1R18A

Drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
223
structure length
223
Chain Sequence
IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein-L-isoaspartate(D-aspartate)-O-methyltransferase
publication title Catalytic implications from the Drosophila protein L-isoaspartyl methyltransferase structure and site-directed mutagenesis.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 70
structure length 223
sequence length 223
ec nomenclature ec 2.1.1.77: Protein-L-isoaspartate(D-aspartate) O-methyltransferase.
pdb deposition date 2003-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1r18A00
3KQMA 3EGIA 3KQYA 5B1SA 2YUIA 1EAMA 3P2IA 2OZVA 2ORED 2UYQA 2AN3A 3GWZA 3P2KA 3TLJA 3DH0A 1ZHFA 4QPNA 3CJQA 4KRGA 5EKUA 5BW4A 2PXCA 5JR3A 1VQ1A 4C06A 4RTOA 2FHPA 1SUSA 4XUCA 4PCAA 3T7RA 2HWKA 3SM3A 4B17A 3B3JA 3BKWA 4M36A 4RWZA 4FS8A 3ERCA 1D2HA 2ZBQA 4EK9A 3GRYA 4GOND 3GRUA 1EJ0A 4X1OA 5FQNA 4OQEA 3JWHA 4EMSA 2XYRA 3JWJA 2C7PA 2P41A 3E7PA 2ZW9A 4RV9A 3BXOA 3HEMA 4E32A 2PGXA 4BP3A 4MWZA 4R6XA 2B9EA 4XUDA 3HA5A 2VZ9A 1XTPA 3LGAA 3ELYA 2Z6AA 5G02A 5EHIA 1G6Q1 4E2WA 2P7IA 5E2AA 3SVZA 2XVAA 5DX1A 4RVDA 2PXXA 3NMUF 1NW5A 1FP2A 2O0LA 2YXEA 4OA8A 3HCAA 3TKAA 3A25A 2FK7A 1XJ5A 3HCBA 2QRVA 3IHTA 3V8VA 3FUVA 2QE6A 5E1DA 4IKPA 5EVJA 5K0EA 5LQKA 5CIYA 3FTFA 4EKGA 1XCJA 3LSTA 3Q87B 2P3OA 5EC8A 1YZHA 1VP3A 3OFJA 3M6UA 2GAFA 3C6MA 5DM2A 4C05A 4K6MA 3OE4A 3AWIA 1EG2A 3A7EA 2JH9A 5ERGB 5GINE 2UYCA 1ORHA 2WA1A 5HIIA 2UYOA 5DX0A 3FRIA 2JHAA 4YUXA 4EQZA 1WG8A 1G55A 2PWYA 2QM3A 3SSMA 2O06A 3TQSA 5F2OA 3UJAA 2VP3A 4YV2A 2IBTA 3L8DA 3LX6A 3A27A 3QOWA 3REOA 5HOQA 1N7IA 2NXJA 3M6WA 2NXNA 1SKMA 4IV8A 3DMFA 3SMQA 1OR8A 3P9NA 4RTSA 3GGDA 1FJXA 3MAGA 2PV0A 3G2MA 1M6EX 3NVKI 5E2BA 3GNLA 2GA9A 2BR3A 2ZIFA 2ZBRA 3BUSA 3I64A 3TOSA 5EG5A 2EJUA 4DKJA 4RTPA 4O29A 2QY6A 2AOTB 2FCAA 1BC5A 2PT6A 3BT7A 5CVEA 4PYQA 4A6DA 3FUWA 2I9KA 2GB4A 3FYCA 2V7EA 3PVCA 5FADA 4PYIA 4HC4A 5LQUA 5KS2A 2BM9A 3CBGA 2WA2A 4P7KA 4PGHA 5CM2Z 1IXKA 1M6YA 4PYJA 5LQJA 1I9GA 3TM5A 3OCJA 3THSA 2DULA 2CL5A 4R05A 2PSSA 3MQ2A 2Q41A 5K09A 3DMGA 4P7JA 1P39A 5LQCA 2C7OA 5K01A 3UWPA 3DUWA 1BOOA 2XVMA 1EQAA 2FRXA 5DLYA 2R3SA 3HP7A 3K6RA 3KPWA 3M4XA 3OFKA 1R74A 2PBFA 3FTDA 4FSDA 4PYMA 4P7FA 5FQOA 4CKBA 4HRAA 3UFBA 4ER7A 3G7UA 5K0CA 4ER5A 2G71A 2P3LA 5E1BA 3FUUA 4KDRA 1P1CA 3GRZA 4LECA 4DQ0A 4MTLA 3RIEA 3U81A 1KXZA 4BY9E 1NKVA 1YUBA 3MTIA 3OU6A 4V0RA 2NXCA 2IDKA 4WXHA 5ICGA 1YFJA 2F8LA 2PKWA 1JG4A 3MB5A 3MTEA 4YUWA 3NDJA 4RTRA 2PWPA 4BLWA 4PINA 1Q0SA 4CXMA 3KPUA 3LCVB 4FP9A 4HH4A 3IEIA 4MQ4A 2EFJA 4QDKA 5EPEA 2AOWA 2QYOA 2ADMA 4FT2A 4DZRA 4FZVA 4PWYA 10MHA 2ZVJA 3H2BA 1X1CA 3FTCA 5E8JA 5LQNA 1WZNA 2IH5A 3EGVA 2IPXA 1G8AA 4Y2HA 1KYWA 2JHPA 3FYDA 3B3GA 3M33A 4PYKA 2GPYA 3CC8A 4GC5A 4E70A 3KPVA 3LCCA 1JQEA 3EEYA 5EOVA 3CVOA 3BGDA 2B78A 1N2XA 2AVNA 4OQDA 3EVCA 1JR4A 2Y1XA 2PX4A 2JHCA 1AF7A 2ZBPA 3I58A 1UWVA 4R8RA 2B3TA 1Z3CA 3KR2A 5U4XA 5KQRA 3C3YA 5K03A 3SGLA 1KIAA 4RTJA 5HIJA 2CWWA 3EMDA 3B89A 5K0FA 3GDHA 3MCZA 1X1BA 4CWAA 3ID6C 5KVAA 4BLUA 3LKDA 1YB2A 1R00A 3D2LA 2AOUB 3HCCA 3HVHA 5IH3A 3TM4A 2ZIEA 4C4AA 5CVUA 2R6ZA 4E2XA 4C08A 5K0JA 2A14A 2NNWB 3HM2A 5FCDA 3PLAE 4GC9A 3TPZA 4WVLA 3UA3A 5ICFA 1F3LA 3O7WA 3EVAA 3IV6A 3I9FA 4AX8A 2AN4A 4CKCA 3C3PA 2BH2A 1JQDA 4R8SA 4RX1A 2P7HA 2OXTA 3EGEA 3FPFA 1KP9A 1ZGAA 5CCXA 4RTKA 4PNEA 1NW3A 1R18A 5FULA 3JWGA 5BP7A 3PX3A 1X1DA 3SX0A 4X60A 3AXSA 3GU3A 3K0BA 3WSTA 5E9QA 4KIFA 2BM8A 1O9HA 1JQ3A 1KPGA 3PX2A 5F2NA 2G1PA 3A26A 4M37A 1QAOA 4DA4A 5M5BA 2PVCA 5DXJA 3G8BA 3UJDA 1AV6A 1YF3A 1B42A 1RJFA 3PFGA 5JUWA 2OYRA 3UBTA 3DXYA 2IDJA 4ER3A 1XVAA 1NW7A 1TPYA 3LKZA 1HNNA 3ELWA 4OX9Y 3NJRA 3ELDA 4PYLA 1IY9A 1XDZA 2ZLBA 4QPPA 1RJDA 3KU1A 4LWOA 3P9CA 3G5LA 1ZQ9A 3FPEA 3HVKA 3R6TA 1MJFA 1WY7A 3SXJA 3UJ8A 1KPIA 2G70A 3KHKA 3LL7A 2P8JA 3UA4A 2PX2A 2G72A 3ANXA 3DXXA 5CVVA 5DXAA 3THRA 3MCTA 2Z6QA 1PJZA 2IIPA 1XCLA 3SSOA 1QANA 3EVFA 3HVIA 4HTFA 1L1EA 3EMBA 4IV0A 3RW9A 4CTKA 2G8NA 4GOOD 5E1MA 3LDFA 5K0LA 3P9KA 4YUYA 3FZGA 1SVUA 5BW5A 1KPHA 3QV2A 3KQPA 2OBFA 1I4WA 4E2YA 4KVZA 4E30A 4EKIA 8MHTA 2YXLA 4C07A 1X19A 2XYQA 3F4KA 3BWYA 5HZMA 1RI5A 5D1NA 2FPOA 3NVMB 1XDUA 1RJGA 4IWNA 3GRVA 3CCFA 2K4MA 3KKZA 2B2CA 4XUEA 1JTFA 4POOA 1YFLA 1VIDA 4PONA 5KYGA 5E1OA 2QRVB 1WXWA 1DL5A 3FRHA 3PTAA 2I6GA 5LR6A 4A6EA 4PYNA 4MHTA 2BR4A 2GS9A 3KQVA 2DPMA 5ICEA 4RVHA 4X63A 3G88A 1P91A 3I53A 2N47A 4MIKA 3DP7A 2I7CA 3E05A 4KW7A 5F2KA 5GM2A 1NT2A 3GIWA 4AZSA 5HIKA 4PIPA 4UOEA 3ELUA 2HNKA 3P97A 4L7VA 2C7QA 2IH2A 3GCZA 4ISCA 1R8YA 3E23A 3EVDA 3T0IA 3TFWA 3LDGA 1PRYA 2CMHA 3LBYA 3RODA 4E2ZA 1QAQA 2YR0A 3UJ7A 3DLCA 3MGGA 4PCLA 5ICCA 4LWPA 5GIPE 3PB3A 3HVJA 4QDJA 3P8ZA 7MHTA 4ER0A 5E8RA 4ER6A 5CCBA 3PFHA 4JXJA 4RVGA 2Y1WA 4DCMA 3V97A 4V0QA 1BHJA 5HIMA 3LCUA 3DTNA 2ZZKA 3O31A 3R3HA 5EIFA 1ZG3A 1VLMA 5EHGA 1FBNA 2AVDA 2GH1A 3HTXA 3KQSA 4OBXA 1RI2A 5LQAA 4RTMA 1R6AA 5DWQA 3VSEA 3ER9A 2OO3A 5DM1A 5HEKA 4GQBA 2ZULA 2JH8A 3SR4A 1WXXA 5H02A 4F84A 5EMMA 3CGGA 1JG3A 3KQWA 5K0BA 4RTNA 3P71T 2IH4A 3KQQA 3C0KA 1VP9A 2CMGA 4P58A 3R9XB 3DMHA 1JSZA 1R8XA 5DRYA 1G60A 1V39A 2HMYB 5CVJA 2HV9A 2IGTA 4ZTBA 5DSXA 5GP1A 3P9IA 3KPJA 5C1IA 3EEOA 5FWAA 3EVEA 2I62A 3OE5A 1O54A 1VE3A 3M6VA 5EIWA 3VC1A 2CKDA 3I5UA 4FSXA 2AN5A 5FTWA 3G2PA 2FK8A 1QYRA 2ONYA 2OPBA 3NDIA 4FR0A 5DM4A 5E9WA 5EZSA 5FUBA 3CKKA 3TR6A 4AUKA 3MHTA 2YTZA 1AQJA 1RI4A 3B5IA 3A7DA 2V74B 5EKXA 1JG2A 3TRKA 2VS1A 5C9ZA 1DCTA 5CUQA 5EMKA 5IKMA 1KYZA 1YZ3A 2JJQA 3M70A 1ZKDA 2PJDA 3M6XA 3QOXA 4G56A 4HGYA 4YUVA 1VBFA 2YXDA 3JWIA 5K0GA 1VPTA 3T7TA 1IM8A 3UJ9A 5DPMA 2PY6A 5D1HA 2YVLA 4X41A 1O9GA 4YV0A 2EX4A 2P40A 1TW3A 3MERA 3EVBA 3OZTA 4Z2YA 1T43A 3GJYA 3KR9A 1SQGA 4PGGA 3KQTA 3EPPA 1SUIA 2VDVE 5LQRA 2ZZMA 4F85A 2ZTHA 4DF3A 2C7RA 5BXYA 3BGVA 3C6KA 4QVKA 4GOLD 3UJCA 2OB2A 4RSRA 4U7PB 2ONZA 2PT9A 2AR0A 3CJRA 3B3FA 5HILA 3CJTA 1TW2A 3ER8A 2WK1A 5HFJA 5K8VA 3R24A 1H1DA 3A4TA 9MHTA 4HGZA 3O4FA 3OU7A 1QAMA 4FT4A 3OZSA 3PT9A 3AY0A 2AOTA 1XDSA 4NECA 5DX8A 3KR1A 3VC2A 5FHRA 5FWDA 4YMGA 4YV1A 5KQSA 4Y30A 3BWCA 3KQOA 3LECA 3DOUA 3DULA 2P1DA 3EVGA 3BGIA 1UFKA 1JTEA 2P35A 2H11A 5EMLA 4YUZA 3LBFA 3AXTA 3BZBA 2IFTA 4GEKA 2ZSUA 5T64A 4DMGA 4DCGA 1KR5A 4EVIA 3OPNA 1FPQA 3NW9A 3OZRA 5GIOE 1DUSA 3Q7EA 4DM3A 1KHHA 1VL5A 4H0NA 1NBHA 1EIZA 1UIRA 1L9KA 1L3IA 3FPGA 2GLUA 3LHDA 1NW8A 1WS6A 5DSTA 4AZVA 4KIGA 3HCDA 2ZWVA 1JSXA 1NE2A 3OU2A 3IYLW 2ZZNA 1ORIA 2VDUE 2OY0A 3G89A 1AQIA 2OB1A 2OKCA 3GRRA 5DM0A 1I1NA 4GOMD 2AOVA 2AOXA 1MHTA 4F86A 4LG1A 3KR0A 3TMAA 1P1BA 4CTJA 1G8SA 1RI3A 3G2OA 4OBWA 3X0DA 4BP1A 5E9JA 3BKXA 2AZTA 1M0EA 4HSGA 5T67A 2NXEA 2ESRA 4HG2A 2NP7A 4C04A 4X61A 2LD4A 1Y8CA 4GUAA 2VDWA 1BKYA 2BZGA 3ME5A 4QVGA 3R0QA 3BWMA 2ZIGA 2PLWA 4OA5A 3S68A 4KWCA 4C03A 4E33A 2ZFUA 5GOZA 4U7TB 4M38A 2ERCA 3LPMA 3HCEA 2NP6A 3G5TA 3KPYA 4RYLA 3HCFA 5MHTA 2ZWAA 4M7RA 3B7PA 4XCXA 2P3QA 3UJ6A 4HTFB 5DTRA 4GBED 2IP2A 1HMYA 3NWEA 2UYHA 1G38A 1RJEA 3FPJA 3VYWA 1X1AA 3LDUA 5GWXA 5C0OE 3T7SA 4PYOA 1Q0TA 2HR1A 4KDCA 2IBSA 5K0NA 3G2QA 2O07A 3FPHA 3EVZA 3NTVA 4QQKA 5EMJA 5EGSA 1FP1D 5DTMA 5FHQA 4QQNA 4RTLA 1F38A 4P7GA 1NV9A 3G8AA 4QTTB 1INLA 2BR5A 3DXZA 2AOUA 2PX5A 3UZUA 5DRTA 2Z6UA 3FTEA 2HTEA 5CD1A 4AZTA 3TKYA 1D2GA 2NYUA 3SSNA 3E8SA 3GXOA 2B25A 2EG5A 2O05A 5P8WA 2XBMA 1L3BA 3BWBA 5CVDA 3PS9A 2H00A 2EJTA 3HA3A 5EEHA 5EZQA 5T6BA 3AJDA 1QZZA 1D2CA 1EJ6A 1N7JA 1NV8A 1NW6A 5GM1A 3GO4A 4R6WA 1L3CA 1SQFA 5FA5A 2JG3A 1JG1A 1XXLA 4FGZA 3HNRA 4CKEA 4GF5A 5DT2A 1ZGJA 2YQZA 3ORHA 2YX1A 2PXAA 3HA7A 4QTUB 5K05A 2UZ4A 3DR5A 4YMHA 1NBIA 2E5WA 2PX8A 4PIMA 5EQJB 2ZCJA 4ATNA 4E31A 2KW5A 2O57A 3NWBA 4AZWA 3UJBA 5LSAA 3DLIA 3FUTA 1RI1A 4BLVA 2FYTA 5EEGA 5FA8A 2AS0A 2H1RA 4RVFA 2XYVA 5DTQA 3FUXA 4RTQA 1U2ZA 3P2EA 1SG9A
chains in the Genus database with same CATH superfamily
4W4TA 4F04A 4PFJA 3GWZA 3BDVA 1W94A 2AN3A 3E48A 1YJCA 4M76B 5DW3A 3WXMA 5B36A 2QUIA 3INYA 2XCIA 1MPTA 2G1JA 4MLDA 4Z99A 5BW4A 3UAWA 1NBAA 1V9CA 1Q7CA 1TI7A 2FJUA 2P9CA 4S35A 4CLDA 3OT5A 4D56A 2MHCA 3WZ2A 2ATVA 2EYQA 3ZWKA 1HZZC 1L7EA 3NWPA 4WLUA 4BVHA 3I2HA 1XALA 1G6KA 5K2MA 2G4LA 4BVLA 1W4BA 5BPFA 2Y2UA 3GEEA 3JWJA 2V8OA 3E7PA 2B30A 3PK0A 1QSGA 1X7HA 4PSCA 1ZUNA 2GZ2A 1H3EA 2QSYA 4RIHA 2HU8A 5K3OA 1JE1A 5EYPA 2PRYA 3T38A 2C96A 1YBAA 3LGAA 2HT1A 2X0FA 2CV1A 2AMLA 2P2GA 3CLRC 3M5DA 3GJSA 4GI7A 3V4ZA 2GWRA 2WYVA 1P61B 3SVZA 4EITA 1OC2A 2Q1TA 2NUTA 1FP2A 3I6ZA 1ODIA 2Q8PA 1C1DB 1PS9A 2H52A 3E2MA 3F8SA 3FSGA 3MLEA 4G25A 4RJIA 2G83A 1QHIA 4LJ7A 2XJ4A 2QRVA 3IHTA 2PTHA 4Y9TA 1PLJA 2R5FA 3UKOA 1T2CA 2Y4OA 2R68A 2VJQA 3GEMA 1D3AA 1NUQA 1WHTB 3HI4A 4FX2A 5L6LB 3OPYB 1I80A 4B31A 4ZOBA 4ZQIA 5DM2A 2AQ8A 2B6HA 2X3YA 2Z0MA 1AHNA 1NATA 2E4ZA 3IPRA 1TEVA 1EZ4A 3HU1A 2JI9A 2MTBA 5A02A 3TB4A 3PR2B 4E46A 1FJHA 2NSLA 2H5EA 4W8OA 4IOLA 1WG8A 3MUEA 4AG3A 1M1YB 4X20B 3JQPA 1JU4A 4U6NA 1F17A 1TUEA 2QK4A 2FPWA 2MYTA 4I5DA 4ZOLA 2V8BA 3WLKX 1GPH1 4EW2A 1M2FA 5B5SA 1V2GA 1U4OA 1UL1X 1Z0JA 1GGFA 5F52A 5C52B 2WTUA 3J81A 1RXSA 3ZHSA 3RSLA 2AX4A 4GOKA 3KQKA 3BUSA 1J90A 4ENQA 4BS9A 2YNMA 1W1WA 2AW5A 4QG7A 3HKEB 4JS0A 2ID8A 4TZKA 5LP6C 2XEDA 4W5OA 1X7WA 5ALJA 2GB4A 3C1UA 2WKSA 1THTA 3T12A 4RFLA 2PYZA 5F7ZA 4FR2A 2BM9A 2O5VA 4HDAA 1CQJA 3MUNA 5SYAA 2IXBA 3VHLB 5AD1A 3A70A 2HO5A 2XMPA 2ZJBA 3H83A 3G13A 5D01A 1VLQA 3O93A 5JS1A 5HM6A 2IITA 3CSUA 4XM0A 3H2ZA 4YWJA 5HWSA 2B4AA 1TQ8A 1KMIY 2XUPA 2W71A 3VJKA 1E3JA 1FE8A 2OZEA 4NV1A 3RRFA 2NT4A 1L6RA 2OV2A 1RVDA 1YI8A 2F59A 3Q3HA 2VHQA 4WE3A 5FTKA 4Q15A 2IOYA 3KJEA 4JXKA 1KP2A 3L2OB 1V3VA 2NV6A 2MSKA 2OBMA 4RANA 1PV1A 2JDID 3U80A 4RSGA 3SOZA 3EZNA 4IIDA 4PICA 4X45A 3MQ4A 4YFVA 1W4CA 4LISA 4RD4A 5F64A 3TBHA 4DJDC 1AQNA 1T1RA 1DBWA 4M49A 2Q9CA 2DG2A 5BRNA 3TW0A 3PC3A 3VPCA 2H63A 1I0LA 4NARA 3ZWYA 4QDKA 1HEUA 5EPEA 4CPDA 5G0UA 2AFHA 2ZSKA 4BQPA 1CEEA 2OXEA 3MS4A 5L4LA 3AR2A 5E8JA 1LEHA 4RYDA 1FRVA 1L1RA 4ZQGA 3CRRA 1A98A 3I2FA 3P94A 1G8AA 3SBXA 1JFLA 2WU3A 3M5WA 4M8LA 2GVDC 3M33A 4LJAA 5JISA 3PT5A 1V1MA 4BFLA 4JDUA 2VK8A 3EIHA 2OO5C 2WNHA 3A1DA 4RJ2A 4FGJA 3CT4A 4Q00A 1UZAA 3CWZA 4LOHA 2IV3A 4D3DA 3FOBA 4PGFA 1QHFA 1X7XB 5KQRA 3I58A 2G8LA 5EESA 1C9EA 2LCIA 3I9MA 5K03A 3ZC3A 2CWDA 2GRJA 5FIUA 4N41A 5I51A 3M2PA 3EH1A 1N2EA 3G49A 3ODGA 1AS3A 1L4HA 4A8JC 2DHRA 3JZIA 4ZMSA 4UEWA 1XNGA 4I5IA 3AG5A 1GUBA 4O2AF 1QRUA 3QKRA 1IEQA 1SVKA 4L8GA 1U3VA 4FLFA 1EP1B 2Q9UA 4EYOA 4DLXA 5JEDA 5TMDA 4LN1A 1PD1A 3RC7A 3AERA 1ECBA 1VCHA 1MC8A 1ZK0A 3HJBA 4YROA 5JVDB 4JJ6A 4LFAB 2PEYA 3EC7A 5K99A 1J56A 4MPTA 3O7WA 5DHTA 2XNSA 4FDVA 4PV7A 1E1DA 4QAQA 3D7KA 2AI1A 3X1YA 3DVAB 4JUDX 2CVHA 3CO5A 1JSCA 3IAAA 4EA9A 3Q0EA 1EMDA 2OECA 4M1TA 3ZTYA 1N6HA 4GL4A 3QFSA 4ARAA 4K8OA 3HKCA 2EP8A 5EERA 2XXAA 1VJGA 2H1VA 2PR2A 1A9ZA 3I23A 3THOA 3OPXA 1CY2A 2HCJB 4Q19A 5CNMA 3HFRA 4JVMA 4CM1A 2G0TA 1DTSA 4OQMA 3E7WA 1OCEA 3BE6A 3CPHA 2IL1A 3JPWA 3P9PA 3KL4A 3DXYA 1AUOA 1O6FA 4D74A 2ZI5A 4P35A 5IDQA 3AKCA 1XJCA 4C20A 3NBKA 1JQAA 1XDZA 2DH5A 5IF3A 1PJRA 4D41A 1SELA 4EYKA 5KTYA 1B0UA 2HRRA 1DIHA 1RWBA 3C7TA 3HVKA 1KZGB 2L0XA 4NPHA 2OYCA 4WACA 1KWGA 4MQUA 3ML1A 1CB7A 2EKLA 5JO9A 4UTRA 2Q0QA 5A0TA 3OJOA 3I34X 4Q3CA 1QIHA 2JFHA 5EIAA 5CVVA 3THRA 3MCTA 3WGKA 2SECE 4AJOA 4MWEA 5F2EA 4B9AA 1I0IA 1OI4A 1XDDA 2J46A 2ZAYA 3FLBA 3K0EA 4WNYA 5CTJA 3NXSA 2OTCA 2V0GA 3PUIA 4QQ8A 4M88A 3KXLA 1JV2B 1WD7A 5FLYA 1QCYA 3GLFB 1QP7A 5EZYB 2P69A 1TM1E 1GNTA 5AFSA 3WI7A 3LL4A 3EAGA 5JVDF 3NONA 5BSHA 1CLEA 4P4UA 2ENWA 4IIYA 2ZJ0A 3FPAA 5FI5A 3HZZA 2HRCA 4L5BA 3UHFA 5KYGA 1EYZA 4FE3A 4DAEA 5TVGA 5CXSA 1GKKA 4FUTA 1BMQA 3GPCA 2QX8A 1P91A 1FLDA 1PT9A 3A6LA 3OJEA 3TLXA 2YJ4A 1DKLA 3E05A 4TMWA 2OGWA 2DH6A 2Q7OE 3SE7A 3QW2A 1ITZA 5CA1F 2BEUA 3PGXA 3ZWVA 4WCFC 5M3BA 4MW1A 5C46F 1HSZA 2ZYGA 4P80A 4PZ0A 4B75A 4MRNA 2KHZA 4Z51A 3T3DA 2YJGA 1VE9A 2C4HA 4KZPA 5ICCA 4RZIA 4PWZA 3WBJA 2LTAA 4IGFA 3H9BA 3F90A 3R9KA 2J9FA 1RZRD 2YFYA 4M1ZA 5ARCA 3RUDA 3OTHA 1F14A 3LQKA 3GQBB 5HIMA 3S1SA 1PN3A 1WIWA 1HLPA 2O3UA 3FRJA 3IP3A 4NY1A 2Q6TA 2WSIA 2JAXA 2JGDB 1G7CA 2HJHA 3I3OA 3N7TA 4OMDA 3UW1A 2K7FA 4EM6A 4CLRB 4OP3A 1V9SA 2X8WA 1JXMA 4ND8A 4O4JA 2F17A 2KI5A 2X1HA 3ESQA 3C5WP 3N8NA 5DVZA 3SR4A 2Q5JA 5AP9A 2JCGA 5CDGA 3SHQA 5EHQA 5H02A 2A88A 1MXHA 3L7AA 4KB5A 5K0BA 5LMNB 4FEAA 4KQ2A 5EQDA 2YASA 3R6LA 4YJ2F 2ID4A 2O19A 5CIQA 5CVCA 3D4IA 5EZYF 2JZOA 3VU8A 2CNOA 1A8HA 1JSZA 2BEJA 3DMHA 3PQ4A 1TECE 1YS1X 4L4RA 4MARA 1DRKA 4Q9AA 4GKBA 4IAOA 1PR1A 4X84A 3RAJA 3AEUA 1HE8B 4TM7A 3ZIUA 2PUDA 3PX7A 3C3KA 4I99A 1VBKA 3UMGA 3CEJA 1CS0B 1RABA 2O8NA 1K3UB 3LAWA 1IJBA 2CD7A 2OPBA 4AUMA 4J0KA 2FPLA 4AUKA 2PGOA 5C3UA 5L7WA 5TMPA 5BRJA 1LWNA 4JX9A 4KR2A 2ZIAA 2REQB 2C98A 2D7CA 3CZRA 4Q01A 4X9XA 5K4GA 3CZQA 5GMOA 4OHCA 2FZLA 4RMNA 1C1YA 2P9JA 5D6OA 3TQRA 1LBTA 2JJQA 1GO2A 1D04A 1FTQA 1W73A 1C9MA 3GJ3A 4DR6B 5K0GA 4JI8B 1H4TA 5DBOA 3RADC 3L8EA 3W2HA 3WIUA 3ZGLA 4KSYA 3ZY4A 1QPGA 4TV9B 5FPTA 5BSVA 1QG0A 1ZISA 2Q3LA 1TF2A 4QC2A 4X41A 4DTCA 2DR3A 3EVBA 2PJRA 1O97D 1KI4A 2C2WA 3NX4A 1NVKA 3GJYA 2IUYA 4TX1A 2WM2A 2ZB8A 1Z4OA 1V8PA 3R5TA 4OYYA 2HJWA 2JDIA 1SUIA 3MTQA 1JEAA 1C29B 2VAWA 4FDTA 3KETA 3TZHA 1OXTA 2IIQA 2CCJA 3SZLA 4DF3A 4F46A 3GLIE 1XRNA 3NDBB 3UJCA 2DUNA 1I9CA 3E3OA 2CVZA 5BWBA 5FOTA 1V8ZA 3V7NA 3O1LA 2X9GA 3LQRA 1T36B 1NN0A 1OWOA 2CJXA 3AESB 1CVIA 3MWDB 4NCXA 2PHZA 3KAKA 3BB4A 4BUZA 3LO8A 3REFA 2OMKA 3TSWA 5IHPA 2FJPA 3O4FA 2E87A 5CK4A 4N0EA 3BWXA 4KWTA 1NIPA 2W2KA 3HXOA 3VH3A 1EFCA 4ESHA 3FDIA 1ST2A 2HXSA 1T9AA 4DNPA 4RETA 3KYIB 3L1UA 3V1TC 2ZWMA 4GZ5A 3BGIA 1U6KA 2W42A 1GV0A 1IB6A 5IJ9B 1SXJB 2V7QD 1CETA 1CV2A 4BYMA 1BYIA 2QP3A 4CIBA 3K6KA 2QX6A 2I8AA 5FTNA 1FSGA 1P74A 3PXGA 3WO0A 4KQEA 4C7JA 2A0FA 1BN7A 1VHLA 1X8XA 1KYXA 5ITZB 5FBKA 4IWXA 2IYNA 2YVKA 5A1JA 1KIMA 3SR0A 2YWCA 3TD9A 1DX9A 4BQQA 4N8SA 1RQ7A 2OA0A 4ZYVA 2ZS8A 3OWOA 2JI6A 1XF9A 4BE9A 7ABPA 1R9JA 1V2HE 2PUWA 5P21A 2BFCB 4WH0A 4DPKA 2O1EA 2WSMA 2ZJ7A 3NNNA 4R1QA 1KY4A 4HRXA 4MX8A 3Q72A 2OCGA 2ZYAA 3C6QA 1P1BA 3OCXA 4BNUA 1QS0B 4EVQA 3M1YA 1CEQA 2HIHA 3KIPA 4W5JA 1CR1A 5HBGA 5T67A 4MA0A 2NP7A 4B6SA 5JBNA 1WDKA 3RAPR 1Y8CA 1PYOA 4DLUA 4RH1A 3H2IA 4KFRA 1QIGA 4DRXA 1VKZA 1C0PA 4K9PA 8OHMA 4R9SA 4EG6A 5J2TF 4KE8A 3TOXA 2EF0A 4M0UA 2PGIA 3V7WA 4LNUA 1GGKA 5G3YA 3HCEA 4PEVA 1V45E 4PRYA 1ISSA 1OXSC 5LKRA 4O2LA 1M7GA 2VZEA 4Z86A 2GHQA 2DPHA 5DTRA 4COKA 1FP4A 4IJ6A 1A2KC 4ES6A 3LK6A 2EGUA 2FY8A 3QXHA 3WL4A 1UPUA 1W49A 1H5QA 3O8DA 5K1ZA 3SE0A 1U28A 2BD0A 4IWYA 1TT5B 3SHVA 1JU9A 4RBNA 1JRLA 2EX1A 5AICA 2QLBA 2PMDA 3RSGA 2CE7A 3EVZA 2VHYA 1IWOA 3LFHA 3PE6A 1XBTA 4IDPA 5EGSA 5FHQA 3AW9A 4RV5A 3TVTA 3UQYS 4R8KA 2WLSA 4F6RB 3HY6A 4P7GA 5JZBA 1B43A 3CFYA 1FB5A 2WHEA 4LYEA 4RLQA 4HN2A 5AIBA 3O91A 2GA8A 3ANTA 2PX5A 2RHCA 3D9QX 1DBSA 1Z8DA 4CIXA 2XXJA 1V7ZA 1D5CA 2NZJA 5EP4A 4B5KA 2C99A 3OFND 4DPMA 4B3TB 3B6JA 2YRWA 1LLFA 5ERXA 4JLWA 2JZNA 2G4VA 2R44A 1IXRC 3CQ9A 1MC1A 2O05A 1T9DA 3MFQA 2CNNA 4BV2A 4N01A 2BSQA 2EJTA 2IYEA 2P27A 3HA3A 5KAMA 2LXNA 1BW9A 4TRRA 3B60A 4B3SB 3GX1A 1H94A 4WFQA 1NIJA 1S2NA 1ZY2A 3L4BA 1O95C 4OB8A 4P3OA 1UANA 4OSPA 1L8AA 4AMVA 2QJWA 3NASA 2Q50A 4AKTA 1XKTA 3EOBI 1ZUWA 2WHPB 1G1AA 4AJ2A 2AEFA 3U44B 1FDSA 3BN3A 3D31A 4L50A 1QFYA 3QLEA 4R4JA 1Y4UA 4I1OA 2E21A 1MO3A 4X00A 2Z2ZA 3V6LA 1XDWA 5AOBA 1DKMA 2EOAA 2IYSA 1U7UA 1ZIYA 1SG9A 3U40A 3ZKWA 4Q4LA 1QLJA 2HZBA 5B2EA 1A5TA 1TF7A 2BZSA 1PSDA 4EBBA 1EZZA 4ZCQA 3I8SA 4D1YA 1J9ZA 1O6GA 1SCAA 4NS4A 3GI1A 3ZJYA 3G8YA 1I2AA 3JASA 1TJ3A 3LZ6A 3D6MA 2AD1A 3QP9A 2DHCA 3FFTA 2WQZA 1A27A 1JG7A 4F71A 4B17A 2CDAA 4UD2A 5FPKA 2XQKA 1RTKA 2YZNA 3GCXA 4RWZA 1D2HA 1XZHA 3IKTA 5HX7A 2WKRA 2JFUA 5CB4A 3DZGA 3EASA 3S2ZA 5HDQA 3BE4A 2P41A 3ZCVA 2ZW9A 3PYXA 3EG9A 1YC2A 4TS1A 3VSDA 3PXBA 4Y2YA 2VZ9A 4FOTA 1X13A 2IHTA 4MCIA 5FPSA 2QN3A 5J5CA 4F38A 3ADDA 1P7ZA 4QQRA 2DFTA 2JLCA 1W4LA 1QORA 4ENRA 5E0OA 2YWHA 4ZMBA 3TZQA 1STOA 4FB4A 3P45A 5BR7A 3FYUC 1NW5A 2B8NA 3EZFA 4FHEA 4G07A 2WFZA 1GNQA 3HCAA 3IOYA 4MVJI 5A05A 3TKAA 2O2CA 5AW0A 1B73A 1B6SA 5EVCA 5K6RA 1NFFA 1V7QA 1EZ1A 2DTXA 2JI4A 2WUEA 4U2DA 3JRNA 3L93A 4WKCA 4GXTA 5EVJA 4A0FA 4CKCB 3IESA 5K0EA 3OZAA 3L7LA 4DT1A 2H3EA 4ARCA 5ECWA 1QGDA 4LOIA 1PBNA 1DFGA 4HB3A 1Y8RB 2EEZA 3AZPA 4OXIA 5HS6A 3UC9A 2YRXA 2BFBA 4AF7A 3KT3A 4B7CA 3N74A 5C81A 2FMFA 3IL2A 1PQPA 4L7QA 3EUEA 4PPQA 3JATA 3L1IA 5AK5A 3A0RB 3TQTA 2PGJA 2XUIA 3JZAA 1GSIA 2ANCA 2C5AA 2PWYA 3SBOA 4MI1A 1K5HA 2O06A 3ZHVA 3TGLA 3K0HA 4JC4A 3TTXA 4MGIR 4Y18A 1ISFA 2IXFA 3WLQA 3WV5A 5LIPA 4TWIA 4UEQA 4W5QA 4FXOA 5TC4A 2WR8A 2LZ0A 1ECPA 3F6PA 2BR3A 4V03A 2NMVA 4DA8A 3IUEA 4OGKA 1M9NA 2NTNA 4LRSB 1C3VA 2WFLB 5KTTA 2JLWA 1BC5A 1CNMA 3C4JA 5KWVA 1TFUA 2EBFX 3VYRB 4A2PA 1Q16A 5LQUA 4QPDA 4IDHA 1UJ2A 5A9RA 4P7KA 4KAJA 3WNBA 2QD2A 1OYWA 4F96A 4O1IA 4Z4FA 4KQKA 1T2UA 1XQ6A 2CSUA 2KLBA 3CVXA 1VPVA 2JEZA 4IDBA 2AB0A 3X1KA 1DZIA 2G09A 3RB8A 2PSSA 1XVUA 3MQ2A 1T6YA 3ZCXA 3NJ4A 4C6TA 1BXRB 1YRBA 3DAPA 3NM4A 4P7JA 5KHOC 1PBTA 4G5HA 4ND7A 3HJFA 2H16A 2FW8A 1QB8A 4KYIB 1NHGA 1AE1A 3C74A 3L0DA 1D03A 2F00A 3RK1A 3LUFA 1MKYA 4GBJA 4LY6A 1GTG1 2XE6A 3T4PA 3PE4A 5LP1A 4DJ5X 1NRIA 2VF4X 3DP9A 3K72B 5DYYA 4IRXA 4EOGA 3U7HB 2BW0A 2WVGA 3EAQA 4KQJA 5U4QA 1HBJA 3N53A 1XXHB 3IR7A 2KPOA 4QLOA 3TGPA 2XUKA 4TYPA 4WMLA 3WBKA 3OU6A 3Q3GE 4H7KA 2W6OA 1E2NA 4CF6A 1RWVA 4A8TA 1W36B 3LKVA 1FUYB 3FHJA 2JC3A 3D8UA 3TRHA 1NP3A 2D2VA 2J5QA 4KDEA 4MEAA 4MUYA 2D2FA 4OAPA 4RD6A 4HH4A 5F7XA 4CXMA 1CKEA 5FR2A 4ID3A 2A9VA 1DE0A 2IVZA 2A30A 2IQ5A 5BSFA 2WUGA 3DFUA 1N6RA 4FZVA 3RBXA 1CZHA 2H31A 1BA3A 4KXNA 1XRJA 4LW8A 5LC1A 1P2UA 2WD8A 4PYKA 1TM3E 3B1WA 1QVRA 3AF0A 3CC8A 3QG5A 4JI3B 1CTQA 3K1ZA 4RWEA 3S3TA 1F1BA 1T91A 1DEOA 2N75A 2HU5A 3DR3A 3HUFA 4X93A 5FBWB 1YIAA 2YV4A 4TKVB 4ZJPA 2BJHA 2A0KA 2C84A 1TVKB 4R8RA 1J9EA 5CCEA 2FZVA 4JVLA 3BD7A 5LUAA 2FW6A 2COKA 3MCZA 3OIGA 2GAOA 4PC1A 3HXTA 2XRMA 2QRZA 4GSLA 4QXQA 1AGRA 1DAIA 1X0VA 4UJ5A 1RPJA 2FZCA 5LNK6 1Q0RA 4IMRA 4IH4A 4FI3C 3I32A 4GWLA 1A9XA 3OZUA 1E4OA 4F2DA 4YGYA 2R6ZA 1AKMA 2FQYA 3F74A 3P5BA 3CU5A 2A14A 1SG0A 4JWKA 4OTZA 1RWMA 4IKOA 2BV3A 1M2VA 5J23A 1E4EB 1ISIA 3CUUA 3QX9A 3IV6A 3TWOA 2AN4A 1WMAA 3TF5A 3VOTA 4EHBA 2F43A 3DDUA 3K73O 4OBBA 3REQB 4ENPA 2IXDA 4MRMB 2GAAA 2FW7A 1HPLA 2JIPA 1XZCA 1HT2E 3B20A 1X1DA 3EJ6A 3M7IA 4G2TA 1W581 2FHSA 5I7EA 3ZV5A 1NMYA 3Q1KA 1MJNA 3ORQA 5B3LA 3UK6A 5FPHA 1M1NA 1DO2A 2HMTA 2XMSA 3TLZA 2B36A 4QFDA 1BVHA 2XE8A 2OAQ1 1YMQA 4OH1A 3RC2A 1MZVA 2EW8A 2VBCA 2VRCA 3IVXA 3KWFA 4RKEA 3UATA 5IVHA 4F3CA 3LRPA 3TFOA 1CUHA 3UTCA 4QFBA 4TMYA 4C0XA 3NJRA 3V42A 1D2RA 2WYOA 1P9NA 3OG9A 1IHPA 2WF7A 3OKCA 3FHOA 3PHBE 4IIHA 5CYFA 4LWOA 4R01A 2O2YA 1DT5A 4U8GA 4CEIA 1PJ2A 2Z56A 3K4HA 3PNLA 1YRYE 5A6VA 1OGJA 1M73E 4H7FA 4HAIA 3A1NA 2AXPA 4PSAA 4GRAA 5AVSA 1GTRA 3MT9A 3E27A 3AUSA 3M6MD 2J7PA 1L5MA 1UIMA 3GPIA 3JQCA 1XCLA 3NEYA 4K9OA 1L4YA 1RPAA 2ACEA 3EVFA 5AXCA 3W6NA 2G8NA 4M60A 2JZCA 1LBQA 4KQ6A 4YUYA 3ZJVA 2MR6A 1CU1A 2E6UX 4BX9A 4RMJA 2OBFA 4XWWA 2EGGA 1I3NA 2Q3DA 1QLHA 4IHJF 3OPVA 4JLKA 3R8CA 4C3ZA 3QIVA 2FPOA 2XSZA 3RRNA 1T4BA 3QVUA 4Q3AA 4WN9B 1EUCA 3N0RA 3VNRA 4ALIA 3JQ9C 1EE9A 2K4MA 1N8NA 1SRRA 2XKAA 3OJXA 2FSUA 4NQRA 3TTUA 3HMKA 4EFLA 3K9WA 2NO0A 2BT4A 1XAJA 3U37A 1A2BA 3KZCA 2EZ8A 4G5OA 4YIHA 2BR4A 4E5VA 5M04A 1Z82A 1Z6AA 3A8TA 3CSDA 3OJLA 4B48A 4W7SA 3EIWA 1N57A 4M9XA 3KLPX 3QVGA 5BYJA 3U60B 2NZYA 1M3SA 5AT1A 3B85A 4H4DA 3EQ9A 5HGJA 1U4SA 2QS9A 3M6FA 1SUEA 4UDXX 3DBLA 4RLFA 4YO8A 4ZO9A 5F5XA 3WK4A 3C3WA 1T3TA 1BAPA 1L5SA 2X8JA 2ZBVA 3A9WA 4PQFA 3CZMA 3JVIA 4PNPA 3U7RA 2EG9A 3R5JA 2HXYA 4ZYXA 5MFZA 5CYOA 1HKHA 3SDBA 2FN3A 2ZP1A 2EF1A 4ROTA 5IBCA 1AKVA 2Q4OA 1YHZA 3MWEA 2FUCA 5A6SB 2YIJA 2YYAA 3WFIA 5K6AA 1FJGB 1HQYE 3PNVA 4UUOA 1VLMA 2QRUA 4M98A 2PQ6A 4YRGA 1ZEMA 4HH3C 4BNFA 1DWQA 3JAKA 4EF6A 4H1HA 1I4TD 2XQFA 1BRTA 1R6AA 1TD1A 1RHJA 1QYDA 3Q3JB 5AVZA 5FAXA 3TLBA 2PM8A 3G1UA 4WADA 3L0YA 2D62A 2OBXA 3BGWA 1FJ2A 5CB8A 3DZ8A 4C4OA 3LWDA 2A9FA 2NAFA 1VB5A 1R27A 2V3VA 5GZ3A 3KE8A 3NNSA 5B1YA 5DRYA 4JGBA 4QBIA 1VPWA 2NGRA 1U99A 2VPTA 2XOKD 1XFAA 2FRDA 3TTSA 4TLMB 3L01A 4GE0A 4QFMA 3KPJA 2OD2A 2I62A 1HNWB 2OC4A 2Q1SA 3AW8A 3RYHB 5B57C 5FBZA 2Z8YM 5F9MA 1DEXA 3O1IC 2FWIA 3FH0A 3G2PA 4C0HA 2AN1A 3L7OA 3DKRA 4QJBA 5JFOA 4CI9A 3JR7A 1ESZA 1G19A 2C92A 3HSYA 1JEDA 1FRFS 2AKAB 1TYCA 1CUVA 3Q6MA 1DCTA 3R3SA 4KPUB 3KZKA 3W5IA 3ROFA 1C1DA 2J59A 1Z0ZA 3V4RA 1RRMA 3JWIA 3ZBTA 3BAZA 2PVPA 1V47A 3IEVA 2PY6A 3P0IA 3IUSA 2OLJA 2R7KA 5D3QA 2Q4TA 1H9BA 2C5EA 4ABYA 2NZ2A 1ENZA 1WHTA 4YV0A 3OPYA 3GDFA 1U0GA 4KTVE 2YXPX 5DK6A 1DQPA 1IY8A 1OW3B 1KJZA 1USUA 2ZI3A 3RT9A 4HDCA 3TEFA 5T41A 1RWKA 1P75A 3FVTA 4XTRA 2GK4A 1YS4A 3TLAA 3OOJA 1E8DA 2NSDA 3WMGA 1DPFA 4JFAA 1RYNA 2ZU0C 4MV8A 3LA6A 5AOAA 3U3DA 3AHDA 1M1YA 4X20A 3N0XA 3Q11A 1NBOA 1E2LA 2LE0A 2O7VA 3H0EA 4JU9A 1RM4A 3SU8A 4BNNA 3BIOA 1Y9DA 3PQFA 2WWTA 2WAAA 2B8TA 1N5DA 4YP5A 4FLEA 3PT9A 3HKEA 1PDVA 1EP2B 4A0QA 3C8UA 3VC2A 4Q3OA 4I08A 1BCRB 1GQYA 2JGRA 3CN9A 1T9BA 3PPYA 4JQOA 3SYLA 1R4AA 2QL9A 3HXQA 1N5OX 4X3CA 2DY0A 2PRSA 4BRUA 3SP1A 3S4YA 4MNTA 1PWXA 5CEEA 3AXTA 2C20A 2WAYA 4CL8A 1W35A 3B1JA 3P4YA 3CUVA 3AFGA 2HA4A 1GFSA 1Z4PX 1SC9A 1Z2CA 3BRQA 3FHCB 3GW8A 1GIAA 3L6RA 3MB8A 4HWRA 5EIHA 3VISA 2ZI7A 3QFHA 3ZDRA 2X9NA 3HB1A 2R87A 1L3IA 5DSTA 2Q7DA 4G67A 5KTPA 4GKJB 3PE3A 4KIGA 2PMBA 1HETA 5DI3B 5B58T 1GTZA 3CKYA 3AHFA 4CNBA 1NW4A 4RW0A 2IF2A 1RQRA 5A0VA 5C2JB 3B5EA 3S0JA 2DCMA 1CCWA 4QXOA 3H0KA 3VPGA 1X3SA 1I4LD 1B4DA 3EZ7A 4GOMD 4DNOA 4EAQA 4BGUA 3QEOA 1PD0A 3E3MA 4F86A 3PNMA 2QRLA 5DM60 5KHLB 1CXZA 3EZXA 3RJZA 2X8LA 2CXOA 1VL1A 3F1KA 1D8TA 3ZW8A 1XKXA 3I01A 1KOJA 1XCOA 5ILQA 3VR1A 3AP3A 3B1ZA 1ANKA 3DE3X 2CVQA 1F8UA 3RBVA 2BMVA 3IILA 3BF8A 3F5MA 2D8MA 3DL2A 4DUGD 5E3IA 3TZ6A 3ZHTA 4KRXA 4PBTA 4RGYA 4QVGA 1HXHA 1VECA 3ESXA 4R84A 5FYQA 3M4NA 1YXMA 1ISRA 4HVTA 4ZCSA 1T25A 3IEUA 3RJ9A 4E33A 4G9BA 3Q12A 3H86A 2HA5A 2RGNC 3A0UA 2A5FA 4NXNB 2R8YA 4UUBA 1TUGA 2JASA 4E6EA 5I5GA 2IZ1A 2ZTMA 4X8HA 4FHFA 1HL3A 5HGXA 1E2EA 2E5LB 1M83A 4QE3A 1ZCBA 4INZA 4XYEA 2R84A 4KNVA 4EUNA 1X7XA 1XTZA 3N2GB 5GWXA 1SJ9A 1EUZA 1VZ3A 2E1RA 2HF2A 4GGMX 4UBNA 1ML4A 3X1JA 3PSHA 1MB4A 1SXJD 3DEFA 4Q34A 5A5VA 4J4HA 2JCXA 4QQKA 4RMGA 2XVYA 3DCJA 2G88A 5BN4B 1HORA 4JJAA 3E9RA 2QRPA 4QQNA 3EDMA 1SKYE 3L6DA 4X3PA 2OXIA 3VZDA 3AM4A 3FYHA 1T35A 4WDRA 3FX2A 2R0QC 3QI7A 5AW9A 1M1XB 3FTEA 5D86A 5AXDA 1U7TA 2A1TS 4J0DA 3SSNA 5LKAA 3RTCA 1N3BA 2CNWD 4CL0A 4Q3KA 5CX1B 1FFCA 2VJAA 5JVDA 3L9XA 5CLHA 4IO0A 4ND3A 3BWBA 5EKSA 4DLWA 5BOVA 1QZZA 4FOSA 3QLJA 3L7MA 2QD5A 4KLCA 3OSZA 4Z3KA 5JI3E 3DL7A 1R9NA 4HWPA 2OILA 3DVAA 3M0EA 4UTZA 2JIBA 2GPBA 2XE7A 5BV7A 1IN6A 1I4OA 1H6CA 2W4MA 2WJPA 4R9NA 4RSHA 4X71A 3SJZA 2BKEA 4KE9A 1Z33A 1ZU4A 3JYHA 4AJ1A 5M29A 2BTQA 1ESEA 3B6ZA 3UM9A 3U13A 4ATNA 5CFOA 4YDQA 3DD5A 3NWBA 3DMTA 5I9LA 4ZI2A 1UKVY 3IQIX 1TZJA 1U31A 4WNIA 4DW8A 1C7RA 4JBHA 2O52A 5I7SA 2J6IA 1Z0FA 2AQIA 2D5AA 1WTCA 3PKIA 1YI1A 4UBLA 5TSDA 4BVFA 1W7AA 2I54A 2W2VA 3I72A 2VNAA 3ABSB 3KQYA 4LVOA 4YJ3B 5UKDA 3A4MA 3PDUA 3T41A 2OZVA 5K3FB 2UYQA 4HS9A 3V7YA 3ZNPA 2W6MA 5HJ7A 5IHXA 4OLFA 5IM4A 1U2DC 5B7QA 2AFVA 3QX7A 5CT6A 5D2CA 2TMGA 1PK8A 1IJFA 4GECA 1E5VA 2D0DA 2B0JA 1XLTC 3CUTA 4MCAA 5KJFA 3LBNA 4PCAA 1W5BA 3ZW9A 1I2CA 2HWKA 2P9TA 4O2BB 4X97A 2I2XB 3N7AA 4U5XA 1HDOA 2CEKA 1GITA 1ZD9A 3VDQA 4CT4B 3FCOA 3GRUA 1U0BB 3ETLA 2OV8A 3PTLA 4CMEC 4BNDB 1SULA 2OFFA 4KUEA 1PJTA 3UHJA 4E32A 5LOVF 5EZYA 1T8RA 5C18A 3GLFA 4WK0B 5EE1A 1ADCA 4BEBA 4TYYA 2NTEA 2XOKA 4QGAA 2QUHA 3EHDA 4GDMA 4QNNA 3UWMA 1IZ9A 1R8SA 4AO8A 2QAJA 4HLUC 4CMKA 3RM3A 5F4BA 5TXGA 2PAFA 2CHUA 4KE6A 1WABA 1KZYC 2NLOA 3O8RA 4B47A 3NBAA 1ULSA 4NLLA 4E15A 2Q5EA 3I0ZA 3Q87B 4OYRA 1H6DA 1LVGA 3WRVA 2CF6A 2GAFA 1UBKS 3PEEA 5D6NA 3U3JA 2AXNA 2F1JA 1YR6A 4LY3A 2RHJA 2OEPA 3P0FA 3U7FB 2EWWA 5GINE 1S96A 2ZJ8A 1VJDA 1HDZA 1B76A 2REOA 3CRVA 2NPFA 1PR3A 1QE5A 1NWCA 2QM3A 3A4YA 4YV2A 1J8MF 3FYTA 4YJ3F 4G86A 5TGZA 2IJGX 3SQOA 3D4PA 5H5JA 1YQWA 3X2FA 3GUYA 4RZUA 3P9NA 3GQBA 4J0EA 1UOPA 4ZU1X 3DYIA 1AZWA 1P5RA 4PXSA 3X44A 2OHHA 3ZHZA 2RK6A 2XA9A 3ZD7A 2ZIFA 4DKJA 2JGDA 5ESWA 5DULA 3K70D 3MHPA 3T99A 1V26A 4CLRA 4XYGA 3ZY3A 1Y9JA 4IIXA 4JVNA 4PXAA 1XLVA 1KZ9A 3EXHC 2MR5A 3PVCA 2QE7D 3HFJA 5DHPA 4KWEA 1FVHA 3HLKA 3TDMA 3HHEA 3ZUGA 5KS2A 1P2BA 4HVLA 5BVHB 4JI2B 1EG7A 1Z16A 3I37X 2WJIA 3PC6A 1IXKA 3ST7A 4OLAA 2A9OA 4RF5A 1JH8A 2NYRA 3ZY6A 4A8PA 4QD3A 4ABTA 1HDIA 4NJEB 4XXHA 4BO0A 4KBFA 4ZT2A 5D7BA 4DV1B 1OX6A 2QMYA 4NBKA 4PTLA 1G21B 1AV7A 3NHWA 3RWBA 5CK5A 4MR7B 2JLYA 2PV7A 4NZMA 2B37A 2BL4A 2ZJ5A 3AP2A 4HBZA 3KPWA 4OX9B 1BX1A 1JHRA 1R74A 1CS0A 4BN0A 1FCJA 1T8SA 1C3OB 3ZWBA 3DQZA 1JW9B 1S0UA 3ZVMA 2REQA 1LC0A 2VEDA 4MTLA 2Q3BA 1YNSA 2QTWB 1P6XA 1RAAA 4FMDB 1YUBA 1XTIA 2ZXEA 3KBOA 2NXCA 4V0RA 1M8GA 5AVWA 1CRLA 2C8VA 1NDUA 4YUWA 3AR8A 2OK8A 3BBPA 1U7XA 1JHVA 3AG6A 3HRIA 4TV9A 3B48A 1Y1QA 3W77A 1GSHA 2XH8A 2J6HA 1DAHA 4KOAA 3R75A 1XNRB 1X1RA 1EK1A 1JXAA 1XD9A 2ZUBA 4IZHA 3AI1A 2K2WA 1LTQA 1NJSA 4CDRA 2BGIA 4EG7A 3TRIA 1SD1A 1Z8HA 4ZT5A 1OWLA 1P9OA 3CURA 3H2SA 2Q3MA 1O08A 3LUGA 2W2XA 3O4GA 4H6VA 3T9DA 3MTBA 3PEUA 4O4LB 3W6OA 2CFOA 4B46A 4C88A 2OFPA 4YRQA 4E5UA 1YACA 4D3SA 2O3QA 2XECA 2FOLA 4DABA 2JVIA 1UDXA 3AESA 3MWDA 5C80A 1BE1A 1KIAA 1QFXA 1RXUA 3TUIC 3JYPA 3ZQ6A 1T5SA 4DIEA 2B98A 3THXB 1HKUA 1QYVA 3LF1A 4RIFA 4D9HA 5BOSB 4CLXA 4E4YA 5K0FA 1FLVA 1MEEA 1UEXC 2WTAA 3L84A 2ZYDA 3MMPA 3WNQA 1T5IA 4KXXA 4LJLA 1GGVA 1V5IA 4EG4A 1M1YE 1VIAA 3IT0A 3DCIA 4UNPA 2F1RA 5IBRA 4TS9A 1KF0A 4XVHA 1KE1A 1ZN2A 2JCVA 4BRZA 4CMJA 3TCNA 1M8PA 1NVMB 1SXJA 1J22A 1NRWA 2EKPA 2NSJA 2R00C 2WD7A 4X6XA 4IHAA 3RC8A 3RFFA 2BC9A 2PU5A 3I04M 1V5WA 1H8ED 1AY0A 5DIZA 3UMFA 4ENSA 1Q5PA 4LZAA 5DXFA 1QTRA 2GYUA 2I6FA 2WT4A 1J39A 4O0LA 4NMHA 1ZITA 1TQHA 2ZI9A 5J63A 1L5KA 2QA5A 3E4DA 2AZ4A 2RCYA 4UXIA 5ITZA 4GZ3A 5IARA 5JNLA 5IDXA 4FMDF 4FW9A 1W36D 4YB8A 3K0BA 2CNWA 2XE4A 3LT4A 4J16A 1NSYA 4R7ZA 4UUPA 5FBLB 2LCQA 3ZNQA 1J5EB 1E7YA 1AN0A 5F5LA 1PFYA 4B4DA 4K7JA 5EIBC 2BFCA 4ZYYA 5AVTA 5TMEA 1LI7A 5EUBA 1WSDA 4R7TA 4N7JA 4QEDA 2GM5A 5KREA 2ZM6B 1CRQA 1W9HA 3FWYA 1WW2A 2ONJA 1QRSA 1K7FB 2CDRA 3AOGA 1CR0A 1QS0A 4JC5A 2I7DA 5AW4A 5KKCA 1SUAA 1N2IA 1XWFA 3CTMA 4MKGA 1A9QA 1B8UA 4JFRA 1ZM2A 3L5KA 2GZHA 1XTRA 1ZH6A 3PXAA 3DZBA 4LYFA 4TQUS 4FGLA 4AKHA 2H4WA 3X2EA 2QQEA 4WXEA 1RYFA 3AJ8A 3UAGA 1GLNA 1FYEA 1OASA 5A1TA 3LQYA 2G36A 3KNZA 4WOJA 1KWKA 2ZT8A 4LE1A 4Z4EA 3NYRA 2WBLC 3VTAA 5T8KA 3HVIA 4BAUA 3JTEA 2X0DA 3M3DA 3M83A 3RW9A 3SNKA 3RI3A 5H70A 4WLOA 1JLHA 1ENPA 2AK2A 3HDGA 5T4EA 4NBRA 3U49A 1ZOLA 1TT5A 4YMSA 1WMFA 3DC7A 3DTTA 4KVZA 4FMBB 3M4ZA 3CNNA 3I52A 2HADA 2Q9AA 2XY4A 3N6VA 1UP6A 2ACKA 4FYXA 2I3AA 4F6RA 3ZGZA 5AESA 2FFJA 3OZVA 4N9QA 2MWMA 1DI0A 3RCBA 1IFXA 1PEAA 2YJTD 1WLSA 3HEBA 4S2UA 4DV2B 2YCBA 4DR4B 1QDLB 3GJ6A 3ZE9A 3LC0A 2GS9A 3MJSA 3UMVA 4HAOA 1I2DA 3NNDA 3IQEA 5ERYA 4GPTA 5DP2A 5IU6A 2XTMA 3C48A 5E6UB 5FUYA 5BQOA 3NRBA 1F6DA 4ZALA 1HYQA 4FOLA 2PFKA 2NZVG 4UOEA 2BBTA 3OOEA 4E5PA 2XDYA 4BVAA 3TFWA 5KYXB 1KFEB 5ED0A 4A16A 5E9AA 4U63A 1AB5A 3ES9A 2V7PA 4E22A 1WQ3A 1GEEA 1ZBDA 3GL9A 3RGGA 3ORSA 3V8BA 3W9YA 3S55A 2BPOA 2WWIA 5AK0A 3VNUA 5FB3A 3GROA 2WHPA 2VKTA 3ROZA 3U44A 2VSFA 4HJRA 4LYDA 3T1VA 1GYPA 4X7PA 4IBOA 4JZYA 2CLIB 1PGOA 1MB2A 1K4KA 3O03A 3O47A 4ZOEA 2WNIA 2FZGA 1GZSA 3PCRB 4N0DA 2QHXA 5G4KB 4AJHA 2WQ7A 1R0RE 1XVLA 3EZGA 4WOCA 3MK31 1AHIA 4GX2A 3RS3A 4WESB 3OWHA 4GQBA 3T35A 3C8MA 2FDRA 4U7FA 3FPCA 4M0FA 1DC8A 4NP6A 5J59A 3TW8B 3WK8A 3WSWA 3KEMA 1AZTA 3A11A 1AS2A 3GOHA 2G1UA 1C9YA 1JU3A 3NKFA 4O33A 3FVRA 4WJLA 3U4HA 2Z5VA 1DQRA 2JLQA 2AMJA 3OETA 4B2LA 1O0CA 3GHYA 3GLUA 4HPJB 5TJHA 2H2FA 3FKSA 1IHXA 4NBUA 5JD5A 4UQOA 5C1IA 4ZZ0A 4K0KB 3EC2A 4YRSA 4RPHA 3BG5A 1OREA 1P0PA 3UH1A 3UTDA 3AM5A 3AHGA 4B3XA 4P33A 4G8JA 1QP8A 3OQPA 3NDIA 4LXHA 2SICE 1JDTA 1YB6A 2Y9PB 4X91A 2C4UA 1JDBB 4GSYA 4WJZA 5CUQA 1R0KA 4FN4A 1P1RA 4EHIA 3QOXA 3TQQA 2XMZA 3H6GA 3IBFA 3PG5A 1E18A 3JSAA 4MVXA 5KCZA 1WUKS 1NLZA 1EWTA 2Y8EA 4OD0A 5CW1A 4DDKA 4I50F 1S8AA 5JAIA 5IXYA 5JEEA 4M46A 4R8LA 4Y2RA 4D45A 4I4CA 1DJNA 4MWBA 4P08A 3OZTA 5EQFA 1KDYA 4PLYA 2Y0CA 1TQ4A 2RGYA 3R4CA 4C3VA 3QEMA 1J5XA 5JANA 4R71A 3EA5A 2C1EA 3AIOA 4JB3A 4B6FA 2FSVA 2FMHA 4D99A 2YDXA 1KFKB 1XP5A 2ONCA 3H19A 2QW0X 4P4TA 1XQWA 4QVKA 2WJZB 3EHEA 2DQZA 5F21A 3I28A 5FRDA 3K2EA 1PU2A 1THZA 2E7ZA 2RBKA 2GEUA 3QVTA 3LUPA 3OQ1A 1WBJB 1F8FA 1UXKA 2XQVA 3LT0A 3O9ZA 4WPGA 4ZVVA 5AO9A 4GAEA 5HFJA 1N0IA 4TT3D 4D4HA 2XCSB 2Q9BA 4EG8A 2P1RA 4PG6A 5IX8A 1FTNA 2WFLA 1VG9B 3AY0A 4WOBA 4X6LA 4BVGA 3G6WA 5DX8A 1CS4C 2AJTA 2GPNA 2OBBA 2OUIA 1BQ4A 4A3SA 1PAUA 1VPDA 5DOZA 4KGVA 3R7DA 2RH5A 3EVGA 5EJ6A 2QMHA 3ULKA 1MD9A 3LC2O 2ZBUA 2HSEA 4KRYA 5DWVA 4Q21A 1T9HA 1E9DA 1XCBA 3NYQA 4DEVA 4LOLA 4MROA 4IMIB 2ATCA 1XD8A 4V3BA 3K94A 1BXRA 1T9CA 1XT6A 3Q9NA 4I5GA 1G3MA 5KNDA 2GM4A 2WP0A 1EIZA 4NJMB 2AMYA 1TA9A 4FMPA 1JHYA 2AE1A 5DM70 1YIOA 1KZ6A 3CUSA 1TU4A 2HQSA 4TSFD 1N77A 4UAJA 3IQFA 1NE2A 4TTRA 5DIFA 1RE0A 1NAIA 4IDDA 3ACDA 1C8KA 3CF4G 2C4TA 1H8EA 5C3MA 2DRIA 1LS1A 4R3NA 3CRNA 2ICAA 2ZE6A 4BZXA 3T4XA 3N5CA 3BGOS 4G89A 1VRVA 1BRMA 2PUHA 4BRSA 1DPGA 3ZE7A 1IONA 5ISMA 4MV9A 4TM8A 3ZS9A 3ZX5A 3OQMA 3W8EA 3AYXB 1Z8NA 3O3NB 3VYSB 1U3UA 5AW1A 2ZUFA 3HL4A 1L5YA 1SWWA 2IHJA 2FUG6 2FFRA 1JJFA 2BFAA 1G3RA 1N5RA 4GXQA 3AIKA 1KEEB 1KI6B 1SVWA 1E9VA 1KMNA 2UVPB 3S68A 4C03A 4FILA 1E9FA 3H3JA 5K20A 1P81A 2C5HA 2QTAA 1KETA 5H3CA 5E0KB 3R7WB 3UAYA 1LQTA 2FP4B 4IDQA 1K5GA 1ZM3A 1OZ0A 1UJ6A 2CFCA 1E6WA 1XMJA 5J1TB 1ICIA 4WY8A 2VHCA 3I8OA 1UUFA 1R37A 3HV0A 4TKVA 1E79D 1LDMA 1SEPA 1VDMA 2O0JA 1TVKA 3BK1A 3G5UA 4AAYA 4C7BA 3HZRA 3IAS1 3DKIA 3OQOA 4KOEC 1GPDG 3MC1A 2OVFA 1ESNA 4A15A 5EXEA 3FD8A 2UZIR 2GO1A 2TMKA 1FW8A 1T29A 3CNLA 2QL5A 5IP5A 1K68A 3OZIA 3R9IA 4BNJA 4BVKA 2P5SA 4OJKA 1PR5A 2P79A 5AVQA 1FNNA 4JR0A 2R8OA 4Q12A 1YDMA 5BV1A 1NUUA 3L05A 4Q05A 2ZSAA 1XNJA 2BAGA 1E4EA 1U7WA 5COQA 1J8DA 2PSHA 2R6CA 1P2GA 4ITVA 2AIRA 1XHLA 5YASA 1Z6TA 1QB7A 2I55A 5FV7A 3QBEA 3ICOA 5H68A 1VHDA 3KAPA 3REQA 2HLDA 4MRMA 3BDIA 2GCPA 3P2YA 3ZEIA 1A7JA 1XQ9A 1A96A 2CVFA 2LWIA 5DDIP 1OFGA 1MG5A 3ZVKA 3DPSA 2IYFA 3ZEAA 3KZNA 2EJVA 2EBWA 1TU0A 2PX8A 3WIOA 3PQEA 4LXGA 4PLCA 2DTDA 1C0KA 1DKUA 1LK7A 1IK4A 2QMQA 1QPBA 3K92A 4QPJC 1XA4A 3R20A 3U7JA 2FYTA 1QMPA 2B5VA 3OCWA 5FA8A 1JDNA 3M6AA 1C7FA 1LXCA 5ENZA 1JUDA 3U7IA 2WU8A 1S2MA 3TNJA 3TQCA 1NU6A 3AEQA 2B4YA 2VPWA 3ESBA 5CFZA 2Q6LA 3VNQA 3ZG6A 3KQUA 3TLJA 1GARA 2Y0EA 4JP8A 3WIEA 2X5OA 1EXDA 2CXPA 1UXHA 3ZXYA 3ONFA 2G06A 2DR0A 1KYVA 1T0PA 2VTEA 5AW7A 1K8XB 3FUCA 3RVSA 2PO5A 3U1TA 5I9TA 4RPKA 4O4HA 2YV1A 3P9YA 3T3GA 1X7DA 4X24A 2WHXA 3WC4A 4XVRA 1PYGA 3W5HA 3NPMA 1S2GA 2ZBQA 4XFDA 4P31A 621PA 2ZIXB 3JWHA 2EKZA 1RC1A 5HUQA 4KR3A 2SHKA 4LOAA 5ILOA 2QNBA 3VR3A 1TADA 4TTAA 4MW9A 2IP1A 4XUDA 4LIPD 3WKCA 5BNWA 2I4RA 1M0TA 4A8HA 5F7JA 3DDHA 1PUXA 3R3WA 4W5HA 2CFSA 4OVKA 5KYNA 3F4BA 3K9NA 2R5NA 3P0RA 2O0LA 3DOEA 3C85A 4R1MA 1BJTA 1E61A 2YXEA 5JAUA 1K66A 1U0TA 4F2GA 1PQYA 1FDUA 1FTWA 3ANYB 3CLKA 5I7HA 3FFAA 1VHTA 1J0AA 1YGPA 2XNKA 3PQ5A 2J45A 5EP2A 5IM5A 3ZIDA 5LXTB 4YIKA 1XMXA 2P3OA 3H6KA 1KMQA 1ORTA 3NALA 2ODWA 3OFJA 3DZDA 3OCCA 4E51A 3QE2A 3FXAA 4C05A 4JROA 1CEXA 3LQFA 3L7CA 4FHDA 1MMFB 2FR8A 5BSRA 4CKXA 3FMGA 5D3KA 3LKBA 1K86A 4IUCS 5B6JA 5IZ4A 1JVSA 4GVPA 1Y80A 4JEIA 5DX0A 3QNWA 5DTIA 4ZOQI 3HRHA 4EAAA 3R9WA 1G55A 3HJUA 2YBEA 3TQSA 3NV9A 3ONEA 1RMTA 1NZDA 1VCOA 1TLLA 2PBZA 1FNCA 2QUAA 3A27A 4LRWA 4TYQA 4J3NA 8AT1A 5HOQA 1QO7A 1Y1SA 4IV8A 4DA6A 3TN7A 5A6SA 3IP7A 1RQXA 4L9SA 5IASA 2PKXA 1DC3A 1T4CA 3OQHA 1NFQA 4MHOA 3TQOA 4Z1OA 2OAGA 4IQ4A 2GKGA 3TH5A 3S2FA 2DQYA 4RLSA 1RLJA 2Q4BA 3CT6A 4FZRA 4U0KA 2BMFA 5ALUA 1L1FA 1BJKA 4PYQA 4AKGA 2W37A 3FYCA 4WY5A 3OCVA 3AY6A 2I6XA 4PYIA 4RQTA 2NAPA 4F1KA 4G0WA 4BVBA 3HL0A 5CM2Z 4RIGA 2QRQA 1SC6A 3EDCA 3PC4A 1I9GA 4H6XA 3PXUA 1JEOA 2P4SA 4Y7CA 3MIZA 5EE0A 3HCOA 1CZLA 1UBSB 1TFRA 2IU3A 3H4MA 1BIFA 4MYHA 5ALFA 4BC1A 2QJFA 5K09A 3BFKA 3WHIA 2I7XA 1JI0A 3IE2A 4GOXA 4PG4A 3D64A 4EW6A 1AG9A 1E0DA 2D2XA 2GZDA 2XVMA 1WMSA 3OMWA 4KI0A 3RYHA 3DT6A 3U3KA 3TBFA 2O1XA 1K0FA 3FTDA 4P7FA 1N92A 4HRAA 4UVIA 1P1KA 3WX0A 1A4UA 5JCPA 1FIUA 4JKIA 4AMGA 5E1BA 1HOTA 3FUUA 1AT1A 4MDHA 2VPXA 1V3UA 3QEBZ 1NWHA 1RIFA 3R3JA 3BXHA 2IV2X 2YZMA 4C4RA 2PKQP 1EPUA 2XLCA 3Q9SA 4OIMA 2VOJA 4MUBA 1XR3A 2KS6A 1VTKA 2FMUA 1NM5A 4KPUA 4KPGA 1JALA 4LHEA 4LMBA 1PJ4A 3B38A 5B58C 2OORA 4B3DA 2R7NA 5FFNA 1GLVA 2ARKA 4F91B 4PINA 5JADA 1UM9B 1IN5A 3VBEA 1RQPA 2VF2A 5TPZD 2HV8A 1K3FA 5J40A 1E3IA 2ZVJA 1Z3IX 5I7RA 1G8MA 2UUAB 4LXXA 2FTKE 1ZLXA 2AEJA 4NOLA 4CM6A 5KZMB 1EBFA 2AFIB 1ADBA 2I1VB 2LRHA 3A9CA 3GRAA 4IVNA 2I33A 2LW7A 4LPKA 1W46A 4ARBA 2XT6A 1EQ2A 5EOVA 2CF5A 3BGDA 3F7NA 4IDGA 3AV0B 4K9NA 2VT7A 3U5TA 1Z4NA 2PX4A 1YA8A 3K1AB 2R6GA 1UWVA 2F4NA 1AGPA 2GJ9A 2YMPA 2O14A 1KEPA 1KIFA 2J3KA 1SXHA 2D1YA 1U65A 1Y3HA 2UVDA 2ZYVX 2B1JA 1QKKA 3PEVA 1YB2A 3O9VA 4C2AA 3DEIA 1SCUB 1BCRA 3HCCA 4XFKA 1EGQA 3CLVA 4O08A 5AKEA 3ZWAA 4WTOA 4EJ0A 4J1SA 2CUZA 4GLOA 1E79A 4JI6B 2JF0A 4BCCA 2FQWA 2QMUA 3AFMA 5HVNA 4EVRA 3IIKA 1IZ8A 2FN4A 1JHMA 2ENUA 4QU9A 4RPJA 4AJKA 5A4DA 5J43A 3K70C 1WB6A 4HAXA 5JJBA 4R8SA 1BHQ1 1CG6A 2GUGA 3B3AA 2MYPA 4INOA 4LC0A 5MN5A 2BGWA 2H9YA 1B6TA 4QOFA 3L8ZA 1PWHA 4Y2JA 4K9MA 4D9FA 4E2FA 2X0KA 3OPYI 2BTEA 3FZNA 4QGGA 5E9QA 2BM8A 4L22A 4F9FA 4DIDA 3IOEA 1YOVB 2O7NA 5JS6A 3BDAA 5ALWA 2PUFA 3OM8A 1GV1A 1J09A 1AQ6A 2WMNB 1Z4JA 3HLYA 4L4UA 4PO9A 1A9SA 4X6UA 3G8BA 5M5BA 3PUKA 3EIFA 5AKJA 1G16A 2Q8QA 4U00A 4M86A 5B1EA 5IEJA 5JUWA 1M2WA 4DLKA 2GCGA 3GCGA 1R4MB 1NXQA 1HDRA 2RHDA 3D0RA 3I9V1 5AI9A 5D5PA 5HF8A 4D98A 2ZQYA 1ZDMA 2ODBA 2VK4A 3GYBA 3TCKA 2D59A 3UUGA 3VDMA 4DJAA 2Q5QA 2QZZA 4QPPA 3AEKB 1HTBA 3NT2A 3G9UA 1ONSA 1E4VA 3WY9A 1R5OA 1NLFA 4G5SA 5AXBA 4OKNA 4DN6A 1CUBA 4U6SA 1KEWA 3T5DA 3WB9A 3IB3A 2BISA 1VLZA 1J7JA 3A3PA 5JDCA 4IJ5A 2OHIA 3FWZA 2C83A 2OG1A 4EUFA 4F4HA 1U2RA 4MV1A 3VPSA 2EFEB 4GKKB 1MC4A 3OECA 2LGJA 4I2VA 4MW6A 1HE1C 2IIPA 4U7GA 2HJSA 3PIRA 1T2FA 2DLNA 521PA 2C5SA 1PL8A 3U6KA 1MIHA 3TLKA 3P9KA 2VK1A 2JJ8A 3EPRA 3N2GA 2WU4A 1R0LA 2JAQA 2DWOA 4XIJA 5J3JA 1AJEA 1Q0PA 1E7WA 2A7QA 4YACA 5MDHA 1YC5A 2BMEA 5FF9A 5BN4A 4EJ2A 3NVMB 4L4ZA 1LTHR 1GZ5A 3WIBA 3O92A 3HYLA 4WXPA 2B34A 4A36A 1XVIA 2X8AA 1UPCA 2E89A 1FYVA 2PGNA 3GVCA 3GGJA 4D8YA 2Z9CA 1EVEA 3PNOA 2YOGA 3KQVA 1VJ1A 1NURA 4RKWA 3HJHA 4TGLA 4KLNA 5CX1A 4X63A 1H66A 4CG0A 4GP6A 1YVRA 2O3SA 4UU8A 3VKHA 3C87A 2UYGA 1D6JA 3HQ4O 1K8ZB 1KI2A 1M2EA 3WLAA 1YQEA 2HNKA 5BYBA 3WL8A 3GCZA 4HFRA 4I4IA 4ZWNA 2VNSA 5FT9A 2CMHA 3DTYA 4GO1A 1W88B 2H1WA 1UINA 2OOKA 4ZVPA 3H5NA 3BMCB 1ZICA 3LYLA 4WNCA 2OQ2A 2PS3A 4LPSA 1SXPA 3Q3VA 1OJLA 1JT2A 3OF5A 4HAUA 4P5PA 3WQQA 4D8XA 5JNRA 4LF5B 1REQA 2WINI 2WYWA 4BP9A 1NI4A 5BSUA 4OB6A 4EB6B 5JCOC 2JANA 4TN5A 1EVKA 4KITB 2WB4A 5LZ5A 4PG7A 1QR2A 5J2UB 3O5AA 3U3MA 3SZGA 3V3KA 1DQSA 1II9A 1SMKA 2GZ3A 1LQUA 4M55A 3KKOA 4JBLA 3R3YA 4PAWA 5HMMA 4AKSA 4DTIA 1LK0A 1UPXA 4GI3A 3HXMA 3ZZNA 4FYHA 1JAHA 1R50A 3CMMA 3GH1A 4EF4A 4TXNA 3OY2A 3B2NA 5BV2P 3N75A 1OYOA 4R7GA 2X5KO 3LYUA 1VM6A 1SVMA 4F21A 1YTUA 3KWMA 3DYBA 3R9XB 1GM5A 4O2BA 3UT5B 5IT9A 1V39A 3GLHB 5CVJA 4O02B 2F8TA 1EK5A 2PFSA 3OF3A 4JI1B 5HZKA 5CPBA 2L17A 2ES4A 1N2SA 3C2QA 3ZUPA 1YE8A 4KC0A 4B35A 2ZJYA 5MFPA 1VCIA 3VTZA 1A9TA 4KIJA 2YV3A 5AW2A 3MEQA 1FS5A 4A27A 4F9EA 3IURA 4FR0A 4EUSA 4ZXPA 4DQVA 3BH7A 4C0LA 1ACLA 2V74B 5BUQA 3IVAA 2E37A 1X2EA 4KPEC 4HWTA 3AV3A 2ZIVB 4GZLA 2PJDA 4B73A 4CV2A 2ZCUA 1D2MA 3AINA 3D3NA 3I2YX 3OZCA 4GMDA 4BNGA 4DDHA 1GTSA 1J0CA 1J6UA 2XMDA 3A9TA 3ABOB 3AUYA 4LQ4A 3N2EA 4WBSA 3SLKA 4YAGA 2R8XA 4ALNA 4ZI7B 2HK6A 2IU6A 4Z2YA 3GA0A 4YDHB 5KPJA 2A2ZA 3A2MA 3SZOA 1T2VA 1TMGE 3AVTA 2ZVPX 4XYLA 1E6CA 2D5LA 1DLJA 2Q62A 1AUPA 4OXKA 1UEIA 1XN4A 3ZTTA 5ELLA 4C4XA 4H7IA 1R10A 1OBOA 4IINA 3EEQA 5E3JA 5BRAA 4MUHA 2W93A 3ORRA 4WECA 2K2QB 3OOSA 3W9BA 1FZTA 4TV8B 1YSCA 2HLNA 2ONZA 4LF6B 2VHEA 1KSJA 3C8HA 4BDSA 4QUJA 5TPZA 1SVNA 4LGVA 4Y1EA 3GAAA 5H4GA 2ECQA 1U3GA 1QX3A 2NUPB 3EFEA 3GUVA 4YRZA 2CEAA 1MDBA 3R24A 2GEDA 4PQEA 1H1DA 1V9LA 4L85A 2A4KA 2QR5A 2IZ5A 3CY6A 2X2OA 3IUPA 3MM4A 4PX5A 4OGLA 3WE7A 1K7CA 2C3UA 1BMTA 1WPRA 4KGZA 4PLPA 1ZGGA 2YXNA 3NHSA 5KSYA 4YVFA 3NIFB 2QLJA 5K5EA 1I10A 1GPAA 5BVHA 2ZIZA 4EI7A 1IBRA 1YS6A 2PQ0A 4EJ6A 1JTEA 3DL4A 2FPMA 5LQSA 4BO8A 3E9YA 4J7XA 1OJ7A 1L7PA 1QYIA 3DHYA 2ZGVA 3GFPA 1R8JA 3CEAA 3E35A 1FPQA 3OZRA 1RKXA 4NJEA 4RZXA 1E2DA 3HFGA 5C34B 4DM3A 1UF9A 4H0NA 3PBKA 1G21A 1YCFA 1R6BX 1L9KA 2F9MA 4NDNE 4M1QA 1T9ZA 1NW8A 4MR7A 4F6CA 2F64A 4Z7NB 2UUCB 3PKZA 3SG0A 4LYAA 1EB9A 4AJEA 3WS7A 1E3EA 1HT3A 3DMRA 3HP4A 2R8RA 4MQBA 3WRWA 3G89A 5BR4A 1AQIA 1I2ZA 3R7NA 3LVQE 2YWJA 3O2JA 5A3QA 5KTMA 3KE9A 4LG1A 1LVHA 4GLBA 1HRKA 2OD7A 4CTJA 2VAMA 4L16A 1KJYA 2Z1MA 2GM3A 3IAFA 1JIVA 2V65A 1NYQA 3OPMA 5E9JA 3ZTWA 3IV9A 2X14A 2RBEA 5DZSA 3ZQJA 4B6RA 1XZ8A 4GNRA 4C6RA 5JI2E 1Q7EA 3GGPA 1EUYA 2X5NA 5EHNA 2KB0A 3V1MA 1F3OA 1ZOPA 2R96A 4DCNA 2IV7A 1J07A 2QL7A 2IDMA 2ODQA 2EQBA 2G9RA 3DOCA 3NTUA 4IUYA 3VTFA 1XC7A 3RHFA 1OKKA 1PFGA 4PCVA 3R74A 3FDXA 2WUFA 1HDCA 2QX9A 1N0HA 1YZUA 2O50A 2OGUA 2WIFA 1X0XA 3E22B 1ZOSA 4FWIB 4KQ1A 2O8DB 1HMYA 4UZEA 4BNLA 2YN2A 4J0FA 4O4LA 2YMLA 3DFKA 2CJFA 2FW9A 3NYWA 3N9IA 2PXHA 3WGZA 3QEKA 4KDCA 2LIVA 4GPBA 3S2GA 2DJ5A 5KMGB 2O1WA 2HYIC 3AB7A 1K8RA 4QARA 4NU0A 3THXA 5THQA 5BOSA 5JJIA 1F5NA 2E4WA 1VMEA 1P3DA 1LLCA 4PC3A 1SUPA 4NRDA 2ZSEA 4RA6B 2Q1WA 3QSGA 4IQ0A 3BX1A 2X0RA 1Z38A 2YYSA 5FFFA 4QO8A 1X80B 1SU7A 1DG1G 5ABPA 3NHBA 1TCAA 3GXOA 4JNCA 3JTMA 4OBEA 3KHTA 4LBYA 3V4OA 2HU2A 2XBMA 5KSPA 3U4DA 3VU0A 3ABZA 3IQWA 2RJ3A 3E18A 1BE0A 2JPDA 5AHRA 4OO3A 4MW2A 4UTNA 4RL4A 1R2QA 2RARA 5JHHB 2MOKA 1PWYE 4FMCF 1XXLA 4FGZA 1TCCA 1G41A 4O4IA 1LF5A 1GQRA 2IOQA 4ZU6X 1EDDA 3K31A 2PEZA 6PFKA 4P82A 2X4GA 4WFIA 1YQDA 4DMRA 3IB6A 2VWHA 4PIMA 3QQPA 4CI0B 3MT8A 1EEHA 1B0ZA 2JW5A 4KTTE 1YMVA 1E59A 4INJA 4E31A 1W59A 1RIIA 1YQUA 3NHPA 3WLLA 4BXOB 1MNQA 4V2UA 4YT8A 3VOAA 3VZQA 1IN4A 4MAFA 4U02A 1DB3A 2ZJFA 4KUGA 3WKBA 2X3FA 3JR3A 5IK2D 3FCUB 1E1YA 1SKQA 1SCDA 3GVXA 1W44A 5I9NA 2KE5A 1J49A 1GYQA 4DVGA 2IT1A 5LDDC 2G1KA 2YUIA 4G1MB 4LOKA 3VR6H 5KOYA 1IG3A 5JV5A 1LNQA 1T3HA 2CXQA 3GQVA 4XEUA 3UHAA 3C39A 4FCWA 1ADJA 4QPNA 3JYLA 4DMFA 3BHJA 2J48A 5JR3A 3PDCA 1LWOA 2FW0A 3OX4A 4NU8X 4W6ZA 4BEJA 2FHPA 4D9NA 4E07A 4KO8A 4MUNA 4XUCA 1PT7A 5A2QA 4TN1A 3UT6A 4CM7A 3FGOA 1ZKMA 3BSFA 2GXSA 3T1QA 1Z15A 4H08A 1YNOA 2FWAA 2RGEA 4RVOA 3X1XA 1NVFA 1EFKA 1PGQA 3ZHOA 3RLIA 3RSQA 2Q1UA 1IEVA 3U39A 4EFKA 3Q8MA 4XWYA 3D4NA 2JFZA 2GBGA 1DTWB 2PIDA 3B7WA 3C24A 3HN7A 3KEGA 4CEHB 4BP3A 1WUJS 1F12A 4LE0A 2Y1KA 4MO9A 4YMIA 3BM5A 2P4EA 4NBWA 4E2WA 2QD1A 4MLPA 1EGAA 2OXRA 5MN6A 4MW7A 4K2AA 5K9ZA 3PGJA 3PI7A 3PUJA 4KKVA 3I2GA 3ZU4A 3HCBA 3H5OA 1EFPB 2VUIB 1JR3D 4E7PA 3IDOA 5E1DA 2IU0A 4LHWA 4DSZA 1KJWA 4B8ZA 4HVCA 1APBA 5EC8A 4MQ5A 1LLQA 4TLLB 1RHRA 5KVVA 3LX8A 1H3NA 1IQ0A 3L7DA 1LSSA 3G6KA 2XBLA 3W3AA 1N2OA 2JH9A 3MYYA 4TMTA 2VXBA 4BKRA 3WWEA 4M1SA 1K89A 2C82A 2E4YA 2IPMA 5KYXA 2I4OA 4YMLA 3FRIA 2CLHB 2QXUA 3RJMA 4J90A 1DUIA 2JA2A 3LU1A 3WL3A 4ZCMA 3T4EA 2IBTA 4OKSA 4L74A 1FDRA 3QOWA 2ZB3A 4XB1A 2OC9A 4NEQA 1TGVA 1U5BB 3QY0A 4DB2A 1CR4A 4ARIA 4DBZA 2R4TA 5FOWA 3NVKI 4TRMA 2B2XA 5EG5A 2GETA 2MYNA 3IT3A 4FGUA 4HFNA 5LZ9A 1VMIA 3GUHA 5G4KA 1EUQA 2FSFA 3HB5X 2KYRA 2BUAA 5A7GA 5C32A 1N2CE 1C8LA 3FW1A 1VSVA 4WESA 2ISQA 3GA7A 5TMBA 2BJWA 3N2NA 5JOQA 1A4XA 1CQIB 2C5FA 2X86A 3I1IA 4HC4A 3TW8A 3UK2A 2ZE8A 3OTQA 1CZUA 1IH8A 1XTVA 2B82A 1SVOA 3E03A 3JWEA 4ZC1A 2D0IA 1DBVO 4L8YA 1Y82A 5GAJA 5MGBA 1UC8A 1HC7A 5DNEA 1L8OA 3ZDZB 2NVWA 1Y5MA 3FI9A 3TB6A 1PFWA 1V37A 1SGWA 2HHCA 4FFBB 3G23A 1ZUIA 3DMGA 4PFQA 1U2GC 2BH9A 3A1CA 1KH2A 4FFLA 3FTPA 1A72A 4UQPA 1TK2A 1VRWA 2HIAA 3KUUA 3OM0A 1AKUA 1TJ4A 4JSTA 2FRXA 3S5JA 1HEIA 1W8IA 4TQGA 3T1TA 4IZOA 1I7QB 1YAHA 4ER7A 1YI0A 2EERA 5C4MA 1RC8A 2Q3HA 1E2FA 1E1CB 1USKA 4PLHA 2G9UA 1Y4SA 2OE2A 2ZYTX 3A36A 2QENA 4QXAA 3GRZA 2W83A 4JP1A 2G3YA 1JIQA 5H3LA 1ZSYA 3N0VA 4YN3A 3SHTA 2GFQA 3CRMA 1S02A 3ONWA 4LDZA 1DQNA 1VL8A 3D4OA 4WXHA 5C4GB 5JZSA 1YFJA 3ASZA 2JHGA 2VQDA 5DISB 1EH5A 2OK7A 1TZBA 1R5NA 1UBJS 2QQGA 1MU0A 3Q6IA 4TROA 4BECA 2I80A 4LA4A 1Q1QA 3LCVB 1I51A 3IJ5A 3I42A 1OIWA 3O2NA 5SY6A 4ETMA 2QYOA 2E9SA 2W2OA 1OT3A 1RFGE 4CLHA 2FEPA 4CHTA 9LDTA 10MHA 3GY0A 3NCHA 3GJZA 4GM1A 2Z30A 3VPAA 4BL5A 2IH5A 1OWPA 3EGVA 3EMVA 3NTRA 1QGZA 2HWUA 2Z98A 2VSYA 3FYDA 4QYIB 5ALNA 2GPYA 1P0IA 3BF7A 4BKMA 1X8KA 4FWTA 4E94A 3F3KA 2HSJA 3CCBA 3COVA 3PR3A 1TVEA 4XB2A 1VSTA 2XKBA 1QO0A 3AEYA 4C22A 1RM5A 2WM3A 3K0SA 3PRHA 3ROPA 4MUXA 3RF6A 3S81A 1H2XA 4B5LA 5A4IS 3GH3A 4Q02A 2COEA 4RCZA 3FNBA 3ZGNA 2OAEA 2QD3A 4CWAA 5B1HA 1XU9A 2O0KA 1SCBA 1R00A 1GCAA 1T8WA 2WWGA 3TM4A 2QM0A 1RVV1 2Y0DA 4BMPB 4N5IX 1KNXA 1M7HA 2FWPA 1J1IA 1MA0A 2JFBA 1NRXA 2VP4A 2A33A 3SZ3A 3AF1A 4RF3A 4C7KA 5ICFA 4JUIA 4WZZA 1US8B 1SVIA 5CH3A 3RAGA 5CLJA 3C3PA 3NHZA 2DBRA 2HQBA 2QXYA 3A06A 3EGEA 3I62A 1ZGAA 3CX8A 3VR5H 2VBIA 1O5TA 1R18A 2FQ1A 2XGSA