1R18A

Drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
publication title Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 70
structure length 223
sequence length 223
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2003-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r18A00
1BC5A 3FTFA 1JR4A 2Q41A 1ORHA 3FPEA 3PFGA 4V0QA 5CD1A 1XDUA 3DXZA 1EAMA 3L8DA 5ICEA 4FGZA 5HILA 5E9QA 4RTJA 3FTCA 4YUVA 3RODA 1I1NA 5FADA 3TLJA 3FUWA 3TM5A 5BW5A 2B78A 4GOMD 4OX9Y 2VDWA 3PX3A 5E2BA 5EZQA 1D2CA 1JQ3A 3EMDA 3GGDA 4P7GA 1D2GA 1R74A 3P9IA 5K05A 5FA8A 2GAFA 4PIPA 3M6VA 2GLUA 3KQYA 3BWYA 3P71T 1XDSA 4R05A 4RSRA 5EOVA 3JWHA 2Y1WA 2FCAA 1BHJA 3P2EA 5FWAA 4O29A 4E33A 3TR6A 1F3LA 5GM1A 2I6GA 3UFBA 5FUBA 5K0LA 2ZIEA 3KPVA 1X19A 3G8BA 3DMHA 1XCLA 1X1AA 3KPUA 1UFKA 2AOUA 2PT6A 3O4FA 4FP9A 4KVZA 3SGLA 3UWPA 4GQBA 2ZZNA 3OCJA 4OBXA 1VLMA 4RTSA 4OBWA 2H11A 2I62A 5GOZA 4C03A 3MCTA 3NTVA 3BKXA 4E2XA 1SQFA 1AQIA 3ANXA 5C9ZA 5E1BA 4EK9A 4XCXA 4YV2A 5F2NA 5K03A 3MGGA 5C0OE 4KWCA 4GEKA 3REOA 2C7OA 5EGSA 2ZSUA 3ORHA 1FBNA 2CWWA 2PXXA 1JSZA 2ZW9A 2AS0A 2NXNA 4X63A 3KQQA 5E2AA 1HNNA 5FTWA 3UJ8A 3EPPA 5DTMA 2AN5A 2BM9A 3PFHA 1VL5A 4ER6A 4YUWA 5LQJA 1WS6A 1NKVA 4ZTBA 3SSNA 2XYQA 5CUQA 2C7QA 2IDKA 4KDCA 1ZG3A 5DTQA 2P3QA 1AF7A 3KPJA 1R6AA 3C3YA 2QM3A 4POOA 3T7SA 4IKPA 1QAQA 3UJ6A 1FP1D 4RTNA 3K6RA 3KR9A 4HC4A 4PCLA 4ER7A 5JR3A 1VP9A 2VP3A 1D2HA 1HMYA 4BP3A 1AQJA 3R9XB 4CWAA 1NBIA 3UJCA 3EVFA 4C08A 3HTXA 3MCZA 1XCJA 4QTTB 1M0EA 3P97A 3FTEA 3NJRA 5EMJA 3NDIA 4FSXA 3OE5A 2ONZA 2JH9A 5CVEA 4ATNA 2Z6UA 2HNKA 5BP7A 2HR1A 1JSXA 3G7UA 5HFJA 3FPFA 4CTJA 3EVGA 4XUDA 2H00A 4YUYA 2ZCJA 3QV2A 1H1DA 3PT9A 3O7WA 5FHRA 2G71A 2P41A 2E5WA 3HCAA 4KW7A 3RW9A 3LDGA 1YFLA 3KU1A 2IFTA 1DL5A 5DM4A 1JQDA 2QRVB 2YXLA 2XYRA 5DPMA 2Z6AA 5DX1A 3MB5A 5HEKA 4PONA 3LCUA 5HOQA 2OPBA 3QOWA 4AUKA 4BLVA 2BR4A 5DXAA 5T67A 1P1BA 3CKKA 1O9HA 4FR0A 3GU3A 4RVFA 3SMQA 4MHTA 4OQDA 2XBMA 5EKUA 2YUIA 3FUVA 2NXEA 1P91A 4RX1A 3KR2A 4LWOA 5KS2A 3DH0A 1Z3CA 5K0FA 1YB2A 4CKBA 1RI3A 1SUSA 3I53A 2PBFA 5HIIA 3G2OA 5K0JA 2BR3A 3FTDA 5M5BA 3A4TA 3T0IA 4DZRA 3CJTA 4F84A 2G8NA 4WXHA 3EMBA 3GJYA 3THSA 1KYWA 2PVCA 3DMGA 2QYOA 1ZGJA 4E70A 2P7HA 3PTAA 4IV0A 5E9WA 1RJDA 2O05A 4X61A 4DCGA 8MHTA 2FK8A 3IYLW 3LPMA 1KPGA 3HNRA 5ICGA 3T7RA 1NW5A 4C4AA 1L3BA 4BP1A 3NWEA 2CL5A 3GIWA 2DPMA 5LQUA 3FRHA 3KPYA 3G2QA 4B17A 3EEOA 4KDRA 4GUAA 1O9GA 3IHTA 1NV8A 3TM4A 3AXSA 1ORIA 2VS1A 5DM0A 2WA2A 4C07A 1NBHA 1TW3A 2ZZMA 1JTFA 3HEMA 5DRYA 2FK7A 2CKDA 2XVAA 4DM3A 2QE6A 1G8AA 3DOUA 3R24A 4RTPA 2OB2A 4PYKA 3F4KA 1R8YA 2BH2A 3SR4A 3I58A 3LDUA 3RIEA 2PWYA 4A6DA 2IBSA 1PJZA 1YUBA 2AN3A 4K6MA 1G6Q1 3JWJA 4Z2YA 1QAOA 4DF3A 4C04A 5EMMA 3DXXA 2PGXA 1Q0SA 3IV6A 3H2BA 2EG5A 1JG4A 3OU7A 5EKXA 3B89A 2Y1XA 3LKDA 3HVKA 4YV1A 3EGEA 3EEYA 5T64A 3E7PA 2VDVE 5DWQA 5EIWA 4CKCA 1KP9A 3C3PA 4RVHA 5DM2A 2YVLA 3VSEA 1Y8CA 5DX0A 5HIJA 5B1SA 2QRVA 3LCCA 4P7KA 3EVBA 1KXZA 1T43A 2HMYB 1N2XA 3BWMA 5GINE 3HCFA 3BGDA 2V74B 2PV0A 3A25A 3AXTA 4QQNA 3DLIA 2UYQA 2IDJA 2V7EA 3SX0A 5ICFA 3QOXA 3ELUA 5EMLA 3MHTA 2VDUE 3KHKA 4P58A 1KYZA 3UZUA 3C6KA 1WXWA 4RTMA 2IBTA 2B25A 3D2LA 4E2WA 3A7DA 2EJUA 1NW6A 4BY9E 3UA4A 5LQNA 1M6YA 2FRXA 3M6XA 3T7TA 4YUXA 2PXCA 3GRZA 2H1RA 3NVMB 2CMHA 4QDKA 1EJ6A 2WA1A 2XVMA 2YXEA 2AOWA 4HGZA 4QPPA 5GP1A 3BT7A 5DSTA 4HSGA 3THRA 3HCBA 5EG5A 4CKEA 4ER5A 3LBYA 3P9NA 3DULA 3HVJA 5K09A 1ZGAA 3A27A 3BXOA 3LX6A 4E32A 4BLUA 4UOEA 1KPIA 3KQPA 3UJDA 4AZVA 4E2YA 5P8WA 5CCXA 3ID6C 5K0EA 1UWVA 2ONYA 3BGVA 5K0NA 1XJ5A 5LR6A 3AWIA 3VC1A 2LD4A 3KQVA 1L3CA 3CVOA 3LGAA 3M4XA 2EFJA 4FSDA 4QPNA 3PX2A 5U4XA 3S68A 1EJ0A 3LHDA 5CVJA 1MHTA 2P8JA 4PIMA 2ZIFA 1IM8A 4Y30A 3C0KA 1R18A 2ZFUA 3FPJA 2OKCA 1EIZA 1SG9A 2YQZA 1L1EA 7MHTA 5EC8A 3SM3A 4F85A 4P7FA 2K4MA 2WK1A 4DQ0A 3GCZA 4MIKA 1NV9A 3TKYA 4MWZA 4PINA 1SKMA 2BM8A 4PYMA 1EG2A 2UYCA 4ER3A 3FRIA 9MHTA 2PT9A 2IGTA 1WZNA 3BWCA 3DP7A 3MERA 3MTEA 5E8JA 3SSMA 1U2ZA 5EEGA 4E2ZA 4KIFA 1X1CA 2OO3A 2P3LA 4R6XA 5EIFA 3V97A 2PX2A 3HVHA 4E30A 3DTNA 2P7IA 3FZGA 2ZBPA 3P2KA 4LWPA 4EKIA 1R8XA 4CTKA 3I5UA 4P7JA 3E8SA 4RTKA 5CCBA 4GBED 2IIPA 3P8ZA 1YF3A 3CC8A 2PKWA 3A26A 3OZSA 5E1OA 2NP6A 5ICCA 4PWYA 2P35A 1KR5A 3BWBA 3Q87B 2VZ9A 1NW8A 3DLCA 1XXLA 5CIYA 5IH3A 1IXKA 4PGHA 3KR1A 5EHIA 1JTEA 2AVDA 4MQ4A 3EVDA 5K0GA 1RI5A 1YFJA 4PYJA 2O07A 2OBFA 3OU6A 3AJDA 4L7VA 3TQSA 5D1NA 1WG8A 5EZSA 3CGGA 3GWZA 4RTOA 2UYOA 1N7JA 2O06A 2OB1A 2PX8A 3B3GA 3BGIA 4HH4A 3M6WA 4PYIA 4R8RA 2AOXA 2AOVA 5DT2A 5E1DA 2G70A 5FQOA 2NP7A 3O31A 4AX8A 2AZTA 3NWBA 2IPXA 4GC9A 4PCAA 5KVAA 1FJXA 3KQOA 1NW7A 4RWZA 3G8AA 3FYCA 4AZSA 4M36A 5K0CA 1VIDA 2O57A 3C6MA 2F8LA 3DXYA 4KRGA 1PRYA 3UJBA 2C7RA 3SVZA 1TW2A 5FA5A 4U7TB 1JG3A 3GNLA 5CM2Z 3G2MA 1BKYA 2ADMA 2P1DA 1QAMA 5EEHA 1M6EX 1YZ3A 1L3IA 3FUUA 3HCCA 1QANA 4FZVA 4X1OA 3G89A 5EHGA 3ER8A 2KW5A 5KQSA 4HGYA 3BZBA 2ZZKA 5LQCA 1P1CA 3LBFA 2AR0A 3LKZA 3KR0A 4RTQA 4QTUB 4X41A 5FWDA 3VC2A 4YV0A 3UJAA 5LQRA 4DKJA 2ERCA 1YZHA 3GXOA 3M33A 2ZTHA 2YXDA 3UBTA 1B42A 2G1PA 5GIOE 1X1BA 3PS9A 3A7EA 1I4WA 1KHHA 2ZLBA 3HCEA 3WSTA 3V8VA 4RVGA 2HWKA 3R0QA 4YMGA 3E23A 4Y2HA 4DMGA 1XDZA 3EGIA 3KQWA 5CVDA 5DX8A 4M7RA 5D1HA 5GWXA 2AVNA 2PY6A 1MJFA 3EVCA 3IEIA 3Q7EA 2GA9A 4A6EA 4F86A 1FPQA 2JHAA 4OA5A 3GRUA 1G55A 1KPHA 3MQ2A 3M6UA 1QZZA 3EVAA 4JXJA 1OR8A 4M38A 3TFWA 4C05A 3HVIA 3PB3A 1VE3A 3BUSA 3K0BA 3LL7A 1JQEA 3GRYA 4PYNA 5E1MA 3R3HA 5HIKA 2JG3A 2JHCA 4G56A 2NXJA 3NMUF 4LG1A 1EQAA 3TOSA 2O0LA 5JUWA 2B3TA 1O54A 2AOTB 1IY9A 2Z6QA 1ZKDA 5MHTA 3OPNA 4H0NA 1SQGA 3ELDA 5DRTA 5FQNA 3KPWA 2JJQA 2IP2A 2PJDA 5KYGA 3GRRA 2ZBQA 3VYWA 2OZVA 2B2CA 3NVKI 1RI4A 5EVJA 1SVUA 4HTFA 4AZTA 4GOLD 3R6TA 4FT2A 2YTZA 5DTRA 3G5LA 3B5IA 2ZVJA 1L9KA 2OYRA 4DCMA 4NECA 3PLAE 3EGVA 3FPGA 2ZWVA 5F2KA 1VP3A 5IKMA 1FP2A 4PYQA 2I9KA 4RVDA 3P2IA 2GPYA 1I9GA 4M37A 3G88A 4BLWA 2PX4A 2JHPA 2JH8A 4RV9A 4U7PB 3M70A 4QDJA 3HA5A 3MTIA 4WVLA 4PGGA 3EVZA 2ZWAA 3G2PA 4X60A 5HZMA 5LQKA 4FS8A 2FYTA 1G60A 2DULA 3P9CA 4PYLA 4R8SA 5E9JA 4DA4A 2ZULA 3ELYA 3B7PA 2UZ4A 2BR5A 1XTPA 4KIGA 1G38A 3OU2A 3ERCA 3HA7A 3KKZA 1N7IA 2P3OA 2ESRA 3DR5A 1JG1A 4V0RA 2QY6A 3X0DA 3JWGA 4IWNA 3JWIA 4QQKA 3ELWA 2HTEA 4GF5A 4QVGA 1AV6A 3BKWA 4XUCA 4ER0A 5FULA 2GS9A 2B9EA 4MTLA 2ZBRA 5T6BA 2FHPA 1Q0TA 1RJEA 2C7PA 3LDFA 4GC5A 1DCTA 1INLA 3UJ7A 2GB4A 4RYLA 2CMGA 3CCFA 4R6WA 1X1DA 5KQRA 1SUIA 3LSTA 5EMKA 3B3FA 3E05A 3UA3A 4EKGA 4RTRA 3FPHA 3KQTA 4EQZA 3SSOA 5FCDA 3CJQA 2BZGA 3FUTA 2PSSA 5K0BA 5LQAA 3OFKA 2IH5A 3TPZA 3PVCA 1RI1A 5BXYA 2ZIGA 1WY7A 4IV8A 4OA8A 4QVKA 3TRKA 1QYRA 2N47A 1RJFA 5K01A 3HP7A 3AY0A 4XUEA 3NW9A 3GRVA 1VQ1A 1UIRA 5HIMA 4FT4A 5FHQA 1JG2A 1RI2A 2AOTA 5C1IA 3OZRA 3U81A 4RTLA 1WXXA 4HG2A 2P40A 3I64A 3KQSA 2PX5A 2R3SA 3OE4A 2PXAA 2PWPA 2XYVA 3G5TA 3LCVB 3OZTA 2R6ZA 1ZHFA 3UJ9A 4ISCA 5LSAA 4E31A 1DUSA 3HM2A 3LECA 3HA3A 5BW4A 5CVVA 2AOUB 3SXJA 3CBGA 3FYDA 5DM1A 5EPEA 3GDHA 3CJRA 1G8SA 3TKAA 4C06A 1F38A 4HTFB 2EX4A 3MAGA 1NW3A 3HCDA 2FPOA 4EMSA 5GM2A 10MHA 2I7CA 2PLWA 3ME5A 1TPYA 5F2OA 3DUWA 1BOOA 4PYOA 2OXTA 5DLYA 1ZQ9A 2UYHA 3ER9A 1V39A 1RJGA 2YR0A 3GO4A 4GOOD 2YX1A 4GOND 4OQEA 5CVUA 2A14A 5GIPE 1XVAA 4LECA 5G02A 1NT2A 3NDJA 4HRAA 4YUZA 3TMAA 1VPTA 4CXMA 5K8VA 1R00A 4AZWA 3P9KA 5EQJB 1KIAA 5E8RA 3DMFA 2IH4A 2G72A 3OFJA 2HV9A 3FUXA 5DXJA 5DSXA 1NE2A 3B3JA 2AN4A 5H02A 5ERGB 1VBFA 3KQMA 3EVEA 2EJTA 3I9FA 4EVIA 2NYUA 2GH1A 2NNWB 4PNEA 2IH2A 4YMHA 2NXCA 2OY0A 1P39A 2ORED
chains in the Genus database with same CATH superfamily
3ILHA 2O3UA 1DBSA 3LUJA 4OUKX 3H6HA 1RRFA 2HCRA 1C30A 4REQB 3UWDA 4IZOA 2OYSA 1CUUA 2GEKA 1ZINA 3BK1A 3LW8A 3QX7A 3DEZA 5DNAA 5IHPA 2W2OA 3FPLA 1CRLA 2G67A 4JLNA 1Z3IX 3FUWA 4J0HA 4TKZA 1WWKA 1KQFA 1B8OA 1DRVA 2P3SA 2EZUA 1E2EA 1OCEA 1N5RA 4BTVA 4IG4A 4Q18A 5IM5A 1VJ0A 1RYNA 4UCFA 4KX3A 5FI1B 1JV2B 3IP3A 4GX1A 5JXJA 1U2GA 1WCIB 2JKYA 2Y05A 1UZAA 2PUBA 4KPEC 4UDNA 4S04A 1YJXA 2HA6A 5DULA 3RVPA 3ZCXA 4OM8A 4U63A 1NIPA 5HZGA 4L57A 2P4EA 2OZKA 1H4SA 4BX9A 1PL7A 1GKKA 1M8KA 5IK2D 4CL0A 1S89A 1BRMA 2Q3JA 2PYIA 2XRFA 2O7NA 3IKLA 5BV8A 4WMLA 3B9QA 3T12A 5JS6A 3UMYA 1HOXA 1YRBA 2FMXA 3BFXA 5JR3A 1PAUA 1K27A 1EQ2A 1M9NA 1ZONA 3HO1A 5E1BA 2RGEA 4EK9A 3BHIA 4KH1A 2REBA 3BSWA 1UM8A 5C0OE 3WKDA 2JJ1D 3PF8A 1G20A 2C77A 3ORHA 3B8HA 4MUNA 4NZPA 2Y6UA 2QPAA 2MMGA 4KO2S 3OPYB 3MOSA 3W1VA 2A0FA 1UPBA 4Y1RA 4F46A 1UL1X 1WPGA 2D62A 5JY6A 5DTJA 1GSAA 2J30A 4UM9B 1JHVA 1QQTA 3C3XA 1E2NA 1OYYA 1QFJA 3ET5A 3QEOA 1J9GA 3OIGA 3QWAA 3L92A 1LFDB 1Q16A 1R6UA 1AK2A 1ZRNA 2M2IA 1P7VA 3DBLB 4JODA 4P31A 5JQGB 3L93A 4FWTA 2HU5A 3HGQA 5TS2A 2CUZA 2QGNA 5D7BA 5BVGB 3FPAA 1NP3A 1AO0A 4LVCA 1YQUA 1D4ZA 1GXSA 2QM3A 2AHRA 4KYVA 1MA0A 2Z9DA 3WG9A 3WKEA 3EIQA 2V0NA 4IV5A 4RF2A 4CI9A 1E6KA 1Y8QA 1DG1G 5HDQA 2ZB3A 3M0EA 2W58A 2IYSA 4IF4A 5TVGA 4RXMA 4EEXA 1T29A 4EPTA 3IP1A 1PJQA 1TYZA 4U2DA 4M1YA 4Q4HA 1CR4A 4F2HA 4AY2A 1N92A 3LQ2A 1GTJ1 1YC5A 1OYOA 2YBEA 2YHSA 1OFHA 1TQ8A 3EAFA 1XCOA 3GUYA 2Z6UA 4K1XA 4A5OA 4A73A 4O3MA 1H6DA 5CBPA 3PC8C 2BBTA 4TV9B 1TQ6A 2G1KA 3HI6A 3CSDA 2QG6A 3MMSA 1P0FA 3CGWA 3HGTA 4RPLA 1N6NA 5KAMA 2Y77A 3INNA 3UKOA 5AFSA 5BY2A 3TFOA 5IAOA 2Z6AA 2QAGA 1TAHA 1EVZA 3DHYA 3F90A 1ZXBA 4RORA 4G0OA 4MNTA 3PICA 4TLMB 4XD7A 2QTLA 1Q84A 1DBPA 3LXRA 4YAFA 3OVMA 4DC9A 5A1TA 4GHWA 2C95A 1P91A 2ACKA 5F78A 3HUTA 2NAFA 1BJTA 2QAIA 4WJLA 4TVKA 3UW3A 1JILA 4OXNA 3STYA 2NU8A 2BR3A 3DCYA 3SHTA 4BKQA 1BW9B 1D2EA 1EE9A 2D5CA 1E0AA 1U0FA 2HPZA 4AJOA 1SVIA 4WXHA 3JSXA 3EMBA 3NOOA 4F45A 3NANA 3SSAA 2H2GA 4J16A 3ZZTA 4CZ2A 3Q2KA 4HQKA 1UMDA 3LK6A 4MKFA 4E70A 4BVKA 2XUFA 5FWYB 4O8ZA 3ZQJA 1FNCA 5AUOB 1VBKA 1E79D 1V1MA 3PR2B 2IHKA 4A0QA 4N8SA 3T1YB 4DRXA 2WWVD 4QC2A 4QEKA 3TUZC 3OCVA 4XCVA 1I2BA 3H65A 3JYPA 3IT1A 3Q5EA 3E5MA 4WCFC 1OH5A 4LDQA 2UUPA 2J87A 1QIHA 3TL6A 1FW6A 2XLCA 2P68A 1VE5A 2GYYA 3EGDB 3EBPA 3AL3A 4ND8B 5B58T 4KXNA 4DCPA 1NX9A 4YMTA 5J4VA 2R00C 5HF5A 2Y67A 3GMIA 4CHTA 4A6DA 5ARBA 4RADA 2Y76A 3OLXA 2YIMA 5HTOA 1M6VB 3Q9NA 3RS9A 1QV7A 3FLBA 3PRYA 4KLAA 4XVRA 4LSMA 5AM3A 1B8UA 4WXPA 5K8UA 1KKUA 4RANA 1JPUA 4Q5IA 1CEYA 2Y8EA 3JALA 1ZMBA 5IK2A 3E9QA 3IMCA 1NBME 2HGSA 4FDAA 5BNFA 1OXMA 5DMXA 1ILEA 5AH0A 3HMKA 1X7XA 2J3QA 4HQ6A 1DDGA 4RDHA 3T3OA 2H08A 4HR7A 3QJYA 1J99A 5HIJA 4AJPA 4AVYA 1JZSA 2V98A 3FMFA 4HF7A 4PC6A 3S2IA 5KJ1A 4OATA 4ZEWA 4IILA 1LW7A 2Z2YA 2NTVA 3RVSA 4DADA 3KT6A 3MWGA 1ZVVA 2XMBA 4LJ6A 1TF2A 5ICFA 3SC4A 4YRFA 4BMCA 3T1VA 4TT8A 1RXCA 1XSEA 3CX3A 3FCSB 3MJVA 1WXWA 4B2IA 1W5AA 4FYIA 3F0TA 4KU4A 1XHFA 3IQWA 5L4LA 4BY9E 3V3TA 2EWWA 2R6AA 1XKTA 3AY6A 3FAZA 4P81A 2H1RA 2B92A 5T41A 2CYCA 5AW7A 1NDQA 2MJLA 3LLSA 3IJPA 4CLOA 2BHSA 5KEIA 2BKXA 3D3WB 3UC5A 3ASVA 3OJEA 3HB0A 1N9GB 3BE5A 3IIEA 3JASB 4JJKA 3HVJA 3QPDA 3SD7A 4CKEA 3ZLJA 1ZGAA 1XLWA 3DEFA 4UOEA 3KBOA 5DW3A 2C8JA 2H16A 1H2HA 3IPLA 1OV4A 3STHA 4NAHA 2XZLA 4QFMA 3AG5A 2DGDA 2O5VA 3ABZA 3E2PA 4URFA 3SBXA 3WJ2A 4F1KA 3QBEA 4XTRA 4F5YA 2C3YA 2KE5A 3LHDA 1G2IA 4LRXA 4MV1A 3K16A 4PPYA 2B98A 5D51S 2Q7XA 1IK6A 3HKDA 2RI6A 2O1WA 3HKBA 3DE3X 1MIOB 4DV1B 2XD4A 2D1YA 1GU0A 4NHEA 5KOJA 2VA8A 4HK4A 1VJ1A 2QL7A 4D02A 4W5QA 4J6FA 1YZYA 1M0WA 1SG9A 4DLPA 2FF7A 4NYJR 5I3ZA 1I0LA 1CQXA 1P7ZA 4EI8A 1I2ZA 4YQEA 2OMKA 1THTA 1RBQA 2G1JA 3VDMA 4JI2B 2M1ZA 1T8WA 2ZPUA 2WWYA 1R15A 4N48A 4X20A 4M0LA 3ODGA 1JAIA 1Q0ZA 4HXGA 2W2MA 3BWXA 5KNLA 4QYXA 4PYMA 1EG2A 3G79A 1ML3A 3ML1A 1XVLA 4PRKA 3T0GA 3QLTA 4TQUS 1P1RA 1WZNA 2RB5A 4GPBA 4N18A 4Z0NA 4E2ZA 4L5YA 1BMQA 3RVBA 4CMAA 4UUMA 2P3LA 1P18A 2WAXA 1Z12A 3BDVA 4N3NA 2HGZA 1C8KA 1CIVA 3ZU3A 1GSHA 1ZJ4A 3L1HA 1J1ZA 4CTKA 3MS7A 4N76A 3WYAA 3MJHA 5EZYB 3R7SA 3I42A 1A5BB 1PFGA 3KZXA 4GE3A 2IYWA 2QE7A 2GVDC 2XSZD 3VNUA 4UBKA 4EYEA 4PWYA 2HPAA 3GN1A 4L78A 1ZL0A 1EFTA 4M6WA 4YLGA 5I7RA 3DLCA 3ZWPA 4I50B 5KYXA 4Z7NB 7ADHA 3VR5H 1LS6A 1GTRA 4DAEA 1FF9A 2ZUFA 1ES9A 1BXGA 1C41A 1NJ6A 1XTJA 1F9EA 1M2JA 4RK7A 5AMXA 1TZJA 4BO3A 1K2WA 2PZGA 4DMHA 5ALQA 1QTIA 1U99A 1N0HA 1YA4A 2PL1A 3EGWA 4XYLA 1W73A 4K46A 3M1LA 2PPVA 1QTNA 4PYIA 4GUDA 3V42A 1Z4QA 2C8KA 3KUKA 4LY9A 4ZTZB 1GT6A 1R9GA 3FVQA 3QEMB 4R1PA 5AKZA 1P0QA 3NWBA 4JVNA 2O5EA 1NKTA 1QBKC 3AG6A 3R9IA 4CBVA 1SQSA 3B5JA 4FINA 2XECA 3E2IA 4QUGA 4BNIA 4MS1A 1VIDA 1VHLA 4RSGA 2E6UX 5L95A 3DQPA 1GADO 4KRGA 4M1TA 5F3RA 4OAOA 4RPKA 3EZNA 4KK3A 3WKBA 3GNLA 1GAEO 4L0MA 5DKFA 4X6YA 1QAMA 2WHXA 2Q27A 4NIMA 3HCCA 5EKTA 3RTDA 2R4TA 1QANA 4HX9A 3RYTC 4JDPA 3SYMA 5KQSA 1M2WA 1MGPA 2QN3A 1Z17A 4MUBA 5DHAA 1VGRA 3V2GA 3VPGA 4YXWD 1P2FA 2CHFA 2O0MA 1SUBA 3F6BX 3T95A 1MABB 5AYVA 1TOAA 1WHSB 4WZBE 2ZRLA 3ISVA 3UJAA 1OUMA 2JLBA 4D8XA 4KE8A 3EFEA 3EF0A 2HHJA 1JFVA 2BFFA 2W4MA 3F2IA 3K1JA 4K9NA 3CUSA 4U2CA 4XIGS 3WZ2A 3MRTA 4EW6A 2Q1XA 2QZZA 3FTPA 1JKMA 2F3UA 5DE3A 1BN6A 1J8QA 1EVEA 3A7EA 1WXFA 2PIAA 2N3ZA 4N6NA 4RHTA 4QBHA 1DBIA 2A57A 4PSDA 1Y63A 3K9LA 3QVVA 4RKWA 5K1ZA 2NU9B 2QD3A 3VBCA 4ZZ1A 1OYWA 1RDFA 1YI0A 2JIZD 4MI1A 3BCHA 3NTXA 1OILA 5AVVA 1CQIA 5EIXA 6CHYA 4FHCA 2D3WA 2P90A 2C2MA 5TVKA 2CN1A 3KVOA 4O4HF 1U1EA 1PX2A 3OOHA 2HLDD 3IJ5A 4EM6A 4INAA 1F2TB 1L7QA 2GTPA 2XCOA 4LAFA 5MFPA 3JRWA 2R11A 1USWA 4RAQA 1FRVA 3MTJA 2B3TA 2IUEA 1I3NA 3M49A 1PEAA 3NM5A 1ZKDA 4BJHB 3D0QA 1JEYB 4H0NA 1SQGA 4DHEA 1BVHA 4DA8A 1L5QA 3A1UA 3MPUA 4KCGA 4DPLA 2O5CA 4FI3F 3I62A 1E3WB 1RW4A 2PO5A 4FGLA 5EJ4A 3GRRA 1ZD5A 5CA1F 4M3NA 1JBKA 4P5EA 4A2CA 4CT0A 1E1QD 5B37A 4V0ME 2H9AA 4MV0A 5FUMA 1C29B 1SU7A 4UUPA 4NECA 1C3OB 1OU0A 2GCEA 3A2LA 4WKGA 4D3XA 4HV4A 2Z57A 3CZMA 3LC2O 3PCXA 5YASA 1TRHA 2D0DA 2HQBA 1MX9A 3F5SA 4HBZA 2V58A 2VYND 3QXGA 1YA6A 5HHTA 4G0WA 4KUGA 4RV9A 3WLOA 5ANRB 2YV1A 2VF5X 4A2PA 5NLLA 4X66B 4KRFA 2NO1A 1PZFA 2XKBA 2YHUA 2YWGA 3S2EA 3YASA 1H93A 3ELBA 3OLWA 4C5CA 1S3FA 1MO4A 3B5EA 1OZGA 4LHSA 4S1NA 5TR9A 3KKEA 4AZ0B 4LJ7A 5JV5A 2XCSB 1X14A 3KKZA 3X43A 3IP9A 4PX3A 1L7RA 2J9YB 1T0PA 1FY2A 5CA1A 2HW8A 1XYVA 2X2PA 4QQKA 1DC7A 2FI1A 2ERXA 2HTEA 4YCAA 3U2QA 3I3SR 1X9HA 3C74A 2CXHA 3N05A 4US2R 3BIXA 1ZUWA 3DWFA 4KSYA 5GOTA 3RRNA 2XSZA 4C6TA 1KRWA 2ZYRA 3SXPA 2FZLA 1PBTA 4CLRB 4RFLA 1DCTA 3UJ7A 1NRIA 5I8ZA 2WSSA 1NRXA 1NOJA 1H05A 3FDIA 2FGJA 3LSTA 2IZZA 2E0IA 3E05A 3SC3A 2PKCA 5K51A 3DBVO 1J25A 1WPXA 2FDXA 3QUSA 6GPBA 2PWZA 4X91A 3I4FA 1ODCA 3OFKA 3AEYA 3N7AA 2R8XA 4M7PA 3TPZA 4WNCA 5FLKA 3S1AB 4FNGA 3M34A 3G2LA 2ZIGA 4JBHA 5K01A 1XX6A 2DPLA 3V1NA 2C5AA 5LWQA 2CZQA 5KVVA 3UKJA 4IQGA 1WB5A 1WB9A 3M82A 3UB2A 3WLKX 3IXQA 4CKYA 4DLUA 3VKWA 2CY0A 3MWKA 5FIUA 5DISB 5I7EA 2GTHA 2HBQA 5D7NA 5EA2A 2H18A 3T7KA 3K6JA 3NIFB 4UVDA 5G0VA 4M8LA 1LLUA 4B35A 3FBWA 5K0CA 5LD2B 3GDHA 4KSBA 3ZDRA 3ADKA 1KKMA 2AT1A 3H8WA 2P1ZA 1ZHHA 4HGQA 4FBMA 2ZTVA 4IFBA 1R0KA 3AF1A 4ZAXA 2R1VB 2BFDB 4D41A 1NONA 2PLWA 2PMWB 1TYCA 5AK3A 1RM3A 3EWAA 3IE2A 2R87A 3OWOA 3OZ7A 5K2MA 3VR4D 4EF5A 5AOBA 1MVOA 2CLCX 4E6PA 3ICEA 1XU4A 2XOKD 3N8IA 4YXWA 5L3VA 2YX1A 3D3NA 5LIPA 1RTTA 3DWIA 2BP7A 3DSRA 1KK2A 3OCCA 1N1GA 4HWGA 4RLSA 3OCZA 3X1XA 4L75A 4I5IA 4IP0A 4ZVSA 5J1SB 2ID7A 16PKA 1XHEA 1JTVA 3DMFA 4HDNA 1GGFA 1YAHA 2H2HA 2QG4A 3BXXA 3E18A 3OFJA 4B4KA 4JUAA 4X7PA 2D1RA 3MJTA 5KQPA 2GBCA 4FC7A 4NG4A 2EHDA 1P4GA 3UB4A 2YHIA 5C37A 1NDUA 5FOUA 3TG2A 4YALA 4AG3A 1IXZA 5HM8A 5AKIA 2VJDA 3PC8A 1YT5A 4NHOA 1OLOA 1RM4A 1GQSA 1X86B 2JIZA 2GH1A 2XBLA 1S7CA 1DG3A 3PJEA 1MT3A 1PNVA 5MN5A 1P39A 3EYWA 5A6SB 5GADl 1V5EA 2ZK7A 2O3RA 5LKAA 2ZJBA 3PFGA 4REMA 1YZNA 2HLDA 3WR5A 2DUJA 3B70A 3M4ZA 2O2IA 1BAPA 5T5QA 1W5EA 3BXEA 4M60A 1LU9A 4XB6B 4NYJQ 3RFCA 4FGJA 2PV7A 1GPMA 4JX9A 4RLQA 2R6JA 3LBNA 1D2CA 1FS5A 2FFHA 3EMDA 2E1RA 4UARA 1NQTA 3IOCA 4KEAA 1L8AA 1ESMA 4I1SA 3WK8A 1JA9A 1W35A 2ENUA 3PHBE 3E0QA 3V1TC 2WNHA 1UXOA 5IMBA 2ZYDA 3WP0A 1BCSA 1B0PA 4ZOQI 1QOQB 4TQAA 3AZQA 2H85A 2C3PA 2GDJA 1E1QA 1HGXA 1U3VA 2NZWA 4MW2A 2AK3A 4FJ0A 1QGDA 4FLMA 5K0LA 3AEZA 2NAPA 5REQA 1NYTA 3KPUA 1IJFA 4FP9A 4JJGA 3ZCVA 1SA0A 5MN6A 1P3JA 3OKAA 1TCBA 3ZU6A 1MN6A 5DGHA 3OCJA 5C3MA 2HZBA 2ZAIA 1KS2A 1HFKA 2G9UA 3I6IA 5EP4A 4FFWA 4W99A 4E5NA 3TEJA 4DLSA 1X1TA 4PM4A 3SYKA 2OSBA 2DQYA 2PFSA 2W2QA 3BKXA 3NH9A 4J0GA 2J3MA 5FUVA 4DWWA 2M6LA 3Q85A 1W5TA 3MIZA 1VKOA 1RBMA 2EFYA 3K0CC 3IVGA 4ZD6A 2C7OA 1XNRB 2ZSUA 1SKYE 1ZU5A 2VF8A 2A0YA 3V7YA 1ULAA 1FBNA 4HEQA 1A9XA 3QFTA 1UT8A 2R00A 2ZOSA 4LZNA 4LZJA 3E1KA 4JLWA 1RADA 4GKBA 1U9JA 2JH3A 1OPRA 1OFUA 2YJ4A 2ZKLA 4FKBA 4MLCA 1RRCA 4O2AB 3UJ8A 1XT6A 1G21E 2BEUA 1T34A 5KREA 4XWGA 3P2JA 1Y6FA 3KVRA 1OBCA 2YJGA 3QFRA 3AB8A 4YMLA 1GNVA 1H3NA 1LNZA 1ZI8A 3MB8A 2VT3A 4PRLA 1J6UA 1HV8A 2IDKA 4X44A 4JLJA 1KORA 1G9SA 1N2IA 3WGKA 1RYFA 4A6XA 3H04A 4LOLA 2ONKA 3ADBA 3Q5DA 1UXJA 2ZBFA 2CJPA 1NYLA 4PCLA 2H51A 2VP3A 4L4SA 4KOAA 2P6UA 3DW1X 1AGRA 3PXDA 1WMSA 4FKZA 5C32A 5CT6A 5CCDA 5EVCA 3FTEA 1EJBA 1UKZA 4ZAFA 1IAQA 3LUAA 4P3PA 5A1JA 1OU4A 4RQTA 4DQUA 3H9JA 2GN2A 2Q2NA 3HLKA 1NVAA 1NHGA 2C2XA 4WNIA 4YJDA 3FPFA 4AUNA 5FOWA 4KR7A 1EK0A 5IVDA 7YASA 2W37A 3QE9Y 3NJ8A 1PLLA 1CQJB 1X92A 3D3EA 2G71A 3WMWA 5JMWA 4BMZA 1E3JA 2J3HA 1E5QA 2XZPA 5TDHA 5JNLA 4L3OA 4D4JA 5KOYA 2N75A 3KU1A 4XYBA 4C22A 1NFQA 2FQXA 3V7WA 1JQDA 4WOBA 2YXLA 1WEKA 3EIOA 3H9UA 1I2DA 2FWRA 5HEKA 4RD4A 2ZJ0A 4YRPA 1MKYA 1VYVA 2LV8A 2XOKA 3UM9A 1ZL2A 3HYLA 1Y82A 5F5NA 4J91A 4BB0A 4KZPA 1BE1A 2ZBEA 1QCYA 4O63O 2FN3A 2I8LA 4U3JA 1B6GA 3QZUA 1IU9A 1X8LA 1L1FA 1EBBA 3HSKA 4M1SA 4O1MA 5EUBA 1V16B 5BT8A 5C46F 2J1LA 2I2CA 3Q7RA 5M5BA 1II0A 3A4TA 2HTFA 4A8JA 1TGVA 1QGZA 1LS1A 4G4JA 2H59A 3OP1A 2ZITA 1JDZA 4CIYA 1U0OC 4Y9DA 3T9AA 2WIFA 4Z1MD 3PLNA 4KITB 3I5YA 3FNHA 2I1LA 3ANYB 1S2GA 3DMGA 2ZSBA 3LBIA 4ZOLF 1SHLA 5CIWA 1VGVA 1Q12A 4LYYA 3NHRA 2QTGA 4OJNA 4WDQA 3D6TB 4ND1A 4Y18A 3GNSA 4B7UA 3C4QA 3ZEIA 2VHCA 1V2GA 4UBMA 3F7MA 5D5QA 4YY3B 1GDHA 1K08A 1Y1QA 3DKPA 3HBMA 3HNRA 2X8LA 5KTTA 2BGJA 1UKYA 4S0XA 1CY4A 4CODB 1K7FB 2BHTA 1NAHA 1UKVY 4YBZA 4BLSA 2DH6A 3LYUA 2ZREA 4U2FA 1RVDA 1WSBA 4B7XA 1W30A 3KOXA 1VB5A 3SKXA 2ZE6A 4OFWA 4PYKA 1PSZA 2H9YA 1T0HB 2FQWA 3NYIA 3O9MA 2P2YA 2VP2A 1RJ9B 4ZOLA 4JT2A 1YUBA 1HYBA 4MDFA 3OOEA 3TPCA 5BWCA 4Y6QA 1YS2X 5EN4A 5C5EA 1TT7A 1Y6ZA 5EMMA 5IJ9A 2H2FA 2JIDA 4Q6WA 4GSKA 2PLRA 3ZXSA 2G77B 1LPNA 2ZSEA 3DTVD 1VDMA 5CFQA 3AVPA 5B30A 1CJSA 5LLTA 3WGOA 2X3UA 2Q0HA 3PYMA 3TGPA 3QX8A 3DE4X 4U1RA 3STWA 3ZUGA 1M34B 5JVDF 3KU4A 5HCNA 5DX0A 4YH1A 5LDGA 3U61B 2HMYB 3N3AC 2AI3A 3KKKA 4X3CA 4X8MA 1P6UA 4W63A 1OXVA 1LBTA 3CUVA 4BKRA 3ZNOA 5GINE 3SS9X 3FH0A 3T54A 3BICA 1J0CA 4ENVA 2H1WA 1G21B 2PBLA 5G1OA 4R1TA 3E5RA 4QBTA 5EMLA 1QQ7A 4AD8A 1OH7A 2DHDA 2X7XA 2FJ0A 1T1EA 2EJUA 3RYCB 2BC9A 3I9NA 4ZI7F 2V7VA 2Y0CA 3ZVRA 4X94A 1SJ9A 3QWBA 5AJHA 2PIDA 1XB2A 1ZK2A 4LXUA 5IM4A 1GLGA 5AJWA 2D0OB 4EA8A 1W8IA 4Y67A 2EP7A 3RJ5A 3I1FA 3WGIA 5DIZA 1AE1A 1KIFA 2OA0A 2D3TA 4M8NE 3C5HA 4QRHA 1DTWA 1X7YB 5K09A 2Z2KA 3SMVA 3DKRA 2RKWA 2VLIA 2FFRA 3NORA 4ZQBA 3IVRA 1UBFA 2VT6A 1VA5A 1BFDA 3DE7X 3IKJA 3O1JC 2X6QA 3VO1A 2IU4A 1CHNA 1JIVA 3IMFA 4MJLA 4MW4A 2RBEA 4EY7A 1X42A 3CH7A 2ZRIA 3HGMA 1OC2A 2EFJA 1YNOA 3LGAA 4Q9DA 4RLFA 3TLGA 4B40A 4F4HA 1KZ7B 1CNFA 2R6DA 1DQZA 2RE8A 2GT1A 3EFOA 2HLNA 1E5TA 1RXVA 1ORVA 1TXGA 4D96A 1ZWLA 4D43A 1E94E 4PBSA 5CJ2A 2P11A 1FP4B 4OLJA 4P86A 4YTEA 4PLTA 1KI4A 4FILA 4BO0A 2G08A 4IR7A 1SCKA 4BQFA 4WKCA 2PO7A 3AI1A 2YN4A 3ZHOA 2J5XA 4RK4A 3BHNA 3OIUA 4MQEB 1V4BA 2BHNA 1USUA 1PT8A 1XWWA 2NPIA 2QRGA 2JD2A 3KTAA 1YB6A 2H52A 4J0DA 4P4TA 1JLSA 2APJA 4CQJA 2I7DA 5FB3A 3GCDA 3RPEA 3EDRA 4QOEA 2CXTA 1CF9A 1ILWA 2PT9A 1ISSA 1GGVA 1QO0A 1SD2A 2HU7A 2R751 4JC0A 4P3OA 4QYIA 2QXUA 1IHOA 1CUAA 1X1CA 2XCUA 1MQ9A 2XUDA 2ZBVA 3HDVA 2CNKA 5IC6A 4MKRA 2Y4OA 4CL2A 1U0BB 5FTJA 5CXXA 1APBA 1P4SA 2D13A 2P1RA 3H5NA 3UGJA 5E4TA 4Q01A 4F4IA 4Z54A 3A58B 2KMLA 4WI1A 2P5SA 5DMHA 5CJJA 4GSYA 1PYGA 421PA 3WYCA 3QOYA 5I9TA 2CLIB 4UREA 1KR5A 2OG1A 3DGFC 3C98A 1N6LA 2VZ9A 1UKAA 2QUBA 4MP6A 3ROXA 4QVIA 1NMEA 2FEXA 1EDBA 4PN7A 1MJHA 2V96A 1VZ2A 4GI5A 2HN9A 3HHEA 3AJDA 2C31A 5CH5A 5CURA 5LLSA 1DVRA 4HAWA 1L4FA 3BA1A 2UYOA 1N7JA 4FMDB 2FZCA 3IJEB 2V6IA 1M0SA 5TMPA 2QPOA 4NWIA 2XQGA 1B15A 2Z8YM 4Q19A 3FI9A 3WDLA 2NP7A 3RFTA 2HY7A 5AOVA 3UH1A 2OORA 4JNCA 1TZ2A 5IN5A 3ZGVA 4KNYA 4YMUA 4H7FA 1IJBA 1N1MA 3TOZA 3SY8A 3KWMA 3TZEA 2P27A 4X24A 4CQMB 1FXUA 1PJTA 1PRYA 3T34A 1VJRA 1WU7A 3W6NA 1SCIA 4E88A 2BMEA 2UZ0A 4WE3A 2CGEA 4UPDA 1DDOA 3V1LA 2NACA 2FW6A 3NGLA 2DSNA 3HN6A 1FIUA 2P4SA 1HFEL 2OWEA 1QF6A 3MBOA 4D81A 2QM8A 3DBRB 4FHGA 1M2OA 3TH5A 5MDHA 3AEKB 3VFDA 3CS3A 1ZK1A 1EQUA 3A6FA 4QTUB 3FR7A 4MXDA 3WMRA 3QA3E 3OPMA 1KMHA 3ND6A 2VCHA 3FSEA 3GLFA 4YFYA 3GLHE 2IW1A 3GGSA 2MYUA 5FT9A 3SE0A 1NMQA 4LPSA 1JIKA 3MLAA 5FA6A 2POQX 4AI6A 4DV0B 2LGJA 2P69A 4NCKA 3KQUA 3RHSA 2OTCA 3HCEA 2QNRA 2ICAA 4RVGA 1YIOA 2QZSA 4GPAA 4J7AA 1QX4A 1BCRA 5JJKA 1DEAA 1B4DA 5EY5B 5GWXA 1MJFA 1O08A 2O0JA 3KLOA 3HJHA 4QAQA 3TRFA 3HVIA 2EZTA 1S2DA 2VWGA 3K6SB 2BBOA 1QBGA 4PYNA 4DLAA 1K92A 2PD3A 3IQIX 3AESA 3C3CA 4ABYA 1YS7A 4U9UA 2E87A 2PT7A 4PZ0A 3MEQA 3H2KA 3PGMA 4Y3UA 3NMUF 3T5PA 1GQRA 2B1IA 4YREA 4HNTA 1RZRA 2P6PA 3RVOA 1V4NA 2WUFA 2GN1A 4RF3A 5A6VA 2IIQA 3WXBA 1ZVJA 2XCLA 3QVJA 5C1DA 5TEVA 3MCAA 2E21A 3VTAA 1MB3A 3WWEA 4CM5A 2Y93A 3AF0A 1XLTC 2BCGY 3EUFA 4A0FA 4UE3S 4TZ6A 5IDYA 3V4LA 4WGGA 4Z9YA 4Q4AA 4XH9B 2IXFA 2RSLA 3AF2A 3IE0A 4HDMA 4BECA 2GFQA 4CDMA 5L3QA 4H6XA 2Q4TA 3NC0C 3CX7A 5U4QA 2IEGA 7GPBA 1DT5A 3TAXA 2FEWB 2YJNA 3QHAA 4U2EA 1KDRA 1QK5A 3G88A 3GAFA 4URHA 2JHPA 4OIMA 3RARA 5BQ5A 3PFKA 1JLKA 4WVLA 2GASA 3R0ZA 1CEXA 5T6MA 1XVUA 1PCXA 2EW8A 5HCUA 4S24A 4DDWA 1LV8A 1DKQA 4JR1A 2QP4A 5E6RB 3THYB 2D00A 4R40A 4GLBA 3ERCA 4ZHQF 3DVAA 1NN3A 4WLNA 1BQ3A 2QS9A 3LRPA 2WQ6A 2QY6A 4CFYA 4EQ6A 3X0DA 4IWNA 2HF7A 3HV0A 3C1OA 2YQ4A 3C8HA 1DIRA 2AC4A 4N0DA 4D8VA 3O38A 5JXHA 5LJLA 4GS5A 2PUEA 1QE5A 4C9BA 5E4JA 2QMOA 4PZYA 3STTA 1L5RA 1PZEA 4F3YA 2RAUA 3T7AA 5E2IA 1OFUX 2VHUA 4X71A 1MR3F 3AR7A 1CETA 3LDFA 3M83A 3MRXA 3L0YA 1HDXA 3GEIA 3WP1B 3LJKA 3P9SA 2X9VA 4BNHA 1TPZA 3LOQA 2ATCA 1SKAA 3FPHA 5TT0A 3S7TA 1YJBA 3AB3A 1KMMA 4IWYA 3KTDA 1MAHA 4KBYA 2XUOA 2JZCA 3ASYA 2YXNA 3PQ3A 3QVOA 5EINA 3VH3A 4ZHQA 3ZDCA 2JLYA 1CUYA 1G5PA 1I4TD 2ON6A 3K0CA 3NEYA 3PDUA 3HXOA 1RHMA 1VQ1A 5H4GA 2X19A 3RU7A 5FHQA 2CDNA 3A1CA 3ORFA 5KVCA 3F6YA 4Y1GA 3UGKA 3DZIA 4A8HA 3K9FC 3SAJA 3V8QA 3FWNA 4AKHA 4E5SA 4M9QA 4AJ4A 4FDUA 2E89A 1V6AA 1SXJB 4NG5A 3ZWQA 2D5AA 3CWQA 1Q11A 4TYNA 4OHRA 5BUCA 4OHCA 3E3MA 3CR3C 3L1KA 1QIGA 2XVXA 4LXYA 3O82A 4AC9A 3D59A 4ZIRA 5BORA 4MKXA 2OESA 5KCMA 2C7BA 2REQA 2XZTA 3OFVA 1TYDE 4MS3A 3WQHA 1K68A 5IMSA 1UKCA 2A3NA 4G9BA 1PO7A 4YAJA 1RCFA 4QTZA 4HVCA 2QQEA 2P4HX 1V6CA 3GLHB 3ER9A 2YR0A 4JP1A 3C5VA 1JU9A 4K03A 4GOND 5EWJA 3H87A 1RMYA 4YP7A 1W85A 5DV9A 2IBMA 1KC3A 1Q0QA 2WHRA 3GZ4A 3PUIA 4G1EB 2JFQA 2C88A 2VRWA 1W75A 4HRAA 3HFRA 3GRPA 1G8MA 2VSFA 4LNUA 3WSWA 4PZ9A 1A5TA 2ZSAA 1SHTX 2IEBA 3N8NA 5AW8A 3HKEB 1GCGA 3DPUA 1QFMA 4EHHA 4MAMA 3LNTA 4GYWA 3ZCUA 4DNQA 2JCSA 3U4CA 3K20A 2DG2A 3MNFA 1L5GB 1VBFA 2IHNA 1BOFA 2OM2A 2PEYA 3O93A 4AURA 1XNGA 3EVEA 2O2YA 3C1TA 3IAM6 3Q6NA 2NYUA 2VNAA 4IH9A 1NY6A 1GM5A 2H65A 5JCZA 2AKEA 4LW8A 2JI9A 4YJKA 1BROA 1YMQA 3IIJA 1KOLA 2OE2A 2NP6A 1A96A 4BLQA 4OGLA 2IZ5A 4Y9SA 2B6HA 4D3DA 3VA7A 1K3FA 4FGZA 4KXVA 4LFBB 1R4MA 2FPPA 1T24A 3GOQA 5FADA 6AT1A 5EJAA 1Q22A 3MWFA 4ZQIA 3H9QA 5CB6A 4EW2A 4CMJA 2ZXUA 4NC9A 2R6HA 4GU5A 4ZP1A 1CY7A 2ALJA 2GXUA 5EXPA 3OFNA 4OHMA 3LX5A 2BGLA 4IDNA 1MQ8B 3U4GA 3LG2A 1MZPA 3AR6A 5BSTA 4E33A 3F3MA 4JT4A 1I14A 2XQKA 3ZCTA 3H1FA 4F3KA 5FEUA 3FCOA 2FSGA 3VU3A 2ZSFA 2DCMA 1LSUA 8AT1A 3RWMB 4KXFB 2NU6B 2GZAA 1X1AA 4LJRA 2FMUA 4FQ8A 1RP7A 4O0LA 4B79A 1DB3A 4KVZA 2WG2A 1YHYA 2D1QA 3GG9A 1CZUA 3AP2A 2A4KA 3QX9A 4ZVVA 1YBAA 2FG6C 3B36A 4L4UA 4AJHA 5I3CA 1CJMA 2LCQA 1FQOA 1JWBB 2VUSA 1C7ZA 221PA 2SCUB 3GJXC 3H05A 3JVDA 2GPSA 5JCPA 1WMDA 4QOGA 3JY6A 1IHXA 4YJGA 5TRTA 4A15A 1OWPA 3WB9A 2J7KA 1TJYA 3EQ7A 4B3SB 5UKDA 1E9EA 2KB0A 2Y1CA 1RM0A 2FRDC 2XE7A 5AW9A 4CUJA 3RRZA 3OM0A 3JQRA 1ZN2A 4ZCIA 4AT1A 4BBPA 1DKLA 1R4NA 1JE1A 1ADYA 4OXRA 5SY4A 4ZRMA 4EUEA 1BMDA 2AXNA 2XNHA 2W11A 1V11B 3H5LA 3QBVA 2PX0A 1QX3A 4FDMA 1FNBA 4JU9A 2YMLA 4IXTA 1H2FA 4FCWA 4HRYA 4QUIA 1QH0A 1XKLA 5DB4A 1FQJA 4RY0A 2CLKB 3NATA 4KMMA 5KYNA 1FFSA 1R6AA 5ALIA 2V1UA 2ZCJA 4MKGA 2P2DA 4X6XA 2YWRA 5C34B 2WZBA 2JBAB 3QITA 1ZRMA 3ZOZA 3R9XB 3QU5A 5ESRA 1CUVA 1NRJB 3UJCA 1CLEA 2VWHA 2NZJA 4F3CA 1AY0A 1ID8A 4UPVA 3P97A 2QTHA 1OFVA 3AUTA 2J4DA 3NDIA 1AN9A 4UAVA 3L46A 3MLEA 1UBGA 4BJ6A 3MA0A 3UMCA 4F56A 1ETUA 3T5BA 3ZXYA 5DM60 4JYAB 4RABA 4NCHA 2A86A 4LISA 1Z0FA 5EWMB 1SELA 4HFMA 5LMZA 2GEFA 1UBJS 1KARA 1M72A 3AHFA 2O4UX 4GM4A 2BI8A 1A4UA 3K30A 3O8OA 4NDZA 1RYMA 1EUQA 3QV2A 4DTIA 2H9IA 3FLMA 1S8NA 2X2EA 4OMUA 3ZCPA 2O59A 1HFJA 4JI3B 3UATA 1DL5A 4RZUA 1N2CE 2QRVB 1N57A 4Y0VA 5DPMA 4BUJA 5KMGA 1E96A 5F7ZA 2VUIB 3EF1A 4G1UC 4ZQEA 2NVUB 1RWNA 1G7TA 2VHQA 1V96A 1X7HA 4RO0A 3SKYA 4AG5A 1P5FA 1XRLA 3D4NA 2VHVA 2IZ6A 1TUIA 4KX5A 4PZEA 1RC1A 4N3BA 1UC4B 5L3ZA 2DQ4A 2VP4A 3NAMA 4G8CA 4WW0A 4CCYB 1GFIA 1Q6YA 4WESB 3C97A 1SQ0A 4FOOA 2LWIA 3H42B 4F84A 4TUYF 1PEYA 2QP3A 2QTMA 3ZNQA 4W1RA 4CF7A 5KDLA 4YXFA 3VU0A 3TRJA 2Q1YA 1PR2A 1ECCA 1Y5RA 5HQ3B 1Q44A 3BGOS 4KV7A 2WUWE 5DI3B 3NOXA 5B4UA 3K70B 1UPTA 4KQ1A 4RH1A 4ZA2A 4AP6A 2UVDA 3MN1A 4W9NC 2ZUWA 1UZMA 3DTYA 2WF8A 4YJ3F 1U7HA 2XMDA 4ZCTA 3QI7A 3U3JA 4I14A 2BEWB 3GLRA 2WUVA 4GLLA 3ZJYA 3CLHA 3EEOA 1GKIA 5GVSA 4IDOA 1IUKA 3SZ3A 1MIHA 2NYAA 1R50A 1STOA 4O2RA 1WZ2A 2WAOA 3AVUA 3TM4A 3NASA 2ECKA 2VS1A 1IPEA 4PX5A 5ESDA 3FM9A 1M2EA 3GUVA 3O74A 3C7KA 3IMKA 4O2LA 3SE7A 4EYKA 3BMOA 4IAOA 5U1PA 3VC7A 3WIUA 4QEZA 5KOHA 3DOUA 3HUDA 2HMSA 3DL4A 2Q5FA 2GF2A 2R68A 1IN8A 2ZRBA 3I9LA 3RIEA 5A5EA 2FSPA 4BNXA 1OTYA 4R9VA 2R7MA 3JQBC 2V3VA 1QS0B 5KYUB 2ZYAA 4PTZA 3VHXA 3JQAB 4O4JB 2EKPA 1FYDA 3R0XA 2EG5A 2J33A 1RKXA 1A2QA 1JAZA 4Q3LA 4AKSA 4Z2AA 1F9AA 4JC5A 4W5TA 1JQLB 3L49A 2Q6TA 3BE8A 1YRAA 5EIWA 1QU3A 3GF4A 3RSQA 2GSWA 3JD2A 3W2HA 1I1QB 1EBUA 5JDCC 1T0IA 2C2HA 3H9CA 3JAWA 4IIHA 3RKRA 2X5KO 3ONDA 3EDYA 4QLBA 1GQOA 3HJAA 1KVTA 3LY7A 5FUQA 1BXRB 3CG0A 4UCWA 4E4TA 1WD5A 4N41A 2VTBA 1XQ1A 4F3TA 3DFUA 3D4BA 1GWNA 4E0BA 4FDTA 3E7XA 1F7UA 1NATA 2I5PO 3RT9A 1RZVA 4OGKA 2WUEA 1G7RA 1CEQA 1EI9A 2V6MA 2RAFA 4Q3KA 5CLGA 4YUXA 2WYUA 4NJEA 4ZREA 2CSXA 2FMHA 5IC4A 1XRJA 4R71A 1X2EA 1MAVA 4HH0A 2JAWA 4JOSA 4YAEA 3JRXA 4E6EA 4EFDA 2ZYTX 1KMNA 3L0CA 3MJ4A 5KSWB 1Z22A 4JYBA 5EG5A 1OX5A 1NSTA 3MFYA 1PK7A 3MS4A 4JUCA 5COAA 5CDSA 4DIEA 3BA6A 3MUOA 3MM4A 2Q9AA 1UK6A 2J3DA 3F98A 4Z9FA 1Y1SA 4YDSA 4OGWA 1UQRA 3BGVA 1NPDA 4ETNA 4NE9A 1YVUA 3LCRA 3M4XA 1L3CA 3IMGA 5IU6A 1UP6A 3ZZNA 3BD8A 1GL9B 3E4CA 1UM9A 4DXAA 1XEAA 4KK4A 2V7QD 3RF7A 2X3FA 3KSUA 3RG2A 4B6OA 5HQJA 2Q7OE 4G07A 2XAAA 2RD2A 4MI9A 3UXMA 4TQ9A 5CFZA 3Q8MA 1L1RA 1N2CB 1Z4LA 2I3GA 4XA8A 2JB9A 4BB9A 1KU6A 2X8BA 2HJSA 2HDNB 2Z3WA 3SYTA 4PC3A 3WWCA 5ALTA 3OZGA 4WBNF 4EVSA 5HOEA 2P2CA 3N1UA 2RHHA 4M98A 2DJIA 1Y3HA 2WK1A 4HLNA 4GI1A 2YFHA 1C50A 4YQYA 3FDJA 5EPOA 2KSQA 3IAXA 4MV3A 2QD2A 3A10A 2VH2A 1NVFA 3OZXA 3DP7A 3KJHA 2PBZA 1KWGA 1NBAA 1Y8RB 4ZCLA 3M4YA 3U1TA 5HKOA 5E3IA 5EIFA 4YLYA 2WTMA 4ZV7A 5BSWA 3CRQA 3KL2A 1XLTA 4R3UC 4IGFA 5CB4F 4UTVA 1N75A 3WQRA 5C8ZA 3WQQA 3A4YA 3R7DA 1SC3A 4V24A 1J1IA 1Z6XA 1A9OA 1T6NA 1FFGA 2NYVA 4WBNA 5ICCA 2YASA 2RGWA 5A4IS 3MGBA 1YI8A 2XV1A 4F8JA 3NHBA 5D6OA 4UU0A 4FS3A 4K8OA 4MUJA 1O7JA 5LYJF 3LXMA 2AVDA 4TMFA 2WZDA 3JZIA 4R4JA 3IPRA 2OV1A 3K1YA 1MJ5A 1LKZA 1R0RE 4JBIA 2C1XA 4LJYA 2IF2A 1N78A 4YP1A 4U5QA 1JNYA 1C3VA 3QKRA 5D1NA 4DNFA 3VR6D 4EG7A 2C2GA 3LHFA 3BS4A 1SUFA 3SYLA 2D7DA 5CB4A 3A37A 1XRRA 3D5QA 2DQZA 2QMUA 3MLBA 3U5ZB 4LA4A 5DTEA 1N0UA 1J8MF 3KZVA 2IPXA 2Q49A 2D1FA 2ZUSA 4JJEA 2VJCA 4YEDA 3ZGZA 4RLHA 4AZSA 3MELA 4LDNA 3CEHA 3AEXA 2YC4C 4G4SO 3GGJA 3GJ5A 4M2LA 4LZZA 4RD2A 3WLRA 4C4RA 1Z6AA 3N7TA 5FRDA 1E3SA 2JI4A 3ZH2A 3V1MA 5ABPA 2IS6A 5TPWA 4DHWA 2WHEA 3ND7A 5LYJA 3U19A 1Q0PA 3IBTA 1PJCA 4AJ1A 5LQMA 1OAOC 1ACLA 1E98A 2JGEA 3QU2A 3S7ZA 3VPHA 2D1TA 2QN7A 3WV4A 2X9NA 4H1WA 1TUEA 2C5HA 4JLPA 4MV9A 1GCUA 4ID3A 2ZRDA 4Z7JA 1DJNA 2VT7A 3QF4B 3E9YA 5HGJA 1V3TA 2IE0A 3TZBA 5LQCA 2IEIA 4Y6LA 3UGTA 3N58A 2J4FA 4DLWA 2EHJA 4WFQA 2EWMA 4Z0TA 1CY2A 3RLIA 2NTJA 4U4AA 2R5NA 1G5HA 1YB5A 1KP3A 3BD7A 1ZSVA 3EJ6A 2WSBA 2VZ8A 3QKSA 1H66A 4GZ6A 3M1AA 2F48A 3ITKA 3PS9A 3QFSA 5CM9C 3GXBA 3HWWA 1RPZA 2QTNA 3ENQA 3VTFA 3TGLA 4I55B 3LWDA 3R5FA 3IILA 2F1IA 4ZT3A 1KE1A 4US1R 4LWZA 1XDZA 4RA9A 3ZE2B 1FJXA 4MVJG 1KJZA 2B1RA 1GA4A 3EVCA 1D9XA 4FYKA 1G8HA 4TMYA 4OUDA 4U7JA 4BQPA 2C7QA 2OCGA 4IDGA 1DUIA 3IC5A 4M38A 4C6SA 2HSWA 3QSGA 1L5YA 3L6DA 2R48A 5AOCA 1BU5A 4KYIB 5DNYB 1WMEA 4IJMA 1NVDA 4G56A 1UOEA 3D8HA 3TOSA 1JI0A 1LJ8A 2YNMC 1GEEA 2GO7A 2AUNA 3JD1A 4WVFA 3MTBA 4WL0A 3VAZA 2G9ZA 4HWSA 2CVHA 3PUVA 4EECA 1CEEA 1A8PA 2VATA 3THWA 2NPFA 2G80A 3EW9A 4IEEA 4XSGA 2JA2A 4TXNA 3W2GA 4MGHA 5KYGA 3IEVA 3RROA 2OZVA 1WV0A 3BAZA 2WE7A 3A9RA 3WB2A 2V7QA 2FWNA 3R6TA 5K3EA 2JAPA 4XVUA 2M98A 3A4MA 1C7FA 3TOCA 3WBKA 4JSYA 3QY9A 5A9TA 1X15A 3H1GA 4KLCA 2R44A 4QA9A 3KYCB 4I1IA 4Z8YA 3NHJA 2H4HA 4JBNA 3ZE9A 4QREA 1HA3A 4DW8A 5JFTA 1E9CA 4K3UA 3B2EA 2X7HA 1U8XX 3J81A 1EFAA 3L0BA 4QO7A 3CB2A 5C8DA 1QCZA 2HEIA 1N5KA 3BCUA 3D9QX 5HRAA 1D1QA 1U65A 3ZG6A 1YXMA 2A1TS 2W2XA 1ZM2A 1MXHA 5IT0A 1UK8A 2PSDA 1PJLA 2RHMA 1FDRA 3ELYA 3AVQA 4HAYA 2HMVA 1DCFA 1JFFA 3BX1A 4UC0A 1EDDA 1BMFD 5KJEA 3U31A 4B6QA 5AT1A 4DE5A 2ESRA 2QSUA 5JNWA 4G0MA 2WU0A 1XMVA 3L7CA 4QXOA 3LXUX 2CNDA 1PQWA 3EQ2A 1FEZA 2D2EA 3DAOA 4Z8XA 2A6PA 2OUIA 5AVJA 2R65A 1D1SA 4MTLA 4M53A 2PXHA 1XVVA 1LK0A 3BHJA 4AQ7A 4JXKA 3NLLA 4Q00A 1CUHA 4BBAA 1IOWA 1T3GA 4CLXA 4CPDA 4HEJA 3JZFA 1T4CA 1ZC4A 2DY0A 1OJLA 2WJIA 3EZ9A 4QOIA 4RYLA 1AKYA 4OHWA 4YUZA 1O1YA 1OB2A 1T1JA 3OOSA 1MXFA 3JQ7A 1IK4A 3NNDA 2BZGA 4CQNA 3VNRA 3RRXA 4Q4LA 4BLTA 2QPLA 5K3OA 1ARZA 3BSFA 1OI4A 1WUYA 2VVTA 4KQ2A 3VR6A 1NI4B 1VPLA 1R0SA 4CTMA 4YRBA 1HORA 3JCZA 3EC7A 1YULA 4FCCA 2N1BA 3JVIA 3H3FA 4G5XA 3S2GA 3W3AD 1K06A 1U04A 4R9UC 2AOTA 4RTLA 4Z4QA 2C5SA 1W4BA 5IARA 1HZJA 2PWPA 3TUIC 1X2BA 2VOEA 3OJWA 3P5BA 3SFTA 4JWTA 3HA3A 2DKOA 3SXJA 4M9RA 1ZUNA 1Q21A 3CBGA 3FOCA 5DM1A 4DSZA 5LXTB 1G8SA 1D1PA 2FWIA 4GWLA 3QBJA 4K40A 5AK6A 1IMOA 4IDPA 4F04A 3L6BA 1SPXA 5ALUA 2BONA 2I99A 3DUWA 3QW2A 4QQRA 5EP2A 1YBHA 5LP1A 2WTAA 4ERXA 3GO4A 3JYHA 2XNSA 4CU2A 2Y1LA 3COPA 1G4UR 3VX3A 1G3RA 4TSRA 3MJCA 2DVMA 1RXYA 4DMCA 1PT5A 2R1TA 2Q1TA 2ZBGA 4L95C 1N2ZA 4F4JA 1YK0A 4R2WA 4G0UA 1DAEA 4KQ6A 3MTGA 3WLQA 3I5XA 1US8A 4PR3A 5FOSA 2W70A 4YT4A 3ICWA 3KUXA 1HL7A 4Y2GA 5CJPA 4ZVKA 4R41A 4EO4A 1Y5MA 3TDMA 3TRIA 2XOXA 4EZEA 4OQPA 4TVBA 2W2TA 2ZB4A 1VE7A 1PHRA 1UDBA 2YV3A 2GBGA 3EEFA 2WKRA 2MSDB 3OURA 4R1SA 3UAGA 3K2IA 4OU5A 4UPEA 6PFKA 4WOKA 4UNPA 1YE5A 3OX4A 1JR4A 3QBDA 4HDSB 4D6PA 1SFRA 4JI7B 1T5OA 1VIAA 2O2XA 1XQWA 2DTEA 5F35A 5HQTA 2FFAA 1A1SA 2BF4A 3JQDA 4BFTA 1KXJA 2WIAA 2WMNB 3FTCA 5J5AA 2UUBB 2XGMA 3KHSA 3I37X 4X0EA 1BFKA 1XMOB 3CT4A 1THGA 1E9FA 4I6EA 4LZAA 3KAJA 3VZSA 1AXEA 3CZQA 4HT3B 3T1QA 4JLSA 4PEVA 3EZLA 5CLJA 3KQYA 3B60A 4ZJZA 1CUBA 1P5JA 3TXAA 3RWBA 4CMKA 1CQWA 4M99A 5JLAA 3V4VB 5EIEA 1AVTA 2IYZA 3LUPA 2JGNA 2VJBA 3N2IA 1T1GA 1JL3A 4NESA 5GM1A 1R9NA 3SI7A 1DCMA 3DAGA 4NENB 5AW6A 5FUBA 3NJ4A 3G5AA 1NJ2A 1XVIA 3HBFA 4YACA 1GG9A 4H31A 5A71A 3OLQA 4JJIA 1GNPA 3S5UA 1EXVA 3K9QO 2GCIA 3QPCA 4LEIA 2IU3A 3QU7A 4W9NA 3U7JA 3WL4A 4AUMA 1YIDA 4BCCA 5KSZA 1HR0B 2EOAA 5JS1A 3T7DA 4EB6A 3MJEA 5JSQA 3ZHTA 1ODTC 3L4JA 4MWBA 2YYYA 2EG9A 1CS0B 2JGJA 4UEQA 4BNVA 4EG1A 4HN2A 1AQIA 2GCPA 2OZLA 5LWHA 2PUCA 3IUMA 1QH1A 4XCXA 3B7WA 5GJWC 3RJ9A 4CDNA 5F2NA 5JQWA 2OZEA 3TR0A 5ALXA 2AX3A 4KWCA 2IDMA 4AY6A 5JBQA 2YWXA 3F6RA 4JFAA 3ZGYA 1U1GA 1T3ZA 2PXXA 3GARA 3O5AA 3TINA 1CZHA 2FF5A 2ODQA 1PTKA 2P0EA 3WMXA 2B7CA 4R7GA 3WNBA 4BTLA 2OWDA 5KINB 4DR7B 1V8PA 4L0QA 4EP1A 4D98A 3NBUA 4NNPA 3JQBA 2C20A 3VMMA 4P35A 4TWJA 1MRNA 1MOZA 3G1TA 4O8CA 3LFUA 4M21A 4DAOA 4ZTBA 5I4KA 4NFSA 1RS0A 1JMVA 3PDIB 4KH0A 3J80A 5BSEA 3GQBA 3QOFA 3DE0X 3JU3A 3D54D 4Q48A 2ZI3A 4XIYA 1O94A 2UUAB 3TBFA 5CG1A 2JFGA 1U5CA 4REQA 3KWFA 4JGGA 2BFBB 2X1LA 3RT7A 5BYAA 4HC4A 1UH5A 1ZGBA 3GY0A 3KKLA 3F5FA 4GWGA 5IVIA 3O8DA 2GA8A 4K3VA 4CWAA 5HS4A 4FKMA 2F8SA 2P79A 3KZMA 4ZU3A 2Q2VA 3RAFC 1A04A 2ONZA 3U4DA 3PTZA 3DOJA 5BP7A 3Q3JB 1HNWB 2QK4A 2ADOA 2AF4C 4S2UA 1M1YE 5ECYA 3UJNA 5KJ6A 2H00A 3U48A 2HRQA 2XUGA 5CDTA 4EPYA 2ZTSA 1DV1A 3UT6A 4MV4A 4TYMA 5L6MB 2HT1A 1WCIA 4GWKA 4N39A 4OQXA 3U3XA 5JSHA 3DLAA 4YFVA 4CIAA 1TKCA 1LF0A 1QR2A 4CKCB 3R44A 3REQB 1U7XA 2CDRA 4WAUA 5KC8A 3I6BA 2IOYA 4WIAA 1L4LA 1NQAO 2GARA 1ADGA 1XCGB 3MAAC 4ECEA 5JQGF 3R9WA 1ZD9A 2YV4A 2Z43A 4RJJA 1UFOA 4BLVA 1VYUA 4BQEA 1VJGA 6YASA 2FJUA 1FXWA 4QHSA 2EBWA 1R6TA 1PFYA 2J9ZB 4BZZA 1C8VB 3FUVA 1KNXA 2RB4A 4B3XA 4B2YA 3NDBB 4R9SA 2RBKA 1EMDA 1LPOA 1UZNA 1W96A 2VRNA 4JKIA 1IZ7A 4MRRA 1S01A 5E7QA 5AVOA 1Z62A 1JDBB 2FGKA 2VF4X 2GEUA 3WRVA 3G2IA 3MK31 2XT9A 1RP1A 4HLUC 4MO9A 3GNTA 4C4SA 4DCOA 2CL7X 1XZBA 2DBRA 2NZ8A 4EX6A 4DLNA 4HLDA 1FDSA 3UV7A 1OLXB 3B2NA 2FZEA 3B1FA 4MICA 2PCJA 3AIKA 5LD2C 2X0FA 1IQ0A 4M46A 3KJGA 3O94A 4FMBB 3RC2A 1QPZA 2R6FA 3E3AA 3I9V6 4G37A 5JQGA 5ICGA 3W5AA 3NWEA 3O83A 4XWKA 4GLFA 5BVGA 3GIWA 2G83A 3FOEC 5CH3A 2HMUA 3I0NA 3T9FA 1ZGZA 3TE6A 1VHTA 3OO0A 1WL8A 3Q0TA 1XA3A 1EBFA 2PLAA 2EQ5A 3BJMA 1E2GA 1NVTA 1AQYA 3BL8A 3EXG2 3L8HA 3O95A 4MA4A 3MC1A 4DM3A 4OK3A 3PZRA 4GMKA 1DMRA 4QX6A 4AM8A 1CUDA 1R8YA 3F4KA 5AM0A 2V3WA 4FGKA 3SR4A 4XB1A 4CM8B 1UDRA 5G3YA 4B4DA 1FFXB 2NLOA 1KOGA 2Y1FA 2HJHA 3UHPA 4XGIA 4U02A 2CWDA 4NS4A 3Q9SA 3DXXA 4L6IA 4NTZA 2GRUA 1G4AE 3AERB 2MSKA 3HPQA 4HVTA 4RETA 5EAIA 2QR2A 5BRAA 2PUVA 3OU7A 5BQFA 5HKKA 3HJCA 1Q1EA 2C2WA 4TV9A 3G85A 4KAXA 5JMPA 1GITA 3VJRA 2C61A 4A0SA 4RH3A 3ZJVA 3RUCA 3BXZA 4R2HA 2B8WA 2XGJA 1HT2E 4U6SA 1F51E 1RWMA 2LIVA 4HB2A 3A9TA 4KIUA 4OP1A 2E4XA 4PE5B 4XRGA 5LYYA 1VYTA 1C3XA 2EEPA 3WX0A 1XQVA 3WMFA 2FEMA 5J2UF 1E3EA 4AY5A 3II6X 2BFNA 1FTGA 2XCIA 5ALLA 3RANA 1KEEB 1N5OX 1Z38A 4G5GA 3MHTA 3AX6A 1KP2A 3KHKA 5DNDA 1ZH4A 2Y1OA 3RIYA 2Y4NA 3CRW1 4AWXA 5ISMA 1SKUA 2FPWA 1VMAA 2D8AA 1DX9A 3N0VA 3PE6A 5LQNA 1GLNA 5B3JA 1VFNA 2HDHA 3WRYC 2GZHA 1N0IA 1FSPA 1EJ6A 2A67A 3DF7A 2NQ2C 2AOWA 4QPPA 3VC3A 4RZSA 1T9GR 4AWAA 1DEOA 5TMBA 2AW5A 4LVNA 2AEJA 3GGOA 1JP7A 4H7JA 1BGXT 1TT5B 1WX1A 1NPYA 3L8GA 4V0NA 1GYRA 4BNDA 1CB7A 1DXYA 1UWVA 1Y4DE 5ECWA 4R3WA 5KPDA 4EMBA 1DBRA 4UQPA 3PA8A 4N1AA 2WB2A 1HLGA 1UPCA 5D01A 2KS6A 3PJRA 1TRKA 4NS1A 3ZKWB 2ORIA 2A0XA 1EUCB 1THMA 1IM8A 2Q1UA 4LE0A 3C0KA 4GG1A 1RHKA 1SRQA 1A5AB 4QGAA 4D9BA 5KX5F 2HC9A 4ND8A 3C1UA 2OKCA 4NJMA 3UHFA 4C7BA 4CL8A 3AKCA 1L5OA 1OBHA 3HFSA 4XJVA 4PQRA 1UF9A 2LP4Y 1NBMD 1O87A 4AN4A 4A4DA 4F85A 1UMBB 2NU7B 5BUQA 2V7TA 4MIOA 3RSLA 4DR2B 1TF7A 4KQFA 2PUJA 4F0JA 5AVWA 1SKMA 3FYUC 2YNMA 5D3MB 3VM6A 4M87A 5TLSA 1I7DA 4HP8A 5K0SA 2HA7A 1P0PA 2QNIA 1V47A 3MERA 1ZD8A 2G06A 3IO3A 3SJ7A 4BIIA 1IG0A 5L3RA 1I1HA 1BNCA 1QQ6A 3UFXB 1P8JA 3CZPA 5BQOA 3TDKA 2P7IA 3K32A 3ZU5A 4D26A 2E4VA 3P0EA 1Z0UA 4PG4A 1KSGA 3U6BA 3LD9A 4MYHA 3ACBA 5IZCC 4F91B 1E2JA 6Q21A 5IJWA 1JDUA 4JI0B 1FRQA 4RVUA 2AJBA 4L9AA 2WHPB 2ZYUX 3Q87B 4DR3B 2HO5A 4G6ZA 3ANNA 3U0BA 3NBKA 3L6EA 3ECCA 2GN4A 4X92A 2ZRNA 1WVGA 3DOOA 1ST3A 3L8MA 1PGOA 1Y81A 3HRIA 1YE8A 1XTSA 3D3WA 1J1UA 4EYQA 1EA5A 4QWWA 5KJCA 1XMPA 1N9GA 1JIXA 3AYXB 1UMKA 3JASA 5TE9A 2PX8A 3DOIA 4HRVA 4R8RA 2AOXA 4V39A 3F74A 3QEAZ 3S2UA 4J0JA 4MTCA 3LSYA 2R84A 4FZRA 3X1WA 3AM4A 4QU5A 5B12A 4GPZA 2F8LA 4V2UA 8GPBA 4LF8B 2NT4A 3G02A 3OJ0A 1YI1A 3OM1A 3ZLTA 3WNDA 3FI0A 4U7TB 3MYRA 4BL5A 4LF4B 1B26A 4BUZA 2ADMA 5LFAA 1FMTA 4HAZA 1E5VA 3RJZA 1MIOA 5IVPA 4GNRA 2WWHA 4JP2A 1YZ3A 1M7GA 3K4PA 4M4SA 5EZYF 5TMEA 5LL6P 3GEMA 2P5UA 4PSKA 2Q3EA 2JIMA 3HXMA 4FCTA 1P2GA 2LKCA 1U90A 3AUAA 2JGDA 4RBNA 3FPCA 4TV8F 1G5TA 1D6MA 5FPHA 1GGEA 3K4HA 5AVXA 3IESA 5LQRA 2Z1DA 1DKRA 3SF8A 4JENA 4I1RA 4IXMA 2R7AA 4AJJA 4LOKA 4YRRA 4AS1A 1KFCB 3CF0A 2NVWA 5KNCA 1W19A 4BAUA 5IFLA 3SM9A 3JVEA 2I7VA 4L28A 2IHJA 2H31A 2EATA 3R3WA 4YMGA 3CEJA 3EZ6A 2QTTA 4ARZA 1QCDA 5BQXA 5EZYA 3WOHA 3MT7A 2B0JA 1XFAA 5CLQA 1VPVA 2HKIA 1IOVA 5E9AA 2H1HA 1LPSA 1OR8A 1YQEA 2J3LA 3BE4A 3R75A 2AFIE 3PPXA 3ZQUA 5JMOA 4BMVA 5J4YA 1SC1A 4CMEA 4I50A 4KPFC 1Z5PA 3NXKA 4FFLA 4PHGA 3ZLUA 5F3WB 3M4NA 3JR7A 2IUYA 4JJ7A 4KC0A 1ZYUA 2WJAA 2XH8A 5J63A 4OI1A 3VR3A 2I6TA 2GVZC 2ZS9A 1LDMA 1ZRHA 1XJQA 3CSSA 5FBZA 2VI5A 1LK5A 3FYHA 3K2QA 2B5OA 5J1TB 3VYWA 3FNGA 2MYNA 1FUIA 1C9KA 3CBQA 4L8LA 3GFPA 3TBKA 1DIGA 1NLFA 1F8FA 3AKEA 3MJSA 3EBLA 2FCRA 2QLMA 5GPBA 3REFA 2NVOA 2H5IA 2Q5QA 4ZQHA 5IAKA 4F72A 3HP1A 1C1DB 5IF9A 4LTDA 4LRQA 5D5HA 1RNLA 1M7BA 1RCUA 3QJGA 3U3DA 3AGPA 3AHCA 2JCGA 2VZ0A 2RC6A 4R8VA 1TM3E 4ZICA 5L53A 4R69A 4BVAA 1QONA 2O2CA 4NBVA 2P78A 4I36A 3CN7A 3G6KA 1L0BA 4DA4A 2GM3A 5B5SA 3OQMA 1BX3A 2PVSA 5EIBD 4XUGB 5F4BA 2GAJA 1Y0BA 2PM8A 1RMTA 1JAHA 3DR5A 1MABA 4TM8A 3G0OA 4QG3A 4OCZA 1WHSA 3DAHA 1ISIA 2FG7C 1KZ9A 1HDYA 1RIFA 2BFMA 3NR2A 3AB7A 4XUCA 1KYTA 1WDWB 1FS6A 1Q77A 1QOZA 4GYYA 4YLEA 1PLKA 4UM7A 3A36A 3DV9A 3FTNA 3S2YA 2UXCB 2YWHA 3C6YA 5G02A 4LF5B 1TA9A 2IYVA 1L4HA 4AP5A 4C7OB 4C30A 1ECBA 2OHVA 2FUG1 2NU9A 2ANCA 2YWEA 2LCIA 1T2AA 3BIOA 1SUIA 1KZGB 1A72A 2IOFK 4KIJA 4IKEA 1K6MA 2W43A 2QI9C 3A9UA 4LGMA 2D1SA 3KQTA 2H4JA 3OCXA 5EMHA 1JKXA 1ODLA 1LFAA 3C8MA 4TPKA 1C0LA 4WKBA 4OQZA 5FCDA 5A4FS 5KCZA 2AXEA 1U2PA 1C81A 1EWTA 5C1PA 4ZAVA 1Y3DE 2BOVA 4QVKA 2EL9A 1Z4IA 1OASA 4G8DA 5LBTA 5LUAA 3NPMA 4ZK2A 1JKFA 3L40A 2GZ1A 1TAUA 1X8XA 4CM3A 4MX8A 2CNNA 3CFYA 4DQKA 4Y2RA 3IDFA 3IA2A 1RAHA 5JSKA 1EFVA 5AHOA 5AD1A 3DJYA 1E3WA 1Z75A 1L5SA 1GTMA 3FN4A 3KWJA 4MV5A 4B74A 4JKOA 3KYJB 3WOVA 1B0ZA 1T5LA 1GP2A 5IWCA 3CJRA 1P61B 2I33A 2TSYB 3NTOA 4GECA 1AG9A 4XGQA 2FPOA 5KVSA 1QXSA 3TWOA 5ITWA 2I1VB 4GI3A 1IULA 3L6UA 1UPFA 4M9XA 3ILVA 1YZKA 3PD1A 5FPTA 4MUEA 2JS7A 1UBSB 1JSRA 1JJVA 1NT2A 4PGFA 2YZMA 1V7QA 1VPTA 3A32A 3BRCA 3R0VA 4JIGA 3L4BA 2WICA 1B3RA 1FJHA 5EQJB 1MEEA 1YCGA 4MJXA 3RHTA 4JLKA 1CY8A 2G72A 3TMYA 2Y2VA 2CEKA 5IT5A 2GWHA 1C9MA 1NWCA 3OKPA 3GRFA 3B1XA 3G9TA 2QTVB 3D4IA 4EVIA 2WFLA 4FYPA 3VR6H 4CM7A 1P7WA 3G8AA 1YDMA 1QP8A 2R4UA 2RG1A 3FCEA 3N75A 3OLYA 3EDOA 3ENWA 5CIQA 1XDGA 1PWYE 1H4TA 4WJKB 2X5XA 4RKQA 4X45A 4CLRA 1EAMA 1KZ1A 5AVZA 5L4SA 5JZVA 4JCOA 4C4ZA 4GBMA 4S35A 4RTJA 2DTDA 1VSTA 3KE8A 3WYDA 2X76A 5ILQA 2F90A 3PX3A 2CB0A 4J29A 5CVTA 5EZQA 2GM4A 1CIJA 1MG5A 1ZD2P 1GD1O 4G5QA 1A4RA 3VNAA 5CB8A 4XQEA 1Z5WA 4KWEA 3TEFA 4EITA 3VQTA 3H0KA 4UZSA 1E61A 2P91A 1SVOA 2GLUA 4HZUB 4JGIA 5EOVA 2XDYA 4HLUA 2LRHA 3CQ9A 4CKWA 3JWHA 5JXGA 1HDIA 1BHJA 3L5KA 3WGLA 4EYOA 4MPJA 3W7BA 2RI1A 4I9NA 2QTBA 1PD1A 1NN0A 3AZOA 1VCOA 2ZIEA 4EENA 5JW6A 3NHWA 4HGRA 4FC6A 4MGZR 1NE7A 1GU7A 5AJTA 2XIJA 1K7EB 3E9CA 4BBZA 3HVUA 4GSLA 4ACAA 4A9AA 1VLMA 1TIBA 5AKKA 4RZXA 3S0JA 2H11A 2BFDA 4UU8A 4B3DA 2MR6A 3D2AA 4UBOA 4OKNA 5E3JA 4CV3A 5SYAA 3EIUA 3JQGA 1ZCZA 4ZHSA 3KB1A 1AIPA 5ILOA 4KGDA 4PZPA 3E5NA 1T2VA 3EASA 3OPYI 3TN7A 3AF3A 4JJZA 4KQWA 1JWLA 3PSHA 1T9ZA 3GJ4A 5EGSA 3TTUA 4XDHA 2BBSA 5LN1A 3OFSA 5I45A 3UMGA 1JT9A 2AS0A 2VSOA 4KXXA 3RABA 2FQ1A 5IYZB 3EXEB 3A05A 3PWSA 2MIIA 5DCYA 1UPAA 4CEHA 1HNNA 1PWXA 3FOAA 2JFHA 3OO1A 2Q3CA 4WK2B 3VISA 1YMVA 4HDRB 3GJQA 3LQQA 1X8KA 4NKRA 3PNKA 5J43A 2ODBA 2A92A 3JYQA 5LUBA 3W9YA 3GMDA 1I94B 3IOMA 4BPBA 1V6SA 3DV2A 4L22A 4DSNA 3KSAC 4HNSA 5A6SA 3DLTA 3TQIA 2FPLA 5F9HA 3V1KA 2W48A 5FAKA 3OX2A 4M1WA 2DFPA 2ZJOA 3B1VA 2G6TA 3IEKA 1G0NA 2NTYC 3OESA 2ISQA 3WE7A 2HHCA 1ZIDA 1NBIA 2PL5A 2WM8A 3VAAA 4C08A 2P9YA 2AG5A 1HQDA 3QKIA 4A1OA 3NJRA 1FYXA 4U2KA 5EMJA 2YZNA 4DTCA 4COKA 1DKUA 3HBNA 4U6QA 2R96A 4H3SA 4CM9D 4V0MA 4HDAA 1CX9B 2OD2A 4DLLA 3LC7O 1U81A 1WUIS 2BY4A 3SC2B 1ZSNA 3CUKA 2ZBDA 4ALIA 4ZZ0A 3SEFA 1JA1A 2Z08A 4IUYA 3WRYA 1LRLA 3F49S 2C97A 2IDZA 4IDBA 3UHJA 2DT8A 1UDAA 4UEWA 3HCOA 1WE2A 2XMZA 4KW7A 3B6KA 5HA5A 2AB0A 5EXDA 1VKHA 3ZBQA 3LDGA 3EOAI 4EFLA 5L40A 2JVJA 1I4DD 1IDN1 1SUAA 2OBBA 5DM4A 2YVAA 2FR8A 1IN4A 3AIIA 4O2AF 3LQYA 4YJFB 1CUEA 4PONA 4BFVA 1Z26A 4NPAA 3EXHB 3GPCA 4W6ZA 1UP7A 4WNAA 3I6MA 5DXAA 3I30X 2VLBA 2BGIA 3ADDA 2RAPA 2UAGA 4YP0A 2O8BA 1WHTB 4X84A 1U8UA 2D5LA 1UDXA 2VDNB 4RX1A 1J5PA 3LUKA 3W5HA 4Q3NA 1OGIA 2EKDA 1V8ZA 4O6VA 4Q3OA 1E7RA 4YMIA 4Z99A 5HIIA 1YOVB 5ALNA 2ZCVA 1ESCA 3PDWA 4INPA 3FYSA 2JD1A 2CBGA 4V1CA 3NRCA 4I9UA 4FYMA 2C5EA 5HRCA 2FWPA 3D1LA 3TX2A 4L6AA 1RQXA 2ZJ2A 4Q1AA 4O2AA 1KDZA 2GCGA 3O8CA 3K9CA 3W3AH 4MYTA 2BGUA 3WKCA 4DEYA 1QGAA 4BASA 4QU8A 3ZDFA 3U7IA 3LUHA 4DVJA 3EPHA 4MV6A 5BR8B 4FYYA 4FGUA 2PS0A 5IJAA 2JGMA 4O4HB 1CUWA 3A4LA 2JFNA 2ZYGA 1A9RA 1S2IA 1TCUA 1IAVA 1L7BA 4COOA 4EI7A 4BBJA 5JAPA 1FQWA 2XE8A 3JWEA 3JW8A 2GDZA 1KDVA 4PBRA 3TKLA 2X1VA 4LY0A 1YCHA 4X62B 3F8TA 3ZWVA 4F9GA 4NCIA 4JYZA 2H4ZA 1B43A 2DKFA 2C7GA 1B1AA 2G3YA 2XNKA