1T9ZA

Three-dimensional structure of a rna-polymerase ii binding protein.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
181
Chain Sequence
MQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADMLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLIMDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Structure and Mechanism of RNA Polymerase II CTD Phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 181
sequence length 181
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1t9zA00
3NRJA 4Y2TA 3OCZA 3WK6A 2BDUA 2YJ5A 2G07A 2WF8A 3R9KA 3WKAA 4BEVA 2GFHA 4F72A 3RFUA 3NANA 1N9KA 1Q91A 2B1RA 1Z4JA 1TA0A 1MH9A 2ODAA 2WF7A 2W4MA 4EZEA 2WF5A 3QGMA 4DCCA 1RKUA 4EENA 4MWOA 1RKQA 3FGOA 4RESA 1RMQA 1XPJA 4CF4A 3MMZA 2AGVA 2YBDA 5T41A 4UU1A 2X4DA 2Q5EA 3L1VA 5ALOA 1NRWA 3ZWKA 5ALSA 1Z5GA 2B1QA 2G09A 4L6CA 5AICA 5ALWA 5AM4A 4NWIA 3WKDA 4KN8A 1WVIA 1L8LA 5AI4A 5A3SA 2HCFA 3ZVLA 3AR5A 3QUQA 4H1WA 2BDEA 3QNMA 4Y2JA 4UM7A 3L0YA 1J8DA 2OM6A 3VAYA 5AI0A 3E8MA 1VFPA 2B82A 1Z4NA 5AW7A 1CQZA 1WPGA 3WKBA 4IFTA 1TJ5A 1YV9A 5AVTA 4G63A 3E81A 3QLEA 4YIHA 1YMQA 4NABA 2I6XA 3L8FA 3J7TA 3NIWA 3PGVA 3A1EA 4HAIA 5AM5A 1TJ3A 5AW0A 5AW6A 1RLTA 5ALRA 4BYGA 5AK6A 1RQLA 2OBBA 3BA6A 4B6JA 1L7NA 3MC1A 4YIKA 2C4NA 3KC2A 4EELA 4O8CA 5JJBA 4FYPA 2YMLA 5IT4A 4JDPA 2W11A 4GIBA 5AW3A 4YCMA 4C4TA 2AUTA 3CZ4A 3DDHA 4IG4A 4AP9A 5AK3A 1TE2A 2JAWA 3QU9A 5AKXA 2G08A 1L7OA 2ZG6A 4Y2QA 4UAUA 2GHQA 3WGUA 4BBJA 5ALPA 3M9LA 4DFDA 2R8EA 3N07A 2WHEA 2IOFK 2RAVA 2PR7A 2I34A 1ZOLA 5A3RA 3ZTYA 3U7GA 3A1CA 2GO7A 5AKIA 3A3YA 4CE6A 2VKQA 5AKEA 3OCXA 4KX3A 2JARA 3NASA 5AM2A 4OFZA 3U26A 5AW4A 2I7DA 3UMCA 2ZXEA 3TLMA 2P11A 2ZBDA 1Z4OA 3OCWA 4AS3A 2EATA 1LVHA 3M1YA 2YMMA 3DV9A 3P96A 4L57A 2I55A 5ALFA 2CFSA 1T9ZA 4EEKA 4GXTA 2OYCA 4DWOA 3U7EB 3I76A 5AW5A 3MPOA 1Z4MA 2QLTA 1RLMA 1T5SA 2JAOA 5ALKA 5AVXA 3FPSA 3L7YA 3QUBA 5AVVA 5ALEA 4E88A 5AKZA 2HEGA 3E58A 5AI5A 3W5BA 2BY4A 5ALUA 2C88A 1LTQA 4UMDA 1U02A 4UMEA 5AKKA 3PCTA 1O03A 3B9RA 3KOOA 1ZRMA 2YJ4A 3N8GA 3N28A 5AVSA 3B9BA 1N8NA 3ZU6A 2MSNA 4KYTA 2ZBEA 2YFYA 1U7OA 3UM9A 5AHXA 2CFTA 1Z4PX 5ALDA 3ZTWA 5IT0A 3WGVA 1AQ6A 2RBKA 3ED5A 2AMYA 4PNHA 5AI8A 4UMVA 1WZCA 3OCYA 2FPXA 3KBBA 3PGLA 1RKVA 5AKGA 4UARA 5AIAA 4NFLA 4Y2YA 3WK5A 3WK8A 1YNSA 3FPBA 3QU7A 3L8HA 3R4CA 3FM9A 3WK4A 5ALLA 3L0CA 5AKJA 1IWOA 3ZI4A 4YCNA 2ZBFA 3SF0A 2P9JA 4UASA 5AIBA 3ET5A 2CN1A 1Z4IA 1SWVA 1ZS9A 5ALQA 4J2TA 1ZD4A 2FDRA 5FP0A 2HF2A 4YGYA 3SD7A 4RETA 4Y2UA 3UMBA 5AKHA 3L0BA 3AR3A 4HGOA 2HSZA 3QU5A 1S8OA 3U13A 3DNPA 2HF7A 5AVYA 1RMTA 3CNHA 2YJ3A 1ZD2P 2YMPA 3E84A 4KNWA 1U7PA 5AI9A 2FEAA 3QUCA 2YN4A 5ALZA 3U7HB 5ALVA 4YCLA 4Y2XA 3PDWA 3FZQA 3L1UA 4HYTA 1QYIA 3QX7A 3HYCA 4HGRA 4I9FA 5ALMA 4HGNA 1Q92A 4Y2SA 3QXGA 5AW9A 3I6BA 1ZJJA 1ZD5A 2FUEA 5ALYA 1QQ7A 3AR7A 3EF1A 3U7FB 3MN1A 3NUQA 3EWIA 4BEWA 1X42A 3QU2A 5ALXA 4CNQA 1L8OA 3L8GA 3DAOA 1Z4KA 3WKCA 1NF2A 3WK9A 3KZXA 1XVIA 4YH1A 2NO5A 2ZBGA 3K1ZA 2IYEA 3W5AA 4Y3UA 3AR9A 3L8EA 3WK7A 1EK2A 2Q4TA 2YJ6A 2B8JA 2CFRA 4C4SA 1KYTA 3L5KA 4JB3A 5AM1A 3IRUA 1WR8A 2P27A 1Z5UA 1RRCA 2B30A 4UU0A 3A1DA 3SLRA 1TJ4A 3S6JA 2WM8A 3OCUA 3ZVMA 3NALA 2OA0A 4OCZA 3ZX4A 4UATA 2IOHA 1Y8AA 3ZX5A 5AK5A 1K1EA 1CR6A 1Z4LA 1NNLA 2D2VA 2JAUA 4UW9A 1YDFA 3FVVA 4Y2PA 4KX5A 4OD0A 3F9RA 2FPSA 1JUDA 4BX3A 2HO4A 3SMVA 1Z4QA 3U19A 3OTQA 3ZVNA 3RF6A 3R09A 5E0OA 4BX0A 2W43A 2RARA 4BNDB 4ZEVA 4ZEXA 2FPUA 4XQ0A 4C4RA 5A3QA 2O2XA 3KDPA 3IB6A 3WKEA 2G0AA 4MUMA 1PW5A 1RMYA 1VJRA 5AVZA 3QYPA 3IJ5A 4NV0A 2NYVA 3AR4A 2PQ0A 3UMGA 2Q4RA 1F5SA 1ZRNA 4G9BA 4L6AA 1ZD3A 2ZOSA 5ALNA 2MU1A 4XOUA 5AVUA 2HX1A 4UMFA 3QU4A 2IOFA 1YJ5A 3I28A 5AVWA 2AH5A 5AW1A 3I1YA 2C9MA 4OHFA 4ZEWA 3ESQA 1U2TA 5IS2A 1RLOA 3W5CA 3SHQA 5AW8A 1L6RA 1XP5A 2GHTA 5ALHA 1EK1A 5AKYA 3SKYA 3N5KA 3BWVA 2NO4A 2JGAA 5ALIA 1RPZA 3AR6A 1YS9A 2GMWA 4XE5A 2WFAA 3W5DA 4FFDA 3OPXA 2FPRA 3AR8A 2FPWA 4KNVA 2C8LA 4UM5A 1L7PA 1QQ6A 5ALGA 2FUCA 2WF6A 3EPRA 4UAVA 2FI1A 2QYHA 2I54A 2PKEA 3NAMA 3ET4A 3B8EA 5ALJA 2G06A 3ONNA 3ZW7A 4HGPA 2B8EA 4BKMA 1FEZA 5AVQA 4I9GA 5AESA 1SU4A 2RB5A 3N1UA 5AI6A 2R8ZA 3ZUPA 4DW8A 5AM3A 1RQNA 2B0CA 2R8YA 1J97A 1RC8A 4J03A 2DQSA 5ALTA 2IA5A 2WF9A 1VJ5A 2HDOA 2EARA 1O08A 4EX6A 3D6JA 4QQFA 4CF5A 1S2OA 4NAVA 4BNDA 3ESRA 3ZWDA 1U2SA 2HI0A 1L7MA 1T5TA 3AR2A 1Z88A 3GYGA 5AKLA 4F71A 2O9JA 5AM0A 2C8KA 2YY6A 2I33A 4BX2A 4Y2VA 2R8XA 2YMQA 3OCVA 4QJBA 3KD3A 1QQ5A 3EF0A 4Y2RA 5AW2A 4FE3A 2G80A 1QH9A 4HGQA 2EAUA 4XPZA 4CF3A 2HOQA 3SKXA 4AS2A 2P69A 4EX7A 3QUTA 5AK4A 5AVRA 1SWWA 2HHLA 3HLTA 1RDFA 2G1AA
chains in the Genus database with same CATH superfamily
2EF0A 4IJ6A 3KUCA 4BNYA 1PIWA 5TLSA 3ERCA 2IZOA 1PQWA 1SC1A 3QOWA 4N6OA 5LDHA 1EA7A 4GVPA 3OEEA 1YDWA 4CR7A 2OD9A 1U0SY 3ZD9A 2JFVA 4IKPA 2NGRA 9GPBA 2AD5A 2O8BB 1EZZA 1BCRA 1L5RA 1WDTA 4ZVTA 1PR1A 1KZHA 4FXPA 2ZW9A 2R8PA 3RHSA 1RMQA 4HTFA 3RM3A 4URVR 5CDSA 5K0ZA 4Z54A 2EHJA 3RIXA 1PFYA 3Q7RA 4L5IA 2VCHA 3W2TA 5HHTA 2WKSA 4QG7A 4JS0A 2CNOA 3JD4A 1AK9A 2NUPA 3ELUA 3IT2A 2WIFA 4EFLA 4LSMA 1NN1A 4CM4B 3V8NA 4BFTA 2D00A 4PHCA 2CB9A 4LTNA 3RYFB 4IRUB 4MB6A 1VRVA 2A78A 5KYVA 1W7AA 2PJUA 3B6JA 3JQAD 5A4AA 2PL1A 3PHGA 4L1KA 2IVFA 4RVUA 4DQDA 3W7AA 4XYLA 3RBXA 3L0DA 3VNBA 5ALSA 5GGXA 5I47A 3NHJA 4TQUS 2UUCB 3WKDA 1ENPA 1I1QB 4UBLA 2QJTA 2AG5A 3AI3A 3ZCVA 5BN3A 2NU8B 1G3QA 1II8A 5DYGA 1K89A 1WETA 4YJ2F 4COOA 2P9TA 1HDIA 3D02A 3P26A 4M9UA 4JSRA 3GQBA 4KXMA 5HSGA 4MUAA 5JNWA 1XAGA 1WKCA 1PGOA 4CODB 1CB7A 2WJWA 3HNRA 3HB0A 4K03A 4M9CA 4EKNB 1WPXA 3OWXA 2UXBB 1M1YB 3EOAI 2EWWA 1F2TB 1HO3A 1PT6A 1WEKA 2QRGA 5CT4A 1WL8A 4E5YA 4EB8A 3RRXA 1OWLA 5TS3A 2IS1A 3NM4A 2X4LA 3KQQA 3PNYA 4NPCA 1MB0A 2R9VA 4TQGA 4LS3A 1U5BA 4V2UA 4XEHA 1EBBA 5JS6A 1RXEA 2IIPA 2PQMA 4NP6A 4RAQA 3DAGA 3GQVA 3OM0A 3T3NA 3WFZA 5HJ7A 3UIEA 2GN1A 3FUXA 2M98A 2AJDA 5JLAA 1MTOA 1UBOS 2RGCA 3HVRA 3I42A 3PITA 1SKAA 1TIKA 5IHXA 1B00A 1C3LA 3R0VA 3CVWA 4D56A 2HT1A 3NT4A 4ZT7A 4BY9E 1KVTA 4O33A 4D0SA 2VQDA 5CPFA 1URPA 2BCGY 3KLBA 3PX3A 3IKMB 4I7EA 5CW2A 3WA7A 1TUBA 2DM6A 4RH0A 3ESYA 4RGBA 2QMQA 4DDKA 5BPFA 1CUHA 1GPWB 2ACWA 2VBFA 1UMDA 4ND8B 1YOBA 2CLSA 2OHHA 1KHTA 2I71A 4I6EA 3W90A 2DTXA 2NO1A 2BPOA 3AXSA 4JGGA 3EARA 3NEPX 4MB0A 4PQYA 1GP2A 3IJRA 3SJAA 1CVRA 1NVGA 1R8YA 1TOAA 4KITB 1KSHA 1OV4A 2Y6UA 4AMVA 3WAGA 1B42A 1AN0A 1GILA 1L7OA 3N86A 4G0WA 5H4GA 3QVGB 1QANA 2UUBB 4G5OA 5D84A 3K6SB 5I51A 3EY9A 5ALPA 1IRXA 1L5MA 4DFDA 5LQAA 3L4JA 2I65A 1TU0A 1ZK4A 1RSZA 2JIMA 1CYDA 2XVYA 3RSGA 5FR1A 4L51A 4HNHA 3SZ3A 3VNUA 4X1KB 4OMUA 1WSDA 4FC7A 1RAFA 3UA3A 2P91A 5AJUA 4ZOLB 3OZCA 1R7RA 1DAFA 1G17A 1W9MA 2FSHA 3ZCUA 3BN3A 3ENWA 2QN6A 1DBQA 3A1CA 4LY0A 5GM1A 3TGWA 3TLGB 4E11A 3RAFC 3QNWA 3ZWWA 3MWFA 3IOMA 4LC0A 5AKEA 2G25A 3E23A 3R0IA 5CT5A 2ZJ4A 2DWCA 1Y7PA 4F9EA 4MWCA 1QE5A 1QP7A 1N7JA 1E5TA 3WIEA 3N8HA 2DWQA 3KFLA 3S7TA 3VOTA 2XLBA 5TC4A 3WGGA 2P6RA 4ETMA 4TYYA 2W58A 1A9RA 1W8IA 2VVTA 1X74A 3O3CA 4RNCA 5K3BA 4TXMA 4AM8A 4Q9HA 3TPFA 1N2HA 4EKDA 3CZ9A 3E8XA 4I0WB 5CEEA 1DIAA 2CEKA 2JAPA 1TT5A 2X8JB 4ZMBA 3U7EB 3FWYA 4R2IA 2O7SA 4G0XA 5CA1B 3R7LA 2D5BA 5THQA 2YY7A 4AY6A 3QVWA 4EI2A 4TWZA 2IKQA 2CLLB 1NBAA 4L8YA 2CLMB 1M75A 2GCNA 3FUVA 5EXDA 2ZBPA 1PWZA 4ITRC 3KVVA 2WD7A 3C8MA 5E4FA 1DG1G 5BQFA 4PFSA 5CA0B 5DX0A 1NJ1A 1YDHA 3AJRA 3U16A 1W48A 3N5CA 3GLRA 1XTBA 4DCNA 2NVBA 1SOWA 2PT6A 4N7JA 3FCSB 3I2FA 3T52A 3WSTA 4II2A 4YRCA 3BRCA 5B3JC 2E3JA 3SC6A 1XZNA 3M82A 5F7ZA 3RIMA 3QFRA 1SPBS 4S05A 1K8ZB 1U8FO 1EXNA 5ES4B 1DRKA 2BELA 4REQB 4EPWA 1A8PA 3ZCTA 1R8JA 4CI9A 3KOOA 1KPGA 4QG3A 1IK4A 1BNCA 2HWWA 3ADKA 3LWNA 3O4IA 3ZU6A 1PLJA 1TC1A 1VP9A 2IT1A 3KTDA 4JI3B 2C78A 3EMBA 3Q3IA 5TPWA 4EOGA 3GLFB 3CQ9A 2ZYTX 4F8JA 3GLIE 3D8RA 3PUZA 4MO2A 2QE6A 4Y1GA 1T4MA 2Z5LA 4OQEA 2FA9A 5FQNA 3U3XA 1RXVA 5IT0A 4RVFA 2RBKA 5IBRA 2AMYA 3BD9A 1GYQA 2HRQA 1M2GA 2JI8A 5JD4A 2NMVA 1S1CA 3VR4A 4FFMA 1BD3A 1GTZA 3G1WA 3N2LA 3FPBA 3KCNA 3R4CA 1AS2A 5L7WA 3B1YA 1ITZA 1VYUA 2CJWB 2I3BA 2R1VB 4JGBA 3VC2A 3ZDRA 3T95A 3RGGA 5T5QA 2E5WA 1CZNA 2DH5A 2INGX 2OBFA 2OK8A 3N2IA 4KGZA 4PICA 1CB0A 4YQYA 2CNLA 4UOZA 4EYOA 2I76A 1D1QA 4J3FA 3NWBA 5FP0A 3GROA 4RETA 3UJAA 1NXQA 1PGJA 2E5LB 1LVUA 3L0IB 3EIOA 1K0FA 3L0BA 1JEOA 2H8GA 2JASA 3ZLVA 4S1VA 1UT8A 4D0NA 4HWGA 3K6JA 4Q9AA 5KNDH 1LH0A 1P2GA 2W37A 1HYHA 1KH3A 3HFGA 3BXFA 3UWKA 1Z8FA 1ZD2P 4B6OA 3E84A 4IOKA 4FOOA 5CHEA 5EIAA 4Z53A 1S2DA 5IBQA 1OI3A 1CJTC 2VNJA 2QRUA 1FQJA 4YCLA 3C3DA 1A8HA 2AF4C 2VJMA 4XLZA 2YZ2A 4CKZA 2SHKA 1X87A 5DU2A 2B4RO 2Y2UA 2O2SA 4RO0A 3I6BA 2PU7A 1FP4A 5A3VA 2M6RA 1S2MA 1EG7A 4KQ2A 3DFUA 3IEKA 2ZDGA 4DLUA 3IALA 2MMGA 3SHWA 1NF9A 1E32A 1USIA 2ZB3A 3AV3A 1BDBA 3CUTA 3EA5A 1L8OA 2VTDA 1WKVA 1QVWA 3KQYA 3NBMA 1Y5LA 4K46A 3LLSA 4LOLA 4C4YA 3RU3A 4RGQA 1I2DA 4RA9B 2CMHA 1DINA 3GK3A 1SUIA 3BB1A 3W8DA 1ESMA 4TRJA 4ASUA 4DM4A 4EVIA 3Q1KA 2C00A 3R3JA 1XZKA 2IW3A 2HWKA 4H7PA 3JASB 4DY4A 1E0JA 2V6BA 2HN9A 1OTXA 2VNKA 5AP9A 5HF8A 2CFRA 1DC4A 1YBVA 5AOAA 5E8RA 3T3EA 1E3DA 4X1OA 3GAZA 1ZITA 4C7MA 3NTOA 4CMBA 2I5PO 3ZWAA 1ZISA 4JUAA 4WN3A 5AM1A 4NDAA 2W6NA 1HLGA 2UVDA 1WXFA 3DP9A 1G20B 3EK2A 3WI7A 3R5TA 5L53A 1C4OA 2VWGA 2VF8A 5CBKA 1V16B 4JNKA 1H4VB 1NR1A 2BBOA 3GFOA 3TTVA 1F7VA 3L0PA 3PFCA 1NYLA 2C7QA 1CEEA 3SX4A 4KAJA 1KKUA 2FEWB 3AW9A 4ENUA 3P0HA 4RTPA 4BV2A 2RGRA 2J3KA 5SY6A 3WYFA 2PZAA 2RGYA 2W8BB 4LK2A 1MABA 5EJ9A 3D1VA 4LJ5A 1KNQA 3DMFA 4Q12A 4YRAA 5CCXA 3H16A 2OG2A 4QOGA 5I8PA 2GZ1A 4OTZA 1W6RA 4R01A 5TF0A 3SMVA 1VCOA 4EUNA 3ZXXA 4BXOA 1JVNA 4JEUA 4JN6B 2VEOA 3PNKA 2BLNA 1Z3CA 5CIYA 1O5OA 4NK4A 5E0OA 1GN9A 4C0KA 4P7JA 3N75A 2Y6VA 3RNOA 3VC3A 5DLPA 4C20A 4EPYA 4OQQA 2QVBA 2PWBA 3L9XA 2BHRA 4XFDA 1S5PA 4P3YA 5KKAA 5T7BA 1AURA 1E77A 3ESDA 3DHVA 4NR0A 4CU5A 1NW8A 5I3ZA 4UVHA 1UBUS 2B8WA 5EJ4A 3E3NA 3TMYA 2X5JO 2JGNA 4HWPA 2B4YA 1TCBA 2YYSA 2ZJYA 4QGFA 2Z5VA 3HO1A 1IG0A 4P2BA 4IMPA 2P9BA 3L06A 1BVUA 2IV7A 4C9BA 4WW0A 4OH7A 1X3SA 1NFFA 3AO0B 4PHFA 3W5HA 2YVAA 1U1GA 1ZRNA 4DABA 4DR7B 3PLAE 1B0PA 3COPA 1KDRA 1M2HA 3C7AA 4TWBA 2B4QA 3K5PA 4EO9A 1X7YA 3TQFA 3Q85A 5C51B 2JAXA 1JQLB 2VC2B 3SS9X 2ODNA 2ID4A 3DL0A 3G9XA 3V46A 3FNFA 3I28A 3IBCA 4XCXA 4BVEA 5H8WA 4QXMA 2RHLA 2AR7A 2C2KA 4DJ5X 1D2RA 1PCXA 3H17A 4RPIA 2NV2B 4ZI2A 1EX1A 3BICA 4AKIA 2AKEA 1QB8A 3GAMA 2C4MA 1XI2A 5EUBA 1K66A 3QOFA 2M1ZA 4UJ3A 3WL5A 1IWPB 2JLQA 3NP7A 4Q37A 5E6RB 5JJCA 2UZ4A 1EFAA 2F8SA 1ZRSA 5HWSA 5J43A 1R10A 1LPNA 3OSUA 1YA8A 5FA5A 5LJLA 5KU1A 1IY1A 1QTQA 3UAWA 4R7ZA 2C7OA 3F49S 5CFQA 4AN1A 2WTXA 1FQWA 2V7QA 5IDYA 4N3CA 4WGGA 1QZTA 2ZPUA 3LJKA 3IKLA 1YJ8A 2CHFA 2EZTA 3PFKA 4IFIA 2FPRA 1GSIA 3BFJA 4KNVA 1JDVA 4C0JA 4QOEA 4C0HA 2Q5JA 4Z4QA 5A71A 2Y3IA 2CNWA 5ALGA 3VPDA 3DD1A 4ER6A 1R4MB 1Y5RA 1E6CA 4WERA 2X5OA 1T3GA 4DUPA 3KYBA 3O92A 4YRFA 3AIMA 2I2FA 3PWTA 3KQSA 3TRJA 3OY7A 4ZDIA 2XBMA 1V47A 2NUPB 3JQ7A 4M87A 2FMIA 1CF4A 5HE8A 3GIWA 3IAS1 3U7QA 4JC8A 1AZLA 1MNQA 1PBTA 3D8UA 4DPLA 4IIJB 1ZUIA 1KAOA 1KDYA 1JAXA 3CNOA 5E4TA 5EJFA 4O02B 1IEQA 1KC3A 1V2HE 5DNUA 3H1BA 4NI5A 1WJGA 4RD6A 1AJEA 1D6MA 3MTBA 1AQIA 4UXHA 2ETXA 1LBTA 1OWMA 2IELA 1WDMA 3KKPA 4JX9A 1IMJA 6NULA 5IN4A 4KIFA 4MCAA 2E9SA 4K05A 4QYXA 3V1MA 3D6JA 3GQBB 4D9FA 3H1PA 3HCCA 3QVVA 5JNSA 1MBZA 4IQ0A 4A36A 4BP9A 3NIDB 3GMTA 3AP1A 3LWZA 1MJ5A 2C5HA 3ESRA 1VHQA 2ONCA 5ILQA 3RV4A 4F1JA 2YR0A 1XTUA 2ZWVA 3H3FA 3QWFA 3N9IA 3FHLA 4ZAVA 4Z4CA 1JI3A 4WFQA 2J6CA 3PG5A 4DV2B 1RM3A 3AUFA 4WEOA 5ESDA 2COKA 2PKCA 2H92A 4IIUA 1TCCA 1U5BB 1AO3A 2J1LA 5LNK1 2JAHA 1B26A 2GNAA 5EIBC 3WNVA 1C1YA 2JC3A 3Q3CA 1Q7RA 3U0VA 4JJ6A 4ZVQA 1HNZB 4JLSA 2C7RA 3LLVA 3AC0A 4L95C 4MYRA 3WNCA 5A5EA 3I2YX 3CT6A 4IH4A 3U7IA 1Y82A 1CQXA 3HBFA 4HFNA 2Z3ZA 4BBPA 3JZIA 3OZDA 5SYNA 4IEIA 2SCUA 1B14A 4IJ5A 2WR8A 3RW9A 4NDNE 1XFAA 2MJLA 2RK4A 1YE5A 3FKJA 3TZEA 4CF7A 2VQ6A 4RV5A 4QSMA 1BQEA 3G9UA 3FDZA 3ZGNA 1EP1B 1QK5A 4BV8A 2ZXUA 3ONFA 5K8JB 5F2NA 2H18A 3JQ8A 2HJHA 3NC1C 3K8YA 3UH1A 2FKAA 3C6KA 3MWLA 4ZYWA 3VFDA 1GZSA 2Y67A 3DE6X 3LK7A 3WK6A 4D9MA 5CAEA 5KOYA 1YUMA 4GXQA 2PS1A 2Z8YA 1K63A 4I2VA 4EL5A 2ZDQA 5JADA 1UMKA 2YC4C 1ZEJA 4QELA 5IJZA 3QTBA 3CZRA 3M4NA 2VUSA 3E9MA 1IAQA 2ZYUX 1MH9A 2IEGA 2PYIA 2YXPX 3O2QB 1DEOA 2OWDA 1Q7TA 1D1TA 1V4BA 4R2KA 2AEFA 3F46A 4RE5A 3CH5A 5IM5A 4QBIA 4QGSA 2GPNA 2Y1DA 3TI9A 3T3DA 3FDFA 1HDEA 1KK1A 4D4LA 4C3VA 4RIEA 4MA5A 4EMUA 2RONA 4KO4S 4K0RA 4HXFB 4B9AA 1Z33A 1LLFA 3N0WA 4IMJB 4OEHA 4R51A 2UXCB 3W3ZB 1BA3A 4KN9S 4E3ZA 5A2QA 1YHZA 2FZGA 1JDNA 2PGLA 2G09A 2H1HA 2Q3LA 2VF2A 4JLAA 1TQ8A 5AICA 4DRYA 1NW7A 1NVMB 5IC6A 2QPOA 1FVOA 1HDYA 1XX6A 1H2AS 4RY2A 3TSOA 3U17A 4EY7A 2CV0A 3UT0A 4D43A 3SICE 3RT1A 4YUZA 1S8FA 1TRHA 5DYYA 2C83A 3PNQA 2FXIA 1H0RA 1NDHA 3DMNA 4PSAA 2N42A 4C0SA 2CKDA 3DFZA 2VP9A 5B36A 4H35A 2X9VA 3QKRB 3U3ZA 2BTEA 3A4IA 4DPMA 4P7KA 4N7MA 4YYZA 4UM9D 3HZOA 4CQNA 1S89A 4JCCA 1C7QA 5AVTA 2DJ5A 3SHTA 3ONDA 1I1OA 5KYNA 5LJIA 1G21B 1NC1A 3PDJA 3PE3A 5DBOA 1XQ6A 2B7CA 4ALNA 3CWCA 1NJSA 3UK6A 2R6HA 1K8RA 1VSUA 3LPLA 4KMSA 1B8VA 2O3TA 3FFXA 5J5AA 2VZLA 4UU8A 4FLFA 3KSAC 1KY4A 4IVQA 4K6MA 4HC4A 4PEVA 2VRBA 1L7NA 3EBLA 4UUAA 2RHHA 3P9XA 4PO1A 4CTJA 5JNTA 1GG2A 3NXKA 3I39X 2O1SA 3F9IA 1KEEB 1USWA 3L0ZA 4ZYXA 3DYIA 4ZZ0A 4J1NA 2HNBA 3SI7A 1ODSA 2CDNA 3TBKA 4D9KA 4QHTA 5FF9A 3GEDA 5TPWB 4YT8A 5KQMA 2QW1A 2WAYA 4KU4A 3OD5A 4BLQA 1AQUA 1YBHA 3KM0A 4FFNA 2NZYA 2GDZA 2A33A 3KPVA 4L8VA 1HT2E 5D3ZA 5B7NA 3HKCB 3VI4B 2ZIUB 1QO7A 8AT1A 2GCGA 1DOAA 1NLFA 1UM9B 2CF6A 4JROA 4IUBS 1YK1A 4G4IA 4IICA 3WISA 1LI5A 4NXMB 1T9CA 3OKPA 2IYLD 4AMGA 3HDQA 1CSEE 1N92A 3M34A 5IJ0B 3EXFB 4FDMA 1I3CA 3LT4A 2EX1A 4NCHA 2JFXA 2QXUA 5E4YA 5HF9A 3ZDXB 3EWAA 4DA9A 4QU0A 1OUMA 1X13A 1ZW6A 3R7FA 2VK1A 2O7QA 3KSDO 4W5HA 1M2FA 1P2DA 3MAGA 1NYQA 4F2WA 4UHJA 5LWHA 4LE2A 1NLMA 1U3GA 1ZNWA 2G6TA 5DT2A 3SXJA 2ZSFA 5E7MA 1XNQB 2JARA 4WNIA 2R0QC 3R4VA 2FHSA 2VXBA 3TTTA 1K86A 1ZMOA 3IFSA 3K9CA 1MQSA 5IEBA 3VU9A 2OFOA 1J25A 3T9EA 1JN0A 1COZA 2IYFA 1XMOB 3FSRA 1T9GR 3OJOA 1I4EB 1LKZA 4LXQA 2ZAIA 1M34A 3FD8A 1BTOA 1XROA 5BN4A 3H6KA 1TCUA 1B8PA 2OV2A 1NKVA 1WCIA 2PGNA 1BRMA 1ZH0A 2EGUA 4FGWA 2OXIA 3VSAA 4EGJA 3IVXA 4AMZA 5IX8A 5K7SA 4FUQA 2Q8NA 6ADHA 5LZ5A 5K6TA 4EEKA 4AG6A 2EXXA 3B38A 3QTTA 3T4EA 1IM5A 4GC5A 4DHWA 3LK6A 3WICA 3MPOA 1P33A 2VJMB 2HIAA 1BG6A 2QLTA 4YRZA 3BWDD 1UPUA 3HE3A 4W9RA 3E6AA 4L5AA 5SY9A 3ZWOA 3VC7A 4UBJA 3CNBA 1XPRA 4XIYA 1FP4B 2F1OA 3L7YA 1WU8A 1H05A 1VPTA 4ZOBA 1N32B 2D5LA 4MA4A 4D3DA 3MB5A 2KMLA 1AKWA 4X8LA 1RLUA 3CF4G 1V5EA 1SUAA 2X9QA 5CG2A 4HF7A 3ETCA 3EXAA 2CHQA 2H08A 3RLFA 2BY4A 4NOMA 4CKYA 1WY5A 4QUHA 1KBOA 3LECA 4BNUA 1GXSB 2ODTX 4I6GA 2W2QA 5TXGA 2GUWA 3LF1A 1Y34E 5ICFA 4CR8A 2L2QA 2XWJI 3EVGA 3ETEA 3V6MA 3WDSA 1OZAA 1RRGA 3BIOA 4ZXFA 4EFNA 4D9NA 2PBZA 1J0BA 3RBVA 3T7CA 1I8TA 4XSHA 1CUUA 4URZR 2D5IA 4CU2A 4QECA 1YULA 2I4OA 3KYIB 2QY6A 4X54A 4R1SA 2IGTA 3JYLA 1N8NA 4EPTA 4WL0A 3W1VA 2ATVA 1KVQA 1P7WA 4TTSA 1A5TA 4YCSA 1BVHA 1ZONA 3PC4A 4BWYA 2OGTA 1NU8A 3JSXA 4N3BA 4IGIA 3RJTA 3PGXA 3V4SA 4PZ0A 5DWDA 4XWOA 2V3VA 2RHOA 4F5EA 2R8BA 4JVLA 4TV9B 3PUWA 4O2AF 5DHTA 3SR4A 4OLFA 3NATA 3N2ZB 4RFLA 4LQLA 1XF1A 2VT6A 4PNHA 2PX0A 4ZGWA 6CHYA 4LPSA 3AL0C 1WBJB 2BUBA 2VTVA 2XUGA 4DSTA 1KZGB 1MABB 2JJ1D 4NFLA 1YNSA 4QDKA 3R8FA 5I4CA 1VHWA 1YNOA 3MNFA 4Z3KA 4E5UA 2VNIA 1RBZA 2FW9A 2Q5OA 1P75A 2XGSA 2H7XA 3FLEA 3MGAA 4M4SA 1K8XB 1WX1A 3MUNA 1V96A 5ALLA 4EG4A 4BXOB 2ZM5A 1O89A 3SF0A 2KX7A 3AUYA 3QA9A 2O7NA 3OFVA 4FMDB 1ZS9A 4DM3A 3C98A 4XVQA 2ZUWA 3LHKA 1QE3A 1YOVA 3FOAA 4K8RB 1HNNA 1G6Q1 1PO7A 4RADA 3TXXA 4XLLA 1UOEA 1ISJA 4QEKA 5EE3A 1JWBB 3R5SA 4JMLA 4KXUA 3WQSB 2HSZA 3BRWD 2C0CA 1IU9A 2ZAGA 3KT6A 4MP6A 4DAOA 3IAFA 3H9BA 1BU8A 4BQRA 1B41A 1QORA 4R2LA 1Y1PA 4YLGA 1YONA 2VEDA 3IXMA 4TKZA 4ZFNA 5F23A 1JH9A 2ILVA 3M49A 4IS3A 3WE7A 1RPTA 2IP2A 2JNWA 2IP1A 2XMGA 2BEUB 2EDCA 1PR4A 3DZFA 5ALZA 3FWZA 4Y9RA 2C29D 4PRYA 4H6XA 2N75A 3CXUA 4FMCF 4HAWA 4Q4JB 4FKMA 1I0LA 2WKPA 3BL5A 5KPJA 3KAKA 1D7OA 3FSGA 3GJ3A 1VCIA 3L1UA 3QX7A 3WDLA 2CNBA 2CMGA 4M7RA 3HHEA 3VDNB 2MSWA 3IE2A 3AJEA 2BBWA 2DPHA 4M53A 4GC9A 5IJXA 2QLJA 2VOJA 3UYLA 3IOEA 2QUZA 1VLHA 2H06A 4JLJA 3RT7A 1OCEA 5KPDA 2XPCA 3H04A 3GEBA 1BJKA 1PQUA 2POQX 2QRKA 3PTLA 3Q6IA 3VKUA 5E1DA 4CLDA 5C5CA 3CWZA 5HFJA 2ZSJA 2HPZA 3FCYA 3WXBA 1M8GA 2YIJA 2WVJA 3FYHA 1YQDA 3MTIA 4L4ZA 4RMIA 4UAJA 2R48A 2RBGA 3USES 1MDFA 3SC4A 4RACA 2LKDA 1TKRA 3RVDA 1QFXA 1U11A 3HSYA 1P9WA 3QJ5A 3EIUA 1B16A 1V45E 2Q4TA 4BL5A 1U7DA 1CNFA 3MWDA 3EVFA 3LY9A 2V98A 3O21A 1BH2A 1QZZA 1HA3A 3H8JA 2XOKD 3FOBA 4JT2A 2X5XA 2GN9A 2CVPA 4D9CA 5K3DA 3K9HA 4ZYTA 2PJRA 3DH0A 1P18A 4TLEA 3ZJYA 3PXCX 1T25A 3G8DA 3LCCA 4MS1B 3TLAA 2B35A 2X5KO 4ZQCB 1HLPA 1RIFA 2IUEA 2H0QA 3AF4A 5E9AA 4LF6B 1YIOA 2E82A 3N2NA 4X8OA 4GS5A 3I30X 5DSTA 2NU9B 5P8WA 2A1UA 4YRGA 4IP0A 1X39A 2G1JA 2X5NA 3R7WA 2NVWA 4F60A 4CKCA 3B82A 2PZMA 1ODFA 2YS7A 4G67A 3KQMA 1JG6A 2VTBB 3WFJA 1G8MA 1PU2A 1E3JA 4CTKA 1WPRA 4I5IA 1W5BA 2IBSA 1ZN9A 2JL1A 3ELDA 4UD6A 1RYHA 3CRNA 1U28A 4UBKA 1D2NA 4OY3A 3OLZA 1XRJA 2V8BA 4QYWA 5FAXA 1K3TA 3AUTA 4O2BA 1HX7A 1JJIA 1EGAA 4ZN6A 4MWEA 4TTRA 5M34A 3GLGA 1XT6A 4GM0A 4H6VA 1FDUA 3H7AA 4EI9A 3WIUA 2H4FA 1YRHA 1CC1S 4BQEA 3FI0A 3BDVA 5TQJA 1U81A 3ETJA 4FXOA 2FPKA 4DCUA 1XZBA 3DZDA 1PW5A 1B8UA 3BK7A 5AVZA 3P52A 2IL1A 4G25A 4MDFA 1EFPA 3L6DA 2G17A 2RAFA 1DTSA 1FUYB 2PD6A 1R18A 2WSIA 3CE9A 4BX8A 2AD1A 4NTZA 1S3IA 2QN2A 1KDZA 1GRQA 4BMCA 1BS9A 1NV9A 1S4QA 3C85A 2XDQA 3CRMA 4G9EA 4X91A 4EG3A 1I5OA 4HWTA 4NHOA 4QYMA 3KR9A 1U0BB 5KYXB 2F62A 2IUFA 2PLAA 4Z1OA 3H2JA 2NTNA 3HBMA 4K6CA 4XLTA 1U9CA 3L2OB 6YASA 2XX3A 2SCUB 4WDQA 4F5ZA 2YV4A 4W1PA 2YV5A 1PZHA 2WSLA 3TI7A 5JSZA 4BBZA 2MSEB 3OLYA 5FB3A 4JI5B 3W5CA 3EGVA 3T3OA 5KOHA 1I4TD 1UPFA 1J9GA 4HN9A 4I36A 4Q4AA 3OOYA 1YL6A 3ZE1B 4PPFA 3UMVA 1EK1A 2PXXA 3DB2A 3L6UA 4PYQA 2R87A 3JQ8B 1Y7TA 2Y1FA 3NHUA 3WBKA 2VDWA 2EL9A 3IV6A 4I4CA 3UHFA 1RPZA 1PWYE 1AN9A 2QM3A 2FMHA 3EBOA 1OLOA 4IEFB 1W9HA 4YMIA 2WFAA 1KI2A 1PZMA 1O3YA 1KO4A 1V11A 3KZOA 5JV5A 3OPXA 4G9GA 3T94A 4AAYA 1VKZA 3LHDA 2O23A 3AI7A 4HNAA 3RKRA 5KI6A 2C8LA 4NJEB 4C2UA 4CGZA 4UM5A 1OW3B 2C54A 4RZQA 3SYRA 4UTPA 2NSLA 5C1BA 3H2HA 1M6EX 1YQWA 5F5XA 1UDXA 2AVNA 4BLOA 2XZLA 2UUPA 4L8WB 4B3CA 3OY2A 9ABPA 3UJ7A 5H3LA 5CXUA 1Y3BE 2OCIA 4K5QA 4YGXB 4EMBA 1M83A 2KS6A 2OQ2A 3BFXA 5EJAA 3I8XA 1U28C 1P7ZA 1PR3A 3LPAA 4BB5A 4PLZA 5ALJA 3DEIA 2E4AA 2B8EA 3CCCA 3I2IA 4P83A 2GZAA 2FJ0A 1EJBA 1QYDA 2DPLA 2E55A 4DE5A 4YV7A 4MYSA 5J4YA 3ZLUA 3AEQA 4NYJQ 3N1UA 1P5FA 3DXYA 1N5JA 1YB1A 4D5GA 5HZKA 2H4YA 4MYTA 5ER9A 4RKWA 3OEYA 1CHDA 1J23A 4YBZA 2P30A 5DNEA 1UZNA 4U7HA 1A27A 3K9WA 2PAAA 4MVXA 1AKEA 2NXJA 3HP4A 4JNCA 4U0JA 3FETA 3DQZA 4WN9A 4DLBA 5LKAA 1JHZA 2WJZB 4HDNA 4J0HA 1Z36A 4MIEA 5EWLB 1QHFA 3MYRA 3QBJA 4WJZA 1ULBA 3AF6A 4H4CA 1N2IA 1T5OA 4TKVA 4JQZA 1U3UA 5CNIA 1B6TA 4NIMA 2JFQA 4KH1A 1DKRA 1OIVA 1QCCA 2BEVA 1A7KA 1JQJC 2FMXA 3DTVB 3BJEA 3FE2A 5EQDA 3MJCA 3AERA 3FOWA 4AZTA 4N6GA 1VI5A 1AGXA 3AM1A 2I87A 3A9UA 3WLLA 4F71A 4HRVA 3EZLA 2FFQA 4FZJA 2X0FA 1E0AA 2D1TA 5DNYB 1NTRA 1AHHA 2E4UA 4HZUA 4UOEA 4UUOA 3AY7A 3LDGA 3NAGA 2Y4NA 4XX0B 3PP8A 5AYVA 1LW7A 2R8XA 4CKBB 3DS8A 2ZUEA 2A0WA 4XVRA 3Q0IA 3LT1A 3OQHA 1ZI9A 3QFCA 1W85A 4OV6B 4ZQFA 4HQNA 4IMIB 4GKAA 3BH0A 3D7NA 4DB4A 5F1YA 1XRSB 4WASA 2PJZA 1N2SA 1XCJA 2KBEA 4K6FA 1DJOA 3IAEA 3C48A 3EIHA 3RANA 3L82B 4MW0A 5HDQA 2YJTD 1NQTA 2CC2A 2WVAA 4ZI5A 1NAIA 1P73A 3QXXA 3AF5A 5AFSA 3TECE 1WMFA 2OD2A 5LQDA 3RGWS 1PV2A 4MQ6A 4BJ6A 4ZTZB 4ROSA 4JSYA 3ZQ4A 3MMPA 3DE1X 3DLAA 2JIZA 3RFTA 5DHUA 4XWGA 1XZHA 1UUFA 3ZJVA 1GQQA 4QUJA 2YJ5A 1EFTA 3GCWA 4HQOA 1YC2A 2CV1A 1EDEA 1S2GA 4QJ4A 3BM5A 2QZ4A 4GT1A 4H16A 2ZP1A 1IULA 4MUIA 5JARA 4BEVA 4HAOA 4JP8A 3R7AA 4AJPA 5IXSA 1L4EA 1U6IA 1V8ZA 1SUEA 1A4XA 1PJSA 2PX5A 1Q91A 4CIXA 5JANA 5KQGA 1QCDA 2AOTA 3QWHA 5EE1A 1XZFA 3N0RA 3PRKE 3W79A 5JNVA 3TZ6A 3PJFA 3W6UA 3EISA 1DX4A 4YAFA 1DUVG 5EERA 2NM0A 3I6MA 4NMHA 3EDYA 3L4BA 4YS6A 3RUDA 3VOSA 4F84A 2AJLI 2VJQA 2ZZKA 4P33A 4YACA 1JAIA 4D98A 2HRBA 1GFZA 4X93A 1XHLA 4B80A 4EGFA 2YY5A 1PT9A 4MS4B 4EHLA 2AZ4A 2BH9A 4D3FA 1DKUA 3CZAA 3MT0A 4X20A 3JQBA 4IX9A 4CCSA 2D2IA 4GFDA 4WKCA 3UMJA 4FCCA 4ZQEA 4BNGA 1Z63A 1UZLA 3PHHA 2B1QA 2VYVA 2EG9A 1CY2A 1WCIB 2OP1A 1WD5A 1MH1A 3BAFA 4HAYA 4F4UA 1TJYA 1T2CA 3S1SA 5JFOA 3BSYA 1E1RD 2NO9A 4F97A 3FCOA 2LPMA 1DAKA 1O1YA 1T1RA 3RQSA 1Q0PA 4UM7A 3VR4H 5BRJA 3NTQA 1DJLA 3WRWA 1C14A 3QHAA 2OM6A 2Q7DA 3T3IA 1Z2PX 1YUNA 5DTJA 1PJ4A 2B82A 1E2QA 2QQFA 4QVIA 2DY1A 3T7EA 5AVJA 2G7MC 1XD2A 2MYNA 3NHPA 1J2EA 2J3DA 1Z08A 2R7LA 1YV9A 2XVXA 3D8BA 4LV8B 4QX6A 5IABA 1AMNA 3CZ5A 3JQAB 4DCGA 3HGTA 5CMLA 3GCDA 4M9ZA 4YAOA 5REQB 2IXGA 2VJBA 3FI9A 3SS7X 1Y9ZA 2DFVA 2I6XA 1U0GA 2VNAA 3HS3A 4JGIA 2ZUVA 4G1BA 1XXHA 3PIDA 3SYLA 3LXUX 1LS6A 4F2GA 1LPAB 2B5OA 2W2LA 4H7EA 1TJ3A 2Y8EA 3OZAA 1PX0A 3AY6A 5LIPA 1QX3A 2Q3FA 5JSQA 1YBFA 3C97A 3GJ7A 1P2BA 3OIWA 4KL8S 4HATA 2O5CA 1L4FA 1J9EA 4L0MA 4E08A 3VH1A 3BB3A 4K1XA 4EELA 1Y3AA 4ENRA 5DK6A 1KI7A 2A9PA 2QUKA 3SNKA 1J8VA 1LF0A 3SJUA 5IT4A 2X8BA 1GL3A 2J5XA 4GI7A 1HLDA 2W11A 3FOEC 4A1OA 1TMYA 4YCMA 3LGSA 1VIVA 1Q57A 2BFNA 3W05A 2ZSBA 4HVTA 5KYWA 4AP9A 2JHCA 3PQ6A 3TAUA 3G6WA 1R5BA 3HJFA 2V8OA 2LP4Y 3L4BC 1OU4A 4JVSB 2ZR7A 4QASA 5HIIA 3TUZC 2SECE 4BO3A 2OLJA 2ZG6A 4G0OA 2CWDA 4LQDA 1XA4A 1XVLA 1TYBE 4H0NA 5C7LO 1RNLA 1JFFA 3GBPA 5D6OA 3PS9A 3A9VA 2QYOA 2R8EA 3D0RA 4MO9A 3OHPA 1UR5A 3RKSA 1E1NA 4C0LA 4K81B 5BYBA 1HDRA 4EYQA 3BH7A 1FE8A 1UIRA 1UQTA 1W2HA 3GWZA 2AMFA 2ETVA 3U49A 5FDFA 2VUUA 2ZBRA 2YRXA 3KVRA 2KWIA 3U7GA 1GCOA 1NXVA 1PI3A 3D4IA 2OM2A 1GCIA 1ZJ5A 3IDAA 2GO7A 5AUPB 3A6KA 3A3YA 4EHHA 3FTFA 2EIHA 1U2RA 1ISHA 2BMJA 4QAQA 3OCXA 4X90A 3SSMA 1YOVB 4B71A 4IWYA 3AZPA 3PKJA 4WH0A 4DUYB 4PZCA 2PUFA 3V1UA 3IAS6 1E9BA 4YHHB 3TNDA 5T6BA 2AXPA 3NTUA 3G7UA 3HVIA 1H69A 4H1TA 3PYXA 4HP8A 1PDWA 1UKZA 2BM0A 2ZROA 1KK3A 3QMVA 5AW4A 5A0TA 2ZXEA 4RPLA 5BQ3A 5K0TA 2H63A 2ZBDA 5IDQA 4TYQA 1MAVA 2ZK7A 1YK0A 1P2SA 4R1NA 4IKOA 4O29A 1KIMA 1YBAA 3C6YA 3CJTA 3VO8A 2WZDA 3DFMA 4R2XA 2RGNA 2PRSA 2QD3A 3C7KA 3L1JA 4RA6B 5KAMA 5KHLB 4N39A 4C76A 2AK2A 3ZH2A 3ZQUA 4RFVA 4W82A 5JHHB 4EYKA 8OHMA 4H60A 3GVXA 3DAYA 3IILA 2I7VA 2BBTA 4XWKA 2QUHA 1ML3A 2C9DA 3JALA 3QSGA 4GHWA 4HWKA 2FLVA 5ALEA 1V3QE 2VSOA 1T4BA 5B7QA 1ZM7A 2GLUA 4GLFA 3V4FA 3ANSA 2PX2A 5LNK6 4PBSA 2C0PA 3DAFA 2B94A 2JA1A 3GRPA 2I3AA 3W5BA 2QXTA 1D2AA 1VKOA 3TX2A 2H1SA 2A3RA 3HBNA 5ALUA 3U9LA 4CCYB 5ES3A 1LTQA 4DCTA 1UBCA 3VOAA 4D8YA 1WMDA 3G9TA 3Q0EA 3A4LA 2FN4A 3OMXA 2CMKA 3PCTA 4LRTB 4UMEA 1XNHA 4US0R 3OE5A 4HN4B 5ITZA 1C3OA 1PUIA 3MWDB 3NOVA 2FN3A 4Y1FA 4DDTA 3ZS8A 2OPBA 1O95D 2Q6TA 1XDBA 3L41A 4PONA 2RHMA 5EP2A 1V1MA 1YR6A 2ZIVB 2ZI4A 4FCWA 3WQBA 2OAGA 3VYWA 1JAZA 4ALKA 2J0EA 1RWPA 2ERXA 1XKLA 1Q0ZA 4LI0A 4FB5A 2EFYA 1HEYA 4YP0A 5IZ4A 5HVNA 1PWHA 4YCAA 3DW3X 5EP3A 1T6XA 5AQ1A 1N7IA 4Z51A 2IITA 2YFYA 4EG6A 3G5UA 1AY0A 1P6QA 4DT1A 1B4DA 1UOQA 4BVBA 3T35A 4HWSA 3HB1A 4MW9A 3OBIA 4Q3DA 3R7WB 1ZBQA 2C3OA 4CKCB 1QIIA 1UBFA 3FB1A 1SY7A 1WZCA 1W6UA 5E6SA 3DMPA 1ZSYA 3A9SA 3EVCA 2I3ZA 4FOTA 3IULA 3ABQB 1IOWA 1E79A 4POAA 2YWRA 2XVMA 3KZMA 1LA2A 4LWPA 2EJTA 3I5AA 5FTMA 1UBNA 3GLHE 4P4NA 1M5RA 5A9SA 1DKQA 1F6WA 3IAHA 1YS6A 4GLOA 3KT0A 1L5QA 1GNQA 3PIRA 2CN1A 1BYUA 2ORYA 2FEPA 2J67A 4YGYA 1SHTX 4KQKA 4NEHB 3SD7A 3SQMA 2IX3A 2RGNC 2GEKA 2CYAA 2GWHA 1NPYA 1Y0BA 3NYWA 8LDHA 1E6MA 3VTKA 3CX8A 4FHGA 1M2EA 4J43A 5PGMA 4CIWA 4L7QA 4MVWA 3TFQA 2TMGA 3D9QX 4HGZA 1P62B 4INAA 1S8OA 3VDRA 3ICEA 1EFPB 3OKAA 4QPJC 4IDDA 2J9RA 1E2BA 1WO8A 3KZVA 1JQAA 1BN6A 3FX2A 4Y2GA 5EYPB 1KFKB 1Z2EA 2ADMA 3S7ZA 3MBOA 4R9VA 2DPGA 1TLFA 1C50A 3EXG2 3JS5A 3KOYA 3P2IA 3ZUGA 4A8JA 3ZW9A 2TRSB 2OHXA 3T6KA 1DCFA 3OAAA 3GLTA 1ZMTA 3BZWA 4HYTA 3HYCA 4J0KA 1FUIA 4NU6A 2YDYA 4U3JA 3A2MA 1RKBA 2JLAA 1TO2E 4MYHA 2C5GA 1HY3A 1ZPDA 1SBHA 3P2KA 5KOHB 1TAGA 3CMMA 1KYVA 1A9PA 4JXKA 4NE9A 1F3OA 4Q4AB 5CU7A 1FFGA 2P0YA 5EESA 3FCAA 3DFIA 4CQMD 1N2CE 3ESCA 4QFMA 2FX3A 2YHBA 1TD9A 1AUVA 4PAWA 3RS2A 2W48A 2XUJA 2HJSA 3RWMB 5AJHA 5KNCA 2AOUA 2OHGA 2ZRDA 3KOUA 4Y1RB 5KTOA 1Q3HA 5KWJA 1MB3A 1VKHA 1BXRA 5JXHA 5KQRA 1SU6A 3O7WA 4TTAA 3HU5A 3ME5A 4LHEA 3WK7A 1J20A 2VJLA 4KP7A 3UB2A 1QHIA 3O8QB 1U0EA 1USUA 3ER6A 2A1TS 4A5OA 2VAVA 2V97A 2E48A 3DMHA 2WWGA 1BOFA 5CW1A 2J7KA 2HSGA 1DCKA 1SD2A 3CV3A 2ZIGA 3RSSA 2DG2A 5LQJA 1IOLA 2CUTA 4UU0A 3H75A 4JQYA 3LUKA 3S6JA 4IHAA 1SURA 1IPFA 1T8TA 4FHDA 5J2UB 1SQGA 2HMWA 2P35A 4FR2A 3NBKA 5T8KA 1OWNA 2Y92A 3MF4A 3MHTA 1GZ7A 1PGNA 1PJCA 1W4BA 4IV8A 3K35A 4ME6A 1UBEA 4MKGA 3HB9A 4UHKA 2A2ZA 5EI5A 2BH2A 1V4VA 3TQQA 4DKJA 2Q4EA 3OIGA 4GM4A 4J0EA 3STTA 2HZ7A 2NU7A 3V8BA 5FJJA 2GZMA 3NHSA 4HVLA 1S6YA 5A1JA 2YXLA 1JUDA 3PUYA 2GSWA 5KBYA 2IJGX 2ZVDA 3DUWA 4D4JA 5JVDB 5BV7A 1HNWB 1KJIA 2X8LA 3LXXA 1EFRD 3OTQA 5DHSA 4MDEA 4BRUA 1JQEA 4WN9B 1YZGA 1NBME 5LBIA 1NLYA 4HDNB 3RFXA 4AN4A 2X2OA 2NAPA 4CM8B 2W43A 1Z07A 2VP2A 1KOFA 4PFJA 5B53A 2AWNA 2N1MA 2QSJA 1MJFA 2WQ6A 3TZKA 2O2XA 2V9ZA 2W2VA 1TEHA 3NC0C 4A8JC 4J0DA 2BEVB 3B53X 4Q5IA 4H77A 1PTJA 3AERB 2C3PA 5DBGA 4QBGB 4LXIA 3CLHA 4F3KA 2ZUTA 2NYVA 4YV2A 4BS9A 2WUGA 3OMWA 2JJ1A 1GGNA 2VHQA 1FXWA 2Y27A 1IYZA 3NBAA 1OPRA 4TOIA 4HZUB 4OYHA 1UEXC 1APBA 3AHEA 3RB8A 1DVRA 2ZOSA 1B93A 3WJ2A 1Z5PA 3H5AA 3X43A 1FS5A 1VE7A 3A37A 3E9CA 1KC1A 1XVVA 3OE7D 1W85B 3WY9A 1PRYA 4D9IA 2JEYA 1JLRA 4O5AA 1RBMA 2F67A 5JZBA 2XRYA 5JS1A 2C9MA 1BA2A 3ESQA 5AH0A 4FD3A 4DLTA 3JZDA 1CFZA 2H2FA 3C3YA 2FSSA 2JATA 2PUVA 3DDZX 3RSZA 1H8ED 1YTUA 1TFRA 1YRBA 5ALHA 5IF9A 3OZSA 1ZKDA 4EHFA 4XARA 3K0CC 2EZ4A 2GK4A 3EDRA 4PC1A 4UUMA 2XB2A 1J33A 1GQ2A 2NPIA 2VQSA 3TLKA 2I4LA 2ZRKA 3OZVA 3WDMA 5LD2B 2B37A 2XMQA 1EIWA 1R0CA 3E53A 3ROZA 3WGZA 4FR0A 4KACA 5T8KC 4DOMA 3L5OA 1P0PA 2C3UA 1UP4A 1DAOA 1BGWA 3ENNA 2DKOA 1JJBA 2AOTB 4Z9FA 3GMSA 3IQFA 5ABPA 1ZG3A 3DCNA 1ZL0A 4PQEA 3GVHA 3BWXA 3L1KA 1X7DA 2XQGA 4M0FA 3K70D 2WF6A 1W34A 4NCKA 4P32A 2OHFA 1GTG1 1Z0UA 4GX1A 3MCZA 1W1IA 2Q99A 1J4AA 1HQCA 1NKSA 1T5LA 2QM7A 4FJ2A 3TTWA 3P5SA 2VDNB 1UANA 1OU0A 2PFGA 5IKOA 3P2EA 1JBKA 4L16A 1UP6A 3M1AA 2Z4RA 2GOYA 1PYOA 1HUQA 4IDFA 5AVQA 2R4QA 4TXHA 2BFDA 1BHSA 1T5DX 3FCEA 3VHXB 2O8CA 1TYEB 2A0XA 3HP7A 1GGHA 3KSMA 1A9ZA 1UBJS 2D3WA 3I9OA 4UPVA 2P4UA 5AM3A 3TXYA 1JXQA 2ZRGA 1R6TA 4DLNA 1PTJC 3AEKA 3KVOA 1VJGA 3NJRA 5DN9A 4XB2A 4PIPA 3WLEA 3WWDA 1KH2A 3ZHTA 1RYYA 2OUIA 1OTHA 2OZLA 2WMOB 1FUEA 3II6X 5GMOA 4CF5A 5DN6D 1DKPA 1TO1E 1U0HC 5DLDA 3V33A 4EY8A 2R97A 3RS3A 2FN7A 1PK9A 1CX9B 2H52A 2NUBA 2ZSEA 1JHOA 3GFSA 1JDPA 4WBNA 5L45A 4HUQA 4ZO7A 2YIMA 4AXBA 1ZU4A 3P4UA 4JYPA 4OMCA 3ZXYA 2W42A 2VSNA 2HF9A 3OOHA 5KC8A 4R1LA 2H9AA 5KINB 3CCBA 4JLPA 1FNNA 3WLAA 1NHWA 4DIOA 2OHOA 3OZBA 1JIQA 3DE0X 3L6CA 4AO6A 4PLPA 1X77A 3PC3A 3RRBA 4BUCA 5JS2A 2XUOA 4YPOA 2QD4A 3UCFA 2RI0A 1XXHB 2OZVA 4FQ8A 1V8FA 2Z2JA 3U61B 1UJMA 1P1FA 4WZAA 4ZWNA 2GPYA 4QNNA 4AZWA 3VPXA 3P0IA 1UP7A 3G0OA 2VPIA 3HWX1 1P60A 3CLTD 5D6NA 1WMAA 1YB6A 4BO0A 2O59A 1EM6A 1GEGA 3DAHA 3KSRA 4J1TA 1FU7A 3T15A 1O9GA 3WB2A 3DM9B 4PFQA 2DP4E 3QUTA 3JQQA 4LCBA 3W5VA 2L69A 2O2GA 2OV3A 5D3MB 2DR3A 2XTMA 4PRKA 4QL3A 4C30A 1IHXA 3LLMA 4AIRA 5AVRA 3DE4X 1MVNA 2QTHA 4MUGA 1NXPA 2ILTA 1YQTA 2O0LA 3TUJC 3WA6A 1HTWA 2H65A 4LI3X 2KB0A 4AP6A 3UMYA 3QG5A 2WUFA 4FYKA 3M3DA 4GR4A 1UJ4A 1XWFA 4NQRA 3RIHA 1YB7A 2ZS9A 3UMRA 4CMGA 3RDPA 3F74A 1IXRC 2H7CA 3BKWA 2VPYA 1RBQA 2QK4A 4L9WA 4O0MA 5DGHA 3RTEA 1Z4JA 1SELA 3HXLA 2FSVC 4MKRA 4A0FA 2PT5A 4FJ0A 1HZZA 2JLZA 4ZP1A 1KAHA 2VRCD 3DBHA 3IDFA 4H7HA 3VYVA 3OIFA 4PQFA 1V8OA 3X1JA 4DJTA 4DMGA 4EUSA 3GY0A 4QOFA 1Y4AE 2H16A 3UKOA 1PVDA 3RYCA 2VJOA 2HK7A 3K73O 1U1DA 4YDRA 1WXHA 4ZRDA 5BWMA 1F60A 2XYHA 3QHQA 4FT4A 1MAHA 3UV7A 1JX6A 3KUKA 4HTAA 2VLIA 1PR2A 2JZCA 4MH0R 4YFVA 1KMQA 1V71A 2CK3A 4AWAA 2QUJA 2NSJA 3I04M 4MHSA 4YVFA 5LQCA 1C4XA 3FDXA 1KMMA 1W5FA 4R4JA 2LD4A 4Q9DA 3WGLA 1MGPA 3L9WA 1KK2A 2Y1KA 1ONOA 4FE4A 1R74A 3FAZA 5DNDA 4D25A 1IJEA 4QXOA 2BFCB 5J5CA 2FSPA 2IXFA 5TT0A 2O8DB 4JB2A 5U4QA 4P5EA 3FYCA 3RS9A 2WJ3A 1A8SA 4N0MA 4KR0A 1CE8A 3I9KA 3DWEX 4HB3A 3TLCA 5CXXA 1XWWA 1J24A 1F12A 2VH5R 1JDSA 1EJ2A 1TA9A 1BMDA 3EEIA 3BSFA 3N2EA 4MW7A 1VHDA 5FBHA 4WT7A 3LOUA 1CQZA 5LDDC 4KPEC 4BTEA 3J80A 2X58A 4JQCA 4TSFA 1GNRA 2H5EA 2G63A 5JATA 1OMOA 1P8AA 3VAZA 3B5IA 4DHEA 4FLMA 4J1TC 1WW2A 4KE6A 1X14A 3HXOA 2O5VA 4PHTA 1R2QA 2QENA 2IYRA 3BK2A 3OZXA 3H5TA 3FMPB 1C0PA 3PGVA 4JBYA 4JEMA 3W0LB 2AQKA 2WNIA 4MGKR 3TRFA 1OFGA 4PFKA 1M6YA 1MU0A 1V7CA 1Q7CA 1GTL1 2O3JA 2I1LA 3HI6A 2KHZA 3NGLA 4FCTA 2ZB7A 4PINA 3WYBA 4BYGA 3CX7A 4H0FA 5J4HA 3EEYA 1D0IA 1KFJB 2JDID 1DAPA 1RFLA 4KVFA 4YIKA 5FWNA 2TS1A 1V1MB 2V6JA 1I1HA 1RM4A 1U6KA 3OJCA 4ODIA 4QVKA 1A8IA 1HEUA 2X77A 4L8GA 4HQFA 3FXAA 4WFKA 5TVKA 4LQ4A 4UM9B 1UEJA 1EVYA 2DCUA 4E4RA 4ZVLA 4ZTUB 2AUTA 1SMKA 4BQQA 1I2AA 2UZ0A 1F8UA 1HZZC 4IG4A 2YWGA 3UBMA 2O0HA 2P90A 5HOQA 4FGUA 2EFEB 2IV3A 1XBTA 2PHZA 3CW8X 3QU9A 4GRIA 4AZ3B 4EQ6A 1ILEA 3H4MA 3QEKA 4OP3A 4YXFA 2O48X 4KIUA 2H2AA 4Y2QA 1DWQA 1Z17A 3ROPA 1R50A 2NLOA 2Z2XA 3D5QA 3HO6A 3N2GB 1RXSA 4Q4HA 5J3JA 3ZZUA 3DZJA 3V8QA 3RU7A 2AQ8A 5KVQA 2C4WA 3H7IA 4KWIA 4B9EA 5I7SA 2O54A 3JD1A 4YT2A 2AFHA 1WM1A 5AJWA 3C0KA 1JLSA 1W94A 2P7HA 4CE6A 1Q17A 1J1IA 1DJQA 2FNAA 4IXMA 4TROA 5KDDA 1QGAA 1P72A 2P1ZA 5EVJA 2W90A 4I1RA 4CIVA 2YV3A 2JI9A 5FYQA 3EZ2A 4FLEA 1YZ3A 4QHSA 4DEYA 1ISIA 3U26A 1E7WA 4ZIRB 2V1XA 4RDCA 4FFPA 4LX0A 5I7AA 1FS4A 1X0VA 3LCVB 2HD4A 2BM1A 2ZTHA 4WK6A 3EMVA 4BFZA 3I5YA 3LGXA 3DDWA 1HE8B 2QRVA 3OUTA 4NC9A 3DOHA 4J0FA 2NVOA 4CHTA 5J40A 1GUYA 3W8EA 2B25A 1VZ3A 2VS1A 2P6NA 2IYZA 2PFKA 2LWIA 3MMSA 3TK1A 2I55A 3ANXA 3V8EA 2POCA 4MKXA 4A8JB 1NURA 5DULA 1BQ3A 3RC3A 1N6LA 4GYYA 1TZCA 4OJNA 3CKYA 2Z30A 1QH1A 1Z4MA 3OP4A 1TDJA 1XKQA 1GUBA 1E1MA 2B9EA 3Q3GE 1EWTA 1FCJA 4P8RA 4U3JB 3ZZ0A 4DIUA 1Z5NA 1OH6A 2VP5A 4R31A 3PQDA 5K6RA 5C31A 5E1BA 5LZ4A 2R00C 3DOFA 2ABWA 1GDDA 1C9KA 1Z38A 2G28A 2WNHA 1O2DA 3KB6A 4WZBE 5EXSA 3K72B 4AUKA 2VP0A 3S28A 3GEGA 3RU2A 3GRVA 1XHEA 2AA3A 3GA5A 3OA0A 4CV3A 2VLBA 3NVKI 4MRPA 1EE9A 1NWHA 1P7CA 1B1CA 2CXHA 4MK4A 1BXRB 5J4VA 3HZZA 2WSBA 1D0SA 4KE9A 4QDTA 3THSA 4E6EA 4D8TA 3PHCA 4BX9A 3IQWA 1GQFA 5CX1A 1Y8QB 1T26A 2D0PB 4J94A 4BNMA 5EEHA 3ICCA 1G4HA 4O1IA 1BW9B 2ZKIA 2Y1WA 3PEVA 5J63A 4A0RA 3W5UA 3WIDA 2J4FA 3LCUA 3LUPA 4RF5A 2ADOA 3DZIA 4I9UA 5ARBA 4N0EA 6LDHA 3F96A 3EXIA 4W5JA 1DV2A 1HE4A 3CEJA 3PCRB 1QC5B 4EVRA 1LV8A 3KWFA 2GX6A 4BO6A 5EQJB 1CW2B 2RH5A 3FTNA 4AECA 1AB6A 3ICPA 4MWBA 1E4VA 1QGZA 2ARKA 2QT1A 3HJCA 1J2RA 3IHLA 1UKAA 3AI2A 3CEPB 4M21A 3DHNA 4A6XA 4Z7QB 3QVOA 1UM8A 2VJYA 3SHFA 1THMA 1XPOA 3F8WA 3F5MA 2JFUA 1DWUA 3H8WA 1GA6A 1D2HA 1FTGA 2XKAA 4IZHA 3GAAA 2PV0A 4UARA 5CFZA 3SWWA 1ZCAA 1VG9B 5CRIA 3THYA 2MSKA 4OK6A 5KC9A 3TRKA 4BJ3A 3KPUA 3PE4A 4QT4A 3Q8WA 1G41A 4XM0A 1OIWA 2WHYA 3QYJA 5CVUA 2MINA 3G2OA 3IC5A 4XD2A 2IZ0A 3ONVA 3S40A 3WYDA 1RHUA 1I7QB 2IYYA 1ZINA 1XDSA 5U1PA 3MPUA 1XVUA 1ADCA 3RVKA 3EXEA 1IAVA 3L7CA 4L0QA 2C2BA 4CTOA 1ZGJA 4OHMA 3ITDA 3QU5A 3IP3A 3D8TA 4S1WA 4G1FA 1OLUB 3HKEB 4O2AA 3ZZMA 4Y30A 4C2AA 2Q1UA 4JBHA 2PLNA 2VA8A 3PRYA 2PZBA 4P35A 3CURA 5EQTA 3TH5A 2I3DA 3FA2A 4GH5A 3ASVA 4IF6A 4LGMA 4OFXA 4OI2A 1NRJB 3M6UA 1UMCA 2QGFA 3E2MA 3FJ1A 4Q19A 3SS8A 4HV4A 3R24A 3NEJA 5B4TA 5MN5A 1V9CA 1M0EA 4KUHA 4DLZA 4EA6A 4GU5A 4IUYA 1E66A 5DW0A 2DHDA 1UFOA 2CD9A 4N40A 4DDUA 5A5GA 4N7RA 5IVHA 3QELA 2QG6A 5INTA 2WTUA 1K3UB 2C5EA 3CZQA 5AW9A 2GBIA 3A6DA 4EY6A 5LKRA 3K0SA 3U5ZB 1ZJJA 2FUEA 1GNLA 3E1SA 1WW3A 2H1WA 3H4VA 3KJFA 3L4SO 3RODA 3GGSA 4EHJA 1X42A 3IE0A 4MV8A 5EJMA 4MMXB 3P27A 1YQUA 4BQFA 3EJ6A 2DULA 2L0XA 3DKKA 4LJSA 3OZFA 2HLDA 3FNIA 3PWZA 3NAZA 1EI9A 4I1UA 4ZYVA 2FN9A 5BR8B 2FK8A 3DWFA 4TXJA 1UBGA 1UKCA 4FYHA 4GOKA 3ROGA 4LDJA 4AULA 5JS7A 1HSOA 2KSQA 4AL4A 5K0SA 2FWRA 1EK2A 1M8FA 4LK3A 1VSVA 4FFWA 5KQLA 4UCWA 3THXB 2G77B 3HXMA 3L5KA 5K09A 4DWWA 4LE1A 3JAKA 3SGLA 4CKWA 3K0FB 1G3IA 1E3LA 1Z5UA 2SKDA 2O6LA 4RK0A 3CSUA 2WJAA 3C4JA 3GARA 1XZGA 4XTCS 2G04A 2VT3A 2WWRA 2GUGA 3OPVA 3S2SA 1OY1A 4FS8A 2IYNA 1NMSA 3S8EA 4Q02A 3P94A 3NT5A 3OCUA 3KWJA 1YO6A 2A86A 2NYRA 2ZRBA 4GZMA 3VR2D 3C15C 2CVQA 1C1HA 4KPYA 2I03A 4MMYB 4WDRA 2WWFA 2BFDB 1Z0IA 3TW4A 3C74A 4JB0A 2O8CB 4XTRA 5P21A 3S2YA 4CT0A 1BDJA 2RH8A 3GJXC 4UW9A 2FZLA 1DEHA 1K7XB 4QRHA 4FILA 1DBPA 1O95A 1ULUA 1VI6A 2V9CA 3VH2A 1YI0A 4IDQA 4E09A 1ESEA 1HG1A 4OIMA 2OQVA 2NZXA 1GDTA 1AU9A 3CE6A 2ONYA 1USGA 3HC7A 2OFWA 1RQPA 2OG1A 2NYUA 1AZWA 1NRXA 1X2EA 2G5TA 3L1HA 4M0MA 5F35A 5AXDA 3RWBA 3ZR4B 4HUQB 4C06A 2FPUA 4WBNB 2AG0A 2XBLA 4QULA 5JCJD 4NV1A 4UU7A 1MV5A 2R6JA 3MJEA 1NBHA 5FV7A 5LZ7A 1KORA 1U9ZA 1U8AA 2O2DA 5ENVA 3GMIA 2HCBA 1OXXK 2H9IA 4KSBA 3E0QA 2DGDA 2O2CA 3VGPA 2B0JA 2ZQ5A 4P5PA 4DMCA 1SXJD 3NWEA 4HAUA 3NONA 3PXBA 4FDAA 4WZ6A 3AHIA 3LPNA 1DAMA 4BLVA 4ECEA 4ZOCA 5BVGA 4Z4IA 3KLOA 4YP9A 2FWMX 1NY5A 5SYMA 2PIAA 4UAGA 2CHUA 2O14A 3TZLA 3U3MA 2QMYA 3H42B 3RJMA 3G1TA 1A88A 1RE1A 4YX9A 1NZDA 2EFGA 4ZI7F 1KEUA 1Y7LA 2YW9A 1UXJA 2HYIC 4RJLA 3HJGA 2R8OA 5B6IA 1QRRA 4RYLA 3C41J 3PQ7A 1ZM3A 4JJ8A 2FCRA 2KJQA 1QU3A 1OE0A 4MZDA 1IQ0A 4LECA 2JH3A 1RP1A 4ZOEA 3GD5A 2VHEA 1KRWA 1W0KD 1XJWA 1XNRB 4DGSA 3SKYA 1HETA 1KDOA 3AB7A 1V9LA 3OUZA 4MARA 5FORA 2OZKA 3W4KA 2QG9A 3V34A 3W9SA 2VCYA 3H9CA 4HRAA 2CW5A 4FMPA 1K2WA 1WB5A 3KALA 4KLNA 3VVMA 3WGIA 3MWEA 1WQ1R 4TQ9A 2WHXA 5TPZD 3KD2A 5HYVA 5LU9A 3NDPA 3QI2A 4H4DA 5HGJA 1H2FA 4IL5A 2GVDC 4MQ5A 4EB0A 4PX2A 2G1PA 4I1PA 4KFTA 3B2QA 3GUHA 3AVXA 2QTNA 1DHTA 1E64A 2Y1GA 2ZR8A 3DBHB 4R5MA 4K9SA 4XD7D 2R4TA 1EQUA 3A05A 3RYCB 1O95C 2FG7C 2GTHA 2ORVA 3RPEA 3M0EA 3LBAA 4OXIA 5J47A 1EG2A 1YZHA 2R6DA 3LTNC 3FG9A 3ABSB 3DDCA 4JU8A 4A6DA 3NOXA 1FSSA 4OK3A 1N6PA 3BMNB 4EECA 5T64A 4ZYLA 3PQFA 3P9YA 1J00A 4YI3A 3RLIA 5DB4A 3FOFC 1XZEA 1CY4A 1NXTA 1W49A 2AOXA 2QV0A 3RC2A 2PT7A 1XMXA 2WT4A 4LYYA 5IVDA 3PB3A 3DCJA 3C6QA 3LFHA 3T3GA 3UFXB 2E6KA 1AKQA 4FWTA 4KGXA 2PKYX 1EP3B 1ODCA 4KQJA 5DYWA 5F21A 3REQB 2QVYX 4XM1A 1CS4C 1E2EA 1GKKA 4UPDA 1HR0B 2EARA 1DJMA 1CE8B 2XUQA 1C0LA 1CXZA 2G9UA 2WFLA 1T3LA 4M1WA 4UBMA 3PFNA 3U4AA 3T3MB 3FPAA 4XRGA 2C5AA 1MX5A 4WPGA 2G0TA 2PGXA 1UJCA 5ECYA 1MQAA 5LOVF 5LLSA 3QA3E 4PX9A 5ADVA 2BIFA 1Z28A 5ITWA 2D8AA 3SJBA 1U94A 2WEKA 4A0GA 1W8DA 5C5IA 1KAQA 3CW2A 4N5MA 4GVXA 1ISRA 2B6NA 3IXLA 3SZUA 4B43A 4GEKA 3FWHA 3T0GA 4YR9A 3T1VA 4Z9XA 3PDUA 1SEVA 2FB9A 2FGJA 2TMDA 2YL2A 3EASA 4PYOA 4ZCIA 4ZC1A 3ZCPA 2WYOA 3MINB 3EE6A 4N0PA 5DX1A 5CYFA 4CIYA 3QFFA 5FFMA 3VOBA 1TIBA 2PSFA 4DEXA 4XWWA 4Y6RA 4RWEA 1TM2A 5K0GA 2P3QA 2VBCA 4QEDA 1EFCA 4RHXA 3K0AA 3TTYA 4CF3A 1WHSA 3OFJA 5CVVA 1Z34A 2V9PA 2HOQA 3EEBA 2AN3A 3FTCA 2P69A 3QQ5A 5B6PA 3R20A 4AY4A 4O4IB 3STVA 2O8FA 2P4EA 2A84A 1RYEA 2QL5A 2ZTVA 3GPLA 3ZZNA 1MO4A 1DOHA 2ZI5A 3E27A 1TZKA 4IHJB 4CFSA 4EQ6B 2WNSA 4QTZA 1LD3A 1NI3A 2WSSD 3GLKA 5ED4A 4BP1A 1K4YA 1ULHA 2SNIE 1XMJA 2QZ9A 2TMKA 2ZUSA 2NACA 3FF1A 3KTOA 4GD3Q 4MQ4A 2DC1A 3EHDA 2GFHA 1OXSC 4GMKA 1A96A 4ZJPA 4CFZA 3USCS 2PRZA 4PGGA 3EQ7A 3EY4A 1HORA 1CQIA 1Q1BA 4JOBA 3P45A 1F6BA 2DR0A 2C9CA 2NTEA 2P9FA 4C0BA 1CRWG 1PEYA 3ADPA 3MTEA 4TYMA 5LB4A 2HFKA 4ONEA 1RWWA 4RESA 3QE0A 4BIMA 2DUNA 2ZAYA 3CRVA 1HKUA 4IGEA 4V0ME 5TF4A 4CETA 2ORWA 2Q5HA 3IB3A 4GX0A 4II7A 1KEVA 3ZDQA 1SBYA 5JO9A 3O90A 1WUJS 3G2LA 4N01A 2P8JA 2CCJA 3BSWA 4IZ6A 2DLCX 3FMOB 1OLXA 1K08A 1T8WA 2X4DA 5ALOA 5EIEA 2RBEA 4J91A 4KUGA 4RMHA 3ZWKA 4D96A 4CIAA 1H4QA 3L49A 4C7XA 3C3CA 3CVJA 4AYTA 1LGYA 3CN9A 2HRDA 2MWMA 1KMNA 5ALWA 1IXYA 1KP2A 5EMMA 2DB3A 1KO5A 4LUCA 4WA7A 4BFXA 2A94A 4XUDA 1J0XO 1FOEB 2EJWA 3EN0A 2CUZA 3S44A 1SPXA 2V74B 5J9FA 4B8YA 4TRNA 5DJ5A 4IXTA 1T2VA 1I10A 2ZYDA 2QP4A 3PDHA 2B7LA 1U99A 3I3OA 3VAYA 2AWOA 3SOPA 4U8GA 5DM0A 2YX1A 4FI3C 5DTQA 4Z49A 1FY2A 2HUNA 3FZNA 3GNLA 4FZRA 5D86A 3TLXA 3WKBA 3ZNOA 5LQUA 4TM8A 2H1LA 3P9KA 3VR5H 4MW6A 4F8YA 3ILSA 1REQA 4YJFA 4OHYA 3AFGA 4G63A 1XYYA 2BEWA 1Y5MA 5FBWB 1EB8A 1K9SA 2VDJA 4KK4A 4D4HA 1NYTA 3HKBA 3T7KA 1EP9A 1JB1A 1RACA 3FNEA 4MUEA 4PRZA 3A9TA 2QTRA 1ODJA 3NBFA 4W99A 3QX9A 2DBZA 4GZLA 2Q4BA 4Z7OB 1RQLA 1RI5A 3WB1A 3N39C 2BFWA 4C1BA 3H11B 5JY6A 4NEGA 1V43A 5A9RA 1GM5A 3ZK8A 3VMFA 1V6SA 4FEGA 5JWRA 1MA0A 3OETA 1ZNYA 2J9ZB 3PA8A 1EVQA 1Q1GA 2W6JA 4FMBB 3PEYA 1Q11A 4MP3A 5GINE 3W7VA 3EXIB 3GLUA 3MSCA 1C7FA 1GG5A 3PNPA 5IUNC 4HH3C 4NULA 3OTWA 1YJXA 1T8YA 2PVCA 3JWEA 1GGVA 2LCIA 2OAQ1 3DBLA 2O19A 3FGZA 5AK3A 4CG1A 2XF2A 4LA4A 1DMSA 2J7PA 1LNSA 2G08A 2ZTUA 3LRXA 2P6UA 4IRXA 4FE7A 4M8SA 3WDKA 4D9BA 3C7DB 1GPLA 1GZDA 3R75A 2OXCA 1COWD 4H59A 3M4JA 1FDSA 4FTWA 4WGFA 1UEIA 5D87A 5HRAA 3THYB 4J6EA 3BEDA 3UUEA 2I34A 521PA 4BE9A 2BISA 5KNDD 5K6AA 1BZYA 2G8LA 2HLNA 3KHSA 4ZVOA 2R86A 3AGQA 3ZCXA 1U8XX 2MINB 2XMPA 3FHCB 1NU6A 4WXYB 1SG6A 5HFAA 3U5TA 3FBWA 3KXIA 1W1WA 5CD9A 1YVEI 3UQZA 2W2MA 4CF6A 1VGRA 1WABA 1ZM4A 2W4IA 1A3CA 1L8XA 3CF2A 3EXEB 3NX4A 5LIRA 2RH9B 3HABA 3UN1A 4KYIB 1J70A 1DMRA 3H99A 3GFTA 2DT8A 1RS0A 3BIWA 4Z2AA 5BPHA 3NDJA 2RAUA 4OKNA 2JPDA 4RK6A 4WMLA 3IIKA 3SJCA 4W5RA 1CHNA 3AL2A 1O6CA 1BWSA 2X9GA 1VECA 4L5CA 4RK1A 4C89A 1CUJA 1RWVA 1UMCB 2R4UA 4EO7A 4TUYA 4OAPA 3GT0A 3M4ZA 4DWOA 2B98A 1Q1EA 1P3JA 4BFWA 1VE1A 4MI9A 1EE1A 4QD3A 5FI5A 3EQZA 1VA4A 1GPKA 2ZJZA 1K7SN 1U2ZA 3C3JA 4HWRA 3LP5A 4MDYA 1KYYA 4EKEA 4BOYA 1G2QA 4TGLA 1EWYA 1PJZA 4O4HA 1GGFA 4EEZA 3LUFA 5AKZA 4DTIA 4GI3A 3FNHA 1ZN2A 5BSTA 4DIKA 1KHHA 4ETNA 5F7OA 3LFUA 3IDOA 3P9QA 3G8YA 4B75A 1X38A 3ESXA 3K0BA 3O94A 1RCFA 2QN3A 3ZG6A 4R8VA 4P4SA 4XYGA 2ZYIA 1AKTA 2AN9A 3ZY3A 3L0SA 1IN1A 3IEXA 2BMAA 1G4UR 3R5JA 2GN4A 4WI1A 3UWDA 4UHEA 5A5DA 5I8WA 5JXJA 2ZRHA 3HUTA 1H2YA 3ZWCA 2DX7A 1LSJA 3G68A 1MJNA 1Z2DA 4EJ6A 4UTRA 1GAXA 3BXGA 3QIVA 2C99A 3FPEA 3B9BA 3JAKB 4CKWB 2DTEA 1N3LA 2AJBA 1J90A 1WUTA 3W78A 1WS6A 1NNI1 1OF1A 3RSHA 1FYDA 2QMEA 3VGJA 5C2JB 3O4GA 1Y9DA 2A57A 1CZRA 2JGRA 3NRBA 3CLTC 5H4HA 2FDXA 4JVOA 1QTIA 4BNWA 2Q9AA 5GONF 3TW8B 2CFCA 4EKGA 1U1IA 4J29A 4KFRA 1BXGB 4RW0A 5G0WA 4AYXA 2H00A 4J8PA 3GLIA 2P2GA 3PHBE 4KCGA 2F48A 1KR2A 4CMKA 1LK0A 3PUHA 5BNIA 1QYXA 3VR3A 4HPJB 5CVCA 4CEJB 5A4MS 2XYQA 3G0GA 4FJ1A 4HYYA 2O2ZA 4R1PA 2PO5A 2XNCA 2A4KA 2D5AA 3M4XA 2JDIA 5BUSA 1JJVA 4M8LA 3GBSA 1JJ7A 4LSWA 1RAGA 2ZCVA 1EE2A 5KQPA 2IIBA 2HWXA 4F3TA 1LPBB 2V0NA 1LLUA 2W2XA 2BKLA 3WYNA 1G5HA 1KOGA 1R64A 2BGNA 1ZVVA 1N8KA 3ET5A 4AJJA 4PO9A 3AU8A 4BO8A 2VHTA 4C21A 2QKYA 2HF2A 3F6RA 4JR0A 1SIOA 4TM7A 2YJNA 3HNOA 4JLKA 3V1TC 1QKKA 3TZQA 3CRRA 5FD8A 2EGGA 2Y0EA 1UOPA 4DM7A 4TL8A 1ID8A 1F17A 3GJSA 4GBMA 1M0TA 3ETNA 2QTAA 1M1XB 2D62A 3SDBA 4HSEA 4MPPA 3AQIA 1CLUA 1N3YA 3LDUA 4H6WA 3H1GA 3ZK9A 1FDOA 1NVKA 5AI9A 5EE5B 3KAJA 5C4GB 3QWIA 3AIOA 3CJRA 3LIPA 3RFVA 2PBLA 1VL1A 3AM5A 2CE2X 3BXPA 3DG9A 4Y2XA 2BFBB 2ACEA 1Z6ZA 2Z3VA 3O1HB 3TLJA 3GWGA 3KL4A 1P9LA 1QYIA 4QOJA 2D2FA 8MHTA 3PXUA 3TJMA 3VNQA 1NPDA 1DV1A 2BMFA 3U80A 1OX4A 2HHCA 1ZD5A 3QYAA 1R6DA 1R6VA 2CF5A 3GRKA 2TSYB 4PPYA 3TB4A 2D7DA 1IDN1 2Y4OA 3JQ9A 4IOMA 5ELXA 1SZJG 1CCWA 3JQEA 1KQNA 2NOAA 1RAIA 1BX3A 1NF2A 1YHNA 1X8XA 1I80A 2HY7A 2PYZA 2Y1EA 3DOUA 2P9GA 3HGQA 3K2EA 3WK9A 3BXHA 4DBLE 3E5HA 4A82A 2JH8A 3HYLA 3MRXA 2WU0A 4KYVA 1B76A 1N7HA 2WU4A 4EK9A 4ESHA 4L3WA 4R2HA 3MWEB 1Z0SA 3EEQA 4M6WB 1M67A 1GOTA 1KPIA 2GZHA 3N6VA 5EWMA 1Z8NA 3SBOA 3SM3A 1YFLA 3EUAA 4M1YA 4XW2A 2ZULA 1KYTA 1M9NA 1OZ0A 2O3RA 5CBPA 5IAAA 4EYEA 3SQLA 1C7EA 2VP3A 2PUTA 2AF3C 2QLMA 1G5IA 1TYCA 4ZU3A 4MJ3A 3GJZA 3ZLBA 3MA0A 1RRCA 1Q6ZA 1SVWA 1QIMA 5DRTA 2ZSHA 3OTGA 2NU6A 3E9QA 5F4ZA 2OPHA 1GU0A 5KX5A 4CQMB 1EB9A 2PQ2A 3BE6A 1EK6A 3O84A 3WLNA 1M1YE 3JZFA 3QXJA 5A4FS 1L3BA 3PRJA 4R7GA 4ZI3A 2H11A 4HNVA 3ZX4A 1T2NA 3ZXSA 2X22A 5B3AA 2H31A 1ZOIA 1JR4A 3AINA 1KSGA 4DQLA 1XMPA 5EIXA 4F06A 5KYGA 3CR8A 1CR6A 1ZK0A 4P6VF 4CG3A 1WDKA 1BFUA 3K9GA 2UZAA 3EH2A 5TGZA 1UC4B 4Q6WA 5DLEA 1CY7A 2QBYA 1NP3A 4JBXA 4ZALA 5K2MA 4WXHA 3U19A 2FX2A 4RJJA 3FCCA 4IIVA 5CXQA 3GRZA 2WFLB 2YXNA 2W2KA 1WXWA 4BFCA 3NV9A 5CB0A 1V4NA 5KYYA 2RHCA 2QQGA 4KGDA 5G02A 5LU8A 5IG2A 1H4SA 2FSFA 2R47A 2GO1A 3EDCA 3ILVA 4I1YA 1Z39A 4XGKA 1QGYA 4LZWA 4U2KA 3SY8A 1VJRA 1RMYA 3DULA 3WGKA 4PAOA 1RRKA 5I3CA 3IJ5A 3KOWA 2D4AA 4NV0A 4AROA 4XCQA 3AB8A 1R27A 2J4CA 4PTZA 2PKRA 1RWOA 1UJ6A 4F6CA 4ZYZA 5A0VA 1P4AA 3U4GA 3QLUC 1W4RA 1Q7BA 2XUKA 3JQ9C 4LAFA 2VJNA 4Q15A 3EGOA 5DGTA 1BVYF 4E3WA 3UUFA 4DGQA 1XCBA 1DOZA 3EGDB 3IP5A 2DVMA 2ODWA 4QJ3A 4OJYA 3PQ2A 1H5NA 1QFYA 3PI6A 3UANA 4DAEA 1N33B 1H6BA 1GKUB 2R44A 3K0AB 2PCJA 4P7GA 2WV9A 1EBFA 5ADUS 3DMYA 3L05A 1WNTA 3WLRA 5C18A 3SHQA 2X7XA 5CFMA 3A6FA 2JIBA 2WAMA 3GNSA 2CD7A 3SAJA 1T2UA 3IEVA 2XE4A 4R1UA 2C2WA 4P22A 1J06A 4LHZA 4Q3CA 3ZDFA 2IYWA 1LPPA 3HB7A 4C6SA 4DLXA 4DCVA 3F6YA 1IEVA 3MMXA 1LRJA 3TSYA 5E3IA 1L7VC 2RKOA 4R6XA 1FPQA 5EGSA 1YRAA 4MTCA 5J2TB 2R2GA 4GO1A 4EDHA 1ZJ4A 1MOZA 5FEUA 3CIOA 2IXAA 3MCVA 4HQKA 4L3OA 4DNXA 3UPTA 2IXTA 4FGKA 4MV7A 4N12A 2F9MA 5IEJA 2FX5A 2UDPA 3BD8A 3TLYA 2Z6VA 5IK2D 1FJHA 3EPRA 1V5GA 4UAVA 4BCBA 1XXLA 3CNEA 5CLLA 5T3YA 3JAWB 1IZYA 4B3BA 2JGFA 1XL0A 4WY5A 4W1RA 3NPAA 3X1ZA