1T9ZA

Three-dimensional structure of a rna-polymerase ii binding protein.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
181
Chain Sequence
MQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADMLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLIMDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Structure and Mechanism of RNA Polymerase II CTD Phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 181
sequence length 181
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1t9zA00
4MUMA 1S2OA 4PNHA 2FDRA 2RARA 3MPOA 2HSZA 4Y2XA 5AKHA 4BX3A 5ALZA 2PQ0A 3OCZA 2R8YA 2G06A 1ZRNA 3L8FA 1LTQA 1NRWA 5AKJA 5AM4A 5AVYA 1Z4KA 1ZJJA 2YN4A 3TLMA 1EK2A 3L7YA 1Z5GA 4YH1A 4G9BA 4FFDA 3R4CA 1RLMA 3U7EB 3MN1A 5AM0A 3ESRA 2C8LA 1T9ZA 1RKQA 4UMVA 4YGYA 1RKUA 3E81A 2G08A 4HAIA 2HEGA 2G07A 2B8EA 3U19A 2IOFA 3L0CA 4QJBA 3N5KA 3I1YA 1Z5UA 4NAVA 2ZBFA 1QQ6A 4F72A 4AS3A 3SD7A 4DCCA 4J03A 2AUTA 2HOQA 4H1WA 2OYCA 1K1EA 2YJ6A 2NO5A 2C88A 2Q4TA 2ZBDA 5ALSA 1L7OA 2IOFK 5AI9A 3EF0A 2ZBGA 3UMGA 5ALIA 3AR3A 3WKCA 5ALFA 4CNQA 2OM6A 3GYGA 5AESA 3QYPA 3NAMA 1U7PA 5AM2A 2WF6A 3SKYA 4EX6A 1RC8A 4E88A 1TA0A 2JAUA 2BDEA 1RMQA 3ET5A 5AKKA 1TE2A 5AI4A 3L8EA 4KN8A 4NV0A 3QUCA 2RBKA 4EZEA 3ZVMA 5JJBA 2ZXEA 4UASA 4XPZA 1ZS9A 3MMZA 4Y3UA 3E58A 1QH9A 4UMFA 4BNDB 4F71A 5AI0A 4BEWA 3U7HB 2YMLA 3L0YA 4FYPA 2FUCA 1QQ5A 1YS9A 1X42A 5AKYA 5ALWA 2VKQA 2B1RA 1SWWA 1U7OA 2WHEA 5AW7A 3HLTA 2EATA 3NUQA 3ZI4A 1RKVA 1YJ5A 5AVTA 2HX1A 3L0BA 4J2TA 3OCXA 2CFTA 4UU0A 4YCNA 2FPWA 3L1UA 4GXTA 4L57A 4UATA 1WPGA 1L7MA 2D2VA 4HGRA 1RRCA 3ZVNA 2YJ4A 2JARA 4I9FA 2G1AA 2P9JA 5ALHA 5AHXA 3FPBA 2IA5A 4AS2A 4B6JA 4YIKA 3OCWA 5AVUA 2GMWA 4Y2UA 5FP0A 3KC2A 4KX3A 3SLRA 3ZVLA 4C4TA 1RQNA 3WGVA 3IB6A 2WM8A 3IRUA 1NNLA 4DWOA 2YY6A 4CF5A 5AI8A 2I54A 1VJRA 1Z4QA 3L5KA 3W5DA 4MWOA 3J7TA 4FE3A 3ZUPA 4OCZA 3L1VA 3ZWDA 2DQSA 3CZ4A 2P11A 4HGOA 3U7FB 3WK6A 4KX5A 1T5TA 4UU1A 5A3RA 2R8ZA 1RPZA 2JAWA 2YMMA 3U26A 3QU7A 3QGMA 5IT0A 4HGQA 2AH5A 3NRJA 3AR4A 3ZW7A 3AR8A 2HO4A 1ZD3A 3I28A 4OFZA 5AK4A 1CR6A 4JDPA 3ZU6A 2FUEA 2Q5EA 3WKEA 1Z4LA 4KNVA 1XVIA 2AGVA 3QUTA 3QX7A 1RLTA 4BBJA 2YJ3A 2W11A 2PR7A 3AR5A 3SKXA 3WK7A 4EENA 4EX7A 5AM3A 5ALUA 5ALMA 3SMVA 1IWOA 4RESA 1N9KA 5E0OA 3WK8A 2FEAA 5ALOA 1L6RA 3NASA 4C4RA 3FPSA 4Y2JA 4CF4A 4I9GA 2AMYA 3P96A 1O08A 1XPJA 2YMPA 5AVZA 2ZOSA 2B0CA 3PCTA 1RLOA 4Y2VA 5ALGA 5T41A 3UMCA 1N8NA 3R09A 1SWVA 1Z4JA 1ZRMA 1YNSA 3DNPA 5ALXA 3ONNA 3PGVA 3BWVA 1CQZA 2HDOA 1RMYA 2FPRA 4OD0A 5AVXA 2O2XA 2O9JA 3D6JA 3IJ5A 5AKZA 4BX0A 5AI5A 2JGAA 4XE5A 5A3SA 5ALNA 1U02A 1ZD4A 4YCLA 1NF2A 1TJ5A 1Z4IA 4AP9A 5AVWA 4JB3A 2WFAA 1ZD5A 2HF2A 2B82A 3WGUA 5AIBA 1AQ6A 3ET4A 1FEZA 4HGPA 2IOHA 3ED5A 3B8EA 4CE6A 3SHQA 4ZEWA 2YMQA 2EAUA 2CFSA 3QUBA 3AR6A 3WKDA 3QU9A 3OPXA 5AW8A 3NANA 4BYGA 3N07A 1XP5A 2YBDA 3W5BA 1YDFA 4NABA 1KYTA 2GFHA 3A1DA 5AVRA 2FPUA 2OA0A 5ALPA 4C4SA 4UAUA 3DAOA 2YJ5A 2I7DA 5AW3A 3QXGA 2P69A 3AR2A 3OTQA 5ALTA 3MC1A 2I6XA 4Y2SA 4BKMA 3ZX4A 2G80A 4HGNA 1U2SA 2GHTA 2MU1A 3OCYA 3U13A 3EPRA 1WR8A 1F5SA 2I34A 2B1QA 3L8HA 4GIBA 3WK4A 5ALYA 4L6CA 2B8JA 5ALDA 3RF6A 3S6JA 3A3YA 5ALEA 3QU4A 3N1UA 3EWIA 3M1YA 4O8CA 5AKLA 3FVVA 1ZD2P 5AW1A 3M9LA 2HHLA 3L8GA 2RB5A 1RQLA 2R8XA 3QU5A 3AR9A 2GHQA 5AM5A 1VJ5A 2WF5A 3NIWA 4UM5A 2BDUA 5AVVA 2X4DA 5IS2A 1Z4NA 1L8LA 2WF9A 3KDPA 2WF8A 4Y2PA 3W5AA 1VFPA 1J8DA 2C8KA 2OBBA 4BX2A 4Y2RA 2PKEA 2I55A 4KYTA 4L6AA 1Z88A 4UMDA 2P27A 3ESQA 3OCVA 1L8OA 1Z4PX 5AW9A 2MSNA 5AIAA 3QNMA 4EEKA 1YV9A 3AR7A 3E84A 1WVIA 2WF7A 1J97A 1Z4OA 1RDFA 4UW9A 5AW6A 5AM1A 3PDWA 3NALA 1ZOLA 4Y2TA 3CNHA 2FPXA 3I6BA 1Y8AA 4CF3A 5AI6A 5ALVA 2C9MA 2EARA 4IFTA 3FM9A 2ZBEA 2BY4A 3B9BA 2IYEA 5AW5A 1MH9A 3BA6A 4UMEA 5AICA 5AVSA 2FI1A 4NFLA 4EELA 1Q92A 4UARA 4ZEXA 5AW2A 2CN1A 1TJ3A 5ALKA 4XOUA 5ALQA 3N8GA 4HYTA 3WKBA 3ZX5A 3W5CA 1LVHA 5ALRA 4BNDA 2QLTA 3OCUA 2GO7A 4RETA 4ZEVA 1RMTA 4YIHA 3UM9A 2C4NA 1WZCA 2G0AA 1EK1A 3A1EA 5AVQA 4BEVA 4G63A 2ZG6A 4IG4A 1L7NA 5ALLA 4UM7A 5AKIA 3B9RA 3VAYA 3FZQA 3WKAA 1O03A 2CFRA 4DW8A 1YMQA 2NO4A 3SF0A 3HYCA 2I33A 1PW5A 5AK5A 3DV9A 3A1CA 3PGLA 3WK5A 3I76A 2G09A 2R8EA 4Y2QA 1T5SA 3K1ZA 3KZXA 1U2TA 1Z4MA 3EF1A 4OHFA 5AKGA 5AW0A 2ODAA 3U7GA 4NWIA 5AW4A 5AKEA 2JAOA 5ALJA 4XQ0A 3F9RA 3R9KA 2HF7A 3QLEA 3KD3A 5AK6A 3WK9A 1SU4A 2W43A 4Y2YA 3E8MA 5AKXA 3QU2A 1S8OA 4KNWA 2FPSA 2RAVA 2W4MA 5AK3A 3ZTYA 2YFYA 3ZTWA 3N28A 1L7PA 4YCMA 2B30A 1JUDA 1QYIA 2HI0A 3RFUA 2NYVA 3DDHA 3KOOA 2Q4RA 1Q91A 3FGOA 2QYHA 3ZWKA 1QQ7A 3UMBA 2HCFA 5IT4A 3QUQA 1TJ4A 4QQFA 4UAVA 4DFDA 3KBBA 5A3QA
chains in the Genus database with same CATH superfamily
2FDRA 4U39A 1AGPA 4M1MA 2EDCA 4WADA 4DXHA 5ARBA 1K6IA 4PQGA 3I4FA 3PR2B 4LX8A 1C7FA 3IDFA 5JD4A 1GKLA 1ZVJA 2IS1A 3JXEA 3C6XA 3N0WA 3GL9A 4QDXA 3TLMA 1FNMA 1TO6A 2VVTA 2I4OA 1E96A 1IMOA 2XAUA 3O31A 4K9SA 4WOJA 3F2VA 3VC2A 4W5QA 1PEDA 3PNQA 1JSCA 1XRSB 1EUCB 4I4IA 5CURA 1I9GA 2CLSA 1DHTA 4MKFA 1U7UA 1RYDA 2Q9CA 1RJ9B 4XUCA 3G9ZA 4M53A 3PHBE 1ESNA 3F1KA 4WPGA 5EPUA 1X6VA 2V6BA 3M3HA 4NCJA 4YGYA 3W8FA 2O3UA 2WJWA 2YYZA 3MIIA 1B6RA 2H18A 1RLUA 1GPBA 4Z9XA 3W5VA 5TVKA 3GJZA 3JYOA 5AJTA 4IO0A 2ERYA 2FP3A 1IN7A 3TEJA 2BF7A 3U19A 2O0MA 2ZUEA 4AG5A 5J43A 1JFTA 3LL4A 3NV9A 1Z5UA 3ANXA 2LIVA 3CPSA 3MPUA 2NQTA 3SD7A 4B40A 3MWDA 1OZFA 4H3VA 2Y92A 2N75A 4U63A 3GX1A 4P35A 2C5LA 3LDGA 1KMCA 2IX9A 3O8QB 4FEYA 2ZYUX 3CW8X 4HN9A 3TBFA 4DIFA 1MEEA 4WFIA 2AOWA 2JRLA 1TUGA 4LDAA 1P1KA 5DOZA 2PKXA 2QLNA 2YVQA 3EEIA 4ZOCA 1Y3FE 4YAJA 2ONYA 4H1TA 5CU7A 1K27A 3UJ9A 5BWCA 2QN9A 2YRFA 3CVXA 3DEHA 4MWCA 1U7ZA 4NPAA 5JSUA 2OLEA 2O8CA 1E9CA 3HXTA 1URPA 4PNZA 1E1KA 4IXMA 1U9IA 3AI7A 3NAMA 3DCJA 4MXDA 3AZPA 3GZJA 5I7RA 3MLAA 4NARA 1EVKA 3DXYA 1Y7LA 1UOEA 3UQZA 4YWHA 2B4YA 4BJ3A 3OOEA 3LUJA 4MVJF 4E5KA 3ZD6A 4TVBA 2B6NA 1U1EA 1EK0A 5ANRB 3VBEA 2PWBA 4FZ5A 1DFHA 1PVDA 2VZ0A 5SZIA 3OOJA 5JNVA 1X15A 2PL9A 4QNNA 3U60B 3GI1A 4MR9A 2H9YA 2JJQA 4TKMA 3HVRA 2HAEA 3R5XA 2OOKA 2WP8J 4TXLA 1PS8A 4EG3A 2WIFA 1KI2A 1JI3A 4YMGA 4RZXA 1C4KA 4M0UA 5AI0A 1LNZA 3RUFA 5JH7A 3PNYA 1KAHA 1MAVA 3L6EA 4BLSA 2UZIR 1ESEA 3DLIA 2X22A 3L7MA 3HVHA 1PWYE 1H9AA 3B1YA 3GEDA 3IKMB 5AT1A 4UEWA 1NT4A 2NT4A 4M9UA 1W1IA 1JX6A 2H06A 2BR4A 2VKQA 3HGQA 2IXBA 3CNNA 4CFSA 4F4UA 2D1SA 3GB9A 3PJEA 1ZCZA 2FN3A 4HVCA 3PEEA 1PG2A 4JEHA 3MAJA 1M34B 3SSAA 1A9QA 1DAPA 4NONA 2CDNA 2FKAA 1OH6A 2HX1A 3SICE 1BDJA 2DHDA 4XB6B 1PT9A 4X60A 1U0NA 4OQXA 4WQMA 1U5BA 3KOYA 1WPGA 4V0KA 5DULA 1CUGA 1V3UA 2NTEA 1G5QA 2F3RA 3O4JA 1NJ5A 4D9MA 4AW9A 5IHPA 2GJKA 4ZK6A 3M4NA 1RRCA 2JARA 3AM3A 1R6BX 1ONBA 1IPFA 4YBZA 2NVWA 3GLGB 5LWQA 4MGZR 1LJUA 1YCGA 2PNJA 4M54A 1JXMA 1P19A 1UWVA 1VA5A 4XJTA 5FL3A 2PUHA 2IDMA 3OMXA 3DAYA 4YIKA 3NHSA 2H5EA 4HSEA 5EUCA 4ZT7A 3F6YA 3UGJA 3HGTA 3N76A 3VYWA 1NVVQ 3VNQA 2VJMB 4GGPA 1JI0A 1KDVA 3FHCB 1RHJA 3BE5A 4ZYVA 3KEMA 5KYWA 1OPXA 5DNYB 2QZZA 4PM4A 4RIFA 2OP0A 4EW1A 2F6RA 4AUKA 1EBFA 2MINB 4ALMA 5CG1A 4CBVA 4KWEA 2IXDA 3CVYA 3TRHA 4OMDA 1X86B 4G0PA 4LDJA 1ENOA 2LKCA 5HKKD 2B4QA 3L41A 4I4TF 3ZLBA 1HM5A 1TU0A 4P82A 3P9RA 1VM6A 2IYLD 1A50B 5J4YA 5COQA 3SC2B 3G9UA 2DRIA 2GVDC 4Q5IA 4HVLA 5THKA 3ZUPA 4B2PA 1GGVA 5EHGA 5B1YA 3KTAB 2X6RA 1AN0A 2O1SA 4CTOA 4FHFA 4MKHA 2V59A 2VP2A 4BECA 4U2BA 5A3RA 4UU1A 3N6XA 4P92A 2VNAA 4FR2A 2X0NA 1YUMA 3M6XA 1E32A 3W5IA 3W8NA 1RBQA 4HGQA 4KITB 5BNIA 4RHEA 2Z4TA 2VF5X 1FRVA 3PUKA 1E2MA 1XQ1A 2HCRA 2WJ6A 2LP4Y 3DKPA 3K8QA 4FFOA 4N0PA 4OFZA 1B23P 5GONF 4Y6LA 2ORED 4P54A 5AK4A 5IX8A 3LQ2A 3EXAA 1EQ2A 1S3FA 2Z0MA 3QVOA 3S7TA 5EMLA 3RVQA 4TGLA 1UC9A 2J5XA 2OBFA 1JWBB 1XNHA 2PANA 2Y9MB 2RHJA 1WDWB 2Z30A 1WKBA 4ZCMA 5EXTA 2AUNA 4ZHSA 5E9AA 2QRLA 5A4DA 5AM3A 4EX7A 1RPTA 4M46A 5ALMA 1K2VN 1V7CA 1ZN7A 4RANA 4LOJA 1ADJA 3OAAA 2CCJA 2AKAB 4RK0A 3ZGNA 3WBJA 4J29A 5IAOA 1FFSA 4EF6A 2P41A 1PIWA 1QV6A 4P32A 4BOYA 1Q2XA 3NEAA 3SZGA 3GEPA 3UMYA 5JJ5A 3W3ZB 1YE3A 2VTBB 4LNUA 4IILA 2WHQA 3NKVA 4MRVA 1B6SA 3LX4A 1R10A 4O4HB 3THSA 3P0EA 4O5AA 3VRHA 3RS7A 4EO4A 5JXJA 1N4DA 1XPJA 1VLZA 5CD9A 4H60A 4IOMA 5F9HA 3UGTA 1IUOA 3C3MA 4R16A 3ZNOA 2R00A 4DYDA 5DKFA 4D8WA 4LVOA 1U8YA 5JYBA 2C5SA 3HYSA 5ALGA 3C6BA 3U3KA 4B3RB 2B7BA 2O48X 3E9ZA 4Q4DA 2CJWA 3D43A 3KJHA 3G0OA 5ALXA 3RUEA 1CRLA 3PGVA 1PR1A 4LYFA 2BAGA 4QSHA 5DP1A 3DT8A 1CQZA 3AL3A 1VIYA 5KYXB 4G37A 1R0XA 5I51A 2F17A 1NVUQ 1XXHA 3AKEA 3PD1A 1A5AB 4DA4A 3GOQA 1K8YB 1GV0A 2P4UA 4HB3A 1T9BA 3QEMB 3CKLA 4C0LA 3OI7A 4JUCA 4F5YA 1TEHA 1YA4A 2JJ2A 4UHCA 1M76A 4Q3LA 4YXFA 1KI6A 3Q5DA 2PCJA 3C7KA 5EYPA 1G20A 1V7ZA 5AOBA 2MHCA 4O4LB 4P2GA 1NLZA 1OX6A 2B35A 4HB2A 5ALNA 3WV4A 4F3RA 2O2IA 2GK4A 2COEA 5LIPA 3LUPA 4U0KA 4A10A 2QG6A 2VOEA 3K9CA 2F1HA 4II2A 4CF6A 1YU6A 2JLCA 3H6GA 4J07A 1FZQA 2EKQA 3WLSA 4HNRA 1T0IA 1H2EA 2WFLB 4X63A 3NHPA 3WISA 1VIVA 2EU8A 3TMKA 3PDIB 4ILEA 5BMVA 3DFZA 2FK8A 4I1VA 3QK7A 4IMJB 5TMEA 2QYOA 2OOSA 1ZONA 2FJUA 1TD1A 4X8OA 4OAQA 3REFA 1KMIY 4MARA 5ISMA 5FI3A 1DWPA 1BCSB 2YXDA 1YB7A 3TNFA 3VX3A 1QGED 4RTSA 1ZR4A 1KRHA 4RD6A 4ARAA 2XY4A 3G1WA 2A94A 3O47A 4BCCA 5KDOA 1MT0A 2W6JD 3K0SA 1IUNA 1VPTA 1QORA 2I7DA 2WYHA 3MD9A 3KT3A 3KBOA 5EIBC 5ENVA 3JWPA 4YMLA 2I67A 4RJIA 3FD8A 3S8MA 1P60A 2QP4A 2C9BA 4BCBA 2BFCB 3DNFA 3L0IB 1IHPA 2ZYTX 5AP9A 4AI6A 4BO3A 3URMA 1H6BA 3VNBA 4DPLA 2AR0A 2HSEA 2RSLA 5TEVA 3EZNA 1GUBA 4XM0A 3EWSA 5LMNB 3F6SA 1WQ1R 3L8HA 3TQOA 3RF6A 2JAQA 1L4BA 2EKPA 2GVZC 4KI7A 3D0RA 4C0JA 2BGRA 1YMVA 3ZDRA 1VI6A 2PCLA 4Y2GA 5BOSA 5F52A 5IM5A 4DC1A 2HJWA 3RGWS 5KWSA 4AKGA 4EHIA 4O63O 3BHMA 3E3AA 3SIWA 3AIKA 3TUJC 4YRIA 2EWWA 4GBJA 4N39A 4TN1A 4B8ZA 5DMXA 3NYWA 4Z3OA 3JARB 4RX1A 1OFVA 5LD2C 1IAQA 1OQAA 1XPOA 3AJAA 1WF3A 1AKRA 2WM2A 4YONB 1MIHA 3TNJA 3ZQJA 3DEJA 4L50A 2I2DA 5P21A 2ORYA 2Y68A 1LI5A 2IC5A 3VH2A 2HL6A 4G09A 1IOWA 1WCWA 1XZGA 4B8YA 2IX3A 1PT7A 2HU8A 2RMKA 5A6VA 5CR9A 5IW8A 5L7YA 5T5QA 3ZWWA 5KNBD 2VUUA 2BMAA 2W6NA 1G42A 2VJKA 3O93A 4GX1A 1Z6YA 2Q3FA 2QRNA 2WWGA 3TB4A 2BKAA 1LDEA 4M1QA 4OQ4A 5JD3A 1JH8A 3CKYA 4BO6A 5KMGA 1CZHA 1SM4A 1LK5A 3R41A 5JS6A 1YZKA 1IDOA 1RAAA 3DR5A 3KHTA 4HOYA 4R8RA 1FFXA 4G25A 2G04A 3R1IA 3ESQA 3QSGA 2BHTA 5CCDA 3UJHA 1FIUA 1TMOA 1FUIA 3E84A 1ZK1A 4HEA1 1VSUA 3GCWA 1EXMA 3PL1A 1BW9A 4FCTA 2ZXFA 5KVCA 4PVDA 1DG9A 1PVOA 4Z4FA 2QZPA 4YT5A 2VYQA 2F1RA 3FM9A 5INTA 5HKKA 4KRGA 3RC7A 2V7VA 3B51X 3WNDA 2ZU0C 1UDRA 2QYSA 2C1EA 2ZT8A 2D06A 5A5DA 3ZZUA 1PKXA 3ZBQA 3DTVB 1V8DA 1KI7A 3C8HA 3LX8A 4JUDX 4BGDA 5FULA 1H94A 3TLCA 3I9NA 3I1IA 1KVUA 5BPHA 1QH8B 4JP5A 4Z1MD 5KTPA 3W5CA 4A1FA 4B4OA 1RWWA 2OORA 3AZQA 1RXCA 4XH9B 4YP1A 2C7RA 3BWXA 1F2VA 3BFVA 3DBLB 1P4SA 4RETA 2A86A 3D8UA 4ARCA 2C4NA 4Q9AA 1F3LA 5TR9A 3ZIUA 1WY5A 3E8SA 5DGDA 3UENA 4GS5A 3G6WA 3FDZA 3BXOA 1CUAA 4IGFA 3BYZA 4HZIA 4FTWA 3R3SA 4DJJA 1L7NA 1L5MA 2PNFA 4PE5B 2E87A 2WQ7A 1J49A 4BLVA 2G5CA 1SC9A 4P4TA 2QX9A 3MRTA 3BICA 1ACJA 2GJAA 3O91A 4DL9A 4KRXA 4DEXA 3TECE 4RM3A 4W8HA 2CFRA 3KUUA 1U8ZA 3JR7A 3RRMA 5DNVA 2XMQA 1AGYA 3A26A 1R3DA 4QA9A 4DRXA 2WA1A 1VE3A 3A9SA 1VE7A 1PL0A 4MYTA 4JXJA 4OOFA 3KWMA 4R1SA 2HBZA 1DQYA 4RIHA 3TDKA 3IKJA 1T34A 1PR9A 3I12A 5HCNA 1COWD 4M1TA 1CU1A 1XEXB 4GGMX 4TV8F 1T5SA 4XYEA 3F9IA 1OWLA 1JLHA 3VO9A 4RZQA 3V4ZA 1ORIA 3EOZA 1DDIA 3AHGA 2QG9A 4Y1FA 1HDYA 5IPFA 5EJ5A 3CR8A 3ENZA 1K63A 1JLRA 1N92A 2XKAA 1XZ8A 2DLDA 3KZNA 3B1KA 1Q77A 3C7AA 4NBRA 5BSRA 3VOAA 4EGJA 4E94A 1QBKC 5FYDA 4LXHA 4ZRMA 1RWNA 4AKTA 3MWLA 3IPXA 3U44B 4WOKA 1TF5A 5I5GA 1MC1A 2CCGA 1EE1A 1FL9A 3R20A 2MTBA 3AXTA 3RCBA 4X7RA 1DKRA 5CLIA 4ZVOA 1DC7A 1JAZA 1TT7A 4ZO4A 4NYMR 1KWGA 2C0PA 3W2GA 2H08A 3SF8A 1SKYE 1PWEA 1TTTA 1MT3A 1EFUA 2JH8A 1D5CA 4V39A 1E64A 4ZT6A 4Z6KA 2WAOA 4A3SA 1ZVMA 4YCMA 5H1YA 4ID3A 1D8TA 3I92A 3THWA 2HMSA 2AJLI 2IL1A 2RBGA 3JCZA 1VKZA 5EIEA 5IG2A 4FXPA 2IZZA 4P7KA 4BO2A 1KS2A 2ZIUB 3I01A 3RBZA 1USWA 3JZIA 4L9AA 1QQ7A 4YALA 1J06A 3WFIA 4P3YA 1CIPA 3IDSA 4IDGA 1TKAA 4YP5A 2BHNA 1OC4A 2CJYA 2VXYA 3NBZC 4J0HA 1BDMA 5HP4A 2A58A 3SC3A 1P6UA 3HA2A 3NKLA 1TQ8A 4GOLD 4J1NA 5EFOA 2YWJA 5HKAA 2IEGA 5EWMB 5F4BA 2ANBA 1R0WA 4W5JA 4EK9A 1OLSB 1KSFX 1B3BA 2IF0A 2HSWA 1ZMRA 2E18A 4CZ2A 1R0SA 4ZGWA 3H8SA 4EUFA 3D02A 1ZVQA 1EK2A 1V1RA 1UZUA 3ABZA 3L7YA 3TH5A 3PFCA 4PQEA 4LV6A 4MS1A 3SLKA 3CF6R 3TZ6A 4J1SA 4X90A 1HEYA 4FP9A 4ZO9A 4JI1B 1FVFA 2QE6A 4UE3S 4F5WA 4GKJB 5BN4A 1DUVG 1BJTA 1E2BA 5FCDA 5CFPA 1KEKA 2F9FA 1GUYA 1QZUA 4KDRA 4XB2A 4LKRA 1JVNA 2QL7A 2W6JA 2ZBUA 3S2FA 3CZPA 1WHSB 1BXRB 2AF3C 2HEGA 3GH3A 2FY8A 4MWBA 2HMTA 1X7YA 1ZCAA 5LNK1 4QJBA 4FGWA 2PX3A 1JKJB 1J0DA 2ICAA 3TR5A 3ZDXB 3ZJVA 2PKQP 4YRQA 1OF1A 2FFQA 3GJQA 2ZRNA 4G0XA 4M2LA 3RWBA 2VAVA 3F4BA 2J9FA 3WGYA 4C78A 4W4TA 1TZ2A 2J5KA 1G6Q1 2OORC 2OYCA 2BFFA 2X5NA 5CA0A 1Q16A 3F67A 1EG2A 2MR5A 5EUQB 5GZ1A 4CCWA 3SBOA 5JE8A 4O1MA 2PYIA 1XTSA 3Q7EA 1RIIA 2D5IA 1M5UA 2YN0A 3HBFA 3RU2A 1DEAA 3M82A 3DOJA 1UBFA 5J4LA 4WBNA 3H2ZA 2HW8A 4G84A 4FBMA 1JQBA 4OQDA 5JWOA 3AKYA 2WF6A 3HKBA 2IV7A 1KDRA 1G4UR 4E88A 1H0SA 2IIQA 2BDEA 4BO5A 2ETXA 3O2SB 3ACCA 2JAPA 3P9YA 3UHJA 3BN3A 4I9UA 3R7DA 5E4TA 3H5AA 1W4RA 3K0HA 4LHEA 4TTRA 3ENWA 3O9MA 4DLUA 1VCIA 3AG5A 4L3WA 1ODSA 1YJQA 2L17A 1E2JA 5REQB 3AYXB 3FWNA 1O0BA 1G1AA 3KV3O 2I2AA 3UUEA 4H4EA 1HGXA 1D4AA 5DM1A 2QUAA 1P1JA 4FR5A 3IHTA 2ZXEA 4QRHA 3TMAA 1QCDA 1QE3A 1A4XA 1JG2A 1JQLB 2NX2A 1ZNXA 3PGMA 4Z4CA 5K0CA 1EP3B 2IPXA 3FSRA 3B2EA 4Y3UA 1JQJC 4YBRA 1XAIA 4CKWA 3YASA 2DWQA 3BRSA 4FGUA 4IUCS 4NP6A 4ZDJA 2W42A 3F3MA 1RQPA 5K8LA 4URFA 4C4XA 4EGQA 4Z9YA 4IHJB 2IWRA 4D98A 3LQKA 4P98A 4O2AB 5CVCA 5IDWA 1JDBB 3AESB 1N9ZA 2FOLA 2MMCA 1JTEA 4FPXA 2YXBA 2XRMA 3UGQA 2AZTA 4JV5B 2ZPUA 3IOCA 4S05A 3WGHA 2BIFA 1RQ2A 1IN1A 1I8TA 2B1RA 1E5LA 1EEXB 3B5IA 3VSEA 1GXSA 5BWOA 5BUSA 3LTNC 3FMOB 3OQ1A 5DHAA 1I3OA 2B5WA 2OHGA 5BNFA 3RFVA 1TYZA 3C7CB 3WB2A 2QP3A 4OB8A 3P0HA 4UDOA 4DIKA 2ODBA 4BPRA 2JFHA 3R3WA 4W63A 1R5BA 2ZWMA 1NSTA 3ZVRA 1DOHA 3QP9A 1X7WB 4XYBA 1W48A 3O83A 4RY2A 1KEZA 2NNWB 2WM3A 6NULA 4CR6A 1KDOA 2YJ4A 2WHPB 4RC9A 1JYSA 4JOCA 1O1YA 3KUKA 1U2QA 3A4LA 3H2SA 1AKYA 4LG1A 2FP4B 2NPOA 3T7KA 4JL5A 1ADGA 1XYYA 1EB9A 4ANFA 1ZICA 4NYIR 2Z5GA 2R7LA 1T9HA 4HF7A 4B31A 5AVUA 2G3YA 3CZ5A 5DBGA 1THMA 3DOHA 1NM5A 2QKYA 5EEHA 2H1FA 2IEBA 2XDYA 3BFXA 1P17A 4LBZA 1PCXA 5LBTA 4LZJA 4NBLA 3AK4A 3NFRA 1W6UA 2V6JA 3HRKA 3LZCA 2VHJA 2OUKA 3L6OO 1V8BA 2FEWB 1ENYA 2BBSA 4NRDA 4RJTA 2GF2A 3R7WA 1T8YA 4DXDA 1WPXA 2O05A 1KFBB 5DTRA 5IMBA 1GNLA 4TYNA 1XVTA 4R01A 4TV9A 5CLQA 1DAMA 3LT0A 1XTRA 3VISA 2FSUA 3HYLA 3KQYA 4OHZA 5K6AA 1SVSA 1NF8A 4PO9A 5ENDA 3KPWA 2Q7DA 2JCSA 4EVRA 3MSCA 10MHA 1OREA 2I54A 4N82A 2PS9A 2DWPA 2YUTA 1XWIA 3X44A 2VJPA 5TX7A 4CMKA 1WD5A 1Z35A 5JAIA 1COWA 3W6UA 5KREA 1AF7A 4GM1A 1ZLYA 5GV7A 1LPMA 1TOAA 2ZRHA 3GRUA 4M76B 3VSDA 3R8FA 1VLJA 2QD2A 3CZ4A 3SS7X 5KC9A 3H83A 5L7WA 4NK5A 3EIUA 2XVXA 1LPBB 2HO5A 1O96B 4JBYA 4RIGA 4BN5A 4D0LB 2BFDB 3G88A 4EPYA 1MJHA 1FXSA 3KNZA 1QK5A 2JB9A 2XEXA 1GGJA 2IZ5A 3GJ0A 4OB6A 3AHFA 4TROA 1WF6A 3JAKA 4FLMA 4TLEA 3GRAA 4GOJA 3WIBA 2WNSA 5IMSA 4Q4JA 4YRBA 1VMKA 2OQRA 4YRKA 1WZIA 1Z38A 2QAGB 1Z4LA 1JA0A 3U9LA 2JLYA 3E82A 4QUIA 4DSUA 4ENRA 1ST2A 2AGVA 4HJRA 5K8JB 3R5HA 2HIHA 1YASA 3HZZA 1N2OA 4ESVA 2BBOA 5ALUA 1Z0SA 4TSRA 2GEBA 4JI0B 5DX1A 2C84A 3CCCA 3MFYA 2P4QA 4IZIA 2ONZA 4G1VA 1JDJA 1QTRA 2BJHA 4FDLA 3WK8A 3TGLA 2ZRQA 2AEMA 1H4TA 1H2XA 3BXEA 3FLEA 1IIRA 3V46A 3LY5A 5MN5A 2QBYA 4GZ5A 1TQ2A 4FN4A 1Z0ZA 2QRVB 3G5MA 4Z0NA 4EVSA 3SDBA 1EFCA 3GNTA 2REBA 4LJ6A 3B6KA 3DZBA 5K99A 4YCNA 3A3PA 1NQOA 2IP4A 3HU2A 2W90A 2B36A 3D5EA 2QXYA 4GRDA 5ILQA 4ECEA 2AR9A 4G2TA 1NW5A 3H4TA 2WWWA 3T1VA 3N0VA 3IQIX 2GLXA 2JFXA 3D7KA 1EPUA 2FKNA 4IX1A 2NADA 1DLIA 1KZYC 4AZ0B 4E5PA 5KSYA 1GGNA 2ZRPA 3ONNA 4W5WA 1XZIA 1NUPA 3K05A 4ZC1A 4AKEA 1M1NA 2TMDA 1E4EB 3PICA 1GV1A 4EF4A 4LWOA 1MQAA 3BMOB 4W6ZA 5EJFA 3LQ1A 3E03A 4X8MA 1WVGA 2MCFA 4EGFA 1J1UA 3NP9A 3AGPA 3T34A 2X3YA 1REQB 2TECE 4HNUA 2Y0BA 4QZVA 4B33A 2DFKB 4F4FA 1ZNYA 3O8OB 1XZPA 3EW9A 4IJKA 3FCXA 1DIGA 3GA7A 1TF2A 2IOYA 3KEQA 1KU6A 4XCXA 3T1HB 1WL8A 2VZEA 1ZM4A 4IH9A 4CIYA 4I50F 5HZGA 4KUGA 1J2UA 2WT8A 5BPFA 1FSFA 1OGIA 1VE5A 4XJXA 2JFVA 4M1KA 1GILA 4TXNA 3ZZTA 4F11A 4D9NA 4ZC8A 1T3GA 1HDGO 4MRAA 1FVOA 4CKYA 1PUXA 4Y0VA 4B7ZA 4AY3A 1BSVA 4MQEB 2GKOA 5HW0A 2VBFA 2AC2A 1NU6A 3NVMB 4ZOLB 3T4PA 1GM5A 9MHTA 4TMKA 4JH0A 4G56A 2CZQA 2Q3EA 1WP9A 2X13A 4DEVA 2V3VA 821PA 4B32A 5LU8A 1EBBA 2RGRA 2VRCD 1NM5C 2VRNA 5AW8A 1R9NA 1Q0QA 3BHJA 2D1RA 3ZWMA 3WGJA 2HV9A 3A3KA 3H8JA 2EF0A 2VQEB 4TM8A 4CMEA 3VTFA 5GZ3A 1F2DA 1OXTA 5C8YF 4CG2A 2PN1A 4WBNF 1EWTA 3MGCA 3U61B 4CLXA 2NZVG 2PJZA 3B48A 4HPJB 1ODIA 4NK4A 1QYXA 2HUNA 1KVQA 2HY7A 4QYXA 4U6NA 5LP1A 5K6AC 2OHHA 3V7FA 5EJIA 3G0IA 3JZAA 2PT5A 1SHUX 4RTPA 1VHTA 1Y6QA 4AXBA 2ZUFA 2D1FA 1JW9B 1UPCA 2RDMA 1U8XX 1UK6A 4EOGA 1BHSA 4BU0A 2WMDA 4QNMA 4MW6A 3Q4GA 1X77A 3Q7SA 3ZDYB 4Q21A 5J9FA 3DWFA 2NUPA 1NY5A 2ZRFA 3JQPA 1WU7A 2OFOA 3Q6MA 4C08A 4CV0A 4GPD1 2G7ZA 1NVAA 4BVEA 1JHMA 4HBZA 2FQYA 4NZMA 1MF7A 2QLJA 4LJLA 4WKCA 1XMQB 4RKEA 4DRZA 1HH4A 5IVHA 1MCZA 2W98A 1VCOA 3Q7QA 1NXXA 3NDRA 5HPYB 4A03A 4BN0A 3BJMA 2FSGA 3K15A 2Y1FA 3MZ0A 3PDJA 5AM5A 2FX5A 3IV6A 4X41A 4U6QA 1E4YA 2DXIA 4BVBA 3AVTA 3UPDA 2C03A 2XUZA 2V7PA 1M8FA 3IAXA 1O97D 4GU5A 3U09A 4IJ5A 4ALKA 4XUEA 1JFSA 3ZHQA 4Y2PA 3DTYA 3Q87B 1I36A 2FEOA 2JC3A 2PRIA 2ISSD 1IQPA 4WKPA 4PYMA 1PLLA 2B4AA 5SZHB 3K0FB 4TS9A 3BSSA 5IFKA 4D3XA 5J4VA 1Y8RB 3C1AA 1ZRSA 1FJGB 1R8QA 4HNAB 3M5PA 4KLAA 4N8SA 4DA8A 4M0DA 3CUVA 1KYIA 1K4KA 2HK6A 1YU9A 4C7KA 3ZJUA 1QRUA 1YQUA 4Y7DA 1SC1A 2DJ5A 2QNBA 1BJRE 2IK8A 3LQ4A 3C45A 1P5FA 2VAXA 3ZU5A 5JI3E 2AOTB 2QL6A 4ES6A 3G7UA 1DARA 5CW2A 2UAGA 2R3SA 1TJYA 4RJKA 2HRDA 4M6WB 3RFXA 3UA3A 3GQBA 3ZHCA 1Q2UA 1JIQA 1ZFNA 2OCKA 5KHLB 3AOEA 1NVWQ 4OJYA 4D9GA 3CH4B 3HNOA 2XBLA 4H3SA 1LSSA 5AXBA 5A6SA 3TZHA 4C5BA 2ZVPX 4UCFA 1B16A 1L4NA 2XNJA 2Y2VA 4MV8A 1ZN9A 2DBZA 4I99A 1SU6A 3BXGA 3GP5A 4YP6A 1Q6ZA 2O6HA 3AEQB 4NFLA 4J7CA 3WV5A 4DMCA 4ZIRB 1KO1A 2R84A 4K05A 2B4KA 5J47A 3GVPA 1QMGA 3MCWA 2CN1A 2NIPA 3CHYA 4EYQA 3F5DA 3D7NA 4FT4A 1R4AA 3QXSA 3NBYC 3I5UA 3K9QO 3E23A 2B78A 3RIEA 1LBQA 3P0JA 4IGEA 1X3LA 2W6QA 3AB7A 1OYVA 3NC1C 4G8DA 1EFPB 2NUAA 3F6BX 3M6MD 3D31A 4FCVA 4E5NA 4YJ2A 3L4EA 5HSGA 3U1VA 1Q14A 2F9LA 2JF0A 1YJCA 3ADOA 1ZUD1 3G2IA 2Z95A 3RTGA 3LQQA 1UXJA 2Q3JA 4BEVA 2IHBA 4F56A 2Q27A 4KQ6A 3U3XA 3U17A 3F71A 2GO1A 5DNDA 1K75A 4LYJA 1HQKA 4EG8A 1Z13A 2XBMA 2AJ8A 4C7MA 1C7JA 2AYXA 1D04A 3TD9A 3HL0A 3PTZA 4PLZA 3IUYA 3PRYA 3ZD9A 1O03A 2XZTA 4BP3A 4DLTA 2HGZA 4PYJA 1KMMA 5SYMA 3VAAA 1R0LA 2QRZA 4MRPA 4BQNA 1XMPA 4DN6A 3BZBA 3M6AA 3TLXA 3PEWA 4X7MA 3IRVA 3NDBB 5HQ3A 1MA0A 2UKDA 4RKYA 4CL0A 2E2WA 1G3RA 4OXKA 3EW7A 3N2YA 3MYRA 1H2ZA 4Z7JA 3ORRA 3HTXA 5BSFA 1ND6A 2HQOA 3V6LA 2V58A 4OX9Y 3X1ZA 4GBGA 1FW8A 1OYWA 1M73E 1T1EA 3TPCA 4C7BA 4F4HA 5HZMA 3CGWA 3PFBA 5I9MA 4EDHA 3DBRB 3ZDCA 4NFHA 5F23A 2BMFA 3PHIA 1PZXA 3KKZA 1SBCA 3KQTA 1NV8A 2I1WA 2V65A 3B1JA 3ILVA 2OGUA 4M0FA 4QAJA 2JFFA 1W59A 9GPBA 5JNTA 5ER9A 1HK7A 1YNOA 4A0HA 3DGEC 2EJWA 5JBQA 2AVNA 1SXJD 3KZKA 3ZD7A 1UKCA 4J0JA 3V8VA 1GRCA 1TA4A 1EFKA 1LI7A 1Z29A 4IIHA 2AFHB 4YRTA 2R7KA 4B6SA 2R6GA 1DC4A 4FZVA 2B94A 5CT4A 3RRBA 2VZ9A 3QU2A 4LZAA 4UNNA 5GIPE 3ZNPA 4H0FA 3MCVA 4BO1A 3PR3A 4KPEC 1QHHA 4WIAA 7ABPA 4XQEA 1E3WA 1MRNA 2IUYA 1ZJYA 3LYAA 4KVGA 1JTFA 3W8DA 3QVTA 2WT4A 3MTAA 3FE2A 4B2LA 1R9JA 1NWCA 3A05A 4IO1A 1IJKA 5EI5A 3V4VB 2VP9A 4EB8A 1YR3A 1HX7A 2ZT6A 1M74A 2Q4RA 5EIAA 3DVAA 3OP1A 1IN8A 2CXTA 4FX5A 4PYLA 3WX0A 3ZZ0A 1Z7EA 4Q02A 1DZ3A 4E03A 4ARIA 4RTJA 3ZV7A 3UCFA 3C5VA 1EWQA 1B42A 1RTTA 4LJAA 4WRRA 2J30A 1KEWA 2EC5A 3C3DA 3KUCA 3LKZA 3KBBA 3DMNA 4LJ5A 1V4BA 1EP2B 2PO5A 1OZGA 1CJCA 2HZBA 4ALJA 1GLVA 3LK7A 4BC0A 5GVRA 1U2GA 2PQMA 1OH5A 1WKCA 3EY9A 3TJZA 2CWWA 2VUTA 4HDMB 1S2IA 3QPUA 3OF3A 4MVJG 2VHEA 3GELA 3I6ZA 3SN6A 4YH1A 2H29A 1YR1A 4C4YA 3G0HA 2VRCA 2RD2A 2NZXA 2EW8A 1OMOA 1O87A 3QXJA 4FZRA 3HO1A 2RC6A 3CT4A 5F76A 2YL2A 3MN1A 2ZDGA 4MLCA 4MR8A 5J59A 1DDGA 3EUWA 3ZKWB 4EPTA 1HYEA 2RHLA 2ZJ2A 4CMHA 2YV1A 3AOEC 1RKQA 4H6VA 4TWRA 2OO7A 4UMVA 1RKUA 1NURA 2PG3A 3E18A 4KJZA 2F9MA 2ZM6B 3GNLA 1GG2A 1YBHA 1Z07A 2N0SA 2YWFA 4QBTA 1JEJA 3U31A 1O6ZA 5AUQA 3D3JA 1JU3A 4ZAZA 3DAGA 4HKTA 1UKAA 1I32A 1T9CA 1ZGJA 1Y5LA 3K5HA 3FCSB 2NYRA 3I64A 3SZRA 4A6DA 2UXCB 4FDAA 4EW2A 4DCCA 4DSAA 1KJIA 4PZZA 3BQMB 4IVPA 2YJ6A 1IB6A 2Z9CA 3UXEA 1HYGA 5LQCA 3F49S 3NAGA 3DYVA 1TQ4A 4EG0A 5D2CA 1USIA 1POWA 2C8VA 4X3CA 3VQTA 4IIXA 1XPRA 5KQRA 1BFUA 2PX8A 2O8BA 4NYMQ 1QIGA 2JGJA 2J41A 5KPJA 3RFFA 2UUCB 1HY3A 1GTG1 5E4JA 3LNCA 3EPHA 2OBMA 2JANA 1NPYA 1N6NA 2ZUCA 2PE5A 4HUTA 3L2OB 2GOYA 3DBIA 2VDRB 4HDOB 5EJ2A 4ZRDA 4OI4A 4LHVA 1GSIA 3WWOA 4GI3A 3RHTA 3UV3A 1XCPA 4KUHA 5AOAA 5K0ZA 1OA1A 1T3TA 3E9MA 1YHNA 3Q3IA 3FNHA 1ECGA 1C4OA 1FXWF 5BVGA 5I4BA 3MHTA 4PF1A 1TM4E 3UTCA 4EY8A 5HYVA 1P33A 2CXSA 2CLLB 3ZGOA 3OFJA 1C1YA 2XQKA 4BVLA 1L4EA 3J80A 3LBIA 1RI5A 1UANA 3S68A 2Y3IA 3MRXA 4M1YA 3FGZA 2Z4RA 1CG6A 4NENA 5CT5A 2APJA 2PU7A 4X93A 5CCBA 3I52A 2VPWA 3LWZA 4DJAA 1ATIA 4JK3A 2FMKA 3V1YA 4PSAA 4JA0A 4DMHA 3OG9A 2YMLA 2FPPB 2VHYA 4ZVKA 2HZ7A 3RS8A 4CQNA 1Z82A 2FQWA 3AXSA 3GA0A 4DCVA 4IDEA 5JXWA 5TNXA 4IEEA 5FR2A 1WXFA 1R7RA 1NIPA 2FQXA 2IHJA 3FSGA 2CF5A 3MQFA 1P2TA 3WMWA 5KTOA 3IJPA 3ZE7A 1U7OA 1T8UA 3LCUA 2A5GA 3N2IA 5C1IA 1VB5A 2CNOA 3MD0A 4D80A 3L8CA 2A7QA 4PHCA 5LIRA 1J9ZA 4B85A 5EZSA 1LEHA 1YS7A 4RJ2A 3TIXB 1Z18A 5FQOA 2QORA 4UATA 1L7MA 4NJEA 2GZHA 4EJMA 3JQQA 1Z39A 1MOSA 2QMQA 3FMVA 1ISSA 1O6CA 3HI4A 3GMTA 2LRHA 1MIOB 4PQRA 1P9LA 3MGGA 3RC3A 3SQNA 4ENQA 3EPLA 1TIKA 2XE7A 2G72A 5LZ7A 2CLOB 3L46A 1XV5A 2ATXA 2ZKIA 4L51A 3A06A 4ENTA 3G59A 2PA3A 3R3UA 4GKAA 2EDAA 3ILYA 4BWFB 2FSIA 3PWTA 3D59A 3CVWA 4GL2A 1EJ6A 3N2NA 2GMWA 2XMGA 3UFXB 4E70A 2P6RA 4GRIA 1W4BA 4IDPA 2QU8A 4U7WA 4DNPA 2R6DA 3P45A 1MOQA 2GN1A 4KAXA 3TR0A 4EZBA 3T0FA 2H59A 3ZDEA 4DZZA 2CV2A 2R2GA 3UUWA 2PMFA 2GZ3A 2ZUSA 1U2GC 1SCNE 3RVKA 4IHQA 3HR4A 5JU6A 5F35A 1EVQA 2Q6OA 1H9BA 4RV4A 1YCHA 5E38A 1AXEA 4ZP1A 5LDHA 4G81A 3PFNA 2O7SA 3UVEA 5FO1A 4J6EA 3LZ6A 4G0VA 1PK7A 1YFJA 4MPJA 3GLHA 4IUYA 4L72A 4G1EB 4Q6BA 2GSDA 3DMDA 3MT0A 3JQEA 4OP1A 3RIHA 4ERXA 5GIOE 1XRNA 1HTTA 1Z62A 3HB5X 5DW3A 1PG0A 1VIMA 3EEFA 4QUKA 3ZEIA 4ZYLA 4JI4B 4HDQB 1Q12A 4K6OA 5EHQA 1IG3A 1JNYA 2PMBA 1E62A 4BN4A 2G7MC 4QQNA 1NP3A 3A6LA 2ZUTA 3VNAA 3THOA 2EQBA 1RJDA 2QMOA 3IOYA 3ETJA 2YMMA 5FBWB 3SI7A 1XR3A 2FMFA 4CIWA 1GCIA 4JLAA 3B20A 3SVTA 2AK2A 4ON9A 4TWAA 3RC9A 1QWSA 4BXOB 2QTAA 3L02A 3QE0A 3E9QA 5A4FS 1FSPA 1WA5A 5BSWA 3R9WA 3FG9A 3DUFA 1GDHA 1SXJA 1YB6A 3OE4A 1CR6A 2NG1A 4C20A 1UAGA 1YR7A 3FLAA 4DB2A 3Q98A 1P1HA 2YVAA 3RRZA 1KYXA 1SHZA 4ND1A 4IVQA 3SZLA 1PV2A 2CF6A 1FE8A 3GN2A 4R9RA 1RLTA 2XIJA 1DWUA 2JEOA 3VKUA 1HTWA 1KKLA 1X1CA 1N7HA 1OYOA 1ZSYA 1ZY2A 2L82A 3BGVA 3KXPA 4IOLA 4JVSB 4KN5A 2BGIA 4KQKA 4BP9A 1CIVA 3CG0A 2XMZA 2OMKA 3FLMA 3HCBA 4OMFG 4Q3CA 2D6FA 4K46A 3V2UA 5CHEA 1OTHA 3EFBA 1W85A 1WMFA 1I33A 3NCTA 4PYNA 3TRKA 3VNUA 1AN9A 1UOQA 2I91A 2WPNA 4BV8A 4N48A 3GT0A 4P5EA 4V38A 2IYFA 1EMDA 5BWBA 3FOEC 1DTWB 2H11A 3KJIA 4GR5A 4RGVA 4OI0A 3EXHA 1WDLA 2R5NA 4AL4A 1O08A 2JIQA 1T4BA 4NYIQ 4BFUA 1WMAA 4BKUA 1CULC 2ZP1A 5AOVA 3WB9A 3A0UA 1AQLA 4PRZA 3ANNA 2FXVA 4NMMA 3MAGA 1PI3A 3CPEA 1BA2A 3F1LA 4F91B 3R3XA 4L4RA 3OESA 1Q7TA 2P9CA 1PGJA 4GDMA 1Z4JA 5EQDA 3P4XA 4NICA 1CJTC 4H7JA 1XT6A 2X3UA 2JLXA 1WXEA 4H9GA 1MEOA 2IPOA 2VS1A 2WTEA 3H11A 4HVTA 4DTIA 1W52X 2WMYA 2PLFA 4PFKA 4PPQA 5AVXA 3U4CA 1FSZA 4N5LA 3G5UA 4OGWA 2O2XA 4GX0A 4L2IA 3DPUA 3JWGA 5LYYA 3R8XA 1ISMA 1NBME 4R8SA 3PEVA 1YVDA 1ODCA 2W5UA 1JDNA 4QNRA 1HLGA 1YQGA 4F2WA 1LS6A 2IQ5A 1U0SY 3I2HA 4I5FA 3CLHA 4XDHA 1EXWA 2FMUA 2G5TA 2TS1A 3TDNA 2JLAA 1U02A 3WGTA 3RYHB 1TFRA 2CXRA 1VE9A 2UZ1A 2FCRA 2ZB7A 3EZGA 3C6ZA 4M22A 4Q9KA 1XWFA 4KJXA 3T95A 2WFAA 1ZD5A 2HJSA 4HXEB 1H6DA 2B82A 3KUXA 3OCCA 1Q1ZA 2J67A 4TKLA 4WACA 4E1VA 2HMAA 4U7HA 4NFYA 4DTCA 1KVSA 3AETB 3LUGA 4ZEWA 2FSFA 3DDCA 3LCRA 3MA0A 1FMTA 4WE3A 4P31A 2EAUA 3A58B 5JAOA 3EE6A 1LLCA 5H9WA 4AJ9A 4I08A 1GKIA 2H1RA 3V4OA 4EUEA 2AS0A 4G5OA 5JXIA 2GNPA 1LJLA 3QKWA 2VI5A 4IZHA 4LV5B 2C95A 2X0JA 4XFJA 3D7LA 4HS9A 2W2XA 1M8KA 3I6IA 4TYMA 4DWJA 1B14A 1E7SA 1KYTA 3JY6A 4JI6B 3DLHA 3FDXA 3CWCA 2QMHA 2J1LA 3O1JC 5BN1A 4M8NE 3GLIB 2P6UA 2FZGA 2C7PA 221PA 2CE7A 1X0VA 3ZZNA 2I6GA 2H0RA 1MGOA 4QT4A 5F3DA 4YRDA 5KYYA 1UJ6A 4Y2SA 4TLDA 3UK7A 3MJDA 3W79A 3TRDA 1MX1A 3Q6IA 2IHKA 4EKNB 4MP6A 4TVKA 2P4SA 2XTJA 3LKVA 3OEYA 4L5CA 1UKEA 2GCIA 1PV1A 5FWXB 5F5LA 2GKSA 3EPRA 3LSYA 3LC2O 4MRNA 4Q19A 1Z2OX 1CPYA 1KK0A 4IIGA 1KMHA 3UWDA 3D6MA 3FDJA 3BF7A 2VHTA 4ZT2A 5T57A 3REQA 2DECA 2OZKA 1S8AA 2WU1A 4OK3A 3VPAA 5BUCA 3L18A 3FVVA 2G5GX 3PEUA 4YUAA 1RWMA 3G0GA 5BN3A 4NXMB 2VN8A 3ZBTA 1CD5A 2GAJA 2XLBA 1NVBA 2PGOA 2IU4A 3HWSA 4Q4HB 3R6DA 5GM2A 3TQQA 4U2KA 1C8BA 1WIWA 1Z0AA 3MAAC 4DSNA 2RH5A 4TYYA 2PVCA 1XMSA 4PCUA 1VJ5A 3W5UA 5F9MA 2ILVA 1SZJG 3D4NA 1FPMA 3IQDB 4TMVA 5I7UA 8OHMA 1T36B 4EA8A 2QN3A 5FTLA 4NATA 4Z4QA 1H3EA 2FPOA 3SYTA 5IS2A 3N2EA 2I29A 1J42A 2WF8A 2XOXA 3UZUA 1IBCA 1XD8A 5GV8A 3VU0A 2CCKA 2CJPA 3AH8A 2IFTA 1QFXA 1OYYA 1JPNA 3ZXUB 1R3UA 4B80A 1Z26A 5M7EA 2IYNA 2G0TA 2AQHA 4IUDS 2GFQA 4X6XA 2OQVA 1WRBA 4ZXPA 4CKEB 3KOWA 3PEYA 3A2KA 4KXYA 1Y1SA 3AQIA 4KTTE 1ML4A 1DBRA 3LT4A 4MUKA 4OHWA 2X4GA 2JL1A 2CLIB 5AIAA 4X64B 4UBLA 3QE3A 3QNMA 3AUFA 1ORWA 2BEVA 4AQDA 4DUZB 2ZIAA 3VHLB 1XVVA 1NI4A 1U8CB 3PRJA 4IQ8A 2YWXA 2CWDA 3L7BA 3MUEA 1I4LD 1U2RA 2CNWD 1VXOA 4CF3A 4JT9A 5KYKA 4EMUA 1FYXA 1UP7A 2VDWA 1F2UB 2F8MA 5TT1A 3SQLA 4HB0A 4WN3A 1QG6A 3AU9A 3ZCRA 4K5QA 3AY6A 5K4GA 4M1WA 5M3BA 1ATZA 2M1ZA 1K6MA 4MGHA 1OFUX 2E4VA 3LHKA 2FX2A 2IUSA 3D6TB 1P9NA 1WCV1 1TJ3A 1SQ5A 4JC8A 4RS3A 1T0PA 1UBNA 4UC0A 1YBVA 2YJNA 1NMSA 3RSSA 1CIJA 5CG2A 2X8AA 3FAZA 1Z33A 1B2RA 5DW0A 4LC1A 2LGJA 4PYIA 3N7TA 3LVFO 4ESOA 4L0CA 4Y6QA 5EFZA 3D8BA 3Q1LA 4JITA 1UXKA 1ZH8A 2JGRA 4GE0A 2ZYHA 4P4SA 4XYMA 4RCZA 5FHRA 1UMCB 2Q5QA 4YIHA 3P9KA 5KIAA 1XF1A 1Z25A 3T5GA 4AURA 1MJ5A 1EK1A 1FSGA 4RK1A 3DMFA 2B61A 3A6HA 3FYUC 1HZJA 1B74A 1WKVA 4BUZA 2VJYA 2HA3A 3DV0B 2ECKA 4B6OA 1NN0A 3C16C 3EGOA 3K3PA 3TIFA 1X9IA 3LC7O 1XTKA 1XNJA 3KQKA 1VHWA 1CR4A 1STOA 3B70A 4OL9A 4YMWA 5IASA 1MP0A 3TZBA 4LE2A 1GUAA 5JV5A 4IG9A 4LQLA 1O94D 1TGVA 4E51A 4JU8A 4AJKA 5IEJA 1YMQA 2NO4A 1VA4A 3GQVA 4RFSA 1A1VA 4CU5A 1JH9A 3CWZA 1FFYA 2B4RO 2RK6A 4CLRA 1O8BA 4KQ1A 1SQ0A 5KHOC 1QFJA 5A4KA 3O8RA 1XL1A 3COYA 4KKXB 1CUIA 2FR1A 2OLJA 5HK9A 4Y2QA 5KTNA 1C9NA 2BSAA 2FPGB 2O4CA 3KZXA 5LXTA 5K3AA 4MDHA 2ISCA 5H82A 4BQRA 2GX6A 4O0LA 2A84A 2X9LA 4XGNA 3UW3A 3AW8A 3TF5A 4LFBB 4BFXA 5G4KA 2QY9A 3TCNA 1MO5A 4OUKX 2XJ4A 1M2VA 4IXNA 1LRJA 4CMGA 3DL7A 3O2NA 3TK1A 3EXFA 1RAFA 1E5VA 3OC0A 3A37A 3FUTA 2K6GA 3TVYA 1SU4A 1TLFA 5J23A 1U0LA 1NQVA 3CIOA 5A5VA 3QXCA 3T5AA 4MUJA 1NR5A 4N5HX 5GWXA 3WRVA 3H5IA 3IUNA 4GBMA 4Q47A 4Q3OA 2I62A 3ZDQA 2ZTSA 3E8XA 4U0JA 2V7QD 4EW6A 3SZMA 5CCEA 2UXDB 4RDXA 1KOGA 4WY5A 3GLRA 2FWRA 2EX1A 4IY1A 2RH9B 2P91A 5TGZA 1KZ1A 4WZAE 1W73A 2YFYA 4YY3B 1MBZA 2XMSA 3FBTA 3QPCA 2BM8A 4LYGA 6Q21A 4QEDA 1QYIA 2V7XA 4Q7MB 1ARZA 3SVZA 1B26A 2YV4A 4S1OA 1FJ2A 2QGNA 3O9ZA 4HH4A 3I5YA 3C74A 2JHFA 3UWKA 4BMNA 4ZTBA 1JWLA 1H0RA 3FGOA 1V5EA 3ZWKA 1EUCA 2DQKA 1AQUA 1PJLA 3QYJA 4XIIA 5FUXA 3ZK9A 4C2BA 3W06A 1E1QD 4JODA 4G0OA 4YJ3B 5J58A 3N9IA 5BSTA 5EKUA 3W8RA 2QI9C 4G65A 3PFGA 1QH0A 3GFTA 1I5EA 4PYKA 1GU0A 4C6SA 1LKZA 4L9WA 4WZAB 2YW2A 1X2BA 5EZYB 2R8YA 1G17A 1ZRNA 3H18A 4L4UA 2ZYRA 2V1UA 1E5QA 1F4VA 4EQ6B 4EJFA 4F84A 1MZPA 3IH5A 1Z2CA 5JUWA 1B7GO 3OT1B 2PWAA 3OTOB 5FLKA 4XPIB 1NMYA 2QL9A 3IOMA 4NYJR 5IF9A 3O8QA 3TLAA 2H85A 5IH7A 2JFOA 4WNIA 1KGDA 5SYAA 3A36A 2HLDD 2Q29A 2ZANA 3CV3A 3LLUA 2EFGA 1JMVA 3OUUA 4QGFA 3VPCA 1JPJA 5EP3A 1FJHA 2MJLA 1T0BA 1L7BA 1SU8A 3KYCB 4OQQA 3NOOA 4FSHA 4IUBS 4KE7A 1FA9A 4TKZA 1LW6E 2Y76A 1ZPDA 1E1RD 2LZ0A 2MT9A 2B8EA 3JTMA 4HFRA 3CN7A 3WP0A 4LF4B 4WK6A 3EVTA 2AFRA 1JBEA 4WLFA 3FBGA 1CY2A 4LIPD 1XEWY 3C85A 3NHUA 1ZVKA 1J09A 4QYWA 2DQZA 2HHCA 3F96A 2BKXA 1K97A 2CXOA 5HJEA 3AM4A 3AUYA 2F48A 1IDN1 1GNSA 3F9CA 4E5SA 1NLUA 2C88A 3JWEA 3PQ8A 4U7GA 3GAFA 4F45A 3TIVA 4Q82A 4C5CA 2VDJA 1DIOB 3BC1A 4KQ9A 5FAKA 2JLQA 2HB6A 4C6TA 3LKBA 4IWXA 4ZAYA 1YRHA 3GC6A 2Z56A 4HDNB 4A0QA 3LCJA 3UMRA 1INLA 3H4IA 5IKEA 3RIMA 4TSFD 1JLMA 4WESB 4K0RA 5LNK6 1C0KA 3FSEA 4TUYF 4KP7A 4OP3A 2I9KA 2YXEA 3ZQUA 4HZGA 3DMGA 4M99A 3U4GA 1VIAA 1YJBA 4Q1AA 1LC3A 4CT5A 4D45A 4HMOA 3QEKA 1ODTC 2OXFA 3GUYA 4GR9A 1RP7A 3FOBA 4FQ7A 4JCCA 3QUCA 4G8JA 4N49A 4Y1RA 3RLIA 3JTEA 4JC0A 1A2OA 5ICEA 4IEFB 3QITA 3KZMA 4X65B 5FPYA 4LJRA 3PSAA 3KTOA 4W1SA 4FYXA 3CG4A 2V7GA 1ZIXA 3P2JA 5C52B 5K3DA 5HHTA 1M34A 2HMWA 4LQ4A 4MX8A 4TN5A 4R83A 4YAEA 3I4LA 5DI3B 3K5IA 1EFLA 1VRCA 3HUUA 3NYQA 2DJIA 2AN3A 3GGDA 3B6JA 2PEYA 3MW8A 1QP7A 1ULZA 1XZKA 1GL7A 4KGDA 2V45A 3R3JA 4IIDA 4DCOA 1AIPA 1SBZA 2OFWA 4J0FA 5FLEX 3GLGA 5ITZB 3U56A 2PD4A 1XU9A 1NU8A 3D3KA 1OBOA 2FOIA 3KLMX 4QUGA 3HJBA 1NJ2A 3V7YA 4DMFA 2JCGA 3I9V6 1E0SA 1HFKA 1GPYA 3L79A 3Q7RA 4OHOA 2X1LA 2ZR9A 4LGMA 2ECFA 2PIAA 2VJMA 2VK1A 2JPDA 2DT8A 4CJXA 2QV7A 3WLFA 3GPDG 4PIMA 3DTTA 4NH0A 3VR4D 1DI0A 5LZ8A 4D74A 3BXHA 3T7AA 3EX7C 2DBVO 2VF2A 1W49A 4HB4A 4UM9D 1GEGA 5LMUB 1F8YA 2H1IA 3HBMA 3P2MA 5CNIA 4B43A 2O19A 2VO1A 2MINA 3M6WA 1UXIA 4I9FA 3TXXA 4CDMA 1M8JA 1ZN8A 3QJ5A 4OOEA 4UXJA 3IC5A 1CUEA 4EW3A 4KPUB 2GEDA 1FFEA 1TW2A 4CI9A 3ADBA 4AS2A 1JAYA 3MJFA 3QWHA 2BH9A 5FEMA 5K8IA 4N7JA 2PGAA 2DH5A 4KG7A 3U37A 3DTVD 3EEYA 3S4YA 4E12A 1OXMA 3WYBA 3ONFA 3K6RA 1E9VA 1ZWLA 4Q9HA 2ZPTX 5IARA 1RXYA 3KC2A 2IKSA 5HCIA 1KJNA 5KCZA 2OBYA 3ZVLA 5B58C 1RQNA 4IIVA 4BLOA 1M6WA 4XVUA 3IB6A 4FFVA 2IS4A 1WEKA 3MMNA 1QZTA 1EGQA 4QHSA 2QT1A 3E7WA 4NDAA 4TLBA 3NBMA 1NI5A 3OVMA 1O94A 1SKQA 5LQJA 3NVKI 5C1BA 1KYZA 3H5LA 3PGKA 3TEMA 1UPTA 2ZE6A 4KBYA 5L4NA 1VMIA 2P30A 5DHUA 1G60A 3DW3X 1W94A 3I73A 1DG3A 4OGLA 1IXYA 2CY0A 5HOQA 3S2UA 1ZQ9A 3HLKA 1KAGA 2R86A 3WICA 5CA1B 3AKZA 2ONKA 2KSQA 4EKDA 3WMFA 1A5TA 1SFRA 4UD2A 1MAAA 1UKYA 3PP8A 1TKCA 4Q34A 3CRZA 2WV9A 2BHLA 3V8NA 1GY8A 1GPAA 2JAWA 3TQIA 1NY6A 3OSZA 4KR7A 1S3SA 4DPMA 1WU8A 1WUKS 2Q7OE 4DMLA 4G41A 1PRYA 2D8AA 3BERA 3L7AA 4ZT5A 2FE4A 2AB0A 3OETA 3HPRA 1E63A 1LTKA 1TZJA 3HB9A 3R74A 3ZV6A 4JDPA 1I0LA 4O4HA 5FFMA 4EFDA 3UG6A 5A0TA 1AA6A 2Q5EA 4EYSA 4PCAA 1FZTA 4AJEA 3C3BA 5KJEA 4EI9A 4PVCA 3PQ6A 3VSCA 4U9HS 1KETA 2QM8A 1L4UA 1CZNA 1L7VC 1M2JA 2W11A 1U0OC 2F3UA 4N65A 5F1KA 1IIBA 3C3CA 3TXAA 4DCTA 4CIBA 3WQHA 2EJTA 4U4AA 1NVGA 4FI3F 2ZYAA 1GGKA 3K32A 1TQ6A 3A04A 5HDQA 4U9UA 2YINC 4L95C 5E0OA 4RSGA 3IAM1 3I2YX 5LA6F 4D79A 4Z53A 2PFSA 4UTRA 2CLHB 4NCNA 4FB4A 4G5HA 4JGGA 2PKCA 3S0JA 3FPSA 1V1MB 5EIXA 3UOAB 4CF4A 4QOFA 1OB5A 2PWZA 2GJ8A 1E1QA 1JDPA 3PI7A 1GLGA 4M0MA 5FOVA 5AVZA 2ORVA 2EEPA 2LDXA 3CVJA 3I30X 4JL8A 4NCHA 4QBFA 3QEMA 1V3TA 3LDHA 4LGVA 3CLSD 4U2DA 4Y2VA 4EJ2A 5J2UF 2BMWA 4ZKEA 3ZGXA 1KPGA 2AFIE 5HKLA 4GGOA 2DHQA 3IHLA 1M83A 2ZWIA 3GBPA 1JEEA 1KC3A 4KWHA 1SQGA 1J5PA 1ZSNA 3BWDD 1E79D 2DULA 1U0RA 3GP3A 3IIIA 1C7EA 1T0HB 3QFCA 4HRYA 1XX6A 5EJEA 3D1LA 3EDOA 2M2IA 1WV0A 4W9NA 2QTVA 2FVYA 2D00A 4OD0A 2HLDA 3VC7A 4WXYB 5EKSA 1E8DA 2X6QA 1G8KA 1IZYA 3EARA 1KEEB 1FP7A 2X2PA 3IBGA 3K5PA 4UE6A 5FL7D 5A9SB 3KTFA 4XLTA 2Y6UA 5E2IA 2DFDA 3SM3A 2ZCJA 2A30A 1VPLA 4KXFB 1E1RA 2B37A 2X5XA 4LDPA 3OIYA 3PDIA 2AFIB 1PNQA 4U02A 3FBWA 4N8DA 3VZDA 1NOJA 3OM0A 4J3FA 3DZFA 2QVGA 2P2LA 3CR3C 1RYNA 1P5HA 4OREX 3ZC3A 1BCSA 2FFBA 5KYVA 4HFNA 5AVWA 2DGDA 4ZOBA 5K51A 4MVJH 3UAYA 2Q8PA 1JZQA 4TZTA 1SOVA 3P4UA 3V4RA 1GZSA 1TYAE 4DLSA 4IJMA 2GM9A 3WJAA 5KQPA 1CUUA 5GAJA 4CVNA 5JWRA 5JTUA 3LO8A 1XJ5A 3ET4A 4HGPA 3ZS8A 2BH2A 2H17A 1DZIA 1DO8A 4Q6WA 3JQCA 3ZCPA 1DX4A 1I4EB 1ZJ4A 4LHSA 3GUUA 1KQOA 1BH6A 3O92A 4BVHA 4GYKA 1QFMA 2GZSA 2UYQA 2BFCA 2W6MA 3F8SA 3H1AA 4GF5A 4TSFA 5HBRA 1IBLB 3GLUA 5DX8A 5LJLA 3STYA 2LKDA 4LXIA 5CAEB 1R18A 4X0EA 4ROSA 5K0BA 2YNMA 1E98A 1MV8A 5KSOA 4GC5A 5IJAA 2FPUA 2B7CA 4ZK2A 4N7RA 2W2PA 2ILTA 3EPKA 4YJGB 2G82A 3EGEA 3OTQA 3PFFA 5FRDA 4II7A 2GK6A 5TS2A 3JARA 4YFVA 2GB4A 1P2GA 1USKA 3ZU2A 2G80A 4XYLA 4HGNA 2FR8A 2RJOA 4TL8A 4Y7CA 4EBFA 3QWBA 4HP8A 1E0JA 4AMBA 3IE0A 1UDWA 2W83A 2J5QA 3N39C 3RUCA 5I7FA 1VLMA 3ZG6A 2PZ8A 1JHZA 2FRXA 2PRKA 4R0NA 4S2EA 2AHRA 3CLRD 2C9OA 3IVCA 4YQEA 2PZAA 1V7PC 4R0VA 3HA7A 1MQSA 2DM6A 1PD0A 4AUNA 1V96A 2XADA 2PAFA 3AY7A 1U6KA 2Y1WA 4JROA 1KO5A 3MWEB 1YB1A 3BF8A 3R23A 1L5YA 2VLIA 3R0XA 3T35A 3QI7A 5J5CA 4B4KA 5JOQA 3NM4A 1FFWA 3QU5A 5DBOA 1X7GA 4M1EA 3VV2A 4UNQA 4YDSA 4DIOA 4FB5A 1DBWA 3BCUA 2PS0A 2JCYA 5A03A 3D7RA 4AG6A 5EL0A 1S3IA 1PX0A 4UM5A 3VR4A 2FDCA 3IE2A 2V9PA 3CLUD 4A2PA 5ECYA 1L8LA 5IHXA 3T3GA 4N76A 3A9TA 4IM7A 1GZ6A 3LRXA 3NWJA 5DLDA 3Q1KA 3SNHA 3FI0A 5JS8A 2O2DA 4K1XA 4ODIA 2BE7A 2OM2A 1SRQA 3D9QX 3LW7A 3L7CA 4MGKR 2R48A 3STUA 5K0GA 1GKYA 3R3HA 4BV2A 1UDBA 1N1EA 5LOVB 1W36B 2TMGA 4LYEA 4X20B 4CCYB 1NUQA 3BRQA 3WL5A 1G5IA 3H4VA 2JAXA 1CB7A 4H7HA 2ID8A 4X71A 2KJQA 3DTVA 2PT6A 3O4HA 4LVNA 5EP2A 2JCXA 2CXNA 3HSSA 3HA3A 1QH8A 2WF7A 2F62A 1ZGAA 1QOZA 4QPJC 5IN5A 2GPBA 4LF7B 1M2OB 2IY7A 1BXKA 3CNHA 1CY0A 3C3PA 2FWJA 2GBIA 3HJRA 4PYOA 5DM0A 3ROQA 1ENZA 2FV8A 2C4TA 5CJPA 1CNEA 1CYDA 3F3SA 3S8YA 3TBHA 3VPBA 3B52X 2VPYA 1KI1A 1Q74A 2ECQA 3QPVA 4KZKA 4H77A 4RA9B 4X6YA 5HQJA 1SXQA 2VEDA 4I4LA 5DYWA 4KQGA 1Q92A 4W9NC 2ZDQA 1RHUA 4HDAA 4WD3A 3WB1A 3AYZB 2ZM5A 2Q2NA 3TE7A 4KPYA 3V80A 2I66A 1J2YA 1N2EA 4K6CA 4Y98A 4B6EA 5I7HA 1CDEA 4JYZA 5E95A 1II8B 1SVUA 4FR0A 3VDRA 3WKBA 3ZX5A 4WFQA 1JR3E 5SV2A 1KU0A 2VWGA 4TVOA 4LUCA 5KZMB 5ALRA 2Q3DA 4BMXA 3NJ8A 5B58T 3DFKA 4AJIA 4L08A 5FOXA 2X41A 4XIJA 2DKNA 2XYQA 3GCGA 1FQWA 3LFTA 4E08A 1BROA 5DGIA 1UT6A 1XEXA 5AVQA 5H3LA 4L4SA 1T2DA 3LJKA 2OCYC 3MLBA 2Y67A 5EE3A 5ALLA 4UZEA 1HL7A 4UTZA 4QGSA 2NU9B 2IWHA 1CT9A 5E3JA 1I80A 4AJPA 1I0IA 2JBWA 3LF2A 3ZWPA 2JD1A 3KWFA 3C87A 4JP3A 3KYBA 1UIRA 1ZM9A 1KVTA 3ECAA 3RB8A 4CR7A 2M32A 3R0JA 3U44A 2HTFA 2NXWA 2Q28A 1QRDA 2CLEB 2BOVA 2OV4A 1L7DA 3PGJA 4KLNA 2H7YA 2HA0A 3H5TA 5LB2A 2G09A 2AEFA 4L74A 4TQGA 4I8IA 2YNMC 1T5OA 5ILGA 5TRTA 4RD1A 4RY0A 3H04A 1OI7A 2HM7A 3GPBA 4D96A 1SBQA 1T5BA 3K1ZA 4NESA 3W6NA 3ZWNA 2ON6A 3JX9A 4KBGA 3GLTA 4DR3B 4JX9A 1IUPA 1SBIA 1U28A 1ZI8A 2R6HA 5ALJA 4JOSA 5ESWA 1O4VA 3RVPA 3K35A 4I6GA 4E3ZA 4CGZA 2JKYA 1E4OA 4RGYA 2OCPA 1YJXA 1WM1A 3VKFA 4Z7OB 4HH0A 4RZ3A 5B7GA 3KE9A 2PXCA 1PFUA 4DPKA 4Y2YA 2HQBA 4LYDA 3TD2A 4C76A 2W8BB 2VT7A 3D6NB 3SYNA 1FFHA 2R1TB 2H1CA 4GYYA 1LLDA 3R8CA 3ZHSA 4PAGA 2NV0A 1E79A 3OX2A 2HKIA 2IHUA 4H3HB 4CT4B 1DO2A 2FVXA 1ULUA 2GN4A 2ZI3A 1YTUA 1UEJA 2GXSA 3VUFA 1WTCA 1VE1A 2CUTA 1KE2A 4LSZA 1WCYA 4OU4A 4N7BA 2DOKA 3O9VA 2VWQA 2W4MA 4C3OB 5EWMA 4X54A 3TSZA 5LP6F 3LY9A 1KJQA 1OLSA 3ABQB 1B8PA 5EQTA 1P0PA 3BMCA 1HXHA 5FL7A 1NW9B 3S1LA 2GDZA 3TINA 2HHHB 1CJBA 2OKCA 4RTRA 1RVV1 5H59A 2TMYA 1U3CA 4A92A 4I8DA 1R6TA 4NNPA 2II6A 3P26A 3T3MB 2ZSJA 5LBIA 3WYEA 1WZ2A 3JPYA 5FI1B 2OC9A 2JIOA 3FUVA 2NXCA 4KE6A 5CFQA 3NT2A 3HCEA 3O95A 3MCTA 2VJQA 3FN4A 4A26A 2ZBVA 1HE2A 1G2QA 4N12A 4PLCA 4MQ5A 1XEWX 1K8QA 1KQPA 1WHSA 5KNCD 2VF7A 5HIMA 1H4VB 1MMFB 3F90A 1Y42X 3LQFA 2FSVA 3M9XA 2WOOA 2IU6A 3ASUA 3T5DA 1RRFA 2AL7A 3L8MA 4ZVNA 1H2YA 3WLQA 2AZXA 1MX9A 4XQGA 1PR6A 2Q0QA 1FFGA 5CH3A 4ZI5A 3OQMA 1CVLA 2J87A 2QXUA 4IXWA 3DHWC 4DLWA 2XYRA 1VI5A 1SUAA 1FFBA 3ZPXA 3CVVA 5AM0A 4E2ZA 4EPRA 5C8ZA 6CHYA 3BJZA 3EFOB 1MXHA 1JEDA 1F9EA 1R6AA 1NUSA 2G08A 3FNGA 2P4HX 3ND9A 3H9EO 4V24A 2W8ZA 1QS0B 3T3HA 4MW2A 4V03A 5K2OA 4RCYA 3B5EA 3P97A 3ZY2A 1QBGA 2XUIA 3VOTA 2P78A 4CFZA 1WSAA 1U3FA 2BN4A 4NAVA 4WOCA 5TE9A 3SBEA 3HWRA 1U8EA 3JQAD 2FRDA 3HDGA 1T9DA 2O14A 2PLNA 3PF9A 4LSMA 4RF3A 4N47A 3CTMA 4C4OA 1WPRA 3DXFA 5HKOA 3HXMA 5D3ZA 2DUMA 4JHXA 1EHCA 5E9JA 4C4PA 4H1WA 1U90A 4DWWA 1PSWA 3LBHA 1QQBA 2JA1A 1OI2A 2ZBDA 3ELDA 1J0CA 1NVEA 4L5BA 5REQA 1RACA 3G7SA 4JI7B 3OE5A 1Z8HA 3KKLA 4RELA 3EPPA 4FUTA 4W5HA 1F12A 1PT5A 1Z83A 1KNXA 2QJFA 3DCYA 5ALIA 4RE5A 4NECA 2VWHA 3TM5A 2R1VB 2QL5A 4LYAA 5IJXA 4HYYA 2QVXX 3HDVA 4EX6A 3L8ZA 2XQIA 4FS8A 4P58A 2R11A 5JCZA 1IHOA 1XZMA 2GCGA 2KBFA 1TD9A 2RHWA 1SNYA 1LBSA 3IXMA 4IHJA 3AKDA 1LPOA 4A8JB 1SUFA 5B2EA 5HR5A 1W44A 1LDNA 3Q10A 1L4FA 3DMTA 3VR6H 3AESA 2ZI9A 1CERA 2PXXA 1NBOA 2IU3A 4NBUA 3CIFA 3IR6A 1U99A 2IYYA 1FPQA 4GPIB 2IPLA 2REOA 4TLCA 2GCPA 3NHYA 3VVBA 4ZVVA 3DEAA 2B20A 5JC8A 4J3JA 4B6PA 3PWZA 3JASB 1E2FA 3FKJA 4DIBA 4BWGA 4YYEA 2VJDA 1RBYA 1SQFA 1DINA 2RGGA 4JQYA 3L40A 4QPZA 4ALNA 3GLSA 2CFCA 3BG5A 3P5SA 3QVVA 4FD3A 3U7RA 3ESZA 4B7UA 4ND4A 4O4JA 5A4IS 3DWGA 4P0QB 4FWBA 1U28C 1LVUA 1X7WA 2BGLA 3O7WA 4NFSA 5AK0A 2C94A 1O8CA 2I22A 5B53A 3IHKA 4JOQA 5KVAA 1NN3A 2GRAA 2WHPA 5J5AA 2F59A 4G1BA 2PO7A 3K1AB 4QU0A 3KFVA 2M6SA 2FP4A 2WWHA 3HC7A 3B5JA 1NHGA 4GPBA 1J4AA 4YMTA 1BXZA 3IP7A 3R7FA 2J32A 4RULA 2WUDA 3PR1A 1P72A 1O0CA 1EDDA 3S29A 3ZHVA 5DPMA 1AK2A 3I4CA 4A8TA 9LDTA 2QS9A 5KC8A 4UU0A 4IDAA 3STVA 4V0OA 1GZ3A 3IO3A 1P8JA 1SVMA 3FPLA 3KCQA 2DWCA 3B1FA 3AC0A 2OV2A 1YJAA 1UUFA 3WB0A 4DUYB 2QGFA 5EIHA 3FPBA 3T0GA 5BW5A 5JHHB 1LSOA 3NT5A 3CH6A 1BMFD 2QD3A 4P4LA 5GY7A 4PXSA 3KXLA 3Q41A 4UNPA 1R8SA 1KDPA 5GM1A 3BJIC 3X2FA 3RRYA 1OAOA 3L07A 3CXRA 1SULA 1V45E 2XKBA 2CDAA 4J94A 4UXIA 3RT1A 3T5MA 2WUGA 3PPYA 1MD9A 1B73A 3IE1A 5HJ7A 1ZQ1A 2WM8A 5KQGA 1VMEA 3V2GA 3VUEA 2YBEA 2FPLA 2NTJA 2RB4A 3T7SA 4Z8YA 4TMFA 1GTRA 1P73A 3U81A 3C5EA 1Z28A 3LLMA 1KWKA 1JAXA 5AI8A 3SR3A 4CM6A 1JB1A 4DIMA 5JJKA 1LBIA 4RKWA 2XTZA 2QZ9A 1EX6A 4BJHB 2VDKB 2QAGA 3D64A 1WLSA 4MWOA 3SE7A 3O90A 4BNUA 4D44A 5FBVB 5K8UA 4LF8B 3E4DA 5JSFA 1VYTA 2E7ZA 4G0QA 5D84A 5IDQA 1EHIA 1WWKA 5K8TA 4G5YA 2P11A 2H7XA 3WLEA 1MAWA 1OUMA 1M66A 3N2KA 4KX5A 1OVGA 2HJ9A 4JBGA 2DT5A 4ARBA 5KX5F 3JQ6A 3MBKA 3QGMA 4RF4A 3NKFA 4XSGA 5EXPA 1Q57A 3VO1A 2IPNA 1NQTA 4KGZA 4LI0A 4C30A 3K70B 1JWAB 3NMUF 2A9FA 3O2QB 2QRVA 3ESBA 2GRJA 4YDRA 3AEKB 4IDFA 2CVPA 1EDBA 1CZRA 1O95D 3L4SO 3O3OB 1W88B 4HFMA 3ZGYA 5C1PA 2D7DA 2REQB 5ECGC 5CLJA 4PN7A 1SZDA 1G18A 3VAZA 4DE5A 4NQRA 2YJ3A 3WK7A 8ATCA 1SGWA 4LRWA 2NP6A 1W2GA 4RTMA 2HSDA 4RK4A 4AZ0A 4WXEA 5LQNA 1N9KA 5JYDA 3U3RA 2I7VA 2FEAA 4J0DA 5ALOA 4P5PA 1YFLA 1HFJA 1USUA 2BC9A 5A62A 4AKHA 3FUXA 1JNXX 5DYNA 1GAXA 4I55B 1JDBC 2XTAA 3A25A 3B6MA 3DMTC 1NI3A 1ZK2A 3KDSE 4MCJA 3CINA 3KKPA 3KVVA 1HI9A 5F7OA 3VKGA 3O8OA 4CKZA 2VJLA 1TYDE 4JBWA 4AJ4A 1E1CB 5FWNA 3K6KA 1DBSA 2WAMA 5BSHA 3CCBA 5KNCA 1XPUA 4I81A 3NYIA 3LKDA 3IP3A 1J9GA 2VSFA 5NLLA 1XTBA 1Q19A 3H1FA 3TCKA 2W2VA 4D43A 2FNAA 5I7AA 1J2TA 2YWRA 1Z37A 3INGA 1U2DA 2VLBA 4EJ0A 1Z2DA 1EI9A 1WMEA 4LRXA 5HRUA 4MQEA 1TK2A 1ILWA 2Q3CA 2FPRA 1EXVA 4ZOLA 2FWMX 2JFZA 5IXYA 3QVUA 4JLBA 1US8B 5KWIA 3HXQA 3V3KA 1ULAA 2QT9A 1Y4DE 3MMSA 2BP7B 2WFZA 4ARVA 1RS0A 1FDSA 4N54A 3NETA 1ND5A 2JI9A 3I2FA 3M81A 3P9IA 3UN1A 1GKKA 3BXPA 1ZZGA 4XE5A 4JJZA 3UK2A 1D2RA 3L0OA 3EXEA 4YCLA 2CSUA 3KAKA 3JQAA 3HN6A 2BFPA 1G8MA 3K0AB 3WJ2A 4D25A 2I6TA 4CQJA 5IC4A 4KYVA 2JFBA 3RRXA 5ARDA 1LQ2A 2IHNA 1XMXA 2C77A 2BMEA 4L9SA 5JDIA 4HQ6A 5LU9A 3UWPA 1SBTA 3IAFA 4F2GA 1EA5A 2H51A 4IVNA 3GJTA 4LRSB 1JHVA 1RCFA 3DKIA 4P3OA 4G5XA 3Q88A 3X3HA 1OAOC 3GT4A 5CIWA 1RAGA 3ZLJA 3H9UA 3NATA 3PUJA 4IPTA 1OT3A 4MHOA 1Y98A 2FWBA 1BEZA 1M2EA 4ALIA 4X00A 3ER6A 4K88A 4QUAA 5I45A 2Q3BA 3OHSX 3NHFA 1BWRA 1IY2A 3TQCA 4FDMA 4NMHA 3ZDAA 2O7NA 1WXWA 4C4SA 3A31A 3PE4A 4FHEA 1JFLA 3B13B 2WU3A 1V1JA 2BTOA 2PH7A 2GCOA 1M54A 2XE4A 4OF4A 4F12A 1FYDA 5HA5A 4FT2A 1TU4A 4E11A 2X8JB 3H75A 1XA4A 1WUYA 3H65A 3LLCA 1ZKMA 4JUBA 4MV5A 2IIPA 4RFLA 4DC9A 5TQVA 2GH1A 3UB2A 1U4NA 3LCCA 1E9RA 1J2JA 1D6MA 2QAGC 3RUDA 2D1QA 1N6RA 2WAXA 4JR0A 2PGNA 1QE0A 1MGPA 2Q2OA 1M1YB 1POXA 1VXRA 5DBIA 2D5LA 1IQRA 1JLKA 1ODJA 2EOAA 5ALEA 5MGNA 4RM2A 3QG1A 1YDGA 3EWIA 2XD4A 3K0FA 5FB3A 3UC5A 3WMEA 4A23A 1U9ZA 1D7OA 1H4QA 4PGHA 2GUGA 1RQLA 3DEKA 4YCBA 3L84A 2C0CA 3Q72A 4O4JF 4HNAA 4CMCA 3HU1A 1XZHA 2P2SA 3NIBA 2YWDA 3WZMA 5E8RA 1KI9A 3LDUA 1ODFA 2QUIA 2VK8A 4WCVA 4AFNA 5J3JA 3IDOA 3L0DA 1TZMA 2JVKA 1DMRA 3HKCB 4GOMD 4BTVA 4EJSB 4ZJUA 5KSWB 4MYCA 1BS2A 3TVTA 4P38A 4ZCRA 2OWDA 2AOTA 3HDTA 2OCXA 4TRRA 3RHSA 2X4DA 3PXBA 4RDCA 3PCXA 3PX3A 1DKNA 1IZ0A 2H2WA 4R9NA 1XVAA 4M6WA 4Z86A 4LN1A 1VHLA 5DM70 1K7SN 4HAWA 4RPLA 5H68A 2OHXA 2OMEA 4IJUA 2OLKA 4QLOA 4BVAA 4C0BA 1XQWA 3IX7A 3NAZA 3PJFA 4IRMA 4B5KA 4CI0B 2NUBA 1FQOA 4J4TA 4DS3A 1BMFA 3MTJA 4ZIRA 5B3JA 2HA6A 1CR2A 4E30A 4OJNA 1GR1A 3ZXXA 5TMPA 3TNYA 1QQTA 4NBNA 1N5LA 2WSSD 4NZPA 4MV1A 2MSNA 1O77A 2YZ7A 3SZOA 1J9EA 4MKGA 2GGSA 3V2HA 3QA9A 1N8SA 2XHEA 3KAQA 3OM9A 1W47A 4K3UA 1VC2A 1I6LA 2C5EA 2W6OA 5HDBB 1F6DA 1Y8AA 2P1DA 2E6KA 3QBVA 8ADHA 1NRXA 5ALVA 4CEIB 2GA8A 1RHKA 1N7GA 4IIFA 3FRIA 3NZEA 4N3AA 2BM0A 1OCEA 5J2TB 1ICIA 1GNQA 3W4JA 2OAQ1 4I8XA 1GPKA 3HWX1 4URZR 4MV0A 5FPKA 1N5OX 1NX9A 3LFUA 2JKVA 3UWOA 5F5XA 2O5RA 4AU1A 1S5PA 1XG5A 1C5KA 3GAMA 2WJGA 3WNZA 1PFQA 2H48A 3UHAA 4NJMB 5GADl 1ZHOA 2GTHA 2A5DA 5IUNC 2EKZA 1NJFA 3EMKA 1W93A 1QYRA 3AF0A 3C3JA 3Q2KA 5HUQA 5I7SA 4L75A 2RHMA 2I2XB 4J0QA 4NDNE