3A3NA

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the two c-terminal residues
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
319
structure length
319
Chain Sequence
TQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 113
structure length 319
sequence length 319
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3a3nA00
3DE4X 3EDYA 3GT4A 4YN3A 3WIVA 4BWGA 1SBTA 1P7WA 4MZDA 3VV2A 1BJRE 2HPZA 3DE1X 3DYBA 1TM4E 1WMDA 2PWBA 3ZXYA 4C3VA 4B5LA 1Y3CE 5I9SA 1TM7E 4NMXB 4HVLA 1OT5A 5ARDA 1T1IA 3Q5GA 2PWAA 1BFKA 1KE1A 3DDZX 3F7OA 4NE9A 2PKCA 1SCNE 2HD4A 3DVQX 4WOCA 1SCDA 1AK9A 1R6VA 1EA7A 1TO1E 2XRMA 1KDVA 4DJ5X 1GNSA 1XF1A 3SICE 2B6NA 3CO0S 4KG7A 3VYVA 2W2MA 2ZWPA 1GCIA 4K8RB 2W2NA 3A3NA 2IY9A 2P4EA 1YJAA 2ID8A 4JP8A 1SBNE 3P5BA 2ID4A 2PQ2A 1GA1A 1SBCA 1GNVA 3D43A 2WUVA 1AV7A 1V6CA 2X8JA 3AJ9A 2IXTA 4LVNA 3UNXA 1ST3A 4NE7A 4CFYA 1ZVJA 1YJBA 3EE6A 1SIBE 1TECE 2PYZA 1SELA 2V8BA 1SCJA 3QMPA 1GT91 1NDUA 1C3LA 1S01A 4J94A 5JXGA 1A2QA 3DW3X 4CG0A 3F7MA 1EGQA 3BGOS 2DQKA 1PFGA 1T1EA 3OSZA 1MEEA 1AH2A 1GTJ1 3T41A 1Y3DE 3PRKE 3DVRX 5AQEA 2SBTA 1SBIA 1SUDA 1SVNA 1YJCA 2TECE 2G4VA 3GCWA 3VHQA 4H6VA 2Z58A 3L1KA 5ARBA 4KPGA 4AKTA 1DUIA 3WIUA 1R0RE 1SBHA 1BH6A 1Y4AE 1TM5E 2ZWOA 1OYOA 1THMA 1KDZA 3VSBA 4C3UA 1AVTA 1SIUA 1SUCA 3BPSA 2Z57A 1C9NA 1SUEA 1Y1KE 1SUBA 1SH7A 3WHIA 2WUWE 1LW6E 3DE2X 1PEKE 2DP4E 5CW1A 3CNQS 1AQNA 5JXJA 1ST2A 3VV3A 1ZVKA 4I0WB 1S2NA 1C9MA 3Q40A 3QTLA 4WOBA 1DBIA 4DWWA 1TK2A 5ARCA 1KDYA 5SICE 1WMFA 2GKOA 5FBZA 5JMOA 1Y48E 1T1GA 3QFHA 4HX2A 2QTWB 2WWTA 5AMXA 1AU9A 1TM1E 2Z2YA 1OYVA 1CSEE 1TO2E 1NDQA 3DWEX 3DE6X 3ZXXA 1WSDA 1MPTA 1AF4A 5FFNA 1KE2A 1IC6A 2PRKA 1VSBA 4GI3A 2Z30A 2Z2ZA 1BE6A 2SNIE 3I30X 1SCAA 1S02A 1GA6A 5B1DA 3VTAA 4OMCA 1BE8A 5JXHA 1SCBA 4OV6B 1Y3FE 1Y34E 1HT3A 1P7VA 2SECE 2SICE 3I2YX 1WVMA 4ZARA 4Z2AA 1TMGE 2W2PA 3SQOA 3DE3X 5FAXA 4AKSA 1JEAA 4DZTA 1SUPA 3I37X 1GA4A 2ST1A 2DUJA 2WV7A 1IAVA 3LPCA 1PJ8A 1YU6A 1BFUA 1Y33E 1R64A 1Y9ZA 3DW1X 3DE7X 4M1ZA 3BX1A 3WQBA 5JXIA 5B1EA 2ZRQA 4FONA 1SPBS 3LPAA 1PTKA 2XTJA 1Y3BE 4ZOQI 1C9JA 1GTG1 3H42B 5AVKA 1SIOA 2Z2XA 3LXUX 2X8JB 2E1PA 3AFGA 3LPDA 3AJ8A 3HJRA 2PMWB 5AVJA 1UBNA 5K7SA 1SN7A 1NLUA 3EIFA 1GTL1 4H6WA 3GCXA 1Y4DE 1CNMA 3A3PA 4CFZA 3A3OA 3GT3A 1P8JA 1Q5PA 2W2QA 3TI7A 3TECE 1TM3E 1V5IA 4LVOA 3DE0X 3TI9A 3DE5X 4RYDA 3DVSX 3I34X 2W2OA 4H6XA 4OMDA 1WMEA 3D9QX 3F49S 1SUAA 2Z56A 3PTLA 4KB5A
chains in the Genus database with same CATH superfamily
2CXOA 3K15A 4NEGA 3U5TA 3T5CA 1FNSA 1VE7A 3VH4A 3D8SA 3D8UA 4GI1A 2ZYGA 1U8ZA 2HA5A 4S1VA 1BXRA 5U1PA 1AHHA 2UYGA 1EZ4A 1HF3A 5DIFA 3K70C 4CEHA 2X1VA 2AQIA 1XFAA 1PNQA 2AXNA 3MPUA 2UXCB 3VYWA 3PQ5A 1TJNA 3KXDA 2RONA 2O8BB 3PHCA 1XQ9A 1TT5B 1AKUA 1N9ZA 1KMCA 2JAOA 3IL2A 1NZJA 3E18A 1HQDA 2FY8A 2NUTB 1J0EA 1U0NA 4F5ZA 5LJIA 1M1YE 4ZOAA 4FFDA 4E5KA 3SM9A 3A6EA 2PRIA 3QIVA 3T5AA 4ZEMA 3DL7A 4M83A 5DWQA 1PJ2A 2PWBA 1CJSA 3PIRA 2TS1A 1KJWA 1QKIA 2ZIXA 3DH0A 4ND4A 5FEUA 3IIKA 4W1RA 1L3BA 3ENWA 3H2SA 1TM7E 3PL5A 4NRDA 4P34A 1PR1A 4EI9A 4KXLA 5A7GA 2AG6A 5DN9A 3C97A 4RPJA 2AC4A 5IC6A 4X6YA 2X23A 5H5JA 1EA5A 3ML1A 1U8FO 1ZCAA 3H1EA 4RORA 4NE9A 2C3YA 4WASA 1WXWA 3I23A 3M89A 1VMIA 1W34A 1FDUA 3M81A 1T4DA 4KQMA 2VRCA 1BDJA 2OHFA 2QTAA 4DHWA 4Y2JA 3O7MA 4BMNA 3TPZA 5GJVC 5F3WB 2WNSA 4PZCA 5TF4A 1R0ZA 4IF6A 2QM3A 1XCOA 3JYLA 4ZHQB 1KI7A 1Z2OX 3FYHA 4BQQA 4CCYA 4UOQA 4HDKB 1EIWA 1BXKA 1J2UA 5LUAA 4DIEA 4G85A 3ZZ0A 3SEAA 4DSZA 2HDOA 3PJGA 5C3UA 2QD2A 5AVSA 2H7XA 1EVZA 1M54A 3HN7A 1OX5A 2UZAA 4XDZA 3O9ZA 4HI0E 1KR5A 5AM1A 2Q5IA 3UTCA 1WU8A 4A0HA 2H59A 1P91A 4RH0A 4KR2A 3WDMA 5JD3A 2FOXA 2JFBA 4J2HA 3RF7A 3SF8A 1E3MA 3GT7A 2PLNA 2QD3A 3OURA 5BPFA 1OWLA 1QS0B 5CFLA 2FYTA 2XB9A 4NBUA 3GO4A 4KQ9A 2XCOA 4BIIA 3C7CB 1V8FA 3QRWA 1TYEB 4ITRC 3B1ZA 4M2LA 3WJ7A 1QRAA 4ZICA 3AWDA 3NP7A 4ZYLA 2ZVQX 4HHEA 4TUYF 1SBNE 3ZI4A 4LOIA 5B6JA 3D6MA 3ENKA 1WUTA 3NETA 4KPYA 2XYQA 3HCOA 1XNHA 3IE2A 3K16A 1QH8A 1WE2A 1UJCA 2I34A 3CE9A 3D8NA 3IH5A 3IP1A 1RCFA 2BFEB 3P0JA 5A0FA 1NX9A 1T8TA 2ZI4A 5KTOA 1WBDA 4DLSA 5BNTA 2JGIA 3T4PA 3ENNA 4R41A 1SBCA 3R9XA 1DBSA 3HVKA 4EH1A 2JKVA 1HZZA 1I0LA 3ZV3A 1CDOA 4AROA 4CT4B 1XV5A 3EUWA 3K05A 2VO1A 3DEJA 4ZWNA 3CH6A 3V7YA 3NEAA 5KJFA 3DBHA 2RBGA 4ZI3A 5F2NA 4P84A 4TWIA 2AW3A 1YT5A 3S7TA 3WLJA 1QQBA 1G1AA 3C87A 3SHOA 2OGWA 2J3QA 2Q4OA 1V3QE 3E5HA 5C8YA 2HNKA 1T5DX 1K9SA 1A71A 2B20A 2X77A 3WYGA 1YAHA 1NF9A 2EV9A 2W4MA 3F5SA 4KQEA 4AKHA 1RRMA 1WTAA 2WM8A 2E4XA 5AI6A 1IDOA 1O89A 2GVDC 1EAYA 1N1EA 1IH8A 1JU9A 3OZIA 3JZMA 4AIRA 4PG5A 821PA 1AKNA 1P1IA 3IUJA 5DGXA 3KM0A 1AY0A 5B3JA 3WQHA 2CWWA 5HG0A 3BRSA 1NIPA 2B35A 2OZVA 1QANA 2JW5A 3IX7A 3UCFA 4QOHA 2IP2A 3VHRA 1ZKMA 3S2FA 2Z6QA 4FQ8A 3RS4A 5NULA 4WVFA 2HK7A 2NM0A 1Q7CA 1U2GA 1W6RA 3MJVA 1GXSA 4MHSA 3KVNA 4RQUA 1EPUA 1UEXC 4HB4A 3CRZA 3UY4A 2IUFA 3DZHA 2ZB2A 2C20A 4F9GA 5H59A 1P9WA 3QVJA 5IAJA 2I6QA 1V43A 2NACA 3GFFA 3E82A 4G5QA 4HGYA 5DHPA 3T0GA 3GMSA 2YS6A 4H60A 1JQKA 1PJBA 2OOSA 2PXCA 4AD8A 1J2JA 3RYHB 2G82A 1BWPA 1KKUA 3L8ZA 1L5RA 4BQIA 1Y42X 1W36D 1VP3A 1NIJA 5JADA 3DR3A 2VA9A 1LPOA 1FYWA 4F46A 1GTJ1 4X5OA 3WQQA 2NPIA 2AMFA 4HFMA 4W5NA 1OA1A 2QF7A 3DVRX 2C03A 3VISA 4AWAA 2C2OA 2HPAA 4LHEA 4TSRA 1SD2A 3OY2A 9GPBA 1L5VA 4BTLA 4C2BA 2GK4A 4K03A 3B1XA 1A4UA 4Q48A 4JP1A 1VSVA 5DU2A 2GPYA 2DXIA 3R0VA 4R2MA 2B4QA 2QRQA 1DO2A 2V5AA 2YX1A 1RE0A 1B74A 1BQ3A 1GSHA 2BN4A 2YCLA 1Q1EA 3AVPA 1IMOA 2O5VA 1ZDMA 4H6VA 2CCJA 2NTYC 3LLVA 2ZDGA 1OZGA 5TQ0B 2ZSUA 4PNZA 4PZ0A 4ONEA 1JIIA 3AU9A 4H27A 3BE4A 2NTNA 1PL6A 3PNOA 5BQ5A 4HZUB 5KHAA 3U44B 1QR6A 4C04A 1VCIA 2A3RA 2B2CA 2ZWOA 2AGVA 3ORFA 3SS9X 1W88A 1Z18A 4MVJH 4NXMB 4EHFA 4PC6A 3FROA 4OI2A 1LPMA 3FNGA 3O8CA 4BO1A 1J97A 1VE1A 3DTTA 4WN3A 2RHMA 4CTJA 4P54A 2EQBA 2CF5A 5AHRA 4J43A 4ITVA 2JASA 3M49A 4U3JA 5HKKD 5IAOA 3LO5A 3NV9A 1Z7YA 4AL4A 1GPAA 3TDMA 2FSGA 1Z36A 1OXUA 3TQSA 3RFCA 3ZY6A 1YONA 4KGXA 4MWGA 3UTDA 1E1RA 2FVXA 3IESA 2I76A 1J1ZA 5IARA 4AURA 3A8TA 4DA8A 4HKTA 1GO2A 1XJ0A 2PLWA 5TE9A 2OCXA 5LB4A 3X1JA 1QYVA 4B3BA 4AZ3B 1N7GA 2PTGA 3CV3A 3RYIB 2TMGA 2Q21A 5LOVA 2FRVA 4M8LA 1ZU4A 2WP0A 1ESMA 3HKDB 2NSLA 4QAQA 1HMPA 3T1OA 3OICA 3NNNA 2I4NA 4CKEA 5CDGA 4PPFA 1BCRB 1A9RA 1AQNA 3V1MA 4MP6A 3H5VA 1RLTA 5DP1A 4BJ1A 3BDIA 4PFSA 4BVAA 2VQ6A 4HNHA 5CH3A 3CVWA 4QRHA 1U2DC 3H11A 2Q41A 2R751 3EIWA 3EQ2A 2WIDA 3GCDA 3E53A 1FUKA 3GNLA 3NGLA 4GVLA 3DJFA 3QXSA 1LVHA 2WZCA 2JGDB 1SU6A 1NI5A 1W0JA 2QA5A 3AESA 1M7GA 5HCIA 4C4OA 2C1ZA 4HNTA 1NYLA 1DWPA 4PZYA 4WLOA 1GUFA 1P60A 1L8AA 1FJXA 3AF6A 3IO5A 1QZUA 3KDSE 4IM7A 1KHHA 1H1DA 2XOXA 4DQVA 1S3SA 5K8VA 3OA0A 3W5SA 2JGEA 2BEVB 2P30A 2Z3WA 3L7AA 3R6TA 2YCBA 3HNOA 1KZYC 3LSTA 4N0EA 1YZHA 4XI9A 5TXGA 3VR6D 2H8GA 5DLDA 2YBDA 1O9HA 3HC7A 4B0PA 4W8GA 3AFNA 4NOJA 1ZCFA 4H4CA 4JC0A 4CLEA 4JI5B 3K9WA 5TQVA 3LWBA 1JKIA 3JD3A 1WXIA 3JRNA 4IMJB 4YRNA 4HX2A 4D0RA 2REQA 3SIXA 4BCCA 4EFNA 5EJ4A 3M1LA 1A7UA 4DA6A 4B31A 5LPNA 3GLIB 5A3SA 3AL0C 3KEMA 1GGKA 2DWQA 2X3YA 4AZVA 1QX4A 1EX9A 2J3IA 2WJPA 3GJ7A 3Q7IA 4DMCA 1WU7A 1N4DA 2ERYA 1YRLA 3DV0B 1KVQA 3DWEX 1MV5A 3ZXXA 2DU8A 4ZAWA 3ORSA 5GZ3A 2E4UA 3LLUA 1VCNA 5IYZA 4EYQA 4N54A 1WL8A 4W1QA 3BGVA 1DAOA 3O03A 3DXYA 3MRVA 4OJYA 3G23A 4QRIA 5EWMB 1NMQA 2IHUA 4WEQA 3C8UA 1J99A 3TRKA 3VVBA 4GOJA 1NUHA 1QGZA 1VKHA 5BN4B 1P72A 2XYVA 3RYFA 2RK6A 1ZGJA 4Z8XA 4GI7A 3RYCA 3C2QA 1NTRA 4TQ9A 1L4FA 1UC5B 4GL4A 4EO4A 4F04A 2K7FA 1RCUA 1DFIA 1RI5A 3KZNA 5E8JA 2V4MA 4BZWA 1D2AA 2Z30A 4GZ6A 1XKTA 1RZ3A 1KIAA 1CE8B 3KQMA 2BUCA 4P82A 3RB8A 4S0ZA 3OI7A 2BEWA 5AYVA 1NUPA 1VOTA 3EBOA 2UAGA 3F3MA 2NUAB 4YV1A 4B9EA 1VI5A 2IYNA 2P4HX 2JAQA 1IHDA 3UHFA 1GA6A 3EUEA 1TU3A 1VZ2A 2BDEA 2JJQA 3LKDA 5ALIA 4DLVA 4IDNA 1T3SA 4GR4A 2I65A 4J0IA 4MK4A 4B0OA 4XASA 5CNIA 3C1OA 3EFBA 3S2SA 5A2GA 3KSUA 3WLQA 4DAEA 1SHZA 2IUUA 4I5EA 1WKCA 5JSZB 5DXAA 2KSQA 3NHWA 4HNAB 4K6HA 4YI3A 3CVXA 1PV1A 3R2JA 4FOSA 4BGVA 3RAFC 4QFMA 1OVMA 1VCHA 3IO3A 1GG5A 5LVAA 2BEKA 1PR0A 3ELWA 1E3LA 2WHPB 1HNNA 2F43A 5HJ5A 4YV0A 2OB1A 1WVMA 3U49A 2EARA 4YUXA 4L51A 1TMGE 2RGNA 1SXJA 2W2PA 3SVZA 5IXYA 4AYWA 5J2TF 1YOVA 2PKXA 4OCZA 3FMOB 4M1YA 2X7JA 1YL6A 3NRJA 3ZIAA 1E58A 1YMQA 2FGKA 2FNAA 3NFYA 1W59A 3LKVA 1NX6A 1SUPA 3FCEA 2GZMA 1G38A 1E62A 4GU5A 2H1FA 1M0EA 1AZSC 5G40A 4KN9S 1QYCA 1DJLA 4OQMA 3ASUA 1WDMA 1BGXT 3H65A 2M6SA 2RK4A 2ODAA 4C30A 3WRXA 4C4PA 2Q0XA 1XWIA 2IQIA 2C5HA 2P0AA 3PD1A 4PR3A 4U5XA 3KDAA 3OMXA 2JFGA 2CXPA 1NSYA 3TL3A 1PR9A 2HOQA 1ZP6A 1AGXA 2ORYA 3KQPA 4EB8A 4RD3A 2I3GA 3V33A 3SCZA 3UHPA 4B1FA 4WBNA 1CP2A 1PQUA 1VE9A 1U5CA 2P91A 2O1SA 2Y93A 2VTBA 1K6EA 5C5IA 2WJGA 4DJAA 3BX1A 1E7YA 5FRDA 4BNYA 3P20A 3NC1C 16PKA 4UCXA 1XRQA 2GCEA 1KRHA 4GKBA 2JFFA 3T9FA 4QYTA 2XA9A 1SPBS 2D5CA 3K2IA 2RI6A 5JUWA 2G3YA 1KMHA 2W48A 4LSMA 5CM9C 1EUCB 4Z9BA 3FG9A 3HP1A 4OJTA 2GF2A 3GA7A 4M49A 3JASB 5JR3A 1YQGA 3S6JA 2H2IA 2IVZA 4ZEOA 1T2NA 2QAGB 1NG9A 1YQTA 4QE3A 5HFNA 1KEEA 3GJSA 1N7HA 3OHMA 3TLGB 3ENVA 4GFDA 1ZK2A 2FPWA 3OTIA 1C3OA 2ZK7A 4IO1A 1DO0A 1IEWA 2QT1A 2IYYA 5C7LO 2P27A 1Y81A 3C8DA 1A7AA 4PYMA 1BE0A 4MVJA 4R8SA 4RFLA 3NEPX 5CMLA 5KJCA 1YE3A 2Z5FA 4PGHA 4F45A 3TW0A 3ZJYA 4Q34A 3GDGA 2C9YA 3HBMA 4XUEA 2PMFA 1NBME 2X6QA 1N9GB 4KAXA 2JJMA 3G2KA 3ENQA 3HJRA 1E2IA 1KETA 2ZYUX 2X4DA 4GWGA 3U3JA 3QUQA 1T2AA 1E1QA 1G8HA 3ZE1B 4BLTA 1J9GA 1F3LA 1ZH0A 3KB2A 3AIIA 3QKSA 1B8PA 1YR2A 3A2NA 4J1TA 5EIBD 3U2QA 2IYSA 4CFZA 3Q3VA 3NVMB 1AKMA 2HRRA 3P2YA 1T5BA 2O2DA 3EMVA 3COJA 1CU1A 1ZR4A 3WO0A 2HIAA 3W2IA 4LYHA 4A23A 3QWHA 5ECGC 1HL7A 1PLLA 4UEQA 4XYMA 2EJUA 3T3NA 2F8SA 2C9DA 1V5IA 2BAGA 1KYYA 2PZ8A 3GPCA 3K3PA 3L8CA 1VXRA 4IGKA 3UXHA 4E13A 2XVYA 3THYB 1KYWA 1W4CA 3UAXA 3A6LA 1V95A 4BJHB 5C3MA 3NWBA 4WH0A 1NUUA 3R5JA 2A1TS 5KAPA 4OAOA 4X71A 1M1YB 2YJ5A 2W2OA 4TKUB 3G2JA 2P9TA 1N5MA 2OFWA 1UBJS 4PYQA 1EK2A 2WHEA 3WAGA 5AJUA 3T0FA 3GLFA 1IY1A 1ZM3A 2J32A 3F6EX 2BBOA 2OILA 2OSBA 2VN8A 4KB5A 3AUFA 3EZLA 2D5AA 2HQRA 2L18A 5CIYA 1ATIA 2O3QA 2ZYTX 3O74A 4FBGA 4HG2A 4YN3A 1Q3KA 1U1CA 3G8BA 4ND5A 2C2XA 3LT0A 4B6PA 4DXHA 2Q0SA 3D1JA 3QLUA 1X9GA 4TT8A 3WNZA 2GJAA 4KHPB 3AVXA 1MAUA 4CM9D 1FZQA 1FVHA 2FP3A 2H63A 2X9VA 2BTQA 3DL0A 3F3KA 1YQUA 3G0CA 3KC2A 3O8QA 3WOVA 3QEAZ 2QBYA 4UBNA 1ZMRA 3B3AA 1XK7A 1GU7A 3TJZA 4B6SA 2J0QA 3HJAA 3LLSA 5CA1A 2F3TA 3N53A 4HC4A 1T2VA 3NVKI 3QPVA 1PRYA 5C8YF 3OLYA 3L46A 5CT6A 1SGWA 2FG5A 1ULUA 1ZC3A 1XU9A 1T2CA 3IDSA 3OT1B 4G63A 2MJLA 1ZK3A 2PM8A 4J8PA 4V0SA 3SS7X 4B3JA 5EJ7A 2P5SA 2R0QC 3SEQA 5JVDA 1K0FA 4CLHA 1RPJA 3DHNA 4M6WA 4FEYA 1P6QA 1NXTA 4OQNA 3RC7A 4Z4HA 3E1GA 3ETCA 4XCXA 4DV2B 1AKQA 3BD7A 4U6SA 1MNQA 1X7WA 4PFQA 4UBOA 4UU0A 4B44A 4UTRA 1U3DA 5FLEX 3OT4A 3V4RA 4DARA 4HVLA 2O8EA 1Z8DA 1FUEA 1VA5A 5JJIA 2VBCA 2FZEA 4R0VA 1L7MA 4WZZA 1WJGA 5DYIA 3OTGA 1ONBA 3PUKA 3DDZX 1NVXQ 4TL9A 3AERA 1XAHA 3JWPA 3LECA 5L3QB 2OGUA 2Z43A 1J21A 3LUKA 4HNUA 1YL5A 2GTHA 3PNVA 1R6TA 1OTYA 1SCNE 1U7HA 2W2LD 3KS9A 3QMMA 4EHDA 1UPXA 1V2GA 1P2SA 1XVTA 4XB2A 3I45A 2HXGA 4PC2A 3UT6A 2W2KA 4ENTA 1YR9A 4RF5A 4DT1A 3GJZA 2OEPA 2IYQA 2I2FA 1QHSA 2EKPA 3N2GA 3OFND 1A9TA 1P8AA 1ZJ4A 1D2GA 2ATCA 3OIYA 4Q05A 3TLZA 5M5BA 3UWMA 2D1YA 2WYOA 1F6WA 5KX5A 3VZDA 1QHXA 1ZH4A 3RTGA 3OTWA 3DEZA 1SC3A 3N3AC 4B5KA 2G4LA 1Z8NA 2HSDA 3A6KA 3AUYA 5A4DA 2ZT8A 3B1YA 4KIGA 3TRJA 1ATZA 3AI2A 2WTNA 4FMCB 1SHLA 1U2EA 2R7LA 2QTMA 3TRDA 1YZFA 3ZOZA 4Z7NB 5BR7A 3SXUB 2IBTA 4CHTA 3SPXA 1WV0A 1QK4A 1YQDA 3LVRE 2XF8A 1E32A 1OF1A 2XDAA 1V4VA 2YYYA 4Q00A 4UVHA 2COUA 2C8KA 1EG2A 4E5MA 2EQ5A 4YUYA 2BOVA 2W2VA 2O0MA 2XMRA 4GD3Q 5BWBA 2P7HA 1KQGA 3RBXA 2E9SA 3DM5A 3UATA 4D6PA 2HCFA 3AWIA 5JU6A 1O94C 1U11A 2NZYA 3H17A 3LX4A 4R8KA 1YDFA 2X13A 1I94B 2G04A 2J5RA 2HK9A 2J8ZA 2ZP1A 2ZYWX 1VHQA 2QTNA 3PGKA 5DYNA 2CMHA 3AT1A 3NIGB 2VP4A 1DKUA 2RGRA 2QL5A 4JEHA 5G0VA 1WP4A 3V2IA 3T06B 3A1UA 1NVMB 4R2LA 5EA2A 3DDUA 4OQZA 5CGZA 2OPHA 1VLJA 4TL6A 4BVHA 5ALSA 1AKRA 1G5FA 1Y98A 2PCJA 5JSFA 2XYHA 5KTKA 1O6FA 5DB4A 1ID8A 3MXOA 5AOVA 3V6MA 3EDCA 1ZJ5A 4E3WA 3GA0A 3BC1A 4H4DA 4JJEA 2GCIA 4EG8A 4I1UA 4PSKA 2GPJA 1G6OA 5AW6A 1NM5A 1NA5A 1QDLB 2P3QA 3C7KA 1PKXA 3GJXC 1J09A 3T5PA 3K8YA 3ROTA 4V3CA 3AQ4A 3R5XA 2ZIAA 4NQZA 3UJPA 3OE7A 4LJRA 3D02A 4N5IX 4DBZA 1KXJA 4S05A 1EBBA 3QKUA 3F1KA 1CR4A 1FFEA 3PC8C 4I50A 3K8ZA 1J20A 1ABEA 2ZAYA 4QU8A 3WBBA 2FQYA 5JY1A 5LOVF 1H2AS 1AMOA 3ZU4A 2KM1A 4KX3A 2PLFA 1B7GO 5AM0A 3MJCA 2O07A 2Y0EA 1E2KA 3Q8XB 4FDAA 5K3SA 2VK4A 3RT9A 2R8BA 1M8KA 3WFZA 2JI6A 1RKBA 1D2RA 4RDXA 7ADHA 3QBVA 2G67A 1IUNA 1XMPA 1Y7IA 1U8EA 4V0NA 5TS3A 1MENA 1VG1A 1YZTA 4MOWA 4EJSB 4HXYA 4BN4A 1CUUA 1CQPA 2UVPA 1QVWA 3JAKA 4X00A 1RLIA 1SVKA 1NXXA 3R24A 2XODA 1C30B 4DMGA 5T3UA 1FPQA 3BORA 3CCBA 3KCQA 3WL7A 4LF9B 3PFKA 4WDQA 1EGQA 3BGOS 4DLUA 4LRTB 5H3CA 4GDMA 2ZJ0A 4KXXA 1IK4A 4QJIA 1E1CA 1RYMA 2VHUA 4LI0A 1TU0A 2I9KA 2EX1A 1JGTA 4P6VF 1AH2A 3CLVA 3CT4A 2P78A 3OEWA 4KVAA 1NC1A 2OYSA 4UAVA 5BW4A 3LOUA 4XLLA 1Q77A 3FPJA 4EHIA 3BHNA 4H3SA 3RU2A 2WG1A 4H7EA 3W9YA 2VK2A 1X7XA 3RC8A 3F4BA 4LNHA 3DLTA 1TA9A 1US8B 3O4IA 1GKLA 4PU0A 3SHFA 3G49A 1T26A 1A1SA 1LC0A 1YJCA 4WV3A 2CMKA 2GOYA 3W8EA 1LEHA 4ABYA 2GNPA 3WK9A 2X5JO 2F8TA 3KVVA 3N07A 1SG9A 5ALHA 2EFCB 4BMCA 3E2MA 2QWXA 1EGVB 1ZGAA 2HC9A 4JUIA 1CZRA 4QG7A 5LWHA 3WIUA 2I29A 2ZM6B 4ZVUA 5I7UA 3RIHA 3GDHA 1SBHA 5FTLA 2RBEA 2WD9A 5U9CA 1W5TA 3CE6A 1G2PA 3R77A 1II8A 3GD7A 3I5MA 3ER8A 1CUFA 2IH2A 3PPXA 4AS2A 3ELYA 1T9KA 2OQ2A 1M1XB 2ORIA 2JF0A 3DZDA 4KNYA 3EGIA 2PBFA 4NJOA 1IQRA 1R9GA 4FCCA 2F1KA 3SIPA 1SM4A 3WK5A 4ZDJA 1V1RB 1IXSB 2QUAA 1N5JA 3DNPA 3B12A 1CB7A 4XQCA 1C9NA 1Z7WA 2R68A 4FS3A 1T91A 2R5WA 3H9UA 3SZRA 1QBGA 4UXIA 4D99A 1LI4A 4RVGA 2XNDA 2C5EA 3E8SA 1JIVA 4S1PA 2QK4A 5FH9A 3O1JC 3SJZA 3WJ1A 3OZSA 1JSLA 3V55A 4D82A 3EPJA 3MJ4A 1OTXA 3P32A 1XCGB 3L6BA 3HHPA 3GGCA 2QP3A 3MS7A 1Z4PX 5CVTA 2ONKA 5FX2A 4G23A 2H4JA 2MSCB 2FOIA 3IAS6 3JPYA 2YHUA 2NO1A 5CHYA 2A58A 3KYCB 3CNQS 5GQSA 3ABOB 1TD1A 3BMOA 3E35A 4TTAA 1YR3A 2CHUA 2PIDA 3EWNA 1JG7A 4D6YA 5MN4A 4HVTA 3VTKA 2C7PA 4UAJA 3HV2A 2I03A 4JYCA 3GEGA 4IS2A 1X38A 2L42A 4ER5A 3IUPA 2EFJA 4I9GA 5IFLA 1EJ6A 3VNAA 1O3YA 3ILSA 3AF5A 1A76A 2V3CC 1QK3A 3L6DA 4C29A 1NJ2A 5HKOA 2D54A 1ORWA 3DLHA 4F06A 1HE5A 3CWCA 3E9EA 1MCZA 2C92A 3K0FA 2H0AA 4LYEA 4JODA 1DFHA 3VGPA 4A82A 5C7YA 1OYYA 4HJXA 1LI7A 1H2FA 1YTLA 4G9BA 3VR0A 2CBGA 1ODJA 3NAZA 4KR6A 1SPXA 2DHRA 5CDHA 5KZMB 4IZOA 2VF4X 3V7UA 4N39A 4HAUA 3VU8A 1ZONA 3HR4A 2C7QA 2XMSA 3EW9A 5K8LA 5IULC 1E5QA 3PZRA 4UASA 4G5HA 1CQIB 3HBFA 1IJKA 2PPLA 4W8HA 4W9NC 4PINA 2HJ9A 2G5CA 3ZHOA 1KEZA 1NPYA 1ABFA 1OH5A 1OR8A 1Z5GA 4L57A 4Y0AA 3TN7A 3HP7A 3IXQA 4KE9A 5LP6A 3K53A 1Z12A 2WWTA 3C48A 2GPBA 3EGOA 3ZEIA 1C0PA 5K2MA 5BSTA 4LE1A 1D1PA 4I9UA 1G5TA 1HLDA 2Y1EA 1E2DA 3R8FA 2QUHA 4WNIA 3O1HB 3D3JA 4BGIA 2P9JA 1JMKC 4AF6A 4OBXA 5CDTA 3OQHA 2QM7A 3H1TA 1FMJA 3HGQA 3ZK9A 2WD7B 2OBBA 5FJIA 1M6VB 2FEKA 5LQSA 4QYXA 3KFLA 4MSUA 5BXQC 3G2HA 4BLVA 1LLQA 4QULA 5BSHA 5TQ2B 1U4OA 2ZEJA 3AOEC 1P1RA 2QZ4A 4OK6A 3VPSA 3B51X 3GNQA 2P0EA 2AMYA 3ECSA 1JH9A 4MVJF 1KEKA 2C9OA 4Z0TA 2R2AA 2FR1A 4MTCA 3FPKA 2H92A 4TPKA 2GCPA 1GRCA 3VO8A 1PEYA 3ZXSA 4E70A 4R40A 4ENRA 3KQLA 3JWIA 2X2OA 2Z5GA 4GZ3A 4Z3OA 3TQRA 1TIKA 3ZLBA 3L5OA 5CDFE 3GAZA 2XJ9A 1ZM4A 4GOND 3KEFA 1FSSA 2YXBA 1TGVA 4PBTA 4RNCA 2B4AA 4A1FA 4Q9HA 2JIRA 3S8YA 3RJZA 4MGZR 4ZVMA 2FRDA 2VJNA 2X15A 2VTDA 2GEKA 2R65A 1WS6A 3HFRA 4IVQA 1S02A 1JG1A 5B1DA 4XM0A 2HSGA 3ITNA 3LX8A 4IOKA 4NYIQ 5K0CA 4S1TA 4BRZA 2DTEA 5JMWA 4JP2A 1FYDA 2DQSA 4MHTA 1ZBDA 1NR7A 2QLBA 3I2JA 5I8WA 4IDQA 3LYUA 5CFZA 2GRUA 5CM2Z 4W4TA 1I13A 2YZMA 2C8VA 1P7VA 4JI7B 2C3MA 3E70C 1QX3A 5DLPA 1XRJA 3HBLA 5I9TA 3N2KA 1JJVA 1TQ6A 4G3XA 4N5LA 2AJDA 3D7SA 4OYLA 2ZTLA 4F21A 3MFQA 1PYOA 3O2JA 4LHXA 3KQHA 2WUGA 1QRTA 1IVYA 2F67A 4HXFB 3RIMA 1ZG3A 2EJCA 3EGDA 3DOUA 1IOVA 1JBKA 3F8WA 4INPA 4TWZA 3ZWWA 2A5DA 2IYTA 4DCJA 8GPBA 4XWWA 2O19A 4HD8A 2PMDA 3SXUA 1V3UA 1Z6YA 4RK5A 5CJJA 3E3AA 1DIAA 5KU1A 2O1XA 2W6MA 3QEMA 2OORC 4OSOA 2QAIA 1QF9A 1XA0A 4YRMA 1H2BA 4GKAA 2CLCX 4PSVA 3VH3A 4QYMA 5JATA 2WPNA 3OPMA 5CFMA 4WNAA 5K0LA 4P81A 4ZOCA 3ZX5A 5KVCA 4L0MA 1R9JA 2EDCA 3WGKA 2AT1A 1ONOA 2VYND 4FXOA 5GY7A 1FNCA 4C14A 1HT0A 2W6PA 1C81A 2Q3HA 5ICEA 2E55A 4IGAA 1VDMA 4RPLA 4L4YA 4IJMA 2VF5X 3DDHA 5F78A 5H4GA 3UBTA 1NJ5A 3OCYA 3FKSA 4IFIA 4TYQA 5M2QA 5LMZA 4ZT5A 3BRCA 4RZUA 5BWOA 4I4CA 4TYNA 3ZGVA 3TZKA 1M9NA 1YS4A 2J87A 3FUUA 1W6UA 2C00A 2ZAOA 3LA8A 1WHSA 3TOSA 5CBPA 1IM2A 4GPAA 4ES6A 3Q3IA 5ILOA 4BFVA 5JVDF 1B0UA 5DCYA 5KHLB 3PEWA 2WZBA 2O7QA 3AONB 1F6BA 1PO7A 1VZ3A 1GPUA 4M76B 4EA9A 1EUDB 5A71A 5CPFA 3KLMX 4R68A 1KEPA 5EE3A 4Z49A 3LLMA 2DJIA 2KMLA 3EQZA 3ZWVA 1ZGGA 1EI9A 2QTBA 3O9MA 4MW0A 5KQPA 4ID3A 4JSRA 4F60A 2G6BA 1EFVB 3FCAA 4RCZA 3C6BA 4MRRA 4XR4A 1NI4B 2DE0X 4YA6A 3A9TA 3RV3A 2F1JA 5FPYA 5TDHA 1W1WA 1N2HA 1LJUA 2WFLA 1QJ4A 1SBQA 3PR1A 4J9VA 4RE6A 3V3TA 4FC6A 1GHTA 3T3OA 4ZP1A 4BECA 1GG9A 2QLFA 5JNRA 2XGMA 3I8XA 4F1JA 2YRFA 3FJYA 1C2TA 1L7DA 4RUKA 1PVDA 1YVUA 2A1UB 5DNAA 1GUYA 2JCVA 3NTOA 4GPIB 3UUEA 3OQMA 4PY2A 3EDMA 3UJ8A 2Q9CA 1G21A 1Q1NA 1UBNA 1UMDB 3VVMA 1R50A 4LWZA 2AZ4A 4C3UA 4B4VA 2JI4A 1GZ5A 1JPUA 1ISIA 2D06A 2J3JA 4GO1A 4HUTA 4ZCIA 5K99A 4D0SA 3L9XA 4NQRA 3GCXA 3PU6A 3O91A 5FR2A 4DEVA 3DP7A 1CNMA 3IELA 2AQ8A 3QWIA 3F6BX 4JQSA 1YR6A 1HQCA 3GT3A 3RFTA 3BJEA 4FOTA 5JH7A 4YIKA 1BRMA 5K51A 2AOTA 3NJRA 5FHRA 3MWYW 3AVUA 4MI6A 5EMMA 3V8PA 3IDZA 3U1TA 3R20A 2GPWA 3QHPA 4RAQA 3TECE 2X8WA 5HEKA 2BCJQ 3N8HA 1AOXA 4JP3A 5ERXA 5FUQA 1DAIA 1KF0A 2IP1A 3L7MA 4NI5A 3PJDA 3IPAA 3RIXA 3LC7O 3UIEA 5EVJA 4CM1A 1CUWA 3W2GA 5D85A 4YCCA 9ABPA 3EZYA 3HB9A 1D07A 4KQKA 4RF4A 3X0DA 4OKIA 5BNFA 4OHPA 4N12A 2LTAA 2IBSA 1QC5B 2Q7XA 3OOYA 2G36A 3P96A 2YS7A 4NZYA 3L40A 3H5LA 3X1DA 2ZULA 4KXYA 2PKWA 2VHCA 2QT0A 3FE2A 4FBMA 5ENVA 1DCKA 5KKNB 1GNRA 4AT1A 5HXAA 5FPPA 4YRBA 4INOA 3W6NA 3NHZA 3VSCA 4EHHA 5BSGA 2ZI7A 1XTVA 1ZJJA 1E92A 3EY9A 1Z63A 4O2BA 2VSFA 3GA5A 2B99A 3IQIX 4FNAA 4YJHA 5ALTA 5P21A 3ZCTA 1DKLA 4JWTA 4UPVA 5EY5B 3TQOA 4BUCA 4BUJA 1I6MA 2JJ1A 1GR1A 1REQA 2K7ZA 1FFWA 4MTLA 4RTRA 4EB0A 4XDHA 2ZIEA 2AZDA 2QDKA 1W5EA 3OAAA 1R8SA 3TG8A 2NTVA 4KBGA 3MOIA 4TXJA 1YUBA 3UUFA 4WCFB 2GYUA 3CUVA 3FGPA 4HEA6 4X97A 3VU9B 4B3RB 1UJBA 2C4NA 4R2KA 4EUSA 2F1HA 4PGFA 3A6PC 2OOKA 2QEQA 4F7WA 2XD4A 5LR6A 2VYCA 4FMDF 4JB2A 3ADCA 3HZZA 1DT3A 4AFNA 4K46A 2WG2A 3GEBA 3M5WA 1D6MA 1U3VA 1ZZGA 2ZBGA 2CJXA 4S12A 5FUWA 4HPJB 1QGUA 3O8BA 1TB4A 4GUDA 1HY3A 3QLEA 4RHXA 5FOQA 4OIMA 1EFHA 3SEFA 4BO3A 3TUZC 1DARA 3W1VA 1VRVA 3QYPA 3QKRB 5C4MA 3W4JA 3ZQJA 3KJIA 2OCAA 4RLHA 4M0LA 2QR2A 3QUCA 3OLQA 1O8CA 1SCDA 2JD2A 3KSRA 3L7NA 1UKVY 3KIPA 1S2IA 4I3GA 1QGDA 5AKYA 3TQIA 4YWJA 1RM5A 2ORED 3FJOA 1ZITA 1BJTA 3EXG1 3VHXA 3OIWA 4G84A 4OQXA 5EWLB 4PX3A 4UTXA 4AW9A 3QUSA 4I55A 4HDSA 3LGAA 3O4FA 3NOVA 1ILWA 2HYIC 4X3CA 3RJ5A 2B8TA 3A1TA 4NCJA 1EKXA 1Y7HA 3SJAA 4DUGD 1KU6A 1EVLA 1WB4A 2QJFA 2ZCVA 1GL7A 1OC4A 1YDHA 5TMDA 2B8EA 2QG9A 2P4EA 3THXA 4NCAA 3AY6A 2MINA 2Z3ZA 4ZGGA 1QLWA 2IYAA 4RGVA 3KG2A 1TT7A 2G9ZA 2JFUA 1XF9A 4ZT4A 1ZBQA 4OHFA 5K3OA 4BPRA 1ML4A 2NPFA 4DIDA 2ASEA 4LQDA 1W47A 4NYMQ 3U56A 4LZAA 4PVDA 5JOQA 1I0ZA 3IRUA 2GM9A 2NUPB 2IWHA 1BWSA 1CNEA 1GNLA 3MCZA 1WXHA 3DO6A 5LP1A 5J5VA 3K70D 3EZ9A 3CZ9A 2I2AA 3AZPA 1T9GS 1J2YA 2Z8YA 1SB8A 1EQAA 3NX4A 4BLUA 5IF3A 3SC2B 3HACA 1XDWA 3FSEA 3CNBA 4TLEA 2VRWA 1V25A 3L0PA 1JIUA 4KDCA 1X94A 4LVNA 4JYAB 4Q1FA 1DXHA 3HCRA 2ZANA 2XE6A 3GB9A 1OI3A 4QDXA 1NVFA 3N5CA 1P2FA 1N0WA 4D02A 2BZ1A 4AKGA 3DO8A 4KOAA 4YJDA 3QNWA 3V4FA 2AR0A 1WNFA 1A5BB 4AMZA 1IEXA 2WSYB 2GYYA 3V2GA 4LF5B 2NU6A 4QPDA 1H2YA 2AHRA 4XCQA 3QITA 3R4CA 4O4LA 1DG3A 1W9HA 4S24A 2Q1SA 1WCWA 5HUQA 1A8IA 2J9RA 3U60B 2C9MA 3GJ3A 2LIVA 1RE1A 3SYKA 4DR1B 2R1ZA 4YRRA 3WYBA 4NZMA 1R88A 5JYBA 3ZE7A 2FKAA 4O08A 1RVV1 3WWCA 5EP3A 2HQOA 3AEXA 3SZ3A 4TTIA 5B7QA 4Y7DA 1TIBA 1C1YA 2R6CA 3L8HA 4YAWA 3IAS1 3A28A 1NJ1A 3UW1A 2H4HA 2HRCA 5EMKA 1GZSA 3UWKA 3WBKA 4EQ6A 3Q6IA 1PQYA 1NDUA 1NVEA 1S8OA 1G98A 1BX1A 2ZZNA 4PYRA 4YY3B 1R1DA 2IIQA 3BCSA 4GMHA 5K0BA 1GAJA 1QQ7A 4ZVLA 5LXTA 4XYBA 4BTEA 1SKYE 5IDQA 2WJJA 3BWYA 3QU9A 1OH8A 3TOXA 2EF1A 2JLUA 2QU7A 4CR6A 3WGLA 4N5MA 3TR6A 4KLRA 1H22A 5DYYA 2DQKA 2HRZA 4E32A 4DM3A 3UV3A 1QVVA 3OO1A 1RQLA 2DR3A 4EK9A 3OSZA 1H8HD 2YXPX 1I4OA 2QSZA 3G2LA 4W5HA 5FJJA 4CMEA 4G5SA 4PAWA 2F1RA 3QVVA 1N6OA 1ZAYA 3HXQA 4H7KA 3RODA 1LRKA 3BH6A 3WE7A 2D62A 4D44A 2QHXA 1KS9A 1N3LA 3TK1A 2KLHA 3HI4A 1Y6FA 4FNOA 2JIZD 3ZGOA 1SD5A 1J2RA 1EVEA 3GLHA 1DO8A 1QFJA 3Q8MA 2C9BA 4JI6B 4IZHA 3C3YA 1FDTA 5TRTA 1Z0FA 2XEDA 2EFDB 1CHNA 2UZ1A 4YQYA 3GLUA 2WTUA 1E60A 1Y7LA 5AM5A 2JLCA 4MEBA 2VDJA 5HS6A 4DGSA 1U7UA 2P90A 3SLRA 1PJSA 4KH0A 2RC5A 1I6WA 2YR0A 4D4GA 1YC2A 4OO3A 1JHUA 4RH3A 3KAJA 4FLMA 1CQZA 2GN1A 3TAUA 3FDZB 4WK4B 3G5UA 2ZM5A 4KRFA 4TS4A 4RPHA 1JFRA 1P4RA 1RS0A 2FZ4A 2FFRA 1XAJA 1ONSA 4I46A 4IDAA 4MW5A 1GGVA 2PRZA 2ZAGA 4KZPA 2H3EA 4L5IA 4KE8A 4LECA 1HNXB 3LCRA 1XAGA 2FFQA 5A9SB 3KXIA 2A86A 2C95A 8ADHA 3TUIC 1OYOA 1JH8A 2BV3A 4Z8YA 4C4YA 2XY4A 3VNRA 5HCUA 1NN0A 1THMA 1OIVA 2CNLA 2J5XA 3EK2A 1KDZA 2IHNA 1XEWY 2IYFA 1WMAA 1UEJA 2EZ4A 2GBFA 3MSCA 4NJEA 1XMSA 5BPHA 2LZ0A 5DYTA 2CXUA 3G2NA 5LZ9A 3VOTA 4JVLA 1NRWA 2HYDA 3IIJA 4BFWA 2O1EA 5JNUA 4BO9A 1Q1AA 3SBOA 2IY8A 3PQ3A 2IBMA 1QH1A 2LKDA 3D2BA 3TMKA 3VKFA 2FJ0A 4NZNA 1T5IA 3GZ4A 4RVSA 3BIXA 5AIBA 4QUJA 3RRZA 3FVWA 2OD2A 1AQUA 3K1JA 3C3AA 1KY2A 3LRPA 1YACA 4MQMA 1SU8A 4E11A 3WGTA 5G2OA 3LBFA 1KL7A 3AFMA 4NK4A 1PEKE 2NU8A 2VK1A 4NFYA 5FXMA 3EEYA 3R7WA 1ZIDA 2IRWA 3AHDA 2FG6C 2J48A 1ORDA 1CLUA 2WKWA 1DEOA 3T99A 4KQXA 3T12A 4QNRA 4JKIA 1EVKA 3WGVA 2AUMA 4P7KA 3PS9A 4JA2A 2VCHA 1YL7A 1BC5A 2XLCA 4B43A 2GLTA 3DL4A 3UK6A 1JIKA 3L1HA 2DUUA 2O7RA 3UJNA 3LY8A 2A0YA 1DKOA 3N0TA 3PQ8A 5EHIA 5I7SA 1OLSA 1GJRA 2FF5A 1UR5A 1DJOA 3BZBA 2PKRA 1AB6A 4QGAA 2Q5LA 1NYRA 4V0ME 5BQXA 3JWJA 4OFXA 3EVFA 2ZG6A 3AR6A 4B8WA 5BNIA 4WSOA 4Q1VA 1LV7A 3BJZA 4WD3A 2IYOA 1WCYA 4PV7A 1GTRA 1Y4SA 1X7HA 3TE6A 1ODFA 1P77A 1NPTO 4XPZA 4F7DA 1I1QB 4DEYA 5DI3B 4KR7A 4XQ0A 1MQ8B 5DRYA 3RSZA 1G20A 3OLXA 2PS3A 4DCTA 4QPZA 4XH9B 3KUXA 3L04A 5DP2A 1OH7A 3QVUA 3AHCA 4MRAA 4BV8A 3DMDA 3I9V1 2P2ZA 3A1DA 1MAWA 1C7EA 3L7KA 3ZIDA 2WSBA 2NSDA 3S8EA 3LP8A 3N8GA 3MWGA 2Z2YA 4J1NA 1E2PA 5A1TA 4DR2B 5G4KA 3DB1A 1MGOA 4YGXB 3QPAA 2AMLA 3IKJA 2G8LA 1JBEA 4ZRMA 4K6KA 1S8NA 3RHZA 3T15A 5B7PA 4XJTA 1UBEA 4AO7A 1YU9A 1O9GA 4EY8A 2FHSA 3EH2A 4M9QA 1PZXA 4C7VA 4UTPA 3PE6A 4ME6A 3D59A 4MR9A 1WBJB 1EFUA 4Y2XA 4B7AA 3WKDA 2P9EA 3MJTA 3MMPA 1QIMA 3DFIA 3MD0A 3FLMA 3OEYA 1H8ED 1N5OX 4FLEA 5DXJA 3VPFA 3VDQA 2H1VA 2G09A 1Q6ZA 4KUEA 4QRDA 4RW0A 4X20A 1M5TA 3VPXA 4D0LB 3GPLA 2OO3A 3QMWA 4MCHA 2A5LA 1IIBA 3REFA 2XSZA 3E0QA 4RJ2A 3TBHA 1TCBA 1ULSA 4N40A 4BKRA 4N3BA 3TLEA 1DAHA 1N8TA 2R62A 4G0PA 4MKZA 1YC5A 2JFZA 3LUJA 2D59A 7ABPA 4HDRB 4ZI7B 1KJZA 4JJ6A 5KNDH 2FX3A 1UKZA 3FPHA 4YJ2A 1N2CA 4WNCA 2G7MC 2EWVA 4U6NA 1Z4LA 1Y7PA 3H16A 1OFIA 2XQGA 4UQPA 4BQRA 4IO0A 5E3JA 2IYUA 5FL7A 1SCAA 1UZAA 1RAFA 5CJPA 3LG2A 1JIQA 3W5IA 3ZHYA 4F11A 2ZUWA 2V7QD 4F9EA 2FFAA 4HQKA 1XEXA 5TMBA 1T24A 5KQGA 1E1NA 1IHYA 5JH7F 4BGUA 4HMQA 4KR0A 2FPPB 2I1WA 3QG1A 4CKXA 1KERA 1N0HA 1U3WA 1MIOB 1T6YA 1W0KA 2JD1A 3CWQA 3OLZA 4NMLA 2HF9A 3PCXA 4S35A 3KT0A 3LPMA 4KXUA 4ND3A 4Q4CA 1Z6TA 4MGIR 3IVGA 2PUEA 2HHAA 4C07A 4NZPA 1NLYA 2J6IA 3ROEA 4XJVA 1RLJA 2CXQA 5CVVA 3SZOA 4Z3KA 1A04A 2OVFA 2P6RA 3H6KA 1CUZA 2Y4OA 1RXYA 2REXB 3LCCA 2VJQA 2IUSA 1PJQA 4XZ3A 1AHNA 1L4GA 3A4TA 3K4QA 3LXMA 1SK9A 4LXXA 2ZSIA 3RRBA 5KNBH 3PE4A 2JI9A 1GUZA 2A4KA 3W90A 2BKLA 4ND2A 2WYVA 3RUEA 1XTRA 4JXXA 1FB5A 1NLZA 1QG6A 2PY6A 1WKVA 1U3FA 2J9FB 3I01A 1H5UA 3R5TA 2PMEA 3N8NA 2Y05A 4JU9A 3FPLA 4Y0NA 1O5OA 1A0OA 4MUNA 3INTA 4UUAA 2FUCA 3IDOA 3DBOB 4UPDA 4KITB 3ZC3A 2WVJA 3ZQUA 1GTSA 1A4RA 1VFNA 4ZEXA 2EERA 4TLCA 4E09A 5C81A 1OAOC 2GI4A 4O2BF 1SC1A 3PRHA 4LNAA 1RZRA 1IPHA 3DW1X 2NAFA 4QXRA 4IJUA 3FNQA 1YS7A 4DR4B 1UBOS 4F2GA 2NZJA 5CH8A 5FOSA 2V9PA 1OFVA 1K97A 1LLFA 4N7MA 4XLTA 2X40A 3NTXA 3NVAA 4UDOA 4LVCA 4NYIR 1E69A 3G89A 5I6DA 2PU5A 1QV9A 1XG5A 5ALXA 4BLPA 4JC5A 4BMXA 1ADCA 2JIPA 4P4SB 1PJLA 3H5IA 4ZK2A 3WZMA 2AOXA 1PU2A 3C3KA 3C3MA 3I0MA 4RKYA 3NBQA 1IEQA 2PUJA 2VJLA 4JBWA 3VMMA 1TD9A 1OMOA 4U39A 4B32A 1A8UA 5KAMA 1VE5A 1E1YA 1SOVA 5TMEA 4TSFA 5BNZA 3EXG2 5AKIA 1XDUA 1M34E 1NBAA 3A14A 1NW3A 4N1AA 4ZJPA 3HYSA 3OOEA 4EHKA 3KKKA 4B2IA 4BY9E 2IDMA 2ZJAA 1KVRA 1X2BA 4ASUD 1YIAA 3GCZA 3IEUA 4HN9A 5HJEA 3AZOA 3D0QA 3NONA 2OPBA 4FSHA 3LZCA 4FYJA 3RFUA 3S2UA 3VKVA 1CXZA 3E81A 3V8RA 5BSVA 8ATCA 1KAHA 1UM9B 4ESHA 3B6EA 1WHTA 3UFXB 2I5PO 1FW8A 4JT8A 3UFBA 4AXBA 2B21A 1W46A 3KXPA 2G0TA 1M6EX 3W7BA 2GR9A 1QAOA 4FHFA 3ORRA 4N9WA 2H29A 3WXBA 5JZVA 4JNKA 1EVQA 4PRKA 3DF7A 4MDFA 3F46A 4D9IA 3IIEA 3RBZA 1A72A 1LQTA 4BO4A 3ESRA 5CDYA 4MV3A 2C97A 2WFZA 4I55F 3RADC 4CZ2A 3I6YA 4OHKA 5E3HA 1I6LA 2H2AA 2IYPA 5JD6A 2P6PA 5EHZA 3ZJ4A 5CNMA 2PWPA 2Z2IA 4AZTA 2BONA 4ZRDA 3UHOA 2PFSA 4P1ZA 4TTTS 1P9NA 2PMBA 2Y6VA 2XKJE 3G1TA 3NI2A 3QK7A 3DA8A 5BVHA 2AN3A 5AVXA 1KMQA 3R3UA 1OAAA 3QI2A 1C1DA 2J0UB 2QZJA 1LJLA 2FMFA 3QENA 4PIPA 4UEKA 5E6RB 5KB3A 4RHCA 2QROA 5JNSA 4WCDA 1AUQA 4YMVA 5L45A 2O3RA 4ZO7A 1DCFA 1Q0TA 4YT4A 4ERNA 2C9ZA 3KOMA 1W52X 3VJMA 2E87A 4TRJA 1I33A 2YXLA 3LO8A 5BSRA 1AUXA 1VL1A 3O1LA 1E9RA 1WQ4A 1FE8A 4HADA 4RVDA 4WKBA 3VOAA 2J59A 1Y1QA 5HIIA 3DMFA 1NYQA 4CGYA 4COKA 5LU9A 1ZVVA 4Z4IA 3STVA 4EABA 4X8OA 2WI8A 2JH3A 2P9QA 4ZV4A 2XTMA 3DONA 2FN9A 1X3LA 4MZDA 4P83A 5GINE 5LA6A 4DQKA 4FYXA 1U0HC 1GGMA 1XMXA 2YUTA 1FFBA 2HPZA 2WHQA 2ZT5A 4C3ZA 1HDZA 2UU9B 4RQAA 2REOA 1G3MA 1A7JA 3KKLA 3NHPA 2FSFA 1P0QA 1QFSA 1ULZA 2BGTA 2GK3A 3L4EA 3O93A 4JFRA 4LF4B 3FSRA 2CVQA 4R69A 4RA9B 4S3MA 4RA6B 5DH9A 2BHRA 2C78A 2XUAA 2ZR0A 1WLYA 3AYZB 3BDAA 3PX2A 1PS9A 2VVTA 1JG6A 3IVAA 4O4LF 4YJ3A 2XT6A 3F98A 1CS0B 1ZD2P 1V8OA 2FUG6 3V4ZA 1HO3A 4IIBA 4NFSA 1MB0A 1JECA 5KSWB 2BFAA 4JEIA 3MWLA 4YRTA 2Y3IA 4ZJZA 3UXMA 4GPTA 3AB8A 5LD2C 3A58B 1V0JA 1XHFA 2W6IA 4HDOB 5DM0A 3WLAA 1PV2A 1NN5A 2RHDA 4MI1A 2A9OA 3BFVA 1A77A 3Q5GA 1JR6A 1KJYA 3OHPA 1VC2A 2JFPA 3K0AB 2JDID 2VPIA 3MJEA 2PSFA 3NWEA 5LXTF 2OFPA 1XRSB 3ZH9B 3TW8B 3DZIA 3V4LA 2ZTHA 3DVQX 4B7CA 4AJHA 4CM4B 1R6BX 5KNDA 1R8YA 2VBFA 2FFHA 4FEGA 4HLCA 4FJ2A 2Y0DA 1Q7EA 3G2OA 5DSTA 4HL6A 4IPTA 3KQUA 4R0MA 4BHTA 3NMUF 4ZOBA 5A5FA 3CY6A 1M2VB 2J3HA 3PQ2A 4G9GA 3VR4H 3QKWA 2F9FA 5I8ZA 4A3SA 2IX9A 2VOEA 3DXXA 3G82C 3P9ZA 1DX6A 5F9MA 5LZ7A 3D4OA 1J2TA 4Q6BA 1YS6A 4L78A 2BM8A 2V3WA 2QD5A 5J23A 4DLKA 2P2LA 3K30A 4ZYTA 4OY3A 4KRGA 4EJFA 3HEAA 2O52A 1II0A 2O7NA 3QBJA 4E5SA 1SAYA 3ZCSA 1TL7C 5L4NA 1W0CA 4J16C 1G8FA 1LC3A 1ULBA 2VDMB 4KDRA 4MVJI 4NARA 3SLGA 5AVUA 2WV9A 3CXUA 3GEMA 2KB0A 3GGSA 4OQYA 3ERCA 1J90A 4XGNA 4K8RB 4WXYB 3NBYC 5IZCA 4EKIA 3HCDA 4K88A 1C3JA 4FE4A 4FYIA 3MLEA 1IUOA 1JBQA 1E2HA 2UUOA 3A3NA 3QH4A 2RG7A 2XWQA 2YYZA 5TLSA 2FV8A 4G4IA 3ABIA 3I9JA 5KNBA 2GCOB 1N92A 4JP8A 2FEWB 1V16B 3JVDA 1JX6A 2EFGA 1K4YA 1V5WA 4RZ2A 1AO3A 5JQGB 3WIEA 3HY3A 3U3OA 3QE2A 1HZZC 3TPFA 3W4IA 1UXIA 3TFQA 4C76A 2IS2A 2RGDA 1IE3A 3ZWCA 4IIYA 2O54A 1YR1A 3UWDA 2HV8A 2JFXA 1W49A 2BFMA 4PZEA 3Q9LA 4TRMA 4ARCA 1NXWA 3ME5A 2CCKA 3A2LA 2ONJA 2X8JA 3BWDD 1RHUA 4CKBA 1SQ6A 4DIFA 3NXSA 1EB8A 1Z2EA 5F73A 2AX4A 4ZTUB 1YDGA 2AKEA 3HLYA 4WKPA 2IOFK 2O0JA 5JJBA 1Z6QA 1SKYB 2Y1KA 4HYYA 3OLWA 4X44A 4XIFA 2G70A 4P86A 3ZHXA 1XKXA 3GG2A 3H5RA 4LY6A 1S3GA 1SK8A 2QTLA 2C8JA 4P5DA 3VPBA 4EDFA 3HUFA 3H1PA 4O4HA 3WNCA 4Z4FA 4IEEA 3NIBA 1YJXA 1ZPDA 1PZHA 2OLEA 4IY1A 3KUUA 5B3JC 1OFHA 1SVLA 1L4BA 1LBIA 3DAGA 5FUYA 2Y8EA 3UAZA 5C0OE 3HO8A 5LYJA 4QZVA 1TK3A 4EVIA 1NE7A 2GPAA 3JS5A 2HDNB 2NQ8A 3VR3A 3M5CA 5AM4A 3ICVA 1U2GC 3VPHA 1NW8A 3CX3A 3QFTA 3QMPA 1XDGA 2QS9A 4KI7A 4BEWA 1NFQA 1Q20A 2BRUC 3PRYA 1YFJA 3QTBA 1JR4A 5BN5B 1R6DA 2V45A 4CQMA 1W30A 2JGNA 1DRUA 5BV1A 4WVLA 3AY7A 1VSTA 2BFDA 1KY3A 4N0MA 4AY2A 1B0ZA 2AC7A 3ZLTA 4BP9A 5K1ZA 3BMQB 3M3DA 1V5EA 3F7MA 2HA0A 1UC9A 4Y98A 4DCMA 5KHOC 2Q3CA 3DMPA 3K6SB 2VR1A 3BRWA 2Y4NA 4G8BA 4YRFA 5F51A 2CV1A 2XB6A 3KLNA 3QGMA 3H6HA 4R54A 1DGQA 3TKYA 4RESA 4PVCA 5DPMA 2H00A 1PSDA 4Q4HA 1F8GA 1OILA 1E94E 3RG8A 3ZCVA 1LFDB 4UE2A 3D1VA 2F3PA 4KTTE 5G0UA 3L4KA 1RXSA 2VWQA 4R8VA 5F5XA 1GPDG 1KIMA 1ZM7A 1SJ9A 1T4GA 1SUDA 1D09A 1E0JA 4QWWA 4JZYA 3IV9A 1BU5A 3GMDA 4K0RA 4FN5A 5E1MA 3A6DA 2VPTA 2ZTMA 2YHAA 4PNPA 1F2UA 1E2LA 1JEJA 4KQ1A 3U4QB 1L8LA 1KO5A 1O94D 3OIDA 2V1UA 4DQXA 5FTWA 1EWYA 4QXPA 4QYIB 2FMHA 1L7OA 3HLKA 1N25A 13PKA 3CCFA 1RLMA 5JW6A 4ARZA 2Q7DA 2ZI9A 4YGYA 4V0OA 2XQKA 4R84A 2XGGA 3QEKA 3GJ5A 1FP6A 5K0TA 2JLRA 3I61A 3R5HA 4YJFA 4C5AA 5BMOA 1KP2A 1QQAA 5FYDA 1UODA 2RKBA 2IYRA 4INZA 5TPWB 1NBHA 1E3DA 3VDMA 3HWSA 2PQ0A 3F71A 3VSBA 4XVRA 4MUYA 2HL6A 1O97C 2WFMA 4JY7A 5EIHA 3ANSA 3LA6A 3MGKA 3Q2OA 4Q7MB 3QFFA 3WGHA 2WAXA 3QE9Y 1WD7A 3FFXA 1Y89A 4YJ2F 3OQ6A 2CKMA 5I3CA 5AXAA 3QV2A 4D79A 2H1WA 3RRYA 1P6XA 3DPIA 3GELA 2R79A 2FP4B 4KC0A 3NBAA 2D7CA 2OO7A 1Z6ZA 2HA7A 1E5VA 1USGA 2QOEA 3CCCA 2QUIA 3S2EA 1SUBA 5EWJA 4EMUA 1SNYA 3P9NA 5L7YA 1Q0LA 1ZUNA 2YDXA 1E64A 3R9IA 1GPLA 4B81A 1LW6E 4MA5A 2WK1A 2GETA 3M5DA 1RD4A 3AUTA 3ZNQA 4XSHA 3IHKA 3KE9A 1T9AA 2IYZA 3P0FA 2M9MA 1AV6A 5AICA 1VYUA 2P2CA 2I4OA 4IGIA 3A25A 1XUOA 2BGJA 2IIBA 1RVDA 2YFQA 3G59A 3HM2A 4ECEA 1O7JA 2WWHA 3UT5B 2KS6A 1S6YA 2QDXA 4BLQA 1C8KA 2YHSA 4EFLA 4EGAA 4RTJA 1CFJA 1EFAA 4PRLA 1KEVA 2PVPA 1JMYA 2GHTA 1F2TA 4F2DA 3NEJA 4MQFA 1ZXBA 4XJSA 5L9AA 5HF9A 4GVXA 3U40A 1S2DA 1BS1A 2VAPA 2WQ6A 2GN6A 2GZDA 2XNSA 2Z0MA 4AO8A 2I66A 1J0CA 2C1EA 4LDNA 4PICA 2MMCA 2VNHA 2JLYA 1HQKA 1RXCA 3VR4A 1UK6A 1SC4A 3S40A 1BMFA 1CIJA 2VYQA 5I7AA 3VZRA 1FTSA 4UQLA 1TF5A 4K1LA 4NVRA 5T57A 1HEYA 1TTPB 4RAOA 5JC8A 2FLVA 3HXKA 3FHLA 4DA9A 1OHHD 1X87A 2NVBA 2YV2A 3FPAA 4C88A 5FNZA 2R1TB 2GEVA 2BGIA 4JCOA 4MITA 5JSUA 2BLLA 3W2EA 1EESA 1GWNA 1XYYA 2O3TA 1S4MA 3PX3A 3A7DA 1YK1A 3AMVA 5GGYA 4OI1A 4DLLA 4F3RA 2J5BA 5EJIA 4R9RA 5K6TA 5JNLA 3AF0A 5JPCA 1K5GA 3E9MA 2ZQZA 3G9QA 4V1CB 5K8CA 1OYVA 2P69A 5K8TA 4HV4A 1TO2E 3NDPA 4NULA 2MOKA 3ZI0A 1YULA 3GUYA 3HA5A 3F97A 1FBNA 3EXHC 4FZ5A 4L07A 1H9BA 4EKYA 4FMDB 3DE6X 1R9NA 2POCA 2FVYA 3ESXA 4INAA 2BR4A 2YVLA 2HU2A 3EVAA 5KWVA 4KQ6A 7MDHA 4EKGA 5FUVA 4WADA 4UEJA 4BDSA 3VZQA 2QTTA 3P4XA 2AK2A 1PJZA 2DFNA 3WDLA 2XITA 3FB1A 1DTWA 5E9WA 4ZIRB 1EE2A 2B2NA 5F12A 3BQMB 1A27A 2Z1MA 1EFRD 3S29A 4CV1A 4DRYA 4YUZA 5J4VA 4O4JA 1JTEA 1VHJA 1VPEA 4YUVA 3OEHA 2X5KO 3U3RA 3PC4A 2QUZA 3COVA 4HNRA 3IGFA 4LV5B 4QYWA 3X1KA 4B7XA 3BJIC 1I3KA 2P1ZA 5DXFA 5HQJA 4FZJA 1UBSB 4G5GA 3M1AA 5HDQA 3I2HA 3H75A 4JCCA 2CUKA 4XPIA 4OM8A 3DKPA 3WK8A 3G0HA 3W3ZB 3KJGA 3QKIA 3E4DA 3VJKA 1Y5LA 1E2EA 2BDTA 1UXJA 2W8BA 1GFZA 3QWBA 4HQLA 4G9EA 3HZRA 5LDGA 2WUDA 1ZCZA 3AR3A 2E18A 2AFHA 1KO7A 1VGVA 2FZLA 3CONA 3II6X 3L41A 1XD8A 4I8DA 4M86A 3ANMA 4JLDA 5GOTA 1OXKB 2C54A 5DK4A 1T2DA 3WJAA 4RJTA 1FQJA 1RI3A 3A6ZA 5LN1A 1Z13A 3PYLA 3WV4A 2RH4A 3HFJA 3NLLA 3OUUA 4IEIA 3B7WA 1JIJA 1K7FB 1AA9A 2P7IA 1HT3A 3F96A 2IZ5A 1N2EA 4AS3A 3JY6A 5GM1A 5BYKA 2LCIA 2RGNC 1SXJC 2BF4A 3I5UA 3T38A 1IN1A 1N5IA 2IYLD 3FPEA 4BZZA 2YZKA 1TVEA 1KVSA 3ZJTA 4IXMA 2ZUBA 5L53A 1P4HA 2YC2C 3O4HA 2QYOA 4BMDA 1GGEA 2ZUUA 4P08A 2Z5VA 4QOEA 1PTJC 4C0WA 5G1PA 3GZNA 3W77A 1KI2A 4LRXA 3ZLUA 4RH1A 3GVIA 1TCVA 4Q47A 5HZGA 2BMDA 3WAJA 2G1PA 1GGNA 3M6IA 1QM5A 3OP1A 3WRXC 2ZAMA 1D04A 4I9HA 5ITSA 1QO7A 4S0XA 2ST1A 1TW3A 3A4VA 4N0PA 1FW6A 2V0CA 1LVGA 2RGYA 1M34B 3HKBA 4BVLA 3LUHA 4QQFA 4RK0A 3JXEA 1DIBA 4TWAA 4ZVQA 3LC2O 2FA9A 3CZ4A 2D4HA 4A15A 1C4OA 2G9QA 2YN4A 1ZIXA 3U0VA 2F62A 2XOEA 1VI2A 3EEQA 3PSHA 1M75A 2VCYA 1N0VC 2GJSA 3C4QA 2VPQA 5JMTA 1KARA 2HY7A 5LA6F 1O5TA 4QBIA 2JB9A 2NNLD 1XMJA 3PHIA 5JS8A 1J33A 1DV2A 1ZWLA 1YDMA 2NZ2A 2ZI5A 2WF6A 1S5PA 2ZYVX 5JD4A 5EJMA 4HLNA 4R05A 2Z5LA 3H7IA 4JXKA 4MKIA 4Q3NA 3SM3A 5IUKC 5KOHB 3ITEA 1GYQA 3TS1A 1VB5A 1CY0A 2CSUA 2ACVA 1DC8A 2GBCA 4YJ3F 2O2CA 5ALQA 3QVXA 3HYLA 4RY9A 2V54A 2WABA 4DG9A 2PT9A 3SVLA 5E1DA 2J45A 2O4CA 4Q4AB 4NH4A 4PYNA 3WTBA 4JSTA 2PX2A 3DZCA 1XNQB 2VJPA 2XTNA 5HSGA 4J4HA 2AQKA 1G6Q1 3PEUA 5BN3B 3H42B 3ILHA 3UAGA 4ZAFA 1R5OA 4NHEA 5CT9A 3CIOA 4JQOA 1WDWB 2EX4A 2FDXA 1PZNA 2P1RA 4NBVA 5BV0A 2IW1A 1DELA 2PGAA 1CUVA 2A0XA 3IILA 1U63A 1K98A 1VLZA 3L8GA 4MWTA 4WFJA 1Y9AA 4JLVA 3CKLA 1N5LA 3H2GA 3KR1A 5E0KB 3U9LA 5TGDA 4ISBA 1BROA 3GXBA 4NC9A 1CB0A 1QGYA 1DKPA 5CFQA 1MW8X 4P2GA 1RYHA 4L75A 1V4NA 2OFFA 4RU1A 4J1TC 1JWLA 3W9UA 5D5HA 4RIGA 3R76A 4E5UA 5C8DA 4FYPA 3C5CA 5JNWA 4RIEA 2I55A 2PZAA 1QGED 3P2OA 4BU1A 5LMCA 5K8UA 3U19A 1RRCA 3EGEA 3ON5A 3PYMA 5IG2A 3EEOA 3DR5A 5EE1A 3HY4A 3ZE0B 2H57A 1RRVA 4B7UA 3MCAA 3C74A 2P79A 5KTTA 3QIAA 3QXXA 4REQB 1ULHA 2VJDA 2ZBDA 3BVPA 3R7FA 5GIOE 3EASA 3WYNA 3VR2A 3SX2A 1MORA 4D8UA 1C9EA 4HPXB 3O4RA 3EQ9A 4ATNA 2R97A 2Q3MA 5TC4A 1MR3F 1ZLYA 4FW8A 2NMVA 3WYDA 2ZSFA 5EUBA 4BPBA 3AL3A 2PZMA 1L5GB 2PRYA 4C0SA 5C52B 8AT1A 1X7ZA 1ITZA 5BW8A 1QIHA 3RUCA 1FC0A 1S2OA 5I9MA 3MTIA 1EP9A 2CNNA 3D6NB 4KUHA 3SE7A 4EG7A 1GGFA 3JYOA 3ZWDA 4OGFA 3W2HA 4DZZA 4LRWA 3RO7A 3PTLA 2D0PB 2IFTA 3DE4X 2Q6TA 5H0IA 1GLGA 4AN0A 3A0RB 2OMEA 3QLUC 3KU1A 1ZL0A 2HJGA 5CAEB 4KR9A 1ODCA 2PZJA 5ALOA 3MW8A 3UT0A 1J4AA 2XMQA 4LWQA 3I1IA 3OJFA 4Q1BA 5JAMA 3P27A 4P0PB 1TVKB 4BNFA 5G41A 3FM9A 1P2UA 2NTEA 5K0FA 3Q0IA 1VECA 3IAUA 4BVEA 3HH8A 2ECFA 1NQXA 3D0OA 3KOXA 3LFUA 1X8JA 1T9CA 3KB8A 4U2EA 4NH0A 3KTAA 1BYUA 2C2KA 4IHQA 4DNOA 1UINA 1GKKA 1HDXA 3BD6A 4HY3A 3M4NA 5DYGA 3R7SA 4GXTA 5SZIA 4A8JC 2II6A 4O4HF 2B4RO 4FFNA 5T6MA 4G4JA 2C82A 3TZLA 1RXIA 1ZUWA 2XVMA 1LBEA 4RIFA 4BUZA 2VDUE 1OWNA 4EPXA 5LYJF 1YNOA 4YXWD 1RPAA 1TZMA 1DEXA 1Y9JA 4IBOA 3W9SA 1UBRS 3GROA 4C5CA 1RRPA 3U7FB 4Y6QA 4JLJA 2A0WA 4P58A 2VTEA 1MA0A 1S1MA 1DWUA 2Q6OA 2XMZA 2BZGA 3UHJA 3IRVA 3GUZA 4DTIA 2BZ0A 4I4NA 3ZD7A 2FKNA 3ICOA 5E3IA 2YWGA 3P2KA 4LDAA 2OKCA 3INYA 1H9AA 2XLBA 1U4NA 3TVTA 3NO4A 1LWOA 5KYNA 4N0DA 4XVCA 1J8FA 1RKUA 2Q6VA 3U9SA 3KVOA 5IABA 4CLRB 5I9LA 4C7BA 3VC1A 2HF8A 1TKAA 3BM5A 4HTFB 4AB1A 1Y3HA 5GMOA 4AMUA 2ZUFA 1KP9A 1PIWA 2IEGA 3Q5EA 1JSZA 1XQVA 2H5IA 2LD4A 3LZDA 1OPXA 4FYKA 1V26A 2A5GA 5CNJA 1MJHA 1RJEA 5ED0A 3DMTA 3J81k 4R3UC 3SDSA 3U26A 3KKNA 1Z0JA 2ZE5A 1AQYA 4LBYA 3V1YA 2CXHA 2JLBA 3C5HA 4DJ5X 4XOIA 3SICE 4II7A 3ZBUA 4A1OA 1EU1A 1U3TA 3VO2A 2WSIA 5A4MS 4I8IA 3GJ0A 1W1UA 2CF6A 4MPTA 4OEHA 1Y1TA 2CDNA 5A05A 4RQTA 5DCWA 4YAUA 5FEMA 1FJGB 3EG5A 4L9WA 3LFHA 3BREA 2YQZA 1YA8A 3K9NA 2HSJA 1PW7A 2FWNA 2GARA 2IY9A 4G2NA 4TT3D 4ZDIA 5JAHA 4FEAA 3DG9A 2WUEA 3T7DA 3V9PA 4CIAA 2VNJA 3OOHA 4V0LA 4L5CA 3BJRA 3Q8LA 3MILA 5AJHA 5AXBA 2GBLA 2FN3A 5TS2A 2MYUA 1JT9A 1QH9A 1R0YA 4G81A 3SYNA 4WOJA 3WWDA 2LE0A 1GA1A 4PX2A 2Y68A 5FI3A 5BSMA 2PWZA 4WPGA 1VMAA 3HNPA 1FY2A 3RC9A 2O8FB 4LZZA 3T1VA 3WIOA 4REMA 4D8YA 1WV1A 3CR8A 3GR6A 2BBSA 4WRRA 1VA4A 2YWXA 3TFWA 1IBKB 2AI2A 4K6OA 3ET4A 3T52A 1HYBA 3BCHA 3GNSA 2ZTUA 3D6FA 3I83A 3MMNA 3N87A 1ZEMA 3OPYB 4RK1A 5FDFA 5HUJA 1T8PA 2FN7A 1Z7EA 4KLNA 1PT8A 1FSGA 4JLKA 1WZCA 3P9XA 4DANA 3TEJA 2FHPA 2D1QA 2QTVB 1QOZA 2J7PD 2TRSB 2ZYRA 2QP4A 1E79D 2O9JA 2ZI6A 3EWSA 3RVKA 4Q93A 5THKA 4E33A 2Z8XA 1VDZA 3R6LA 4E4RA 2H9AA 2D13A 4FDVA 3EVDA 4DRXB 5J4LA 3B82A 3ZV6A 2J5QA 5HW0A 4H1TA 4QG3A 2R8PA 4E5PA 3ZJUA 1HE8B 4UDNA 3T1HB 2XYGA 2YIDA 2HLDD 3K9QO 4CM8B 2ZXUA 4MQUA 4AP9A 1LPBB 1TECE 5B2ZA 5CA0F 4DWJA 4E46A 4N49A 3PF9A 4FFOA 1XO1A 4PN3A 2YV1A 3SDBA 1U0JA 2XKAA 2Z04A 1VMEA 1Y37A 4OSPA 2HRDA 3VUEA 4DR3B 2PJDA 2OCLA 2WJZB 1I2CA 3EG9B 3KOWA 1TEXA 5DW3A 3NJ8A 2BI8A 3REQA 3ZW9A 4XFDA 1H2EA 4ZOLA 2RKOA 1ECLA 5E1OA 3DBRA 2E0IA 1A9PA 3A31A 2QVLA 4XXHA 5F5LA 1QYDA 3X1YA 2Q28A 1AN0A 1GKIA 2QVGA 3G1WA 1RC1A 4HVCA 3IDFA 3HFSA 4B6EA 3GEEA 2X4GA 2OBLA 4MW6A 4KRXA 4RABA 1HXHA 3KUDA 5DWDA 2HCTA 4R9VA 4IINA 1IPEA 2EC5A 1FOEB 1MEEA 3DFFA 1XA4A 2C3UA 1I7DA 2KX7A 5K3BA 4F8EA 1GDHA 4XD7D 3FOFC 3WLTA 5L7TA 1HDOA 5GONA 4D5EA 3QPUA 4P38A 5MFPA 3OU6A 1U2RA 4LCEA 2NVUB 1J1UA 2PIAA 3Q72A 4REOA 1GQOA 1Q6YA 2O8BA 2OWEA 5E8RA 4UE6A 1NRJB 1F2DA 1TT5A 4ZVNA 1C0IA 5DBFA 3EQ8A 1OW3B 3MT7A 5J2UB 1N5DA 1Z4OA 4TMKA 1KOLA 2NUTA 5AW7A 4UQOA 2WPDA 4KW7A 4FMPA 5TX7A 1SVNA 3GV0A 3WGYA 3CW2A 2MMGA 1U0EA 3MNFA 4MUXA 4PAQA 2D0IA 4DGQA 1M6HA 4EIWA 5AVQA 5I7OA 1OAKA 4ENUA 1XR3A 3VR5H 4L8FA 1EFKA 1ZSVA 3WGNA 4H18A 2H4YA 4HWKA 4PNHA 5BR1A 3HU1A 4L4RA 5DDIP 2Q5QA 1E7WA 2ZZMA 4KWEA 4N7JA 2B4KA 2YRXA 2YXEA 3I8OA 2IX3A 1HM5A 3F6CA 3QHAA 1I5RA 1NJFA 3E23A 2H2HA 3HHEA 1TKRA 4HGRA 1YCDA 1TM5E 1PUIA 1T1JA 3AOGA 3M1YA 3NHJA 4HR7A 3KAKA 4LJAA 5LQKA 1FMLA 3AF3A 3DOIA 3KEQA 1XRLA 1XTSA 3CU5A 2HWKA 4O4JF 2X4LA 2ISQA 1KAGA 1ZX1A 1PDVA 4IDBA 3N1UA 4TVKA 1DC5A 2JL1A 1FBTA 2IUEA 1M0WA 4TKMA 1T36B 3UC9A 1DJQA 4CV2A 1BA3A 3Q3EA 5B4VA 5K6RA 3BPSA 2QI9F 3QU4A 2N9UA 5DNDA 1LNZA 3K2EA 3BIJA 4ZHQA 3WA7A 1GDDA 3K0BA 2P2SA 4QLBA 2X86A 2RGGA 3NJ4A 4HDKA 4JOCA 3KTOA 2PLAA 4XJXA 5DIZA 4EECA 1PK8A 2JZNA 1DG9A 3PDCA 3URMA 2RHHA 3L7IA 4UMDA 3EXFB 1PHPA 2CNWA 2VUHB 2W00A 1PJAA 1D4OA 4PE5B 2ZPAA 3GG9A 3OU2A 3QVOA 3A6GA 3QVMA 3EVTA 5A6SB 3U4HA 4CXMA 5JD5A 4EB6B 3Q11A 3IBGA 4MYSA 1MPXA 2I6GA 4H17A 4CL0A 5FTJA 5LYYA 2WW8A 4ZFNA 1QS0A 1JILA 1XKQA 4K87A 4QHTA 3GGJA 3RIYA 4D5GA 2MSWA 1ZXXA 3LNCA 4W6QA 5U4QA 1S2NA 2IOHA 3L6RA 3IBFA 1J8YF 4M0UA 4TYPA 3AZQA 3OQBA 3IUNA 2NV2B 4I9NA 2Q5OA 4JI0B 1IATA 3V34A 4TKVB 2BC9A 4M9RA 5HMLA 4FSXA 2HWWA 3GRKA 1NNUA 1A50B 1TAGA 4DWWA 5BRJA 4R9UC 2VQEB 3RWMB 2VXYA 3HE3A 3E84A 2HFKA 3LL4A 1G63A 1ZN2A 2R6DA 3NDRA 3O90A 4RZIA 5IH7A 3TG2A 4GYKA 4E0BA 4XQGA 2B0JA 1K8YB 2CVHA 2EZ8A 2FFBA 1NQAO 4WINA 5DLYA 1T9HA 1R27A 2EFYA 4BMZA 2PGJA 5CNKA 2CFRA 3NOXA 5JMOA 2C0QA 3KZCA 3WQRA 4CN9A 1UBTS 1K66A 1ZS9A 2X8AA 3EIQA 5LP6C 3ZVRA 4RLFA 4MRVA 4DZRA 4CDGA 2PKQO 4L74A 2Q1WA 1YKGA 2GBIA 2XTAA 1W87A 5IDYA 4UDYX 3VNQA 1G17A 1I24A 2VH1A 4QSHA 3C5VA 5MHTA 1YZUA 4MW4A 1I2BA 5A1JA 2BFNA 2D74A 1E3WB 4JXZA 2C99A 2NN3C 3O9VA 2A57A 3DLBA 3LW7A 2MSDB 5CRIA 4FFWA 1IN4A 5G53C 1ESNA 1P3JA 4E6EA 1OE0A 5EEHA 1QMPA 2FDRA 1GIAA 4NZ9A 2HHLA 3EFHA 3JQQA 2W71A 1SC9A 1JEYB 3VSEA 1DQNA 1U90A 4OREX 3N7AA 3IDAA 1WETA 1E9FA 3PEFA 1PHRA 1GNQA 2F4NA 4UM8B 2IU4A 5FFNA 1KE2A 2O5CA 4RLSA 2AOUB 1WEKA 3QU5A 4JLNA 2WE7A 5IAKA 2XB8A 1K7CA 1QVZA 4RX1A 2RAPA 2YJ6A 4GI3A 4NIMA 5ICGA 5GJCA 1VRCA 2C2WA 1G8KA 2YDYA 2HO4A 2EATA 5DMXA 4GM4A 2GHIA 3AEKB 2Z2ZA 3NBZC 3ZHRA 1PK9A 3AX6A 4BX3A 3PDWA 1DIGA 3I30X 2FRDC 4GPZA 3CVVA 3QG5A 4QKQA 1ZOPA 2JCBA 3JQBA 4Z99A 3EVEA 4CLXA 1ZSYA 3H99A 1Z06A 1HH4A 2PSHA 1V47A 2Q2QA 3C3DA 3D5EA 4OSEA 4OP1A 5EFZA 1TFRA 4ECAA 4OHZA 2ZRNA 3RYHA 5CB4F 4JVMA 1CR6A 2X6RA 3WRWA 2HWXA 3UF0A 2E5LB 1ZMBA 2HW8A 4Q82A 4NTZA 4QODA 2G9UA 3GY0A 3R23A 3VPAA 4DIUA 2CE2X 4J90A 5JXHA 4XEHA 1Y3FE 1T5OA 1N3IA 2WKQA 4M21A 5YASA 5KWEA 2C7VA 1P7ZA 3KT6A 3DUWA 2WIGA 1DBVO 3EH1A 4LFCB 4EX6A 1NVVQ 4YMGA 2QLLA 2FJPA 4J7UA 2O59A 3TRIA 4B8ZA 3TO5A 3IAAA 3PI7A 4D56A 5AFSA 5JDIA 5FR1A 2HZBA 2VNIA 1VL6A 1H4QA 3CZQA 1ZJZA 2GPNA 2OK7A 5E38A 1PL7A 4ER3A 2CBXA 2XVZA 1RQXA 2Z9BA 4UULA 3UXYA 1UL1X 1QV6A 1WIWA 2OM6A 4ESOA 1P81A 3EISA 5GP1A 5KDOA 1SCKA 4DEXA 2C07A 5TQ0A 4ZMSA 1WZ2A 4C9BA 5C1PA 2OY0A 1IHPA 2F64A 3K0CC 1GQQA 4HZUA 3C8HA 5NLLA 3U44A 4RIHA 3JQRA 3AINA 4MW2A 4BV2A 3MINB 4H0FA 2H54A 3EZXA 3NFRA 4UUOA 5GADl 4ZO4A 1P29A 1ZCBA 3MQFA 1HDIA 4ZK6A 1Y33E 2ONZA 2YWBA 3CVOA 5DN6A 4ZN6A 2UYCA 3L18A 4RYLA 2W37A 4AZWA 4CUKA 4CKZA 3FCUB 4BASA 1X9HA 2V7XA 3C8ZA 1KZ1A 3KZVA 2QENA 1PT7A 5EZYB 3R7LA 5JXIA 1ZI9A 1GOTA 5D84A 2QD1A 5JG7A 3EF0A 1NBEA 2I7DA 2FWIA 1U0SY 4RY2A 1ISMA 1KVTA 3LI2A 3PNBA 3VR5A 3IQZA 3KBBA 4MRPA 5EKDA 3HN2A 4EGJA 1DV1A 2YVUA 4AZ3A 3RYIA 5IK2D 3JZAA 1JRLA 3HUDA 3PUJA 1FSFA 1IB6A 3H13A 3MD9A 2HQ1A 4QIHA 5AVKA 5JMPA 4EGSA 1IULA 3AR4A 4FBLA 1BCRA 4MGEA 8MHTA 1BO6A 1J8VA 2VSYA 1G8AA 1NP3A 3W8DA 1WNTA 3LXUX 4IJ5A 1UBLS 3SYRA 4ERXA 2R00A 1NG1A 2VP2A 1T25A 3S81A 1JEQB 3LRTA 1I4DD 1SCUB 5E9AA 2JGDA 4ZODA 4DDUA 2HA4A 3IXMA 4HUJA 2JIMA 5AI8A 3RBAA 1NF2A 3LHSA 3IQFA 1CTQA 4QBHA 1ZRSA 1QHGA 4G8JA 4HQRA 4AAYA 2G7ZA 4XWKA 1JR3A 1X7GA 3B7GA 2BEVA 3HCBA 4XGRA 1EXDA 4F4JA 4C5BA 3C1TA 3ILYA 1C7QA 1YRYE 1B4DA 3K5HA 4LPSA 3W0LB 4ND6A 5C4IA 1NBIA 2CZCA 4BMYA 4D9NA 3PA8A 2QN7A 2ZJ4A 3FLBA 1KFKB 2FSSA 1E4OA 1P8JA 2Q50A 2WJAA 1H66A 2HEIA 3C3XA 4DC0A 2W42A 4OHXA 3MCWA 1CG6A 4NL4H 2OCYC 4JYMA 2OENG 3Q3GE 4RMIA 5FNVB 4XSVA 1LBQA 3GLIA 1OB5A 3ORYA 2FWRA 3H2BA 1QMGA 1WB6A 2FEMA 3ASZA 2X4IA 2YWJA 1TVCA 4M22A 5EIXA 4G1EB 3UPDA 4C06A 1OLXB 3DV0A 1JA1A 1SKBA 4YS6A 2IPLA 4RS3A 4FYYA 1NV9A 4MVYA 4YV7A 1E2BA 1I5OA 1CCWA 1T34A 2JD0A 1NWHA 3LQQA 5EHQA 3UAYA 1YDEA 5IS2A 5BSFA 2E4VA 1VKRA 1L9XA 5F35A 2YIVX 4QC2A 2HHCA 4KMOA 5EWMA 3KR9A 1YA6A 5LSAA 4NZOA 4MKHA 5A4JA 1FFXB 2BFOA 2V59A 1V1MB 3JARB 1MKYA 3M4XA 3WC4A 5BN4A 2IT1A 3E9NA 1WF3A 4BWGA 2QM0A 4M3NA 521PA 2VDLB 1DE0A