1T9ZA

Three-dimensional structure of a rna-polymerase ii binding protein.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
181
Chain Sequence
b'MQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADMLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLIMDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Structure and Mechanism of RNA Polymerase II CTD Phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 181
sequence length 181
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1t9zA00
1RKQA 2BDEA 1RLTA 2YMMA 3FPBA 5AVSA 4UMDA 4HGNA 3D6JA 5ALDA 4UM7A 3QUBA 2GFHA 5AI8A 1L7NA 2ZBEA 3IB6A 3NANA 1Z4OA 3A1DA 1AQ6A 2G06A 5AW3A 1CQZA 2G08A 2W43A 5AW8A 5ALEA 4EX6A 3TLMA 4C4TA 5AICA 5AW7A 3KBBA 2HI0A 2AGVA 2BDUA 2HF7A 3FPSA 5AKXA 3N1UA 3WGVA 2GHQA 1Z5UA 4QJBA 3NUQA 2MSNA 4XOUA 4HGPA 1RMQA 5AM1A 1K1EA 5AW9A 5AKHA 5AW1A 2HHLA 2Q5EA 2RARA 4HGOA 4NAVA 1YNSA 2I33A 2WF7A 4GXTA 3EWIA 5ALUA 1TJ3A 5JJBA 3ZVLA 4DW8A 4HAIA 3N5KA 4JB3A 1L6RA 3AR9A 2G09A 3I6BA 2R8ZA 4Y3UA 1WPGA 4FFDA 3KZXA 3ZWKA 4B6JA 1VJ5A 4OHFA 5AVTA 2O9JA 1YDFA 4AS3A 5AK3A 3AR7A 2Q4RA 1J97A 2C88A 4EENA 2B0CA 3QNMA 3WKDA 2IOHA 2JARA 5AI9A 4BEVA 2MU1A 1T5TA 1T5SA 3A1CA 2GHTA 4QQFA 5ALVA 4BKMA 2FUEA 5AI6A 4OFZA 3PDWA 3R4CA 2PQ0A 4OD0A 2WM8A 1RDFA 1Z88A 3FGOA 3ZUPA 5AW4A 4O8CA 4CF3A 2YJ3A 1RQNA 2FPSA 3SF0A 3WK7A 3CNHA 5ALLA 1YJ5A 3CZ4A 5AVRA 2B82A 5AKKA 2GMWA 3B8EA 5AKEA 4Y2XA 3L1VA 4UM5A 2ZBFA 2W4MA 3ED5A 4AS2A 1ZS9A 2P11A 1LTQA 3NAMA 4EX7A 2I6XA 4E88A 3KC2A 1RKUA 5ALIA 5AIAA 2YMPA 1NF2A 3DNPA 1L8LA 2CFTA 4YH1A 2G0AA 3MPOA 5AKGA 4BX2A 1VJRA 3SD7A 4H1WA 3EF1A 3SKXA 1N8NA 5ALNA 4J2TA 4FE3A 3IJ5A 5ALHA 3B9RA 2HCFA 5AKYA 2JGAA 4CF5A 2AH5A 2ZOSA 1RMTA 5A3QA 3B9BA 5AVYA 3A3YA 3J7TA 5AI5A 5ALZA 2G1AA 2FUCA 1L7OA 5ALOA 2HOQA 2G80A 4CE6A 3R09A 1QH9A 3OCWA 1X42A 4GIBA 4UMEA 2FPWA 3QU7A 1QQ6A 3PGLA 4UATA 3UM9A 4BEWA 3ZW7A 1RRCA 1LVHA 1U2SA 4Y2PA 5AM4A 2JAOA 5ALKA 3BA6A 2CFRA 3ZX4A 2WF6A 3W5DA 1ZD2P 2WF9A 4F71A 1Y8AA 3VAYA 2IOFK 3WKAA 2ZBGA 1ZRNA 4L6CA 3PCTA 2R8EA 5ALMA 5AHXA 3I28A 3N28A 1SU4A 2ZXEA 2YJ4A 4YIHA 3ZTWA 3L1UA 3KD3A 5AVUA 3ZU6A 3ESQA 3WKBA 3WK6A 5AI0A 4I9FA 4RETA 4IG4A 1WZCA 3WK9A 1WVIA 1Q92A 1RMYA 3WK4A 2B1QA 3U13A 3NIWA 1O03A 3ONNA 5E0OA 3QXGA 1FEZA 5ALYA 4G9BA 2HSZA 3ESRA 3L5KA 1Z4PX 2RBKA 3I1YA 1L7PA 4NWIA 1N9KA 2IYEA 2YBDA 2I7DA 1ZD5A 2JAUA 4L6AA 4FYPA 3ZI4A 2I54A 2WFAA 3E58A 3OCXA 3WKCA 3ZTYA 3ET5A 3BWVA 5AK4A 4NV0A 3L0YA 3OPXA 3I76A 1Z4NA 3IRUA 4YCMA 4YCNA 1Z4LA 1RQLA 3QU9A 4HYTA 1Z4MA 1EK2A 3F9RA 4UW9A 1ZOLA 2YN4A 4AP9A 3QUTA 1NNLA 2IOFA 2HO4A 1PW5A 2YJ6A 5A3SA 1ZJJA 3AR4A 4ZEVA 3MMZA 3AR2A 4BX0A 1RLOA 3SHQA 3QGMA 2YY6A 5AVVA 1Z4JA 2CFSA 2OM6A 3HLTA 4MWOA 5A3RA 2NO5A 2PR7A 2FPRA 3WK5A 3ZVMA 4Y2VA 1SWVA 3FM9A 2WHEA 2ODAA 3SLRA 3M9LA 4Y2TA 2ZBDA 3NASA 4Y2YA 5IT4A 1U7PA 1T9ZA 2FI1A 3N8GA 3OCUA 4UU1A 3WGUA 3N07A 5AVQA 5ALGA 1CR6A 2Q4TA 1L7MA 2R8XA 3ZX5A 2YFYA 2FDRA 3GYGA 3U7HB 3ZVNA 2OA0A 3W5CA 3UMBA 3E81A 2WF5A 2P9JA 3OTQA 4BX3A 2C8LA 3SKYA 3P96A 1KYTA 3QX7A 2W11A 3AR3A 2I34A 3OCZA 1F5SA 4J03A 1RPZA 2IA5A 2YMQA 3R9KA 2X4DA 5AKJA 4UAUA 3K1ZA 1QYIA 2B30A 3RF6A 5AM5A 5FP0A 3OCYA 1RLMA 3SMVA 1IWOA 4KNWA 4RESA 2NO4A 3L0BA 4EELA 3ET4A 3HYCA 5AESA 1YV9A 1VFPA 4BNDB 4Y2QA 3A1EA 4I9GA 4F72A 1WR8A 1XVIA 2AMYA 2PKEA 3FVVA 3EPRA 4C4SA 1JUDA 1O08A 3L7YA 1XPJA 5AW5A 3QUCA 3KOOA 2FPUA 2I55A 3ZWDA 3U19A 5AKIA 5AVZA 5ALPA 3EF0A 1SWWA 1U02A 3DAOA 5AM0A 3DV9A 1Z4KA 3WK8A 3U7EB 2HX1A 2YJ5A 5AW6A 1EK1A 2JAWA 2EATA 2QYHA 4UASA 4HGRA 1ZD3A 3AR5A 3WKEA 1S8OA 3E84A 2FPXA 4XPZA 4Y2UA 2HF2A 4KNVA 5AW2A 4NABA 4XQ0A 4Y2JA 3UMCA 2VKQA 5ALWA 2QLTA 5AVWA 4DFDA 3QUQA 4UAVA 2BY4A 1RKVA 1QQ5A 5ALTA 5AI4A 3L8FA 3L8HA 4ZEWA 4CF4A 1YS9A 5AVXA 5ALRA 3U7FB 1XP5A 4HGQA 3QU5A 2CN1A 2B8JA 2P27A 2YMLA 1QQ7A 5ALXA 5IS2A 3PGVA 5AKLA 2C9MA 1U7OA 2AUTA 3W5AA 4CNQA 4UU0A 4DCCA 3U7GA 5ALJA 4JDPA 1TA0A 5ALQA 5T41A 2OYCA 1NRWA 2EAUA 1TJ5A 5IT0A 2FEAA 3M1YA 5AIBA 3FZQA 3QLEA 2C8KA 3QU2A 2HDOA 1MH9A 4KX3A 5ALFA 4MUMA 4KYTA 5ALSA 4DWOA 2OBBA 2WF8A 4UARA 3L0CA 3W5BA 4BBJA 2NYVA 3MN1A 4EZEA 5AK5A 4UMFA 3UMGA 2P69A 5AM2A 4PNHA 4L57A 1U2TA 4UMVA 1TJ4A 4KX5A 4NFLA 5AK6A 3RFUA 5AKZA 3OCVA 4Y2RA 1Q91A 2R8YA 3NRJA 1L8OA 1Z4IA 4YCLA 3L8EA 2ZG6A 2RB5A 4BNDA 1S2OA 1J8DA 2EARA 3MC1A 4C4RA 3QYPA 4OCZA 1ZRMA 4XE5A 3E8MA 2HEGA 2DQSA 1TE2A 2B1RA 3KDPA 4G63A 3L8GA 2GO7A 2D2VA 3QU4A 2G07A 2B8EA 4YGYA 4KN8A 3U26A 3AR8A 2C4NA 1RC8A 3NALA 5AW0A 4BYGA 2O2XA 1ZD4A 1Z5GA 2RAVA 3S6JA 4YIKA 1YMQA 5AM3A 3AR6A 1Z4QA 3DDHA 4EEKA 4IFTA 4ZEXA 4Y2SA
chains in the Genus database with same CATH superfamily
2FGKA 1WMDA 1RLTA 2BDEA 3NH6A 2JCXA 3GI1A 4LVNA 3A1VA 2E1PA 4RHFA 1N2HA 1UQTA 1DWQA 3FNGA 4NPCA 5CB6A 1K7XB 1LDGA 2GD6A 2VDWB 2A3RA 2QEQA 3D59A 3EC2A 2OK7A 3P0HA 4J3FA 5AT1A 1T3LA 5JBQA 2CL6X 2QG9A 1WL8A 3O4IA 1EE1A 4NEHB 2PA0A 3W6NA 2G63A 4HEA1 3N2IA 2UUAB 2MMCA 2R6R1 3ICCA 1FS6A 1Y48E 3ZCUA 1R9MA 2GCOA 1I2BA 2JFHA 3HUTA 5DX8A 2WAXA 4PHFA 1XZLA 1E1CA 2DPLA 1RJGA 2GYWA 2K5UA 1OPXA 3EA4A 3I4CA 3RHSA 1U2QA 4B80A 5AW7A 3QLUA 2ZYTX 1EVJA 5EJEA 5AWFC 3VC3A 5CBKA 2AG1A 3WLAA 1D6NA 2A8YA 2OG2A 4HS9A 1KXZA 1Z28A 3EG5A 2OO5A 1K5PA 3AZQA 4H59A 3OLWA 3WGVA 3KEQA 2N1MA 4A1FA 4FGZA 1HFJA 4C20A 4K9PA 2QLMA 1XL1A 4YA6A 5EPUA 3WDSA 5A2GA 4N5NA 4XOUA 4JEUA 4QUJA 3UJPA 5HUHA 3CVJA 3LCMA 4ARVA 3RQSA 1RPNA 4IFIA 3HYLA 2DQ4A 4IZ6A 4DV5B 3NIFB 2IZ6A 3N70A 3QPBA 2MT9A 3PVSA 3UXYA 3PFIA 1MHPA 1TGYA 4Z7OB 7REQB 3BBLA 4HNGA 4GI2A 5H1YA 2PHZA 2YWHA 4ZGWA 3EIOA 4X63A 1ZPDA 1OOEA 1HI9A 1RCFA 5KVAA 1WZEA 1RRGA 3ZWWA 1RC0A 5ALUA 4ZK6A 3QW2A 3QXXA 2IZOA 4HDSB 4DABA 3ZLTA 2IZ0A 4KXQA 3G2OA 3AR9A 3B2NA 4PRLA 4CKYA 1I33A 1GPMA 4CI0B 5AHOA 1FOEB 3H6GA 3HWX1 2GH1A 2N1BA 2V7QD 2NQTA 2WDZA 1SUEA 4MW1A 2ZSAA 4DJ5X 5KNBA 3QNMA 4QLOA 3G2KA 1RYHA 2IOHA 1KAGA 2WJHA 4U2BA 5TQ2B 3E7PA 2ZI6A 4DHWA 1IUKA 3OM9A 3BQNB 4WX2B 5CMLA 1B8NA 1UODA 2FRVA 2J6IA 2FW8A 4N3GA 4RORA 4YR9A 3HP7A 5JVDA 3TF5A 4RCYA 4BNKA 1GYRA 7ADHA 3O8LA 4Q02A 1FRZA 3D64A 2WYUA 2LKDA 4K6HA 5DGDA 1LVGA 3EMDA 2V8OA 1ADBA 2VUIB 4WLFA 3TL3A 3T99A 3TNJA 1U3CA 2W22A 1USVA 2VEDA 1XL0A 4IUCS 2N75A 3DVSX 2R8BA 4UEKA 2XKKA 2W90A 2X4GA 5AMXA 1JQJC 1OGYA 3PBKA 1XTPA 2D1RA 4L5JA 3T35A 1KDTA 4EPXA 2B82A 2ZUCA 3NRCA 3IEVA 1Y1LA 3C4VA 2ZBFA 3D4BA 4JENA 4PHHA 3KPUA 3NEAA 3VA7A 1KTIA 4BPBA 3THSA 5K8UA 3VPBA 4EX7A 2I6XA 2W6CX 3OQNA 5AIAA 2BTQB 4RWEA 4DCSA 5CFNA 2XTJA 1NVDA 1QRAA 5CXSA 2OESA 1L8LA 3ABRB 2FK7A 5EE9A 5TPWA 2Z2JA 1M2VA 5B3JA 3RUAA 3WGYA 2TECE 1B6GA 4A0FA 4H1WA 3GPLA 1UPCA 4KLZA 3O8QA 5G3ZA 1I7QB 2QZJA 1VECA 1QC5A 4M55A 2ZUTA 3SEQA 4AUNA 2J59A 2XF8A 3L82B 4CGYA 1P2DA 2FUNB 3QNWA 5TQ0B 3VNVA 4JOCA 4BLOA 4JC0A 4YCSA 2O7SA 5HA5A 1T2VA 1E6LA 1YU6A 2QMYA 2O4CA 5E95A 5T6BA 1VPEA 2H4JA 4F5DA 4ZDWA 2X40A 1GA1A 5M7EA 3K70D 3NJ8A 3SYLA 2WMNB 2XLCA 2NSDA 4CI9A 5I6DA 3KB2A 3B1YA 2JGIA 3KU1A 4NCNA 2P90A 2F2TA 5KKNB 3SSNA 2WE8A 1TYCA 1E6EA 4II7A 1L3BA 1L7OA 2HNBA 2YJZA 4IDFA 3A25A 3ZGZA 2PKQO 3ZG6A 1JECA 4MVXA 3LHKA 2AI1A 3A6JA 1ZXLA 3O94A 3QWBA 1E1LA 5JCJA 3S5UA 2ZTLA 3WGKA 2BP7A 2FDXA 1H2FA 5HKBA 1UOEA 4MV1A 3UM9A 1HURA 2A4MA 1GZ4A 3FMFA 3R74A 3FE2A 4YJDA 1GGFA 1T1JA 2F1RA 5EUBA 3IELA 3SS7X 3TOZA 4J75A 4US2R 4V2UA 5HF5A 1LVHA 1UBLS 2A9QA 4ZAWA 3ZK7A 4E12A 2C97A 3PPWA 4OMDA 3KTFA 4MYCA 3F6BX 1G8PA 2VAPA 2WF9A 3QZUA 5HIKA 1DIAA 4ZC8A 1Q0UA 4EG5A 2CJYA 4NDZA 4XYEA 2JEZA 5HQJA 4MQFB 4W5QA 4N82A 4YLGA 3TD2A 3VAYA 4A0RA 3EPHA 1Y4UA 4FVTA 1U81A 4UBNA 1NZJA 1XOIA 3DHWC 4GX2A 3GOHA 4XOIA 3WC4A 4HAWA 3FGNA 4EB6A 2PD6A 5BSHA 5DNWA 1ZCJA 3ELWA 1KZHA 3VSBA 1D2HA 1HLGA 1SU4A 7REQA 1QYVA 5JNWA 2JIMA 3WBJA 1IVSA 3MMNA 4BP3A 5GADl 3COSA 4K9SA 5AI0A 3HACA 4KIWA 1D4AA 2BZ0A 2GX6A 2PXHA 3ILVA 3K0KA 4X90A 4EMBA 4GVLA 1WZ2A 3V6LA 3OIUA 3OA0A 2FYTA 3UV6A 3HK2A 1NP6A 1X7ZB 1VA5A 2C1EA 5DNDA 4JVSB 3H75A 3F4LA 4DYVA 4KO1S 3VR3A 2JFBA 3HYTA 2O8FA 4G84A 2JIQA 1V35A 2JHPA 2PR2A 3JYPA 3T9EA 4N5LA 2XTAA 4IY1A 5I51A 3LBIA 3LWBA 5CDUA 3OUZA 4P3KA 3FJ1A 4TWIA 1XYYA 3ISTA 4F3KA 5F2KA 5ELLA 3C4JA 1T6BY 3VU9B 1YMVA 4NJOA 2I62A 2PBRA 3SC6A 2R44A 1SUPA 3MS2A 4FLEA 3W8EA 1CBUA 1KDRA 1O6FA 1SC9A 5CLGA 4E09A 6AT1A 4KQ6A 3CRMA 3JW8A 4UC0A 5G1OA 2B98A 1IXZA 1NA5A 1U0RA 5ERYA 1YZQA 1N2EA 1SC1A 4UDNA 1B93A 3G9TA 4P31A 3RU2A 1UMBA 2GPWA 1JZSA 1QIEA 4G07A 2IBSA 3AVYA 1XEWX 4MLZA 1C3EA 1K5HA 1UM8A 4IDPA 1AF7A 2CLIB 3OPXA 4XUDA 5THQA 1ZGZA 3N2KB 4KRGA 4GMKA 3ETJA 3KUXA 1L5ZA 1M67A 1Z4LA 4PYMA 5B7PA 5C4MA 3V8RA 4RGYA 1ZR4A 3DD5A 4ETWA 3SYTA 1YOVB 1YB7A 3ASVA 3DFMA 4RVHA 3PLAE 5B57C 2NAFA 1NIJA 1NYQA 1X1BA 5KYVA 3A4MA 2NVBA 3I1JA 4H3VA 1KKLA 5A3SA 3S8YA 2HYIC 3JQPA 1ODIA 1NX9A 1MW8X 1SZJG 3B1JA 3K09C 1FXWF 3ZVRA 3TSWA 4CQJA 3BAZA 1RLOA 4NZMA 3ESCA 1BXGA 4WOCA 2VPXA 5CJ2A 2YY6A 2O48X 3LBYA 4CM8B 4CW7A 5AVVA 3AY7A 5TQ0A 1VB5A 1VJCA 2A59A 3GFVA 5L3SA 4ITUA 3W5UA 3WK5A 5CPFA 1CX9B 1U0LA 4ZU1X 1AHNA 3NDIA 4FHGA 5BV1A 3GRKA 1OYVA 4XDZA 4Y2TA 4KLCA 1MJHA 4NIMA 1G5FA 3KETA 3KNZA 1IHXA 1MFPA 3JD1A 4KQEA 1RXWA 2C4HA 4MGIR 2B4AA 2PS0A 3NHZA 4NX2A 3L49A 2BFWA 1CUIA 4JP2A 3MOSA 1GRCA 3LVFO 3RC1A 5CYOA 2VYNA 1PJQA 4HNUA 3ZVNA 3HJAA 5IVHA 1KOFA 4N7MA 2GKGA 4G3XA 3AM5A 3EXHA 4TZ0A 3ZHSA 3U40A 1OAAA 1E7RA 1AT1A 1YZNA 3PUHA 4JBYA 1P17A 2REOA 4JLWA 4A7PA 5KOIA 4U6SA 4WLEA 1M54A 1J33A 3SKYA 3P96A 1RHUA 1Y6GA 1E96A 4YV2A 2WC1A 3AR3A 2X6RA 1OIXA 4GOKA 1F5SA 4J03A 5L95A 2KLHA 3OZVA 3LA8A 3LW8A 5JPDA 3VRHA 5AKJA 1GGJA 3IUJA 3X2FA 1NT2A 4MQFA 4M1OA 3V48A 2QUZA 5ETJA 2J9GA 3B3JA 4Q37A 5JCZA 4RESA 9LDBA 1E3DA 1KQFA 2NO4A 4DB4A 5DIFA 1G6HA 3NX4A 4JOBA 4KYUA 3FI0A 4YONB 3K2EA 1QBGA 2Q5CA 2RJ3A 2VJNA 2YV1A 4DPLA 3TNYA 2C4TA 1OY1A 2I4RA 3PUWA 3MVEA 2PJZA 4PPFA 4RTNA 3II6X 3FA2A 1C14A 1YZVA 3OI7A 2VTVA 1WR8A 2PKEA 3JQ9C 4LJ9A 3CGGA 1AK2A 1JALA 3RAJA 1KARA 4BO5A 2EL7A 4IIVA 2D6FA 2JW5A 2Q4DA 2M6RA 3HADA 3L7YA 4L5BA 5FYQA 3TINA 1FYXA 2OB2A 2Q8NA 2DPGA 1U94A 2JGDB 4JQCA 5AUOB 3JAKB 4MS1B 3PWKA 2JK0A 1C0KA 3L41A 3U1TA 4NS4A 2YRWA 4BKPA 3ZH9B 1NVVR 4GI7A 2HBQA 2BFOA 2DR3A 3O95A 1V47A 2NXWA 4J1TA 4B81A 4QYXA 5K0FA 4FHDA 4P98A 2I4OA 5CXXA 5FDFA 2IL1A 1LLUA 1GRQA 2JAWA 2FLKA 3VU9A 1ES9A 4XQEA 4ZXFA 3PD7A 4RY8A 1ZUNA 1P1CA 1RXIA 4BGUA 5HK8A 4R1UA 3GLGB 1CLUA 1QU2A 1WNFA 5CH5A 3NVMB 4ND1A 4U2EA 4LYJA 4XM0A 3GZNA 4Y2JA 1XTRA 2YQ4A 1RU3A 4BQEA 5IDQA 4IF4A 4QAJA 1RXCA 2W6NA 3FZYA 1O94D 3GFPA 4OXNA 3WXBA 3BIWA 3EY4A 1DAMA 4R1TA 2O8DB 3N2KA 2IYFA 1VG8A 1RWVA 1DQZA 2FPGB 3T3PB 4GQIA 4OQNA 2FX5A 3EZNA 4IHAA 3RYFB 3UW3A 1FL9A 1ZMTA 6GPBA 5J23A 2HLPA 1Y1SA 3CE9A 4QOJA 4TLCA 2EZTA 2B25A 3A9VA 3PC4A 3OEEA 4RGBA 4MEAA 2BJVA 3DMHA 3I05A 2PV7A 3G68A 4Q1CA 5CDFA 1MO2A 3BORA 4J90A 1XTZA 3EWNA 2KQUA 2Y1WA 4BFCA 3NYQA 2RK4A 4E7OA 5IC4A 2F1IA 1PJZA 3MJFA 4BLVA 4N6GA 3A9RA 4IZIA 2P27A 5JNUA 3A37A 4CM8A 4I1RA 3RHZA 1IY2A 5C80A 2ECQA 4WBNB 1E6CA 1E1KA 1RI5A 3Q87B 3E9RA 3ND6A 1CYDA 2VQ3A 3HLKA 3F4BA 4HB3A 4W1PA 2BYTA 3WS7A 4JI1B 2XXAB 1JTFA 5ALJA 3FTDA 1TA0A 4ZVRA 1FJXA 1NLUA 5K0TA 1MGPA 1HORA 1QP4A 2FWJA 2OOKA 3Q72A 3TM4A 1K66A 1Y0BA 5IT0A 1IY0A 3QPDA 3KU4A 1HDCA 3KXLA 3B6EA 4FYIA 3U4HA 2B37A 2DECA 3PIIA 4INAA 4KO4S 5LLTA 3F7NA 3GY0A 1YVRA 1QF9A 1ZU5A 5K2MA 3SY8A 5ALSA 3TFOA 2B7CA 2RGNA 4LHVA 1AM4D 4MVJP 1Z6GA 3L8MA 4QQKA 3OX2A 5E1DA 4P4SA 4LOHA 1GZ5A 3GNSA 2RHCA 4D8UA 3GJ8A 1JZQA 4MWCA 4OQZA 5FFNA 3K6SA 3KUCA 2ZUSA 1B3BA 1OU0A 1X8JA 1WP4A 4GYKA 5LIRA 2Z2IA 3IT3A 1IG3A 4X41A 5AH0A 1AS3A 2XTNA 4L57A 5GM2A 2Y0PA 3E3NA 4HADA 4GXNA 1SOUA 1I01A 2RGXA 4ER0A 4IUDS 3A27A 4E5VA 2RK3A 5J4KA 1IH8A 4TS1A 5AHKA 5FRDA 4II3A 4XQGA 3MUFA 2V7VA 3ZNOA 5JDCC 1CE8B 3AGQA 1SOVA 3Q6IA 4R83A 2D8MA 2WJPA 3OMLA 5JS2A 3ADPA 4BKRA 4JI7B 2XNSA 5IVIA 5AD1A 3I62A 3H9JA 4KREA 3ZDRA 3HCCA 3BHJA 1YUNA 3CRNA 4Q7EA 1JR3E 3EOZA 3QOXA 4BJ1A 2I6UA 5GAJA 1M8GA 2DWQA 3BF8A 4MYHA 4WI1A 4ZQGA 3QYPA 2BFFA 1AS2A 4LY0A 5AVJA 4K46A 4ZCLA 1OA1A 3JVUA 3K6KA 3O4RA 1RRKA 3PDIB 4ME6A 4QULA 1M5RA 2B1RA 1LQTA 2ZI3A 1SVKA 4M1MA 1BQ3A 3GPDG 1INLA 3JAKA 3OFSA 2QXUA 3PUXA 1KJNA 4MS1A 2YHSA 4QA9A 4X6LA 4CV2A 2CNDA 2JKVA 2NV2B 3OZIA 1P7WA 4H27A 4JVMA 1E59A 1T9KA 1S5PA 4KN8A 3F6EX 2XUKA 3B1XA 4UD2A 2HQOA 2I7XA 4IHKA 2QP9X 3SG0A 1UJ2A 1LNSA 1MU0A 5EE3A 4ETNA 4RK6A 1I7DA 1Y6ZA 4UUPA 1BWRA 1KY5A 1WVMA 3L18A 5KTKA 3H8WA 3PYXA 2HJRA 5FQOA 3EZLA 1OFUA 2VUUA 3URMA 4AF7A 4CM7A 4D4IA 4JLMA 3SIWA 5EHIA 4H3KB 3QYFA 1XRRA 3AP1A 4DSOA 1CJVC 1Y8RB 2VRWA 3LPDA 1SG9A 6PFKA 1NW3A 1ZEJA 4JUAA 4WECA 2DTDA 2OHJA 1RHKA 1FUUA 5EIAA 4M46A 1MAVA 2OFOA 1DBWA 2FOLA 2O3UA 3CVVA 1Z6AA 4BXOB 2JJ8A 2YN2A 2E6KA 1RJFA 1GCGA 2HL6A 1VLHA 1JE1A 3NNNA 3GG9A 2R1VB 3R4VA 3VYWA 5IUNC 1J39A 5U1PA 3FOAA 3T3NA 3HXTA 2ZYWX 3FWPA 4GBMA 5KU1A 4DZTA 1X3SA 2I2CA 5AW3A 4NU5A 4ZZ3A 1PS0A 4EB8A 2I6GA 2E4VA 3E23A 5L7WA 4OAOA 2WQZA 2I78A 1JKJB 1V6AA 2MTBA 4KHPB 1UKCA 3WQQA 1ORWA 1L7BA 1X1CA 4XD7D 4Q3LA 2X3UA 4FKMA 4WZAB 3TFWA 2D2FA 1TVKA 3G2MA 4QE3A 2WWRA 4ZRMA 4UHEA 1TM3E 3KXIA 1UC5B 1MX3A 4F3CA 4RJJA 1TZMA 3WL7A 1FJ2A 2R6AA 4HRAA 1SOMA 2BGNA 4M0KA 1AQNA 2ENWA 2GYUA 2IYOA 1XDUA 4HBGA 1RMQA 1A4IA 2O2DA 5HF6A 3C45A 5LZ8A 1QQTA 1BYUA 2X6QA 1UT8A 3GAAA 4XGRA 5LL6P 4MGYR 1AG9A 2GF9A 4PZEA 5CT5A 3EG9A 1Z25A 1VDZA 3ZHZA 1D03A 2IYTA 2QN9A 3HH8A 1KQGA 1M0EA 3PKZA 4C4YA 1CVRA 1KAMA 1RZRA 1DUVG 3I73A 2G9UA 3HY3A 5TNXA 5A5DA 4G0UA 1NOKA 3GELA 1C41A 3D8NA 3MINB 1LPOA 3MW8A 5TGDA 4LSZA 1FMLA 1T6NA 4X91A 3CTMA 5KZMB 3QKTA 3OAAA 3PPVA 2HIAA 5DM70 2N0SA 4JB3A 5D5HA 3O90A 1Q1AA 1BXRA 2A5GA 3GVXA 3IBTA 1VZ2A 3DEJA 1L1RA 3CEJA 4FFDA 5CYGA 5KIAA 3J80A 3LDAA 1R7RA 3OZGA 4C87A 1ETHA 3AR7A 4V0LA 4CKEB 4R0VA 1JR3D 5CA1F 4KXFB 4XWWA 2QSYA 2Q3BA 4KBYA 2P9CA 1K6JA 1DV1A 3NNSA 2VDMB 4LCEA 3GO4A 3PFBA 5L6MB 2GHTA 2ZRKA 2AHRA 5ALVA 2BHRA 3DFZA 1MA3A 10MHA 3DZJA 1ML3A 2WA2A 4AJJA 4G9EA 2A5DA 2CF6A 3C48A 4NK5A 4TRJA 1A98A 2PGAA 2ZYRA 4W99A 3ZI0A 4M88A 2XB2A 5EL0A 2GFQA 1AUXA 3LA6A 1NUPA 3CW9A 1NN5A 4FSXA 1YR2A 2EIXA 5F9HA 4XCVA 2EBUA 2WWYA 2P77A 1WZNA 5AVRA 4CM1A 2GN0A 3B8EA 4JS0A 1D0SA 2IKSA 3AU8A 1G6KA 2EJWA 2YASA 3UUGA 4UFNA 5IZCA 2DFVA 4WERA 1TKCA 2OHVA 3VNAA 2FY8A 1OASA 3O74A 2YUIA 3GUHA 3H3XA 1L9XA 4OGLA 1U3TA 5NULA 2QYOA 2GCIA 5AKGA 4E1BA 1MEEA 3RU7A 2UVQA 1JBKA 4HQ6A 3CLVA 4OF4A 4OPMA 3OEWA 4L3OA 4BBAA 2JGRA 1LGYA 3CRRA 4QFDA 1G4UR 4OXYA 4RJLA 3WL5A 5GJCA 1LW7A 3V97A 4HNSA 5LVAA 4EI8A 3Q8MA 1DUIA 1ZSNA 3AIIA 1FPMA 1UOPA 1LEHA 1G291 1IZ0A 3RRYA 2OORC 4J16C 1ZBQA 1UBHS 2HSGA 2GPAA 1J09A 2HOQA 3E9DA 2WNHA 3BFPA 1HX7A 3DPIA 3OCWA 5ISMA 3QU7A 1Y9JA 2VK8A 4CCWA 1WB9A 1A76A 1SZDA 1CEYA 3V4SA 2C3UA 4Q9DA 3AVWA 1G21B 1T9GS 1MO3A 4FGKA 1VHJA 3O0DA 1E0SA 1W85A 2LIPA 2FJ0A 2Q99A 2PZKA 2OVBA 2BHNA 1YKGA 4QXPA 5JLAA 2GPJA 4WA8A 1UXKA 1Z3IX 3K0AA 3NTOA 1Z0AA 4OP1A 4EA9A 1YCGA 3R3SA 5CVEA 5BVHB 1NKTA 3TW4A 1EVKA 3CZ9A 4B35A 2QJOA 3W5IA 1AD2A 1HQYE 1DXOA 1X87A 1OIVA 1L4KA 3MTDA 1KP3A 4B5KA 1CB0A 3NTVA 1EQ2A 2R8EA 3BDVA 4UEJA 3T15A 3FOBA 1AZTA 1VSQA 4URVR 1S9HA 5JNRA 1RPAA 2V6IA 3H42B 5BORA 5K3FB 1VA4A 3GEHA 1KNXA 2JDIA 5AVUA 1M33A 1TQ8A 1PZFA 1C3JA 1NC1A 1JLLB 3PPIA 4P84A 3MINA 4DF3A 1CSEE 2VAMA 3KQUA 3RHFA 1ZC4A 3HGMA 3K0CA 4R2IA 2PNJA 3PEEA 4D25A 2DX7A 3CWZA 3DLCA 4A8JC 3D3NA 3L8CA 1IU9A 1J0DA 4PSDA 3EHEA 3RYHA 3S70A 1MF7A 4R40A 5B7QA 4HLUC 4ND7A 4RXTA 4G89A 5EJAA 1RVDA 4HS4A 4AIRA 4ALLA 3NYRA 4CKEA 1QO7A 1SCQA 3ER8A 3FLBA 4WKGA 4D5EA 1VL8A 2HUPA 1I6LA 2JGEA 3AUKA 2B1GA 2M32A 3A14A 3P9SA 5D00A 4CTNA 4JUFA 3FUXA 4X9XA 3MCUA 4GSLA 1Y7LA 3EIQA 4D0RA 1E94E 3OECA 3SXUA 1KKUA 1OTYA 3HDTA 2WYIA 1QDLB 1L0BA 221PA 2MSKA 3HG7A 3I12A 3IV7A 2JG3A 3ITDA 3CW8X 4AKGA 3OCXA 1G17A 3WMXA 2CC2A 2Q5FA 3CVYA 1MX5A 3AVTA 3EPLA 3BK1A 1BHSA 1G5PA 3STWA 4YAUA 3L0YA 4YRPA 1PKXA 2COUA 2I3AA 4XWTA 421PA 3GROA 3IIKA 3ZXYA 3LS2A 3UZUA 1SA0B 3AUSA 5ELMA 1SBTA 3QU9A 1M34B 5G02A 3OOSA 2W2OA 1Z4MA 1Y7TA 1O4WA 5A4JA 1TYEB 2NV0A 4L15A 1BWQA 3QV2A 3I2IA 1QIFA 1ZA1A 2FMFA 2OP1A 3K05A 4KUHA 1CULC 3MBOA 1P39A 4PU0A 3GEGA 4XJTA 3IL2A 2DQKA 2WT9A 1M9NA 3PUYA 4HY3A 2BMEA 4AY5A 3H2YA 2F9LA 2N46A 2VQ6A 3AUTA 5FNVA 3QEBZ 3AVVA 2O52A 4G4SO 3WOVA 3IQXA 4PONA 2OK8A 4OO3A 1UT5A 1I36A 1V5GA 2WOJA 3CPSA 2CE2X 1HMYA 2VSYA 1CY2A 1H2EA 1N25A 1QHFA 5DT9A 4D3FA 4RANA 4MIKA 4MO2A 4TTVA 5LQDA 1JB1A 4G8BA 2XZDA 2H29A 2XA9A 1Y8CA 2R5WA 5LIPA 3IEMA 4UULA 1A96A 4E2WA 2ZBDA 3PNBA 2ADFA 3ADKA 1GXSA 3A31A 3WISA 5IT4A 3WGUA 4PG7A 3NKFA 1TIBA 1UKZA 1V6SA 3U4CA 4IS2A 2IOYA 2P62A 1EGQA 1GPDG 3CX7A 4PINA 3ZX5A 3ZW9A 4ZI7A 3BIJA 1LLCA 3CLTC 2FDRA 2KYRA 3OZDA 4C6SA 2IIVA 3QVTA 4RC9A 4YVFA 4DBZA 1UBGA 3E2MA 4CLRA 5K7SA 5KBYA 5DLQC 1RAGA 4K3VA 1X86B 1B00A 1ACLA 3EVDA 1VSUA 4Q1VA 1Q3KA 4IDQA 3RIGA 2W00A 4LGYA 2R65A 3U9SA 3AOGA 1FRVA 2TRSB 5JAOA 1FRQA 1PTJC 1E2GA 2YYSA 3FOCA 2CUZA 4M9SA 1X0VA 3ZHUA 5B55A 3IBSA 2AE2A 4BMDA 2MSEB 4DXHA 3D3JA 4DR6B 4D9KA 3E3AA 3MJRA 4PLGA 5BSEA 3E0XA 5DXFA 4NOMA 2NUPB 2ZPUA 4EK9A 3KWMA 1E1QD 2VZ8A 2JZNA 3KEMA 4BLSA 2WHPB 3IURA 4MVCA 3BF7A 2WMOB 1GFSA 5SY4A 2IXTA 4ND8B 4RZHA 5IVDA 3M5CA 1DV2A 1T9AA 3LX4A 4X64B 4P2GA 1HYQA 2BHTA 3N3AC 4CMIA 1PJLA 5J4LA 3NDBB 2C4KA 1EA7A 1A4UA 5K3FA 2WP0A 2CXHA 4I5EA 4Q4JA 3ZGLA 3QE9Y 2YZKA 1W9MA 2P3OA 3BGIA 1J9EA 4X0EA 1EFRA 4U1RA 2YHBA 4P2BA 1P3Y1 1THGA 4JT2A 5T4FA 3PX7A 4EKNB 2WJIA 1JHYA 4KI7A 3A6LA 4RWZA 4XTCS 2A0XA 1YI0A 4JD5A 2DBYA 2QMUA 2PANA 3AUXA 5F21A 1XJ5A 1TAHA 2OCDA 3HA3A 3IQWA 1IEQA 2V9CA 1XLWA 1R50A 1YIOA 3D6MA 3H9GA 5EXXA 2OHXA 4BO9A 4C03A 2C04A 1XD8A 3DO8A 3DLPX 4NNJA 3WG9A 3T52A 1ISJA 2OTCA 4RPGA 3TR0A 1ZNZA 1V5EA 4Q1FA 5F7JA 1JZTA 4UUBA 2A4KA 2L19A 3MQFA 3PVCA 3MJTA 2JD0A 4H6PA 2EV9A 4OHKA 3WKEA 4XM2A 3A1WA 4IWXA 2Z58A 4PFJA 2VTKA 4J94A 1JXQA 2HV9A 3RH0A 1N1GA 2OHHA 1BD3A 1DKUA 4U7WA 3T9CA 3BYZA 2LZ0A 2TS1A 1B2LA 2GEUA 3FKQA 2WJYA 3IAXA 2ARKA 3N59A 4BGVA 4DFDA 2DEUA 2ID7A 3MCWA 4BNLA 1XJWA 4P1ZA 1H2HA 3LPMA 3TFQA 1TK9A 4DPKA 1EH5A 2UVPB 1DKOA 4M0FA 1SA0A 3PDHA 5DP1A 2VIIA 2OZLB 3SHVA 1EESA 1NOIA 2PCLA 1S8FA 1AO3A 1ZCZA 1LI7A 3FHOA 3KJZA 4LS3A 1KI2A 1OKKA 4TRNA 3KOYA 1U04A 3DEKA 3ZS8A 3UBTA 3T1YB 4CF4A 4D4MA 1EWKA 5AVXA 1SURA 3CXUA 1AGRA 3DOHA 4YMLA 1XP5A 4JLOA 3HJFA 2ZVJA 3QU5A 4IWYA 1OMOA 3DMDA 1C8BA 1YDHA 3I6YA 2OBLA 4AJNA 3MWGA 1SXQA 3PA6A 4LN1A 3WMWA 4E03A 2I6TA 5TY0A 2P78A 4EZBA 1XVVA 3CZ5A 1G8AA 1WU7A 1O97C 3G49A 2Y27A 4RVNA 5D3KA 1VLQA 1R0SA 1ULTA 4LJ5A 2ZRBA 5GZ6A 1LSJA 2D2XA 3OU6A 5BUQA 2BBOA 2JFGA 2P0EA 3OIGA 1G66A 4OGWA 1W4BA 2QAIA 1UINA 2H3HA 1CUWA 4MI6A 2EFYA 5BVGB 1MIHA 2MYTA 3T7EA 3I01M 2WTBA 4E2FA 3GP5A 3JWEA 3I5MA 4NBSA 1G1AA 4S05A 4DWOA 1UJNA 4KYTA 3B85A 3FF4A 1E2QA 2W7TA 1JVSA 3AFOA 4DILA 3K9HA 3RBAA 1OB5A 2I2BA 2R4TA 3QVOA 2ZTMA 1CUAA 4UHCA 3UJ3X 3G0OA 4YJHB 5G0UA 1KGDA 4D41A 3MN1A 1J8YF 2L82A 3ONDA 4IRUB 4JFAA 2IHZA 2P9EA 1Y4DE 1KDZA 1U2EA 1F7UA 4K6GA 2QLNA 3I42A 1XQ9A 1JH9A 1YQWA 3WFJA 3B2QA 2YS7A 1W93A 4XVCA 5CDGA 2W6ID 2DERA 4EZIA 4KX5A 2WHPA 1YZUA 3O47A 4YP5A 4ENPA 1YASA 5JEEA 1X7YA 3ZJ5A 3Q0IA 3ITEA 2Y93A 3AG6A 4HN2A 4MQMA 4NCBA 3QWHA 1EWRA 4HDNB 1T8UA 3NIBA 4PO8A 3LRPA 4HLQB 1HE1C 1JDVA 5K05A 1PWEA 4TMFA 2V74B 2GAFA 2JIOA 5BN3B 2IDMA 1WXDA 3L6DA 4NHEA 4RDHA 3RRXA 5CFPA 2DETA 4KR9A 1W46A 3Q3JB 1R0ZA 3KT6A 3LKVA 3AINA 2H85A 4JAVC 4RSRA 2ZBVA 4IMPA 1H1LA 2QLBA 2JASA 4D4LA 4DY4A 5KOYA 1JPVA 3L1KA 3LQFA 4DJFC 3PHCA 3GK3A 1JLHA 1NG1A 1R0KA 4GI1A 1SU8A 3CVWA 1WAMA 3Q3CA 4LYDA 2CMHA 3RF7A 2DPYA 2FW0A 4YN3A 2ORVA 2GERA 4AUEA 5EP2A 2HJ9A 1BCSB 1QANA 3ANTA 4UD6A 4CKWB 4RTMA 3JVDA 1KPHA 3TGWA 5KVQA 2O3SA 4MR8A 4O8ZA 4TS9A 4NECA 3GRFA 3BN3A 4EG3A 2C4NA 4M9CA 1QH1A 3T95A 2Q2NA 4URUR 2X14A 3IKJA 5GZ3A 4CTMA 4H08A 1G7RA 5JEDA 2C1ZA 3V34A 2P5SA 1WSWA 2RAVA 2Q5OA 2EW1A 3DWEX 2C9DA 1VIYA 1VXRA 2WE7A 1ZM7A 3S6JA 3JSAA 3UCEA 4DRXA 3LNTA 5I7SA 1F60A 1ISPA 4BZQA 1OFGA 1Z7EA 1O0SA 1UM9B 1YACA 2IZZA 3U3JA 4EIWA 2O7QA 3INGA 4NQZA 1IONA 4KLRA 4ZEXA 3FAZA 5AJWA 4J7XA 4AN1A 5BYBA 1KSGA 1UXGA 1X8KA 4WKPA 1HE3A 3R8FA 2DHDA 2CVHA 2ZJZA 1NJSA 3VYTB 2C03A 1E66A 2BFEA 3NQ41 4X7RA 2CJPA 5ICGA 1TLTA 3QVGB 5LNK1 2G5TA 4HFMA 3QYJA 3AEUB 3NANA 3IVCA 4JGIA 5JYEA 3A1DA 4QRDA 1UBJS 4FEYA 3RK0A 3TRJA 1MKYA 1PX2A 1R6DA 8ADHA 2I0FA 4FMCB 3EEIA 1X2EA 3NGXA 3BM5A 3O3MB 4G8JA 4L1KA 4N0PA 3B12A 1K3TA 1XVLA 3PCRB 2AXEA 4TV8B 3DZDA 3C8ZA 1N0IA 3AUAA 3V3TA 6Q21A 4RZXA 4J76A 4ZQBA 3MELA 4B9AA 3ZJVA 2XE4A 2YYZA 2OFWA 4LDPA 2DWCA 4LRTB 2R9VA 4PZ0A 4XRRA 1UWLA 3HCNA 4FFPA 3ZWYA 1XAJA 2O1XA 1DAIA 2OLJA 2PGJA 4QTXA 4M53A 2O3QA 7AT1A 1EJBA 6ADHA 3FLMA 1PJRA 5BOSB 2NTYC 3EVBA 3WAKA 3A6FA 1ABEA 4PO9A 2XTZA 5AXBA 5BVGA 4F2PA 4AULA 1ML4A 3BRWA 1KDYA 2XJ9A 5KQLA 4JI3B 5L7TA 4ZYUA 3DMGA 2RARA 4N6NA 3WDKA 3PSAA 5M34A 1Q1QA 5K8CA 3R8CA 1Y1RA 5KPJA 1C9MA 1M8JA 3IXMA 2VJKA 2VK1A 5BNWA 3UIEA 4F2GA 4RV4A 2Z98A 2AC7A 4PPQA 4NBTA 3IESA 2G25A 5F64A 5FOTA 4CMHA 1QMPA 3SSOA 1HTTA 3R5KA 1P74A 4R2JA 1BJKA 3RREA 4C89A 1CU1A 2LIVA 2CV1A 1OAOA 3HBNA 3KQVA 4FLMA 4OHFA 3DEAA 4L75A 1DJOA 4AS3A 3L0OA 3ZY4A 1N2SA 2P2ZA 1TI7A 3LXUX 2VYVD 3MERA 1R5BA 1B8PA 1C4KA 1DQRA 1NXSA 2M6SA 3FTPA 4M76B 2OHIA 3CNNA 3U80A 3IQFA 1KYZA 1NBIA 2FG7C 4H18A 5DW0A 5AI9A 5HFJA 4ZD6A 1A50B 3V32A 4Q4CA 2E55A 5BN3A 3A1CA 3NOXA 1F12A 1NQVA 2AN9A 4LPSA 2WEKA 1JG4A 3VOAA 3OLQA 4WVLA 1W76A 2FUEA 1CRQA 2HH9A 3P7MA 4C4XA 2GHRA 1P2FA 1NQUA 4OD0A 4CLEA 4FCWA 3FGOA 3ZUPA 1MQAA 1OC2A 1XFDA 3DR5A 4RCVA 3OD1A 3L02A 5JXWA 1HDIA 3PHLA 1Q44A 5BURA 3MEQA 2QM7A 1FLVA 5B53A 1DLIA 4C7OB 3PR2B 1E2LA 1M2OB 3CZ4A 5FPSA 4NJMA 3WIDA 4Z86A 4CMKA 4BP9A 3ICQB 3OOHA 3GDFA 4O2BA 2ZYUX 1E5LA 3I2KA 2G82A 4NAHA 1MTZA 4RAQA 2P2YA 2PZBA 5G4LA 1KYIA 2P5TB 4HVAA 4WFQA 3GBPA 1UBNA 2E85A 1MQ9A 1HGXA 3WO0A 3Q8LA 2CYCA 2PBFA 2GXAA 2C96A 3IVMA 2XIQA 4WQMA 4BQPA 4AMBA 1JP7A 3KKOA 1LBQA 4YH1A 4UUNA 4JLUA 4QREA 1P77A 1IIRA 2O2GA 2O8VA 2BMFA 2OILA 2BKXA 5BMVB 1N6NA 3BXGA 4R6XA 1JLRA 3V80A 5K6TA 5DHPA 1PFWA 3H1BA 4Z9FA 1TF5A 4KSYA 1RAAA 2WHQA 1G8FA 1UM9A 2VS1A 4RH0A 4B8ZA 5BSFA 4Q4HA 4IS3A 1Y6RA 4LHWA 5KVCA 1J5PA 1E77A 1XKLA 3FROA 1OFVA 2W83A 4DNOA 1VCIA 3B48A 3OE7D 2QIPA 1XC7A 4MR7B 1A77A 2WTXA 1HEYA 3GUUA 4KE7A 5GONA 4AMGA 2ZIFA 1N1MA 1U90A 2O54A 1UJ6A 3OP4A 4HH3C 4GBED 3MF4A 3QVGA 4BZZA 2FFBA 2ZB8A 3U1BA 3G0GA 3BXFA 4CV0A 4LI0A 5JVDF 3FD8A 1KDPA 5ALOA 1DJMA 2OV6A 3G59A 3LGSA 1KYYA 4NESA 5IBCA 3JPYA 2IYNA 4MNTA 3K53A 1OR8A 2CZGA 3D5TA 3PIDA 3C1UA 4IJKA 1IB6A 1QH9A 4KJXA 2CV0A 2FSVC 4NMXB 1DIGA 3I83A 4WLNA 4MPRA 2O3RA 1EBUA 4WFJA 2NU9B 3UWKA 4JUDX 1UC8A 1Z0DA 3C3XA 4TV8A 1QOPB 3W6ZA 2CNWA 3WNCA 4BEWA 2CL7X 3W7BA 1JG6A 1RXSA 4ZI5A 2Y1EA 4B2YA 5BN4B 4B4WA 3MTIA 3BE5A 2PKYX 2VBFA 4PIPA 1H65A 3KSZO 3S1AA 1W52X 1SXJE 2L42A 3AVQA 1GOTA 5M3BA 3QE3A 1AQUA 1U2DC 2CHQA 3LOQA 3OPVA 4KFTA 4RY9A 1WW3A 2WR8A 3LWNA 4DLUA 2RSLA 2DT5A 3BZWA 1CK4A 3W2FA 1A8PA 1Q2UA 4P3OA 3UV7A 3CF6R 1RKXA 2GPYA 4JUIA 2YVKA 3QLJA 2J6CA 5GQSA 5IUKC 1T5DX 5EUMA 4ZODA 3UJNA 4X62B 5H82A 3WGZA 4CGZA 5I7OA 1BDMA 1PFKA 1SQ0A 3FVTA 2H1SA 2VP4A 1GDHA 3R6WA 4WCDA 4BEBA 4CYMA 3WGNA 2G3YA 4RETA 4FD3A 1PLLA 4FK8A 1BRTA 2QU8A 1DAEA 3S2YA 2NPIA 2YV2A 3GLKA 4XYMA 3GJ3A 4J1NA 5H3CA 4IQ8A 3DTVD 3V4OA 1JW9B 2QOEA 1UDRA 5KNBH 3K16A 3DM9B 4CCAA 3CZQA 3RM3A 5C81A 4TTIA 5EMHA 3CX8A 4CG3A 4K9RA 1PWXA 2QV0A 3RAFC 3D31A 4E30A 4J3NA 3ZDYB 1DG9A 4YYEA 1QZZA 4G9BA 4EO7A 4X7BA 2HHHB 2GEDA 2MCFA 5FL7D 3B7PA 3FIUA 4OGFA 4MMZB 2P5YA 4ZO9A 3V8EA 1Z4PX 5JSHA 2HRCA 1EB8A 5K3CA 1ZKMA 3IXLA 3KUUA 4J7AA 1M74A 1NU6A 1Z62A 2JHFA 3HJNA 1WQ4A 4EPRA 1GLNA 1FDTA 2GAIA 3UHJA 5ICMA 2KSQA 4MIOA 1ZRHA 4X60A 5T7BA 3L93A 4MWZA 3ROMA 1N75A 1W4RA 1OBOA 2C0QA 3IP6A 4LAFA 4PYJA 1TU3A 3T7SA 1ZHHA 5CW2A 4YI5A 3QLUC 3AEQB 3B7WA 1XNQB 3S2EA 4YRRA 1SGWA 2H07A 4PBTA 1E2IA 1WPXA 3BWVA 4HRYA 1M2OA 2OO5C 1BD4A 3I76A 2O7VA 4O63O 3ZWNA 5KNDH 3MTEA 5JDIA 3PEWA 4JYCA 4AJOA 1Y5MA 2LBPA 3QMVA 4B3XA 5JHHB 1DAOA 4PHGA 4F3TA 3N87A 1O95D 3VVLA 1F17A 5HRCA 4Q7QA 2QY9A 2PH5A 3SICE 3UYKA 2EGGA 4QBIA 2P0AA 5GINE 1Z8NA 1DQNA 3ZE8A 3EB9A 5CM2Z 4MJ3A 4BNFA 2IGTA 4HNHA 4PLCA 2IS1A 3HXLA 2Q6IA 4LRSB 3H87A 5C3MA 1EHYA 2O2IA 3B1KA 3QVLA 2CFSA 1GLVA 3K9WA 1XZAA 3LY9A 5A3RA 2FMXA 2R25B 3UEOA 5E3HA 2OBXA 1FTYA 3JQ6A 2V98A 3HYNA 4DA0A 1LPAB 1JFLA 3O2JA 1Y6FA 4MQLA 3ZCPA 1E4EA 1VPWA 2C5GA 2ICAA 1DRVA 3HJRA 1O9GA 1R6XA 1RADA 2VSNA 5JH7A 3QVUA 1Y63A 3PQDA 4KAXA 5CU7A 4TN1A 3HGTA 3EHDA 2P2CA 4NY1A 2XVYA 2A94A 3COWA 4V0MA 1SXJD 4D97A 1IUPA 1WKCA 1CNMA 2CXNA 2IZ1A 4R3WA 5FLKA 4G0QA 2V7BA 3TOSA 2NU9A 5EZQA 4DWJA 1F2VA 1UJ5A 4IKOA 5B3AA 4KWTA 4A2QA 3CLUC 4D6YA 5P21A 3G9UA 4YRSA 5IAKA 5JE8A 1C50A 3TD9A 4IDCA 2EJBA 2FZ4A 3R0ZA 4XWOA 4MS3B 1E0AA 3VPHA 2MDTA 1ZGBA 2IH4A 3AIKA 1Z5VA 2EX4A 3OHPA 4PW0A 4NH4A 3ZY3A 4AJLA 1SB8A 3LLMA 4L28A 1Z22A 4NOJA 4UAUA 3RLIA 1MOSA 5CLIA 4LWQA 3F74A 4E5KA 1RFLA 3PS9A 3G3EA 2OBMA 3HB9A 1G3MA 2E18A 2GN9A 2NVWA 3G8CA 4FMDF 1DCKA 3QX3A 1QAOA 3ET4A 1GAEO 1QFYA 3WLFA 5AESA 5JXGA 3K9QO 2D4HA 2AG6A 3BQ9A 2GT1A 3PFKA 4HK4A 4MP6A 4Q21A 3ZWPA 4BKQA 2IOQA 5B3JC 2QR5A 3N6XA 4ROTA 3TE7A 2HCJB 3Q3EA 4PG8A 3CKYA 3R5HA 3GLSA 3ILSA 4GPTA 5H8WA 1GT91 1ZG3A 4HYEA 2VAVA 4P8RA 1FFHA 3VAZA 4EY8A 2IVZA 4O33A 1T6YA 3P9YA 3R7WB 2C9YA 4P3NA 3D0RA 4HPXB 3TNFA 4I55A 1IXKA 4B31A 2NWQA 4B85A 1XTIA 4BQNA 1W4LA 2JCSA 1NR7A 4LMAA 4P86A 4W5JA 3ENZA 5DI3B 1SWWA 3USZA 2YWCA 5JC8A 1A2OA 2C94A 1KO4A 1Z4KA 2QXTA 3E61A 1E69A 3HMKA 5CNMA 1HLPA 1QVVA 2GZMA 4E2YA 4JC5A 3QQ5A 3D4NA 4F8EA 1XZGA 4JV5B 5LBIA 4IX1A 2HJWA 2XB6A 3ND9A 5CIYA 2RCNA 2VNIA 3IMGA 3M4NA 4E7PA 4F56A 4DUYB 4LTNA 2CNOA 3EZFA 1GN9A 2B3DA 4JQYA 2YY7A 2FG6C 3UMCA 2WD7A 2WU3A 2UAGA 1P2SA 2PWYA 2XUZA 4FEGA 2CEAA 4EF5A 1ODJA 4O2AB 2QLTA 4OKNA 5IANA 5C4IA 1JJAA 2AX3A 2K87A 2CK3D 2FX3A 3MB5A 3TIFA 1BGVA 1JL3A 1ESEA 3E22B 2FMHA 2GF2A 4EFLA 1D6SA 1KI6A 1PQYA 1DRUA 1SBQA 2X0IA 3EF3A 4MKGA 4O0LA 5ALTA 5FKJA 2FEKA 3E8XA 3WQRA 4W5NA 3CBQA 2XBMA 2VHZA 2G6TA 3OE4A 3R7FA 1RQGA 1V11A 1AHPA 2V59A 1HG0A 4EWLA 721PA 1ST2A 4N65A 2ZPAA 4A8PA 3KLBA 2OXEA 1GHTA 4R1MA 5KPDA 1Z15A 2NYAA 1E2HA 3A0RB 5DTIA 5C7IO 2RFLA 1S2GA 2Z9DA 4NZ9A 4OJYA 4D96A 3DCIA 2I1WA 3NBXX 1DTWB 1JSXA 1UBUS 5KMGA 2FN7A 4EEXA 4CQMD 4F45A 1PDVA 3VI4B 3CUEF 4HDMA 1P73A 3PFHA 4UVIA 5IFKA 3AX6A 3HZOA 3RAPR 2QNRA 3GLIE 3ZJYA 1WJGA 4LY6A 4CNQA 4X5OA 4PGGA 4DCCA 3U7GA 2HB6A 3Q3GE 5JADA 4FDVA 4EHNA 4Z99A 1KWKA 1KI8A 2Q07A 4BL5A 5FTKA 1BMFD 1E6MA 3VZQA 4BO4A 1TW2A 4FEEA 3GDOA 2I6FA 3BE4A 2C2HA 3NETA 4ZIRA 3M4ZA 5JXJA 2V3WA 1E8NA 2ROQA 3HXMA 1RSZA 3LF1A 5EZ6B 3WB1A 2IBTA 4MUGA 1G60A 2OBBA 1J2TA 1P7VA 5ECWA 1IZ7A 1R27A 5CB4B 5CEFA 1MIOB 2ASEA 3W5BA 3PNMA 2ZRCA 3OZEA 4JBWA 1Q83A 3H9UA 3U1VA 5CB0A 3TKAA 4LZLA 3EX7C 1H0RA 1VL6A 4E5DA 5A2QA 1JU9A 2AWNA 3KT0A 4X6UA 1EUCB 2VHEA 4ANFA 4DYDA 1RYNA 3OZ7A 1JTVA 2QN6A 1AHHA 2H18A 2CXUA 3H18A 1LS6A 3FDFA 1JHRA 3UY4A 1E2KA 1WV1A 3ROPA 4AJ2A 1ZRSA 4QDXA 4QYSA 4RAOA 5E7QA 3T7TA 1NBOA 1Q91A 3GL9A 5CCDA 3KQWA 1JMYA 3EGVA 1GJRA 4B7UA 1ISSA 4XQCA 4EL0A 5CFRA 4QDTA 4Q4AA 1GUBA 5CA0A 2I67A 2WK1A 1YCDA 1ISRA 4MAMA 4DMKA 1GWNA 3BG5A 4Q1EA 4UU8A 1G98A 2VDJA 5TJ9A 1UBMS 2GHIA 4PZYA 2R5FA 2OAP1 3ST7A 3F5DA 5F1YA 4BNJA 4ZCPA 4YAWA 4AP6A 4PFQA 1BCRA 2VYFA 3GUCA 4ENRA 3MT7A 3SS8A 5DSTA 4LRWA 4HP8A 4ZAZA 1BH6A 1CD5A 4KI0A 4N0DA 4KGZA 2J48A 4M2LA 5CJJA 4HT3B 5JASA 5KX5B 3AERB 3QRWA 4PGHA 3GFRA 4YY3B 1THZA 1QTNA 2J4CA 5DI3A 5J2TB 5FFMA 1TZJA 4D9GA 1U0HC 2B8EA 4AZSA 1QGAA 1WXFA 4D02A 2J07A 2C07A 3UJHA 2Q7XA 2PUCA 1GKUB 4LNUB 4FFLA 4GGPA 2VPZA 1DIOB 5AJTA 2BKVA 4HX2A 1U7DA 1Q57A 1BIFA 2J87A 4OYLA 5BV8A 2AZDA 1SCAA 2H31A 3FSRA 5HUQA 2YHIB 3OA2A 4XD7A 4M9UA 4PLTA 3EXHC 3B52X 2H0RA 4REMA 4AG5A 4O2AA 3T1QA 2P65A 1Q0SA 3AB3A 3V8PA 3EGXB 5T3YA 1W5FA 2ESRA 3WMGA 5I9NA 1YQEA 4IFTA 4J0FA 1V26A 1X7XB 1DBVO 2CNKA 5TR9A 1ZI6A 1CJTC 1G2QA 1G6Q1 1TU4A 1TYDE 2UVDA 2BD0A 1CC1S 1QHNA 2MSLA 5EP3A 1FFWA 1Q7TA 4S2UA 2UUPA 1ZN2A 4O1IA 1R4NB 1FP7A 1PT5A 2B99A 3S55A 3UT0A 5I3ZA 3VPFA 3ZBPA 5K3EA 4PAGA 3V55A 4YLYA 2ZBEA 1LF0A 2ZIZA 3DBVO 3JZMA 3W7AA 4CIBA 2VP5A 1KO1A 2NM0A 4DM3A 5K0JA 3ZHBA 4HUJA 5M04A 2JIPA 1XU9A 4K0RA 4PZUA 2HIGA 3ILXA 1RHQA 1ZXXA 4G5YA 2VH2A 4BECA 1I14A 4JR2A 4B5LA 4ZI2A 4LECA 4LKRA 4PXYA 1WD7A 1VMDA 2UZAA 3FCUB 4QBFA 2BDUA 5JSUA 5K8IA 1APBA 4TV9B 3AM1A 1JIQA 1ZI8A 1KOJA 4GPEA 5A5FA 4R1NA 2DHEA 1Z0ZA 2AHOA 4R2HA 4PN7A 4LMRA 1DSSG 4CT4B 1VYHA 2HSEA 3N9IA 1JR3A 1V43A 1Y3HA 2YFQA 3L7BA 4I4TB 5COAA 1IYZA 4HRVA 3KWLA 3RBXA 1C3OA 2FUG1 2HFKA 2DPXA 1HNWB 4K0KB 2JH8A 5BQOA 3WL3A 1M1YE 1WHSB 3U4IA 1I4TD 1VGVA 2JC3A 3K72B 4J1TC 1L5OA 3RVJA 3C3DA 2YJGA 3CLRD 4NAVA 2ZRGA 4UOQA 3RNLA 4DQXA 2OLEA 4TKVB 3R7SA 1SD2A 2ONCA 4JVNA 5HZGA 3SJAA 4N5MA 3HEBA 3TOXA 1D1SA 2PH3A 3VPCA 1SHJA 3V9PA 2A0KA 2QTVB 3N8KA 3CKMA 4N12A 1NVTA 4EYKA 1XO1A 2G6BA 1ATZA 1O6CA 1OHHD 1UDCA 2H92A 3A9CA 3H8JA 1G2PA 5H16A 3TDMA 2G09A 2C8JA 4BASA 4Y3UA 5KYWB 2NZJA 2AXQA 4I6JA 5GPBA 3HCWA 3RVBA 3KKLA 1Y42X 3C6ZA 4KOAA 1YDFA 3N75A 2ALJA 2WKPA 4TMTA 1IM2A 1UP4A 2Q4RA 3AI3A 3QBTA 4F8JA 1J97A 4PICA 4DTIA 4K7JA 1I7LA 4IQGA 3RKUA 1L5QA 1RBYA 4PY2A 4R98A 4XIGS 3V7WA 5JAPA 2JLRA 4YP9A 3QVKA 5KNCD 3DOIA 3DNFA 3M8KA 2Q0SA 4OM8A 5AUQA 4EGQA 1N2GA 1W2HA 4YRBA 3DMFA 1OQAA 3DVAB 4G6ZA 1ZM2A 5IAJA 4R71A 1I3NA 2I76A 3S28A 5EJ4A 2HO5A 2GEVA 2RONA 4OFZA 4FNAA 2PQ0A 3N05A 4FHEA 1C9YA 1KFCB 1Q50A 2IY7A 3MRSA 1JG2A 1IVYA 4UKDA 1KI4A 3UOGA 4MS4A 2AYXA 1XTUA 2FPSA 3AH8A 3KEGA 1GPAA 5FA5A 4YUAA 4M1KA 1E8DA 3ABSB 3QOYA 1NNSA 4X3PA 1D4ZA 1UJBA 5I4KA 2QG6A 5IDXA 5KYGA 1QCCA 3K5IA 2JA2A 2JA1A 3DQQA 3VH1A 3LH5A 2IP1A 4B3IA 4DAOA 1Y1KE 4PXAA 2R1TA 3CXRA 3KLNA 4YCBA 3LTNC 3SPXA 1YJQA 3A1TA 4EA7A 4FZRA 4ZALA 1Q0QA 4S12A 1PRYA 1Q14A 2YMPA 5DLPA 3X3HA 3WLIA 1SQGA 2XCSB 2RGNC 1PP4A 2QORA 4K05A 2DTXA 5AYVA 3IA7A 4RJKA 1E7QA 3LY7A 3H9QA 2OC9A 2I87A 3NU1A 4BPRA 1BMDA 2CHVA 3LY5A 3HFJA 4TQAA 4ZMRA 1IWPB 4HRXA 4KE8A 2VTDA 4PPGA 4JJIA 4RS4A 3ICEA 3UA4A 2ZPTX 3BIFA 2ZIVB 3NHBA 2NNWB 3R7NA 3RODA 1R4NA 3UTDA 3VO1A 2FE1A 4ARAA 3H65A 2DAPA 5AVYA 2BPOA 3L4JA 1SVWA 1K4KA 4KMMA 2JEOA 3D6AA 3T3OA 1X1AA 3OF3A 4OFXA 1PFGA 2QQGA 1P1JA 2NW6A 2XUGA 3S4YA 4AURA 4EB0A 4IJ6A 3RTAA 4ALKA 1K6XA 5HKAA 2AQ8A 2P7IA 4KE6A 1L7AA 4TXJA 1XLUA 1ZESA 4TV9A 5IKXA 4QRHA 3C5CA 5F3DA 1VP3A 4CF7A 4N40A 4LSMA 3FZNA 1GQFA 1LPMA 1PG0A 1GPLA 2DVMA 5H4GA 3R9IA 4C1BA 1J0XO 3EEBA 3LFHA 1NF8A 2ZB3A 4AJ1A 3QVXA 1TKRA 3SQWA 1U1CA 1ONNA 1Y8AA 2WILA 4I4TA 4NMMA 3TW8A 3R5TA 5EJ9A 2O19A 2R7NA 1QU3A 5B12A 5KCZA 3EXG1 3K0FA 5I48A 4L4XA 1NX6A 1X9GA 4QFBA 2HZ7A 2O3JA 3I28A 2FB9A 4JQZA 3N2EA 1NXTA 1Q84A 2CVPA 3FYUA 3OSUA 4OAPA 4ZKEA 4JUBA 4R8LA 4EHHA 4A9AA 1Z2NX 3PNSA 4P6VF 2NN3C 1CJUC 2J32A 3ABIA 4MMXB 3B2EA 3ZD6A 3CNQS 3VR4D 2ZTUA 2HKIA 3AI7A 4S1WA 4AJKA 1O1YA 1T3HA 2PWPA 4OFBA 2GSDA 1ZHFA 1ZIPA 3U49A 4ASUD 4FQ7A 4ZQHA 1XKTA 3DF7A 1J07A 1XF1A 3H99A 5LYYA 2QE7D 1K68A 4KW7A 4DMLA 2CKDA 4MVJH 3SU8A 3D2BA 5E1MA 2V54A 3OT4A 3OF2A 4A5SA 3NV9A 3JWGA 5A5VA 2Z08A 1DJQA 3B3GA 3ESRA 3I45A 5F1OA 1JKIA 1DHTA 1M2GA 3LK7A 4EYGA 3EW9A 2RI1A 4WSOA 5FIUA 1PS8A 1AQLA 1T5BA 2O23A 4LY9A 5EMMA 1S4QA 2BIFA 2H5JA 5TPZA 1RPJA 3U44B 4J0HA 4RABA 3HUFA 2GKOA 3BILA 2WUDA 4RPLA 5FBWB 3HB4X 1KSJA 2IV2X 4DG9A 2WWWA 2LXNA 3F67A 1KZ6A 1ZONA 1S2IA 3OLCX 5F2EA 3PFWO 5JC1A 1H3EA 5HOEA 3R23A 1ADYA 3L43A 2VK4A 1GM5A 1MAAA 4AXXA 1GCIA 2VA8A 1G38A 1W0CA 3I6MA 4KPUB 2J3EA 4NPHA 4OHVA 3RHTA 4I5DA 3WJAA 5KHOC 4DV0B 1OF1A 3TQOA 3VV3A 3IRUA 1YDGA 5DKFA 2O8BB 2AW5A 1N5RA 1XXHE 3WIVA 1EWQA 4WXRA 2P4SA 3NGLA 4JT4A 2D4AA 3RUPA 2OM2A 1VG9B 3H1PA 4JJKA 3DMTA 3U17A 1TMKA 2Q3FA 4AP9A 5A6VA 5L53A 3VBEA 3VR6A 5E9AA 3MJSA 4K40A 5G1NA 4E22A 5EHGA 6REQB 4KGXA 3MUNA 1HEIA 4NG5A 1NASA 4IIJB 2H7XA 4MRMA 3VC2A 1P80A 3AR2A 3M4JA 1RCUA 3CYFA 3LFTA 1V95A 3OP1A 4NOLA 4I50B 2WU1A 2ZS8A 1KSFX 1L9KA 1YB2A 2AZMA 2YWEA 5EXSA 1GPKA 3LPAA 4ON9A 4X45A 4MO9A 4DCGA 4B3HA 4EJSB 2PZFA 5FCDA 2VSQA 2XMDA 2WHEA 3FM9A 5DJ5A 3GN1A 4EY4A 3CJRA 3M9LA 5JS1A 3GFOA 3R24A 3LUAA 5A4KA 1Q15A 1GEEA 1ENYA 1P72A 1H23A 4UU1A 3M6UA 3ZHRA 1KVSA 2HYDA 2ZR7A 1BVUA 3LP6A 4P7FA 3UICA 1KEZA 3UT5B 4GPIB 4HGZA 2H4WA 3QJYA 1E2MA 1NW7A 2YFYA 2HBZA 3H16A 4V24A 2XMBA 5FPQA 1MJNA 3OOJA 3R44A 2POQX 1G5RA 4Q3KA 4NNOA 4MQ4A 3K5PA 3CUKA 1VL2A 3W5CA 1OILA 1K6MA 1QYRA 1D2RA 1TUBA 3FNFA 1UPFA 2XDQA 1THMA 1Q2XA 2VOEA 3L0DA 1N2CE 1NN1A 2K2QB 4O4IB 2KPOA 4QHTA 3V2HA 4C5BA 5KS2A 1YL6A 5JD5A 4ABTA 5LYJB 1OWMA 5EIBC 4MJXA 1D7AA 2OPBA 4KSBA 3WLTA 4M49A 4RTPA 3PE4A 3HY6A 1ZMOA 1BMQA 2AZTA 3JQEA 3U5TA 1RPZA 2AZXA 3IV9A 1E8MA 1REQA 4O1MA 3EZ2A 4RJ2A 4QGHA 3R9KA 3WI7A 2J0VA 4ZKDA 4PRYA 2XNKA 2XUQA 5D3ZA 4LHEA 3GRCA 1FXSA 1NVAA 1MQ8B 1WG8A 2V9PA 1VHLA 2GUWA 3HM9A 1E5QA 5B6PA 1TJYA 4GL4A 4KNWA 2QRQA 1R3DA 2J5RA 2TSYB 3MLEA 5FNVF 3ZYCA 1P33A 5A03A 5IZCC 3SLGA 1N6OA 1YV9A 1ODTC 3ROZA 3VKVA 4DCTA 1QTIA 5DP2A 1RTTA 3PUVA 3WLMA 2GJKA 2SKDA 4RY0A 5B4VA 2HK6A 3L6EA 3CUVA 3IPAA 3BE8A 3WQHA 4E21A 1ENZA 1QIMA 5KYUA 3NT5A 2AMYA 3DUFA 4XYGA 4D74A 1JAHA 1UWCA 3QKSA 3R0QA 4MKHA 4GD3Q 1YDWA 3HB7A 3A58B 4NBUA 3L40A 3L7CA 3EY9A 3PEUA 4ZI7F 2H1RA 2OE2A 1CIPA 2BKEA 4U2DA 5ALPA 3O31A 2XGMA 3RUFA 4EPWA 3DAOA 4IL5A 4LV5B 5CX1B 1HNXB 1JG7A 4ZWNA 2Q6VA 3I9V6 1CNEA 4N18A 1XDDA 1UZLA 4G4JA 3V4VB 5IKEA 4GE0A 1ZU4A 4KIUA 4OMUA 4AF8A 3HEAA 1G59A 2O0JA 3U44A 4Y9RA 4H17A 4B3JA 5JSFA 1DO0A 5DGIA 1NSFA 2BFPA 3E84A 5HIJA 4KGVA 4YAEA 4D0SA 4KR7A 1X7HA 5ALWA 2GR9A 3LUBA 4TL7A 2AIRA 5ITZA 4CM5A 4C2TA 3TWOA 3G9QA 4ZZ0A 2NZVG 5DTEA 3LVQE 2EFJA 2GAAA 4DIEA 4KWHA 5EQTA 1S3IA 1G8KA 4DLAA 3UJCA 1RKVA 4M1ZA 2OD9A 1XDSA 2ST1A 2AQIA 2C5BA 2ZIEA 1GSAA 1PWHA 3CR7A 3LBNA 5SZHB 1MP0A 2J0SA 3R9WA 3WHLA 3FPEA 1GZUA 3G8BA 1ZUD1 2HQ1A 4J0KA 4JVOA 4MRRA 5CAEA 3DP9A 4FSHA 4L0CA 2BHSA 4PHCA 4Q00A 4RMHA 5AJUA 1PQUA 3X1WA 5C8YA 4CN9A 3ZXSA 1E1DA 1XNHA 4CMCA 6REQA 4W5HA 4LFBB 1Q7BA 1G8MA 3U2QA 2FF7A 5LD2B 1FYVA 4XXHA 5HDQA 1O0BA 1HH4A 3I6ZA 3I1IA 3PENA 5EXDA 5JAMA 1QQAA 3RVSA 4OBBA 1U6KA 5I7WA 1XTQA 4PWZA 4BAUA 3IOCA 3MMPA 1W6UA 4D43A 3K0CC 3C1TA 3SC4A 4LF4B 1G16A 4CUZA 3FH0A 3PLNA 4EJSA 1MX9A 3BFKA 1ZQ1A 4POAA 2PUBA 4A0QA 3ZZNA 3V1UA 4EABA 1T0PA 2SECE 2X0NA 5EJ8A 1SVSA 2O2YA 5AIBA 1IWBB 2XAUA 5CCEA 4QEZA 3Q1LA 2I5PO 3K4PA 2ZT5A 3UT5A 4EOGA 2BEWB 4GLLA 5KQMA 2QTLA 2GD2A 2QD1A 1TCVA 2V45A 1ITZA 2WSYB 4TLAA 5C1OA 4NL4H 1QE3A 2IHUA 4RNCA 3WV5A 3DYBA 3MRXA 3C74A 3IP5A 4QTUB 3TMKA 4BWGA 4DS3A 4EBBA 1EJ2A 5B4UA 1P0IA 1XCBA 5JNTA 1ST3A 2WQ6A 1K5DA 2WMYA 4GU5A 3ZHVA 3IPRA 1RBQA 3MWEA 4JK3A 2OZVA 3A1NA 3AF0A 3IUBA 4KWCA 4YRMA 1YC5A 4K9OA 4O4IA 1H2YA 1SUWA 2CWWA 2K6GA 2YCLA 3KR1A 5LKAA 4BFYA 1Z3CA 3IVAA 2W6MA 3T0FA 3PQFA 1MGOA 4C4OA 2LP4Y 3H0KA 3C8DA 2Z3VA 3DT6A 1JR2A 4PBSA 5JG7A 4F0JA 1YTUA 3FVRA 1ILWA 1WKVA 2PT7A 4WADA 3EEYA 2X2FA 3RUEA 1PLJA 3R9XB 5DWQA 3TBFA 3F78A 4L0MA 4ZCSA 3IE0A 5BR4A 1FU7A 2QLLA 1BNCA 1OBCA 3AXSA 2RH4A 3FUVA 2Q5LA 4NMLA 5E6UA 5EFZA 2OXIA 3ZYZA 4BVGA 2NSHA 3BC1A 2ZQ5A 1S2OA 3ETNA 1RYFA 2EW8A 1H9AA 1K63A 1PK8A 2B92A 3UFXB 1TRHA 2H54A 4DCUA 3D7NA 1O5OA 1II0A 4PO1A 1VCMA 3E8MA 4KQCA 3GGDA 3W1VA 4FNMA 1ZISA 1JEOA 4IH4A 3CCCA 3O2SB 5T57A 4A0GA 4DXAA 4OY3A 1PGPA 4PSVA 4U0JA 5H59A 1E63A 1PU2A 4O0MA 2WFLA 1BA2A 1MV5A 1O8BA 2FWBA 1XJ0A 2IYWA 4BWYA 5CFMA 5CX1A 2R4UA 3K32A 1B42A 3ROXA 1XLVA 3VUEA 3WJ7A 4RV5A 4JLVA 2Q1WA 3VDMA 2M6KA 4F2HA 2VP6A 3OPYI 3A2MA 4OLJA 3T5TA 3SYNA 3RKSA 4IICA 1AU9A 5KI6A 2E5LB 4FX2A 5G40A 1NVMB 3AUJB 3THYB 1L4EA 4BFLA 2D0OB 1OFTA 2DUJA 5ERXA 3ZJTA 4V1CA 3ELDA 1E3WA 2EX1A 4I8XA 4YAOA 1CUGA 2EEZA 4INJA 4CBVA 3NKLA 4LGCA 1DP4A 1ZK2A 2G9NA 5IHPA 2FXVA 1V7ZA 5FULA 3EK2A 3AVOA 5BWNA 2DFPA 1M1ZA 2NX2A 4B32A 4ARUA 2XWSA 2YJNA 5CP8A 1PWZA 3T0IA 1GITA 3O4HA 5CXQA 2IDZA 1YR8A 3L79A 1U0TA 5JT1A 1EP2B 1R0YA 1H8EA 5CH3A 3BS4A 4WZZA 2YXEA 2XT9A 4EKIA 3FIJA 3OKCA 4TWJA 4E4RA 1Z4OA 2Q0QA 4S0XA 2GCPA 4Z9BA 5EIFA 2ZUBA 5AW8A 1QO9A 2PLFA 4L50A 4Q7JB 3SFVA 1IBMB 5IKOA 5KOHB 1Q7CA 2F59A 3KBBA 3C41J 3A28A 2JCVA 2J67A 2WI8A 2Q2VA 1V1RB 1Y34E 3OICA 4MA4A 3VISA 3HLYA 3HDVA 3GLHE 3WLSA 3A4IA 1QLWA 2H2HA 3EZGA 3E1GA 2E87A 4G37A 3D6VA 1H6AA 3HBAA 5CR9A 2BEWA 3I0MA 5LN1A 1R8QA 1QDUA 3SZMA 1COWD 1YE3A 4IO1A 1GQ2A 4CQNA 1ZGGA 1USUA 1YNSA 4H4DA 4KDRA 1VJGA 3L8YA 4UCWA 3CB4A 2ONJA 1IHPA 2IXAA 2PX3A 4BO0A 5J4YA 3L4KA 1PHPA 3CO0S 3QVVA 3UOAB 4YAKA 1IZ9A 4CDRA 4GNRA 3BTVA 1IVNA 3OCJA 4HAIA 1GRVA 4DRZA 2WIKA 4H16A 4WLOA 3LJKA 1HA3A 3LTEA 4LXHA 3DOOA 3L3BA 1LS1A 4PO3X 1TK2A 4KXMA 1NT4A 4M1WA 2O9JA 2HA3A 5FUMA 2P8JA 1NWHA 2OCXA 4ALIA 3ZCTA 2Q41A 2WFZA 2HDNB 4A6EA 1J7JA 4QPDA 1EVEA 2JARA 4BMSA 5A1TA 1N5MA 2MU1A 4TTRA 1V5FA 2V03A 3GF4A 4RHXA 3AETB 1H69A 3PNYA 3R5FA 1R2QA 4WASA 4WMLA 5DTRA 3RROA 1VYUA 3TLGA 3EPKA 4DKJA 4FNOA 4JJ6A 5JXHA 2PGDA 2C4UA 2XAAA 1B6SA 3AEYA 3GRAA 1D8TA 3N7UA 3ZBTA 3VH2A 4LV6A 4I3HA 1FNCA 1EK5A 3DE1X 2Q28A 3I2HA 3LWDA 4FGUA 4KIJA 3VKUA 1SQ6A 4JJAA 2QVCA 2Y4OA 3AKEA 3SF0A 5MGBA 4D0LB 3OE7A 4UCXA 1YJXA 4YASA 2QRLA 4EJ0A 4MW6A 3IP7A 3N0TA 4R16A 4AS1A 2Q3LA 3QKRB 4GZ5A 4AS2A 1XMXA 2JIBA 5BQ3A 2P11A 2VHJA 2YIMA 4YP1A 3SF8A 1Z56C 3DAFA 4WZBB 3Q9LA 4AMVA 1SXJB 1ZOSA 3OLZA 3OPMA 3QV1A 3RS4A 1G2IA 3OUTA 3VHXA 1IZZA 3OLYA 3KEOA 4LBZA 3QTTA 4LX8A 4NK4A 2FXIA 2MYPA 4Q05A 3FOFC 3MOGA 4UU7A 3LXXA 3QVWA 3OEYA 4PAQA 5HTOA 4KRFA 2P4UA 3UOWA 4G5FA 2CFCA 3M3PA 1RBMA 3ONWA 3GFTA 5BMOA 3JQ7A 1UPTA 2BLLA 2FZWA 1VPLA 1QV7A 2OV4A 3L6UA 4HEQA 1MHTA 2WTMA 3G2PA 1TYZA 3IO5A 3M9XA 1R8XA 3RSZA 2IEYA 4EBFA 1IUNA 1RBZA 2CWDA 3EPPA 3C6XA 2BGUA 5FOUA 4RV9A 2B9VA 5A3QA 3NBFA 1RAHA 5A9SA 4JI5B 2B69A 1T2NA 3J7TA 3Q5GA 4HPWA 4NCJA 5AI5A 2FUCA 4D4JA 1I4WA 1BGWA 4RUKA 1OZAA 1VI5A 3KDSE 4TYMA 4J4TA 1R8YA 3AP3A 2QSJA 2ZJAA 3ODPA 4QQ8A 2XX3A 3LT2A 3TRDA 3RS5A 1T5IA 1IN6A 3PGXA 4AX8A 1ZVVA 3PK0A 4MW9A 5DMHA 5MGNA 3EW7A 3RVQA 4KZPA 3JQRA 4UUMA 3DTVA 3S5JA 1OI2A 1Z33A 3M2PA 3UAXA 3C3WA 1ZX1A 1AGNA 4P22A 3EXG2 1OSNA 4O2BF 4RH3A 4WCFB 2OCIA 3ZX4A 4LNHA 3SMQA 2JJ1D 3AJEA 1MEOA 4JA0A 5DNUA 1A4XA 4K1LA 4YRTA 4LXIA 3L05A 1AVTA 2AR0A 2DBRA 2RGYA 2IQ5A 2CL0X 5FL7A 4ED9A 2IOFK 3NAGA 2X4IA 3VYRB 2C5EA 1OC4A 2CCJA 3L5OA 3NPAA 3H5AA 2EX0A 1P0CA 1RM4A 3OU7A 3N28A 1QAMA 1GAXA 2YVQA 3EIHA 6ABPA 5ILOA 2EOAA 4Z0PA 3WNVA 4A6DA 1VE3A 4PAOA 2HMUA 2ZBQA 3ZTWA 1DTSA 1K89A 2OV1A 3PQEA 3WK6A 2AEJA 1T0UA 1QHHB 3GG2A 2QTZA 5TGZA 3RWOA 3OO0A 4DLXA 2GOYA 4GZLA 1NNEA 2VDVE 4YHHB 5GONF 1D8AA 2AI3A 4XIJA 1E3JA 3LO8A 1AKUA 5KB3A 1XN1A 3DJFA 3GGOA 2AD1A 1US8A 2YIDA 4NCIA 2NU8B 1MLDA 3CUUA 5JUWA 4NULA 3NWJA 4QWMA 4R84A 1O95A 3PXDA 1WCV1 1HSZA 4KXYA 3LKBA 3N2GB 2IIBA 2AL7A 3O1HB 1D3AA 4TV8F 3AETA 1OLUA 4GPZA 5FEMA 3S8EA 3R5XA 1FY2A 3K31A 1RQXA 3C14C 3KAQA 4PYQA 1HFEL 2VH5R 4X1KB 3AVPA 1YD7A 4MKXA 1DBSA 2GEKA 2JAUA 2QQFA 4PRKA 2GWHA 4MGKR 2HA2A 2CDBA 1OTXA 1GTZA 3NEYA 3Q40A 3E0QA 1Z8HA 4GICA 4AN4A 4I0WB 2ONZA 2PS1A 3V1MA 2BSAA 3R0IA 2JK1A 2OGUA 2SKCA 1KK3A 3WBBA 1Y4AE 4RQAA 4TVKA 3A1UA 1TNDA 3LCJA 3MRTA 4ZICA 3QKRA 4PSUA 4PGFA 3RSGA 4EUHA 4I1OA 4YAJA 4WZBA 1UAGA 5FUQA 1RFGE 2FSHA 2LNDA 4M7WA 4TQGA 3DPUA 1S0UA 1WLSA 1NOJA 4N03A 1QNLA 2CZQA 3ECAA 4RADA 2P79A 2WJZB 1YS7A 2BFNA 3QFHA 4IIFA 4BE9A 1JWLA 4BKOA 3VDRA 4N8DA 4U7GA 4MUEA 3QEAZ 3RYIB 2AS0A 1Y5LA 2HMSA 2PZAA 3RVOA 3TZLA 1XAGA 2D7CA 1KMNA 4KQXA 4J91A 1C0LA 4G09A 3I3SR 5LBUA 1FFEA 3EWSA 5HDBB 1IBKB 2A6PA 2DZDA 4Q48A 1OA0A 1AK1A 3RO7A 1N9GB 4HQ0A 3TZ6A 2GVNA 2ZT6A 1KETA 1WF3A 2R6HA 1OAOC 1XD2A 3H3FA 5B7NA 5C2JB 4XAQA 1GNSA 2V8BA 1BN7A 4J6FA 1YIDA 4WPGA 3RG8A 4D79A 1CR6A 2Q4TA 4O08A 3LDGA 2QPLA 4P7BA 3RCBA 4BOYA 2YC2C 2GI4A 4O4JA 2NO1A 4MWDA 4YJ2B 4CQLB 3IVRA 2JLBA 2R48A 5FI5A 4JI6B 3AM4A 1U6IA 3ZV5A 4MV5A 1MN6A 1YZGA 2WAOA 1ZH4A 3G2IA 4R3NA 4D5GA 1BU8A 3M6AA 4ZO4A 5L7YA 4YMSA 3MBIA 5EJFA 4MWTA 1SEVA 3PRKE 4QBHA 3FFAA 3B5EA 2NV6A 2CBZA 2XGJA 4ZJYA 1KC3A 3CG0A 1DI0A 2HD4A 1O0CA 1WM1A 4HWOA 2C2OA 3JATA 2H4XA 3KALA 4PRZA 1C0IA 4CR6A 1XTVA 4J7UA 5K20A 3K70C 2B34A 4N47A 3QYAA 4P5EA 1C2YA 4PR3A 1QLHA 1SY7A 4WESB 2VJMA 3ZEAA 1KEEB 1PQPA 2R79A 3ORQA 4MV7A 5FI1B 3SMVA 1YGYA 1OXMA 2DFTA 3WGTA 2NO7A 2PRSA 1M7GA 1ZLYA 5KEIA 3ER9A 4DZZA 2WWXA 4OQEA 3HYCA 3SC2B 4F5YA 1P7ZA 3W9BA 3OKPA 4IIBA 2QSZA 3CUTA 3D81A 2WIDA 5G0TA 1J7KA 1O58A 4Q47A 3AHEA 1Z36A 2BBSA 1RAFA 3OWXA 1QHHA 2UXCB 2JD1A 2R6CA 1YNOA 4GOND 4TKUA 3BHNA 1WETA 5JWHA 3I23A 1CQJB 1MORA 2G1PA 2HMWA 2FEMA 4RK4A 5JH7F 3QWAA 1WPRA 2CL5A 4UQOA 1V4NA 2CK3A 3W1EA 1H2BA 3PUZA 1NUSA 1ECPA 1U0OC 4K6FA 2H1LA 2UYOA 3ZIDA 2XIJA 4HB2A 3TNLA 1VGQA 2NU8A 3LC1O 1BVRA 1WXXA 4TMVA 1ECFA 4R7GA 3ZWDA 4UTPA 4EGSA 2PGNA 4P0TA 3L7AA 3PNOA 1NYRA 3JQFA 5D87A 2QTGA 4L3VA 5EVCA 4F38A 5A4FS 3GDGA 4QQRA 4AROA 3EQ6A 4GLFA 2C1XA 5CDYA 3GLIB 4QOHA 1YZYA 3D0QA 4G4IA 4X7PA 1R18A 4CHTA 2YJ5A 4KWIA 3TXXA 3F9CA 3EJ6A 3W3ZB 2H11A 3I39X 2BONA 3OJLA 1XCLA 1QCYA 1JHPA 4B3TB 1JJVA 1ODLA 1SVLA 2HEIA 3AJRA 3CH5A 2BOVA 2DHRA 3ZWVA 3HCPA 4AKTA 3I6IA 4LE1A 2EU8A 1TVMA 4CQMA 3VJMA 4POOA 1SKYE 1B15A 1F6WA 3C5EA 3LKDA 4R81A 5EJIA 5HJ2A 5ELXA 4O4HA 4KQMA 2ZVQX 5CEJA 3SYKA 2OFFA 1OFIA 5K8LA 1Z37A 1JHXA 2O07A 4ARZA 1Z6ZA 1IC6A 4X85A 5A9RA 5JS8A 3EAGA 4CZ2A 3PNVA 6LDHA 1GQYA 4NPAA 1YTLA 4UQLA 2JFXA 2JGNA 3BULA 3DG9A 5AI4A 1M2FA 1XMSA 4CM4B 4CM3A