3A3NA

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the two c-terminal residues
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
319
structure length
319
Chain Sequence
TQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 113
structure length 319
sequence length 319
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3a3nA00
4ZARA 3DVRX 1C9JA 5CW1A 2WUVA 2PYZA 1GA1A 3CNQS 5ARCA 3OSZA 3LPDA 1P7WA 3GCWA 3Q5GA 3DE1X 2V8BA 2ID8A 2SECE 4CFYA 3F7OA 1OYOA 1V6CA 3TI7A 1YJAA 2SNIE 3ZXXA 1DBIA 3EE6A 2ZWPA 3GT3A 4CG0A 3GCXA 1Y9ZA 3VV2A 3DW1X 3A3NA 2W2MA 4M1ZA 5SICE 2DQKA 4LVOA 1ZVKA 1WSDA 1AV7A 3F49S 3TI9A 1R0RE 1BH6A 1TM4E 3DE7X 1GTL1 1KDZA 2X8JA 3BX1A 2TECE 1SIBE 4I0WB 1C9MA 3EIFA 1TO1E 1SH7A 1SELA 3F7MA 1C3LA 2WV7A 3DW3X 2XTJA 1VSBA 3I37X 1T1IA 2E1PA 2IY9A 1KDYA 1SBCA 1SUDA 1AK9A 4WOBA 1GNSA 3WQBA 3TECE 3LXUX 3ZXYA 2G4VA 3I34X 3P5BA 1GT91 1S01A 3T41A 3H42B 1TMGE 1Y3CE 3DE4X 1P7VA 1Y4AE 1BJRE 1SIUA 1EA7A 5AVKA 4NE9A 5JXJA 3VHQA 2HD4A 4OMDA 1CNMA 5AQEA 1WMEA 3UNXA 5JXIA 2PKCA 1LW6E 1GA6A 2W2PA 2DUJA 4MZDA 1SPBS 2Z2ZA 3PRKE 5B1EA 4H6WA 3SICE 2QTWB 1SCNE 5ARBA 1CSEE 2PWBA 4NMXB 1SUEA 4YN3A 3DWEX 1OYVA 5ARDA 3EDYA 2X8JB 1KDVA 3BGOS 4HX2A 2Z2XA 2Z2YA 2Z57A 4CFZA 1Y33E 2W2OA 3L1KA 2PMWB 1UBNA 4DZTA 2Z58A 3BPSA 1KE2A 4BWGA 2W2QA 5K7SA 1TK2A 1SCBA 4Z2AA 1DUIA 1JEAA 2P4EA 1ST3A 4C3VA 1SCAA 3WHIA 4KG7A 4K8RB 2SBTA 1SBHA 3I30X 1YU6A 5JXGA 3VTAA 3WIUA 4HVLA 1SN7A 1WMDA 5I9SA 1Y3DE 1SUCA 1IAVA 1YJBA 1AH2A 5B1DA 4FONA 4RYDA 1SIOA 5AMXA 5FBZA 2Z56A 3PTLA 2ID4A 1SVNA 1R6VA 5JXHA 1Q5PA 3HJRA 1C9NA 4KPGA 1WVMA 3DYBA 1SCJA 1PFGA 2PWAA 3CO0S 1IC6A 4B5LA 2GKOA 5FAXA 1AQNA 3QFHA 1XF1A 3QMPA 1PEKE 3LPAA 3DVQX 1R64A 1TM3E 3VYVA 3D9QX 2SICE 1EGQA 2PRKA 1BE6A 4AKSA 2HPZA 4C3UA 1TECE 1ZVJA 4KB5A 1SUPA 1MEEA 2PQ2A 4H6VA 1PTKA 1GA4A 1TM5E 3A3OA 1SUBA 1S2NA 1PJ8A 4H6XA 3LPCA 1Y3FE 3AFGA 2ZWOA 3VSBA 1NDUA 2ZRQA 1A2QA 1TM1E 3DE3X 1SBTA 3Q40A 3D43A 1T1EA 3DVSX 1KE1A 1V5IA 1BFKA 4J94A 3QTLA 1GNVA 3DDZX 4DJ5X 1AF4A 4OMCA 1Y1KE 1P8JA 3SQOA 2WWTA 5FFNA 1S02A 4NE7A 5AVJA 5JMOA 1T1GA 1Y48E 3DE5X 1NLUA 1SUAA 4WOCA 1GCIA 1SBIA 1Y4DE 3AJ8A 3A3PA 2Z30A 3DE0X 4ZOQI 3VV3A 1TM7E 1TO2E 3AJ9A 3GT4A 4JP8A 1GTJ1 1THMA 1BFUA 4GI3A 1SCDA 4OV6B 1HT3A 4AKTA 1GTG1 3I2YX 4DWWA 2IXTA 1Y3BE 1ST2A 2DP4E 2WUWE 2W2NA 1AU9A 3DE2X 2B6NA 3WIVA 1AVTA 2ST1A 1WMFA 1BE8A 1SBNE 2XRMA 1NDQA 1Y34E 1OT5A 4LVNA 1MPTA 1YJCA 3DE6X
chains in the Genus database with same CATH superfamily
3CNNA 3JD3A 2X2PA 1FRNA 2XWPA 4Y98A 3TIIA 4BFLA 3R5SA 4BVAA 2CFSA 1HG0A 2B36A 5JIBA 1JHAA 4B3BA 2RMKA 3H05A 5J40A 3RKRA 1K8ZB 3NIGB 5THQA 3W04A 4FFMA 5BR7A 4DMMA 1AO0A 5FBHA 3IAAA 2O4CA 3SJZA 2V5VA 4EAAA 3Q0IA 5LXTA 4DCVA 1UPCA 4TS4A 4DFDA 1RLIA 1JHYA 1ZIPA 4KPUB 1WETA 2PHZA 5DTJA 2R2AA 2NP6A 3OX3A 1KI3A 3H4IA 2X5OA 5D3ZA 1P2BA 1K88A 1KZ6A 2YICA 1ULUA 4ZALA 4NC9A 3ZR4B 3M9XA 1CG6A 2NPOA 2FH5B 1J33A 1FPMA 1RI3A 2J6BA 1A9PA 2JFXA 3P9KA 4HGRA 3UJCA 3Q2IA 3ZJ4A 3HBLA 1IATA 1D7AA 4S1OA 3TZEA 1BWPA 2I6GA 2Z9CA 4B0OA 2ES4A 4WZBA 3W5IA 1YZKA 4Q16A 4ZVRA 3UC5A 2J33A 4BO6A 2PDAA 1EAYA 5K51A 3NWOA 2BSXA 3PEUA 3BSWA 1ZG3A 3K7EA 1Z0IA 4M8LA 4UMFA 5DEOA 1G59A 3NUQA 4PSVA 1F0KA 5BMVB 2GZ1A 3PFCA 2C7QA 3ACBA 1QV7A 1ORDA 4MRNA 5ERYA 1T5IA 4MA0A 1P7ZA 4GM0A 4UVDA 3DMFA 4S12A 3T0GA 2INGX 5EN4A 1V5FA 3OBIA 4NZPA 4ZCMA 3VV2A 1P72A 4AMGA 2X8AA 2V6IA 1XXHE 3PUVA 2NG1A 1ZRNA 3OSUA 2AG1A 3A3NA 3MQ4A 3O21A 4GECA 4EM6A 3EPHA 2W2MA 4X1KB 1G7SA 3R7AA 2NYAA 4OHVA 1M33A 4JR1A 2G82A 5JMOA 4FMDB 2QORA 3A6JA 4BFCA 2I1WA 4HT3B 2X9QA 3CLSD 1R0YA 4N6NA 1L5HB 3HDVA 4M38A 3E15A 4R1QA 2Q7OE 2DQZA 2JGLA 2OO7A 4U2GA 3ZX4A 4CQLA 1J70A 1WF6A 2GCIA 3CA8A 3CRQA 1Z0JA 3CPEA 2R8PA 3V8RA 3ZJVA 4H17A 1YR1A 4K6FA 1KDZA 4XOUA 4F11A 3UMYA 5HE9A 4IDCA 1EHYA 2QSUA 1WUYA 3ECAA 2Y0EA 3TWOA 2WT9A 3GWZA 4ZN6A 2ZS9A 5CA0A 3QUTA 2NZXA 3VKHA 5COQA 2HCRA 2RDMA 3RU3A 1CIVA 2Q4DA 4PYIA 1ECFA 3TX2A 1QE0A 1SEPA 4W5TA 1ESDA 1PW5A 2AQIA 4HWOA 4PIVA 1HT1E 3C16C 2PJUA 2YYYA 5HCUA 5K1ZA 1UKCA 2QAGC 1GYRA 4BV8A 1S2IA 5JHHB 3HN7A 4J2OA 1UR5A 1Z7YA 5LA6F 1XYVA 1DBWA 3W1EA 2O59A 4QPPA 5ALFA 4AY3A 1JSCA 1XU4A 1CF4A 1YDWA 2PZJA 1Z74A 1P61B 3B1WA 2B61A 3D7LA 4TUYF 4WW0A 3WLEA 1W36C 4HQNA 1K4KA 4YRIA 5EP1A 4DN6A 3DOFA 4HQOA 2ZU0C 1C41A 3NHFA 1C4KA 4UNQA 1OKKA 3HJCA 4ZQIA 2ZBPA 1GHTA 1T1IA 2QLNA 5IEJA 4S24A 2Q3FA 3KYBA 5F7JA 2B4YA 2N75A 2UYQA 1ZMRA 5UKDA 1O4WA 2O4UX 3G6WA 2Z5VA 2BSAA 4UHFA 2CVOA 1ZD2P 3R9KA 2VQ6A 3VR5H 2R6HA 2NO1A 1JJVA 1JDTA 1Z39A 2FWPA 2QRHA 4F97A 5IC6A 1ZOIA 1I32A 2GBCA 3T41A 5JNVA 3BK1A 3AJAA 1J00A 5C7OO 1KPGA 1RRFA 2IXAA 4ERXA 3ZW7A 3NBAA 5IAKA 4KXFB 5TT0A 3DE4X 1N2CA 4YWJA 5AVZA 3QWAA 1H4TA 2NNWB 2G9QA 3MSCA 3QVWA 2IW1A 1SUIA 2GEDA 4MRRA 4EHLA 1AMNA 1YOVA 3GPLA 1T6YA 4ZHSA 1E0AA 4FN5A 4R5MA 2ZXEA 2HIGA 3BCRA 3I58A 5LP6C 4E30A 1MIOB 2PZAA 4PQFA 1K4MA 4B2IA 5JDIC 1RXVA 1T24A 1Q84A 4F56A 5BN1A 3H8WA 3TSYA 4OI4A 1WUHS 4QARA 3DOIA 4JSRA 1DC7A 2E6KA 1R10A 2IOFK 3T3OA 4N8SA 5KX5A 4MUBA 5LSAA 2KB0A 2MYTA 2OVBA 4W5HA 4HJXA 1QK3A 3IPRA 1JJIA 1K63A 1YDGA 3KEMA 4B47A 4BKPA 4D8UA 1AMOA 2YC2C 2BZGA 2P27A 3G1WA 4ZA2A 2VDUE 3JXEA 4N3GA 4ZQBA 3I0MA 2AOUB 2IEIA 5CB4F 5AI6A 5EP4A 2CNBA 3WSVA 5ERXA 3B5JA 1KJWA 1L5SA 2DUJA 2EWMA 3UXMA 1AF7A 5AI0A 3JVEA 2V7WA 1T9KA 4E1BA 1PFUA 1WQ1R 1Y42X 1Z47A 3BKXA 1WCWA 4FI3F 2P40A 3DHWC 3TLCA 2I6TA 3BYZA 3OJEA 2QI9C 3WBKA 2YNMD 1KQNA 2IUYA 4LN1A 4AXXA 4INAA 4HC4A 1XMSA 1OC2A 3RFUA 1DOAA 1VHJA 3R9XA 1EPUA 1K1EA 1U3UA 1XVAA 3G5AA 1FSZA 4IXTA 4ZVMA 4CM7A 4XAQA 1JHXA 1A98A 5JPDA 2R1TB 4OYYA 3WZ2A 1VKHA 2UXDB 1AA6A 1T91A 9ABPA 1COZA 4FB4A 4FNAA 3ENKA 1P4GA 3ZZMA 4I1IA 4RD2A 2QL9A 5DYTA 2NPIA 1IONA 2QJFA 3VVCA 1QQAA 4GUDA 2A0UA 5DNUA 4YV7A 1P1FA 2JAOA 3FTCA 4MKRA 2QBYB 2YXPX 4BLTA 3VMMA 2IS6A 2YUIA 1QB7A 2YWFA 1KSHA 2VK2A 3AVYA 4EHKA 3ZLTA 4YRGA 3FYDA 4NYMQ 3IO3A 5CEFA 1I7DA 1EB9A 3L4SO 2IPOA 3QIVA 2D7DA 4G9GA 4JS0A 1TEXA 4CBVA 2Q2NA 2V7BA 1U9CA 4OIMA 1VI5A 3U9SA 4Y2VA 3NOVA 4ARVA 4CR6A 5JBIA 2QF7A 2ZPTX 1XELA 2WTAA 1LPSA 3CPHA 1BE0A 3UXHA 2W2QA 5ALDA 5ESWA 1SCUB 1UKVY 3TN7A 4EUSA 4MROA 2XNCA 2WT4A 3UICA 3JD4A 1KS9A 1A4UA 3HY4A 3N2GA 1L4MA 4QPDA 3BMOA 4KE7A 1Y9AA 4ZTZB 1OLXA 4MDYA 1QH0A 2YMLA 2HJGA 2V7VA 4Q1FA 5ECWA 4BGEA 2GD6A 2HU7A 5SY4A 4C3VA 4O4IF 3P1JA 2A14A 2R8YA 1P45A 5GONA 4DE5A 4DPKA 3AVVA 4DDKA 1P2VA 3VSDA 2Y68A 4TN5A 5HIAA 2ODQA 1UXKA 2YWHA 1JJBA 2C9YA 5BVHA 3JZFA 4TYPA 5ESRA 3DBHB 3LBNA 4BEBA 4ENTA 3E22A 3CBGA 6REQA 2REQB 3A8TA 4ZI7A 4CDMA 4BX3A 3NM4A 5JR3A 5BUSA 2JKYA 1PYGA 3ESZA 4TMYA 2GETA 4FE7A 2H51A 4U9HS 3DAPA 1DAEA 3PP8A 3QXGA 2YV2A 2OFOA 3RTCA 1ZGJA 4MWBA 1J07A 1DJOA 4KVGA 2JAQA 3SVZA 4AJ4A 4F86A 1TQHA 4F5YA 2JZCA 3OJ0A 3ZE0B 1XN1A 5C1DA 4FJ0A 3BRSA 2VLBA 1DOZA 3K31A 3DOHA 5EZQA 1SVLA 2MSEB 4AP6A 1IAVA 3GF4A 5JY1A 5KCZA 2G83A 1CQXA 2PRYA 1BMDA 2OUKA 3LT2A 3ZHTA 4O29A 1NQAO 2A0WA 3GVPA 3UHAA 3OPNA 1FMLA 2CHEA 3TD6A 3UV3A 4E6PA 3D6VA 2J7PA 3BTUA 3PCRB 3CUWA 2PWZA 3IFSA 2EL9A 3O0TA 4HRAA 4M88A 5CDHA 5FT9A 3IP3A 2AN4A 4EB6A 1SIOA 4EG7A 4NBTA 3G13A 1LDYA 3S1LA 2NO9A 2XWQA 5FBZA 4N41A 4DMUB 5EHGA 1S8FA 5EJGA 2NN3C 3O26A 1XJ0A 4X8LA 4CM5A 2QX6A 5B55A 1IHDA 4KR9A 3QNMA 3K5IA 1BDMA 1B0ZA 2G6BA 4O1HA 2A1TS 5B1IA 1W73A 4DV7B 1U2PA 5KNLA 2YJZA 5COBA 2ZRDA 5KNCA 4Y2PA 1ADBA 2WB2A 1PIWA 3TX6A 3E35A 1E2BA 2JHGA 1V41E 2X4DA 4DB2A 2XUKA 4PLPA 4UVGA 2C94A 2GKGA 1OTYA 3DB2A 3DYBA 1RP1A 1Z68A 4IGKA 2C5GA 4LV8B 1PFGA 3ND7A 4MVJI 1C7RA 3KL2A 1G2PA 4REOA 1EDDA 1L7MA 1C0LA 1G7TA 4XLLA 1RVV1 2EAUA 3HA3A 2H5IA 3IEKA 3WY9A 1H9AA 1U7TA 3OY7A 4B5LA 2XIJA 3HXPA 4RM3A 2LCFA 4OG2A 4TQUS 1O95D 1NJ1A 3QXCA 1ZHOA 5EERA 5LVAA 3GFRA 2Y4OA 4C22A 4BN5A 3DCNA 2GN0A 4UQPA 2IT1A 1CRQA 3F5FA 3PDIA 2EV9A 2QRLA 4XLZA 1OTXA 1K6EA 4PN3A 1K06A 4YRCA 5CX1A 5ISMA 1AS0A 2AWNA 3OT5A 4C0QC 4KV9A 1LBIA 1SQSA 2HAEA 4N6GA 2FPGA 1PR2A 2ZYIA 2VK8A 2A7QA 3LMKA 2Q8PA 4IDNA 4KO8A 2FYTA 4UPDA 3AX6A 4QYIB 5FPHA 1IL0A 2J46A 1W2GA 4EKDA 1LRLA 2AUMA 3ASUA 5KYVA 1TJPB 1VGRA 2WF7A 4NU8X 3ZIUA 3FVQA 2UXCB 4NVRA 1RAGA 1WUTA 1JB9A 3CX6A 5FPTA 2PUVA 2ZK7A 3MM4A 3FM9A 2IE0A 5K4GA 2V7QD 4LS3A 3K9QO 1X77A 4LF8B 1BIFA 2AVNA 3URKA 3KPUA 4JI4B 1DJMA 3RBVA 2CHGA 4AZTA 4MX8A 4IGEA 3QYJA 2WMNB 3BD9A 4JOSA 1ILEA 3KQWA 4TX1A 3SAJA 3AM4A 5AW2A 4EB8A 4ARIA 2C8JA 3B7PA 2RBGA 5A03A 4GXQA 1YE5A 2RCNA 3A1UA 2AMJA 1SZPA 2IIQA 1WUIS 4LDAA 4PYRA 5HS4A 4WINA 1CF2O 2QX7A 3W3ZB 5KVVA 4BNLA 2O1XA 3CUUA 1PJ8A 4IIJA 1X19A 1RJ9A 3AERA 2YQ4A 3REFA 3OE5A 1A7KA 2FZGA 1JDSA 2FN3A 3BG5A 2QTBA 4IVQA 3JQFC 3HBNA 3T5AA 3JYLA 2R65A 4DKJA 1G7RA 2Q2WA 3AB3A 3F90A 4RVUA 3O0DA 4AU1A 1E77A 5BWBA 1SVUA 4Q82A 2NU9B 4XJSA 3K32A 1R6UA 3A0UA 2P1DA 2Q99A 3F1LA 3IESA 2P2LA 1SUSA 2PZEA 4X3CA 5K3CA 4ZDKA 4D0GA 4LFCB 3W78A 5T4FA 1FDUA 1MMFB 3QTTA 5HRCA 4H0FA 1MAUA 1GRRA 4H3HB 3H6HA 4MR7A 3WB2A 1TT5A 4XQ9A 1G7CA 4BUCA 2E9SA 2DR2A 3GRRA 4KTVE 2L42A 2WSSA 1D2MA 2FPMA 1G55A 2PH3A 2H16A 3P2YA 3QSGA 4Z3OA 2IS2A 5FO1A 1T4CA 3AWDA 3U62A 2PUFA 2C07A 2FUKA 1L9XA 3PC8A 3TPFA 4YUWA 3H11B 2DHEA 5JT1A 2LP4Y 3FDZB 3QKRB 2AI1A 4ZAZA 4A8HA 1JEYB 1DWOA 5KNBD 3RDPA 1NASA 3JR7A 3GMIA 4BLQA 5LA6B 2OLKA 3KD2A 4PGAA 4Q05A 1BHJA 5C8ZA 4W5NA 3MGKA 3H8SA 1U9JA 2JI4A 3KV3O 1DKLA 4HYEA 2XB6A 3BXHA 4TUYB 3ZWOA 5BNZA 4KPFC 3DNPA 2HZBA 3MTBA 3CU5A 4EUKA 4XB1A 4HUQB 2OOKA 2FETA 2WM2A 1NVMB 4QXMA 4KV7A 3VV3A 3R0QA 3IAEA 1TYAE 5DKFA 2GTIA 3GT4A 2GPWA 3WK4A 5K2OA 2ZDGA 3DMTC 3H2IA 4IHJA 1XB2A 4DQVA 1MOSA 1GPKA 1Q17A 2OHVA 2A0KA 4LISA 3REOA 4ASUD 1PZHA 1SIWA 1IZYA 4FFPA 2CJWA 3W5BA 3VSAA 1PQWA 1SCDA 3U4QA 3QOFA 4OV6B 5BVGB 2O3QA 1HT3A 4AKTA 4FGJA 4EVSA 1ONNA 1OU4A 4P81A 3O1HB 3PHLA 4HY3A 3NDIA 4DRXA 3AXSA 4LJ9A 1H4SA 2A30A 1FU7A 1I4WA 3D2BA 3PRHA 4J7XA 5KC8A 1PVOA 1OQAA 3O4IA 9GPBA 3V6LA 4R8SA 3WADA 5KMGA 2B6NA 4O2RA 2ST1A 3FSJX 1WW2A 4RETA 1EG7A 2ZIUB 2BV3A 2AR7A 3A9CA 3ESBA 3E3AA 3VX4A 1MOPA 1XZPA 1NDQA 1MDBA 1Q0SA 2JCGA 2Q5OA 3IHKA 3Q2OA 3QFSA 4PFKA 2VKTA 3R7WB 3SU8A 2I34A 3WSWA 2RI0A 2GVDC 1K75A 3LUDA 1LV8A 5HTKA 5BSWA 4LVNA 4RDXA 1TZJA 4XIYA 1JV2B 1PD1A 4YGYA 1UMBA 3CN9A 1CIJA 5CB4B 3FJ1A 4NJEA 4BP1A 1GG2A 1I3LA 2PYZA 2DUUA 1U1DA 3FHLA 1Z6GA 2BBOA 3QWFA 2GPBA 2OB1A 2EIXA 4EEXA 4RIIA 2QT0A 2O8NA 1MC5A 4IDEA 4CR8A 3DKVA 3UV7A 1DRJA 1NV9A 5AHOA 4CTOA 2FEWB 4Q9JA 5B6JA 3HDJA 2XXBA 4GOOD 1KORA 4GRIA 3GN2A 3NTOA 1IY8A 4QHTA 4UUNA 1Y8QA 4BCCA 4I5GA 3R8XA 3VC3A 1T34A 1KAMA 1RC0A 1JR3A 4PCAA 2VHQA 3R40A 4PIPA 5F1YA 1JHZA 4RD3A 2IPNA 2P6OA 1E1NA 2RAVA 1TUEA 5KYGA 3LC1O 2G0TA 2AC4A 4PLTA 5EIEA 1YB4A 5FR2A 4D9BA 2XYVA 2JCVA 3EPRA 3QTBA 5B3AA 2OAGA 4E2FA 2EF0A 1F8GA 3GDGA 3PQEA 3EF3A 3P0IA 2IYTA 4MTLA 2DUMA 2H2HA 4ZYWA 4NZ9A 2OFFA 3H4VA 3C14C 3L4EA 3L4JA 5DK6A 4CCYB 6CHYA 1V3TA 4WXRA 1L5ZA 2ZLBA 5JS7A 4NNOA 1V6CA 1X7WB 3D7RA 2HMAA 5I4KA 3T7KA 1C1DA 1A71A 4KGDA 5L3QB 3EFBA 2WDPA 5JSYA 1VKOA 4MW9A 4CCAA 1O6ZA 2X0IA 2QNIA 3DO5A 1QIIA 1IY2A 3GO4A 3KO8A 4L74A 3URMA 4ND6A 3X1ZA 3SYNA 5LPNA 3OQOA 1NIJA 1X1QA 2ZITA 3PEEA 1KJIA 3DT6A 5K3OA 1FYDA 1GZ4A 2VDPB 2RHTA 4DM3A 4CG1A 4C9BA 2XXAA 3QVLA 4F6RA 4DRYA 4HGOA 5T4HA 3CLHA 1NPYA 4BLWA 2WWXA 1B73A 5BXYA 4X45A 3WGQA 1DBSA 3NAMA 1JKJA 3SN6A 5JVDA 1AQUA 2RHLA 5HMLA 3ZDCA 4WA7A 4A5SA 4O4IB 1O6BA 2GA9A 2ACKA 2ZPUA 3PQ6A 4M1ZA 4BP3A 4DCGA 4G09A 5FPKA 5I9LA 1IJKA 4IMJB 4F2GA 2PFSA 2V7XA 3LHKA 3ROMA 1MRSA 1N6LA 1OXTA 1SK8A 1EB8A 4GHWA 2XRYA 3MLEA 3WHLA 3MF4A 3MWFA 4D44A 5ITWA 3A6PC 4ZO6A 1QOQB 1ZNZA 2F43A 4TS1A 3IAUA 1BMFD 3FNIA 8ADHA 1GTL1 1US8B 2IELA 4MV0A 4A8PA 1N5DA 1XBTA 4JUCA 3IALA 4WNYA 3FZQA 4KQWA 1FP4A 5AHKA 4YBRA 1HK7A 4Y1GA 5EJ8A 5JNTA 5JYEA 3SJ7A 2ZRPA 3IKTA 2J9FB 5G0WA 3MWEB 4MUHA 1JN0A 3OI7A 4DNOA 2X1MA 3O8QB 3SF8A 1PJ3A 2DT5A 1FDSA 3OKFA 4RY8A 1LY1A 3HRKA 4JLUA 1ZGAA 3FGNA 1CW2B 1CZHA 1FX1A 3DL0A 4NEHB 4BVHA 1BGXT 1V2HE 4JJFA 1MG5A 3I52A 3OC0A 3J7AC 4KP7A 4J2TA 1NJFA 1LVHA 1LJUA 2WJ4A 4H60A 5JDCC 2GHQA 4B34A 4PU0A 4E09A 3GARA 3L8EA 4ZMRA 3I0NA 2B0CA 7REQB 2ZPAA 4EYSA 3JAKB 5L53A 1KY5A 3NKLA 1ONPA 2GHTA 1BYIA 5K2MA 3MJRA 4PSDA 4N54A 4HXGA 4J9UE 1A0OA 4URZR 2NOAA 3Q1LA 1DCFA 4RGQA 2AEMA 1WY5A 1QCZA 4GOLD 1J9EA 4CL2A 4Z4GA 5D85A 3BN3A 2J30A 1ENYA 2R85A 2XUOA 3AOEC 4JI8B 1U0NA 2OQ2A 1OT3A 1KYXA 3ED5A 3OCCA 3PUKA 2PRSA 1IWOA 1QO0A 4V0LA 4P58A 3FZEA 5TDHA 4DLZA 4DDVA 4LWZA 5CFMA 1WB4A 3HB0A 3EODA 2RGRA 2NUPA 4PEVA 2JBAA 2ON6A 1ONSA 3GJ5A 3B2NA 1JEQB 4PINA 5BP7A 1A3CA 1O4VA 3COJA 1SRRA 2A5LA 1VMEA 3I2GA 2IIVA 3L6RA 4B73A 1QFMA 1JIUA 1KS2A 3FPGA 5LQKA 5CLHA 4MUJA 5HK8A 3VZPA 9ATCA 2Z4RA 2PS9A 4MWZA 1GP2A 3VR5D 5EHXA 3HTXA 4C5AA 5LXTF 3SIXA 4HEHA 3I01M 3PJFA 3R23A 1EA7A 5D1NA 2IH2A 4L4RA 2DSTA 2Z1NA 2QD5A 2C2MA 2DHRA 3GRUA 4HXYA 1NQUA 3LWDA 1SU6A 2OGSA 4IFBA 2XJ9A 3PGA1 1NI5A 4TM8A 4AP9A 3QQPA 2O8FB 1Q1NA 4MP8A 2IP4A 2FK7A 1MX9A 2EG9A 2HREA 5AQEA 3EVNA 3HDTA 4LC9A 3WB1A 2VP2A 5JC1A 2A9QA 5L7TA 1MBZA 5JXIA 5F9FA 1CUSA 3E23A 2FW0A 1FXWF 2VWHA 2DX7A 3OFND 4FR2A 3UZUA 1JFVA 2VUSA 3SZ3A 3LA8A 4IDFA 4RVCA 1I2DA 3KOZA 2OV3A 4WOKA 1RP7A 5CLQA 2FW9A 2VCYA 4XWGA 5J4HA 2G3YA 4FINA 2G1JA 1R8JA 2AGVA 1H2FA 2W6IA 2X7JA 1SCNE 4NFSA 3ZU4A 3U5ZB 3G9QA 3K20A 3NIBA 2YINC 2GN2A 2PMDA 3MLBA 3OM9A 4ZHQA 1YRBA 1RWKA 3JATB 3R3UA 4EYGA 4XDHA 3EZGA 3AUYA 4E2ZA 4D0SA 2ZXUA 3NWPA 1EBFA 3JZIA 4X00A 3EXEB 1B8PA 3F5QA 3NT2A 4OQQA 4NDZA 1KDVA 3IO5A 5FQNA 1IUNA 3K2EA 4OAQA 3IIEA 4NIMA 4JEHA 4HK4A 2HSEA 2XVAA 4CIYA 3WKCA 1J5EB 3LKZA 3JQ9C 4R0VA 4ZVUA 4U6QA 1R9NA 2D2VA 5FTNA 1TTHA 1NNSA 1EM8A 2VR1A 4B6GA 2BFFA 4EECA 1IBRA 3OHMA 1X9HA 2II6A 1QIHA 5I7FA 3PQFA 2JRLA 3ZYCA 2AOXA 4Z8YA 4QYMA 1XPRA 2IS1A 1WWKA 5DLPA 3VISA 1MX5A 1AG9A 4QELA 2CLOB 1E9VA 1QCYA 2PUHA 3HV2A 4H1WA 2BEUA 2AUTA 3K8QA 3QPDA 3W3AA 2A0XA 2IKQA 3NIWA 3WGGA 3PI6A 1BAPA 2C2BA 3KQMA 3KEOA 3L1HA 3OT1B 4QDZA 4BWGA 5F2EA 1CEQA 2GYYA 1JJAA 2C7BA 2QRKA 3BWXA 3GPCA 5DF1A 5K3FA 3VR3A 5K7SA 3ND9A 5FFMA 2I2DA 1ORIA 2F00A 3A6HA 3THWB 2X5XA 3VC2A 4L4ZA 1FTGA 3CUSA 2HMWA 1B00A 1Q83A 1VMDA 1ETUA 4TQ9A 2I6SA 1PNTA 3SQDA 3S2IA 2CZQA 3I53A 3DMDA 2QAJA 3FB1A 1GR1A 1IFXA 4Z53A 4Q24A 1T6NA 5JALA 5DCUA 4DIBA 5AOBA 1FSFA 1TYEB 3EHEA 5FNZA 3NDPA 1ML4A 1DOHA 2DUWA 4L2IB 4QECA 5JASA 2X2FA 2QDXA 4G5HA 2I4OA 3JVVA 4ZEWA 2XLBA 2XCLA 2XTAA 3HCOA 3TJMA 1OFVA 4DCOA 1EU1A 8AT1A 1JH9A 3FF1A 2NU8A 4J7CA 4FCCA 3QVJA 4E2XA 4FXPA 1MW8X 2B35A 1E5LA 3KAJA 3HH8A 5CT4A 5LLSA 3K0CC 3RANA 4CU5A 1OIVA 1W8IA 5TQ2A 5K01A 2Z2IA 3QELB 2Q5EA 3LFUA 1FP6A 1PR1A 3QJ5A 1SUCA 4L8FA 4R2HA 2QRGA 5MFZA 2VF8A 4WK6A 4G4IA 4LWPA 5HP4A 3AEQB 3E9QA 3I61A 3BRCA 4G8CA 4IO1A 5CG2A 1APBA 4C6SA 1WPQA 3O84A 1Z6AA 2WKPA 1U63A 5H16A 1YUNA 1SBYA 4M0FA 1JE1A 2FXIA 2PBLA 2QROA 4EL0A 5JCXA 4OSPA 3C7AA 3TQOA 4PTLA 1R6BX 3KZOA 1YFLA 2G4CA 1ISGA 1I8TA 2D2EA 2O8EA 5LC1A 1UODA 2PKWA 5DNWA 3ZIAD 4UEJA 4BFVA 5KAPA 1PZMA 2BT4A 1DBRA 3CEAA 2VRBA 4P8RA 3IA2A 3S2GA 2FE1A 5A71A 4P5DA 2FFJA 4D3SA 3QW2A 3UMSA 2WUFA 4MV6A 4NV0A 3RKSA 3A3KA 1DIGA 2GCEA 1HDCA 2XQKA 2QRVA 3L40A 1WVMA 4IHKA 1SPXA 2PUBA 2C00A 2OMEA 2WTMA 1XPUA 3U44A 3JQ8A 1RD4A 4YJ2B 1D1TA 1S5PA 2OHIA 1ZZGA 2X1HA 3D3QA 2PLRA 2QIOA 4NE2A 3ITEA 3N87A 1E79D 1YB7A 2OV8A 4WK4B 4CV1A 5JYCA 5K0EA 4LRUA 4PAGA 4PG6A 1JQJC 3QBTA 2RH5A 1J1ZA 1BRMA 3UY4A 4V24A 2FKAA 4M46A 4R69A 3RS9A 2SKDA 4ETWA 3I9LA 1G8JA 1AKQA 2NM0A 3EEYA 3FVVA 5CJPA 1X0VA 3U7JA 3F7TA 3RG2A 5GZ3A 4FE4A 4JL8A 4NCHA 4Y2JA 1C8LA 4URHA 2BMFA 1NRJB 1QANA 1IY9A 2RK3A 3LK7A 1YL7A 5IDVA 1TIKA 2LBPA 3AHIA 4RVGA 1L0BA 3FOAA 4DWJA 1JFFA 2EU8A 2XQVA 1F2UA 1KYWA 2IQIA 1IJBA 3O38A 4X20B 1EQ2A 3G9UA 4NEGA 1Y3AA 2NGRA 4PO1A 2BKVA 3T6KA 1LBHA 1YBMA 3FRJA 3UGTA 2PVCA 2VJPA 4R05A 4G0MA 5T67A 3UXYA 1E7MA 1Y1RA 1Z36A 3CT4A 1FDRA 3UT6A 2H4YA 3CVJA 3H5NA 5ICSA 4V3CA 1KWKA 4OKIA 4KRFA 1YI8A 4NH4A 1KEWA 3MUNA 2WJAA 4OU4A 4BJ5A 1V4NA 4MYHA 5HF8A 1N6IA 3V3KA 1XL1A 4I66A 4LXXA 5FEMA 1JHPA 2Y2VA 1XMVA 2H1RA 1CUYA 3ESDA 1JBEA 2HJSA 2Q3HA 1QH1B 2Y66A 1HL7A 1VE3A 5HJ7A 3AI3A 4MH0R 5ALLA 3NBYC 1ZKDA 4UQLA 4K7JA 3BWDD 4YB8A 1I1QB 1D03A 1U94A 3EZ6A 3M9WA 2JCXA 2J6HA 3THOA 4YRNA 1WCXA 5KYWA 3MTQA 3ZWPA 1RDFA 2FAXA 3BK2A 4IVNA 4QFCA 1MTZA 3GBPA 4PQRA 1VL6A 2IOYA 1DHTA 3RJZA 2WF8A 2ZWOA 3HCEA 3V8EA 2NSHA 2RB5A 3BHMA 1HMPA 4ZI7F 2IYSA 3WMXA 1N9KA 1Y7PA 3L8GA 1FJHA 4LE2A 3CEJA 1Z34A 1DKUA 1GL9B 3GLHE 4IXNA 3GEPA 5A62A 1VPDA 3JQAA 3UEOA 4CIXA 5G41A 4HAXA 3DMNA 5DW3A 3SJUA 1Z0UA 3BGDA 3D8HA 3LDUA 2CZGA 1Z45A 3G0CA 3GJYA 4G0ZA 4KAXA 4HB4A 2CNNA 2HHHB 3NHJA 1TQDA 3L9XA 1O89A 1NWCA 3MS2A 5I01A 4UPVA 4Z3DA 1OBVA 2XT0A 3A1DA 5CYOA 4H7JA 1FSSA 4R8VA 2YWEA 3GPIA 4K0RA 4E70A 4PGHA 1NM5C 1GNVA 1M6WA 1ZJYA 4PV7A 1EGHA 3HU2A 1A27A 3FPSA 4DJEC 5YASA 5IHPA 3I23A 2DPYA 4Y8VA 2RONA 4FDTA 4HDOB 1M0WA 2GFIA 4LECA 1KAHA 3C8MA 4FMBB 4GRDA 3RIXA 3L1IA 4DNQA 4ME6A 2G9RA 5LZ2A 2IJGX 1ZUIA 4R98A 4Q6BA 3I5YA 4IINA 3MOGA 4DB4A 1TOAA 4ZC1A 4IWYA 3K09A 1M2HA 4V0OA 2ODNA 4EJSB 5KB3A 2UVPA 1FJGB 3VOSA 3DULA 5K0SA 3DM5A 3MCTA 1GUDA 1E1LA 1POWA 1I5OA 3D7SA 1W76A 2OOSA 1T5DX 2CD7A 1G8SA 1K4YA 1IOZA 2ATXA 2VYVA 1B74A 3M2TA 4M22A 1BXRB 3TUIC 5EJEA 3K92A 1JIKA 2XNKA 3AY3A 4HBGA 1Q19A 1GZDA 2IPAB 4LBVA 2H18A 2F4VB 2H0AA 5ALTA 1DAFA 1KP3A 3IBCA 3HEMA 3KQNA 4I1RA 1BN7A 2FCRA 3K9CA 4U9IS 5BN3A 3GFVA 2YRWA 4GEKA 5K0CA 5FPPA 1RHQA 3GGDA 4N1AA 3P9IA 2WZCA 4OB8A 4ER7A 3ZPXA 4D42A 4KQKA 4QQ8A 5LM3A 3OO0A 4D4LA 2RGNA 5K8VA 1OX6A 3Q8LA 2D6FA 2GM9A 2Y92A 1LRKA 2Z8YA 1GZHB 3V7NA 1VE9A 4GG1A 1OBOA 1J24A 1XQ1A 3BE6A 4NJOA 1MH9A 2JJ1D 2WUWE 4N8DA 3PE3A 4X7PA 4LDNA 4J1TA 4IFIA 4RYLA 5LXTB 4XDYA 1B2LA 3WNQA 1LBSA 1Z35A 2VBCA 4K9OA 1CT9A 1GGEA 3RYTC 3VTZA 3RIGA 1DVRA 2GKSA 2QVYX 4M0DA 3M6MD 1J2EA 1GPUA 4PWZA 3YASA 4H0CA 3PFFA 3QBVA 1WMFA 4BHTA 2AG8A 2IUSA 3OF2A 3GXOA 1E59A 2XAAA 3ZDYB 2CHQA 4OSOA 3GBSA 2YTZA 4N5LA 5AK4A 2ZM6B 3AV3A 4AZSA 5ER6A 2OCXA 1ULSA 1KETA 3K6JA 2LKDA 3RGWS 2HM7A 2XEDA 3FCEA 2GRAA 3Q0TA 1QIGA 3K9WA 3QP9A 2DECA 5TVGA 1DXQA 1R4NA 3CEHA 3NHRA 4YO7A 3V1NA 4BX8A 1DRVA 3CYFA 2GEUA 1XTJA 1XJCA 1LSSA 4D6YA 1J8YF 3TTVA 3PBKA 4L8WB 1UBGA 1N77A 1U7HA 3D64A 4NZOA 1A72A 3ZJ5A 4JVLA 2WUVA 4A36A 2ANCA 5I4IA 4BB5A 4HH3C 3UYLA 5FXMA 3TRFA 3CNQS 1MFZA 2BGJA 2QRQA 3GK3A 4HJRA 3T95A 4DW8A 3R41A 1OXVA 3ZWXA 3E9MA 4GVXA 2VRCD 2BMVA 1R8SA 4XX0A 2CXOA 5LZ4A 1ZRHA 2CW5A 3GVCA 1R18A 3O6VA 2H1FA 3EW7A 3LLUA 4QREA 2YC4C 2N1BA 2XKJE 2J3JA 3EGDB 3KXKA 3C4JA 3ZV5A 4B2PA 1U0TA 1O2DA 5GAJA 4N0MA 2Q3DA 4Z99A 2V8BA 4CMIA 1WULS 4DCTA 1J5XA 3W79A 1YR9A 1YDHA 1W1WA 2FWIA 4LYGA 4YVFA 3E9ZA 3ONFA 3GP3A 2RIPA 3VJLA 3OAAA 4CM4B 1STOA 3HDGA 3IP7A 1YF3A 3CLSC 1XP8A 4HTFA 1OYOA 2WWFA 3HHEA 3HCRA 3WRVA 2QMUA 1N7IA 2LPMA 8OHMA 2ZYRA 3RRYA 2XE4A 3GEHA 1JPUA 1PU2A 1M3SA 1NL3A 1DSSG 3E7WA 1ZGCA 4HWSA 4NEQA 4P92A 4PHHA 5CA0B 3KR2A 1WUKS 2FKNA 4F6CA 1KJJA 2J0SA 1QHNA 1K66A 5E0KB 3WBBA 2DEUA 1G0OA 1FNCA 2O1SA 1P2GA 2DXIA 2BELA 1Z18A 2QTTA 3QXHA 4B7CA 1ZCJA 3QV2A 5IABA 2PUDA 3ZCSA 2IV7A 3ILHA 4MKFA 2ILTA 4GKKB 2FSSA 1JJFA 5A1JA 2P3SA 2YS6A 1I4OA 2Z4SA 3IP6A 3V80A 3ZHBA 3HNRA 4C0SA 3ZY6A 1LK5A 1T5OA 4RS4A 4EFMA 1TKBA 5DP1A 4QDTA 4E12A 2R11A 1ODIA 1QMPA 4LRXA 5DHRA 1ATIA 1LC3A 2NV0A 4IIGA 4UDNA 1CQZA 1N2HA 1JWLA 2IZOA 4N5DA 5KKAA 3WIOA 3D31A 1ADYA 4G5QA 1WMSA 4UFNA 4X91A 3LHIA 1TA4A 3E53A 3OFSA 3JWPA 1O5IA 1R0RE 1TM4E 6AT1A 4OLAA 2VF7A 1SB9A 3J81A 1I0LA 2P0EA 3M6FA 4IHJF 1A1SA 1FC0A 3DTTA 2IHBA 1WAMA 1B42A 1XVTA 8ABPA 1DWQA 4NJMB 4WCFB 1E64A 1VBNA 1SXJA 4NY1A 3RF7A 2TMDA 3TZHA 3U48A 2EGGA 3FUXA 4EEZA 2VJKA 2XOXA 2AFIE 2TECE 3HVUA 4L15A 5G0UA 3RSHA 3SSOA 1N2CB 4GL4A 3A0RB 1E2LA 1H3FA 2HB6A 1NRWA 2QUZA 4JVOA 3DBLB 2W42A 3ZWDA 1OGIA 3ADKA 4EJ2A 3BRWD 1OC4A 1DKOA 3FWNA 1EWRA 3T5DA 2VHCA 2WV7A 3CEMA 3DUFB 3PHCA 3ICVA 4WK0B 5CGZA 2Q5JA 3JWIA 2AW3A 2C59A 4B6QA 4B2LA 4REQB 4NZMA 2QQFA 5FWAA 2R8XA 3FWHA 1NA5A 2YDXA 4MS1A 3WO1A 3IV9A 4AJIA 4BBJA 4L0DA 2GAJA 5CDTA 1AV6A 3KZMA 2HWWA 3OJCA 2VPXA 2YVQA 4BO8A 4A2CA 1SJ9A 1QJCA 4BB6A 4JT2A 2WJPA 3BZUA 3WGTA 5IVKA 1ZWLA 1XZGA 2UKDA 3MWYW 4GPBA 3C70A 3I34X 4IEFB 2C88A 2H2DA 5EXSA 5IAEA 3WDKA 4KH1A 2RB4A 3GJ0A 3K9HA 3ABQB 1B8NA 2BOVA 1FQJA 4DL9A 7AT1A 2PSDA 2QR2A 2WHXA 3GFOA 4L6AA 4OHBA 4A6EA 5CH5A 3A4MA 3QBJA 5EUMA 3AM1A 3CB4A 3OO1A 2GZHA 1IAQA 2YNMC 4E3ZA 1K6JA 1PK7A 3DPSA 1JSXA 5JMTA 1UL1X 3HWSA 1J39A 2Z2JA 3IULA 4XVRA 1QH8B 2F1JA 1KMNA 1U80A 1E2EA 4H2DA 3R3JA 2FSVC 4Q3OA 10MHA 5IH3A 4POAA 2ZE5A 2HD4A 2JEYA 3ELYA 3MWKA 4KQ9A 3T0FA 3PUXA 3UMGA 1DIBA 3HCDA 2BHTA 1G8YA 1CX9B 1E4EA 4DA7A 1T9AA 4XVQA 1HYEA 1WMEA 3LT1A 5KTYA 4FD3A 1D2EA 2OM6A 2DERA 3HA7A 1ESNA 1GA6A 4P4NA 4BFWA 3ZBTA 3O4JA 1EUYA 3PXAA 2X76A 2G36A 2WU1A 1KP2A 3AP1A 4UD6A 4WGFA 4ON9A 2KHZA 1LZLA 3A6DA 3G2QA 5EWLA 3PQ5A 4LMRA 2VTDA 3N58A 1YNOA 3GJRA 4BP9A 1TU4A 2D0IA 2GPTA 3RYFB 2H52A 2J3HA 2VL7A 1VP9A 1UM9B 3GG2A 3A31A 2ZUCA 3TDMA 3WJ1A 5JI3E 2PQ0A 2BAGA 2ONYA 3ZWBA 3Q9LA 1I4LD 3WAJA 2YHBA 3SK0A 1RZ3A 2XVXA 4NPHA 2M6LA 1PVVA 4X97A 3NNNA 3N2GB 4PLZA 4BFTA 3GDOA 4F4UA 2YN4A 3AXTA 3WGOA 2LKCA 2XVMA 1BU8A 4MMXB 2WWRA 3N2YA 4TTSA 2F3PA 1WD5A 3CRMA 1ZRSA 1RTKA 2BFNA 4B3CA 1AGPA 1KI1A 3TAHA 3A28A 3OCUA 5E7QA 1QVAA 1VPVA 4BMOB 1MR3F 4HLCA 3IT0A 2ECQA 3JZMA 2CVZA 5KWIA 1LX6A 4LJ5A 2I99A 3E22B 3WS7A 2D00A 4HL6A 4ZI7B 2MIIA 1Z83A 1BDBA 3RUEA 1ZVVA 1C5KA 4B83A 4AYWA 2PAAA 4WX2B 3L1KA 2OXEA 2H2GA 4JN6B 1T6BY 4M8KA 4RPGA 3PLAE 2WG1A 4G97A 2HRBA 2GBLA 4B32A 2V59A 1R37A 3V8QA 1D07A 2K4MA 2ZBQA 4CCWA 3DZJA 4W7IA 5G1OA 3C97A 3UC9A 1Y6RA 4A9AA 3BPSA 2BH9A 3IJPA 3CX3A 4YX9A 4QGSA 3UK2A 1NC1A 1Q16A 4GFDA 2EWWA 1M54A 2BKEA 4FDMA 1JU9A 2C84A 4PAOA 3WYFA 3D4IA 3OA0A 3FVTA 1Y9DA 2J6CA 1EFAA 4ENVA 1HH4A 1NP6A 3C45A 4CIWA 1J8MF 2DVMA 2GWRA 4G0OA 4Q1EA 1MT0A 4EQ6A 4B3SB 2FHSA 2GK4A 3B8HA 4ZCSA 1W6RA 1SR8A 3L6DA 1MRZA 3KEQA 3W1WA 2EVWX 1D0VA 3EQ9A 3MYYA 1X0XA 3S4YA 1PSZA 1GV0A 5DCWA 4D3XA 3FYCA 1J2TA 3BBLA 5EG5A 3BQ9A 5IVDA 3WWCA 4LVCA 2AJCA 2IHZA 1MVOA 5T6MA 3LTNC 2X1LA 1GYPA 4LG1A 1IJEA 1ENZA 4M53A 5C52B 1BHSA 4QXOA 2QEQA 1LBEA 1Q21A 1Z5ZA 4ND7A 4O4HA 5DYWA 4MCHA 4EYOA 2GCOA 4ZICA 2B98A 4HTAA 3X2EA 1YNSA 3LBHA 5AVOA 3AKDA 2VDMB 4HEA1 4M0EA 5LQRA 1U9IA 2I3DA 4IJWA 2OE2A 1KOJA 3O8OA 1RABA 4Z5XA 1A97A 2HQOA 4GT1A 2O3SA 1AH2A 2A9JA 1TJ5A 2XNSA 3H3FA 2XEXA 3SP1A 1Q2UA 4DV0B 3QLEA 3DMPA 4RJ2A 4BNKA 4MEAA 4FONA 3VVLA 3KQPA 1T9HA 3CLUD 3C3MA 3A1NA 1ZAKA 5KU1A 4L5JA 1Q2XA 2ZYTX 2VHYA 1GAEO 2MT9A 1O97C 4YAJA 3TLXA 2R5WA 1QHHA 1A7AA 2VP6A 2XV1A 2V6GA 3D02A 3IT2A 4GKAA 4MVJE 4PZDA 2FLKA 2FR0A 5CK5A 3ZK8A 3ZCQA 6GPBA 2FPGB 2RC6A 5IG2A 5L3SA 5MFPA 4RPKA 2ZUFA 1PF7E 1NRIA 4LHXA 3OX2A 5NULA 2EFEB 4UKDA 4KBFA 2Q5HA 3WP1B 3V2GA 4DLPA 5HGXA 1BZYA 4JXXA 2DHQA 1YDFA 1ULBA 5LWQA 2Q0QA 2ERCA 3SHTA 3SIPA 1DFIA 4N3CA 4TXNA 1PJRA 4XB6B 1JZTA 3D2AA 2PBRA 2X0RA 4YYZA 1JDBB 3OCVA 2PANA 4R31A 4BMNA 3CTPA 2GZ3A 3GLSA 3HRHA 2GM4A 2R62A 5E95A 4ICIA 3HA2A 4ZHQF 5HQ3B 2ZJYA 1A5TA 2GNOA 1NN3A 3HKCA 4NU5A 2CY0A 3V8MA 1PZNA 2HF8A 5EWMB 2F2TA 3T35A 3W6OA 1Q20A 3ASZA 2IL1A 2P2SA 1R64A 2DCMA 2DJIA 3JS5A 4JLSA 1ZSNA 1CULC 2XBUA 4L9RA 4WWHA 2ZWMA 3M49A 3K15A 4PFQA 3ZBPA 3KLNA 2SICE 3LFTA 4OQFA 4W5OA 2FXVA 4J43A 1IY0A 1CUIA 4WZAE 5EE3A 4XIIA 2JVIA 3GUUA 4JEUA 4BYMA 2I4MA 3B3AA 4G41A 3A2NA 3D8BA 2FUG1 2FSHA 2G5CA 4L0MA 4O4JA 4L6IA 3TZCA 3W77A 4KREA 2HEIA 3SC3A 4H3SA 4NAUA 1XJWA 3FG9A 3ZNQA 4EO7A 2XXJA 5FHRA 2CWDA 4MR9B 2QTGA 1E8DA 4Q18A 4CM3A 2AEEA 2E5WA 2YBEA 3EXIB 1GKLA 5CIWA 4FOPA 3HKBA 5LMUB 2JGJA 1Q3HA 2HXSA 2X1VA 4BEWA 1PTKA 3JARB 1V16A 2PA3A 1FLDA 5AJWA 2FZEA 3EB9A 3H4TA 4BPRA 4CV0A 2H9IA 4R2JA 2CYBA 1FX0A 3O75A 4YMWA 1ZMOA 1FPQA 3BH0A 2R7NA 3A70A 4BNIA 4OTZA 4YAGA 2CF6A 4IH4A 4MVJP 4N12A 3WXBA 4AECA 4JDUA 3H0EA 1W8DA 1GLNA 4EMBA 2I1QA 4H6XA 4I4TF 5I3CA 5FH9A 2FJ0A 3LP5A 3MT7A 3LBFA 1T36A 2W2LD 1J8DA 8GPBA 5KWSA 3CC8A 3G68A 4GW3A 4PY2A 5CR9A 3H5AA 2BL4A 4UU8A 3SFTA 2JG3A 2HNBA 3CW2A 5JAOA 1GIAA 3U26A 3SNKA 4S3MA 1VYUA 2D0DA 4AC9A 4DV3B 3RT7A 2CJXA 2RH9B 1IK6A 1PT6A 1KE1A 1BFKA 2I6XA 2QYHA 2VF4X 3QVTA 4GE0A 5DZSA 1OHHD 3W5CA 2R8EA 1AT1A 3OWOA 1YJ8A 4HBZA 4MWTA 1S4QA 1U0GA 2CLFB 2LCIA 4P32A 4IHJB 4Y2SA 4CTJA 4F12A 1UZAA 2EFCB 4GAEA 2PS3A 1S9DA 3L79A 3G8CA 2V7PA 5DTMA 2XDAA 4OOEA 2L18A 1KDTA 2CJWB 2KX7A 2QENA 4XSHA 5ITZB 3FJYA 5IYZA 4KWCA 4XDGA 4MYTA 5B4TA 4CLOA 1M7BA 5TGTA 4EI7A 1FK8A 1G5QA 2PUCA 5DTQA 1T10A 1CYEA 3KQSA 4LBZA 2HHJA 1KY4A 1WZEA 3HL0A 3LYAA 2OZKA 4KQXA 1X7DA 3KKPA 4OVKA 1XPJA 4A2QA 4E5VA 5J58A 2IZ6A 1KKLA 4FM9A 2O7SA 5KMGB 4HMQA 2B1GA 1AHPA 4YAWA 4MJLA 4HPWA 4YRFA 1F1JA 1T0HB 4ZAVA 4BNZA 5F3WB 3M1IA 3EVDA 3AJ8A 3WLAA 2JW5A 2OL4A 1DARA 3UMFA 3FVWA 4RBNA 2CXHA 1YH3A 1PUJA 2P4SA 1M1YB 3DE0X 4YCJA 4MHSA 2AG0A 4RKWA 4WDRA 3TR6A 2LCQA 2EQBA 2JGMA 1UH5A 1IZ8A 5JJ5A 5LNK1 2XBMA 1GQRA 2QAIA 3GLGB 1G38A 3ZGOA 5EA2A 3F5SA 2CGEA 2UV8A 3K1TA 5JG7A 1P60A 4PANA 4X8HA 3VNQA 4Z0NA 3A9UA 1JLMA 4JJKA 1E9RA 1Z75A 2JZNA 2RK4A 3KXLA 3LUHA 4DR5B 4DUPA 1OH6A 1NHGA 1HDRA 2PXHA 3ZY4A 1UM8A 4ZVPA 5L9AA 4LSGA 4WNAB 3ZE9A 2DFLA 4ZD6A 5KU7A 4JIMA 4QASA 2K5UA 3NBFA 1QZTA 2W8BB 1MB2A 1DG1G 4QOIA 5AKHA 4EG1A 2ZZMA 1U8FO 1EXNA 1OVMA 3KT6A 5JE8A 4EGAA 4M8SA 3KDSE 1II9A 2AD5A 1U3WA 2ZDHA 1Q7BA 3LX6A 1GTSA 2BZ0A 3D7MA 4JB8A 1K3UB 1TLLA 2ZVQX 4BLRA 2ZSIA 3TVYA 5CVJA 4Q1AA 4NR0A 2ZQZA 1JI3A 4FZVA 1VIYA 1DJLA 1JAZA 4KXLA 1M2GA 1WBJB 3ROEA 3PSAA 1DG9A 2HDWA 1DPGA 2BMEA 3WGYA 1JYSA 3L7BA 3WX0A 2ZR8A 3JASA 3LP6A 3S8MA 2W48A 1VRCA 4ARUA 1MPTA 4BGUA 3EC1A 3EH2A 1GKUB 3KZXA 4C1BA 4QYXA 1WP4A 3N1UA 3FJOA 3MSXA 5KNDH 2YZGA 2VUUA 1XLWA 3KJNA 3X43A 5JI2E 1NNUA 3RD5A 2LE0A 3CT6A 4YJ2F 1DAGA 5C32A 1NG9A 3V4PB 3A32A 3G8BA 4NX2A 2EF1A 4RHXA 4MA4A 5G3YA 2GMWA 3GP8A 3IBGA 1WXDA 2JLQA 1IBSA 1TTQB 3CR3C 4GM1A 1AZTA 5FUQA 3HBMA 3NX4A 1IN4A 3EUAA 4WFJA 3H99A 2W6JD 3HYCA 3LPLA 2EHJA 4EX7A 4NG4A 2G76A 2QVLA 4TWIA 3SLRA 3T7JA 1LQTA 3AF2A 4O63O 2D74A 4P4UA 4PPFA 2HOQA 3P9YA 4LY0A 5JVDB 3PZBA 5E1DA 2ZB3A 4LX0A 1FTWA 3OZDA 3KIPA 1M7GA 4EGQA 4TYNA 3DE1X 5B57C 2G28A 4XIFA 5CRIA 4G37A 4UBMA 1UXOA 2OG1A 1VG8A 3SXUA 4CFYA 4JKIA 1D09A 1VL1A 2ZSKA 4DWWA 4JB3A 3HP1A 2F43B 1ZD4A 1WE2A 1AHHA 1D1QA 3X2FA 4I6JA 4YT4A 4EG4A 4RK6A 1EXWA 2SNIE 5EWJA 2AMLA 1DJQA 2P4HX 5TS2A 2AT1A 4OLBA 4JI2B 1FMJA 3MAAC 2PR2A 5EIBD 3CX8A 2R6CA 3JAWA 4OPMA 1MNQA 4H7DA 4R71A 2XZOA 1ZN9A 1S2LA 3VPHA 4EX6A 2MR5A 3CS3A 2B78A 3A6FA 4DSZA 3KB8A 5JRDS 2PQMA 1IN8A 4FQ5A 2Z09A 3WLKX 1B0UA 4ALKA 1M6VB 3OQMA 1PKXA 2O3UA 3CZMA 1YOBA 3ML1A 1RZRA 2O48X 2A1UA 2CXQA 3P9NA 3WLQA 5AVTA 5CEEA 2PFGA 4BB0A 3JQBA 5CB8A 3CEPB 1GAQA 1QGUB 2FOLA 1TUIA 3CNLA 4R1PA 2PL9A 5ALVA 5KOHA 1V3VA 2DWCA 1UAYA 3IPLA 5KJ6A 3TQCA 3NWBA 4OX9Y 4C76A 2VYCA 4J75A 2ATEA 3AI2A 4QUBA 4ZQCB 3PYMA 1Z63A 3GNTA 1SMKA 3DBIA 2ZANA 3G0DA 2VPZA 4XASA 2QUKA 1ISPA 1L3BA 2Z5LA 4X1IA 1OIXA 1FE8A 1PS0A 1TZBA 5JEEA 5BSMA 1XXHB 1R12A 1GAWA 1K6IA 1RMQA 2BHLA 2VG8A 3QVGB 3VO9A 4DLYA 1W94A 4OXRA 1QIDA 4Q9AA 2L82A 2Q2VA 3GGCA 3GZNB 4RNCA 3SYMA 4C6TB 4MKIA 3RLFA 3V2UA 4FFBB 1N34B 2X19A 3MS4A 2V9PA 4YQFA 5IKPA 3BB3A 2A58A 3BXXA 4YUVA 3PXDA 2IC5A 3TOVA 4WIAA 4QPJC 3N2LA 2Z3WA 1VLZA 1CUFA 2AFRA 2GXSA 2IHTA 4HGNA 4PQGA 3BXZA 3W6PA 1RADA 1NJ8A 3ROPA 3RVKA 2PKXA 1NVBA 1I1OA 4U5QA 2B4TO 3EGWA 2C9DA 4LNAA 1ZM4A 3OE7A 1G60A 4ZU3A 4QEZA 1AS2A 2RHCA 4YFYA 4FBGA 4KZKA 4F46A 4ODIA 2YZKA 4TLLB 1H1DA 4E2YA 4LWQA 5T7BA 1ND6A 1Z7EA 2GRJA 4JSYA 2CDRA 3EA4A 4LZOA 1OJ7A 4W1QA 2GB4A 4R8MA 1KDYA 1Z22A 3ZGXA 4YV2A 5LMNB 4UULA 5D1HA 3T1YB 1AOXA 1JLLA 4EHHA 2N3ZA 5FUYA 3SMQA 3GRAA 3OTQA 2WYWA 2VQEB 5AYVA 4KE8A 5BUZA 4PF1A 3U9LA 2A1TR 2G4VA 4LKRA 1L5GB 5DN6D 1EWYA 2ZR9A 3IDAA 3D2CA 4B6SA 1B0PA 3M4YA 1PV1A 3EZLA 4DC0A 3D8RA 4R1MA 4O02B 4R8RA 4RJKA 2R3SA 3ZLBA 3C98A 4C06A 3PWZA 1P3DA 1QIJA 3SSAA 3DLCA 3PIRA 5EJFA 1BJRE 4DSNA 5BW6B 2AFHA 4ZHQB 1KO7A 1BCRB 3OQHA 3LL4A 5FRDA 2AMVA 5CVDA 1NOKA 1YBFA 4ZYVA 3GLFE 1XKQA 1G18A 2ZRCA 2ZVPX 3OQIB 5EP2A 4CQMA 2IXFA 3DEAA 1PZFA 4I3FA 1KPIA 1SC9A 2HQSA 4OOFA 1BCSA 1U2GA 4WUVA 2C0CA 2CEAA 1G16A 2W43A 1B26A 1HT2E 3D3WB 1Z2EA 4HEA6 1J0BA 5BYBA 2G7ZA 3MMXA 4LOJA 4Q7EA 5AKXA 2ZE8A 3DA8A 3DZHA 4L3VA 1QYIA 1HL3A 3KQOA 4Y2HA 1YL5A 2YS7A 1GARA 4DEYA 2XYHA 5A7GA 4JC0A 2P2YA 1CE8B 1KI6A 4XJTA 3OD1A 3DC7A 2X6TA 2C78A 4U3JB 2C9BA 1BU5A 1E3TA 2HWUA 5DCYA 1FUEA 3KUXA 1P2DA 1KGSA 4C3ZA 4WLEA 3DXFA 3QE3A 4CKCA 4DJAA 1CY4A 1C9DB 4EA6A 3C3AA 1N9GA 2EP8A 2W58A 4PM4A 4F9TA 5JV5A 4Q6WA 4EW6A 1I6MA 421PA 2BYTA 2Q3CA 3O2SB 2CV2A 4NULA 5DBOA 1P0IA 1SVKA 1F8UA 3N86A 2P62A 4HS9A 1DTEA 2PZLA 4TSFA 3JWGA 1LUAA 5DNDA 5CU7A 1M2OB 1XMPA 2ZDQA 4OL0A 4IJUA 1ZK2A 2CCJA 4XOIA 3DDOA 3S8YA 2ZJ6A 1D9XA 4J7UA 4I4TB 4RTPA 1D8AA 2FW8A 2IA5A 1Q91A 1U4OA 3HCWA 5JLAA 2JKVA 4X85A 5AKZA 1EXMA 2CE2X 3KOXA 3B5EA 2P77A 3QF4A 4TSRA 3UJ6A 3JTEA 1G17A 4JD5A 1D6JA 4KO3S 5F51A 4CHGA 4FFVA 1C2YA 5I7VA 4YCSA 1PDWA 4Y0NA 2CK3A 4EJSC 1NXTA 4G24A 1L7QA 1P1KA 1CYDA 4EHAA 1XI2A 5K3DA 1OFIA 3HWRA 5I3ZA 1HWYA 4ZK6A 1LD3A 3G1TA 3ZXIA 5G0SA 1J0XO 3KWFA 3UAWA 5LL6P 4MSUA 3GIWA 3U09A 2CXNA 2G0NA 4H4CA 4Y0VA 3SZOA 3VYTB 2CDBA 2XB8A 2TSYB 4ZO7A 2FUG6 1AO3A 1NFFA 3B7WA 4B45A 4WNIA 2VPPA 2JLSA 2RHJA 1KJYA 1KMHB 1SCBA 2PZFA 4N3NA 3A9RA 1JSRA 1VIAA 2P5SA 3TIVA 4NCAA 2IU6A 2AXEA 4LZLA 1NP7A 1T9BA 1SNYA 2Q9CA 3H1EA 4Q3KA 4PHCA 2X58A 3FFTA 3VH2A 4B7AA 3LUJA 4ESHA 1QIKA 3RS3A 4KG7A 5L40A 3KTAB 5C34B 3AYZB 1QNLA 5EINA 2W6ZA 2QYSA 4E32A 4QATA 1UDWA 4DA9A 5IJ0A 3IVXA 4TMWA 4OXIA 2IPMA 2PUJA 5CT5A 2VFAA 4PE5B 5CLGA 1UJCA 1E4YA 5ICMA 3I30X 5HGJA 5L45A 5F2NA 2IEGA 1FRVA 4BLSA 1K2WA 4CF5A 2VT3A 4Y30A 3QMMA 3SY8A 2CMDA 1O5OA 4DYVA 2HMYB 1L1FA 3V4SA 4U7DA 1WO8A 3WVNA 2KLHA 1GXSA 4W9RA 4BO7A 3DYVA 3UJDA 5B3LA 2EW1A 4CDGA 1YHYA 5ICCA 1EIZA 4II7A 4JODA 4KQ1A 1E6EA 4HAUA 2W37A 3DV9A 1AD2A 3I4CA 5HIMA 5I9TA 4JL6A 3M6UA 1U5BA 2ZRGA 3LQFA 4XM2A 3WYAA 4XYBA 1UPBA 5CT6A 5A6SB 1TD9A 4CM9A 1DUVG 4LGYA 4XZ3A 3L7CA 3V9AA 1KI8A 3M7IA 1W0KD 4G36A 1P77A 1VKNA 4QU9A 4KNWA 4ZV7A 1QOZA 1TADA 3OPYA 3TZLA 5EJAA 4XGNA 3VAAA 4CF4A 3AHGA 1VBMA 4MYRA 4FFNA 5AMXA 1G42A 3BUSA 5EXEA 4QXRA 3WG9A 1RBYA 3ZLUA 2GK3A 1Z3CA 3KKEA 2J4DA 2QPAA 3FI0A 2QW8A 2IUEA 4RORA 4JBGA 3LU1A 3WLLA 1XZLA 5ADUS 3B6MA 1J49A 2QZPA 4JSTA 1SVSA 4PYOA 1PFYA 1SOVA 1VJ5A 1I0IA 3N8DA 4EKGA 2ZTLA 2NU6A 3HR7A 4M1TA 4ZANA 3IODA 3C5CA 4DJFC 1EFPA 1ESCA 3X1WA 1XU9A 3L04A 5HTOA 4DYHA 4ACBA 3PHBE 4D9KA 3AH8A 1B6GA 4JQZA 1YZHA 2PN1A 3AJRA 3GT7A 4G67A 1BNCA 1EVKA 1Z5PA 1Y4UA 4KPGA 4RA6A 4K9NA 4W1PA 3ZDAA 4A0FA 2D62A 2OQIA 2P6MA 3G89A 3NS7A 4JVSB 1RHKA 4P38A 2JVJA 3VR2A 1U2DC 3C8ZA 4LHSA 1NPTO 5EQJB 4FE3A 1RZVA 2JFZA 1G6Q1 1XTBA 1GY8A 1Z2PX 2OD2A 2WFAA 4GWLA 4JQCA 5B3JA 5SV2A 3RHSA 3GGGA 4FPXA 3H8JA 3WDLA 2QLLA 1ZZEA 3AQ4A 4G89A 1VDMA 1PEKE 3EARA 2GAOA 4JLVA 4HDKA 3ZQ6A 5A04A 1DDOA 1L5OA 3PS9A 5AKYA 4B80A 5LNK6 2PV7A 4NCBA 3TQQA 1JHOA 2VNAA 4KFSA 3GA5A 2E87A 2P6NA 1KO4A 1L6RA 2DQSA 2P4UA 4ZCPA 3UJAA 3A26A 1SG9A 1L7DA 4FT2A 3IQEA 5LQDA 4HAWA 4L76A 1SXJE 2ZP1A 4EBFA 1U3VA 4B3TB 2AE1A 4FOLA 2AJBA 1OBCA 3OFVA 4YLGA 1PBNA 2HPZA 1JEDA 2WPNA 2ZRAA 1T2EA 5IVPA 2ZM5A 1VLQA 1MCZA 4J76A 3C6QA 4PWYA 3LPMA 4UHEA 4C3UA 3PCTA 5I48A 4YRAA 3HO1A 2JFHA 2ZR0A 3H5OA 3RTGA 1SHLA 2BFPA 2YZ7A 2N9UA 3RADC 4GP7A 3H0KA 4B87A 4M55A 3VPXA 1XRPA 4V2UA 3HGQA 2GZDA 2R6FA 5GWXA 4YXWA 4FVTA 1G8PA 3RJMA 4LCBA 4B3RB 2ENUA 2Y2UA 2VF2A 2PX4A 3AR7A 4RKYA 3SIRA 4ZYXA 3HB4X 1ZITA 5E1BA 4WRRA 3WTBA 4EA7A 3GPBA 1VA4A 5K3AA 2ORIA 3FOFC 3RRNA 1PEDA 1WKCA 5D7NA 5IJWA 4WCFC 3GRCA 1NLYA 1IQRA 3LQQA 2ZFUA 4AKEA 4TRJA 1ISFA 1E9AA 1GPLA 2VJLA 1ODSA 4KWEA 3TK1A 3S1AB 1ID8A 4P54A 1IN1A 2N1MA 2ZJ7A 3IDSA 4ESVA 2Q4EA 4E21A 1HY3A 4A0GA 2QMQA 3GMTA 4QBHA 3B89A 3ROFA 4JUDX 1RQ7A 1N2ZA 2ZREA 4TVBA 5JOQA 1HQDA 1R0SA 4P0PB 1U2SA 3KSZO 3GG9A 3HJTA 1Z0DA 4FWTA 4HAZA 2G4LA 3UQYS 3K70D 2Y1EA 5F64A 2HF2A 2UZ1B 4Q4HA 5KOYA 2B8WA 1GUYA 4CTNA 2A3NA 2J5XA 4AJPA 1L4KA 5TF4A 2ONCA 2F3SA 3E6AA 4OI1A 3QXSA 2WSLA 3G8DA 4J94A 4KDCA 4KI7A 1V0JA 4Y2XA 3C5EA 1JKXA 3SC2A 4MPPA 2P0AA 1C0KA 3DDZX 3AI7A 3EC7A 3R8CA 4GXRA 3GH1A 3W9YA 4BKMA 4D3YA 1U0LA 4PC2A 1FP7A 2RFLA 4TROA 4DUGD 1TAUA 1GNLA 2J9YB 2QU7A 2WWTA 4JJEA 4EJMA 1II8A 2IYRA 3PV0A 1Z16A 3OH8A 3ONVA 3KTDA 1OWOA 1VJ0A 5F52A 3I73A 3NKVA 1PK9A 2I65A 4BV3A 1X7XB 3R5KA 4M0MA 1W47A 4A0QA 1FJ2A 1SKBA 3BMCB 4ED9A 1XKTA 3Q9NA 4H08A 3G59A 3QKSA 4PBRA 5EIAA 2OSBA 1RLTA 4HGZA 4BTEA 3CVYA 2ZT7A 3NH6A 1Q7GA 2DBRA 3ZOKA 4EZEA 2CFIA 2JJMA 4C0XA 2XTNA 3MCZA 4FBLA 1R7RA 3RC2A 5A9TA 4IV0A 4JEIA 4CETA 4RMGA 2Q3MA 2YJ3A 4AP5A 3H83A 1R4NB 3FYUB 1C8VB 4DLUA 1DC4A 3PF8A 1NR5A 5DH9A 4BJ3A 5FCDA 3SPXA 1PX2A 2WD8A 4UTVA 4G1VA 4D9MA 5D3MA 1ZNWA 3FPJA 2JLYA 1RMYA 3GUVA 1IHPA 4MGZR 1U7ZA 3I2YX 4QODA 3UAVA 1E60A 1KVSA 4AJOA 3DLHA 5K8JB 3A06A 2XCSB 1NR1A 3BE8A 3OIUA 3RTBA 3GJ6A 3OBBA 3Q3IA 1S7CA 1E1CA 3BGSA 4CG3A 1B1AA 5JATA 1M8GA 3HB5X 4OFXA 3LZ6A 2JD0A 4RMJA 3T3IA 3PUZA 3B9QA 3SBXA 4CR7A 3JWJA 5JSKA 3VHXB 2VSOA 2PO5A 4DY6A 3Q8KA 4QC2A 3AY0A 4OI0A 3TUJC 2BRUC 1K8RA 1Y34E 2R47A 1RKBA 3PC6A 4ROSA 5TMBA 4CMIB 4F0JA 3KJZA 1FFSA 4Q34A 4C4ZA 2LZ0A 4FC7A 1J4AA 3KTFA 2HRCA 3OY2A 3FETA 2M6RA 4G1CA 4X3OA 5ULLA 3E5HA 3A05A 3MBOA 4F7WA 2XOEA 3NWEA 4E1AA 3MMSA 2C2KA 5ALZA 1K7CA 4RMHA 2ZQYA 1X8XA 1JSLA 4BAUA 4PFSA 3NHLA 5IANA 5G40A 3N0RA 4ZT7A 4L0CA 3CXRA 4MHOA 5KYNA 2A9PA 3OIWA 4L8YA 4M0CA 4HQ0A 3MHPA 4M0PA 5IT9A 3IR7A 3WV5A 3RVBA 3W9BA 4YT2A 3ANLA 2YWGA 3DT9A 1PQYA 5DK4A 4TT3A 5HF6A 5BT8A 2H1VA 1CUDA 4XQ0A 5KNDD 1NQ5A 5AKGA 5A4IS 2Q4RA 4TV9F 1VJRA 3UWMA 1CQJA 1ITZA 2J08A 3IJEB 2UYHA 4JUFA 1P7WA 5E6SB 1UK6A 4FKBA 2IWRA 3L0CA 3G5MA 4B6OA 5JSQA 4EKYA 2NZWA 2CYAA 5JS8A 3ZCUA 2ECPA 4NABA 3WL5A 3DWFA 2P75A 5L4SA 4A4DA 3O90A 4W63A 1OROA 4GLOA 3RFXA 2D5LA 2GEFA 5TJHA 1PZGA 1RBQA 4DR7B 1UPFA 3PPVA 4B85A 4DGSA 3R0IA 1V26A 3AILA 4INJA 4NLLA 2MSLA 5GM2A 2X5NA 4MO9A 4QNMA 4MI6A 4RH1A 4IQ4A 5DSZA 3NUGA 2OFXA 4FDUA 4PR0A 2ZYSA 1CUWA 4MKXA 2YOFA 3B8EA 3DLTA 2NZ8A 4V02A 3WBFA 1NYRA 5C81A 1R6DA 2RHRA 3JVDA 1BW9B 3ZEAA 3QOXA 3H2BA 4JI3B 1OD6A 3DOCA 3U37A 3DMTA 2Y0DA 1OF1A 3UAYA 2F9MA 1XTZA 2IIBA 4FMPA 2JFBA 3BAFA 4ECAA 3RC7A 4HMOA 1J8FA 2CMHA 5K20A 1GSIA 1KI2A 1UBFA 2R751 3L8YA 3PTZA 4XQCA 1YR6A 4ZXFA 3IUNA 3U0BA 4YRSA 4A82A 3DAGA 1UJ6A 1VPWA 4ND4A 1CDOA 3KUCA 3HBAA 4LBYA 2GN1A 3HCFA 4Z54A 2O7QA 3G2JA 3LRPA 3KZ1E 3RK4A 4YHHB 4O2AA 4OXKA 3Q12A 1O94A 2FZWA 4ZRDA 3BSFA 5C3UA 1I5RA 3K6RA 2Z04A 1THZA 3IIJA 4YCDA 2GYWA 5C9ZA 3OECA 3HN6A 2PT6A 3EXAA 1I3KA 1HYHA 4YI3A 4ZCQA 1WU8A 3CZPA 3K8YA 4CL3A 1Q6ZA 3Q5EA 5KAMA 4WADA 2HBYA 3ZHOA 4PCVA 5A4DA 1NQWA 2Q07A 3VHRA 4L5BA 3KKMA 4FEGA 4RIEA 4LJYA 4N40A 2AZMA 2JGDB 3FA2A 4PZUA 1GZVA 1T8YA 5DLEA 4V0ME 2Q21A 3AEKA 4IEIA 3VNVA 3SKVA 3A9VA 4E46A 3NVKI 1EDZA 1F8XA 1RWQA 3DCYA 4HNQA 4AMYA 2ZIAA 1YV9A 3Q6IA 2P11A 2FX2A 3UJ3X 4ZZ0A 4JLNA 1N2SA 2JAUA 2J5QA 3NHAA 3F2VA 1I94B 4PXAA 1UJ2A 2ECKA 4EA8A 1SK9A 2YJ6A 1QP8A 5CDFE 1L7OA 1T5BA 3P5SA 3QMVA 3P97A 1XRNA 4HDNB 3W8EA 2ZRIA 1LTHR 3FFBA 4HLUC 3WYBA 5AVUA 3IAM6 6LDHA 4ZEVA 2CBZA 1VSBA 3BT7A 1A8PA 3R0XA 3TGPA 3O4GA 2CZCA 4DYDA 4J90A 5M04A 2D7JA 3GLKA 2IX3A 2E48A 2LW7A 4K3UA 3RAFC 1QXSA 4MRMB 1YQQA 3ON5A 3WQBA 1GQFA 1RC1A 2NVUB 3BEOA 4GI2A 4P80A 3WLSA 1JI0A 2FGKA 3KLBA 4AIRA 5KTOA 4QE3A 4BL5A 1NFQA 2RC5A 3R0ZA 2O0LA 3CRNA 1S01A 3HFRA 4K9RA 5HZGA 4BTLA 3H42B 3GFQA 4TQGA 1KYQA 4FLMA 4UHJA 3VYRB 5GMOA 1TJYA 3RU7A 2Q5QA 5LDDC 1JEJA 1WXWA 1V1RB 2D06A 2PXXA 2J5RA 4HH1A 3RJ9A 3TQTA 5THXA 3G2LA 1I2MA 2C3MA 3DVLA 1YC2A 1YZUA 4FT4A 3DXYA 4JWTA 1WA5A 2HSDA 3BXPA 3CZQA 5GJWC 3IHTA 2W00A 3S7TA 3FTDA 3UJ8A 2QA5A 3PQ4A 5LZ7A 4EENA 5I7RA 4BNHA 3VHQA 3RTEA 4WKCA 3C4QA 3BTOA 1ZU5A 2XMSA 1NVVQ 1N1GA 4KN9S 4X92A 4HNGA 4PG8A 1OH7A 1HDOA 1CLUA 1ZDMA 3UMBA 1NVAA 1OPRA 2PKCA 4QD3A 2NV2B 3CSUA 4TVOA 3OOSA 3S40A 2OKGA 2PZMA 2ZRHA 4M99A 4BBPA 3F6RA 2DLDA 5BOSB 2H5LA 1XWFA 4MZDA 4QEDA 4QUDA 5IFLA 4MUGA 5INTA 2C42A 3QPWA 3NW9A 3R75A 3JX9A 3PVCA 4KO4S 4N0PA 4PC3A 4QJIA 2Z2ZA 4YRBA 5J1TB 4D02A 2FEXA 3H1TA 1WHSA 5H9VA 1DGQA 2PIDA 4FR0A 1XQXA 2DCUA 3T1HB 3CR7A 2C4NA 1WXEA 1D6NA 1GWNA 2VT7A 1GSAA 3AC0A 4M8IA 5CUQA 5C4GB 3TE7A 3UCEA 3VTKA 3GOQA 2GJ4A 2J3KA 5D8DA 4PHTA 4RVDA 3T5GA 4POOA 2VTBB 4CHTA 4EHDA 4IDQA 1W88A 2G80A 1U02A 3DWEX 3RVMA 2WR8A 1U2TA 2PZKA 4J6FA 4EZBA 5C80A 5CG1A 3CTMA 1QHXA 1VMAA 4KQJA 1PDOA 4KRYA 4TRRA 4EQ6B 5HX7A 1HE3A 5C35A 3IAHA 4EF4A 5JDCA 5K3EA 1T9CA 3A6EA 2Z2XA 3LDHA 5C8YA 4DF3A 4HDCA 4DZZA 4E22A 1EVEA 2XODA 3GYGA 1AXEA 3OIDA 3I83A 2O2IA 1DIAA 3PD1A 2R7KA 1F17A 5E8JA 4ANFA 2W0MA 2ZRKA 4DV1B 4OHFA 5H70A 2X8LA 3L8DA 2VN8A 4TKLA 3KSAC 4D0LB 1NAIA 4LK2A 5AK6A 1U98A 3U4GA 1K5PA 1XQ9A 2HHAA 5HCNA 1JQLB 2XKBA 1F1BA 3EFOA 3F8TA 3RYHB 2YFQA 3W34A 4PONA 2A78A 2VDQB 4HGQA 4MKZA 3QLTA 4B0PA 1Q3KA 2C2GA 1YE8A 4XRGA 2A5YB 2IP1A 4UARA 4QAQA 3CKKA 2WZQA 2QPTA 3ND5A 5JAIA 5BSUA 2VZEA 1Z0KA 4B9EA 4GOKA 5IT4A 5DX8A 3H2ZA 5EE1A 1ST3A 3L6OO 4HDSB 1E2NA 2PSSA 2V8OA 3P9RA 4I50F 1Z2AA 4RW0A 2JAPA 3G1UA 3V4FA 3V97A 2YZMA 3WHIA 3RVRA 4F8YA 4YLYA 5I47A 1QFYA 1GTZA 4LZJA 4JGBA 3DZKA 1BWSA 3H7IA 3C15C 5HCIA 2OQRA 4Q3NA 3JD1A 4G1UC 2JHPA 2RSLA 3CLUC 2V7GA 1Z17A 2YN2A 4OQDA 2WQ6A 2XGMA 3AHDA 1YU6A 2EQ5A 3D4LA 3P94A 4GPZA 4N82A 4AMBA 3THYA 1R4AA 1BYUA 1E6UA 1SN7A 1DO0A 2WIGA 2QUBA 3IRUA 3AU9A 3KS9A 2F8MA 4JZYA 1USKA 1CJBA 2OZLB 5AKIA 4B79A 1FFDA 1YZGA 2GN6A 3FOCA 4LSMA 4MWGA 1JTEA 1G5FA 2BFEA 2HA3A 5BUQA 1L5VA 3OZWA 4IDBA 5JADA 2J0EA 5HUHA 1YS2X 4MPJA 1XD9A 4YHBA 4BZPA 1RHMA 1XOIA 3CVWA 3FBGA 1P2SA 4ZO9A 2MMCA 1JF8A 1U5AA 3D1JA 2YMPA 3FKSD 4KZPA 3ROQA 2H7XA 4PHGA 2BHRA 2EL7A 4YP5A 4HQKA 4YRPA 1XTIA 5AW4A 1ADCA 1R2QA 4V0QA 3QX9A 3W6NA 2EKDA 4URVR 3RC8A 2IYAA 4X6XA 2FRDC 2Y93A 4BJ6A 2X13A 2FPIA 3BULA 3SZLA 4FX2A 3AIOA 3WBJA 1LX7A 2PIAA 2VJMB 3T3HA 2O1WA 1C9EA 4E5SA 5DGIA 3I6IA 3QU7A 1JHUA 2AK3A 1GO2A 1H5UA 4FYHA 3ZIDA 1MO3A 2F1OA 2BTOA 3HABA 5AW6A 2DLNA 1UP7A 3TKAA 3GLQA 1PSDA 1S1MA 5CYFA 1G3UA 1Q7RA 1H6DA 4LUCA 4IJ5A 3NYWA 4B7UA 3M3PA 3GX1A 4KGZA 3LZCA 4CI0B 5GADl 3W6UA 4F04A 1RQGA 3D6HA 3ZBUA 1L1QA 1P39A 1C30A 5A4MS 2A5JA 3AO0B 1OE0A 3HKBB 1NW4A 3PNKA 2HLDD 4J4HA 4N9QA 4JIGA 4PLYA 2C82A 2WF6A 5JO9A 3DWGA 1ECJA 2R6ZA 4U2FA 5CHYA 3ZI7A 5LLTA 5B3KA 1YHZA 1PG5A 5JTUA 1I9CA 5JMPA 3VKVA 4UPEA 4ITUA 4WECA 3WGLA 1QWOA 5E3JA 1M73E 1WG8A 2Q9BA 4ZYUA 5JANA 4Q4LA 2W8ZA 2EKBA 3HKEB 2VZLA 4QA9A 4ROTA 5EKDA 4E31A 1C3XA 4HUJA 4G3XA 4UHHA 2ORED 3DT8A 3AHFA 3Q7QA 2WHRA 1FQWA 4BWFB 2GJKA 1R50A 4L5YA 2CL7X 3AF0A 3P52A 4BE9A 5IM5A 3UGJA 3K16A 4URYR 1X13A 3RSZA 3WNDA 4B48A 2H2AA 1CJUC 2Z43A 2PUEA 1XMXA 2ZT6A 2QTNA 3HY3A 3QK7A 4TV9B 5LBIA 4C88A 4HFMA 4ECEA 1YK0A 2J85A 3OCXA 2XWSA 1QYDA 4TMTA 3WJ2A 4A5OA 2Z08A 2M6KA 5DM70 1OCEA 1FUYB 1VLJA 2X9LA 3EMBA 4Y6GB 9LDTA 5C1OA 5T5QA 3FPBA 4BMZA 1ZVJA 4KB5A 3R7NA 4XM1A 2B5VA 1DP4A 2VNSA 4PYMA 2WD7B 4IDOA 4OI2A 1NW9B 1IHOA 4MIEA 3SIWA 3EVZA 4U63A 1I6WA 3HSYA 3EPPA 2CLLB 3RFVA 3L92A 3RSCA 4PVDA 1EX6A 2N46A 1AB5A 4ZGWA 2H4WA 4EELA 3EHDA 1JNXX 2Q8NA 1LTQA 3BFJA 2GUGA 2HXGA 3TL2A 4B4OA 3TCNA 4NBUA 1FY2A 4JI0B 4BWYA 1Z2OX 1I33A 2ORWA 3WLJA 3KHUA 1M34B 1E9SA 3GD7A 5HIJA 2B2NA 4B71A 4C5BA 1Q7EA 3C7DB 1Z5UA 4NYIR 5LP6F 1KFCB 3F2IA 4MQEB 4L4SA 4ENQA 3V5NA 1IPEA 2RGAA 2W7TA 1X1DA 2WKSA 3BC1A 3INTA 2PJZA 2JASA 4MGIR 2PTGA 1PQPA 3RSQA 2OO5A 3D8SA 1IXKA 2BM9A 4YAFA 1RRPA 3AHEA 5EJMA 3WKBA 3A3YA 3WMFA 2UDPA 4C7MA 2YDYA 3E8MA 1T1EA 1W4CA 3FB4A 5LZ8A 1ZW1A 2CLEB 4ZV4A 4YRLA 1Q0HA 4EGFA 5AR1A 4KAAA 1DQNA 4AUKA 2B21A 1B3RA 4D9HA 1IOLA 3HYLA 2H48A 4KPUA 3K9BA 3WAGA 1XDBA 3LX8A 4MEBA 2C3OA 2X8WA 1E7RA 2VHTA 2OORC 4R84A 3SZUA 2V1UA 3GDHA 3K1YA 2QI9F 5DXAA 3CZ4A 3Q15C 1BKSB 2BE9A 4DABA 4YAKA 1KO8A 3PQ3A 4JHXA 4X6LA 3ZZTA 3EPKA 1MJGM 3A6LA 1DBPA 5JZ9A 1RXIA 1E99A 1CY7A 1LI7A 1Y1KE 1RJEA 1TK9A 3P8ZA 4PO3X 5CTAA 3FCUB 4DA0A 1SOMA 3CRVA 3ROKA 3I28A 4H77A 4F96A 4Q9IA 2D1FA 4GOJA 4L8LA 1KZ4A 4OA5A 1IIBA 3JZAA 1UWVA 3L7NA 1T3GA 3NTUA 4UVHA 1SHUX 4ZT3A 2Y05A 5BMVA 3GJ8A 3OESA 1NLUA 2XQFA 4IBOA 1J20A 1JLSA 3BMNB 5EXXA 4ZMBA 4G4JA 1CPYA 4GXNA 1FDOA 2X14A 3RR2A 5HUJA 1CKEA 5ES4B 3L8FA 4IPTA 3LF2A 2V7UA 3AI1A 5KYUB 1ABFA 4MLPA 1MXHA 1TM7E 4P31A 4EVQA 3RQIA 4CKWB 1BGWA 2QX9A 2YV3A 4F5WA 4MRPA 3JASB 1XAIA 4U7FA 1Z7GA 3T4XA 4ZAXA 4X1KA 1ZS9A 2BBWA 1EK5A 1R6TA 2H3HA 1KH1A 3MINB 4JUBA 4CMAA 3FTEA 4OHMA 1Z56C 1LDBA 4TTQA 5EKUA 3ZXSA 4E3WA 4F3YA 3KKQA 1L5HA 3UAXA 3U3MA 3C6KA 2XCIA 3BSYA 4RTLA 1WUJS 3R9IA 3GLUA 3KJQA 4QUJA 2DPLA 2MWMA 3DPIA 1L8AA 3NBXX 1NV8A 1GL6A 2NYVA 3P0JA 3Q7PA 4LX8A 4FCVA 3WL6A 1ORVA 4DARA 3OTWA 1K9VF 5DBIA 2FFQA 2R44A 4LQCA 3WQHA 3OT4A 4DWVA 3M0EA 1ZJWA 5BWNA 2W5UA 3IERA 2AMFA 2B4QA 3NUZA 4BO0A 4UHCA 3EOZA 4WLVA 3FNQA 2UZ3A 2HSGA 4KEAA 3FWYA 1TUGA 1U1IA 4ER5A 2CXUA 2VH5R 3GFTA 3M81A 1YTUA 5EPOA 1YIOA 2CKMA 3D0KA 4JCCA 1DKNA 4WOJA 3G3EA 5CVEA 2EZ9A 1GGJA 3IUSA 5J59A 1TVMA 2VK1A 5ADWA 5KOJB 1YGYA 4CMEA 3A25A 4C2UA 3PZRA 3IE1A 1AN0A 1CY0A 4MVJF 1C29B 3TLAA 3VKWA 2FA9A 3WQRA 3K6SB 4CXMA 1C9JA 2OYSA 2X8BA 1TFUA 4MW7A 3GUYA