHKA 3JWJA 3KPVA 4ER6A 3T0IA 1YB2A 1VBFA 2ERCA 3BGDA 3VYWA 3CKKA 2PVCA 5GOZA 2QM3A 1NBIA 3NVKI 1BOOA 3UZUA 3LL7A 5FHRA 3B7PA 3BZBA 2UYCA 1ZKDA 5HIIA 2QE6A 5LQRA 3LDGA 5E1OA 5CCBA 4AZVA 3UJBA 3NDJA 4AZTA 2FK7A 2WA1A 3P9NA 1P1CA 3C6KA 5K8VA 1Q0TA 1ZG3A 2AS0A 3K0BA 2UZ4A 1L3IA 2H1RA 5GWXA 1KR5A 5DLYA 2HV9A 4KRGA 3I64A 1HNNA 1JSZA 3GCZA 2ZTHA 5K0CA 1X1DA 1SQGA 1L1EA 3FTEA 3PFHA 5DSTA 3P2KA 3QOWA 2YVLA 3HCAA 3TPZA 4PONA 3KPUA 3E05A 2HNKA 3HCEA 1R00A 3SX0A 4RTQA 5K0EA 2CWWA 2B3TA 2I9KA 1JQDA 1WG8A 3UJ8A 4FZVA 3O31A 3O4FA 3SSMA 3VC1A 2YX1A 2YXLA 2FYTA 3KKZA 2ZIEA 3EVFA 4O29A 3ELYA 4E33A 2AN5A 1VQ1A 3FPEA 3ME5A 2O57A 4G56A 5FWDA 2C7PA 3BXOA 4QTUB 2P41A 4IWNA 4QPNA 3UA3A 5FQOA 4KIGA 3GGDA 3MAGA 4KIFA 1QANA 2VDUE 2I6GA 3GWZA 1I4WA 4KW7A 5G02A 5DT2A 4YV2A 2C7QA 3P71T 1EJ0A 2VS1A 3KR2A 4PGHA 4WXHA 3FTFA 2VDVE 4MHTA 2FCAA 2YQZA 3CCFA 1RJFA 4YUVA 5FA8A 2GAFA 3GIWA 3EMBA 2V74B 2JHAA 3FYCA 2OB2A 5DM2A 3GRYA 4GC9A 1EQAA 1MJFA 3FTDA 5GM1A 4IV0A 3BWYA 1KYZA 2PX2A 3PT9A 4PIMA 3X0DA 2ESRA 3HVKA 1G38A 2PKWA 3EPPA 3NVMB 3M33A 5JR3A 2ORED 5E9JA 3H2BA 4ISCA 5E2AA 5T64A 2GB4A 3I9FA 2CKDA 3G8BA 5DTMA 5EMMA 5K0NA 1WXXA 1EJ6A 5EEGA 5EZSA 4DM3A 2IFTA 3LCUA 4WVLA 5H02A 2PJDA 1R8XA 2OO3A 1KPHA 2GLUA 3CJTA 3R9XB 3ID6C 4M7RA 5F2KA 3REOA 3GXOA 4X41A 3TQSA 1QYRA 3A4TA 2B78A 2UYOA 1T43A 4PWYA 5BW4A 2V7EA 2VP3A 3DOUA 1VL5A 3G5TA 5E2BA 1XDZA 4RWZA 3M6VA 3DMFA 3R3HA 4HH4A 2HMYB 3SSNA 5KQRA 3HCCA 1ZQ9A 2O05A 2QYOA 3Q7EA 4CKCA 2NXEA 4E32A 4EMSA 1L3BA 4OQDA 2IBTA 1TW2A 3G8AA 1HMYA 3V97A 4AUKA 2XBMA 1B42A 2IH5A 5K0FA 5CVVA 3BKWA 2PX4A 3G2PA 4F84A 2I7CA 2JJQA 3I5UA 3IHTA 2OB1A 4HTFA 3EVEA 2CL5A 2AN4A 4ER3A 1KXZA 1YF3A 5U4XA 4RTSA 3I58A 5E1DA 4E2YA 3E8SA 1O9HA 2OKCA 1RI2A 2P1DA 3GU3A 5EZQA 4CKEA 2Q41A 2YR0A 4PINA 3V8VA 5KS2A 4B17A 3A7DA 3CBGA 2OPBA 3A7EA 3M6UA 1Y8CA 2IDJA 4YUYA 4HTFB 1NE2A 3SVZA 1WS6A 2PT9A 4C03A 2JHCA 2N47A 3OU6A 2G72A 2PBFA 2PV0A 4YV1A 5LQCA 3PVCA 3LCCA 3NTVA 5GIPE 1WXWA 3U81A 2G70A 3EVZA 2IDKA 3P97A 4DA4A 4Y2HA 3AXTA 3ER9A 5C0OE 2IBSA 2PY6A 3RW9A 3GDHA 4KDCA 4V0QA 2P8JA 3NWEA 3DLIA 4PYKA 4YMGA 1NW5A 5CCXA 2WK1A 2Z6AA 4MIKA 2A14A 2QRVB 4IKPA 1KPIA 3DLCA 3MTEA 5DM0A 4RTOA 3KU1A 4DF3A 1YFLA 5LR6A 3FUUA 2DPMA 4OBWA 3IYLW 5CUQA 1D2CA 2JG3A 2P3QA 1ZGJA 2OYRA 4Y30A 2XYVA 1VP9A 2FHPA 3BKXA 2O0LA 2NXCA 3BUSA 2NNWB 1ZHFA 3DH0A 3UWPA 3KQOA 2WA2A 4GOLD 1FPQA 3M6XA 1L9KA 1NT2A 3DMGA 4PCLA 3IEIA 4OA8A 5T67A 1O9GA 4RVFA 3LPMA 4RTKA 1NBHA 1H1DA 3C6MA 2XVAA 3TFWA 5FADA 3HM2A 2PSSA 2DULA 2Z6QA 4P7JA 3LBYA 3EEOA 2ZCJA 3UJ7A 4LWPA 4U7TB 3EVAA 1Q0SA 2AOTB 3AXSA 3BWCA 5FCDA 3PTAA 2ZZMA 4KDRA 3FTCA 4GOOD 5T6BA 1RJDA 4OQEA 5P8WA 1PRYA 5BW5A 1VP3A 4KWCA 3SR4A 4QPPA 1G8AA 3VSEA 1NW3A 4PYJA 2AOVA 1XDSA 5K0JA 4FR0A 5K0BA 10MHA 1R74A 1EAMA 1ORIA 1BKYA 2FK8A 3JWGA 4PIPA 3P9CA 7MHTA 3FUWA 4PYOA 3SM3A 5JUWA 1FBNA 1ORHA 3G89A 4DKJA 3PLAE 2ZULA 1WZNA 4DMGA 3TM5A 2P7IA 3ORHA 5C1IA 4RV9A 2P40A 1P1BA 5EKUA 5E9QA 5EIFA 4A6EA 2P35A 2AOXA 3BWBA 3FPJA 3FZGA 4QQKA 3R6TA 1X1CA 2AOUA 2AOTA 3DTNA 3MTIA 4ER7A 1VPTA 4AZWA 3JWHA 1SUIA
chains in the Genus database with same CATH superfamily
4AMBA 1N4DA 4XEUA 1OJ7A 1X39A 5IS2A 5BYKA 1MB3A 5CBKA 4HGNA 3AETB 1TEZA 4CR7A 2D62A 3HZOA 2P5SA 4NULA 3LC1O 3QXSA 5C31A 2ZYHA 4HEQA 2JH3A 3S70A 2GEDA 2WMYA 3NBYC 3A4IA 2Y6VA 3Q88A 5A3QA 1KFJB 1O0BA 3QEKA 5F35A 1W59A 2D1YA 3DD5A 4MQLA 3VGPA 1EUQA 1K4KA 3K9LA 1JHRA 2AD1A 1Q1EA 2FEKA 1L7DA 2M6SA 4JYMA 1OB2A 4TKVA 4BDSA 1REQB 5LUAA 4UM5A 4F5ZA 3GLFE 3DCIA 4WZBE 1TEHA 1KZ4A 1FLAA 1PGNA 1O89A 4R8MA 3T5CA 3S8YA 1VKJA 2J0VA 2WNHA 3D2BA 1BDIA 3G2NA 5IAJA 2I6QA 3FAKA 5A4FS 5C9ZA 2HB6A 1R0KA 3ZWAA 4EG1A 1E64A 1PV2A 2BR5A 3KJGA 3JWEA 2YNMD 2CMGA 4HJRA 5F9FA 2FJ0A 2WSSD 3FJOA 4MKXA 4KR7A 4JKOA 3NT2A 3ERCA 4IJKA 4PANA 121PA 1L4YA 1SEPA 1SU4A 2BONA 1YC5A 2NTNA 3LF1A 1BMDA 4J16A 3OIVA 4KWTA 4F96A 1X7XA 2O2CA 1N9KA 3EVTA 3LRPA 3ZDDA 2ZATA 3OZ7A 3RE1A 1XFAA 2QUBA 3CZRA 3STUA 4BASA 3OE1A 4Z6KA 3PA6A 3MJRA 3RAPR 1PEYA 3OOWA 3MHPA 3GJ6A 1LC0A 1CJTC 4LYJA 3QIVA 4BVKA 1XVVA 2WV9A 3N59A 4LYEA 2VAWA 5ALNA 4N6GA 2ASEA 2ZSFA 2ZTUA 3CJQA 3FMFA 2AMJA 3SKXA 1Q83A 4NYJQ 1UOQA 4D0GA 1UOOA 1O54A 2WD9A 2IYLD 2Z56A 1T36A 1X7XB 4QVKA 2YNMA 1UJ2A 4BN0A 4ER5A 5KYTA 3B2QA 5JVDB 3A70A 4BB0A 2PGXA 3HA3A 1LSOA 2GBGA 2XT6A 5E7JA 1G3QA 3TUZC 2Q4BA 3PR2B 1EM8B 1HFWA 1ODIA 1EK0A 3HO6A 1Z0KA 1OE0A 1Q74A 4HO1X 2PX6A 3ZHTA 4R6XA 3D5QA 5HKLA 4F3KA 1RKXA 4BV9A 5CM2Z 5FWXB 3C1OA 2JJ1D 1V5GA 2CDCA 4RVNA 3L01A 1I4DD 2NU7B 5A62A 5JY6A 4E3WA 3FUXA 4IWYA 5K0LA 1UFOA 1GRCA 3HDJA 2FVXA 4LDQA 5BQ3A 1N78A 3AR5A 4NBSA 4BOYA 2WU8A 4DGSA 1PTJA 4D4GA 1YMQA 5KTTA 3P0HA 1QFMA 3A14A 4TS1A 1LBIA 5CVDA 3OPMA 4IPTA 2HUPA 4BO0A 1EDZA 1PSDA 4TL8A 3G82C 3NT5A 5K8CA 1SUSA 1QB7A 4GP7A 4UNIA 2B6HA 5KMGA 3CZ5A 1I14A 4B3JA 2B99A 5CW2A 4A5OA 4JWTA 1Z5UA 13PKA 2IQ5A 2NTVA 3PEFA 5JH7A 1KP9A 3R3SA 5EQJB 1OPXA 5AM3A 4O2RA 4YRIA 4J4TA 4XH9B 2XVYA 2C0QA 5HSGA 3G8DA 3FNEA 3QMMA 4AS1A 3W06A 4WT7A 2A7QA 3SZLA 2ZUVA 4I4NA 3T7KA 2ERXA 2PMCA 3T9AA 3RTAA 5E3IA 4OHOA 5B58C 3U6KA 3K32A 1WTAA 4BFYA 3ZCXA 3JYOA 1JDVA 3LP8A 3EQ8A 2QZJA 1I80A 4M1TA 5F7JA 1A27A 2AH5A 2C5AA 3W3ZB 4L9WA 3NZEA 3ELWA 3MLAA 5CGQB 3WO1A 1IQ0A 1GCGA 1AUOA 5GJCA 3H84A 1T9KA 3LXUX 2TECE 4JJKA 3HR7A 4KE9A 4LNHA 4UUPA 4EDHA 3S7ZA 4Z51A 3E9ZA 3ONNA 1Z5GA 1X7GA 1LJ8A 1YDHA 4AMUA 4JV5B 3FIUA 3KP1A 1GDDA 2QSZA 3MSCA 3LWDA 5IAEA 3SE0A 4HI0E 2KW5A 2Q29A 4XYEA 2JBAB 3LCJA 2I65A 1CDDA 4E2FA 1M5UA 1QTQA 2J67A 4R8KA 3MYRA 1KK2A 3MTDA 5FO1A 5BR1A 4NV1A 3RV4A 4BGVA 3VUEA 4EG7A 1FY2A 2ZI4A 5GIOE 3EVDA 2VYCA 3FKSA 2MCFA 2Q21A 5DEIA 1HDGO 4XRRA 1E2QA 3NAQA 4D0NA 2AZXA 2EGUA 3WIVA 1ST2A 1Y81A 1IM8A 1BROA 1JU3A 2FFJA 2FX3A 5FPPA 3TX6A 4KRYA 1DCTA 3ETLA 4MUMA 4QGAA 1JSRA 2J59A 3A6KA 3AUUA 2B5OA 4QATA 3QA3E 3R7WA 4YRNA 1AD2A 1GXSA 3NBXX 4NU8X 4UBJA 3GP3A 5ALYA 3PFGA 3L8GA 5ESXA 1Z16A 4MKHA 4UXHA 5EMNA 4N7RA 2XCRB 1F0YA 1CS4C 1KOJA 1T29A 1OBOA 2HD4A 3MGBA 4Q03A 1KEZA 1XCJA 1Z7WA 3AHDA 1BNCA 4U3JA 4AIRA 1E5TA 5EWJA 4M1KA 3PVSA 2RGYA 3QEBZ 3DJYA 3KT8A 3LA8A 3HNRA 1E5QA 4LTNA 4CQLB 1DOHA 1ZD8A 1N6NA 2WZCA 3RC3A 1GZVA 5CDSA 1CUAA 4HAXA 3QVLA 2O14A 1Z4NA 3X1DA 4MAMA 1L7AA 3I42A 4PAGA 2XXAB 4MV0A 3G17A 2NP6A 3HA7A 2LCFA 1P2BA 4K8RB 3UHFA 2ZBRA 2F2TA 4CMJA 2QVLA 1MA3A 4ZXFA 4QTYA 2XCSB 4POOA 2W8BB 3AUKA 3QVGB 5J5VA 1CJBA 3Q2IA 4MWGA 4OFWA 5KEIA 2GCGA 1C9DB 5F3DA 4CHTA 2WJHA 2BPOA 3MAJA 4EITA 3AFGA 2XTAA 3H2HA 4LXIA 4EKDA 1DTEA 4ES6A 1UAAA 4EVIA 4AX8A 1DBWA 2ZDGA 1BXRB 1P33A 2JK1A 2FOIA 4IDEA 1SY7A 2ZROA 3K94A 3SE7A 1ESDA 2VBGA 3KPWA 2X5JO 3M9XA 3V2HA 3PUHA 4CKZA 1DC4A 3GJYA 4PGFA 5L45A 2AUNA 4O63O 1RJ9B 5J2TA 4GQIA 3O90A 5EJ2A 5DTQA 2R65A 3H9QA 4BP1A 1NOKA 5JLAA 2D2XA 1OXMA 2R1ZA 1AQIA 1TTPB 4OSEA 1SVWA 2D7CA 3COVA 3QEAZ 1IZZA 1S5PA 1H1LB 2YXEA 3UJ3X 5GINE 3QOXA 3TOSA 2FV8A 2F9LA 3HCPA 5TX7A 4PNHA 2NQ8A 2ZIXB 5KYUB 4U39A 2EX0A 4XCVA 5B6JA 5C8YF 1P4GA 3K5IA 3V1TC 1WD7A 1Z6AA 4BY9E 3O7WA 3H5RA 3PENA 4N0PA 1QP4A 2WMDA 4A2PA 2J9GA 4U7GA 5EKSA 1FMLA 4OHYA 1BG6A 1DS6A 3PSHA 3K70D 5CLFA 2NQ2C 4CNBA 2GD6A 1QLHA 4TLLB 1MEJA 3CXRA 2D0OB 1C7EA 3FTPA 4JYBA 1GDTA 1PT7A 1V96A 3PWZA 2AFIE 4JBGA 4PHHA 2HEGA 1IN4A 4YRSA 1TKRA 5B55A 3RC1A 2BP7A 1ZDMA 2GO7A 3ZE1B 3T1OA 1Z8HA 4KNYA 4FS3A 5AOCA 3W05A 2PGAA 1CX9B 3SVTA 2I8CA 3JQCA 3IL2A 1S3FA 3ROPA 2QLFA 4FN5A 2Y1EA 1ID8A 4MR9B 3H9UA 2HU7A 2J6CA 2DPXA 2P0EA 2ZG6A 1Q1ZA 2HA7A 3D8BA 3HE3A 4TTVA 4P9NA 1W5TA 3K9GA 2WWFA 3IBFA 4DRXB 2CJXA 2ZJ6A 1ZITA 3R77A 3FMVA 1TM5E 1T3ZA 1ZKDA 1N2CE 1KDZA 1B73A 3KYBA 4P82A 1U8UA 3LDGA 4HLCA 4KWIA 3TLKA 1ZM9A 4M0MA 5KO2A 3ZDBA 4ZRMA 3U40A 3R5HA 3S2SA 4JEHA 3M5DA 1ZG3A 4NU0A 3AR4A 4M7PA 2JGKA 1G20B 2EBHX 1U7DA 4OUDA 2RE8A 1KAMA 2VTKA 1WBJB 5JCOC 1W44A 4NE7A 1M8GA 2ZTHA 2GZRA 3NHPA 1UFRA 2O2HA 2Y0CA 5DSTA 3WKDA 1ZOOA 2QOEA 3QOWA 5IYZF 1UK9A 5L6MB 1MPXA 4D6XA 1QYCA 4BRSA 2WWIA 4A15A 5ALTA 1V41E 2JA2A 2C1ZA 4GBJA 3A1SA 3VR5H 4ZN6A 1XLWA 5I9BA 2AX4A 2VATA 3NOQA 1FUUA 1CB0A 2R47A 1UFVA 3MCAA 2P9YA 3KKZA 1IPHA 4OXYA 2F8SA 3NFRA 4GVPA 4Q48A 1KI6A 2ZI9A 4MW7A 3LNCA 1WUHS 2XMGA 1ZI8A 2Z5LA 5K3EA 5I9SA 1E1RD 4G8JA 3TAXA 1JEYB 2FMUA 2O8DB 3QE4A 4MUKA 4MS4A 1NJ2A 1NXWA 1RMTA 1Y7TA 3D6TB 3DAYA 4ZO6A 4KOEC 4HNGA 4ZMRA 5YASA 4D8VA 3ZHZA 1X7DA 4DEVA 3WP0A 3EXIA 1QNFA 2BE9A 3NP9A 4MHTA 1GTZA 2GBCA 4HEHA 1QP0A 1XD9A 1ZN7A 3SFTA 3MA0A 3M1AA 4TYWA 1ZVMA 3A06A 1II8B 2PK3A 1XZAA 1WSWA 3GRYA 3EXIB 4P5PA 3INRA 3L1UA 2J41A 4L5CA 2QVBA 4YH1A 5AOVA 3IUMA 4DMHA 1JEYA 3KRTA 1HZZA 2E85A 4XWGA 1G63A 5KYVA 3ZW7A 3H2BA 4X8MA 4F3NA 2GTIA 5A3SA 2NM0A 4ENQA 1KI6B 5DTMA 1V45E 4DM3A 3WK4A 4JC4A 1UM8A 3DEKA 5LM3A 5FFMA 2IU3A 1VKZA 4CR8A 2ZRGA 1EAYA 2M9MA 5IBPA 4CM9D 2YVUA 4GL4A 1XPRA 1WUYA 4HNAB 4BZXA 2XTZA 4YO7A 5EIXA 5J2TF 4UMEA 1IOVA 2HNAA 4CEJA 3W7AA 3WLOA 4X7RA 4YR9A 1L4EA 3F6PA 3A9RA 4YMTA 3ILVA 2NUTB 1X2BA 5H80A 3UUEA 5BORA 5CLLA 1EP1B 2ZS7A 3DL7A 2QTTA 4HH4A 1I5RA 2AFVA 3N8IA 4PFJA 4NCBA 3B82A 4PPYA 3VZPA 4E32A 3HEAA 4W9RA 3PQ5A 1Y1SA 2OP0A 2IBTA 2XBMA 3KVOA 1U0NA 5K0FA 3T38A 2VHXA 1T8UA 1CUUA 2O9JA 5DTJA 3DWGA 1OFVA 1QTIA 3PWSA 4MQMA 1M83A 4MWDA 1JQKA 1WIWA 4UVHA 1H6CA 2C5BA 4ON9A 5A7FA 1HETA 1X94A 1Z5OA 3AH8A 4E2YA 4B9AA 2XGSA 2GT1A 3R6WA 4HDMA 1BWQA 3R09A 4MGIR 3OT5A 2WKRA 1EYZA 4GKVA 3EXFB 4DYDA 3ACDA 1Y8CA 4WOCA 3U3OA 5B7NA 1AA6A 1Z4JA 1T0JB 4JUAA 1NE2A 2P9TA 4G1BA 2QTLA 4QBHA 5KTRA 1N9GB 3AKEA 2JC3A 1BFKA 1S01A 3BMCB 2PV0A 4YV1A 3UB4A 4EUFA 3N53A 2DBVO 4Q4DA 2PX0A 3BREA 5EJ4A 1FP6A 3A11A 3ZHRA 3MMPA 1ZU5A 4DQDA 5AK4A 2B0CA 2VSYA 1SCIA 2VF8A 4JB2A 5JSFA 2PY6A 4W7HA 4FU0A 1DAEA 2XE7A 5CRIA 2R7NA 3QG1A 1L4KA 3D1VA 5HF5A 2ZS8A 4BP8A 2V0GA 1NNEA 5CCXA 1LB1B 1JA1A 5JHHB 1FXUA 2JGRA 5GTDA 2OG2A 4IKPA 2V0NA 2FSPA 1HFKA 3Q7PA 4Q0MA 3VPSA 3WB9A 3PXEA 1VIMA 1PFVA 1Z68A 1TUBA 3B12A 1TZJA 4ARZA 5IM4A 1TCAA 1YQ9A 1A8PA 3NH6A 5CUQA 1D2CA 2YHIB 4O1IA 4CL2A 4DR6B 4OM8A 1RPNA 4S2UA 2FVYA 1QHSA 1VP9A 1KMNA 5FJIA 4CLEA 3D7SA 3OEYA 2COKA 2QN6A 4KVAA 1GPYA 3SZUA 1D9ZA 3KQOA 4FNMA 3M6XA 3AI1A 1YIOA 3D6NB 4OA8A 1O9GA 1UXGA 5AH0A 2Q7OE 3CRNA 4DSTA 3W4KA 5BNIA 1C81A 1SPXA 3LOPA 1L5KA 4DGQA 3DVSX 3ZU4A 2AXPA 4RJTA 2P2GA 2IYVA 2VTEA 2XKBA 4F2HA 1T2UA 3L9WA 3SVLA 1MV5A 4XWYA 1HZZC 3P2OA 1H2AS 3PTAA 1ONPA 2XGMA 2ZBDA 3HACA 4CLOA 2X76A 1WTCA 2O3RA 4GOOD 4L73A 5M2QA 2VQSA 2ON6A 3RRNA 2OFPA 1DXHA 4BFUA 3K09A 1ZGGA 1VLLA 3BGWA 1DAGA 3BH7A 2X6QA 4C4YA 1EAMA 3KZKA 3GJZA 4BNMA 1EE2A 2OE2A 1Z35A 3PI7A 1ZH8A 1ORDA 2YV5A 3TEFA 2O5RA 1G8HA 1M9NA 1PSZA 2WJWA 2V03A 5H70A 4C0XA 3GLGE 2WTEA 2YWXA 2WAOA 2D1FA 4IHQA 2J0SA 2ZUUA 1KO4A 5DISB 4A6EA 4AZ0B 3KZ1E 3FIJA 1OLUB 3KOYA 4FPXA 1QP8A 3AFIA 5EESA 5C5EA 1VPTA 2GYUA 3DCJA 1Q2UA 1EFCA 3A4MA 4AJHA 4JELA 4D46A 4K86A 4RH3A 3I12A 5HKBA 4PV7A 3FJYA 4U2FA 1F0NA 2JBWA 1ICIA 1WHSA 4G07A 3SC4A 2WF6A 2Z30A 2OHHA 1OXSC 2VJMA 2WM8A 2UZIR 3IVXA 4LUCA 4RKFA 3VR5A 1E58A 5GM2A 3SYKA 3HCWA 4YP5A 4MEAA 3RBVA 3B70A 1QHGA 2O7VA 5ECGC 2FQXA 2V3VA 1U9CA 3UK2A 2KHZA 5JBQA 3OJFA 2ZUBA 3H4VA 3M1LA 4HJXA 4CKWA 1KXJA 1DZIA 1QZUA 2NNLD 1AOXA 3M70A 3BGVA 3QU5A 4PSUA 1VMEA 4ADSG 1AV6A 2V55B 1RABA 1Y5RA 4RADA 5FBZA 3UMCA 4DRYA 1X7WA 1IY9A 1YQUA 3GFBA 4IIEA 4JI1B 2HHCA 4QOFA 3TPFA 2PS3A 4DMMA 5J3JA 4MYUA 1X19A 1ZCAA 3C3BA 3PE6A 2IIQA 2N1MA 3E84A 4IDDA 1QRAA 4I9NA 2ZXFA 2VWPA 1YH3A 1MTZA 1PYOA 4JZKA 4B6PA 1VLVA 4E5DA 2F64A 1QZZA 3IAFA 2WUFA 5TS2A 4PO1A 4UQLA 1PS8A 2FRDC 4DJ5X 3SHTA 2D5LA 5BQOA 2C3OA 4D98A 2ZZNA 3HDYA 3H13A 3ZR4B 2WSMA 1U4NA 3W77A 4AROA 3C1AA 4LISA 4EPTA 5FUYA 1GN9A 3DMDA 1YA6A 4JHLA 1NSTA 4ND4A 5I9MA 4WXRA 4MRAA 4OL0A 3V2UA 1MF7A 3LKDA 4MVJH 1ECJA 3OKPA 4GSKA 4N03A 2P2NA 4PPNA 1RE0A 1UZMA 3U9SA 3DXZA 4ROSA 5ARDA 4E2XA 3R5XA 5LQMA 2XCTB 1I3CA 1C1XB 1LTQA 5FQNA 1R12A 4HDAA 4X85A 1N6OA 1B16A 4OAPA 2AQ8A 4DEXA 3EA4A 1AUXA 3HR8A 1PNVA 1TQ6A 1DTWA 4NYJR 2Q45A 4TQAA 6PFKA 221PA 4XUEA 4AJLA 2ZYUX 3L49A 4OU5A 3FDFA 4N54A 3WE7A 3F1KA 1TU3A 2OYCA 4IH4A 4Y1EA 4RTLA 2W6JA 1OYYA 3UAZA 3FY4A 2EZ9A 3OG9A 1D07A 2G77B 4PX2A 3FXAA 3FUVA 3FUCA 5AM4A 3V8EA 4DLUA 4L75A 5DNEA 2C4MA 5JH7B 2W42A 4JCOA 3FM9A 2L17A 2G17A 3ZXYA 4OK6A 1LLQA 5TNXA 2IYXA 2G0TA 7REQA 4KX5A 3G2QA 3QF4B 4Z99A 4WBNA 4P4NA 4IFTA 3WRVA 5K09A 5DBFA 1HL3A 2WE7A 2X14A 4NQRA 4ROTA 2A86A 3GJQA 1A95A 3GVXA 3QRWA 5CBPB 1FA9A 4H17A 5J63A 4NCAA 1X1RA 3FH0A 3PNYA 3ZDXB 3DKPA 2RH4A 3QBTA 1V39A 2HIAA 2VHTA 3CLRC 5KCZA 1OX4B 1OI7A 1MO3A 4J3FA 5JNLA 2W9XA 3H3XA 1XYGA 1EWYA 1J0BA 1I9GA 2A0FA 4KFTA 3PZBA 1SHJA 5TSDA 2BGRA 2P68A 2O5EA 4UFNA 4DBVO 3J81A 5FOTA 3PXAA 2B92A 2J3KA 4GSYA 1ZOPA 1TK2A 3AY7A 1DRUA 3JQ8B 4Y9UA 1N1EA 3QI7A 2HCFA 5EGSA 3MS7A 5G0UA 3V55A 4BMYA 3R3WA 2PRYA 5EOVA 2BGGA 1EM8A 1QRTA 2W2QA 3TAUA 1UJBA 3TQOA 5EIAA 1R6XA 4TMZA 3M6WA 3R0QA 5JXJA 1RJGA 3C6QA 3M3PA 2FWIA 2YS7A 2A88A 3GQBB 4L78A 5TEVA 5IAKA 2FWBA 3UT5A 1F38A 1T2VA 2J30A 3DAFA 4FZ3A 5JQWA 1XZPA 3JAWA 4H0CA 3H1PA 1KYXA 1CR6A 1D4AA 1AXGA 1FFXB 1KA9H 1CUCA 2FWPA 2WC1A 4HNSA 3AI3A 2QMYA 1OBVA 4LX0A 2NP7A 2ZPAA 1UPCA 3IRVA 3FRHA 4IQ0A 3TTUA 1TEVA 4CDNA 3ESCA 5LC1A 4YRDA 4M22A 4A5SA 4IEFB 2GXSA 2PD4A 1EG2A 2GYYA 4RF2A 4CCWA 3L8ZA 2PGLA 2Q6IA 1OI2A 2IGTA 2ZJ5A 3AP2A 3QBVA 4MH0R 3QELA 4TN1A 2OXIA 4B43A 4QG3A 3AILA 3PC6A 3ZKWA 1UBHS 1T5SA 3EXG1 4M1QA 4ETIA 4OKIA 4HQNA 4ATNA 1ISSA 4O8ZA 1B15A 1Z2PX 3RS8A 4ZI2A 3MJTA 1LWOA 5KDLA 1QDEA 3RVSA 3T7TA 1U1FA 2N3ZA 3F0TA 3NOOA 5EHQA 4UM9B 4A36A 1ZOIA 4WASA 4DIOA 3ZXIA 4QGSA 4F2PA 5F23A 1DRKA 5EHGA 3KCQA 4BLSA 2EDAA 4TS3A 4EUNA 1DDOA 1LJUA 2RHJA 4JYZA 3SK0A 3VHXB 1XVIA 3QVKA 3OEEA 3QGMA 1DUIA 4CMKA 4OIMA 3WC4A 2P4HX 2AL7A 4EHBA 2PHZA 4ALKA 3JYLA 3LQRA 3VR0A 3FOFC 4RSHA 4NBTA 1HT1E 1GV0A 4DUZB 4BVHA 3BIXA 4N01A 4D97A 4EVRA 4XIYA 1Z47A 2FXVA 4HG2A 4CM4A 2RFLA 1XTBA 4NKRA 1SD2A 3OZCA 5JD6A 2WDZA 3EXG2 3OQHA 4BUCA 4N48A 1QH1A 5AUOB 1PIWA 2I2XB 2F3RA 3K30A 5GP1A 3R9IA 1E4EA 2PYIA 1P5ZB 2W2LA 4RPGA 1G3RA 3FE2A 3WL4A 3KIPA 3MCVA 5LKAA 2GUWA 4ALJA 4RUKA 2EFYA 4QUBA 1RR6A 1YFZA 2H2WA 2HXSA 4B2LA 2IZ1A 5BSVA 2HXYA 5CX1B 2VZ9A 3SYMA 2YN2A 3E8MA 3WGMA 4F6LA 3NB0A 3OC6A 1K6MA 2V6BA 2V5AA 3IA7A 1F0PA 3R0ZA 1VYVA 4DQ0A 4P93A 1NBMD 3SBOA 4Z49A 2R5NA 2X8JB 5KQPA 3GLIE 5EQTA 2V4ZA 3GG2A 2P6RA 2PLWA 3LFHA 3NIBA 3DBOB 3H11B 2VPIA 5GONA 3LD9A 3R41A 4W1RA 3WK8A 3N0XA 4W82A 3QV2A 1EG7A 3FYSA 4FSHA 2PO5A 3HU5A 2P0AA 2WABA 3IP8A 4FTWA 4HZUA 4IV5A 2Z3ZA 4J94A 2JI7A 2VUUA 3F2IA 5ALXA 1S2LA 1C3XA 3R0IA 2JFOA 4KQEA 1K0FA 2DPHA 3SSAA 2OBMA 2AMYA 2QMUA 2RAVA 5BRNA 4EB8A 4XYBA 2D0PB 2C42A 3NR2A 3LUGA 1WP9A 4ZDJA 1PR0A 1EZZA 1GEGA 2D54A 1JLRA 4IINA 1XZJA 4HGQA 4K9PA 1K3FA 4K88A 3DS8A 3RYHA 1CUIA 3WB2A 4DQLA 4KQFA 5EHZA 5IDXA 3E82A 2W2KB 4XPZA 5BNFA 5P21A 1XCGB 1YGYA 3D4LA 4OSOA 5LJLA 1OX4A 4KFCA 1U7ZA 2JKYA 3GNSA 4D9NA 4PGGA 2PR7A 1I94B 1ORTA 2G7ZA 4X0EA 5C32A 2DQZA 1JB1A 2OBLA 4Y2YA 1VMKA 1OFHA 3I0ZA 4QLBA 5CBPA 2O54A 3HA5A 4TTQA 4YHBA 2B0JA 2AYZA 5EQDA 1YB4A 3EVBA 5JY1A 2VDWA 3FX2A 1P4HA 3GV0A 1EH5A 1XLTA 5B58T 5JATA 4GI2A 4NMLA 3V32A 3LUKA 3HRHA 4R69A 3A8TA 3SJ7A 3OOYA 1TMYA 1N2BA 2BL4A 2PSJA 2V7GA 2VDPB 3EZLA 4B3CA 4NOLA 3GOQA 2OCBA 3PGJA 2RH8A 1S2GA 4YX9A 3NUQA 2GRJA 1F1JA 1UDRA 3DQZA 1ZY2A 4KLNA 5B2ZA 4WK6A 3WLAA 4UEQA 3C97A 4W9NA 1K7CA 1IUPA 5SICE 5I01A 4UOZA 3G23A 4HEA6 2REOA 4L08A 3PBKA 3VYWA 2JFUA 3TUJC 1CY7A 1Y42X 3VVLA 4TLCA 1OLOA 4ARAA 4EA6A 4XGNA 5F5XA 4B3FX 1JKMA 2NLOA 1Y80A 1F48A 1ZOSA 1YRBA 3CX7A 3PJGA 2O8BB 5IT0A 1EA7A 1ZS9A 1P18A 2PIDA 3ZDRA 4M83A 2H17A 4AZVA 4YV7A 2R4TA 3Q1LA 5J58A 2G1JA 2WU4A 3BCHA 3I6YA 1KEVA 1YTUA 1U0EA 3ACCA 2WWVD 2FFRA 1QVAA 2DQKA 3NJ8A 4FBLA 2VYFA 4TYPA 5B53A 3C85A 3V48A 3CEHA 3URMA 3IKTA 4OXKA 3PFKA 5HOEA 1W85A 1U0RA 4FFMA 5BOSB 2NO9A 4J7CA 4KFUA 2VF5X 3CLUC 3RQIA 1N75A 3ZLVA 3AR3A 3ZXXA 4LDNA 3B1WA 4MUXA 1SBIA 2I54A 2HNKA 3MBKA 3KAKA 4ED9A 4J29A 1SXPA 1LBEA 4P2GA 2JGDB 3SX0A 1NX9A 2HV8A 2REXB 3LPAA 4HN4B 4IJWA 5CB4A 1SG0A 5LOVF 3ZU5A 1BGVA 2Q0HA 3AR2A 4N3AA 1RLOA 4R71A 1L8XA 2AV6A 2X6RA 3R4CA 4MKZA 4KJXA 3TB6A 3UV3A 3SEZA 4FGKA 4JBXA 3F7TA 1IZ8A 2XUQA 3QE2A 4YRTA 5KTOA 3TGWA 1SXHA 4R9UC 3BXOA 4QTUB 5HNKA 1QRSA 4QPNA 2Q5CA 1D2RA 1W4LA 4AG5A 2R1VB 1JQBA 1JVSA 2A0XA 3GBVA 1OF1A 3QBEA 1S7CA 3DPUA 4YJHA 4YV2A 5IXYA 1V5WA 3KFLA 3DZDA 3CKLA 4R2MA 4B6GA 1VSQA 4HX5A 2WTNA 2YQZA 2GEFA 3H2GA 1VI5A 3BK7A 4TLDA 3LE8A 3FPSA 4W7IA 5IABA 1WA5A 1Y1TA 3KVYA 4QREA 4PVDA 4UPDA 1VYUA 3LY7A 3A9TA 3ZN2A 2JHAA 5K7SA 3A9SA 1OT5A 3QY0A 3FETA 4NFYA 9LDTA 2GWHA 3PT9A 5JPIA 1G38A 3NX4A 1ZA2A 1JAHA 4ODIA 1W0KD 4HYTA 3M33A 2ORED 5E2AA 3OPYA 4FW9A 1NVXQ 4MUBA 4OQZA 1IQRA 1RADA 5IJ0B 3FPCA 3IEMA 1RWQA 2FEAA 2QXYA 2Q6VA 2Z58A 5EE9A 5H02A 3GEMA 4NCIA 5BN3B 2PJDA 1U0TA 3RWBA 2OO3A 2F3TA 2OG1A 4B8ZA 3CKYA 3CJTA 4YYZA 1NQTA 3H9JA 2A9RA 1M2KA 2OV1A 5TVGA 1ITZA 3VTFA 1XCBA 5J2UB 1CS0A 2SICE 2WBLC 3F5FA 3DA8A 1T6XA 3GXOA 3QFCA 4CQJA 2RBKA 5G3YA 1GNTA 1PJSA 2F3PA 3Q7TA 4Q1DA 4TQ9A 3A0RB 5DZSA 5L95A 2H57A 4I19A 2GILA 1FX1A 2X5OA 3KB2A 3NDPA 3VJRA 3FHOA 1BQ3A 1YR8A 3M2TA 3BFXA 4K9KA 2EXXA 1SC9A 2GD2A 4CCYA 3AONB 1I2BA 1T5LA 2A5YB 2NZWA 4OQDA 3U3XA 2Q4RA 2A59A 4J2TA 3SZ3A 3SQWA 4JJEA 3A05A 1DIGA 4NZMA 3W2GA 1Z07A 3G2PA 2PX4A 4FYJA 4XIFA 5TPWB 3T5DA 1YL5A 2CXSA 3FCOA 2A4MA 3PNOA 5TIIA 3K9FC 2CL5A 1QSGA 4ER3A 1U2DC 4EVSA 2IYSA 1I7DA 5KPDA 1JMYA 2ZWMA 4Q7JB 1E7QA 5IFKA 5DI9A 1KC1A 2YHIA 3PQDA 1W8IA 3B1YA 5FTMA 5BSUA 2E37A 4QT0A 3CBGA 1GTJ1 4Z3OA 1XZEA 3D8NA 2VXYA 3C3CA 3SVZA 4EO4A 5JQGB 1NULA 2QD1A 4C43A 5JRZA 3IE1A 1LVGA 1BMTA 3AF5A 3I2FA 4WA7A 1XEWY 1CR1A 1NGSA 1WJGA 1BDHA 2GXUA 3BZWA 1S9DA 2C29D 3OTOB 4IRXA 1E2EA 1JIKA 1VHLA 4L16A 3P97A 2NU6A 3D3WB 1OXBB 3BMXA 3AVWA 1NU6A 4RXMA 3RSGA 4MUNA 5AKEA 2B5WA 2J48A 1JIJA 5LMZA 1JXOA 1YTLA 1W88B 1JQLB 4Z4QA 3NHFA 1T9GR 5F7ZA 1DG1G 1FFHA 1I2MA 1XD2B 1N2OA 3MRSA 1I01A 5B36A 4UD2A 3L8CA 4OB7A 3MTEA 3EC7A 2F1RA 3C3XA 4R81A 3Q5EA 1YKGA 3HJHA 1EVLA 2C2XA 1KEUA 2P5TB 4EO7A 3JQFA 1UOPA 2GK7A 3I23A 3L7IA 4INPA 4BBAA 1E7YA 3M4YA 3EG9B 1HURA 1PZXA 1W46A 1YB1A 3C4JA 2J3QA 4UTVA 1N2JA 1UXKA 2H1SA 1Z8FA 4YI3A 1I3NA 3EULA 2H4YA 4Y2PA 1WDWB 4PPGA 2ISCA 2JJYA 1BAPA 4ACBA 5G4KB 2NSHA 2VI5A 1NVTA 3ONWA 3R74A 2Y1CA 4DKXA 3CZMA 5JALA 1QV6A 1KYTA 1GRQA 3IT2A 3EEOA 1Q0PA 3KJZA 3EARA 3FVVA 4GX1A 2EOAA 1CUXA 3EVAA 4XD7D 1GR0A 6ABPA 5KTYA 1DBPA 1HDRA 1UMCB 4HRVA 4RVSA 5BRAA 4COKA 4Z54A 5BW5A 1J90A 5JMTA 4D74A 4TTPA 1Y9EA 3EG9A 5L3VA 2KSQA 3EGCA 3CS3A 2QBYB 2AWOA 3QFRA 4C78A 3HY6A 4G5GA 3ZJ4A 5BMVB 1F5SA 2IRWA 2WB2A 3IUEA 3O4JA 4MMZB 2ZULA 3JATB 2AR7A 4KYVA 3RUFA 3SBEA 2H52A 3TM5A 1G59A 4LHYA 1VBNA 4OHWA 1GPLA 4U0JA 2FQ1A 1AN9A 2FSHA 3PTLA 1K06A 1JR6A 3A1TA 2JGAA 2FETA 3FVTA 2GEUA 3GLHE 4P4SA 2HWUA 4QNMA 5EN4A 4C22A 1B6GA 2PS1A 3BA6A 5CVCA 4BLTA 2HIHA 2IS1A 1FTQA 3LUCA 1CUFA 3O1IC 4E13A 4LS3A 4FZJA 3T3PB 2B4YA 4XQ9A 3D4IA 1GYQA 1W0JD 5IBQA 1P8JA 3P26A 4TRRA 3G2IA 1H2WA 3D4NA 3EPRA 4MS4B 4KN8A 4J43A 2A9FA 5F1YA 3TLBA 2ZUWA 3FBGA 3W8RA 4AL4A 4DA6A 4ESHA 4MYRA 4NYMR 2PKXA 2XKAA 1BD4A 1MXHA 2X8BA 3ESQA 5JZSA 2GJ9A 1CZHA 1ECFA 5DRYA 4YIHA 1DINA 5IYZB 1GM5A 1JQJC 1XA3A 4L4RA 2O8EA 3INTA 2BEVA 4GC5A 4LHEA 4HXEB 2FR0A 1KGDA 1R0RE 3BB4A 1D6MA 2DT8A 3N2KA 5A9SB 1BJRE 2ZJZA 3H9EO 3BAFA 5LIRA 2PIAA 3OQ1A 4GYWA 5DNAA 3EEFA 5MHTA 2IZZA 2PAFA 5LQSA 4NECA 2A58A 2IP4A 3Q3GE 1E32A 4BNVA 3E9QA 3K1ZA 3RSFA 3G7NA 4P5EA 1AM4D 2BVNA 3LO8A 2LVBA 5HE9A 2OO5A 2FPSA 2IP2A 3TOXA 3VR5D 1KRWA 1BMQA 4K9SA 2AQHA 1WV0A 4JUCA 3P9IA 3PA8A 1YRWA 2CSUA 5D1NA 3S1AA 1E6MA 5GJBA 2ZBVA 4KXXA 2H2FA 4JNCA 2CL6X 5AIBA 1RAAA 1HG1A 3RG2A 4F5YA 5A71A 4F86A 1FJ2A 3GJ7A 3HEBA 3RKRA 2IEIA 3UCEA 5KVAA 2JLYA 1SOVA 4BVEA 3F7NA 2OCPA 4XGRA 5BNTA 1Z12A 3B8HA 2D0IA 1Q7RA 3MXTA 4K3UA 3RC2A 2LDBA 5B12A 3C48A 1F7VA 1SCDA 2F90A 1GUBA 2CDAA 1TJNA 5K05A 1XCLA 3TSAA 2I2DA 3IAM1 1ISJA 3PCRB 1U90A 1UK6A 2AI1A 2HU8A 2WJ4A 4MYCA 5IANA 1C7RA 2IPXA 3G2MA 2R4QA 3NHLA 3L40A 2B1IA 4FGZA 3ZWDA 2KLHA 1ZP6A 1MC1A 5PNTA 3V5NA 2DPLA 5ED0A 3CVOA 3OZIA 4RVUA 2GK3A 1DBVO 4YJHB 1O3YA 3UMSA 3RK4A 1JUDA 3NOVA 5E1MA 4RHTA 4L57A 5A6VA 3DHVA 1QO9A 4UFPA 1GL9B 4F8YA 1RYDA 1CUDA 1QO0D 1RJEA 1L6RA 4LXGA 4X91A 3ZE9A 2OAEA 1OX6A 1NZJA 3UGKA 2BKLA 4N3BA 1H8HA 2WPDD 2ZM5A 1P6QA 3W8DA 5DCYA 3HBJA 4ZZ1A 4IIVA 5CFQA 2RHHA 1AUVA 2W6ZA 3T9EA 3A6JA 2AZDA 4BNXA 4C7KA 3TNLA 4Z3KA 1E9SA 1SULA 4O4IB 3IQXA 3LF2A 3V1NA 2YDYA 3WLRA 5DT9A 1FTGA 4PYNA 1GD1O 3I1FA 3WO0A 1E9CA 2ZT5A 2WTAA 2XCOA 2V59A 2V9PA 3CH7A 4FMDF 1WUJS 1IY8A 4MPDA 2QI9C 4N4AA 4CMBA 5HX7A 4QOJA 1KS2A 5FTWA 3URKA 1Z34A 1V26A 2ZJFA 1XN4A 4WGGA 1TECE 4QUKA 2M6KA 1B23P 1USWA 3DBRA 4PAOA 4D9JA 4E5NA 1T1JA 4LZNA 2QTWB 3B52X 4ZJYA 2HTEA 5F4BA 5C8DA 5ALLA 4TXJA 2FDXA 4TVOA 4KQ2A 2PZGA 3OO1A 4L8VA 1JG1A 2ZYWX 3TVDA 1M2NA 4DIKA 1PZFA 2JFHA 5EZ5A 2QA5A 5TPWA 2O7QA 5C7YA 5DH9A 3L8HA 2W8BA 4ND3A 3RK0A 4XR4A 4NQZA 3OMXA 2XA1A 4O0MA 3WZ2A 5CFPA 2C95A 4PEVA 3COSA 3E27A 3WWOA 1CYEA 5I5GA 2OQIA 1E2UA 1X7YB 2GBFA 4KC0A 1TNDA 1XMIA 2IIPA 4DJJA 5JD5A 2Q0QA 3BTSA 1QCYA 5CFMA 1DIHA 2Q3FA 1PGQA 3MJCA 2HI0A 3GUCA 2CW5A 3D02A 1C5KA 2YFYA 3O8QA 4Y1RA 1N6RA 1E96A 2OXTA 1VG9B 1TD1A 5EWJB 1SR8A 2V1UA 3HO1A 4U3JB 4EB6B 4GNRA 5EI5A 3C15C 4J90A 4RFLA 5MGNA 5BV8A 1ZCZA 5REQB 5E7MA 4MWCA 1GXSB 3HYTA 5BYBA 1XMQB 2Z6UA 5FLKA 3EIHA 4CQMB 3R40A 3UJ9A 4DV3B 3BSFA 3R3YA 4FCVA 4LSWA 5IVDA 5T4EA 4CM9A 2V97A 4MSUA 4PQGA 4QXOA 5FOQA 2A9PA 2PUVA 2WYIA 2UZ0A 4CLHA 2DETA 3ZNPA 1EDBA 2IPMA 5EPOA 4J16C 3EODA 3WL7A 1ZMTA 1FVXA 1L4MA 4LXHA 3T41A 2VYND 3F7OA 3OBBA 4IJQA 3PDHA 3L93A 4JEIA 2R96A 5C18A 1OSNA 3HCFA 1GZHB 4FDTA 4IJVA 5CK4A 1DMSA 5C7OO 3AYXB 3KLNA 1EFPA 1HL7A 2CHQA 4WZZA 4RE6A 5ESRA 2VHCA 1C14A 2ZSDA 3WY9A 1PNRA 1OR8A 5FD8A 1MIHA 1WOYA 5TJ9A 3X2SA 4C04A 2B1RA 1E2IA 2XYQA 4ZICA 3K2BA 3KXPA 4JI2B 1IZ0A 1SCAA 1JVBA 1AKNA 5DULA 4ZEXA 4DSZA 5FPSA 5TMPA 3DHEA 3B20A 3LSYA 1RQLA 3QITA 4HGRA 1ZRMA 4H1WA 2P9QA 3BRWA 5JIBA 2R00A 3HY4A 3EMKA 1H69A 1I24A 3N07A 1PL7A 3IE2A 5E7QA 1GLVA 1JBKA 1Y6ZA 3E3LA 3HB1A 3EIWA 4FOLA 4Y1FA 1P5JA 2D2EA 4TRMA 4QQ8A 2WUWE 2WJAA 4JB3A 2EG5A 3CM0A 3BJRA 1MOQA 1LPAB 2BJWA 2JVKA 3B3FA 3M5PA 4MQ6A 3TLEA 2SKDA 4CIXA 3P96A 1BCSB 5LZ9A 1X1QA 3OMLA 1JXAA 4L0QA 1XLUA 1OIXA 1W73A 1Z28A 1YS9A 1DCFA 2PANA 3S2YA 5HVNA 2CC2A 4MUGA 721PA 2ZUTA 1TCUA 1ZD3A 3Q9LA 1R9GA 1X3SA 3NG1A 2I6TA 2QP3A 4C7BA 1XTKA 3MC1A 1MO4A 2G8NA 2OV3A 1XD8A 7ABPA 2J87A 2ZR0A 4FYXA 2QW0X 1KYWA 1Z0IA 3OJEA 4V0OA 4B79A 2Y1XA 4U6SA 4C4SA 2XEDA 4EI2A 5JSUA 4QELA 1VHTA 3NEYA 4NCHA 1N8SA 4DHWA 3C7CB 5IJZA 4ARIA 2NT3A 1D6JA 4HFMA 4EHHA 1WULS 4HAZA 1MX1A 1SM4A 9GPBA 4O2AF 4L7VA 5AI9A 4R2HA 4IIHA 3ND9A 1G8KA 4H7IA 5AO9A 3UATA 2BRUA 4RHXA 2OY0A 4YY3B 2DR2A 1JHQA 1XNRB 1T9HA 3LVFO 3R0XA 2Q5OA 4XM1A 4XE5A 4WI1A 2FZ5A 3UG7A 4QM7A 3ZZNA 5KQMA 5FWYB 2GF2A 1V8OA 5AIAA 1TKCA 5BSTA 4AJ2A 5KREA 4E14A 4ZV4A 5AI5A 5JVDA 3GA0A 1U0FA 1RACA 2DBYA 1DT3A 2HRQA 2VLBA 1Q1GA 3LIPA 2PSDA 3PV0A 3QELB 1HOXA 1HOTA 2NYUA 4NP6A 3KHKA 4HB3A 5I7RA 3AEXA 1UBGA 4OMUA 3O74A 5M7EA 1Y5NA 4BQPA 2P2YA 4A10A 1IY0A 3P4XA 4M8NE 4LNAA 4QJ4A 3GEDA 4KGZA 3HK2A 5EJFA 4F5WA 2D4HA 3FNBA 1J7JA 4GLFA 1SXJE 2BEUA 3WNBA 4LF6B 1IU9A 4A16A 5CXUA 1B0PA 3LO5A 4PHGA 2ZSJA 1DX9A 4PZCA 2GCOA 2PRJA 5ECYA 3RYFB 1KYYA 4D81A 2ZAYA 1DRJA 1FYDA 2XKKA 4ERXA 3P9XA 5CTAA 3TJMA 1HO3A 3ETNA 1WW3A 4G5HA 1NXTA 4RD0A 4PSCA 2FRVA 2WIKA 2JAQA 1T9BA 2HU2A 1IEWA 1PT5A 1EXWA 1QHYA 1U28A 1G5HA 4BLRA 2VQFB 2X1MA 3I34X 4QOGA 5AHRA 2VOJA 5ED4A 4BECA 4B34A 4ZJZA 1K8YB 3JQ9C 3TRDA 1K92A 3AZPA 2B3TA 3EZYA 3F6BX 3K5PA 4JL5A 3O94A 3VJLA 3H5VA 2BI4A 1ANKA 3DBHB 4P08A 3UJ8A 1UK8A 3BFPA 5CMLA 2CKMA 1J6UA 2UVDA 2ZIEA 4GYJA 4PO9A 3PNVA 1L8LA 1RD4A 4FJ2A 4QLAA 1YZVA 4Q4AB 4J6EA 4NBLA 5CVTA 4NDAA 1QIEA 1U8XX 5FWDA 3HJNA 3DO8A 3UEOA 3AIIA 1U3DA 1D0IA 2QYSA 3QF4A 4I1SA 1GGFA 4JY7A 3COPA 4MA0A 4EFLA 5DT2A 5H5JA 2DC1A 1G21B 3LUJA 4UAJA 4YEDA 5T6MA 4ZYZA 1JHYA 1GT91 1RSZA 1U3FA 2VDVE 4NFHA 5AW1A 3DB1A 1QMPA 2GRAA 1XC7A 2R1UA 4M49A 1IBSA 3K9QO 4JJZA 3C1TA 2VJYA 2PUBA 1BH2A 4L3VA 5DM2A 1EJBA 3DOJA 4ZOEA 5JMPA 1KYZA 3KKQA 5HIAA 4MKRA 2HRBA 2FPGA 2JHGA 4NONA 1FNBA 3U3JA 5FI5A 3NVMB 3KB6A 3GHHA 5EWMA 3ISVA 3OF2A 4ZTZB 1NXOA 5LLTA 1Z4QA 1RZUA 1YAHA 4HRXA 4I6JA 4MOWA 2OR3A 1CJVC 4MJLA 4NOMA 2I87A 3X1MA 2ZRHA 3E03A 5L53A 3GVHA 1JT9A 4YCCA 3PDCA 3TDMA 4DARA 3WQRA 4LF5B 3I5XA 3BDIA 4KKXB 2Q6LA 2QR2A 4CMIB 3OCZA 1UEXC 3BE6A 3E5HA 2DH5A 1D5CA 2DY0A 4K9DA 2QZZA 1HG0A 3A4TA 1RXVA 2B78A 4OTZA 3ZXUB 4R2XA 1LNSA 2VP3A 1QDLB 3MTAA 1F1BA 4GH5A 2Z1MA 4DNQA 1C7ZA 3G2LA 2VRCA 4GE0A 1OX5A 5KWSA 3AP3A 2CXNA 2NPIA 3WGKA 4NH4A 3DFUA 1CUJA 3AYZB 4UEKA 2Z08A 1X7ZB 1HNXB 1RM3A 2HRDA 1TW2A 3KYIB 2OBBA 1JA0A 2FP4B 2ZAIA 2DP4E 1X8XA 1L1RA 2MWMA 3BBLA 2ZQZA 4N8SA 4OGKA 1STOA 3HWX1 4TPKA 2YDXA 2QI9F 1UMDA 2R8XA 3L82B 4I0WB 1X70A 2EQ5A 5DYWA 1EIWA 1MAHA 4QX6A 4XYGA 5EZQA 1G0OA 2P9CA 2VJDA 4B2YA 4BNDA 2B4RO 1FP4A 3KEMA 3QPCA 4M9ZA 2O6HA 1K7EB 4UTPA 2RHCA 2Y92A 3WDKA 2K7FA 3DLAA 3VFDA 1DC3A 4QEKA 1XWFA 3KEQA 1NSFA 3A1CA 3L8YA 1QH9A 1FRNA 3OPXA 4HAIA 4PX5A 3RVLA 5JASA 4M99A 5HP4A 1BH6A 1Q0QA 2ZRAA 4MI1A 5FR1A 1OBFO 3LA6A 4X1KA 4EA8A 4QPJC 2B6NA 5AD1A 1GTSA 2YY7A 1BZYA 2OC9A 2CNWD 2YYSA 3V7UA 4Y2HA 5A4MS 1QRUA 3ISTA 2ZSKA 3UJPA 1IXZA 3OCXA 4MGHA 4EW6A 3ADOA 1RQRA 2Z2XA 1FDRA 3L4BC 5IC6A 3ILYA 4AZ0A 2N42A 2C92A 1KQNA 2LKCA 4WCFA 1NI4B 3JX9A 1QX4A 4J7XA 1T0HB 1VSTA 1CLEA 1NNLA 3OT1B 4AZ3B 1M76A 1KDOA 5JCZA 4IF6A 1CVLA 2C5GA 4CM6A 3I09A 2CBZA 1FFWA 1E59A 1FS4A 1HE3A 1H8HD 3CPSA 3UWPA 1ZHOA 2BAGA 2ZRIA 4OHVA 4V2UA 4ZMSA 4RTKA 3FVWA 2VCEA 3JXEA 3AERA 2AQIA 4EYSA 1E9EA 1XQWA 5I7UA 4G9EA 3O8LA 4RY0A 4BAZA 4BO5A 2OLJA 2XA9A 3F5MA 4P22A 2ZRFA 4M0KA 4Z7OB 1HE5A 4GSLA 4D0SA 2R0QC 3VRHA 1ECPA 4TVKA 4ZVRA 4V24A 3B60A 1Q0SA 2ZSEA 3ZWPA 4NXNB 3FTCA 5DWDA 5ES3A 2F4VB 2BV3A 1VSBA 4JKYA 4F4JA 4CKYA 4XTRA 3LPCA 4XIGS 1GP2A 4GGMX 1U81A 3AFNA 4GMDA 3KD2A 3T4XA 1H0HA 3UW1A 3T5BA 3RQSA 2IY7A 2UVPA 2FK8A 1KVUA 2XF8A 4ZC8A 4EOGA 1YHYA 1ZK3A 4R9VA 1L7RA 2G08A 2GOYA 3RFFA 1IRIA 5IP5A 2DTXA 1CULC 1ZICA 2NU9A 3DDHA 2VHJA 4H31A 3RU9A 1C30A 3AO0B 2WQ7A 3JD4A 5TT0A 1E2KA 1O0SA 1NVMB 1F4LA 2XWJI 4L4XA 5K0GA 1EDEA 4JLBA 3AVVA 1JAIA 2WVHA 2DBRA 4IHJF 1CUSA 2PZLA 3WNDA 1HF3A 1O7JA 4GEKA 2XCLA 1D09A 3UPDA 1YRHA 2H65A 4V2IA 2WMNB 3PQ7A 1OH6A 5B3AA 4CV0A 2XY4A 4U4AA 1QLJA 1PFKA 1X1EA 3OU7A 4N8DA 1N6IA 1N9GA 2K5UA 4OGWA 3N0RA 3T15A 1H0SA 1PT8A 2WJJA 4UC0A 3ZC3A 4FB5A 3G5UA 3K0CC 5HMMA 1KU6A 2BF4A 3UT0A 5KKAA 5KVQA 4D2IA 4A03A 2F1KA 1VSUA 1X13A 3WSVA 5IN4A 4CDRA 1PW5A 3E6AA 3R5JA 2P4QA 3E4CA 4D42A 4DR3B 2GZ1A 1IN1A 1N1GA 2Q0XA 4EECA 1WSAA 1P2VA 1VZ2A 2V3WA 3IMFA 1SKYE 3TH5A 1CNEA 4LDZA 2Y66A 4V3CA 1YQXA 2WQZA 3WXMA 1KSFX 4XUDA 2YJ4A 1EM6A 2EARA 2PSEA 4GI5A 2SECE 1R15A 2I0FA 3Q1KA 5DYTA 5HJ2A 2JLSA 5CDTA 2ALJA 4Q3EA 4ZRDA 5FNZA 2NPOA 1RWVA 4ZV9A 2C7OA 2WJZB 3BF7A 4URWR 4JJ8A 1M2FA 4WUVA 5LB4A 4PLHA 3PVZA 5FTKA 1P29A 1AK9A 3A4LA 2YMPA 1DAPA 3FFBA 2CFOA 1ZONA 1Y1LA 5DSXA 4X3CA 2NZJA 1N5LA 2KBFA 4FILA 5C8ZA 2QMHA 2LE0A 2VDRB 2PQMA 1VHWA 2WYVA 4AKIA 1DWOA 1J2JA 1QC5B 4EF5A 4MW9A 1OA1A 1HV8A 5SZJA 2FLKA 1EXVA 1XVTA 5D3MA 3NU1A 1A8SA 1FYVA 3PL5A 4BZPA 4DV6B 4NOKA 1P39A 2IXTA 3EZNA 1WF3A 3FDZB 3OKFA 1RKVA 1OLSB 5D6NA 3TXYA 3UN1A 2R86A 1M1YA 3WISA 4BMNA 3GLGB 1XF9A 1XRNA 3B1ZA 3WKCA 1K4YA 3UO8B 2ZBQA 3NTQA 4E1VA 2JLAA 2ZXUA 1GITA 4M8KA 3OO0A 2ODNA 5BURA 3G0IA 1N92A 3KTOA 4EENA 2YC2C 3MELA 3O4GA 2VK1A 2WYUA 4YRFA 5LIPA 4G1CA 1GNVA 3CLVA 1DOZA 1QFJA 5IN5A 1WL8A 1YK0A 1E20A 2I8AA 3A6LA 1M1XB 4WOBA 5FPQA 1IL0A 2OCIA 1RMYA 2OFOA 2VO1A 2WHYA 2IZ0A 4HFNA 1F0KA 3UHPA 3N2NA 4HNTA 1WRBA 4FEEA 1O6BA 1TU0A 1W29A 2EJVA 4ENPA 1GL7A 1CUEA 3ZQ4A 3GJTA 1YRLA 3DXYA 4UHDA 4NTZA 5ANRB 3W3AD 3L43A 3ZGNA 2B34A 2ECPA 3HCBA 1B6TA 5JAIA 1N7GA 4J1NA 4G5FA 4L8WB 3GT7A 2ADMA 5HQJA 4ENTA 2AYXA 3KZVA 1XZLA 1LTKA 4EAAA 3D31A 4MI3A 5CITA 1M5RA 2IYTA 1KIFA 2PRZA 3EUEA 4Z1MD 5DX8A 2LNDA 3EA0A 1SIBE 3D7LA 3ZX4A 1K9VF 1X7HA 1PNQA 3I76A 3OQVA 1TCBA 3HL4A 5A6SB 2LD4A 5KPJA 3O8BA 1I3LA 3RUPA 4DLVA 4WNAB 1AZTA 2MYTA 3A27A 4G0PA 1NV9A 3TTSA 5CPBA 3DCYA 1T24A 2UDPA 1SKQA 2E5FA 4ND6A 5FUBA 5H4HA 3JQDA 3TQHA 5C4IA 821PA 4YAEA 5HUJA 4RAQA 3DF7A 2JGIA 2XYPA 3FSRA 5BV7A 1GG8A 5FPTA 3SOZA 3ROQA 2QL9A 3PQEA 3EGDB 4RD3A 4CKBB 1W34A 5ICSA 2QSYA 2Y1OA 3T1QA 4DIFA 4MK4A 1IVSA 1Q1NA 4EK9A 4HGYA 3JZIA 2H2DA 2JZNA 3C3YA 2YC4C 2O3TA 3NJRA 3IT1A 2LKDA 2VKQA 4IDHA 1F6DA 4GBMA 2BW0A 1EEXB 4S1PA 4UHJA 1LSSA 2Q2WA 2J3LA 4EYOA 3ZY2A 1N2EA 1LJLA 2WYOA 5LSAA 4MW2A 5IK2D 5TLSA 1KPGA 2BGWA 2HCJB 3OWXA 4X5OA 4LTDA 4YJFA 4RSMA 4L8FA 3AUJB 1VLQA 3EE6A 1ZBDA 4I4TA 2WG0A 4MS3B 2P9HA 2YHAA 2ZJAA 1V1MB 3I2YX 4LIPD 4TSRA 2QPAA 4RZXA 3WHPA 2NG1A 4PYRA 4B6OA 1X8JA 3H1BA 4LXQA 4ZMBA 1QGED 5JJIA 5LP1A 1XLVA 2A5FA 3E1KA 1YKFA 5L9AA 1NVDA 2V8BA 3PUKA 1KERA 3UGTA 3THXB 2RHMA 2I2WA 2Y2UA 4CZ2A 4LJRA 3I9LA 5AHXA 4AK9A 3NTUA 3MIIA 2QORA 1MNQA 3CEJA 4H0NA 5JSZB 2HEIA 4EGFA 2VOEA 3QHQA 1W93A 1SG6A 3KOWA 4XGQA 5AKHA 4CL8A 5BUQA 5AVOA 5EJ9A 3AFHA 4JSYA 3KYJB 4UDOA 5K0SA 1JHDA 1GVNB 3EQ9A 5AK3A 5EUBA 4MEJA 1F4VA 5DK6A 1V8DA 2HW8A 4NU5A 3WLIA 5I7AA 1Z25A 3ZJTA 3SDSA 3FHTA 5AXAA 2HO5A 2ZVQX 3H18A 3O0DA 5F33A 4MEBA 3PDWA 4NC9A 5AW6A 4LRWA 1N2GA 4JGBA 3TR6A 2I29A 2BBTA 1R50A 2H00A 2GN4A 3VI3B 3AF2A 3N0WA 5A1JA 1RFLA 2MMGA 1QIMA 4H3KB 2G71A 3V8QA 2OHIA 3X43A 2FF7A 1XHLA 5H7XA 5L51A 1NP3A 3N7AA 3TQTA 3E1GA 1YDFA 2PU7A 3H42B 3I62A 4ZZIA 1XZ8A 1D6NA 1UBLS 1HH4A 1G8GA 3HO8A 1HM5A 3ASYA 4G4IA 3DBIA 4IUDS 1CR4A 1BCRA 2HKIA 2JDID 3IXLA 4QUGA 3U7QB 2ZU0C 5IZCC 1JSXA 4H08A 1Y33E 4ZK6A 5JAHA 3ML1A 3UJDA 1E1CA 2ZSUA 2REQA 4E4TA 1ATIA 4JBYA 3DDOA 2KWIA 1M2VA 2W4MA 4LNUB 3SP1A 1CK4A 5THXA 2PYZA 3TZQA 5IKPA 1L7OA 4KXFB 5INTA 4MPTA 1A0OA 1M67A 3OZEA 4QDKA 2IZ5A 3OCVA 5T5QA 1PN3A 3PRYA 5F2OA 1KH1A 5DBIA 1LDGA 3WV4A 4NZOA 4CEHB 5FWAA 4IDNA 3ZVMA 1W6RA 4TLEA 3FKSD 1DFHA 3MOGA 3F98A 4U2KA 1OTHA 2J4CA 3B6JA 1MO6A 4D9CA 5B1YA 1RLIA 2YUIA 1Y3IA 3FN4A 3D0QA 1JNXX 1LPMA 2IQIA 1KE2A 3SHOA 3T3GA 3TRKA 1M34E 4JI7B 1U0GA 3VH4A 5FBVB 4BYGA 3RPEA 2JLXA 2FMKA 1QUFA 3TG2A 2HA5A 4A8JC 2N75A 4I81A 1M6NA 3QKRB 4PQEA 1O5IA 4G2TA 4UNSA 2PKYX 4DG5A 4ZYWA 4LMAA 1ADCA 1H9BA 2W5UA 1ZWKA 3NRCA 3CRW1 2QR3A 5EJ5A 4QOEA 2NTYC 5C1BA 1IHPA 3C45A 2ZJ3A 3PKJA 4JU9A 5H81A 4C0AC 5ADHA 3BFJA 3JQ6A 1EUYA 3OD1A 2MR5A 3FYUA 4G0YA 3WSWA 5J47A 2TMGA 3PHIA 4D25A 3OEHD 3PIRA 4DLWA 2V4MA 2QN2A 3IAAA 3MRXA 5IVIA 3WL5A 4C4PA 1HDIA 4G4SP 3VHRA 3UH0A 1P2TA 2KB0A 4BMDA 1JDPA 4DG9A 1NA5A 1RYMA 3PQ6A 1V7ZA 1FEZA 1FSZA 1LRJA 2QTRA 3C6ZA 1PGOA 1XQ1A 3I64A 5KMGB 2GPAA 2OUIA 4QHYA 2F8MA 3EZ9A 1I4OA 4UHHA 3KPUA 1H2EA 1Q0ZA 5JISA 1X8LA 3DWIA 5CYFA 5J4KA 1M1ZA 4A8JB 1VKOA 5E95A 4QKQA 2BM1A 1SB9A 4FMCF 3ZWBA 1J8MF 2I67A 3AOEC 2ZS9A 3KDSE 1CF2O 1PJRA 2BH9A 3IULA 3O2SB 3GD7A 1GSHA 4U63A 3OX4A 3GJ8A 3Q6NA 3H97A 1UJ6A 2G67A 3L77A 1G20E 2CHVA 2DQSA 1VQ1A 2OQRA 1FDVA 1Z2CA 3GEHA 3JYNA 1OC4A 2V6GA 2O57A 3UCFA 2CVFA 1K5HA 2WM2A 3MTQA 4RK0A 4BFLA 4DLZA 4F6CA 3BA1A 5FB3A 2DKOA 4EP1A 1SQ5A 3F97A 3HXPA 3PRKE 3R3UA 4TQGA 3PPIA 4O5OA 4A27A 2VDUE 3JVVA 4DB2A 3P71T 4Q3OA 4F4UA 2ZBUA 3QXHA 3D1LA 2FOXA 4BTEA 2P78A 1PVDA 3TSCA 2H63A 5JS6A 4JVNA 5B3JA 4YUVA 1FU4A 2FG6C 1I0ZA 2YXNA 4OHXA 5AW8A 4IH1A 3TEMA 1MJFA 2VUSA 1QHHA 3IVCA 4FFNA 3PGKA 5CFZA 2OWDA 2PX2A 4PIMA 1N5IA 3OHMA 1MGPA 4R83A 4Q4JA 2PKWA 3FLAA 1PYDA 4TROA 4Q34A 1NUAA 4FNGA 1M1NB 5HJ5A 1K5DA 4BO6A 5EZSA 3OOSA 4XM2A 2Q9AA 2IFTA 5AQEA 2BHRA 4O59O 1QCCA 2C3MA 3DDSA 2B69A 2QKYA 1K8RA 2BM0A 3ID6C 1ZUNA 4M7RA 5F2KA 1Q2XA 2R8RA 3QPUA 5G4LA 2V3CC 4X41A 1VJCA 4QU9A 3AL3A 1CF9A 1MDBA 1K8XB 1AO0A 1LPBB 2VJCA 4UMDA 3ZE2B 4YCMA 1NMZA 3M6VA 3IUBA 5DGIA 2POCA 1RBYA 1I5EA 3HCCA 1DFGA 2W6PA 4O4JB 2C9DA 3TXAA 2AEJA 1XNGA 2IYYA 4EMSA 4MB6A 4DC9A 1TZCA 4LY6A 2AGVA 4MUFA 2Z0MA 3VYUB 5EWLA 4UM7A 4IRUB 3STXA 4B84A 2FNAA 3RBZA 4DCJA 3E5MA 3A6EA 4KJZA 3EVEA 2NX2A 5KNCA 1N3YA 2B35A 2IYUA 4TKVB 4EJSA 1LI5A 1Z8DA 3OURA 4EELA 4Y9DA 4MQEA 1O5TA 3P0RA 3PJDA 1ZIXA 3GGGA 4BIMA 1J25A 1Y1QA 4A23A 1WZEA 5TGZA 3LQYA 4BVFA 4LF4B 4Y6PA 3EW7A 1OXKB 3KQUA 2C9BA 3WGVA 4FIZA 3I8SA 6NULA 4DR1B 2OZLA 3QXGA 4ZGBA 2XCIA 2Y76A 3NTVA 5D5PA 5ELXA 1Z5WA 2G70A 1UQRA 1A8QA 3K1AA 1EI9A 4DVJA 3AXTA 2YASA 3GLFB 3WGZA 3ZS8A 1N2CA 1E6WA 4QXRA 6AT1A 3L2OB 4ITRC 3IP7A 4URXR 4CLRB 5A7GA 1IDN1 2RSLA 4ND7A 4UHKA 5AJVB 4BNZA 4FNAA 2BIFA 2IX9A 2DHRA 4EBBA 1ORRA 1KL7A 4JJ4A 5IU6A 4QSMA 4TKZA 3EG5A 1E5XA 2NSJA 4RLQA 3LUPA 3VR1A 2WJ6A 2Q07A 2XECA 2HT1A 4LJAA 3RHTA 4LE2A 1JHMA 1AS0A 3BJEA 5CT5A 4A0FA 3D3EA 1NMSA 3GLSA 3TSOA 3F3KA 4GS5A 3OZWA 2JS7A 2GNAA 3HHPA 4MA5A 4AMZA 4HDCA 4KIWA 5FUWA 2C2BA 2R7MA 3RSZA 1FPQA 3KSMA 3H4TA 3ODGA 5T67A 3IEIA 3V2IA 3KB8A 4NMMA 3K8QA 4UAUA 3B36A 4GMXA 4N9WA 2AE1A 5D3QA 4S1TA 3AM5A 1G9TA 2BBOA 4JQOA 1TKBA 1ZKMA 1DQZA 1NYQA 2WSLA 5DLEA 1MRNA 4J0HA 3T94A 3UOGA 3VVMA 2Z6QA 3H2IA 5EUQB 3AM1A 1B6RA 2X41A 3W8FA 3DE3X 1USIA 4F9TA 3S40A 1GPNA 1M73E 3NDBB 4OIFA 2XHZA 4P84A 3D6JA 3X1KA 2NZYA 2UUOA 3GB9A 4DCTA 1TEXA 4U2DA 1VGQA 4CIYA 1CZOA 1CWUA 1PRYA 2C4TA 2PYDA 3C4VA 4U9HS 4BKRA 5CGZA 2B7CA 2XDQB 5JNRA 1GZUA 1R74A 3EN0A 2RGDA 3P9CA 2H5EA 2H07A 3ASVA 4IIUA 2E4ZA 5G40A 5LFAA 1F8YA 1ORHA 3G89A 5CIQA 3SDBA 4DKJA 1IN7A 1TCVA 4H27A 4QOIA 1NASA 4LGVA 3CTMA 2IOFA 3ORHA 2R5WA 4AJ1A 2CFCA 4XW2A 2E49A 1CDEA 3KUUA 4RV9A 3UH1A 4ZIRB 3GJSA 3IIMA 2ZIAA 5HYVA 3K6SA 4M98A 1BE1A 5E9QA 5FL7A 2P35A 5L7YA 2AOXA 1U8AA 3BYZA 3TLGA 3GVPA 3HSKA 4Q9HA 3ZHQA 1GRRA 4W4TA 1R4AA 2EWMA 4I1YA 3U4HA 3WB1A 3IHWA 3WL8A 1LLDA 1O0CA 2RGAA 3WGUA 1EFAA 2JIZD 2E5LB 1I7PA 1GN8A 2FR8A 4Y9SA 3OETA 4KDEA 3MTBA 1WKVA 2SHKA 2CF6A 1UM9A 4CMEC 1ENOA 1HQCA 1ZC4A 4YJDA 4H4EA 1QHEA 1RJWA 1AUQA 3MJFA 5JSYA 3RSCA 1FQWA 3V1LA 1RRMA 2OMEA 5JI2E 2Y0PA 4M9RA 3IEUA 1V47A 3KXLA 3R24A 3UKOA 4RC9A 1KFBB 3F1LA 2KMLA 1BX0A 2EGGA 3EPHA 4X1YA 2F00A 2DKFA 3V8NA 3LCMA 2CCKA 2ZIVB 1R4NA 2DLCX 3I6ZA 3GR6A 1NFRA 1WMAA 2GJSA 2JEZA 2XE6A 3JQPA 4IQ8A 4EPYA 1OH5A 5K6AA 1JTFA 1K8ZB 1XAJA 2B8WA 3IUJA 3PUIA 2PMDA 4U2EA 2W6MA 1DRWA 3N39C 1ZSYA 5AUQA 4WOPA 1IBKB 3IAXA 3RTCA 4KBFA 3LSTA 4HLQB 1JDSA 1KKUA 2V9CA 2J0QA 2E4AA 4BVLA 3PL1A 3GFQA 1J2EA 5DHRA 3OTIA 2QP4A 3IAEA 3NS7A 2RB4A 1VHQA 3IALA 3O5AA 2GM4A 3GLQA 3STWA 3HCDA 3HJFA 2GFQA 2ZBPA 4XAQA 4KPGA 2JFQA 1HORA 3HH8A 4Q05A 3SXUA 4DN6A 1BGXT 5AMXA 3HADA 4HUQA 4CFYA 1CUBA 5DM70 4AI6A 3E48A 2CXPA 3MSXA 4LOIA 5BY2A 1XB2A 1QGOA 3KETA 1J1ZA 2ONCA 2WSYB 3DV0B 4AS3A 1P5HA 3LXMA 1N2HA 4Y6OA 1FC0A 4EAQA 3ET4A 3K4HA 4R1UA 1ADYA 1DB3A 1OWPA 2BCEA 5A4KA 4D41A 3ZI4A 4OI0A 4E12A 2OVFA 3Q9SA 1DC6A 1VSVA 2UYGA 4G3XA 3EMDA 5EVJA 5L3SA 4LVNA 3GLIA 3O75A 1MJHA 3SR4A 2AR9A 3NTRA 3LQ1A 3R3ZA 1KMHA 2Y2VA 4J2HA 2VN8A 1EGAA 3STYA 5JS7A 1DC8A 3S44A 5IF3A 2ZE5A 1ACJA 1RFGE 1O9BA 4X6LA 3C2QA 1IK4A 3OPYI 4D3ZA 1VTKA 3K5WA 3AIKA 3TW8B 1PL8A 1BC5A 2EW2A 1OQAA 2VK4A 1MENA 2HDWA 2NACA 3U7IA 4ZHSA 2YHBA 4OMDA 4GZLA 4NL4H 1YU6A 1TAQA 1X9HA 2IZ6A 3EDCA 2COEA 3HG7A 2B94A 4R9RA 1Z7GA 1MHPA 4RYLA 1XRMA 2PM8A 1B6SA 2C96A 3FNRA 3CN7A 3EOZA 4V0NA 2IIBA 3MWDB 4PYQA 3NNSA 4HB4A 2OAGA 2P91A 3SIXA 3TFOA 2WSBA 4PYIA 5HQ3A 3HN7A 4TMWA 1HYBA 3GGJA 3RB8A 4KXQA 3L7DA 4RD4A 1HE1C 1V1JA 2ZPTX 5BVGA 3FJ1A 4FYMA 1RPJA 1N5RA 3MIZA 4AZSA 1U2DA 4NRDA 2K2QB 4L4ZA 2I4MA 3RS2A 3RU2A 3WTBA 1KDTA 1QS0B 2YYZA 3GN2A 1GYPA 4M88A 5DYNA 1HQKA 1U2EA 2ZYIA 4EUHA 1T5OA 2ZI7A 3U4MA 2DFTA 3A6ZA 1KO1A 4HDNB 1EFUA 4XYMA 3RUHA 4DPLA 3R8FA 3ETGA 3O91A 1MB4A 1AVTA 3LQQA 4YT2A 4M9QA 3RYCB 1E3MA 1SD1A 4E22A 3UT6A 1Z13A 2QROA 1Q0HA 1CEXA 1E7MA 4ND5A 5HCUA 1NRXA 1XZKA 1ZD9A 2Z4SA 3R9KA 3RUAA 2VYQA 1VI6A 4I50B 1RP1A 2YKGA 1YXMA 4ZTBA 5B3LA 5HF6A 3AVUA 1DWPA 5DXJA 1J23A 1TT5B 4MVYA 3TTXA 4UVDA 3ADDA 1NG1A 5A0VA 4IW3B 3DAGA 3HB5X 1QCDA 3DOEA 1A77A 1JJAA 3J81k 3UFBA 4FGSA 2C94A 2Q1XA 2VNHA 3GEBA 4XA8A 3WHIA 1A3CA 3OE7A 5BVHB 2PXHA 3PLRA 4F06A 5IC4A 1L5ZA 3PWTA 3SGLA 2VHEA 4GMKA 1ZL2A 3FNIA 1W76A 1NVKA 7ADHA 1M34B 4HZIA 1J2UA 3S8MA 1LLUA 4XD2A 5C8YA 2PWYA 4Z2AA 4FHEA 4DIUA 4A6DA 1QVVA 3C3WA 1V7QA 2XXJA 2O4CA 2VRBA 1T9GS 2FFHA 2NSLA 2OCGA 4HC4A 3L8DA 4G2NA 5FBRB 4N41A 5DM60 1FTWA 3SF8A 4CJXA 4F4HA 1O94C 4KTTE 2AK3A 1XEAA 3A6GA 4HH0A 4MLZA 4MWSA 5LQKA 3ABRB 4FHDA 4YB8A 3NIWA 2O2SA 3GX1A 3WLNA 4ZVQA 4GQBA 1AMOA 4KYTA 5FP0A 1JQ3A 1UANA 4HWRA 3UCXA 1MABB 1BMFA 5M34A 2B7BA 1A4IA 3GFPA 2OHVA 4GWLA 2I8LA 1Q1AA 4WZBA 3ZOKA 4DA8A 2I4LA 2EJWA 2PZJA 3F4BA 1NBMA 1PL6A 4KK3A 2WWRA 1XTJA 3CNOA 3NFYA 3OPNA 1BJKA 1SIOA 2D5AA 4HEJA 1F17A