1R18A

Drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
publication title Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 70
structure length 223
sequence length 223
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2003-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r18A00
3DTNA 4LG1A 2B25A 2P35A 2PY6A 2EJTA 3HCFA 5EZQA 3FYCA 2DULA 3IHTA 4RTPA 2ADMA 1R18A 3CC8A 1YZ3A 2XVMA 4G56A 4DKJA 5K01A 5K05A 2P7HA 5FCDA 5K0EA 2P3OA 4RV9A 4L7VA 5HILA 1SUSA 3IYLW 4YV2A 2PGXA 3GU3A 3CJRA 4FSXA 4KIFA 4MTLA 3ELYA 4FGZA 3A27A 3VC1A 3HCDA 3G8BA 3OE5A 5DTRA 1YZHA 3NW9A 1X1AA 4ZTBA 1UIRA 1KR5A 4QQNA 4RSRA 3OPNA 5DRTA 5ICGA 3SGLA 2IGTA 2ZWVA 2HMYB 1G38A 1I9GA 2ERCA 2HTEA 2PWYA 2JG3A 5GOZA 3EVCA 3SSNA 1RJEA 1WZNA 3O31A 1HMYA 5EOVA 3P97A 2A14A 3LGAA 3KQVA 3QOWA 3SR4A 2JHCA 2ZLBA 2P1DA 1UWVA 3TM5A 2B2CA 2PV0A 2QRVB 2ZIGA 2ZZKA 3KQQA 1JQDA 3KHKA 5EMMA 5F2KA 3BXOA 2YUIA 5K0GA 4CKEA 3C3PA 3FPGA 2OB2A 3R0QA 4RX1A 1M0EA 4GC5A 2VDUE 4LWOA 1BHJA 3DR5A 4M36A 4P7KA 3MHTA 3O4FA 1JQEA 4QPPA 5KQRA 4QQKA 2AVDA 5EIFA 4RTJA 1ZKDA 2AOWA 4CKCA 3U81A 4R05A 2PX8A 4DCMA 5CCBA 4IWNA 4PYQA 1O54A 2PXAA 3LBYA 5EMKA 5DT2A 5EPEA 3ME5A 2XBMA 3BGIA 3P8ZA 5KQSA 3UJ7A 4KWCA 3M6XA 4Z2YA 5F2NA 5GIPE 2I9KA 3DOUA 3FPHA 2AOTB 4PWYA 4R8SA 5HOQA 3AJDA 2V74B 1XCJA 5IKMA 3SSMA 4FS8A 2O57A 5FUBA 4E33A 3X0DA 3TMAA 3KR9A 2GS9A 5LQKA 5FQOA 3FYDA 2ONZA 5FWDA 1MHTA 2OPBA 5K0JA 3PB3A 3UFBA 3G8AA 3KQPA 2YXEA 4E30A 3FZGA 3OFKA 1YUBA 2JHPA 3BT7A 1X1CA 1WXWA 2OO3A 4GBED 5GM2A 3T7SA 4EKGA 2EFJA 3ID6C 5BP7A 1YFLA 2QYOA 4YMHA 3KPVA 1JG1A 3G2MA 3PX2A 4XUCA 3A7DA 1KPHA 5P8WA 3TPZA 1D2GA 3B3GA 1G60A 3L8DA 3SSOA 1NKVA 5M5BA 1ORIA 1IM8A 1SQGA 3P71T 4DM3A 5LQRA 8MHTA 3ER8A 5CM2Z 4UOEA 4V0RA 4FT4A 3B89A 4OQEA 2G72A 4RWZA 5K09A 1NV8A 4RTQA 5DPMA 5BXYA 4BP3A 3HVJA 1R6AA 1WS6A 3VSEA 2CMHA 3LPMA 2CKDA 3JWGA 3M4XA 3HCBA 4H0NA 4V0QA 3A26A 4AZWA 2VS1A 4AUKA 1XTPA 3KQWA 3K0BA 3HA5A 4PCLA 4MHTA 5GP1A 3V8VA 4RTNA 1RJDA 2AR0A 3E05A 1ZGAA 2Y1XA 3FUTA 4CTJA 3E23A 2OYRA 3G2OA 2ZCJA 3KU1A 1B42A 2YXLA 5DX1A 2PXXA 3OCJA 2ZZNA 3UJCA 2ZBRA 3GRYA 2YX1A 2PWPA 1KIAA 2H11A 2IPXA 2XVAA 3I64A 2R3SA 3OU6A 4CWAA 1YFJA 2UZ4A 2ZW9A 2PX2A 4BP1A 4RYLA 4IV0A 5EIWA 4P7FA 5DX0A 5EHIA 1FP2A 3TM4A 4A6DA 1YF3A 1VIDA 5E8RA 2BR3A 3HCEA 4C03A 2YR0A 1FP1D 2JJQA 2ZVJA 3LSTA 4U7PB 1NW6A 3PVCA 4GEKA 4FP9A 4O29A 1R00A 1P1CA 3E7PA 3KQTA 4XUDA 4MWZA 4AZTA 4HH4A 3P2IA 4KIGA 2HR1A 3C6MA 2NYUA 3NMUF 5DTMA 3GO4A 4RVDA 1BOOA 3I58A 2Y1WA 3KQYA 1JG4A 2AOVA 4WVLA 3QV2A 1DUSA 4YUZA 3SM3A 3DXXA 3BGVA 4OQDA 2IH2A 5E2BA 1JSXA 2B3TA 2WK1A 3GRRA 1P39A 5EG5A 5E8JA 5EZSA 1L3CA 1P1BA 3MCTA 3A7EA 3GCZA 3Q87B 3ERCA 3ELUA 5K03A 1P91A 2FYTA 4NECA 2PKWA 3PX3A 5ICFA 5ICCA 4PYIA 1JSZA 2WA1A 4YV1A 5JR3A 2QE6A 3EMBA 5CUQA 4CTKA 3EGIA 3FPJA 2IDJA 3C6KA 3R9XB 2UYQA 4KVZA 4M37A 1ZHFA 3GGDA 5CCXA 4FSDA 2VDWA 4LECA 3LL7A 4RVFA 2P8JA 5FA8A 4ER5A 3RODA 4EMSA 2ZULA 5EEHA 1SUIA 5FTWA 3EEOA 3VYWA 3TRKA 1XVAA 3B7PA 2QRVA 3BWYA 2HV9A 4GOLD 1KYZA 2NXEA 1QANA 1I4WA 2KW5A 1FPQA 3CJTA 3MB5A 5FULA 4EVIA 5FHQA 1XDUA 3OZTA 3H2BA 3FTCA 5EMLA 4GUAA 3CJQA 1L3IA 1SQFA 3PLAE 2PX4A 3FUVA 4QPNA 2GH1A 2AOUB 2P41A 5F2OA 2Z6AA 4AX8A 5ICEA 2IBTA 3I9FA 3HM2A 5HIIA 3O7WA 3DXYA 3BGDA 3NVMB 1ZGJA 3WSTA 2ZBQA 3A4TA 2PT6A 1FJXA 5K0NA 4KRGA 2C7OA 3V97A 5K0CA 3JWJA 2AOTA 1RI3A 1QZZA 3NWBA 5DRYA 2FK8A 2I62A 5DXJA 1BKYA 1AQIA 2G70A 3B3JA 4B17A 3ELDA 4PGGA 2PBFA 5E1MA 4RTOA 3NDJA 3R6TA 1KPIA 5HFJA 3T7TA 3UBTA 5G02A 4OX9Y 2NP6A 4K6MA 5E9JA 3TQSA 2EJUA 2ZWAA 1NT2A 2PSSA 1G8SA 3KQSA 5HEKA 3KR1A 3G2QA 1R74A 4HSGA 1NV9A 4BLUA 3GRZA 5FADA 2CL5A 5E1DA 5U4XA 3CGGA 1VBFA 2AN4A 2ZIFA 5C1IA 5K0FA 1OR8A 1M6YA 3BKXA 3FRHA 4OBXA 2C7RA 3FTFA 2P40A 5GIOE 4P58A 3DMGA 1JQ3A 2FRXA 4ATNA 2I6GA 4YV0A 4X41A 4Y30A 3P9NA 3M6UA 1Y8CA 3GDHA 5GM1A 2O07A 3AWIA 2AOXA 3EVBA 3P2EA 1TW3A 4ER3A 3UJ9A 1RJGA 1QAMA 5HIKA 3EVZA 2K4MA 2XYVA 3NVKI 5LQNA 4PYJA 3FTEA 3MAGA 2JH8A 5ERGB 3M6WA 1JTEA 1SKMA 1JR4A 2WA2A 3OE4A 4E31A 3NTVA 1HNNA 4POOA 3ELWA 3T0IA 5LR6A 2PLWA 4PONA 4AZVA 4X1OA 1Z3CA 2V7EA 4PIMA 1FBNA 2OKCA 3LCVB 4QTUB 2PT9A 4GOND 3AXTA 3TKYA 1RI1A 3GWZA 3M70A 1KYWA 2B78A 4HTFB 2OXTA 3SX0A 3KPYA 3EGEA 2B9EA 2GB4A 3UA4A 1NBHA 3DMFA 5C0OE 1EAMA 4C07A 1NBIA 3G2PA 5EEGA 2NP7A 2VP3A 4YUYA 2BM8A 4OA5A 1VE3A 1WY7A 3DLCA 5KVAA 1AF7A 3TKAA 4F85A 5K0BA 3G88A 3BWBA 5E2AA 5CVJA 3C3YA 1PJZA 4PINA 5DSTA 3UZUA 3KQMA 2IBSA 1L9KA 3BWCA 3P9CA 4FR0A 4E32A 1KP9A 3ORHA 3TLJA 3B5IA 4CKBA 4Y2HA 1NE2A 1JTFA 3IV6A 2NXJA 4OBWA 5FWAA 4C04A 3FPEA 5H02A 4QTTB 4CXMA 2UYCA 1AV6A 2ZSUA 3JWIA 4P7JA 1U2ZA 2PJDA 4EQZA 9MHTA 3EVEA 1O9HA 1WG8A 1EJ0A 2GA9A 4QDKA 1JG3A 2H1RA 4GC9A 2I7CA 5LQJA 4YUWA 4QVKA 5DSXA 4MQ4A 5DXAA 2ORED 2E5WA 5K8VA 5HIMA 1IY9A 3CCFA 5DWQA 4YUVA 1L1EA 2C7PA 2OB1A 3OZRA 2LD4A 3KPWA 4A6EA 4DMGA 3KQOA 3LDFA 3THSA 2ONYA 4IKPA 2CMGA 1X1BA 3HCAA 3PFGA 3FUXA 3GJYA 2OZVA 3R3HA 5EKUA 4E70A 3P9IA 5C9ZA 3I53A 3HVKA 3HNRA 4KDRA 4E2XA 2UYOA 1QAOA 3FTDA 2XYQA 2GAFA 3MQ2A 2P7IA 5CVEA 1WXXA 3IEIA 5CVUA 3LECA 2PXCA 3UJ8A 5CIYA 1R8XA 4C05A 3LHDA 3T7RA 3DP7A 3TOSA 4ER0A 5LQUA 1ZQ9A 2PVCA 3TR6A 3TFWA 3P9KA 4DCGA 4PYOA 4XUEA 4GOMD 5JUWA 1F3LA 1KXZA 3CKKA 3KR0A 2GLUA 7MHTA 2N47A 1INLA 2BR4A 2YQZA 5LSAA 1VLMA 4PYKA 2BM9A 3EMDA 3DH0A 3HA7A 5FA5A 3HP7A 3UA3A 1RI2A 4X61A 5KYGA 3BUSA 3LX6A 4ISCA 3S68A 2ZBPA 4GOOD 3KPUA 4IV8A 5KS2A 2FPOA 3OZSA 3LBFA 1M6EX 2YTZA 10MHA 4OA8A 1TPYA 4FT2A 1T43A 3DMHA 3DULA 3GNLA 3NJRA 4M7RA 5T64A 4YMGA 1Q0TA 1XCLA 1SG9A 3CVOA 2Z6QA 1G6Q1 1DCTA 5IH3A 5LQCA 3OU7A 2OBFA 2IH4A 3G7UA 4RTSA 1VP9A 3UJ6A 3VC2A 1NW7A 3RW9A 2YVLA 3HEMA 2ZTHA 3PS9A 4C4AA 3LCCA 4QDJA 4X63A 3SVZA 2UYHA 5HIJA 5K0LA 3LKZA 2EG5A 2IP2A 2ESRA 2OY0A 5D1HA 2ZZMA 3DLIA 4M38A 2AS0A 5BW5A 1JG2A 1EJ6A 1UFKA 2P3LA 4RVGA 2Z6UA 5FHRA 3JWHA 3GXOA 1Q0SA 2GPYA 3GRVA 5HZMA 3BZBA 4RTRA 1N7JA 1X1DA 4RTLA 4GF5A 1VPTA 5DM1A 3GIWA 4KDCA 2ZIEA 5E9WA 5DM0A 3HCCA 1R8YA 1KPGA 3KR2A 5CVVA 1N2XA 5EVJA 4E2YA 2C7QA 3MTIA 5GWXA 3LKDA 3P2KA 2IH5A 3MTEA 1SVUA 3ANXA 3PFHA 3EGVA 2IIPA 2AZTA 1PRYA 2IDKA 3PT9A 3G89A 5DM4A 2IFTA 5EC8A 3SMQA 4EKIA 3PTAA 4BY9E 1D2HA 4C08A 1XDSA 4E2WA 3MCZA 4P7GA 3OFJA 1MJFA 3EVGA 1NW5A 5DLYA 5EHGA 3REOA 4ER7A 5DM2A 3BKWA 3MERA 3UWPA 4XCXA 1AQJA 3DXZA 1XJ5A 5EKXA 4PYLA 3EVAA 3EPPA 1EQAA 4AZSA 4HGYA 4HTFA 2AN5A 1RI5A 3ER9A 5BW4A 4PGHA 4DQ0A 5B1SA 3KPJA 2PX5A 5CD1A 2EX4A 4QVGA 2ZFUA 2F8LA 4U7TB 2P3QA 4HGZA 3THRA 1RJFA 3HVIA 5GINE 3CBGA 2AVNA 3LCUA 1VL5A 1V39A 1XDZA 3FUUA 4YUXA 3EEYA 1VQ1A 1EG2A 1QYRA 4C06A 5E1BA 4RTMA 5EQJB 2QM3A 2VZ9A 4FZVA 4ER6A 5LQAA 4KW7A 3FPFA 4GQBA 4DF3A 1L3BA 2QY6A 1BC5A 2H00A 5DTQA 5EGSA 3AY0A 1EIZA 3FUWA 3NWEA 3EVFA 1DL5A 2JHAA 2NNWB 1YB2A 4BLVA 3G5TA 1ORHA 3M33A 5DX8A 3K6RA 2HWKA 3HA3A 2HNKA 3R24A 5T6BA 2YXDA 4PYMA 3F4KA 3B3FA 5CVDA 3G5LA 2XYRA 1N7IA 2FK7A 4RTKA 1F38A 2BZGA 5EMJA 2DPMA 2O0LA 1NW8A 2O05A 1H1DA 4PIPA 1X19A 3E8SA 4PYNA 1RI4A 3FRIA 3BWMA 4HRAA 5E1OA 3UJBA 3RIEA 2G1PA 4BLWA 1QAQA 3OU2A 5FQNA 1NW3A 2BR5A 3EVDA 3I5UA 3Q7EA 4DZRA 5MHTA 2BH2A 3AXSA 2FCAA 2G71A 2G8NA 2O06A 3LDUA 3QOXA 3KKZA 4HG2A 4E2ZA 1D2CA 3M6VA 3D2LA 1TW2A 3SXJA 3HVHA 4R6XA 3LDGA 3UJAA 3UJDA 2AN3A 2Q41A 1ZG3A 4HC4A 4PCAA 4WXHA 5D1NA 3A25A 4R8RA 2CWWA 2NXNA 5E9QA 4DA4A 1VP3A 4RVHA 4EK9A 2FHPA 1O9GA 1G8AA 3MGGA 2NXCA 4R6WA 3DUWA 2AOUA 4X60A 5T67A 1KHHA 1I1NA 2R6ZA 3GRUA 1XXLA 1IXKA 3C0KA 4F84A 3HTXA 2JH9A 4F86A 4MIKA 2VDVE 4LWPA 3NDIA 4PNEA 4JXJA 1G55A
chains in the Genus database with same CATH superfamily
1QHHB 1ZW6A 4IJKA 1X7XA 1L6IA 3PU6A 3RRJA 5IP5A 1ZMBA 1K2WA 5AVJA 1W0KA 4MWBA 2GF2A 3TI7A 5K01A 3OF2A 2XIJA 2IIBA 1DIAA 2P3OA 1T8RA 3NIGB 3H6KA 3BEDA 2V59A 2PGJA 1WD7A 4G3XA 4R41A 4LJYA 1ZK1A 4DHWA 4ZI3A 4QX6A 4QQNA 4NC9A 4ZGWA 3FWPA 1W85A 2ZWMA 5BXQC 2XMBA 5HKOA 4H6VA 1PQWA 3DMPA 5KSYA 4ZYVA 2OBNA 3GLQA 2Y8EA 4V24A 1M5UA 3GLUA 3CGWA 1VRCA 2ZLBA 4CF4A 4RIGA 1XU7A 3GH3A 5BVHB 2QRVB 3MJ4A 4EHFA 5ABPA 5FT9A 3KAJA 3KS9A 4GKVA 3A6GA 5EMMA 1CQXA 3DMYA 4MDHA 3UAVA 1BDJA 1KI8A 2OEPA 3K0HA 2CFCA 4LE1A 3ZU4A 4B80A 4NYJQ 4IZIA 3HG7A 5DNDA 1VL8A 4D74A 4IDOA 4DSAA 2W58A 3ZU5A 1IY0A 3T1NA 2R8BA 1IUKA 2E49A 3LJKA 4KQ9A 5GMOA 5KQRA 2I0FA 2CLLB 5KNCA 1KYXA 3LC0A 4RS3A 4IGEA 2ZUEA 4KTVE 2PXAA 3I9OA 4E12A 5CB0A 2MDTA 3UTCA 4TS3A 1M1XB 1ADYA 2GJ9A 5TPZA 2QIOA 4RVOA 2OP0A 5JATA 9ABPA 5AVUA 3BK7A 3I9LA 4OUDA 2ZM6B 2W7TA 3HJTA 2O57A 1KJYA 3X0DA 3CXRA 3WGIA 1T0HB 4GI7A 5EINA 3VBEA 3FYDA 3O8CA 5FR2A 2JI8A 2YXPX 3NTQA 5KAMA 3IKTA 5FBZA 1WXWA 4GBED 1IN5A 4NARA 4I4LA 4UM5A 4BKPA 4BTVA 3AUJB 1EBFA 2WR8A 3LDHA 1Q0RA 1JFFA 2GYVA 2IE0A 4MS4B 1N1EA 4N5DA 3IEPA 4FQ5A 5JS8A 2VF7A 4Z0PA 4E07A 4OUKX 3JQQA 5JROA 2H9IA 1G60A 1U6KA 5AESA 3E8XA 3GC6A 5FTKA 1OJ7A 4C4TA 3Q98A 1KMMA 1MT3A 4PPYA 1VJ5A 3K70B 1WDLA 1M66A 4WLOA 4AKIA 4LQCA 5K09A 3ZK9A 1FJHA 1JYEA 1VKOA 2ETVA 2QPOA 2ZDGA 3BZWA 4ZYXA 3D5TA 3ZDAA 5HVNA 1BVHA 1J0XO 3CLUD 1VBNA 3W8NA 4HWKA 1NULA 1JLHA 1V3UA 3GDFA 3HA5A 1Y8ZA 3RS7A 5H8WA 3EULA 4RJKA 5D86A 2J5BA 1DO8A 2IYPA 3X2SA 5AKEA 5A5DA 1P4HA 1FCJA 1YVEI 1YFKA 4MUMA 3B82A 5B7GA 4FZRA 5IXSA 3BRWD 1Z0ZA 1UPCA 1FYXA 2ODTX 2ZCVA 1ULUA 5I9IA 1UXOA 5FAXA 3TOCA 2GYWA 2YV4A 2D2VA 3E53A 3EBOA 3FCEA 3NBFA 3PR3A 2I4RA 2NN3C 3OSZA 2Q2NA 4XWYA 3SJBA 4HWSA 3KEOA 2B4KA 4HB3A 5GVRA 4ACBA 5B7PA 1Z0UA 5MFZA 3EZ7A 2AG0A 4R83A 3UT5B 2PE5A 1P0IA 4OMDA 1ZJ6A 2R6AA 3FNEA 1FSZA 3KCNA 4TXLA 1JHZA 1U7TA 3D3WA 4MRMA 3VPXA 4A16A 4GQIA 1TJ5A 2G9ZA 2NTEA 3IEMA 2ZBGA 5E8RA 4I99A 3U7IA 1M7GA 2YR0A 5BN5A 1JDJA 3AR6A 5YASA 1Z47A 1Z8DA 2BFDA 3JALB 4N82A 4ZYWA 3K9NA 4B09A 3KXPA 1XMOB 4O8ZA 3VSAA 4O29A 1KO8A 2HCFA 4YBZA 4V0OA 5DI3B 5TT1A 4CL8A 4YP5A 2J5XA 3X1XA 5FOWA 2R00C 3B9PA 3K96A 1BEUB 3P2IA 2Y9MB 4MVJH 3FGZA 4DWOA 5NLLA 5DTMA 3MRXA 4QJIA 5FOSA 5AFSA 3W5SA 3KQYA 4JI2B 1NJSA 4F1WA 1RIFA 2H4FA 5BSUA 2H5LA 1BROA 3HC7A 2Q4BA 1KFCB 4O2LA 4PZDA 3KOYA 4F6RB 2WJAA 1PFWA 4NPHA 1SB9A 1QVAA 1FVHA 1M5TA 4J76A 5C5DA 5EHZA 3Q8LA 3IURA 1HA3A 5ECGC 1NJGA 3V6MA 3FTNA 4KZPA 2QE6A 4EI2A 2OG2A 1EK0A 3Q3GE 4AY4A 2ZJOA 1I4DD 4FNMA 1C8BA 3TLZA 3U13A 4TL6A 4KVZA 2VNIA 1IZZA 1KY4A 1YD7A 2WV7A 3I05A 1OAKA 3O8QA 4M9ZA 1Y7HA 5C5CA 4OP1A 2B82A 1MVOA 3GLRA 5EWJA 8ABPA 1SCUA 1PG2A 2VP4A 3KT8A 2NSYA 2WMOB 3MIIA 3RS4A 3E2MA 1OT3A 4HNVA 1FDOA 3D31A 3Q8KA 1C0EA 3H3FA 1NUPA 5JTTA 1N0VC 1P2GA 1JTVA 1CDDA 3DEAA 5E7QA 1BXRA 4G0MA 3OD1A 1Q1BA 3LRTA 4TGLA 2Q3JA 4URWR 3VR0A 1P1JA 2IUFA 1L5LA 1TO6A 5J2UF 2P41A 3HM2A 5DNVA 2A0YA 3PTZA 2JFNA 1J8FA 3A32A 3GP8A 2ZBQA 1CZLA 2O7QA 1P2UA 3QRWA 1ODSA 3JWPA 5K0CA 1RWXA 1CY4A 2MMCA 4UQPA 2V5AA 3EOAI 3VSBA 2C5LA 4JVLA 1BE8A 5A1TA 2RGGA 3JX9A 3DW1X 2C3OA 2G3YA 3QU9A 5AKLA 3D3NA 2DBVO 3FXAA 3BAZA 3MD9A 4I36A 1USGA 4K05A 1Z5PA 2O0KA 4KN6A 4OH1A 2YZ7A 4RZQA 1QKKA 3CLRC 1RMQA 3LVBA 4XIIA 1KDOA 4X90A 1HZZC 1UJNA 2BJHA 1JW9B 3HE3A 3RUHA 3RRXA 4HSEA 2QGNA 2AE1A 3BOSA 3BDAA 3F97A 1RPNA 2CXQA 2XMZA 1GWNA 3O2QB 2EC5A 3PHCA 1EQUA 5IK2A 3TOZA 4A5OA 4Z5XA 5K0FA 4XOUA 3J81A 1QTQA 1GL9B 3NPAA 4LGMA 1P0QA 3VR2D 4BNDB 3DMGA 1O1YA 1E3JA 1X1RA 1Z9BA 1CD5A 2GPSA 3AJ9A 4H08A 3UCFA 3GEHA 4GMGA 3VDNB 2HIGA 4UARA 4N18A 3ZD7A 2BKUA 4K2AA 1SCDA 2EL7A 2PA3A 4Z7NB 3FNIA 4OHCA 5IVKA 3E4CA 2YYYA 4NOJA 4BNKA 3HO1A 1EFPA 1PKEA 2ADOA 1V4NA 4QLAA 2E21A 2JCXA 2B99A 2HQRA 3BFVA 4JXKA 4EHKA 1DBIA 3JD0A 4H4EA 1YJCA 1ZN9A 2VVTA 1PD1A 3U1BA 1Q12A 2YL2A 3WOHA 1HNNA 1T6ZA 4E31A 2P6NA 4LJ8A 2X3YA 4A8JB 2NV0A 2X5OA 1G64A 1TVCA 3JQ9A 3GT0A 5K2MA 3IMCA 2W8BB 1RMTA 4UFOA 4EPRA 1KAGA 4MO2A 2PT9A 4JL6A 3ZHQA 1R9NA 3COJA 2F8TA 3W79A 1W9MA 4WJLA 1MEEA 2A7XA 2B78A 1GUDA 3EQ9A 5GONA 1NQXA 1KQGA 2ODAA 4EMTA 1JU9A 2CB0A 4RK5A 5DDIP 1SXJE 4TN5A 1JRLA 4C07A 2AXNA 3LPNA 4AJJA 3UUFA 1XMQB 4CIVA 4NMMA 2Y4OA 3VZDA 3HUEA 1W0CA 2VRCD 5D84A 4K26A 1O95C 3R3ZA 1WX1A 5CVJA 2R1UA 2UZ0A 3PR1A 5DSTA 4LF7B 2PZBA 3KQMA 5CLLA 1CS0B 1MJNA 4C0SA 4MVWA 2G06A 2Z1MA 4UTOA 3OJOA 1I30A 2LDBA 3H2JA 4WKPA 5DBIA 3DHYA 4LBYA 2H2WA 3FPEA 3OOWA 4FDMA 4ZC1A 5CLGA 1PTJA 1I3KA 3X44A 3M5PA 4X97A 5DBFA 4REMA 1GTG1 1O9HA 1KH2A 4HHEA 4TXNA 2Y1LA 3I0MA 4AICA 4M6WA 2NXWA 3LFTA 1N32B 4H7KA 1UPFA 3ASUA 3OM1A 4XJVA 3RIHA 1IPEA 1T26A 2OT3B 1HX7A 3MG9A 3OQMA 1NPTO 2GVDC 3IE2A 5FP0A 5DWQA 3QIAA 1L1EA 3I30X 4TSFA 3WK7A 2ERYA 3H2HA 8OHMA 5ENZA 3NRJA 4NG4A 3RUEA 1Z45A 2GAIA 4BJ5A 1YDMA 2IXFA 2ZR7A 3JQ7A 4RY9A 3V2UA 1ORDA 4HO1X 1FP4B 4GH5A 5BO5A 2HB6A 3CPSA 4QXRA 4J4BA 2UYOA 3GVXA 4CG1A 1R37A 1YZQA 3H5VA 3LXMA 3ZWMA 1S01A 1RABA 3GGCA 1KVSA 2IY7A 2V6MA 1WXXA 5B6PA 5CIYA 2BFEA 4L50A 5HDQA 2YIDA 3L7CA 1UJ5A 4ZGGA 1VG8A 2ZUFA 3WRYA 4DAOA 1Q14A 2D1TA 1H5QA 4BVFA 2IX9A 2OWDA 4Q4HA 5J1TB 3S99A 5TY0A 2GBIA 3QKRB 4I3GA 1JE0A 1TAHA 2Z2IA 3MWFA 4HDRA 4EM6A 1YB5A 4MIYA 1F14A 1GNLA 3DZ8A 4TTQA 1WXFA 1Z18A 3FZYA 3JVUA 1ZMRA 2FG7C 1P7PA 3HYSA 3T38A 1KKUA 3MGKA 1DE0A 4XUGB 5EXEA 4B9EA 4X62B 1JEYB 3LX6A 1MGPA 4TS4A 1E9EA 3V4RA 2OXEA 4R2XA 1XUOA 2Y9PB 3BMQB 5EJ7A 1FRZA 4GT1A 2WP0A 3GNLA 3FOBA 4OG2A 1CE8B 2K87A 4QFBA 4M55A 4L4RA 5ERXA 5HP4A 4IJVA 2HNAA 2GRAA 1NYTA 2D06A 2GEDA 1XEWY 1KMHA 3ORYA 4B48A 3EARA 4D81A 4KREA 1XXHA 1DQSA 1PS8A 1Q17A 2G1AA 2GASA 3BXPA 3G49A 4RA9B 4W1PA 3LLCA 2X0DA 4GX0A 4GEGA 3V2GA 4AFNA 4AXXA 4EI7A 4W7IA 621PA 1KO7A 4EGQA 1V0JA 1Z7EA 3M3HA 2ZRLA 3AF5A 4B44A 5KU1A 1E1MA 3O4VA 4AQDA 3OKAA 1AGYA 4HNTA 1IG3A 3RI3A 2W6ZA 3FNGA 1D2AA 2C9DA 2GPYA 4G37A 4MI6A 1PVOA 2X8LA 3BFKA 421PA 4HGPA 4K03A 2GSDA 1D4FA 4EY6A 1QCZA 2JGIA 3P5SA 2D0DA 1XMSA 3ESRA 3M1IA 1TMKA 4CN9A 2XXAA 1SC9A 5M29A 1QTIA 3GZNB 2WU8A 3GQBA 5ES3A 3KKQA 4BY9E 1WW2A 1NLMA 1TADA 4ZCSA 4ND3A 2R8EA 3A4YA 2X2PA 3BKWA 5IDYA 1UMBA 4MRVA 4I4TF 1LRJA 4YRDA 2WE7A 4GAEA 4DLNA 4G5XA 2LR0A 2X23A 1P72A 1RI5A 3E03A 4F46A 2H4ZA 3MC1A 4ZRMA 4FINA 5CLIA 5J4VA 2D7CA 1FX1A 5A02A 3VYUB 5B1SA 3FY4A 1M83A 3I1IA 1H2RS 2GTPA 4L85A 3UF0A 5FYQA 3C3BA 1Z82A 4HFNA 1K0UA 2JIPA 3F6PA 3GN2A 3HKEB 4RELA 1V96A 3NHAA 2L69A 4G9GA 3E5RA 2RI0A 3NUQA 5LXTB 1STOA 1FFHA 1GTZA 3F5QA 4KR0A 3RYIA 3OCYA 5CH5A 2OOSA 3UB3A 3BA6A 1E69A 3RYFB 5FI0B 4PLTA 1PK8A 5AW5A 2XF8A 1X9IA 3UAGA 2ZRQA 2PMCA 2XHZA 4UEWA 3PG5A 3GJ3A 3VAAA 3D59A 2GAJA 3ZWYA 1DL5A 2DTXA 1A69A 2V3CC 4FCTA 4S1NA 4H7FA 1YI1A 2XEXA 2CFIA 4TL8A 2G88A 4FNOA 4Y2YA 2BZSA 1TMOA 1VG9B 1W94A 2JLBA 3SXUB 4C88A 1YQUA 1Z07A 4OMUA 3GVPA 4PPFA 4FB5A 5CIQA 2W70A 2FJUA 1RM0A 1IUOA 1H2BA 5JNSA 2C7GA 5LU9A 1Q7EA 3HEBA 4JI7B 5DP1A 2V7UA 2PFGA 2QUJA 1Z7GA 4M0PA 4RULA 5EY5B 2JD0A 5A3JA 2WJWA 4MUGA 4TUYF 4ALJA 3G6WA 3I9MA 3NX4A 4ABTA 2Y0BA 4ID9A 4HQKA 4MV3A 2YIMA 3ET4A 1AHPA 3LY8A 3B36A 3OCZA 5G3YA 3RVPA 2G71A 4ZZ2A 3ZI4A 4LFAB 2O06A 1J24A 4DQDA 1KEZA 2BMVA 1I7LA 3L8MA 2HBQA 5JNUA 3P9RA 2GI4A 5ETJA 2DUNA 2H51A 2ODQA 3G02A 4TZTA 5JJ5A 2XCLA 3AEUA 3GNSA 3EXHB 3PE4A 4ZVOA 5T3UA 5KSPA 3PKJA 4B2PA 4NCAA 2BBSA 3UXEA 1N8SA 2QA5A 3C8UA 2O5VA 2AXPA 1HRDA 1JSCA 1H0KA 2JZNA 3CH4B 1YS4A 3CVYA 2C5SA 2JARA 4P3PA 4Q1VA 2YICA 4OGKA 5CT6A 3LNCA 4BJ6A 1DJMA 3OLWA 5AVSA 1XXLA 5LZ8A 4WCFA 2F1IA 3TSCA 3VTAA 3JAKB 4JC5A 4RJ2A 3ZYZA 4W5QA 4LWPA 3ANTA 1NUSA 2I2CA 2P35A 2R1TB 4IRMA 2BL4A 2VJAA 4WLUA 4XD2A 4IH4A 4BTLA 4RHXA 4RTPA 5G1NA 5EZ6B 5BSEA 4LYYA 2F3TA 5AHWA 3T5TA 4Y2QA 1TIPA 2C9MA 1SUSA 5EZYB 1ZGZA 1M2OA 1H66A 1E3DA 2A0FA 3BHMA 3IYLW 4NESA 4EDHA 3N7UA 1RQRA 5ALRA 3DLBA 3NV7A 5EKTA 1UMCA 3RE1A 4C7OB 2GFIA 2DHDA 2J5RA 2EWMA 1M72A 1PJ4A 5KDLA 3RVNA 3TCKA 3U7FB 4AMYA 2PWYA 3MMNA 2WIJA 2Y1DA 4D4HA 2V7BA 1Y48E 4AQ7A 1I0IA 4AMBA 2VLBA 2WVHA 3ELBA 3GUCA 3V46A 5KIAA 4P3XA 2FUKA 5LN1A 2RKBA 1K9VF 3QUTA 3CXUA 4ZQBA 2PV0A 1LSSA 5F1KA 5FPPA 2H54A 4UC0A 1FX0B 4Z2AA 5GINE 3AM1A 4QUEA 2VPTA 3O8NA 5H0IA 3RQIA 4ETNA 2CMKA 3DCNA 2FLVA 4DM7A 3HS3A 1MJGM 1OLSB 1VLJA 4D98A 1UKVY 1PWHA 3K9BA 3U81A 1NZJA 3AHDA 4DVJA 2D00A 2FQ1A 4IWNA 4KYVA 4L9AA 3O3NB 2PAAA 2GCEA 4H3VA 2WM8A 1TYEB 2Z5LA 4MKHA 3Q9SA 3OIDA 5DGHA 3U1VA 4EJ6A 3KJEA 1Y8RA 1KVQA 1KYVA 2GCPA 1C9YA 3A1CA 3DAYA 4U2GA 4B83A 3T3PB 3L7BA 4D46A 4C1BA 4ESHA 3NBUA 1J5XA 4FS8A 4JOSA 2GPTA 3PLRA 1GJRA 3TMAA 1QJCA 3VV2A 3C3MA 3TZEA 3U3MA 4J49A 3L06A 3S7ZA 2Z30A 2XT0A 1A2QA 4E30A 4J0QA 1QNLA 3OVMA 2IXDA 1GUFA 1ZN8A 2OO3A 2VNHA 3C6BA 1Q3TA 4QSMA 1XQYA 2PSJA 3OT1B 4G5QA 5JQGA 5A5FA 4DIDA 3T7JA 5B58C 4C20A 3L8DA 2MWMA 4JA2A 3K4QA 1CR1A 1Z4KA 3A1UA 2QJTA 4YAOA 1C2YA 1SBIA 1GG9A 3AUKA 3R44A 2G72A 1QZXA 3E3LA 3T95A 4IJWA 3O93A 1JFSA 3HVJA 4U00A 1H2FA 3ER6A 1L5QA 2I91A 2ZRBA 4YJGB 1OROA 4ZCQA 3T3MB 4E21A 2L19A 4MHTA 3F71A 4FFRA 3SE7A 3S8EA 1TQHA 2PKCA 3MJSA 2DC1A 3TMKA 1VYTA 3IH5A 3TLEA 3LBAA 2IDZA 3A0UA 2ZCJA 1H94A 4UCQA 3USCS 1AT1A 5LBUA 3TGLA 1PNOA 3EGXA 4ARIA 5BN4B 3WYGA 5JCOC 1J7KA 1DHRA 1SK8A 1YULA 3QF4A 3OX3A 3PGA1 4CV0A 5H16A 5DYNA 1XN4A 4EECA 4QBHA 2IYQA 4F7WA 2QX6A 5FTMA 4JB3A 4N03A 4Q4AB 4M99A 4E4YA 1H69A 5FLEX 2HJVA 3AC0A 5G0SA 5TV2A 3LAWA 4UAUA 5JMTA 1KI9A 4E5MA 1Z2AA 3HB9A 4M9UA 4Q21A 4JN6B 2M6SA 4OREX 3P5BA 5AUOB 1AK1A 3HBNA 2IEDA 4B7CA 4CM8A 2Z0MA 3GGOA 5CDUA 2R1ZA 3GRKA 1B16A 1K4YA 4E1AA 1LX6A 4D6YA 1KIFA 2YBDA 1V4VA 4KIGA 1QP0A 1A82A 2HR1A 4JUDX 1K63A 4MW1A 5F52A 3WBBA 1JDPA 1GKIA 4FC6A 1A0OA 1Y0BA 3BSSA 2HIAA 2HJGA 2Y1WA 3WZMA 1JEEA 3LCRA 4J2OA 1RAGA 3R5XA 4K81B 3M9XA 2W2KB 3DMNA 4OQDA 4QWWA 4U02A 3RC1A 4COOA 3K9WA 4FMCF 3ZQKA 4CKWA 1EDDA 1R64A 2AZDA 3F3YA 4MUXA 4ZO7A 5GONF 4F3CA 4D3XA 1IK6A 1XTRA 3I32A 4IHQA 4B82A 3ERCA 3OEWA 1B8OA 3ZZ0A 5I7SA 3PX3A 4QO8A 5ICFA 4FILA 2J4CA 3NEAA 3QWFA 1WHTB 3W5BA 3UAZA 4UM9D 4CEJA 4JP5A 4DTCA 2W00A 5GY7A 4F1KA 2W4QA 1FZTA 2YS7A 3EGIA 3GYBA 5KMGA 1TL7C 4HDCA 3NGMA 3SHWA 2H17A 1ICIA 3GFTA 3B6EA 5A9RA 4LJ7A 2R1VB 1RZUA 2ZRJA 4AX4A 5IJAA 4DPKA 2OZLB 1X3SA 4H6WA 4QU5A 2F4VB 4A27A 3OPVA 2Z3WA 1SC1A 1QANA 4RIFA 1BN7A 5E0OA 4BKMA 2CLEB 3UT6A 3RUIA 2HSGA 5I3CA 2HPHA 2P2CA 5BW8A 2P2YA 3BJZA 1SUPA 4UTZA 4PICA 5FNVB 5FJJA 5G0TA 2ZRKA 3BDVA 1YACA 1Y5IA 4FCWA 2PU7A 2DPGA 4BB9A 2ZR0A 1DB3A 1JBEA 1Z08A 1QLJA 1NXWA 4Q93A 2ZAYA 3D6VA 5KNDA 4KX3A 4XB6B 1G42A 3A4TA 4ZU6X 5K3FB 3RG2A 2WSLA 1O03A 4EMBA 2QTVA 1MB4A 1TUGA 4UAGA 4KUHA 2PBRA 3O47A 4IQ8A 4LMAA 1JH8A 2VZLA 4BKQA 3KYJB 1J99A 3B3JA 4ILKA 5D7BA 2QAGB 3ZLBA 4YAIA 3R6TA 1O58A 5I9MA 1QORA 1VMIA 3HUDA 2HC9A 3ZW8A 4OX9Y 1UM9B 1N7HA 2ZT8A 5JV5A 5C8ZA 1KHTA 1QH1B 3WNQA 4DUPA 4JL8A 5KJ6A 5KX5A 3VKHA 4L4ZA 5IVPA 3BIWA 4KZKA 1JDNA 1FJ2A 1U2DA 1GV1A 4HYTA 5EKSA 4C6SA 4AKHA 3UMVA 1RQGA 1C3VA 4ROTA 2Q1UA 1H5UA 4WNAA 1Z0DA 4WFIA 2OD9A 1GQYA 3U37A 1M6YA 3I6IA 1GGFA 4HVAA 1NLZA 1EUCB 1P31A 2JANA 2A0WA 1RXUA 3EIEA 1CY1A 4S2UA 3U6BA 4OJTA 2IXBA 1HETA 5DSZA 5SV2A 5AKZA 1CEEA 1DXHA 2YXBA 5GM1A 1W76A 2OAEA 1ZUHA 2BI4A 2GZ2A 3PEVA 2OVFA 2VL7A 1NRIA 3ONEA 2PA0A 3ON5A 1JHQA 1XGKA 4P84A 1JKFA 1SIUA 4BQNA 2G1KA 3H4IA 2I8LA 1U94A 1MQAA 2NUAA 4CQMB 1Q1AA 1RJGA 4TV9F 1BVYF 4DABA 5AP9A 4H7DA 2BFAA 1D0IA 2BIFA 2BP7B 5A71A 3W9SA 2GKSA 4H3KB 4HNHA 5ITSA 4JZKA 4LKRA 5AQ1A 4DR4B 5DLPA 2B94A 1E1KA 3K6SB 2DT8A 4POOA 2QGZA 4C6HA 5HX7A 1E7YA 1KI6A 1LPOA 4KPUB 4M3NA 2QSJA 1TM7E 3PIIA 3L7OA 4JJZA 4E3WA 2NVWA 4FHCA 1G3QA 2VLIA 3BTVA 3TKYA 5IW8A 2JI6A 2AI1A 3KT3A 5HPYB 5HUJA 3D5QA 3VR4D 3FI0A 5K0ZA 4DV2B 5K3CA 2VG8A 3K0CC 1QBKC 1GU7A 3EGEA 3GW8A 3KPYA 4HDSA 4RGQA 1E2QA 5AR1A 4ZEXA 5IN5A 5IASA 4LJ6A 3H4TA 1PLKA 3ZDBA 2YJ5A 4D5GA 5H9WA 3GJ5A 2H07A 1JJ7A 2GZHA 4Q7EA 4CUZA 2ZIWB 4IDFA 1QV9A 3JQAD 1QFMA 3B9QA 3IAEA 4JNKA 4Q1DA 2G5TA 4QYIA 3KOXA 5JECA 4JI4B 4TTJA 1Z74A 4PZPA 4DA0A 3PYMA 2AH5A 1WB5A 3SHTA 3ES9A 1MAHA 1DKUA 4CN8A 3A9RA 4BU0A 3A1DA 3L7IA 4ND2A 3IV6A 3LDAA 4ZYLA 3E9ZA 1J8MF 3L4JA 1O9BA 4DV4B 5H02A 4ZK6A 1DT5A 2CHEA 4F8YA 1L5WA 4KWTA 2QZSA 3W5VA 3R23A 4I55B 5JANA 1HSZA 1Q16A 2HU8A 1BD3A 4YS6A 4GW3A 2IIVA 4XVQA 2H4XA 2B8TA 2G82A 2H1RA 3GOQA 4TROA 3LL4A 4X20A 3VMFA 5HKKD 2JAQA 1TTQB 2HAEA 1EWKA 4XE5A 2HPZA 3L1HA 3ITKA 3RS3A 3SJAA 4MQ4A 3T5BA 3T3HA 2Z9DA 3JPWA 4KN9S 3RD5A 3VZBA 4YCMA 4GKJB 2FX2A 4TYWA 1CVLA 3D3JA 1EDEA 3QNMA 4R2IA 3H11B 4Y2TA 3V7FA 2KBEA 2Q4RA 1XZNA 1MT0A 1A9SA 3KKKA 1YI0A 3K1AB 1LPNA 1W88B 3R5JA 4Z9YA 4QGSA 1IQRA 1T4CA 3UB4A 3KELA 4DT1B 2LKDA 1ZS9A 1YRYE 2EEPA 4JDPA 1PJLA 5I7AA 2GAFA 4XGRA 3IA2A 2Y6VA 1FOEB 1G2QA 5I9BA 1ZD2P 4OI4A 1MOSA 3JSXA 4B3BA 2PXCA 1JSRA 2MSNA 1GKYA 4TQ9A 4YCAA 4ZDWA 3RAGA 4MGYR 4NJMB 3TOSA 2W42A 3DBIA 3QEBZ 2VPWA 1LWOA 4JOQA 1NW9B 1EU1A 2ZUBA 2FHSA 1DZ3A 3S0JA 3E6AA 4IPTA 1TAUA 4JGGA 3PFFA 5EFOA 3AEZA 3L4BA 3ZEIA 4EJ2A 5I4IA 2AUNA 3MCAA 5F51A 3NVDA 5IT4A 1MO3A 1C0PA 4KL8S 3D43A 3EC7A 3MLAA 3S68A 2YWHA 2QSYA 5AW3A 3UAXA 3VXKA 1VGRA 3RNLA 4G24A 2YMMA 4RA6B 1R0YA 3L7LA 4A6PA 3A6PC 2IZZA 2AD1A 5LOVB 4BEWA 1UDCA 3FAKA 3HV2A 4DG9A 4TKMA 1CB0A 3HB4X 5HJ5A 4ZQIA 1BMFA 4L57A 1J2TA 3RUCA 3B8HA 1UWKA 3DYVA 5JSHA 1ZLYA 3L18A 2VSXA 1ZL2A 2Z2JA 5C53B 3DL4A 4PHGA 5A62A 2CDCA 4Q3BA 3W5JA 4IDQA 5KVSA 3DC2A 5JIBA 3RW9A 2K7ZA 3EZNA 4P93A 1E9VA 1M1YB 3I73A 4WT7A 3TQOA 3BHNA 4QDJA 5LZ9A 4Z9FA 4CLDA 4WKGA 1XVTA 3LKZA 3VH1A 2ZZMA 1E2MA 4EHIA 4FFVA 3MWEB 4M38A 3AFGA 4UHCA 5DNWA 4AJ1A 2WJGA 3ZY3A 4WUVA 4BKUA 1YA4A 3JWHA 1K6JA 1LNQA 1ZP6A 1JZTA 4HMPA 4JJ6A 1Y89A 2IHKA 4QBKA 4BQFA 3U7QA 2PKQO 4MP8A 4C7JA 2XODA 4O2RA 1X2BA 2EP8A 4GF5A 3UWKA 2WEKA 4ZI7F 4DA8A 5E9WA 2JGMA 5EVJA 1DCKA 1IG0A 1KPGA 1RAFA 1GZDA 2E48A 4HZUB 1C7ZA 1M0WA 2FWAA 1S4MA 5BV1A 2GRJA 3QE0A 4DNPA 1J23A 2IIPA 2ZIZA 4PO1A 1XRNA 1E4EA 3O9ZA 4CKCB 5JDIA 2CMFA 3QSYA 3K0SA 2IK8A 3HFGA 2DQZA 3NHUA 2PSFA 3M4YA 1YCHA 2E3JA 5JOQA 5IVHA 1QGAA 4P53A 3HB7A 1CP2A 1M8FA 2UXCB 2B4TO 4M49A 4QEZA 4O2BB 2RC6A 1E66A 1ONSA 4JEUA 1KQFA 1Y6QA 3KSDO 1MX1A 4LYDA 3CG0A 1RTKA 4E70A 1F4PA 1T9ZA 4CEIB 3CKYA 2IV7A 4DDHA 3RSHA 1GPUA 5FJIA 2EGGA 2DR2A 2QDKA 3W2IA 3OFVA 1NJFA 4J6EA 2OV8A 4HX9A 1EFRD 1FU7A 5JPCA 1EX7A 3T9BA 2AEJA 2G08A 3I52A 3ANLA 1C4WA 2HQSA 4K1LA 4QU9A 3KTAB 1C8KA 1EFRA 1EXNA 1QG6A 2XKJE 3RQSA 3ROZA 4FYIA 4AWXA 5K0TA 1Y9ZA 1KXJA 3CM0A 4FFBA 1KZ6A 3QPVA 4CCSA 3K9CA 3ZVKA 2QTHA 4DQKA 5B1DA 2AFIA 3R7WA 3R9KA 1U2QA 4GLJA 4GQBA 5DBHX 4DF3A 1H22A 1TT5B 1DPGA 1GUZA 3V42A 1PO7A 4P2BA 3MSXA 4RKEA 4YQZA 2QROA 1K8YB 4XAQA 1ORHA 1U80A 4HH1A 1O94D 2QW1A 5T6BA 1R0LA 3MJHA 1LY1A 1SO8A 2JKZA 4PPGA 2QQ0A 1YR9A 2FY8A 3WBJA 3ZI0A 3WLKX 3AKZA 1EFKA 4EJMA 1RBZA 3OE7D 4Y2XA 3UUEA 1QH8B 2YV2A 4P08A 5DYWA 3OBBA 4MVJP 2Z2KA 3OZUA 5CB4B 5I9NA 5JQGF 3OE7A 1VBKA 5L3QB 1NW3A 2OXRA 1Z0KA 4JENA 1HI9A 1D2MA 5LUBA 2VDJA 5IJ0B 5JH7B 5EP2A 3LDUA 3OEYA 3BE6A 1RE0A 3H5RA 1SBZA 1H42A 3NH6A 1SUCA 5D00A 4PAGA 4JJKA 3SXJA 2ECFA 3LDGA 3ONWA 5EE5B 1TT7A 5JLJA 5CYPA 4Q1AA 5LLSA 4GIBA 5JASA 1TK9A 1TD1A 4GP6A 3JVIA 3R74A 3V7WA 2WWGA 4KQFA 1LSOA 3H9BA 3H9CA 4J7XA 2D4AA 3HI6A 3IJPA 1SVIA 4D4KA 2IXAA 3ZY2A 2UXDB 3GCXA 3BE4A 3OPXA 3PP8A 3U62A 2JFXA 4ZREA 3H8WA 2AOUA 3LVRE 2M6LA 5KHOC 3C0KA 3HTXA 2CL6X 1E3WB 4MIKA 1DUIA 2HADA 4PNEA 1YQ9A 3OPYI 3EXIB 3UC5A 5I7UA 4FMDB 3R3YA 3S3TA 1VB3A 5JVDF 1YZGA 1R18A 2KS6A 3ML1A 2Y67A 3VU9A 4J07A 2WHPB 5K05A 1U11A 2GZDA 1NNEA 4R9VA 3LT4A 2C57A 2ZB8A 3NM6B 3QVLA 5FORA 1UXHA 2VPXA 1XHLA 3FNRA 4FIZA 1F60A 2JJ1D 1QUEA 1G4HA 1SOUA 3N5KA 4IAOA 4PC2A 4TM7A 3NW9A 5KYKA 3I5XA 1ADFA 2Z6VA 3C2QA 1BE0A 2JJ1A 3EEBA 5ALZA 2HRRA 2XGJA 5GOZA 3LY9A 3RTEA 1WV1A 1HMYA 4Y9UA 2QYSA 2A14A 4K9MA 4A5SA 4ZVQA 2IIQA 1A50B 3ZHRA 4O4LA 5DULA 2B8WA 3KHKA 2AEEA 2J0UA 121PA 2ZETA 5H81A 4CKEA 2DBQA 2X2EA 4IIJF 5B12A 4N41A 1M0EA 4Q9DA 3KIPA 5GV8A 1LU9A 1V9LA 3O75A 1HDRA 3IA7A 1N4AA 1Q20A 1XQWA 3VPDA 3CB4A 4GX1A 1XRLA 3HO8A 3QFSA 3VDRA 4YRTA 1SQ5A 3E9NA 1T5TA 3ILHA 1V37A 1L7QA 2H8KA 3QU4A 3SHOA 3UMFA 5DTJA 4UTNA 2VBIA 3LBYA 1WMSA 1LK5A 1DAOA 2ZJBA 2CT8A 3R6WA 1DBWA 2NWQA 4N7MA 4N49A 1IVSA 1V5FA 4OH7A 1FTWA 3KJQA 1QU2A 1Q7CA 1I36A 1GFWA 1C7RA 1TF5A 2F48A 2FF5A 2G9RA 1DQZA 3N8DA 4GI3A 4JQSA 1HNXB 3OA0A 1EVYA 1G8HA 3QYPA 2QTMA 1TEVA 4W1RA 4LV8B 1DTWA 4EX7A 3B52X 3DE1X 3LBNA 3EC1A 2R6DA 1MAAA 3K92A 4HMQA 5KYXA 3PUXA 3V8BA 3E9QA 3G1WA 1I01A 3SDSA 2YXEA 1A9RA 3NATA 3WNVA 1B0PA 1BVUA 3VHLB 4DG8A 1GTSA 1KFEB 1YCDA 2CE2X 1P9NA 3CT4A 2IDMA 2V8OA 5A4KA 2EFJA 4DZZA 1ENPA 3AHIA 1YRLA 4YP1A 1K89A 3R7FA 1ZNYA 3WGKA 1U0FA 1DC7A 2IHTA 2Y4NA 3JQGA 3KPVA 1JG1A 4G84A 3SDBA 5KTTA 2J87A 3ZJTA 4K6FA 3BK1A 1ONOA 4IIBA 1D2GA 1G5RA 3ESQA 1UDWA 1NKVA 3N87A 4BU1A 4DCSA 1I7QB 1KAHA 3DFMA 3G2LA 5K3BA 1CZKA 4H1HA 1F1JA 2DP4E 1E20A 1J56A 1P0CA 5BN1A 3C7AA 3MQFA 3PF8A 3HN6A 1G20A 3IUQA 4IO1A 1F48A 1SURA 4M54A 5GJWC 3AEXA 3NHYA 1RWNA 3HCBA 4H0NA 4WLNA 1S4QA 3IDZA 4QRHA 3GUYA 1X6VA 3GJ8A 4UU8A 2RGRA 2UVPB 3COSA 5EGNA 2AFRA 4N3NA 4KXVA 5BYBA 1KFBB 2XQVA 3NFYA 2XTMA 3ECAA 3L79A 3PHHA 1R5JA 2IKSA 2PR7A 4CTJA 3FR8A 4WN9A 1B42A 5DW3A 5LDGA 1DRJA 3CR7A 1PT9A 4G36A 2CL7X 3PNPA 3VVBA 2IU6A 5CAEA 2B6NA 2QDXA 3DL2A 4ZO8A 5J4LA 2ST1A 1KIAA 1N7GA 2NO4A 3JQFC 4LTDA 4UHFA 3VZCA 4CNQA 3A1VA 1EFHA 1MUUA 5G53C 3BZUA 1IZ9A 4GNKA 2X0RA 1GKUB 1FFAA 1PR2A 2AC2A 1G8JA 4C5BA 3NBKA 4P2GA 1AHHA 4ENQA 5A0TA 3LSTA 3NAGA 2R85A 4NS4A 4GEKA 2O8VA 3K32A 3IBFA 5EE1A 5ADHA 4XGIA 2K2QB 2EVWX 2PZGA 1MZVA 2P90A 4RD6A 3L07A 2DBZA 1XVUA 4QYWA 5BYKA 3IEVA 1T3HA 3EW9A 1U8AA 3U60B 2WIKA 2NYUA 3OT5A 4NATA 4ZZ3A 3RAEC 4FPXA 3RJ9A 3VPFA 2RKOA 3RS2A 1DEHA 3RTBA 9ATCA 1XTKA 1S7CA 2HGSA 3NHSA 3K0KA 2H63A 3FYUB 4TKLA 4B74A 1YH3A 3ISJA 3ZWNA 1JEOA 3DKVA 1AO0A 4R1UA 4QAJA 1DKMA 3A7EA 3Q87B 5CYFA 3ELUA 3ZWWA 3OA2A 4PG7A 1DX4A 2C4UA 2ZUWA 3CKMA 2E4XA 2I87A 2DLDA 4I4CA 5EESA 4XB2A 5IZCC 3ETGA 3AKDA 3EW7A 1P73A 1MO5A 1S2DA 1VCIA 2PWZA 3EMBA 4I4NA 5BMOA 5BR1A 5LZ2A 5CFZA 2GHQA 2IDJA 1OI3A 1GNSA 2UYQA 3DZBA 3OCVA 3PUIA 3GGDA 5CCXA 1MX5A 4A2QA 4AF7A 2DFTA 4R8MA 4RVFA 4ER5A 2OBLA 1RJ9A 2CLCX 5B4VA 1J5EB 2VBFA 4J0JA 2VH5R 3C7DB 1P9LA 4O5OA 3WLOA 4S2EA 4IOMA 5J5VA 3RR2A 3DBLB 2CCJA 3F0TA 1L5HA 1Y7TA 2TSYB 3GVHA 4ITUA 4BNXA 4OLFA 1HYEA 4O0MA 4XIJA 5EJ4A 3OWOA 1YKSA 2QP4A 1PR1A 1L3IA 1Z16A 1NONA 4D3SA 3PPVA 4NHEA 3LPCA 1MX9A 1BSVA 2L82A 5ILQA 5DYIA 1KJIA 5IF3A 3AG5A 2CK3A 2P11A 2WC1A 3KB8A 3NVMB 4L0CA 2F55A 3GFBA 1T8TA 3WLMA 1UBKS 3FE2A 1ML4A 4CQLB 1T9HA 3I12A 1OV4A 4IVPA 1S1CA 4L28A 1KI7A 4ZHSA 1N5MA 2HU2A 2AOTA 3M4JA 4PZ0A 3FNQA 4QO7A 1BIFA 3HNOA 5DXJA 3WZLA 4A23A 1C7QA 2G70A 3MBKA 3NBYC 4PSKA 2E87A 2WWVD 4S04A 1P7ZA 4LQLA 4JLWA 2R00A 3G23A 1EFUA 3TQSA 3OEED 3VNRA 2JVIA 3DO6A 1XROA 3LV8A 1NT2A 2PSSA 1YONA 3DEHA 3IDAA 1J5PA 5J23A 5J2TA 2AD5A 2B35A 4OL9A 3JRWA 1YAHA 4WVFA 4KAAA 2WNSA 5FX2A 2XD9A 2XNHA 4QQFA 4NI5A 4XQ0A 3ZCSA 1EYZA 4Q82A 1N6HA 5FUMA 5C1IA 2V7VA 4YAKA 4URUR 3VU0A 3TNDA 1ZI8A 4EUSA 5JNLA 3LF1A 4UEKA 4HQFA 4R71A 2C92A 1Y42X 1VXOA 3ZOKA 4CMJA 4BNGA 1E0KA 1YVRA 3QYFA 3LUPA 4WEQA 5JO0A 5K6RA 3FUCA 1Y34E 1J9EA 2BFWA 3RJMA 1XLTC 1V7PC 1S89A 4XPIA 2Q2OA 2ZR9A 4FXPA 4Y6RA 2D59A 2G63A 2JGNA 2RJOA 4F4DA 2C2OA 2OENG 2PRZA 1S2GA 1DU4A 1GCOA 2VN8A 3QBEA 2WF5A 3II6X 4MUHA 4OGFA 4EW1A 4PYJA 5A06A 3PQCA 4B5KA 4DFDA 4GL2A 2AQIA 1XZLA 4BGVA 1XZ8A 4Z6KA 4B84A 3ZQJA 2OKGA 4TXJA 4J1QA 5J2TB 2EZ8A 1G5TA 1VRVA 2IZ6A 2YINC 4KLNA 3RJTA 2NT3A 2HTFA 3WRXC 3BIOA 3BGOS 3GUVA 4MP6A 4BJ1A 2X1MA 4BNTA 4D9FA 4OX9B 3RC7A 3M3DA 3ZV3A 2NU6A 4GOND 3AXTA 5F5LA 2XCOA 3N8KA 3OJCA 3KLNA 4X8MA 2WY2D 4ZK2A 3GUZA 1RM4A 1TEXA 3L7AA 4XARA 2BFFB 2CXRA 4HH3C 4Q3EA 2PZFA 1RWBA 3GLIA 1X74A 3C8MA 2DU8A 4F6LA 4DDTA 3PEEA 1IZYA 3AVWA 4KHZA 3FB1A 2XGSA 1UBNA 2Q3EA 2NP7A 3QJYA 4Z3OA 3BSYA 4BFTA 1AF7A 2NU7B 4H7HA 4LXTA 2V7XA 2EJVA 1H0RA 4ZYYA 3EGCA 5C8YF 3CLRD 5KPDA 1O8BA 4KKXB 4BYGA 2XUZA 2H5EA 1NR7A 2OBMA 2C4HA 1V16B 2G0AA 4GZLA 5C4IA 1HZZA 5T8KA 1JEAA 4QTTB 1AXGA 4YO7A 2NO6A 4AZ0A 1GV0A 3N86A 4P7JA 4EQZA 3B1FA 1KH3A 1SBHA 1IU9A 4GBJA 4OQ4A 4D9KA 5JS1A 3L7MA 3EQ7A 4M53A 3I9JA 4OXXA 1NLUA 2JLZA 2I2BA 3R8XA 1QFSA 5LQJA 5MFPA 4Z51A 3W7AA 4XLTA 3S1SA 3K0AB 3W9YA 1I0ZA 1G3IA 3M83A 3U2QA 3PXCX 3HPQA 3P9YA 5LM3A 5BR8B 1VHLA 4ENVA 4G65A 5JXJA 5TJ9A 1BX0A 1QFXA 2A2ZA 5BRNA 3L1JA 2NPFA 1R0KA 5DEIA 4AD8A 1RVDA 3R0IA 4E5YA 4ZZIA 2FEMA 1JAIA 4ZOLF 3VU8A 1Y1PA 1NR1A 1O3YA 3R3HA 1RWPA 3K70C 1W36D 1Y81A 4BP8A 4W8OA 1NMEA 1XMPA 1OPRA 1PJ2A 2NZUG 4AMUA 3UK6A 2JLYA 3OEHD 3U9TA 1GRRA 2BRUC 2HZ7A 3VR3D 1RRPA 1BGWA 4Q3KA 4ZT4A 3TTXA 2O8CB 1H4SA 8LDHA 4YJ2A 4DG5A 4E14A 2XJ4A 2YZNA 3D3EA 5CLQA 1YE3A 2XBUA 3K5HA 1EGQA 4W5OA 3TR6A 1PV2A 2RGWA 5DHFA 3NRBA 3C7TA 3OAAA 3DHVA 1Q1QA 4RMIA 4WA8A 3VJLA 2FU5C 3TAUA 4AO7A 1SHUX 2V1XA 3CKKA 1XKQA 3QHQA 2GD6A 4LZOA 4MW2A 4Q4CA 2HF2A 2ZP1A 4GM4A 4PZZA 4MKGA 5HS6A 2BDTA 5MDHA 1B6RA 1PTKA 2WKWA 1R9MA 4ZWNA 3W4IA 1PNQA 3U44A 2O0MA 2F4NA 2XW6A 1O95A 2IYTA 3DOOA 1N5KA 5AJTA 4HUTA 1PJ3A 2RI6A 4RV5A 3TPCA 3WLSA 4U39A 2PWBA 4MULA 3DLAA 3OZSA 2ZIXA 2WQZA 3PXDA 4LOLA 3HZHA 2IELA 1KMCA 5T64A 5T8KC 2D7JA 1QM5A 1D3AA 3KYDB 4L16A 1V11B 5JMWA 2VQFB 3ZLVA 5IT5A 1PGJA 5FXMA 5A04A 1JA1A 1M1NA 1NVVR 2P9GA 2XH8A 2ZITA 4E94A 1BA2A 4IOJA 5EAIA 2TMKA 4UNIA 4BX9A 3DZFA 1XHFA 4F2HA 1GP2A 5A05A 3HYTA 3I39X 1JG2A 3PD1A 4ONEA 4JGBA 3N3BC 1GA4A 4IXWA 3WLJA 1KC3A 2REQA 4BNJA 3BJEA 3ZCXA 2WF7A 1AC5A 5JYCA 2W6ID 3KNZA 3QEOA 1HF3A 4K9PA 1L5SA 1MQ9A 5J47A 2BD0A 3HJCA 2IYFA 2O2CA 1SUWA 2NX2A 2J31A 1O57A 5FI3A 2N0SA 1X1EA 1LDBA 3N74A 3CWQA 4K6HA 4UHKA 4DLSA 2IUEA 4LXQA 4CMHA 2VUIB 3PT9A 5HCUA 2RHCA 4RY0A 4A0GA 3BIFA 4QICA 1W19A 4E6PA 3U26A 3FVQA 1CUWA 3EVGA 1XFDA 2JNWA 2H2DA 2QN9A 2X9GA 1LPSA 3M6MD 1U81A 3HSYA 5DLYA 3SBXA 1U28C 4PN3A 5L45A 2Y3IA 3Q12A 3PNYA 2VNAA 1FQOA 3FTQA 2NADA 1HQDA 4D80A 2R65A 1TUEA 4OYLA 2CLFB 3JYOA 1U3UA 3A04A 3COZA 3IIEA 2H57A 3R3WA 4O4LF 1H4VB 2CNBA 4ZOAA 3ZK8A 4X6XA 2V3WA 3L8FA 1KO4A 4KOEC 1X7WB 3BD8A 4PE5B 4U5XA 1X70A 2G4CA 5CD1A 3FHTA 2VT7A 1HFJA 4B6JA 4E2FA 4R2WA 1JL3A 3O5AA 1S2IA 2PQ6A 4N5HX 4YUXA 1PEAA 2XUAA 1D2RA 5LB4A 1DVRA 3AJ8A 3N2ZB 2IU0A 2J3MA 3IHWA 5JY1A 5K3EA 1XZBA 4CM1A 4JLVA 4KW7A 3O73A 4QOEA 1ZD8A 4AJNA 4QFCA 1BX3A 2OE2A 2NAFA 3LHIA 5A4AA 1GFSA 3PLNA 2V6BA 3EG9B 4HAIA 3WSWA 1V8BA 1ETHA 2J1LA 4MAAA 2RH4A 2CF6A 3ZE1B 3SJZA 2GK6A 4BUZA 3K6RA 3P0EA 1FNSA 4KNYA 1NFFA 3TBKA 2HWUA 3LOQA 4HWOA 4X1YA 3EPKA 3TX6A 2Z08A 2GCOA 3UH1A 4F3KA 1N6LA 1SCKA 1Z56C 3L7KA 4KFCA 1U9YA 1UF9A 2O2YA 4GPAA 4IDGA 4FW8A 3RFUA 3D2BA 2XR1A 3V9PA 4YRKA 4HFJA 3KJFA 5CH8A 3ZGYA 2JJ2A 3HFRA 4IOKA 4MRSA 1J9ZA 3D7KA 4KB5A 3RIEA 4BLWA 2BH2A 3WMXA 4DSNA 3QVGA 2OWEA 2EX0A 3CVVA 5EHQA 1U31A 4FBLA 1CULC 4AN1A 4FFPA 2GM3A 1I80A 1KZ4A 5KAPA 4V1CA 3HEAA 3H75A 3ILSA 2AIRA 1TGYA 2IYNA 2DYKA 4GD3Q 4QOFA 3RVMA 1I3NA 4GR5A 4PR3A 5LD2C 1ZNZA 1TYAE 3TSZA 1ZG3A 3HM9A 4MVXA 1G19A 5CDTA 2OFOA 2CWWA 4TKUB 1WEHA 4HS4A 2G6BA 4EK9A 2QUKA 3ILYA 2QKYA 3NUGA 5DMHA 1NUAA 1CZOA 3BG5A 3PUWA 4A0QA 5JD3A 1CDOA 3CHYA 1FDUA 4CM3A 3HU1A 2XSZD 4ZOEA 3EUAA 1Y63A 2ODWA 1H6AA 2A1UB 2C07A 3F47A 3NDIA 3WA6A 3VNVA 3PDIB 1BGVA 3JTEA 7ABPA 2J9ZB 4E0BA 3GAFA 2GX6A 4O4JB 1LBQA 2PO7A 4MHOA 1LW6E 2X0IA 2WABA 5FCDA 2H4HA 3E27A 4C4OA 2R4QA 2XQGA 2R86A 4MR7A 1TLFA 1GOTA 1MH1A 1OLUA 2R62A 4AIRA 3WGNA 4YV2A 2IODA 5KYWA 3M6LA 4FGZA 4PQYA 4EG4A 3G9TA 5TS2A 2CD9A 4RSRA 4ZQGA 1UP6A 4ERNA 5FV4A 3LNTA 4NBLA 4Q9JA 4B9AA 3IPYA 1DCMA 3R3JA 3HKDA 5KWJA 4OVKA 2X4IA 2WJYA 4FLFA 2OHOA 4G5RA 1O8CA 3ZXIA 3NS7A 3Q2IA 4RD2A 2PUDA 1A5SB 2EFGA 4ESOA 2ZIGA 2YZGA 1L7BA 2HRZA 4M89A 4MYHA 2AYXA 4YLEA 1W0JD 2XADA 1PWZA 1XD2A 4IF4A 4MJXA 5BR4A 4LWOA 2VDUE 3T3IA 3NDBB 1BZYA 3RVJA 3KV1A 1UEJA 1VCMA 3U7HB 3N07A 4QQKA 2BHNA 1QX3A 2JZCA 3AB8A 3EG5A 1ZKDA 3KYCB 3L01A 2Q50A 3MUEA 3BTOA 4I1VA 4WXRA 3WV5A 1I7NA 3SVTA 4BXOB 1G1MA 1Q7RA 4FNGA 5AT1A 4KR9A 5BN3B 3OCXA 5DT2A 5E4YA 4HRXA 4GGMX 1I4TD 2Q49A 3I6ZA 3IQEA 2A6PA 2WJJA 3H7IA 3QXHA 4P32A 4CM9D 1PL8A 5F2NA 2BGTA 3STUA 5EA2A 2TS1A 5MN5A 1P62B 4O5AA 1RHMA 2BGUA 2J4DA 1T3LA 1FFXA 2MSKA 6CHYA 5BSKA 2GCNA 3L40A 4L7QA 3CRVA 1J2YA 4U7HA 2ID4A 3WIDA 5LQKA 1CUDA 1T8UA 4FOOA 4AKSA 2EP7A 4ES6A 2VJOA 1VJGA 3ZZ1A 2J07A 2BVNA 1F2TB 3C3AA 4KQJA 1XTUA 3KWLA 1O0BA 3N2KA 4TV8B 1WQ3A 3V9AA 1BMTA 5ADUS 2VJNA 3U56A 3HY6A 4RDXA 1HEYA 1G3RA 1XVVA 2H85A 1ODJA 1B6SA 2AFIE 1EB9A 2QRQA 2ZT6A 3A7DA 3BJIC 2P6MA 1HDIA 3O95A 4RF2A 5P8WA 3RRZA 3LYHA 1L5VA 1V1MB 4YCLA 5FUWA 5TQ0A 3C6XA 1CJMA 5LQRA 2W43A 3B1VA 4LJAA 1XTQA 1B3RA 2FGKA 2PV7A 4RWZA 3ZHSA 4J1NA 2Q6OA 4NV1A 3JZAA 1LK7A 4MKFA 4R31A 1UCFA 5EJFA 5T5QA 1NI4A 2EDAA 3LBIA 4PX3A 3GJXC 3ETLA 4MHSA 1CFJA 1SHLA 2D1RA 4RDIA 4AUKA 1G0NA 1DJOA 1H1LB 1ULAA 3PUKA 4PQEA 2HU7A 2DWQA 2FXIA 3P2MA 3K05A 2O2JA 2OOKA 3EZ9A 2RGAA 4PPNA 3D6FA 2EKPA 3RUPA 3V55A 3VTKA 2WJPA 3URKA 2Y1XA 2A30A 5T4FA 5IARA 3E23A 4NJEB 4PWZA 5AUQA 2XWQA 2VT2A 5JADA 1XPOA 5LYJF 4O0LA 3OCJA 2QRZA 2VQSA 3BMCA 3W34A 1GTJ1 4R68A 3WS7A 2REOA 3I64A 3PTLA 1JFTA 4KHPB 2WB4A 4XM1A 3THWA 1NX9A 1ZFNA 1Z4JA 2XRYA 4WZAB 3UTDA 1AK9A 5EHIA 5A3SA 5CM9C 3H9EO 4XRRA 3WK8A 4JP2A 4DQXA 2X8BA 2WZDA 4W4TA 3EOBI 3TUJC 1RRGA 1EVZA 4LOJA 2XTNA 4AWBA 3DCIA 2I8CA 2B4YA 1GNRA 3NNSA 3ODPA 3C3DA 1AUPA 4HLDA 1HNWB 1C1XB 1NWCA 2BY4A 5EL0A 1K2VN 1BKDR 2X9QA 4I1RA 2PR2A 3IDFA 2ATXA 1XAIA 4CR6A 1ZVVA 1P4AA 4TYNA 1MEOA 5L9AA 3S5JA 1BXGB 4D0RA 4MVJD 4N0QA 3VR1A 3FG9A 2ZVQX 1UPXA 2XNSA 3G68A 4IS2A 5BV7A 2YKGA 1TIKA 4CM4B 2XXJA 2EFCB 4DGQA 4EVSA 4WBXC 1WZ2A 2R4UA 4IFIA 4KXMA 2FYTA 5B3AA 4UBNA 1VKRA 1S02A 2MINA 2Q7DA 2I78A 2EZ4A 2WA1A 4B6FA 3LQKA 1LI5A 4WBNB 2BCGY 4Q7KA 1KQOA 4PYRA 2I4OA 4EQ6A 4TVSA 4TL9A 1CVIA 1X77A 2HPAA 2QF7A 4HTAA 5JXIA 3KK0A 1DARA 3VZRA 2EARA 1IDOA 2ZB7A 4ND4A 4I5DA 1S6YA 4NZOA 4UMEA 3N9IA 4YRNA 4GXNA 4RKRA 1BH6A 1G5PA 1GPAA 3GARA 3OQ1A 4LUCA 2HV9A 3SF8B 4R2LA 2I34A 1Z75A 5DM70 2COUA 2KX7A 2EJBA 4C3OB 1XDUA 3E9RA 2UZ1B 1FLAA 5J40A 1EE2A 2X3FA 5JCOA 3W8RA 4GUAA 5CEEA 3ZHOA 3OM8A 2NMVA 5ALSA 5JCZA 1QHXA 1S96A 1ABBA 1TVMA 1YRWA 4MRNA 1ZW1A 5ICEA 2FPRA 4HDNA 3PQ7A 4US0R 3C3KA 5A5VA 1ZGJA 2ZSFA 4BC1A 5EJ6A 1UFRA 4MB0A 2GN0A 2QXYA 3EE6A 1KQNA 1WLSA 3P19A 1B00A 1PR0A 4YMTA 4M9QA 2C3YA 3RK1A 3JWJA 5CTJA 2OM6A 2HHLA 3MWJA 2I8AA 5FOVA 4GHWA 4B43A 4CR8A 4EIWA 3K53A 3FMVA 5DASA 4PZCA 1V1RA 3LECA 3LUFA 3STWA 1KPIA 4OJKA 3T7TA 4EB8A 1UM8A 2ZREA 3A3KA 5G02A 1ZUWA 3W6OA 2PMEA 3LW7A 1P19A 4UNNA 5CEFA 2NZYA 3TXYA 1BMQA 3O91A 1IM5A 1P0FA 4IUBS 4L73A 1U3WA 3RC9A 3TZCA 3U4AA 2Q28A 3EXHC 4Y18A 4BNNA 4WOCA 1NVMB 1P9WA 2YZ2A 4HSGA 4YJ2F 1CUAA 1YQTA 1NV9A 4J03A 3JRXA 3WKEA 5K6TA 3GB9A 3WB2A 4MVYA 5ALHA 1IOLA 5JJCA 1Z5GA 2I55A 3QV1A 4MLCA 5U4XA 4AKTA 1E3EA 2DJ5A 1ORRA 2G5PA 2RJ3A 3OKCA 1JWBB 2FAXA 4IIUA 3BKXA 3A3NA 1HE2A 1QC5A 4FYHA 4ZVLA 4XFJA 3ZGXA 5EJEA 5IFLA 5GIOE 1ZM3A 2AZMA 1NVVQ 2FPIA 3GRFA 2HA5A 3R4CA 4L9WA 5L3SB 1MTOA 4UAJA 3M6UA 2BUCA 4OB8A 2L42A 4GMKA 4RLFA 3H17A 4ZFNA 2W48A 1OX5A 2AOXA 4EY8A 1CB7A 3EQ6A 5DBOA 1IATA 1EFLA 1V8FA 3K8QA 4CLRB 2FV8A 4AJ4A 4DQLA 3MRTA 4U1RA 4D8WA 3HDHA 3GRAA 3BB1A 4J29A 4YACA 4J0IA 1SOVA 2HMVA 1RXIA 4R69A 1A7AA 3CIOA 2IXEA 1T13A 1EK5A 3PIDA 3PGVA 4RXUA 2IV2X 5LQNA 2DQ4A 2FFHA 2PGOA 2ZRIA 4ID3A 4ETMA 3Q72A 3V7YA 3NP9A 3CTPA 4K8RB 3AHEA 4Q3DA 3N5CA 3DKPA 4WNCA 4AZVA 1EESA 1GXSB 3VPHA 4KQEA 4KKVA 4UBMA 1U0EA 3MUNA 3SC6A 1N2ZA 2PS9A 3D64A 2YRWA 5BOVA 1YB7A 1CY7A 4LYEA 3EC2A 3TAXA 4ZOQI 5KU7A 1WMDA 5GJVC 1UAAA 1SPXA 3F7TA 4K9QA 2D7DA 2OV2A 2O3JA 2VJLA 4HQNA 5AI5A 1HBJA 3WICA 4ENRA 1M8PA 4RE6A 3LQ1A 2G36A 3QTBA 2GJSA 1OE0A 4D7AA 2GR9A 6ABPA 2VP3A 2IEZA 4OA5A 4RABA 4JK3A 1UMDB 3MK31 2RGCA 2LRHA 4PINA 3RF7A 4A8PA 1NP6A 5LJLA 2W5UA 3P9CA 3IC5A 2QY9A 16PKA 5E3IA 4LYJA 4C14A 3IUMA 1JHAA 4F5YA 4NXNB 1A8HA 4KQHA 1JLSA 3PUZA 1FMTA 4DLUA 3ZX5A 1T9CA 4DV7B 5I4CA 1U2ZA 3WLNA 9MHTA 1UAGA 2EGUA 3I0NA 2QAJA 3RRBA 2M2IA 3UNXA 4B3XA 1M10A 4RD1A 2Q2VA 1K6XA 3EK2A 3TJRA 4NZYA 2FN3A 3MXOA 5LXTF 1U2EA 1U04A 1RKBA 2Q3MA 1IY9A 2FWNA 2P9ZA 5CYGA 1GGJA 1SQSA 4OQLA 2AFVA 4S1PA 5HRAA 2C2MA 1ACMA 3RIGA 5IABA 2W2LA 1X3LA 2B30A 4LFCB 3ICQB 3DB2A 4WZ6A 1S8OA 5MN6A 2W90A 1HKUA 1E2FA 3JD2A 5IYZF 4DNOA 1TQ4A 1KARA 3HNRA 4HPXB 4I81A 1E92A 2JAUA 1NVFA 1ZH2A 1QAOA 3FTDA 4JT8A 1N8KA 4OV6B 4AUMA 2PGDA 3MQ2A 2BHLA 2R47A 4YHHB 1DI0A 1SHKA 2J9FB 3EA5A 5FDFA 3VC3A 3HXOA 1XT6A 2IHVA 3ICWA 3OMLA 3BTUA 3R6GA 4I19A 3HYRA 5A9SA 3NHWA 4CVNA 2JGKA 3GELA 2E85A 4QU8A 3QXSA 1AQLA 2RFLA 4JT4A 4YJ3A 3F2VA 3K0CA 3TOVA 2CMDA 2WHEA 3KR0A 3RBXA 2FEXA 4BAUA 5HJ2A 4C0XA 5JSYA 3TLYA 4HCJA 2FWMX 2YWEA 5IANA 4QUBA 1UT5A 3HKCB 4FHGA 3ZIAA 4BMOB 1SOMA 2I2XB 3TD9A 2F1OA 3JAMA 1FUEA 2MSLA 1U0NA 4GOOD 4MUYA 2NO1A 3K8ZA 4KXWA 1QP7A 3ZU3A 3LBFA 3AM5A 3A37A 1T5SA 2XOKD 1R6VA 4OA8A 3EFOA 5EIEA 2BV3A 3KD2A 4ZO9A 1ORTA 1M34A 2ISCA 4JUBA 4TTTS 2XOKA 4D0GA 5JUWA 2Q5FA 3SEZA 1DELA 5KQPA 2IL1A 3C41J 4LJ5A 1ZH4A 3R2JA 3Q15C 1JFVA 4RTSA 4HH0A 2ZRMA 5LL6P 2XCSB 1W9HA 5H4GA 1SVOA 5LP1A 1IIRA 2EKLA 3M3PA 2FZLA 3RIXA 1M6WA 1UP7A 4O4IF 3DS8A 1U8ZA 3HSKA 5KNCH 4TPKA 2OY0A 4D97A 2HRCA 2QX9A 1XAJA 2AS0A 4AAYA 3OJWA 4HDOB 1NVKA 4QOSA 1RZRD 4G0OA 4NWIA 5EZYF 4UDNA 2FRDC 2X7HA 4RTRA 1QGOA 3G9QA 2G7ZA 2B5VA 1Y82A 4BVHA 3AKCA 3UGQA 4F2WA 1G8FA 1FS5A 4F4JA 1II8B 2R7KA 2X42A 2J3IA 4H2DA 4OY3A 4JJAA 4P4LA 4MW0A 4LJLA 2BEWA 4Y1GA 5EWLB 2DFKB 2PX0A 1DWPA 5AHXA 5ALIA 3FMGA 1KO5A 4FVTA 3IEKA 4GYKA 5GGYA 4F2GA 2CV0A 4ALMA 4D96A 4XCXA 1RD4A 1XJ5A 3IUYA 1UQRA 3SBOA 1D6SA 2DSTA 3LC7O 2ZJ7A 1J20A 3L8CA 3QVMA 4LN1A 4O8CA 3GLIE 1NRXA 3JASB 3LHKA 4QC2A 5ILGA 3OQBA 3PJFA 3SD7A 2O3QA 4FHZA 4CW7A 4E1VA 2BM0A 3TDNA 4OOFA 2F8LA 2I3ZA 3V34A 4EWLA 2HSJA 4NCJA 4OB7A 4LHXA 1IJBA 3QZUA 2DQKA 1K66A 3INRA 5L6LB 1TZJA 1NYLA 4P3OA 1TCUA 5DCYA 1F2UA 1GPNA 1JMKC 1O97C 1ARZA 1UQUA 4IVNA 5D5HA 5JZMA 1NQWA 2GZRA 4MQEB 5CVCA 1BWQA 2WYOA 5FBHA 5EHXA 2VK8A 1KBQA 1ZM2A 3ACCA 3CBQA 2QAGC 3HADA 3NORA 2OV1A 1C3LA 3KLOA 1BC5A 1U1FA 2PD3A 4XZ3A 2BEVB 4KR3A 3FUWA 1E2KA 1TOAA 1BVRA 2A5LA 3TN7A 2VK1A 4MWGA 3W2EA 2JHAA 3JVVA 3AGPA 4DB4A 1E2LA 2F7SA 2GNAA 2PJZA 1G16A 4JP8A 1E8NA 1K7XB 4IFTA 3WG9A 4L4XA 3SX2A 1H8EA 4P4TA 4P5DA 1F38A 4H7EA 3QE3A 2O0LA 4FDVA 4J3FA 1KY5A 1FK8A 2FR1A 4NJOA 1JLMA 5CPFA 1N2BA 1WVMA 3USZA 3FOEC 3ZBPA 2VCEA 1CRLA 5M34A 2X8JB 1FQJA 3OTHA 1B7GO 3QG5A 1QAQA 1MVNA 2WT8A 5D6OA 2DWUA 4AROA 3BPSA 2VRNA 5C5IA 1GVNB 2OCDA 4MUNA 3DD5A 1CQJA 5EPOA 2LCFA 4NCNA 1HGXA 3AP3A 3ORSA 1K4MA 1XJ0A 2PL5A 4R5HA 5FBRB 1KE1A 2WMDA 2II6A 3IOBA 5ALXA 3H99A 3RBVA 4HV4A 4IRXA 3T12A 3K09C 4GO1A 5IKPA 4AZ3B 2C8JA 4WGFA 4AK9A 4BB6A 2PNFA 2VHYA 3WAJA 2PEZA 2NXNA 2G1JA 2X9VA 3AIKA 1EM8B 4GL4A 1MQ8B 4P4SB 1H23A 4OXQA 4UU7A 4Y1RA 3VI4B 3ZDXB 5FTJA 2VDKB 3FCAA 4LE0A 3IPXA 4RFVA 3RBZA 4BN0A 4DIKA 2A5DA 2GRUA 3DV9A 4JP3A 3AYXB 4A9AA 4BX0A 1P7YA 1NC1A 3C8HA 3OHSX 3OT4A 3WMEA 5HGJA 4PLYA 3GFGA 3Q2KA 3TCNA 4D56A 1CP3A 3DTNA 1GZ5A 3WYDA 5EZQA 4DY4A 4TX1A 2C8KA 3NB0A 3SXPA 2ZK7A 1FYEA 3N05A 3TLAA 3WKBA 4DQUA 4RF4A 1J42A 2AUMA 4L27A 3HGMA 1BE6A 4R81A 3R3VA 3WQSB 2H6EA 1QV7A 1UXKA 3FM9A 5CXXA 1LNSA 4O25A 5CNMA 3VTFA 3OCWA 2CJWA 4ZTBA 4G0WA 1KR5A 1XHEA 5HIAA 3LUKA 1R0XA 2XF2A 3F6SA 3R3XA 2YRXA 3FD8A 1DDIA 2HTEA 3NBMA 1FSPA 3PDUA 1PGNA 4R2MA 4DMHA 4OQYA 4YP6A 2EXXA 3STVA 1NOJA 1Y7PA 3H18A 1UWVA 1Z28A 3HPRA 3N76A 4FK8A 1KR2A 1RT9A 3BWEA 1SH7A 1CUUA 3QKSB 1U98A 4NZNA 1SD5A 2X76A 2E1RA 4Q1BA 3WIOA 4R8LA 3VR6H 2ATEA 4YC7A 1P5ZB 5C1BA 2YWXA 4GC5A 4IHKA 3KFVA 4MVJF 2FMIA 1CKEA 2OGUA 1CEYA 3BVPA 2FSFA 2AOWA 4X6UA 3EIOA 3P2YA 1DKOA 2XECA 3QTTA 5CCBA 4HLCA 5ENVA 2XCQA 5AKYA 4BRZA 1NF2A 4QBTA 1KZ7B 2CHFA 2JIQA 4N3CA 3UPDA 4CF7A 1B1AA 1VG0B 3UJ7A 2I6XA 2JRCA 3X43A 4LJKA 3KUDA 4IL5A 1FVXA 1YJ5A 3AJDA 4AJIA 3WRVA 4DDMA 4X1KB 1CRPA 1Z6AA 4EHNA 4JLPA 3HBAA 3UW1A 3UK1A 4OHYA 2D62A 4E15A 1T8SA 1MHTA 2OPBA 5DM60 3RJZA 1WUTA 1HFKA 2JI4A 3VO8A 4DXDA 2O54A 1C4KA 4PXSA 1O6BA 3A4LA 3FWYA 3CNNA 4BE9A 4IDHA 1DDOA 1E1CA 4MWEA 2VDQB 3GBVA 3GMIA 2YY6A 5E38A 2QMYA 2HYIC 1F0YA 1NVEA 2IOYA 1AUXA 3WGZA 4ND8B 1RW4A 4QPCA 4BFXA 5BVGA 3U4QA 2Q1XA 2O0JA 4QNMA 1QS0A 5EIBD 2BEUB 2WU1A 4KBFA 2VH1A 3QLJA 2QT1A 3IXMA 3S2GA 5K4HA 2HPVA 2VHWA 3GR6A 1WSBA 4GMXA 2O6LA 1DKPA 1AKRA 2ZATA 1Z35A 2V7TA 3C6ZA 1PSWA 5FRDA 1CR2A 3S1AB 1YUMA 1WEKA 2XGOA 3GPDG 1VHWA 4XCVA 3PXEA 2IXTA 2PBZA 1U8YA 2HA4A 4Y6OA 2ZIUB 1BJRE 1LH0A 1LX7A 3WAGA 1YU9A 4P0PB 1DJQA 5KOHB 3OP4A 1NDHA 3I72A 4KXUA 4EB6B 3OZWA 5LZ7A 1JKMA 4ZZ0A 1KK0A 3RFXA 5ALNA 3ZHYA 3O8OB 1M8GA 1P5HA 1XZAA 3DTVA 5F9MA 3W4JA 2YJTD 3B2QA 4RNCA 4F71A 2XDQB 2Z58A 3RYCA 1RRKA 4PLWA 4BMCA 3DVAA 1MJGA 4RDHA 4WN3A 5JAQA 4EO4A 1F0NA 2XVAA 4MCJA 3WGHA 3OOHA 2UZ4A 3CNQS 1QKIA 2ZYDA 3GLSA 3VZSA 1RVV1 3SLRA 3GUHA 5F76A 3FGPA 4DMFA 4J1SA 1Y5MA 3HCEA 1JHUA 3RSQA 4G0ZA 3DBHA 3NC0C 1UJBA 4GXTA 4U7PB 3UQZA 2BJVA 4RACA 3DR3A 3AF0A 1NVDA 1JHOA 3NM5A 1FIUA 2QK4A 1UC4B 5HM8A 4XUDA 2RBEA 5I8WA 2O4CA 3ZUPA 2P65A 4HNRA 4AUNA 4MVJI 4CKYA 3OURA 4HXGA 2I1WA 4OQQA 3D7LA 2C00A 5ALUA 1A9XA 1QDUA 5EN4A 3B51X 4RSGA 1ZVKA 3CLVA 1V6CA 3J7TA 4LTMA 3WHIA 1PU2A 2ZSJA 3HQ4O 3NZEA 5GV7A 3TAHA 3RLFA 2XUIA 2WUWE 5EZSA 5AI8A 3GBPA 2PZMA 2XZTA 1X7ZA 4PBTA 1YCFA 3AESB 4OKNA 5ALEA 4RVSA 5JSFA 1YU6A 2QMEA 3H42B 5J2UB 2VP9A 1N9GB 3AR4A 3N6VA 1LI4A 4R51A 5ALWA 4XQEA 3SQXA 2OV4A 1R10A 2WJ3A 3C6KA 4LWQA 4RPHA 5HGXA 4ZT3A 3F49S 1LFAA 2VDWA 3LL7A 3PVZA 2OCBA 5AKKA 4FFNA 1L7AA 5HHTA 1ZOIA 1L5NA 4B1FA