1T9ZA

Three-dimensional structure of a rna-polymerase ii binding protein.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
181
Chain Sequence
MQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADMLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLIMDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of RNA Polymerase II CTD Phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
total genus 44
structure length 181
sequence length 181
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2004-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1t9zA00
3CZ4A 5ALJA 5AVVA 1S2OA 2GMWA 2FEAA 4YCMA 4UAVA 3MMZA 4BKMA 4Y2RA 5AW6A 1X42A 4HGNA 2WF9A 2JAUA 2FPRA 2I34A 2P9JA 5AW4A 4YCNA 3I76A 2YJ6A 5AKZA 5AKIA 2OA0A 3DDHA 5ALGA 1KYTA 4UAUA 3IRUA 3W5DA 2FPUA 3CNHA 5AKYA 2QLTA 3ONNA 3TLMA 2CFTA 4AS2A 3AR8A 1JUDA 4UARA 2WF5A 2W11A 2B8EA 1SU4A 1YS9A 3U7FB 4JDPA 5AESA 5AKHA 3MN1A 1VJRA 4B6JA 5IT4A 5AW0A 2HO4A 2W43A 2G08A 1FEZA 2X4DA 2BDEA 3DV9A 3PGVA 5AVSA 3NALA 1RMQA 5AM2A 2YJ5A 3N5KA 1YV9A 3N28A 5AVXA 3EWIA 2B82A 2WF8A 2OM6A 3KD3A 4YGYA 3B9RA 5AI9A 3FVVA 1J8DA 3L8GA 4I9FA 3QGMA 1Z4KA 3ZUPA 2O9JA 1T5TA 2C88A 3J7TA 4FYPA 4Y2YA 5AKGA 2ZBEA 3OCZA 5ALYA 5IT0A 4FE3A 4NABA 4UATA 1L7MA 5AW5A 4HYTA 1YDFA 3WK7A 2IA5A 3NIWA 3PDWA 3KZXA 3QUBA 5ALSA 4EELA 4DCCA 5AI6A 3WKEA 3WGUA 3QU7A 1Z4QA 1T5SA 3QXGA 3WKAA 1L7PA 3U19A 5ALMA 5ALFA 5ALEA 3WK6A 5AVZA 5AM1A 4BBJA 4UU1A 1XPJA 4NWIA 5ALKA 5ALNA 1NRWA 1ZD2P 3ZTWA 3D6JA 2JAOA 3VAYA 3SD7A 3SMVA 3L1UA 4J03A 1QQ5A 1TJ3A 1NNLA 4GIBA 1RLTA 1L7NA 4OCZA 5AKXA 4KN8A 2JAWA 5ALIA 3AR4A 3I1YA 4CE6A 1YNSA 4OHFA 1RLMA 1RPZA 5AM5A 1XP5A 2C8LA 4HGQA 5AW3A 1TE2A 1RKQA 5AK6A 2FUCA 3OCXA 2OBBA 1AQ6A 1TJ4A 2G80A 4KYTA 1Q91A 2B1QA 4ZEWA 5AIBA 1CQZA 3SKXA 1ZJJA 2AMYA 3R4CA 3EF1A 3ZTYA 4UMFA 2YFYA 5ALZA 5AVYA 5ALPA 5ALRA 2WHEA 2YBDA 4YIHA 5AKLA 3SLRA 3KDPA 4UM7A 2NO4A 2G07A 2HX1A 2I6XA 2Q4RA 3IB6A 4XPZA 1QQ6A 5AI8A 4CF5A 5AM4A 3R09A 5AM0A 4UM5A 1YMQA 5ALOA 2WM8A 3NASA 4Y2PA 4MWOA 3UMBA 3E84A 3AR7A 5AVTA 2D2VA 1Z4NA 2HF7A 1XVIA 4NFLA 2GFHA 5ALUA 4CNQA 2JGAA 4ZEVA 1F5SA 1ZS9A 3M1YA 5AVRA 3DAOA 3NUQA 4XQ0A 4HGRA 3ZI4A 3NANA 5A3RA 1EK2A 3ZVMA 2BDUA 3FZQA 4Y2JA 3HYCA 3W5AA 5AHXA 3OTQA 3R9KA 4EX7A 2WFAA 4Y3UA 4ZEXA 2MU1A 2ZOSA 2G0AA 1ZD5A 2EATA 1ZD3A 5AK4A 4Y2QA 3KBBA 4UU0A 5ALVA 1J97A 1YJ5A 3L8EA 5JJBA 2NO5A 5A3SA 4HGOA 2RBKA 3QUQA 5ALLA 2ZBDA 3U7EB 2YJ4A 1RRCA 4CF4A 1ZD4A 2HHLA 3OCVA 2I55A 1Z4OA 2YMPA 3F9RA 2C9MA 3QLEA 3WK4A 2PKEA 2Q4TA 1L6RA 3QYPA 2WF7A 3AR6A 2W4MA 3FGOA 3ZWDA 2OYCA 5AIAA 4YCLA 2ODAA 1O08A 5AW2A 2IYEA 2QYHA 2RB5A 3SKYA 3OPXA 1N9KA 1U7OA 3NAMA 4CF3A 2B0CA 1RQNA 3FPBA 3IJ5A 3E58A 1MH9A 2HEGA 3L8FA 4BEVA 1T9ZA 4KNWA 2R8XA 4Y2TA 2HCFA 4I9GA 2I33A 3WK9A 4DFDA 5ALHA 3RF6A 3OCYA 5AM3A 2PQ0A 2ZXEA 3L5KA 1SWWA 4O8CA 4L6CA 4QQFA 3QNMA 1U7PA 2R8YA 3WKBA 1RKUA 2EAUA 2ZBFA 1Z4MA 2BY4A 2B8JA 3QUTA 1EK1A 4FFDA 4RETA 1ZRNA 4XE5A 4RESA 1Z5GA 3EPRA 3HLTA 1S8OA 3PCTA 4BNDA 1PW5A 3ET5A 5AICA 4DW8A 1RMYA 4Y2XA 3ZVNA 1O03A 2IOFA 4E88A 3AR2A 2FI1A 2GHQA 2HSZA 3ZVLA 4UMEA 4Y2SA 3WK8A 2WF6A 5AW8A 1U2SA 4DWOA 3UMCA 3U7HB 4KX5A 3U7GA 2HOQA 3ED5A 3L0CA 4MUMA 3NRJA 4GXTA 3KOOA 5AKKA 1RDFA 1WR8A 4OFZA 4EX6A 3W5CA 2FPXA 2HI0A 3N8GA 3PGLA 1TA0A 3AR5A 1IWOA 4KX3A 4G9BA 3E81A 2ZG6A 4BNDB 3BA6A 3OCWA 1RMTA 1RC8A 1Z88A 5IS2A 2IOFK 5AI4A 3A1EA 2P11A 4UMDA 4EZEA 3N1UA 2FPWA 3UM9A 2MSNA 5ALTA 3ZU6A 1K1EA 1Z5UA 1VFPA 2R8EA 2YMLA 3B9BA 3WGVA 4BX2A 2C8KA 3N07A 1U02A 1L8OA 5AK5A 3S6JA 2AH5A 3QU5A 3ZX4A 1QQ7A 2AUTA 4NV0A 4C4TA 4BYGA 3B8EA 3U26A 1L7OA 3E8MA 4PNHA 5AVUA 2AGVA 2CN1A 3QX7A 1LTQA 2I54A 3SF0A 2PR7A 3MC1A 3I6BA 3QU4A 4YIKA 4C4SA 3AR3A 5AW9A 5FP0A 5AI0A 3A1CA 2C4NA 4BX3A 3P96A 1SWVA 3L0YA 3ZWKA 1TJ5A 1RKVA 1RLOA 3OCUA 1Z4LA 4G63A 1Z4PX 3DNPA 2JARA 2P27A 1CR6A 3U13A 1QH9A 1QYIA 4H1WA 5ALDA 5AW7A 3BWVA 4C4RA 4Y2UA 4HGPA 1NF2A 2YMMA 3EF0A 3ZW7A 2P69A 3ESQA 5AKJA 3K1ZA 3UMGA 5T41A 3WKCA 4HAIA 2CFRA 4XOUA 2B1RA 4BEWA 5AW1A 1Z4IA 2GO7A 2HDOA 4UMVA 3QU2A 5ALQA 3RFUA 3ET4A 2I7DA 1Z4JA 3KC2A 4EEKA 1Y8AA 3I28A 3ESRA 2EARA 3QU9A 4KNVA 1Q92A 2G06A 4L57A 4UASA 5AVWA 3L7YA 2B30A 1WVIA 3A3YA 2NYVA 1WZCA 4AS3A 4IG4A 1ZRMA 5AI5A 4F71A 1ZOLA 2G1AA 3L1VA 4F72A 5A3QA 2G09A 3SHQA 5ALXA 3FPSA 4YH1A 1WPGA 1N8NA 3FM9A 3A1DA 4OD0A 3WKDA 2YMQA 5AVQA 4NAVA 2HF2A 3GYGA 2FPSA 5ALWA 2O2XA 2YN4A 2YJ3A 4J2TA 4JB3A 3ZX5A 2FDRA 3WK5A 5E0OA 1LVHA 2R8ZA 1VJ5A 1U2TA 5AK3A 3M9LA 2DQSA 2VKQA 2CFSA 2GHTA 3W5BA 4AP9A 4Y2VA 2YY6A 3L0BA 2RAVA 1RQLA 3AR9A 3MPOA 2FUEA 3QUCA 4L6AA 2RARA 1L8LA 2ZBGA 4QJBA 4BX0A 4IFTA 4UW9A 4EENA 3L8HA 5AKEA 2Q5EA 2IOHA
chains in the Genus database with same CATH superfamily
4I5DA 4IDDA 1DWUA 1MAUA 2YHIB 1UAYA 2VP2A 3FWZA 3VDRA 4G5HA 1DU4A 4I1IA 3UWPA 4LDQA 1ADBA 1ZHOA 4L8WB 4LQCA 3EODA 4MTCA 2YW2A 4Y2RA 3R3ZA 2MHCA 3MWFA 3IPYA 4LJ5A 4J0JA 4UEJA 3TI7A 2D5LA 2W42A 3IEVA 2X0DA 5CA1B 1NNSA 3NHUA 4TYNA 4KBGA 4U7FA 2R8RA 2R1VA 1TCBA 3O73A 3CKMA 5D00A 5G41A 4XD7D 3JQGA 3BSSA 5H9VA 5SZKB 2QTLA 4NBUA 1I0ZA 1LNSA 2BKEA 1ZOPA 3LDFA 3DPIA 2OA0A 5FA8A 4CODB 2B4QA 5DE3A 3RV3A 2QAGB 1H4SA 2A4MA 3OU7A 1WCIB 1QFJA 1V8PA 2R5WA 4UOQA 1PT7A 1PZGA 4FYMA 2OP1A 1TLFA 5KQLA 3DFKA 3JXEA 3LH5A 1SC4A 2E18A 3PQFA 1RJFA 3AL3A 4DLLA 1YS6A 5TNXA 1JYFA 3JD3A 4CNBA 1RCFA 1MJFA 4ZDWA 3UOWA 4KW7A 3CRQA 4CM6A 4OLFA 5KTKA 3DW1X 2OYSA 1JG2A 1MAHA 3SFTA 4DVGA 2ZCVA 3K0FA 2I6UA 1HXHA 1RC1A 2NUBA 1BW9B 5K0BA 4G9EA 3CNNA 2IUEA 3K2EA 2P91A 1FUYB 2II6A 1JEAA 3DR3A 1KJWA 4I9HA 1ZOIA 1K63A 1NLFA 2RHDA 4PG6A 4D41A 4UOEA 2XVYA 4J0HA 5AESA 5F1PA 3HBNA 2CNBA 3DLHA 4Z4CA 1P33A 1U28A 1YT5A 3FHLA 4OH7A 4P08A 5LZ8A 1MOZA 3BGIA 3GDFA 4YO7A 3RUCA 5EZQA 3TR5A 1FIUA 2G82A 3ZY2A 3IULA 3IOMA 2G08A 1J99A 3HZZA 4YQZA 4CTMA 2X4DA 4RZQA 4D81A 3UC9A 1A27A 1U7HA 5BQ3A 1Y1LA 4FZRA 1M6WA 1DIHA 3CLSC 1E18A 1M5RA 5AM2A 2XMDA 1M9NA 2V9ZA 4M0KA 3AO0B 5LDHA 3F7NA 3W90A 1XEWX 4MDHA 2CZQA 2QPOA 1FVXA 5HYVA 3G2PA 3REQB 3DHNA 4QELA 2GPJA 1T2AA 2XNJA 4QUEA 2CJYA 3OZEA 1CJKC 2QVZX 4B40A 3KALA 2LKDA 3RRBA 4D9GA 2CLDX 3MMNA 4GSKA 5JALA 2C4MA 3PQ5A 4X93A 3HHPA 4D4GA 3IFSA 3WMEA 1LXCA 2XUIA 2HZ7A 2QGFA 2VF4X 4J90A 1PQ4A 4O4LF 5HRAA 4NMWA 2ZRNA 5KS2A 3PDCA 5T64A 4XCVA 4MR9A 4ZCPA 4YC7A 9MHTA 3PDWA 3DWIA 1SUAA 3KZXA 5ALSA 4CV0A 4LQDA 1O6FA 1P1IA 2BW0A 4ETWA 2I22A 1GRVA 3SNKA 2W9XA 5C1BA 2XYHA 2P5TB 5ALMA 4C6HA 3AF3A 2WIDA 1RBMA 3Q4GA 4H1VA 4IHKA 2C4WA 3B52X 5HKLA 2FOXA 2YH2A 4FCVA 1NXVA 4L8YA 3SR0A 1P4RA 3ZU2A 3AVWA 2PWBA 1T5BA 4OMDA 1SVWA 4GOMD 3EIQA 1UFOA 1DFGA 3VI3B 4RZSA 4GL2A 1GEGA 3QKUA 3JATB 4ZVNA 4D3FA 5GONB 5A9SB 2FQQA 1Z5ZA 1PYGA 1H2WA 2EKZA 2JK1A 3PKZA 1RE0A 4OUDB 3WR5A 4YRIA 3TFWA 4O4JF 3T94A 2O54A 4ZHQB 1PJ3A 3EGDA 3I6MA 1E60A 4I0WB 2CMHA 1P0PA 2DUWA 1PG5A 4UBNA 5TJ9A 1PR5A 2X0JA 1X1BA 3AETA 2J6IA 3B3JA 4MUGA 1GDHA 3DCIA 3FR8A 4ZI2A 4J0CA 1OH7A 3M5DA 3LCCA 3CV3A 1Q7BA 1NQTA 2PSJA 2WDPA 2YY5A 3CCFA 4MKRA 4PX5A 1TCUA 2O7VA 3O7WA 1B8NA 2V97A 3BK2A 3DP7A 3KQWA 3CFYA 1DC3A 1KJJA 3G79A 3M1LA 4KO3S 4ZK2A 3P32A 4CIVA 3DQPA 2J0SA 3QA3E 2JG3A 2I62A 3G7NA 2JBAB 3A31A 4QDUA 3TKLA 2G3YA 3N8HA 1R6VA 1EFTA 4UUBA 5L45A 1O8BA 3GK3A 3D7RA 2OL4A 3Q2IA 421PA 1HDCA 3IQZA 3NI2A 3ZZ0A 2ZB8A 1NC3A 4WL0A 1Q91A 1X1QA 2BHTA 2X2PA 2CDBA 3PPIA 4QEKA 4RPCA 5BR4A 4INZA 3RKUA 5FI5A 1ZXXA 1JFVA 4F4CA 1TM2A 4W1QA 3NCHA 3VPBA 2FMHA 1C3EA 1GD1O 2FSSA 2UKDA 2D0IA 4PC1A 521PA 2OB2A 3S8EA 2QMHA 4E3ZA 4PAQA 1ORRA 4BLOA 5KTNA 4DLYA 3SCZA 2GZ1A 2QEQA 4TWBA 1CUUA 1U2GC 2CE2X 4Z9BA 2XECA 4JLUA 2C9YA 3CM0A 1FE8A 4ZMSA 1XRSB 3P8ZA 1SU8A 1HT2E 2NPOA 1GXSB 1JRLA 1DAHA 2NYRA 3QPUA 4J9UE 1KDZA 2EU8A 4UXIA 2DT8A 3I01M 4MW1A 2LGJA 5EMNA 3IQGX 3LDAA 4B2PA 5CAEA 3KSAC 1NBWB 3H83A 4QDJA 3T5PA 3EF3A 4UTVA 4G89A 3QYAA 4PBRA 3LOPA 2V7UA 1TU3A 3KDAA 2F1HA 5JO0A 5M5BA 4AKIA 1Q57A 4TWRA 1U6JA 2CXXA 4I6EA 4QPNA 4N3NA 3Q0IA 4HCJA 4OP1A 4MH0R 3BWMA 4WOBA 3OTQA 4QL3A 2FPKA 2BUBA 3OQIB 3SXUB 1YQUA 3K31A 4GECA 3IUEA 5BYJA 1V1MA 3VMFA 1QOZA 4GE0A 3GFPA 4EVIA 3WV5A 2WNSA 1YIAA 1FNDA 4IO0A 3CBQA 3A11A 3DEHA 1OILA 1RAGA 3INRA 4QU8A 5I5EA 3LHKA 1S96A 5EIEA 1TM7E 2ZE6A 1NR7A 1R6DA 1IOVA 2XT6A 3FUUA 5HQJA 2ID9A 4A16A 1QHHB 1Y3CE 1KZ4A 3BK1A 4UZSA 1ZXBA 5AVKA 2G1KA 1XD2A 2BEUA 2PWPA 3NWJA 4XVRA 4CF4A 3FVQA 2ZANA 4Z7NB 3H97A 3NTLA 4JZKA 1M6NA 1BMFA 5BUQA 2P3SA 1IBMB 3QLEA 4ER0A 1T6YA 2LD4A 3G13A 5ES4B 3UV3A 2G40A 1XG5A 1KDTA 3DQZA 3RNOA 3G89A 4O2BB 1ZCJA 5BSEA 3A25A 2GK4A 4YECA 1WABA 3N3AC 4G1VA 2PPVA 1ADYA 1JDTA 2Q5OA 2H51A 3IE1A 3FOFC 3M5CA 1YE5A 1DCKA 2CL0X 5LP1A 3C15C 4RELA 1P6QA 4Q1EA 3LOUA 1DTWB 1RQNA 4QKQA 1BWPA 2PXAA 4TTJA 2WYOA 1FFBA 4A03A 2JAXA 4ETMA 1C9DB 4D0GA 1VBKA 4LFAB 4JITA 1F6WA 5I4IA 1Q84A 3FSEA 4BKRA 3KQNA 2G1PA 1T9ZA 3TLZA 2PZLA 1KMHA 1SZCA 3NYRA 1TU0A 2R8XA 4ZT2A 3O94A 3PI7A 1OLSA 2Q3FA 5D2CA 5SZJA 3W1WA 5B57C 2J3QA 1Y5IA 4G07A 3B82A 4YBZA 2X14A 5FFNA 4D9KA 4UU8A 5H81A 5FA6A 5JSFA 5ALHA 4L0QA 1IWPB 1BHSA 1PLKA 1PZHA 4U7HA 2Y0DA 1GGKA 2O57A 2IX9A 4FYXA 4OI1A 1RBQA 4AL4A 1C0KA 2DQ4A 3A28A 4CYMA 1JYSA 2UZAA 2ZE7A 3DHEA 3K72B 3MGCA 4U2GA 2DKFA 2QAIA 5DP2A 4EUNA 3O3CA 5M2QA 1JKXA 5IKEA 2DXIA 1NLYA 3ETLA 1KZ9A 5BV0A 1CJUC 4LC9A 4ZMBA 4OATA 1B93A 2QT9A 3PCTA 3EY4A 1ZRSA 2Q5CA 5E1MA 4EKEA 4DR5B 2JFUA 1XVVA 4C2BA 5CDHA 2JNWA 1G8FA 2ANCA 1I2MA 1YVRA 2ZRJA 1COWA 2P3QA 3O74A 1C3XA 1TM3E 4R1UA 3H4VA 3VHXA 3ONEA 4K9OA 4E5PA 4KFRA 1KZYC 4B6FA 5BWOA 2IOFA 4XARA 4F85A 3IAM1 3RVPA 1RHMA 3E9NA 3V1LA 2DCUA 3ASZA 1YBHA 4Y2SA 3WIUA 1GU7A 1K8RA 1Z2DA 4K3UA 4QDOA 1IAVA 4DABA 4Q1DA 3TFOA 4HWPA 3PICA 3LYAA 4NYMQ 4G0PA 3L0CA 5CVCA 1YCFA 2FSVA 4XGKA 3U81A 3H5IA 3KTFA 3WHLA 4FHCA 4ALJA 3AX6A 4AVYA 3AB8A 4GUAA 3TX2A 4ZYLA 5CDUA 4DR2B 1SXPA 2ZS8A 2HA4A 3DDZX 1NXQA 5AJYA 4L16A 3UV6A 2IZ6A 2O7RA 1IWOA 4OQMA 3PYMA 1SVKA 5L40A 2G77B 2XAAA 3A2MA 2GF2A 1UMKA 3OQVA 4MA0A 5DGDA 5HIJA 3RW9A 2WIKA 4KO1S 3IVXA 1DEOA 1RC8A 5E38A 2CNDA 1HLDA 2H85A 4TT3D 2GJSA 2IBSA 1DLJA 3O8NA 4B47A 1TLTA 1DFIA 2FWJA 4ZAYA 3CT6A 2FNAA 4RACA 1VL1A 1P2GA 1JILA 3N58A 2R1TA 4H77A 2BMDA 1K1EA 4IIEA 1U4OA 1H6CA 2CNLA 1HORA 3PUYA 3UK1A 4OYLA 1JKIA 1XRLA 2R8EA 5C8YB 4PYKA 4A73A 4CHGA 4M7WA 4E5DA 1GYQA 3HXOA 5KQRA 3HA7A 1X0VA 1U8EA 3IBSA 3CU5A 1XXLA 3FUCA 4P33A 2VQ3A 1E0JA 2FVYA 3QKTA 3LOQA 4JJ4A 5E7MA 4YYEA 1ZEMA 2AH5A 4L4UA 4ZVRA 4Q1VA 1KH3A 4BBZA 3GA0A 2R62A 5CG1A 1JV2B 1HEUA 2BJWA 1E79A 2PXHA 3O9VA 4BFTA 4HVCA 1FNCA 1I0LA 2PFKA 4O1IA 4XCXA 1ODFA 4BFUA 5IF9A 2XODA 3QBEA 3PD7A 2YCBA 1I30A 2I66A 3AFIA 4REOA 4TMXA 5AVUA 2GJKA 3AUUA 1W85B 5DI3B 5M3BA 2Q9BA 4OQLA 1WMFA 1EGHA 3H3FA 4MQUA 2VEOA 1R3DA 1UBHS 4NZOA 2B8NA 1AO3A 3DT6A 6LDHA 3N87A 4OQYA 4ZI5A 4DR3B 1U8AA 1MF7A 1LI7A 4JBWA 2ZULA 5TF4A 1QTNA 1R9JA 1G5PA 1HPLA 4XASA 3SOZA 4HO1X 4PBSA 4AB1A 4AJIA 5BV8A 3ZVKA 1BYIA 1CBUA 5I9IA 3CF6R 3H16A 3KQSA 4OJQA 3LX5A 2XIQA 2OCXA 3LK6A 3UUEA 3E3NA 4OQFA 1J9GA 1QOPB 4AU1A 3VZQA 3VU1A 1N2HA 1J49A 2WIJA 4FU0A 5ALDA 5JSQA 3A4TA 2PGJA 3BWVA 3O90A 3HDYA 1MJHA 4AURA 3PJDA 3QXHA 4TTSA 4PC3A 4UKDA 5TQ2A 4MVCA 3QX9A 1VHWA 5FV7A 3H1TA 4ENTA 1OLUA 1DWOA 4MGYR 4DY4A 3TRJA 4P0TA 1AUPA 3GG2A 1WU8A 2EJCA 1CR2A 1NMSA 1VLQA 2OBMA 3IHKA 1FFGA 2CYBA 1SB8A 1NZJA 2GN4A 2F3PA 2Y1GA 3PUKA 1DXOA 4WK6A 2FR8C 4GM0A 1X7GA 5FKJA 2GKOA 1KOLA 3ET4A 3UMYA 4PGAA 5EZYB 1K0UA 2EEZA 1EBFA 2QZ9A 4CQMD 3ZV4A 2Y67A 2ZRDA 3PDJA 1NW5A 4GI3A 3KC2A 5JH7A 2KI5A 4TXHA 3BULA 1V1RB 3LW8A 4EEKA 3GP8A 5JZBA 1U1DA 3CVOA 3U44A 2AB0A 2ZYHA 4F9GA 4J91A 1Z6ZA 3FCEA 3JTMA 5F9FA 3AU8A 4B2LA 3WYAA 3NYQA 4PC2A 3IMCA 3CW2A 2A5YB 3TOXA 1DHRA 5DYWA 4WQMA 2BTQB 1FLNA 4LBVA 3FPHA 1EX6A 1T2FA 2EJUA 1X74A 1P81A 2YWFA 3WL4A 4EA9A 4GOLD 1AN9A 1KVQA 4JYPA 4PX2A 2H1CA 2FB9A 4XW2A 1KQPA 2QAGC 3BAZA 4H17A 4IIHA 5LQAA 3Q1KA 1T1IA 1LTHR 4F4HA 1RAIA 1JVSA 4HVLA 1VM6A 3AIKA 3MD0A 3OUTA 3OOWA 1P4JA 5BP7A 3ZWAA 4YLGA 2H1IA 5KSWB 5DSZA 4RVHA 4UBKA 5EKSA 1R0LA 2CWWA 2YOGA 3A9CA 1H2YA 2FPPA 2GKSA 3IVRA 4L50A 1GZHB 3ZR4B 5I7HA 5E0OA 1US8B 2QTVA 2VTVA 4O4LA 3KXIA 1VJ5A 1KXZA 1G42A 1S9HA 3OLWA 5F4BA 1TZCA 4G5RA 4IW3B 3UXYA 1VRVA 2D59A 2XOKD 2R751 2FSVC 3GNQA 3OC6A 4Y2VA 3U0VA 4EHDA 5IDXA 1JQBA 3EVGA 5FO1A 5KAPA 3TW8A 5CT8A 4YFVA 4ARCA 3GYBA 3TCXB 2ZSEA 2H16A 3EEFA 4I3GA 4NBSA 3IELA 2J33A 3L0IB 4KHZA 3L4BC 4ZQFA 5TF0A 5ALJA 2C00A 1MW9X 5JFTA 4FHEA 1CRPA 1I3NA 3QRWA 4JT9A 4KQWA 3CW9A 1ZOSA 1VLMA 1QCDA 3VA7A 4C78A 2XYQA 4BN5A 3V9AA 1GV0A 1LBQA 3RS3A 1JHUA 4MWSA 1PHRA 4YMLA 4ATNA 5LMUB 2C8JA 1DAMA 4GR4A 2BWJA 1EPUA 3QELB 2GOYA 3QBJA 3RG2A 1USKA 1SUWA 5LFAA 2HMVA 2RB4A 2P9JA 2YS7A 4LDZA 4AO6A 2O5CA 1GFWA 3F0TA 3VHQA 1GPH1 1VPVA 3KQTA 3HRHA 4E7OA 3UZUA 1MQAA 1QHYA 2WU1A 4NBNA 5AKZA 4QUAA 3ORQA 3MAJA 3DVQX 4RPKA 1T4MA 4YGXB 2NO0A 2C83A 3L7CA 3ZIDA 2XYGA 4YT4A 5ADWA 3W5DA 4DLKA 2QROA 3ZHQA 3HUTA 1AV7A 3HUFA 5JBNA 1VKRA 1Z25A 1GL6A 4MQBA 4MVJP 1PS9A 3DJYA 4O6VA 1RWQA 1VCIA 3EQ8A 4MS3B 4EUFA 3WYEA 3LXMA 3AF6A 2OFFA 1RIIA 4IXNA 1WMAA 2IXFA 3AY3A 4GZ5A 2XHEA 2EBWA 5EVJA 1BDMA 3NEPX 3R41A 5J4LA 5DRTA 2KW5A 5KKCA 2IHKA 1T4DA 3A7EA 1L5GB 4YI5A 4HFNA 2GEDA 2VJNA 2APJA 3C5CA 4BN0A 5JNTA 1EWTA 5K9ZA 3GR6A 2PL9A 2HA2A 3H2KA 3OY2A 3QLJA 4M8LA 3DT9A 5DXJA 4ZKDA 3NEYA 1HSZA 1DZIA 3MN1A 4EABA 4X7PA 4C0WA 2J6BA 4HAUA 4BNLA 1UWKA 3K0SA 2BGGA 5DTEA 1JIUA 2BFDA 4I4NA 2HSEA 3E0XA 1E96A 3G0GA 4OGFA 5C7OO 2GDJA 1TMKA 2ZRMA 4GC5A 1EK5A 2VHEA 1P91A 2PH5A 3DR5A 4GBGA 4CDRA 5AVXA 3DZKA 4EEZA 1XWIA 1V11A 1KBQA 4JUIA 1PEDA 4Q0MA 1CIPA 5BSUA 7MHTA 2QUAA 1IBSA 4R1QA 4ZO6A 5E9WA 1LGYA 1DBSA 5DX0A 1IK6A 1AXGA 1XDSA 3B3QA 1UZUA 2X7XA 3B6EA 3N59A 1ISFA 1UC9A 3N7TA 2DEUA 3EUEA 5CBPA 1BS9A 1T5TA 2XMGA 3V8EA 1UEXC 5SZHB 4HZUA 2OYRA 3R1IA 4AP6A 1FUEA 1SIOA 5KAMA 5HVNA 1F1JA 1RAFA 4EQ6A 2BLNA 4FKBA 4NARA 1FQOA 3Q3JB 5AW5A 3UFBA 1AGRA 1BEEA 1JIIA 4QDTA 4ZEOA 3A9RA 2VKTA 4F3RA 1A7UA 1DKPA 2XPCA 3O7MA 1Z8DA 4F93B 1GCGA 2K5UA 3UF0A 3FCYA 3EUAA 5AI6A 1PUIA 1R0SA 3LKDA 4TV8F 4JP8A 5EXXA 3ZQ4A 4DSNA 4EI8A 4BBPA 2HCBA 3UIEA 1H1LB 1Z4QA 4RA9A 1T9AA 2D74A 1ZW1A 3KZ1E 1YDGA 3M4XA 1L4NA 3D0KA 4MTLA 4AECA 2FMIA 5COQA 3I2KA 3TVYA 4L9RA 5AOVA 2PXCA 1XPJA 4NWIA 1XDBA 3TSOA 1H2FA 1QZ3A 1XDZA 4AZ3A 1TEXA 3GVHA 3QEJA 1QVAA 2XMCA 1Q19A 4NESA 2PUWA 1N9GA 3ZXUB 4TUYB 2W2TA 1OXSC 4I1SA 2FUG6 1JQDA 1GUAA 1JU4A 3BT7A 3THWB 3X2EA 3DQQA 3EAGA 2WD9A 3QUSA 3FI0A 3KLMX 4MQEA 2JHPA 3ELUA 3HU3A 3IBGA 1R27A 1DOHA 2ZI9A 4J16C 4O4IF 3TTYA 3R74A 3X1ZA 4A2PA 4RPJA 4GL4A 2GESA 3VBCA 4QTZA 4CETA 1EVKA 1US8A 2QTVB 3MRXA 3JD4A 3CLRC 1LPPA 3L82B 4JKYA 4ND3A 2DTDA 4AM8A 2ZUVA 2OGWA 4HGZA 3MTBA 1DXYA 4MWCA 3IUBA 4R2HA 4E30A 2QP3A 3EXIA 3E03A 2FKNA 1YNSA 2QRNA 3EVNA 3IAFA 1MABB 1VCMA 4TMYA 5B1YA 1Z3CA 3ICCA 3OPQA 4FVTA 2HC9A 2XE7A 5CX1A 4OI4A 3BMOA 1Z12A 4BKOA 3QBDA 5AW3A 1N5JA 1IEWA 1BHO1 4OI0A 5EHNA 5AK6A 1GKUB 4KODA 4UU7A 1FYDA 1GO2A 5J63A 3NHPA 4JOCA 3SXJA 3FSRA 4C1BA 2FF5A 1HOXA 2Y93A 3EGXA 2VAMA 4ESHA 1NF3A 1XTQA 2ZYRA 2EYQA 3ISTA 3HADA 1ABBA 3RE1A 2R85A 3A3NA 1HDRA 3DP9A 2ZR7A 2C9ZA 2Q1SA 2IJGX 3VM6A 1JPVA 2YFYA 5EWLB 1MC8A 1ZNWA 4Q7EA 1DBIA 2B2NA 5L4SA 4RKRA 3PWSA 2ZQZA 4HOYA 3I1IA 1GDDA 4D80A 2BELA 2UUPA 3UQZA 3GJYA 4N9WA 3KX2A 1E1RD 2DVMA 2BMWA 2ZROA 3FZEA 4UM5A 1U5AA 4DLVA 1JVBA 3EBOA 1AKRA 1WZIA 3PQCA 3C3YA 4Y2PA 1KPIA 1E7SA 3SDBA 1W44A 1ZZGA 4UTZA 5C8VA 1Z4NA 2UDPA 1QBKC 1KJIA 1OLUB 2VRWA 2EGGA 2ZVQX 1R9NA 2WAMA 1F3LA 3L7BA 4K8OA 1ML4A 3ROFA 2RI1A 1DQZA 5FLXA 3SX0A 1LJLA 2OCBA 2ECOA 3TZLA 1BJRE 4NFSA 5J2UF 3OSZA 1NURA 3HN2A 2XT9A 2JLRA 2R1UA 5I45A 3Q8WA 5KQPA 2RHJA 2E85A 2QGZA 3LYHA 2LDXA 5JC1A 2I4OA 5B58C 1M34A 1TCCA 3MINB 1E2IA 1PG2A 2C9DA 2PKQP 3THYA 4OVKA 4MX8A 1BCRA 1E3DA 2ROQA 4WEOA 1G3QA 1NW9B 4UEQA 3FZQA 4F5YA 3VNAA 3HYCA 3W5AA 1GTMA 1XTTA 1T5HX 1ZLYA 2VJPA 1H2ZA 3HGMA 4L07A 1KR5A 5LA6B 3JVDA 3IIKA 5ECDA 4O5AA 1LZLA 1F6BA 1J42A 2EATA 3JAMA 1WZ2A 3LK7A 4OXRA 2C98A 5ERGB 1HTTA 5A9SA 2AD5A 3WRXC 3DEKA 4GQAA 4UU0A 2H7XA 2JLAA 3ZCUA 2V1XA 5ALVA 2E1RA 3F6SA 1OFTA 1YS1X 4PZCA 4Q4JA 1VE7A 2E6KA 3BXEA 3HNPA 2AQIA 4LJRA 1G6HA 3EBPA 2X9NA 1ESEA 5PNTA 3THOA 3SSAA 3JQAD 3F5FA 5L8VA 2KJQA 3NM5A 2P77A 2Z8ZA 2VH5R 3RADC 2JD2A 3MQ4A 3UWKA 5JSUA 4QUKA 1WKBA 2IYOA 3K4HA 1E3EA 1YZYA 5BQ5A 2DWUA 1ZD4A 3BGSA 4H7IA 3STHA 1CEQA 2VLBA 2XOKA 3L18A 3WLPA 5JT1A 2O2HA 4D6XA 3V5NA 3CKKA 3FYCA 1GRNA 1BJKA 2HGSA 3PEVA 4X95A 4OREX 2HWUA 1C29B 1A5TA 1L6RA 1WY5A 3EJ6A 1HLGA 3R77A 4YRSA 1OXTA 3UH0A 4RVGA 1Y5MA 1C3VA 1LK5A 2UYHA 3ZNNA 1M2KA 3BTOA 1DV2A 2XLBA 3UWDA 5LSAA 2FW8A 2CVOA 3GRUA 3VSDA 5JXGA 4FCTA 3AUAA 3QXXA 3HXQA 2J41A 3LUGA 3PU6A 3RYTC 3AJ8A 3OTWA 3D4LA 5EFOA 3WL8A 4K2AA 2HJWA 4TVBA 1MIHA 4HWKA 1TKRA 1NKSA 2PGXA 2VPTA 1MJGA 1E32A 3L1IA 3KVVA 3OJWA 4JVLA 1A71A 2B0CA 2YN2A 3OJOA 4FK8A 5BORA 4R84A 2G88A 4MW7A 4DLXA 4NHOA 3QLVA 1MG5A 1TT5A 4JJ6A 4B4UA 4QXRA 1SKAA 2VAWA 3D64A 3EVEA 3A1SA 3KYIB 4IIGA 4KGDA 4J3NA 2W6OA 4C76A 1JF8A 4MI9A 2GCIA 2VQ6A 3G2QA 4KL8S 1V37A 1CYEA 2V6BA 5EEHA 1CNMA 4E07A 2C5AA 2ODEA 4OHVA 3TDNA 2PBLA 2AFRA 2DFPA 2E6UX 5DH9A 1KC1A 1T43A 3Q41A 3IXLA 3KQYA 4OJYA 2HIAA 4WOJA 4P98A 3TQCA 4YAOA 4IF6A 4KXWA 4LQ4A 1P8JA 1T1GA 2QN8A 3KT3A 3D6UA 3RRZA 1GUBA 3K8OE 4LI0A 4MIKA 5BYKA 3TGPA 3KZNA 1HMYA 4D9EA 1ZPDA 2Q9AA 3DZGA 4YJKA 1RRGA 1XT6A 4YRRA 3ZLVA 3P4YA 4V0QA 2BY4A 4G4IA 1EWKA 1NVKA 4RESA 3KHSA 3PFFA 5CEEA 3NR2A 4ZCMA 1G21E 3AJDA 1W76A 1U3FA 1NU6A 1JT9A 2GJ8A 2IYLD 4TLEA 5LKRA 1UKAA 2OZPA 2BH9A 3AG6A 2B8TA 3NTUA 4KLCA 5IBQA 5T6MA 1Q7TA 2Z9CA 4M88A 1KSJA 4ZU1X 2W6PA 3OOYA 3WA6A 3UCFA 5AJUA 1C7EA 1Z6YA 5FWYA 3CLRD 5JZ9A 1KEEA 5LL6P 4IDQA 4MWTA 5FAKA 2CMKA 4JR1A 3JQAB 1JLMA 1Q16A 2BOVA 4UE3S 1GR1A 5DTRA 3UMCA 2OD9A 2A0FA 1QJCA 1FPQA 3W2IA 3CLSD 4OXNA 4FTWA 4DARA 3UCEA 2EL7A 2HBYA 3ZGYA 4B8WA 3KOOA 5LQUA 1YUNA 1T1RA 3E3LA 2A7XA 4C0HA 4P53A 3O31A 1YJ8A 3FTCA 3RK1A 5KNDA 3PUWA 4DT1B 3NJ4A 1SXJE 3TTTA 1Q20A 2ZT6A 1OBCA 2ZG6A 4IL5A 4EJMA 2YNMA 3AFGA 4Y9UA 1VZ3A 1AQYA 1FDIA 2XCTB 2CZGA 2QZ4A 3K6KA 3I05A 1WW3A 5I7OA 5JDIA 4M0LA 1SCBA 4E1VA 2WHXA 1AZTA 2VTEA 4NQRA 5E9JA 5I9BA 3KEQA 4UUPA 3T7AA 4NNOA 5INTA 1E8DA 1RI4A 2VHXA 2XEXA 3BH6A 2KYRA 5A3JA 4OXQA 1XGKA 3BL8A 4B82A 1GGMA 2GTHA 4OXKA 3MK31 4R16A 5BR8B 1TVCA 2H4ZA 4P54A 4EYSA 2NUTB 3ZD7A 1PL8A 1PWZA 2WWYA 1E98A 4KO8A 1YFZA 4Q47A 3D6HA 5KC9A 4ALLA 5HCNA 4D8YA 4M83A 3C7KA 4C5AA 3REOA 1SD2A 2E1PA 3CVUA 1PV2A 1B8UA 3EVCA 2WP8J 4Z4EA 4I50F 3VJKA 3TNYA 4CF7A 2PZGA 5BY2A 2VA9A 4BGVA 2B78A 2OKGA 3NETA 3TLYA 3C3KA 5FPYA 4X24A 4U7JA 4YALA 3KOMA 3KLBA 3HKEB 3QMPA 2K6GA 4Y1RB 3CZCA 2HWXA 4IDPA 5D6NA 5KI6A 3X2FA 3DEYX 3DD1A 2ZXFA 3OUUA 1NBMD 4LJ8A 1P62B 1P7PA 5FYQA 3OOSA 1V41E 1EHIA 2SICE 3P96A 4HDNB 1GRRA 1XVLA 1V0JA 1OWMA 3C4QA 5C8YF 5LB4A 2PWAA 4FMCF 4OUDA 4KR9A 4BECA 5IEBA 4ZODA 1OH6A 3PFCA 4F7DA 3RU3A 3HRKA 4EPXA 1RLOA 2O7NA 4FJ2A 5ECWA 2AI1A 4BO4A 4NDZA 5BV7A 2O19A 3BJZA 1M8JA 1Z4PX 3VGJA 2P27A 1JQJC 5CVUA 4HXGA 5E1DA 1QYIA 3ZCSA 3D8BA 3G49A 4FIZA 1Q1EA 3FDXA 4FJ0A 4QPJC 1E1NA 3FSGD 1BOFA 4I08A 4MVXA 1EBBA 1L1EA 1TJYA 3EF0A 4IFBA 1O54A 5A5GA 4HNAA 3WGMA 3D4NA 5AKJA 3H42B 4JMLA 3GNLA 1CWUA 4A1OA 2YS6A 3RYCA 5KEIA 1XEAA 3CWCA 2Z98A 4RIIA 1RJ9B 4CM7A 1K8XB 3R7DA 2PKQO 2O1EA 4YAFA 1O4VA 1MVLA 1VSVA 3M4NA 3RTEA 2RGNA 3BCUA 1L8QA 4CW7A 1GT6A 3SE0A 3USZA 1DC4A 3ESRA 4K9DA 4H08A 4Q01A 1VGQA 4FFBA 2ISSD 3BMXA 4XCQA 2G63A 3LDGA 3WLNA 4RGYA 3SBDA 2E4VA 3NBYC 3I6YA 3Q88A 4NBTA 2AOVA 3BWYA 3MQ2A 4XX1A 2XVXA 1PT9A 1XQYA 3ZOKA 4IO1A 2W6ZA 4DV2B 5D01A 3GDOA 4GXQA 2HJGA 2WQ6A 3R5HA 2YYSA 1P31A 3DTTA 5FOQA 4YUAA 2PUDA 5U9CA 3DXZA 2GRJA 4HLUC 4X65B 3HP7A 1I1HA 3A04A 4OBWA 4BO5A 1QG4A 2V3WA 4XQEA 5E2AA 3R3JA 1HFEL 4L3VA 1H4TA 4EKDA 1O0CA 2FU5C 4BO9A 3FKJA 1W1WA 2CF6A 4B3XA 3PFHA 4AWBA 5CPFA 4DA7A 4GZ3A 4JB3A 3KKPA 4GLLA 2VATA 2J6CA 1XZJA 1XI2A 1GLGA 2PEZA 3BJIC 5FBRB 3WK5A 3ZLUA 4X8LA 2PVCA 3WJ2A 4TMFA 3OFVA 1CF9A 2WSYB 1YASA 1IN6A 3IP7A 2EKDA 3I83A 3PEUA 3ZHCA 4LZJA 4BFCA 1QH0A 3G6WA 1VXRA 2ZBQA 4V0RA 3TJMA 3W5BA 1XSEA 2VS1A 2H1RA 4KH1A 2WJIA 3WMWA 3CH4B 4BZXA 3AVYA 1Q22A 4FNMA 4PO1A 2F8SA 4XI9A 4WY8A 1YGPA 3ICOA 2PN1A 3EXG1 3A3OA 1PSZA 1NXPA 2PSSA 2BHSA 4ZCSA 3QXJA 2XB9A 4ASUA 3K70D 3EJWA 3I6ZA 1L5RA 1ZI6A 3TRFA 4AUNA 4BNGA 1IBLB 5ITSA 1UXHA 5JIBA 2XWQA 3QE0A 4CKXA 3G17A 1UT8A 3LY9A 3T1TA 1AUOA 3GPCA 2WR8A 4E2ZA 3KO8A 1ZUD1 2R7KA 4EW1A 2WICA 3B85A 2ES4A 5BN5A 2OFWA 4OGGA 1C3OB 2F2TA 2FPRA 4EWLA 2IGBA 2V45A 3QEOA 4GU5A 4X3OA 4BQNA 3IOEA 3K16A 4FFRA 1D7OA 4JJFA 1HE8B 4LIPD 4YT2A 4P4SA 5IN4A 3KQHA 1JJBA 3BHIA 3GN2A 4OKIA 1G5HA 2OCGA 1QKIA 3I76A 4I46A 3RR2A 5BWCA 5JO9A 2WSIA 3LRPA 3OX1A 1DDIA 1QGUA 1USWA 3ENVA 3QNUA 1X94A 4TKUA 1O95A 5DLPA 2IUYA 3RVKA 3V2IA 3D7SA 2PT7A 5KVCA 1I3OA 1U3GA 2AVDA 2PSDA 3DMRA 3OVMA 4LZOA 4XUCA 3ZGVA 5KWJA 2BJVA 4MV8A 5AKYA 3FOZA 2FZLA 2VWHA 2ZIZA 2P40A 2POQX 2W2MA 1QO7A 4JJ8A 1W35A 2KSQA 4US2R 5D7NA 3ZBTA 1JUDA 1G1AA 2Q0XA 2ZUUA 4RGBA 4S3MA 4U7WA 2YQ4A 5DFAA 2YFQA 2X0NA 4LXXA 3TDKA 4B35A 2V5AA 1RU3A 1R64A 1T91A 4HXFB 1FTNA 4P3PA 3C6YA 4IDNA 2I3DA 1J2UA 2W58A 3KAPA 4NSNA 3NPAA 4C4YA 2ZU6A 3IBYA 2BMFA 1THMA 4M7RA 2FGJA 4AN4A 3FJ1A 4HVTA 1E6MA 3OQIA 1DEAA 3R5KA 1OAOC 3SXUA 4RHEA 2NU8A 3T35A 3OX3A 3SZUA 5A4IS 3QYJA 4XPIA 1IJFA 1ULAA 2BF4A 1I4DD 3IUJA 4L4ZA 3R7SA 1ADJA 3A14A 1NE7A 3A3PA 3ZOZA 5HHTA 1LWNA 4MMYB 4OHWA 4KSCA 2Q99A 3L4JA 3OEWA 4GD3Q 2VH2A 1J7JA 4PXSA 5I3ZA 1VG8A 3WL6A 2EW2A 1W25A 1Z08A 4HN2A 4MUYA 1RMQA 2YRFA 3ZWCA 3IHWA 3JAWA 1K4KA 3BILA 3PRJA 3I5AA 3K0CA 1QLJA 1SN7A 2I7VA 3O75A 1PG0A 1ZM7A 2JLYA 1ZVQA 2AYXA 2Y0BA 4D9JA 2OO5C 1R7RA 4TXLA 1T0BA 2Q3BA 3VHXB 3KOYA 3C87A 1J07A 2HRCA 2WM9B 3ND8A 3J81k 1R9MA 2YWXA 2J45A 1I2CA 1XCOA 3CINA 5AKGA 4B5KA 3NUZA 8AT1A 2IOQA 1XLVA 3A2KA 2X15A 3HBJA 3RVOA 4CM5A 4ZOCA 3I3SR 3R6GA 5J4HA 3RVLA 2KBEA 2HXYA 1NR5A 3LNCA 2GETA 2WT4A 1OXUA 2AXEA 1F9AA 2FZWA 2ASEA 2R6R1 3II6X 2F7SA 1Y6ZA 3G8YA 3LLSA 1QE5A 1CUIA 2DOKA 3OTGA 4PCLA 4CF3A 4G24A 4DQLA 5KSYA 1L7PA 2VJAA 4FXOA 1DLIA 1WVMA 2J3KA 1JE1A 1NNEA 3R7BA 4GDFA 1U1EA 5CB4B 5FLKA 1CJTC 4RF5A 4LDRA 3VPCA 5FWYB 4BBJA 5ALNA 5ALKA 4KQFA 5JOQA 1UPTA 5BSRA 2AUNA 1ECLA 1J25A 3IT1A 2JHAA 2Z4TA 3BCRA 2XJ4A 2Q2OA 4JC5A 4AJKA 4A2QA 2RGYA 5JY1A 1LLQA 3QYFA 1UMCA 1GSHA 2WTNA 1GGNA 3LFTA 4W9NC 1J2YA 3A9WA 5JNVA 2WTBA 1HDZA 2W83A 3AETB 3BD6A 3CF4G 5TMDA 1B3BA 2B83A 1JKJA 2QTMA 3CRVA 3OETA 4N3CA 5E6SB 3TIVA 1NWCA 2OBYA 4TL7A 1EDZA 4E33A 3OEYA 1Z2NX 3NIFB 3PA8A 3JR3A 1U0SY 2D4HA 2IYNA 2Q6IA 1E63A 1G0NA 3BB3A 4QEDA 5L3SB 1ARZA 1L8XA 2XJ9A 1KI9A 3NHSA 3QW4B 2PZBA 4PYNA 1UBSB 4ZVLA 3R9IA 3VSBA 5JW6A 2O8BA 1GCIA 4RXUA 1I2ZA 4WVLA 4OHFA 3IO3A 3H18A 1PQWA 2P2CA 4PONA 1RLMA 4LOJA 3V1MA 3JWIA 3TLKA 1NHGA 2PVSA 1P9LA 1MT0A 4FGSA 4Q66C 4JENA 1TE2A 3FJOA 2GGSA 3SYNA 3C70A 1W87A 4BX9A 1SBZA 1V7CA 1TJ4A 1OR8A 3JZAA 4F46A 2FX2A 5GGYA 1ODIA 2B1QA 4Q34A 2D2IA 1XU4A 1CUCA 1MENA 1QNFA 2VJKA 1JECA 4PINA 3R9WA 1D8AA 1YU6A 2X8BA 3ISJA 2HU5A 3KQVA 3LX6A 2A0KA 1P73A 1RSZA 4MI6A 5CXSA 2Y1WA 5ICEA 5LQDA 1VGRA 4M6WB 1E3IA 3EEIA 3PZBA 1LNQA 3DF9A 4DA9A 2V8OA 3KJZA 4DAEA 3WWYA 2LR0A 1M0TA 3EXFA 3D4PA 1KJZA 3L2OB 1RAEA 2JW5A 3O0DA 4BVBA 2XXBA 1UDBA 4HX2A 2YC2C 1QH1A 1UAGA 3JR7A 5AVTA 1GZ5A 2WTEA 2C2YA 1H9AA 1D6NA 1DWPA 2WE7A 3EGCA 3W7BA 4JXZA 4HSEA 4PSUA 1IVYA 3H7IA 1RXEA 1MJNA 2VUIB 4PR0A 1Q0QA 1E0DA 5CAEB 5SY6A 3I0ZA 3BX1A 4PHTA 2ZAIA 3VPFA 4LBZA 4MLDA 1WHTB 2P1DA 4B85A 3GLHA 4RXTA 4Q9AA 4ARZB 4K0KB 5HE8A 1MEEA 3ZHUA 4UM8B 2PIDA 2EHDA 1E2PA 2R3SA 3GPBA 1FUUA 5A3RA 2P9YA 5GJCA 4FWBA 2H6EA 4XGIA 4B6SA 3QXSA 4GYWA 2VK4A 5DK4A 1AF4A 3THXB 4NE7A 2JI6A 2O0MA 1G4UR 2ATCA 3LP8A 1I24A 4TTRA 3RVQA 3SVZA 3K6RA 3UJ9A 5TPZA 4M9SA 2W4QA 1RVV1 2IXEA 3LO8A 1UC5B 1YIDA 1Q0PA 3LCMA 4Q3CA 4UVDA 4Z54A 2RH5A 1X1AA 1KYXA 3VSEA 2XE4A 4QXOA 1K8QA 4WA8A 5EHZA 1DTEA 1NZFA 2DWCA 1KNXA 2WWFA 1J97A 3QITA 1QANA 4XD7A 4A82A 1FDVA 1E5DA 5BVHB 2P6UA 3PNOA 4PZ9A 4WCFC 4K6OA 3GRKA 1F60A 2F59A 2VRCA 2WAOA 3BXPA 1LPMA 4E4YA 3WBKA 1ZU4A 3HHEA 3SJ7A 3NHLA 5C46F 1G16A 3M9XA 1QV6A 2HHLA 4M55A 3TXAA 1AX9A 1HETA 1N2GA 3DZJA 5GIPE 2DPYA 1BWSA 2UVQA 2XNKA 4CT4B 1L5ZA 2C59A 4KXUA 3VNQA 1CYDA 2HLPA 1I6LA 4WLEA 3ZE9A 1NHWA 2B37A 4INAA 4B3IA 5LQJA 2R1VB 1CEEA 4JYAB 2REOA 2NTJA 4MUFA 3ZWDA 1WTAA 1P74A 1V43A 2NSDA 2XDWA 4DL9A 1YZGA 1U8ZA 4MS1A 3WFJA 5CCDA 5JYDA 1YHNA 1GA6A 3DFUA 3GIDA 4PXYA 2Q27A 1JR2A 4J1SA 5FYDA 5J5AA 3RUDA 2GM5A 4YJ3A 3REFA 1YB6A 4DAOA 4EY5A 3B1VA 4TWJA 5HJ7A 3T1QA 2HRRA 3T7EA 2Y68A 2WUVA 1IYZA 1H1DA 3JWPA 3PEWA 1FYWA 5JWOA 3VR2D 2AQKA 4US1R 2I99A 3DBHA 1B2LA 1K5DA 4W8HA 4W63A 3JALB 1W4RA 1PR6A 4ERNA 4IDFA 4QASA 3WOVA 4CV1A 4JV5B 2MJLA 3C3CA 2QTRA 3MGKA 2A8YA 3HYRA 3IEMA 4BVJA 2WYIA 3PRHA 3MD9A 2ZXEA 4BNMA 1IXYA 4OHPA 3DMHA 4GMKA 4I50B 2BP7A 1ZGJA 2VPYA 3GLFB 1DI0A 1GN8A 4RLSA 2ET6A 4HAWA 2CVFA 4YREA 4BVGA 2EAUA 2ZJZA 4QAJA 3SIWA 3T4EA 4RY0A 1S4QA 3TOVA 5DN6D 4FFDA 1SC9A 2ZB2A 2PU5A 1UJCA 1N2ZA 1OWLA 5BT9A 2DETA 1Z5GA 1N6OA 1V4NA 2XCQA 1KAEA 3QWBA 2HT6A 1VPLA 3HYSA 3L6DA 4PYMA 5AICA 5SY9A 2Q0QA 5FUWA 3RFTA 1BGXT 3ZJUA 4HDMB 4M86A 1BE1A 4A6EA 5KO2A 2OCDA 4AJOA 4LBYA 2IXAA 5K05A 1NRJB 3FPAA 2C1ZA 4G4SP 5KIAA 3AR2A 1SBIA 3DAPA 4IMRA 1Y1PA 2VNAA 2WUDA 2C8VA 1CLEA 1D0IA 3BMNB 4YV0A 1KVRA 1YS4A 3L6OO 2W8ZA 4K46A 2XBUA 3FA2A 5J4KA 5JCZA 4XH9B 1B76A 4R40A 6NULA 2OAQ1 3DFFA 3RRNA 3CRRA 3HTXA 1S0UA 3L0OA 5H83A 4LNAA 4R69A 4FYIA 4ZP1A 1F2DA 1WAMA 1FRZA 2IZ0A 4L5CA 4EG3A 1TA0A 5GJBA 3NHBA 2PNJA 4DIOA 2N75A 5DLEA 4M1MA 4Z99A 5SYMA 4DT1A 1Y3AA 4EG6A 2DJIA 4I6JA 4JR0A 1DJQA 1V5IA 4QARA 5A0TA 3KEOA 2VUHB 4G8BA 2CUNA 3FZYA 1AVTA 5BRNA 4B76A 4FP9A 1BZYA 4H3SA 4WLOA 1ODJA 1LS1A 1WHTA 3ND6A 2FPWA 3COWA 3KXLA 2XMBA 2J30A 3NHMA 4IXMA 1JA1A 4OQQA 3DUFA 2JLVA 1BA2A 1IQ0A 3M9WA 4W5JA 4AF8A 3DUFB 3A6ZA 2VQEB 1I14A 2QX7A 3KP1A 5K8UA 3JWGA 4KE6A 4GX2A 1EUQA 3F1LA 3F67A 3HY3A 5DGHA 3U49A 3EHEA 1PIWA 5IJWA 3U1VA 3BBLA 3AEYA 3GT0A 1RYZA 1VI5A 4PLYA 4WWHA 1SCQA 3IXQA 1N2XA 2C4TA 1NPYA 3ABIA 2PD4A 3HCDA 1BX3A 4I3FA 5AK5A 4CRWB 1LI4A 1XZAA 4G6ZA 4GKKB 1A4UA 2HPVA 3LPCA 2HDHA 1Q7EA 3ZX4A 1QQ7A 4NCKA 4M0MA 1AUVA 3DTNA 4Y2HA 4C4TA 4BYGA 1YULA 3E8SA 3NTOA 1U7ZA 5FQNA 4BCCA 1MGOA 1G2IA 2PR2A 1N2CA 1Z17A 4GSLA 2CK3A 3NU1A 3PDUA 3CX3A 2AGVA 1UZNA 2YWJA 4JSYA 1ES9A 3U9SA 5BNWA 1RXWA 1RC0A 4XUDA 4OP3A 4YWJA 3IBTA 1J9EA 3E35A 1LDBA 2I6SA 1GPJA 1TYAE 3NCTA 1CP2A 1Q7GA 2NU9A 4TPKA 2R4QA 1K75A 3DJFA 5EMKA 5G4LA 4D0SA 1JT2A 1P80A 2XCRB 2AG5A 2IIPA 1I6KA 1Y4DE 4X1YB 2BH2A 2CK3D 3ZKAA 2DBZA 1R0WA 5DVZA 3L9XA 1T0JB 4PE5B 5CRIA 5DKFA 2BEUB 1CY4A 2AE2A 2ZAYA 4G63A 3IAS1 4CMHA 3QF4B 4HL6A 4D5EA 2Q5LA 5GOTA 4DJDC 4AI6A 3M4ZA 4AICA 1EQUA 5AW7A 4UCXA 2DWPA 4NPHA 2ZIXB 3CF2A 1NSFA 1Z7GA 5KDDA 2PXXA 2UZ1B 1GAQA 5IW8A 1MLDA 5DNYB 2UZ1A 2VDRB 4MS1B 2I4NA 2YMMA 4O2BF 3ZW7A 5B6IA 7YASA 1JXQA 1FFHA 4QUBA 1AUQA 2GK3A 1RADA 3QPBA 5ICGA 2QY9A 4NLLA 2ARKA 1ORDA 3OEHA 3IE2A 1RPNA 3O8DA 1UJMA 1C8VB 2DY0A 4J43A 4UMVA 1DX4A 1CE8A 1NM5A 2QP9X 1YBFA 4G81A 4RMNA 3L7DA 3EWNA 1Y80A 3SMQA 3A9SA 4AJ1A 1QO0D 2Z9BA 4UCQA 3E18A 4ARBA 2Z6VA 1SBHA 1TVEA 1IPEA 1N5RA 1WDTA 3G85A 2W70A 5EHXA 4MOWA 5JADA 3S29A 1VG1A 1Y81A 3KB6A 4R81A 1IUNA 4JWTA 3SN6A 2Q6TA 1E9SA 3IDFA 1WVIA 2H59A 4H1TA 1M34E 4HN9A 3BQNB 1RQRA 3D0RA 3IEIA 5A0FA 1Y1SA 4N5MA 2OLJA 2QN7A 4NX2A 3UICA 5ITZA 2UUBB 1T1JA 3CEHA 3X0DA 2JBHA 4JEMA 4CMEA 3AFNA 2JA1A 1U3CA 1G1MA 2PKYX 4HNGA 4WKNA 1N1DA 3PLRA 2VT6A 2YW9A 3A6DA 4WESB 3P20A 2OOSA 1NKTA 3HDVA 3G88A 4MO9A 2VK2A 2FPSA 2B69A 2YV1A 3E05A 4ZAFA 1Y7PA 4Q3DA 2HRBA 3ZWPA 2VT2A 1R9GA 3MXTA 2BN4A 5C2JB 1U9JA 2GPTA 4Y9SA 5TMEA 5DCLA 1X15A 3MWKA 3D6TB 4CN8A 3PF9A 2NUPB 2AZ4A 2G9UA 1C7RA 2CUKA 3KYCA 4RTKA 4D2IA 2YY6A 3MJTA 4EKIA 1NQ5A 2C5FA 2RAVA 3GD5A 1JIQA 3WAJA 3ADBA 2PUGA 3MRSA 4JLBA 4TX1A 4M87A 2J5XA 1IZYA 2VRCD 5BSMA 2HT1A 1T5IA 5DNAA 3C43A 3IERA 2BGIA 4P3YA 2PBRA 2J3HA 1GQFA 2IVFA 1L4KA 1NOJA 2IV7A 4E51A 2FEAA 4EG0A 4GWGA 1VL0A 1QB7A 4G67A 3GRYA 5LUBA 2WA2A 3IUYA 2VLIA 3DOUA 3FOCA 4HD8A 3SQMA 5AW6A 2OHJA 1Y8QB 3PCXA 4IVRA 3U3MA 5BR1A 2UXCB 4YAGA 3V8VA 1ETHA 2WHRA 1JHRA 3WHIA 3DSRA 2R2GA 1JHPA 1Z0DA 4LHVA 2O8FB 2IWRA 1MJ5A 3N70A 2H8GA 2NZVG 2R9VA 5EKTA 1Q14A 5EXEA 4N76A 2HA7A 1RI5A 2FLWA 1RYHA 2JCGA 5EIXA 2ZCUA 1GU0A 2QVXX 4MW6A 4YRFA 3EMVA 1MTOA 2QAGA 2F9MA 4WKBA 4C07A 1JTVA 1SHZA 5ALGA 2EJWA 1M6VB 1H23A 4I5FA 3QEMA 3OZBA 4W1RA 1Y5RA 3KVOA 1SBYA 1Y98A 3HVKA 4QUDA 3WIOA 4NYJQ 4WRRA 3H1EA 1ZN8A 3FCCA 1ZR2A 2CFTA 5E6UB 3HJGA 3IH5A 5F98A 2O8DB 2GHRA 5BMVB 4LUCA 1K2WA 4OKSA 3QSGA 3SBEA 4TS9A 1GYRA 4B6EA 2CFOA 3DMTA 5FOXA 1TEHA 2OG1A 4FNAA 2H2HA 2PFGA 3GH3A 4MQEB 5KNDD 4ZCIA 1YZHA 4RPIA 2H4YA 4R2IA 3ACBA 2HMYB 3OZWA 4Q19A 3AG5A 1KH1A 1NX9A 4F8EA 5FTKA 1EE1A 3AYXB 3R0XA 2WMNB 4UREA 2FF7A 3C41J 2NP7A 3PEFA 4XLLA 4MCJA 3GLGA 1N3IA 5AUOB 1Q44A 3F8SA 3OY7A 1LW7A 4HZIA 5AQ1A 4QGBA 5KQMA 3L7KA 4LJKA 4U39A 1ZM9A 2VPWA 2E4AA 2YJ5A 3C3MA 4UDXX 5BNIA 1R15A 1HT0A 3COYA 4OAOA 5LQRA 1QP8A 3WLJA 1GXSA 3EG9A 1IN1A 1RWNA 3I04A 1W36B 4KTVE 4TQAA 1ZUNA 2QTHA 3DE3X 1ONNA 3O2NA 4YRBA 4X6LA 4YMGA 3K9QO 4OSOA 1QRSA 3BCSA 5FTJA 3OFNA 4QNMA 5K20A 4C9BA 1OT3A 2QM0A 5GAJA 3TZBA 3R3UA 2VNIA 4C2AA 3UT5B 1KFCB 4N0MA 4XRRA 1OFUX 2CD7A 5I7UA 3CSDA 3LVBA 4NG4A 5EJ2A 4IGIA 2BM0A 2PQ6A 2E21A 1U3DA 3RUPA 2QZSA 3LRXA 4S1TA 4ZOLB 3ZY3A 5BVGB 3C4VA 5B6PA 6CHYA 3O91A 3BFPA 5EJ5A 1KK2A 3BQMB 3ZG6A 2E4UA 2FW6A 3FMIA 4AQYB 3HDGA 1W581 3MTEA 2Q2VA 4QUIA 3JS5A 4RW0A 4ZU3A 1P5FA 2WPDD 3FH0A 3LLMA 1Y9JA 2ZUFA 2D2XA 5FTMA 1KTVA 2VK1A 3BH0A 4NOKA 4P7FA 2R84A 2D13A 3COZA 4QBTA 4XFDA 4MJ3A 5DHSA 3V6MA 2QLBA 4JLAA 1VB5A 1BX0A 3ZIAA 4K9LA 2PUEA 4MUHA 5DLDA 4LOKA 3SMVA 4RKEA 5BXQC 4TRRA 3MSXA 4JUCA 1Q74A 4ZQHA 1N2JA 4LV6A 4UHKA 4QBKA 2HXGA 4DUPA 4QDKA 4DRXA 3FNGA 4KN8A 5LC1A 2JAWA 3QPAA 5JQGB 3KQUA 2JIBA 4DKXA 1PJZA 3DYBA 4ZDIA 1OVMA 2Q1WA 3VUEA 3UAVA 3OIGA 2IHUA 1SVOA 3C5VA 2EG9A 3HBFA 1C1DA 1KQFA 3IGFA 4YJFB 2OG2A 3VAAA 4LPSA 2J7KA 1T3ZA 5KHLB 5FWDA 3FWKA 1A1VA 2P2SA 3PGA1 4MS4B 1XDUA 2W6NA 1SULA 1M1YE 2X58A 4GOND 1HO3A 4M1TA 5ELMA 4FIDA 3CMCO 3H0CA 2F3UA 4NZPA 4S1PA 4ZJZA 2BHNA 2HIGA 2RI0A 1N2BA 4L51A 3UMSA 3VVLA 2BBSA 3JAKA 1V9LA 3MFQA 4G0ZA 2NPIA 4GX0A 4NCNA 5KMGB 5DM70 2MSEB 3AEQB 3OICA 4KO4S 4M8NE 5P8WA 2FR0A 4PG7A 1KTIA 1HQCA 2LDBA 3WLRA 1YL6A 2ONJA 3R8XA 4ZPJA 1D9XA 2IP4A 2QRZA 3E61A 2C9BA 1NYTA 2H2DA 5AVYA 3AVVA 5EL0A 1OBOA 2X2OA 4R7GA 2JLXA 3LQ2A 3SZOA 4RLHA 5EHIA 5KHAA 3IDZA 2VXBA 3AF0A 3EZNA 3H9QA 4OBBA 5JCOC 3LV8A 5K0SA 1R2QA 5JD5A 4JJEA 4N40A 5AM4A 1CT9A 3U37A 3SQOA 1D0SA 3VYUB 4B3RB 2WM8A 4X8OA 2J67A 3PHGA 1M1XB 2Q5JA 4M8IA 1G8AA 1Z6AA 2JFBA 4ZEMA 2FOLA 3W78A 3UENA 1GCAA 2ZYGA 4L5YA 3LY5A 4CNQA 4BLQA 2G1UA 1A97A 2EFJA 1FCJA 2B25A 4RM2A 3RHTA 2ZLBA 3QFHA 4IVNA 3UJDA 1GTSA 2I76A 5KNCA 3ZU3A 3GJ0A 2BIFA 1J0AA 4E31A 3FFXA 2CHUA 4JBXA 2OORA 5AXBA 5IXSA 3T95A 2H0AA 2QS9A 1O94A 3ESCA 3LWZA 1FQKA 3O82A 4KDCA 2IEGA 4RMJA 2COEA 2X8WA 2UYOA 5J40A 1RJGA 2L82A 1FNNA 1E6WA 2IYYA 1XU7A 3FBGA 3BE6A 4P58A 4EY7A 4YXFA 1D09A 1JAYA 2M1XA 2G0AA 3HB0A 3KRTA 1P4AA 2PJRA 4H15A 4ND1A 2BRUC 1QVVA 3K6JA 3IMKA 4TT3A 2EF0A 2O14A 4IIXA 4P35A 4EJ6A 2MYPA 5BNZA 3HR7A 2B4TO 3IALA 2AN5A 4IIJB 2NZJA 4O63O 2D5CA 1CUYA 2COUA 2FPOA 4H7FA 1TX4B 2RBKA 4UBOA 1QV7A 2ZWMA 2ZIWB 3T4UA 4DCSA 1WZEA 4BFSA 4IZOA 4JT2A 2GTPA 5KYNA 3OCVA 4GOJA 1T9KA 5DU2A 1U3WA 4JAVC 3GJ4A 3I8OA 4LK3A 4JXKA 4U0JA 1GTJ1 2VRBA 3VI4B 5JDCA 2Q4TA 2J5RA 1T6NA 3N8IA 5EJMA 1BHJA 1Z0AA 3K5PA 4I55F 4PNPA 4XDGA 1VG9B 1RP1A 3UHOA 2PV7A 2MSWA 2NTEA 2Z58A 3BOSA 4R5HA 1U90A 5CLGA 1I7LA 1O08A 1W5EA 5TQ2B 4ZZ3A 4DR6B 1V6CA 2IYEA 3B1FA 1EZZA 2B21A 3OPXA 4Q3BA 4QULA 3HO8A 2A3NA 2WSLA 3NAMA 4NZMA 1RM0A 5CK4A 4ZXPA 3TZQA 2W8BB 1QQBA 2OM2A 5IBRA 4RD6A 2QTZA 4YQEA 1XELA 4HY3A 2NZ8A 4P2GA 4IHJB 1PDWA 4K6HA 1DBQA 4R51A 4GLJA 4Y30A 4DXAA 2YQZA 4KNWA 4AMBA 4MIOA 1B3RA 2P5SA 3JQCA 3KTOA 4DM3A 3I23A 2HCFA 2VIIA 1GNPA 2JA2A 5AXAA 2GI4A 4DVJA 1GIAA 3VNRA 1PFGA 3D4BA 4S0ZA 1IN4A 4V03A 3KM0A 3DAFA 1MX3A 3DFIA 3L40A 3AEQA 4KLAA 5F76A 2CL6X 5FF9A 4Z49A 1R0XA 4AJEA 1Y6FA 3H2YA 2PQ0A 2XMQA 1CNEA 2P30A 4UCFA 3S3TA 2BC9A 1FS5A 2I1WA 2OV8A 4LY9A 4O8CA 5KJFA 3W6UA 1R0YA 3B8HA 3NFYA 4ZU6X 4YV7A 4A9AA 4BDTA 4WVFA 4UE6A 4F4JA 3IAAA 5B12A 4DA8A 3NBAA 4HR7A 1XFAA 5IH7A 1NE2A 2D0OB 3FOAA 3LLCA 5HIIA 1RAAA 3WO0A 3VO1A 2W2LD 4O4IA 3AHGA 1M0WA 4WINA 3D4IA 1Y8RA 1TU4A 4ER5A 4O0MA 3D31A 2N9UA 3R9XB 3NOVA 4EKNB 5DSTA 2MYUA 3A1VA 1WHSB 3LWBA 2J3JA 3O0TA 4RY9A 4BO2A 5F7OA 4PSVA 4F1KA 1E5QA 3PX7A 2XBLA 2HSZA 4P5DA 2AW5A 1QJ4A 1NVAA 1MAAA 1SUSA 1CV2A 1YR8A 1J4AA 4HDSA 4L72A 1AXEA 3BORA 5FBHA 1Z75A 2EQBA 3D1VA 1ORWA 1M6YA 3VC2A 3ZXSA 4KI7A 3OZIA 3NHAA 4EFLA 3VDXA 4ZYYA 4XDZA 2B3TA 3WRWA 1VMKA 1Q95A 2W2PA 4MUMA 2B34A 4MR9B 2EP5A 4UJ3A 1N6LA 1RDFA 3PJFA 1Y5LA 5AKKA 3RAJA 2BFEA 3VR6A 2SHKA 2V98A 3BMQA 1L7DA 1GL3A 4FM9A 3ZHSA 5F21A 2FXIA 2X4LA 1IZ0A 3LKBA 3SQLA 1ZMXA 4A0GA 4ZAWA 2Z6AA 4MKXA 3T7IA 4DXHA 4WMLA 4XGQA 1FMTA 3OCWA 1VDMA 3OPVA 1A96A 4OMCA 4RJIA 5FFFA 5KYUA 3RHZA 3I5XA 5KYXA 2BI7A 5AI4A 4CM8B 4IDHA 3DVAB 1RRVA 3N1UA 4KSYA 4Q39A 2I3AA 2X3YA 2P2GA 1AG9A 1ENZA 3S44A 5A4MS 1DKOA 1G2OA 3I8SA 3VNBA 4MUAA 3UFXA 3N2ZB 2W48A 1EX7A 3G0IA 3PGJA 2XXAA 1D9ZA 3B9BA 3UAXA 3LUFA 2C8KA 3NZEA 4M1WA 5F12A 4O4HF 1CG6A 4IOMA 4MYRA 5F51A 3V6LA 3WTCA 2AZXA 2NV0A 2A7QA 2PG3A 2HK8A 1WUTA 2X6QA 4MKZA 1Z28A 3IP9A 3OZUA 1KO1A 4RO0A 4EJ2A 3CPHA 3M2PA 1XTSA 3WX0A 5B7PA 1XEXB 2C9OA 3UJAA 4AG5A 4HBGA 2VDJA 5ED4A 1GU1A 1GA4A 4G25A 3GA7A 3GO4A 4P93A 1G3MA 4P0PB 3MG9A 2YZ2A 5KYWB 3IPRA 1QFXA 3KVRA 2NSLA 3SICE 3KWMA 3OECA 1LTQA 1Y48E 2OD7A 4DBVO 3PTAA 4N3AA 2ISQA 1R4MB 1T5DX 3N74A 2ECQA 3ZK9A 3UO8B 1U9CA 2IEAA 2VC2B 3T3MB 4Y1EA 1CHDA 1Q3TA 3K8YA 2NZUG 4GI7A 2V5UA 3IP3A 1SWVA 2X3UA 1J0CA 5A9TA 1PFYA 3IOYA 1RIFA 2QRJA 2I3ZA 1A7AA 1BE8A 2PGOA 1Z45A 4IQ4A 1EFRD 5EA2A 2GPYA 1Z4LA 3B38A 1K6XA 1ZN2A 5LXTA 4B2IA 1ODTC 3CLKA 1R4NB 4RTOA 4NK5A 2PJUA 2FCAA 1QH9A 2AN4A 2ZRIA 4NFYA 4H1WA 1QE3A 3L0ZA 1EXDA 4Q3LA 2QPLA 1E3QA 1ZEJA 3DO8A 4XWYA 5M04A 1VHDA 3JQ8A 1PX0A 3B5IA 4Y2UA 4D0LB 3BTSA 5A7FA 1YZ3A 2JAPA 3S2GA 2KBFA 2KB0A 2HHAA 2ZRFA 3L77A 2ERCA 2VJDA 2NU7B 3O2SB 2B1RA 1JQKA 4FDLA 3OOHA 2FSPA 1ZONA 4W7IA 4ZARA 4YXWA 3WNCA 1FRVA 4KAJA 3TS1A 1IUPA 4IJQA 1RYDA 2KX7A 4UEWA 5I3CA 5KREA 2UAGA 4YJ2A 1ZAYA 1QP0A 2QDKA 1RTKA 2VAPA 1IEVA 2I2WA 3SZLA 1MFZA 2FZGA 2EX4A 4OA8A 2E55A 5CFRA 1UK6A 1FU4A 3DWGA 3E15A 4FSDA 4EW3A 1K7SN 5IC4A 5KX5F 3ZV5A 3OCCA 3V8QA 4ARAA 1OXXK 3N8DA 3OAAD 4L57A 4DRXB 3K9HA 3DV0A 4WHMA 1RWXA 5CLQA 5DX8A 1MQ9A 4GLOA 5IM4F 2JLUA 3E7DA 4FGLA 1N34B 4KQIA 4E08A 4Z9XA 2JFFA 5BMVF 4J9VA 2BJHA 4QXAA 3ZK7A 2GK6A 1V1MB 1HK7A 3NHKA 3IR7A 3SHQA 4YCAA 1Q2UA 4AX8A 1WPGA 2HM7A 2VUUA 1RYEA 3A32A 2ETXA 2IPMA 2W7TA 4QVKA 3RUIA 3D8SA 1TD1A 4B45A 2YINC 1HMPA 4P38A 5CB4A 5AVQA 4G09A 1PEAA 5A5VA 4YRCA 3RJ5A 4DWVA 4IHQA 3UEOA 2Y9PB 3BYZA 3EK2A 3N75A 3PL1A 1ZCAA 1JGTA 4JB0A 1R0CA 4LRSB 2BFCB 2I4TA 3PBKA 4JODA 4KXQA 4BPRA 1XNQB 4IVPA 4N6GA 2VP6A 2XUKA 3W8EA 2C0QA 2VZEA 3BFXA 4PR3A 2AE1A 2P41A 2BM8A 2XAUA 4FT4A 4L3WA 3M49A 3TL2A 1Q3HA 4OAPA 4QYMA 3NHZA 3UPUA 2OO3A 1HTWA 3UT5A 1F2VA 5IDWA 1RQLA 1Z0UA 5LP6B 4FGZA 3U3ZA 3OMWA 3RWMB 1X7XA 1CS4C 2BCJQ 2DHDA 3HCFA 2X5JO 2IKQA 1X7XB 2G4CA 4QJBA 4WD3A 1TQ4A 2HA0A 2YIVX 3WJ1A 1GRCA 4R0MA 2R6DA 1QBGA 4WH0A 3QJYA 3RH0A 5AVVA 2PX4A 5DIZA 1J5PA 5DM0A 1LQ2A 1GL7A 2L2QA 3HL4A 2IITA 4EY6A 1E66A 4Z0TA 3IQWA 4ZA2A 1GQQA 1YQTA 1KU6A 1QRUA 2ZBUA 1A88A 4H7HA 4OB6A 5TR9A 2IP2A 5D51S 4F6RB 1W1IA 2RH8A 1YI0A 821PA 4FFLA 1S2NA 4UD2A 1FJ2A 1E94E 3K09C 4E7PA 2RGXA 1UJ5A 5IWCA 3TD2A 1J8QA 4WGFA 3R6LA 3Q15C 3DMGA 2IEYA 4UHBA 3VTKA 5IX8A 2AI2A 4ND5A 3INNA 3TNJA 4Q3EA 1IDN1 1S02A 3AKEA 3H8WA 2ZB4A 3CW8X 3FLAA 4UDYX 5IBPA 2RIRA 3H1BA 1O9GA 1FU8A 2Q9UA 1F4LA 3GZ4A 3K0KA 3PFWO 4NECA 3RC3A 5K6TA 2PE5A 1W36C 4EUHA 3D7NA 1SXIA 2O2YA 3ZD9A 1JX6A 1FTWA 5AFSA 4HSGA 3U60B 2V7QD 3NKLA 4Y6OA 5ETJA 2AC7A 1EAYA 3FFAA 4TZKA 1EM8B 5IJ0A 3EGDB 3H0EA 1SKUA 5MN6A 4EHLA 5L7YA 1CXZA 3HO6A 4LBWA 3NBUA 1D07A 2Y1OA 1M8PA 3QOWA 2YASA 2QM7A 1JPNA 3EDOA 1HF3A 6AT1A 1KETA 1Y0BA 2FFQA 3I9OA 3AIMA 2WE8A 4KQKA 3P27A 4P82A 4V02A 5AUPB 1OCEA 2BGNA 4B6JA 4MVJM 1OWOA 2A9OA 2YWDA 3M34A 3SGLA 4IILA 4HZGA 3LT5A 1FEZA 4HDKA 4BNYA 1KOGA 1E9VA 4RNCA 3MUEA 3PPWA 4FWTA 3PPVA 1PFWA 1J1ZA 3U7JA 4IKEA 4I36A 4PTZA 4N39A 1A0OA 5LJIA 4R7ZA 4CLOB 1CIJA 4R68A 2P9CA 1IEQA 1TA9A 1DMRA 2EIHA 2ACWA 3AI2A 3THWA 5H8WA 1TTTA 1ZSYA 3V00A 5I7SA 1UMCB 2C2HA 2FOIA 1Q21A 1L4GA 1S89A 5SYAA 2QV7A 3L8GA 4I9FA 4NC9A 2CXNA 4NBWA 3M8KA 4NBLA 3E9DA 1RZRA 1KAQA 4P4NA 3FWPA 1TD9A 3LC0A 3CRNA 4KR7A 2HK6A 3CO5A 3C7TA 1UK9A 4UATA 3EPKA 3NKVA 1DFHA 5E4YA 2AD1A 1T2UA 3SAJA 2R7MA 1DCTA 4DCCA 5KWIA 5ESXA 4DLWA 4BHTA 1JR3D 3E1KA 3QU7A 4FMBB 4L8VA 3CZMA 3VPXA 2A33A 4WBNF 4N7JA 3DVAA 3U19A 4GP7A 3WK6A 4EGQA 4EYEA 3IPAA 1E0KA 5KQGA 3WYGA 2QUJA 2OLKA 4CM9A 5CFLA 4GWKA 3MCAA 4JBNA 2YWRA 3P71T 4WESA 1SQ0A 3PE6A 1Z2EA 4C0LA 4HB4A 5BW8A 5CA0B 2O2DA 4R31A 4R8RA 4IDAA 2AEJA 4G0NA 2I1LA 3FKSD 5E4JA 1N77A 2WFZA 1W0KD 4RF4A 3Q87B 4MV9A 5GWXA 5BWNA 3O4HA 5B1IA 5FTWA 3LYUA 2AV6A 2QN3A 2CDCA 3TXYA 2IL1A 4Y6SA 4ZVMA 5BN1A 3U4DA 4ZCRA 3BB4A 3IDQA 1Q0HA 2J09A 5IDQA 4DLUA 4LK2A 5FHRA 4CCWA 1YO6A 3LDUA 2JCBA 1LC0A 4LECA 2P7IA 1YCGA 3K0BA 3IKLA 4D8WA 3HSKA 2IYRA 4DJFC 1THGA 3FTNA 1I80A 4K7JA 3I9LA 3LBYA 2RGRA 2EFEB 3Q8MA 3DO6A 3GCZA 1V8FA 1H2HA 5IMBA 1GG9A 1RKQA 2NZ2A 3OZDA 5ITVA 1OUMA 2YHBA 2ATVA 2J31A 3JPWA 4IUYA 3ZY5A 1YQEA 3LP6A 4PWZA 2JGNA 3H5OA 1W47A 4TYPA 3RYHB 5CCBA 1E9DA 3SKXA 1G7SA 5A71A 1YQXA 3CB4A 3I34X 2Y2UA 3IDAA 1E3WB 2F3TA 3MRTA 5L3VA 2OESA 4MQ6A 5ALZA 2OHFA 3O1HB 1UZAA 4ENVA 3RAGA 3U7IA 3WICA 2WABA 1UF9A 3X1DA 1YONA 3KDPA 4MR8B 5JPCA 4DR1B 4QYIA 2J6HA 2NO4A 3IIIA 2E3JA 3IB6A 2BCEA 2RI6A 5JFOA 4HFRA 5CIQA 5KNCD 4HP8A 5CXQA 3HCPA 4TVSA 1KBZA 4TTQA 4GPEA 3NASA 3F97A 4R1OA 4A0RA 3PQ7A 4DLTA 4FKZA 1SD5A 5EJ7A 2HF7A 2OHHA 3RBXA 3QY9A 1XVIA 5CYOA 2ECPA 1J0DA 2O3SA 4R9VA 3RK0A 3DBVO 3Q11A 5F2NA 2FK7A 2JGRA 3MQFA 2A0UA 3WNBA 3OT4A 2JGAA 3TL6A 3PJGA 5EMMA 3TCKA 3U3DA 1FBNA 2Q2WA 2AFIA 3RB8A 4MPPA 4OO3A 4PM4A 3VPSA 2WM3A 3GLSA 3ZCVA 1L4FA 4HJXA 2ZSJA 2UXBB 1SM4A 4WXEA 4HPJB 4EGCB 1ISIA 4LZWA 4M1ZA 4XQ0A 5JSKA 4BIIA 5EQDA 4O08A 3NANA 2HNBA 1PF7E 4B3DA 4J8PA 1SG0A 1UM9A 1OTYA 3OM0A 5B30A 5FOSA 2I7CA 2HCTA 4FI3F 1XTKA 3P0IA 4Z2YA 2NUTA 4ANFA 5A7HA 2JFPA 4AJPA 2J4DA 2VNHA 1ZLXA 4CI9A 3PIIA 2H06A 4JGGA 2NXNA 1O7JA 1QLWA 3FPJA 5KSPA 3K35A 3Q7RA 4CQMB 3KKNA 2CVZA 1IC6A 2E89A 1H85A 1DIGA 4OEHA 4Q9NA 4EHJA 1NQVA 5JPDA 3Q7EA 2J3EA 4BNNA 4Z4FA 1T8YA 1U31A 4YX9A 4NQZA 3BUSA 3CLTD 2CCJA 1BCSA 3R5FA 4GGPA 4HLDA 1Z16A 3ASYA 3PUJA 4HGOA 4DNXA 1MW8X 2HO5A 3JTEA 3RQSA 4CKZA 1X19A 3L7AA 1N25A 4V3BA 3EVTA 1M2FA 3O95A 2JFOA 2VO1A 3LT0A 3ORSA 4NYIR 3W5UA 1ECPA 4D46A 5DT9A 2WQ7A 3BXFA 2YHAA 3I73A 1Y9EA 2QT0A 2X86A 2YJZA 2ZS9A 2JVKA 2I2CA 2WWRA 4URFA 1AIPA 5E4FA 3ETEA 2Z5GA 1SKBA 1KAGA 4YT8A 5C8DA 1TK3A 3V1TC 1D4OA 5JZSA 1DC7A 2D2FA 1NW6A 2NUPA 4TMVA 4GAEA 4RYLA 1Z0ZA 2W37A 1PD1A 1OU0A 4DWWA 1JW9B 3WS7A 2IIVA 3V8RA 4OFBA 2ECFA 1HL3A 1B2RA 3OP1A 4AAYA 2GPBA 1KEEB 2B1IA 5CVJA 3MT8A 1ITZA 1VKOA 2PJDA 5L7WA 4OLAA 4WADA 4O1MA 4BEJA 4EA8A 2HUPA 4M1OA 3CJTA 3IT3A 2A86A 3D8NA 1E99A 3VKVA 3WJ7A 1A9XA 4OL0A 2F8MA 4X60A 2E4XA 3T5CA 3EX7C 1ZM2A 1GUFA 2F1RA 2QORA 4O4HB 2PKCA 3T3PB 1RJ9A 3R75A 2Y1LA 4YRTA 1O3YA 1FVOA 4EGJA 3RASA 3CVXA 1GJRA 4PFSA 5CT5A 1L7VC 4C4XA 721PA 1T4GA 1LDYA 4LWZA 2HA5A 1M7BA 3T9FA 2QX6A 5FPSA 1QAQA 3ECCA 1LF0A 2O8VA 1FFEA 4KXNA 4Q4LA 3C3DA 3U5ZB 4MAMA 2TRSB 1PSWA 1OLXB 3QHQA 1ZL2A 4EZBA 3A1TA 3I09A 4WCFA 2DKNA 4QM7A 3O93A 3VYSB 1U0BB 1G6KA 1S8OA 3JZDA 4JL5A 4OMFG 4CL3A 1KWGA 4NMXB 1E3LA 3TW0A 4KPUB 3IS3A 2DYKA 1GP2A 3P9XA 1PJAA 3JARB 1DP4A 3EOBI 3FUWA 4FN5A 5F5XA 1KDVA 5B58T 2OQ2A 2OPHA 4ZVUA 4TRNA 1HT1E 1Q5PA 1X2EA 3RSFA 4AJJA 3IKVA 4R1SA 1EM8A 1PQUA 5IJ0B 1NUHA 4AJ4A 4PXAA 1R8XA 1NVEA 1GZUA 1O77A 1U2SA 1SGWA 2O2ZA 2PMCA 3CXRA 3E8XA 3FWHA 5FEMA 2FH5B 3DLAA 2OFOA 3UB3A 4XJXA 3BAFA 3W2HA 3T9CA 4B4WA 5IU6A 1JPJA 4EJ0A 5KYYA 2OGSA 3I04M 1VHLA 3WDKA 1ZK0A 2VWPA 2WWGA 1J1UA 1VE1A 5GPBA 1LSSA 4D44A 1VL5A 5HGJA 5IJXA 4Q7KA 5T3YA 4BUJA 5BUSA 2IHJA 1T9GS 2P3OA 2PY6A 5CA0F 2GZDA 4BX8A 3OM1A 5JS7A 5AD1A 1BKYA 4I2VA 1G5IA 4B34A 2VWQA 4DDMA 1IXSB 1SRRA 1GPYA 1AA6A 2AR9A 4V0KA 4AN0A 5JJKA 4N6OA 4K9QA 5CXUA 4LXIA 1FYXA 3GFFA 3VV3A 1B0PA 3WNQA 2VTBA 1OZGA 3ZDEA 4AYXA 4LJ6A 2R1TB 3CX4A 5I9SA 4YR7A 2W22A 3QPCA 3JRNA 4ZQIA 3W8FA 2FP4A 4LCJA 1L5HA 3A4LA 5B7NA 3FB1A 4KUHA 3NS7A 3VTFA 1JEQA 3DZFA 1UZMA 3A3KA 5TGTA 1ONBA 2CUZA 2QL5A 5LA6A 4BRUA 4XR9A 4DTCA 4NHEA 4RD0A 3U7QA 2H1LA 3FRJA 5C5IA 2YIJA 5ENDA 4UEKA 3C2QA 4EITA 2AUTA 3G9XA 3GEIA 2ZSHA 3DHWC 5JRZA 3WWZA 3ZS9A 1U9YA 1VMIA 4MICA 2Q3DA 3U1BA 3E8MA 4D3DA 1OIVA 4QYXA 4TTAA 1F06A 1FFWA 3UJ6A 1TC2A 4V0LA 3BSFA 3CEJA 3OJ0A 3VDQA 3H9JA 1E2QA 4B33A 1V25A 4FDAA 4HMPA 1L3BA 2C4NA 5EVCA 3TAUA 4RCVA 3MWEB 3ZY6A 4IH4A 3V48A 3CKLA 2O2JA 1CQWA 1KQGA 4ZC1A 1GTG1 1QF7A 1E2LA 1QTRA 2Q2NA 4C4OA 3DXFA 3DBIA 4BATA 3M6FA 1Z35A 3T3IA 2CXPA 3HSYA 3I9MA 1SG9A 3F96A 2FQXA 1ZU5A 2CJXA 1LA2A 1ND5A 1SXJC 3FW1A 3AVUA 2HSJA 4DADA 2VPXA 4RM3A