3A3NA

Crystal structure of complex between sa-subtilisin and tk-propeptide with deletion of the two c-terminal residues
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
319
structure length
319
Chain Sequence
TQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the interactions critical for propeptide-catalyzed folding of Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 113
structure length 319
sequence length 319
ec nomenclature ec 3.4.21.-:
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3a3nA00
3LXUX 1SVNA 4H6VA 1TO1E 1KDYA 3GCXA 1AQNA 1TO2E 2W2OA 2P4EA 3DE4X 3QMPA 1THMA 2W2NA 2XRMA 5I9SA 1SIOA 1SH7A 1P7WA 1OT5A 3QFHA 2WUWE 1GA6A 1YJAA 2Z2ZA 1Y33E 2SBTA 2PYZA 3CNQS 1AK9A 3DW1X 3VV3A 3A3OA 5ARCA 3D43A 5JMOA 1C9JA 4KPGA 3ZXXA 1DBIA 3AJ8A 3QTLA 2ID8A 4LVOA 4K8RB 2WWTA 5JXGA 3LPCA 5SICE 4HVLA 4LVNA 4ZARA 2E1PA 2HD4A 3BX1A 3F49S 3I30X 4M1ZA 1NDQA 4CG0A 1WMFA 2Z2YA 2X8JB 2ST1A 1PJ8A 3LPAA 3AJ9A 3EDYA 1NDUA 3Q5GA 2GKOA 1P7VA 1GTG1 5FFNA 2Z58A 1T1GA 1WVMA 1BE6A 1SIBE 1MEEA 1SUBA 3L1KA 5FAXA 1R0RE 4OMDA 1TM5E 3T41A 1SBIA 3DE1X 1SUEA 3DE3X 4MZDA 1PEKE 1TECE 4I0WB 4C3VA 1GT91 2B6NA 2DQKA 4DZTA 3DE2X 3GT3A 4J94A 2PWAA 1AU9A 1CNMA 2ID4A 4C3UA 1T1IA 1XF1A 1GNSA 1SUCA 2DP4E 1Y48E 3DE0X 3GCWA 3VYVA 1TM7E 1YJCA 2W2MA 3TI9A 4CFYA 1KDZA 1LW6E 1OYOA 4JP8A 3UNXA 3DE7X 2IY9A 4NE9A 4DJ5X 2WV7A 5AVJA 3F7MA 5AQEA 4GI3A 1S2NA 4OMCA 4YN3A 1BFKA 1WMEA 3PTLA 1KDVA 1ZVJA 4Z2AA 1Q5PA 3A3PA 3DW3X 3OSZA 1Y3CE 5FBZA 1SCJA 1SUPA 1IAVA 1EGQA 1SCDA 2SICE 3DVSX 4OV6B 3LPDA 1GNVA 1WMDA 4WOBA 1TK2A 1UBNA 5JXHA 1VSBA 2PRKA 1C3LA 2ZRQA 1PTKA 1P8JA 1HT3A 3F7OA 1T1EA 1V6CA 1TM4E 3ZXYA 3I2YX 1Y3DE 1AVTA 3WHIA 4ZOQI 3D9QX 1KE2A 3DVQX 1Y34E 3DE5X 1TM3E 3A3NA 4B5LA 2PKCA 1R6VA 5B1DA 3DDZX 1C9NA 3DYBA 1A2QA 3P5BA 1SCNE 2ZWPA 3VHQA 4DWWA 2XTJA 4NE7A 3VV2A 2Z2XA 5AVKA 2DUJA 1GA4A 1SPBS 1WSDA 1Y9ZA 3TI7A 3VSBA 4KB5A 3TECE 1DUIA 1SBTA 3H42B 1GCIA 1V5IA 4BWGA 2QTWB 1SELA 1JEAA 5ARBA 1GTJ1 3PRKE 2IXTA 5AMXA 5JXJA 4HX2A 1GA1A 3BPSA 1BJRE 1EA7A 2SECE 3EIFA 1SCAA 3EE6A 3HJRA 2PMWB 3BGOS 4NMXB 1MPTA 1GTL1 1YJBA 1SIUA 3WIUA 2W2PA 1OYVA 3I34X 1SUAA 5K7SA 1AV7A 1SBHA 1BE8A 2Z57A 4WOCA 1BH6A 4FONA 1YU6A 1SN7A 3Q40A 2X8JA 1SUDA 5B1EA 1SBNE 2WUVA 2PQ2A 1S02A 1Y3FE 2SNIE 4H6XA 1SBCA 3GT4A 3I37X 1NLUA 3CO0S 4CFZA 1Y4AE 1AH2A 4RYDA 1BFUA 5ARDA 3DVRX 3SQOA 1KE1A 3SICE 2ZWOA 3WQBA 1ST2A 1AF4A 1PFGA 2HPZA 2G4VA 4H6WA 1SCBA 1ST3A 2Z56A 1ZVKA 2PWBA 1S01A 3DE6X 5CW1A 1CSEE 2V8BA 1R64A 1IC6A 1Y1KE 3WIVA 1C9MA 2Z30A 4KG7A 3AFGA 1Y3BE 1TMGE 3DWEX 4AKSA 1TM1E 2W2QA 4AKTA 1Y4DE 3VTAA 5JXIA 2TECE
chains in the Genus database with same CATH superfamily
1FLNA 3PUYA 2PMKA 4X44A 3W8RA 3CONA 4ZC1A 2XCLA 4KSYA 4NLLA 1WB4A 4F1KA 2X4IA 4IMPA 4UU8A 1XNRB 4ZAYA 5HGJA 1RVV1 2G8LA 3H84A 1FEZA 1RQ2A 1R0YA 1CDZA 3DEIA 3EIWA 2GZSA 3ADKA 2B35A 4MVJI 5CDFA 4KR7A 2CZGA 3L7IA 4QBKA 3KDPA 4BO5A 2DPYA 2VDPB 1X2BA 1VECA 1W5BA 4RF5A 1KPIA 4EG1A 1N2IA 1GCUA 4II2A 5I9BA 1QK3A 4D0RA 1O97C 4DLSA 4OVKA 4CEJB 2UUOA 2F9MA 4EHLA 3Q7IA 2JI4A 1ID1A 2GARA 3L6CA 4MW9A 3U44A 4GG1A 4QU5A 2XMDA 1HFKA 1VG0B 1H8ED 2GAAA 1YRAA 4C3VA 2KBEA 4W1SA 1YL6A 4BNZA 4C0WA 1ONPA 2C7PA 4Z53A 4RVNA 3WLSA 1XDSA 1DMSA 1HFEL 2OESA 4R1UA 5A3JA 3V7YA 4IGIA 2D1SA 1EFTA 4YI5A 2HY7A 5KTPA 2PU7A 2R7KA 5DKFA 1Z5PA 3OFNA 3ZJ5A 2JIBA 5A6VA 1IOZA 1ZSVA 1ZK1A 2FSVA 5AVZA 3QHAA 3ZDBA 4H35A 4P93A 2VYFA 4UNRA 4C7OA 1N7JA 1C9EA 2FMXA 2OHHA 4Q34A 4ZYTA 3CRMA 1SBYA 4JD5A 2POCA 2BSAA 2E1RA 4FFDA 1Y9EA 4HGPA 3NONA 3IAM6 3OOEA 3RRYA 1OXVA 4L4SA 1US8B 2LWIA 1ZOLA 4ITRC 3GLIE 3S2IA 3RB8A 1HQYE 3FSRA 1GXSB 2O59A 1GJRA 2XUJA 4AX8A 1Y42X 1UOOA 1E2LA 1V7QA 4CMKA 3PJRA 2PEYA 3WGGA 2XMZA 4NE7A 3TQRA 5I3ZA 1MN6A 2HHAA 4FC7A 4G0VA 1ZRNA 3P4YA 1JAZA 5MN5A 3ODPA 2AJTA 3RFUA 2NUAB 1OWLA 4CG3A 5KOIA 4GOKA 4YAIA 3A2KA 3EUWA 3ULKA 1RZVA 2ODWA 5JRDS 3BFPA 4BX2A 4EPXA 2FDRA 1YUNA 2FI1A 3LE8A 4NWIA 1Y4UA 4N3BA 1WY5A 1PUXA 1TTPB 4IILA 4TLBA 4XPIA 3UJ7A 3UJ3X 4K9SA 5BW8A 5HILA 1BAPA 2O57A 3E2MA 1PGPA 4HAIA 4Z9BA 1G20E 1NBME 5CYGA 3L4KA 4PY2A 3KC2A 3VR4D 3RRMA 4IJUA 1HURA 3AEQB 1T34A 3MRTA 4ZQGA 5DOZA 3DUFB 1EK6A 3A1CA 3KYBA 1N6IA 4ERNA 5ALNA 2HT1A 1VL2A 3CLSC 3S99A 2C83A 3R3YA 1UM8A 3KWLA 1JI0A 1YZUA 1CQJB 4G5RA 1C0EA 2QD1A 2V8OA 3GJ8A 2V6IA 2ZIUB 1CUWA 5F12A 4RJIA 2YXDA 1JJAA 4U9IS 2PJUA 5KOJB 4A92A 1PSDA 1DV1A 1E3LA 2RCNA 4ENUA 1TTHA 1R8JA 2QT1A 1WB5A 2JBHA 4Y2PA 2EZ8A 1U0BB 4AWBA 5KTRA 4B34A 3F4LA 3RFFA 2JH9A 2X9NA 1JI3A 2DT8A 3HPRA 4U7JA 3BXFA 2HF2A 1RVDA 2Q1XA 2QZJA 2X6QA 3DE4X 3KB2A 4UCXA 2V3WA 4PM4A 2R5WA 1U7TA 5AM0A 1KY2A 3ZXUB 3I1YA 4EB6A 2X5OA 4J1TC 4RTPA 1OWPA 1M6EX 1XEAA 3R3VA 4BWYA 1SBZA 4PVDA 1LBEA 4PRKA 4ZYZA 2PD3A 3Q15C 5HZGA 2DQYA 3HCRA 5HKAA 2FP3A 2Z8ZA 3BIOA 4L8LA 3MNFA 3W04A 3NDBB 2E1PA 4BL5A 2GAFA 2BSQA 4DSAA 4HAWA 4W7IA 1TEHA 2R6GA 3SG0A 1G5PA 1MV8A 5L7YA 4LA4A 1GTG1 1YZNA 1ZGZA 4PG4A 1NE7A 2I9KA 5GJBA 1VP3A 3ZV5A 4L73A 1XMSA 1N5IA 3DDHA 3W6ZA 4B81A 1TZMA 5BSGA 2DU8A 2ZB2A 1J8DA 1IRIA 4WZZA 2XMPA 3O03A 4W5JA 1Q92A 1JN0A 2AYXA 2QVBA 3PE4A 1YK0A 1WETA 5FPKA 3CZ9A 3W8NA 2ZXFA 3WLFA 1HWYA 4OI1A 5K4AA 1E9DA 2EBUA 5JNSA 1U2GC 1JNYA 1A2OA 1KS2A 2VNHA 3FZNA 3ZWVA 5K5EA 4PHFA 2GYVA 4GLLA 1J9GA 2DYKA 1I1OA 4JI0B 5FI5A 3MCVA 4ZMBA 1TO6A 4IQ8A 4O02B 3SZLA 1ZAKA 5EMLA 1EGVB 1RYYA 4L6CA 3WRXA 1J21A 5BNTA 1GNTA 5B6IA 1ZZEA 4M0PA 4WK0B 3WWPA 5D7BA 1QCCA 2YOGA 3VZQA 5JAIA 4NZMA 3GUZA 5DYTA 1YNOA 1UZMA 2OCDA 5FJJA 3DXZA 2Q29A 5K6AA 4PG6A 4LGYA 4L74A 1K0UA 5LYJA 2QPLA 1IZYA 1E2DA 1GLNA 4G4GA 4GX1A 3B89A 3BORA 4PX2A 4O2RA 2DPHA 5FBVB 3OTOB 4H6PA 3RRXA 1QF6A 1IRXA 1DC7A 1W25A 1BCSB 2GEKA 4Q9IA 4X6LA 2FPSA 3C85A 2E3JA 3PDUA 4H77A 1Q74A 3BRCA 4TT3D 5J5CA 5AK6A 1XK7A 2C4UA 2V6FA 3QWBA 5DYGA 4BVGA 2Q8QA 1YQ9A 4XPIB 2CLSA 3Q3GE 3RH0A 5FNVF 3WZMA 3D1JA 4AJIA 1EA5A 1SKUA 4Q3NA 4EHJA 1Z8NA 1NUHA 1ZX1A 2G1JA 3PGKA 4QPCA 3WGOA 5K4GA 5KEIA 4EA8A 4ENTA 3EFOA 2QDXA 5C81A 3KEFA 4YT4A 3OKFA 1Z9BA 2ZYHA 2RONA 3IX7A 4IX1A 1IY1A 2QENA 5BYJA 4AJ9A 3KM0A 4B3XA 4EHIA 2V6JA 3FW1A 2CY0A 1JHXA 3JQ7B 5HM6A 1OH6A 1XNHA 3IA7A 3TLEA 4TZ0A 2CV2A 3VAYA 1PP4A 2QVLA 3VU9B 3HZZA 4F6RA 1QONA 1H2WA 2CHGA 2H1WA 2VEDA 4L8FA 1K3UB 5FYQA 3QKUA 1DO0A 2ZR7A 2XCSB 1CEYA 1H2RS 1QBKC 1XT6A 4PSCA 5E1BA 3ROEA 1OMOA 1W5FA 5IJAA 1EDZA 1K1EA 3AF5A 1T9GR 1NNEA 3R8CA 4GVXA 5DBGA 3R7WB 3RJZA 3MTDA 3PNMA 1KI9A 4H18A 3KQHA 2Q0XA 1N2EA 1T5LA 5DX8A 1L5HA 3WI7A 5M7EA 1Z0UA 3TJMA 3W2IA 1XVTA 1H9CA 3OLQA 3HZOA 3QVMA 2O4CA 3ETCA 4FD3A 3WA6A 4F5ZA 4DIBA 1I1HA 8ABPA 2E4VA 2GQ0A 1BEZA 2QE7A 2WMOB 3G82C 3HKCB 5BRAA 4EL0A 7MDHA 2MSKA 1E89A 2FRXA 5JZBA 5JE8A 1OX4B 1TMYA 3EXFB 3IKTA 2V0GA 3ADDA 4DR4B 5CT4A 5DGIA 2HGSA 5U4XA 1R18A 1NIPA 4FD2A 3CVUA 3UVEA 3EPLA 5BRJA 1UJBA 1I7QB 3A1UA 4U2FA 1SEPA 5DM60 1QPZA 4QXRA 5LD2B 2QIPA 3ZJ4A 3RQSA 3DFUA 3K5IA 2XWPA 1NLMA 5A0VA 3QPDA 1A8PA 4HDCA 4Q4HA 1IWPB 3PQ3A 1ZJ4A 3T0GA 2QD5A 5HDQA 4Z0PA 1TVEA 2LDXA 3VU3A 1HKUA 1Z29A 2O50A 3HB5X 3O4FA 3PQCA 2QRVB 1GGMA 2KHZA 1ML3A 1QNFA 5ICFA 4OMDA 3I9V6 2JI8A 4G86A 2J3JA 1G8KA 2AEJA 1HEUA 2ZSIA 4DIFA 1FYDA 2IEGA 2BBWA 1AU9A 3ONDA 1CY4A 1QKJA 4UUNA 1BC5A 2FSPA 4BNYA 4N65A 2WJAA 4WN9A 2WQ7A 1G2PA 2ODAA 1L4FA 4U2DA 4X65B 3OAAD 1JFVA 4U0JA 1TB4A 5DM0A 2OC9A 5DBEX 1JJBA 1QK4A 4NE9A 4E3WA 1QVVA 2C00A 2VWHA 1I5OA 1ZN8A 2WWWA 3ZGLA 5KNCD 3NIBA 2GPJA 1TPYA 1K8RA 3NHLA 1LBIA 2ZS8A 2OGWA 1J2TA 1GRVA 1MRSA 3OTGA 4H3KB 4G0NA 4W99A 2ATXA 2K5UA 4N5LA 3PNPA 3S40A 4EECA 2YFQA 3MGKA 3U13A 1I10A 1NVKA 1VB5A 3DKIA 1BGWA 1QR2A 4X1IB 3TQOA 4BYMA 4JENA 4D9FA 4CI0B 1NPDA 2UUAB 5IVIA 2P9HA 3QVWA 3HM9A 1LDNA 1JUDA 2NAFA 4G0XA 4O4LA 3HUDA 4L4ZA 4PZUA 4OH7A 2PT9A 4EPWA 2UZ0A 4PSAA 3QQPA 4H31A 5GP1A 4IJ5A 2BMEA 2XZOA 4CMJA 2P6RA 4TTRA 4HNQA 2HJWA 5FTMA 1L4MA 5DHTA 2B8WA 5JBNA 2CKDA 2X5KO 4DRYA 2QPTA 1XLWA 5EIFA 3DT9A 1QV7A 3CISA 3CZMA 3FYUB 4I08A 4V1CB 1T4CA 3IEPA 2YIDA 4JLNA 2HBRA 3RU2A 4QFDA 2NZXA 2MDTA 4AJOA 1AKUA 4PZZA 4LK2A 4R2JA 3UMMA 2FMFA 4BO1A 4JXJA 3VPHA 4ZXFA 3SMQA 3ZPXA 4FW9A 4XD7A 4NKRA 4DCJA 1G8FA 2CJYA 2FF5A 2ACEA 2IU6A 5C1IA 5J4HA 5BSKA 3WGIA 3LUJA 4GI1A 3RIEA 4OFWA 5IVPA 2YRXA 1A8UA 4EPVA 5KINB 3E7PA 2CZQA 1JXMA 2AN9A 2QUJA 1TEXA 5BNFA 1F7VA 1IZ0A 1UKZA 2AC2A 1JW9B 1V11A 3BHMA 3ITDA 3RJ9A 1XMIA 3EZ6A 1HXHA 2QYOA 4RKWA 3I5MA 1VLVA 5E7IA 1H2EA 1P0CA 3AFHA 5KHLB 3EXFA 4UVHA 1SXJE 1NVFA 3LKVA 2IIQA 3O6VA 3NBQA 4YAJA 3U7EB 4O4IF 5CA1F 1R16A 4P3KA 2B7BA 4C43A 2EFCB 2VH2A 3PIDA 3OOHA 4JFAA 5DTEA 4JBNA 5BN5A 3QTTA 5LXTF 1X15A 3Q12A 1KMHA 1NMEA 2CW5A 4TTIA 1EZ4A 3FSJX 3K73O 4TS9A 3H97A 1ID8A 1OZFA 3NCTA 1P7WA 1N5KA 1Z83A 2GCGA 3M34A 1C7QA 5C5EA 5AVXA 2XNKA 2R47A 2IFTA 2VQDA 3GLUA 3P2OA 4LE1A 1L4GA 3SOZA 5G1NA 4XGIA 3VNUA 4MVJH 3RM3A 3H1AA 3QXJA 2AHOA 3N8GA 4HN9A 4R9UC 2V9ZA 3REFA 3SIWA 2I7VA 3SQLA 1SHKA 1Z6GA 3UPDA 2VK4A 5A5EA 2W98A 2P11A 3E0QA 4TVSA 3AV3A 3RYIA 3ZE7A 4AC9A 1NBOA 2G1UA 4NCBA 1P5ZB 4DSTA 4BCCA 3QX7A 2H1SA 1DC4A 4JC8A 3T4XA 4RZSA 4UZEA 2VTBB 4XAQA 3PHIA 2CNNA 4KVAA 3AZQA 4Q9LA 3NASA 1EEHA 4OXNA 2D8MA 3S44A 1X7GA 4UJ5A 2OV6A 3DE2X 2VYND 5GV8A 1NUAA 2RKBA 3BWXA 1KWGA 1VG1A 2PWYA 2QN6A 1XF1A 1AQUA 4K2AA 1SC4A 3NFRA 1P2VA 2COUA 1PV1A 4N39A 4YMVA 4K9OA 3WIBA 3ZIUA 3D7MA 4LJ9A 1JKJB 4DA0A 1Q57A 3L9XA 3TQIA 4GKVA 3GUUA 1K8QA 3L4BA 5AK3A 1IATA 1R9GA 5DV9A 1LF0A 3RTGA 5F35A 3A6GA 1Z0ZA 5HIJA 3LW8A 5LQUA 1XWFA 3F3KA 4GS5A 5D84A 3F4BA 3L8EA 4NENA 5JAQA 3QX3A 2RK4A 4JGGA 3PZRA 1W1WA 1CIVA 3GR6A 5FL7A 4FGUA 4KWIA 1Y4SA 4PFQA 5JCPA 3KZOA 4BNUA 2Q1YA 4HDSB 2QG9A 2HCFA 2QG6A 1NA5A 3TXYA 1UH5A 2IBMA 3GRVA 1UK9A 1U11A 1QH0A 3FTDA 1EK2A 1H5QA 1VIVA 5EKUA 4HB0A 4S35A 2V59A 4F3TA 1CUXA 3AONB 2JLAA 4WCFB 4IFTA 3PR2B 1HFWA 1Y63A 3H4IA 3A1VA 1M2NA 2XTJA 4AZ0A 4DLPA 1UFQA 1IIBA 1UBCA 4OMUA 1KFEB 2Q2OA 1U8XX 4EPTA 3UCXA 4TLCA 1D0IA 2EZUA 4HUJA 4IL5A 1RRMA 2DX7A 4PPQA 2PT6A 5EJ4A 1HTBA 5HIMA 2ZJ0A 4LHVA 3OZ7A 3TW6A 3I76A 1TIKA 1V11B 3OPXA 3LD9A 2C5EA 1LX6A 1M2VA 3IC5A 1CR4A 2FPGA 3JRNA 2Y6VA 4QNNA 4DV0B 3EVEA 5LB4A 3AU8A 1D4AA 1LJ8A 2GCEA 2NUTB 3EQ9A 3LCVB 5FULA 3AP3A 1U3CA 2QG4A 4TVOA 2J67A 1KHTA 2XVYA 1XLTA 3AFOA 1TYEB 3H4TA 3H86A 3O93A 16PKA 1W29A 3ORYA 4CKCA 1A4RA 2Q3DA 1G7RA 1XTJA 1PL7A 3DVRX 3X1WA 2OLEA 3B52X 2QMUA 3TTUA 3WWCA 5J2TA 1K97A 1DEKA 3P0JA 3KZMA 4IVRA 1LS1A 4ALMA 2R7MA 4LBWA 3MUNA 1J9EA 3WV4A 2AN5A 1U8EA 5BVHB 3A6DA 3R3SA 2JIPA 2YYSA 3FFTA 3VR6D 3NT2A 3ZCUA 1TKBA 1W5SA 4KE9A 2H4YA 1G5QA 5C3UA 1Z12A 1TZKA 2Y1OA 4TN1A 3RVJA 2G63A 4EGQA 5C8YF 2IYEA 3LQ2A 4Q12A 3HLYA 2J3HA 1PJBA 2V4MA 5FTWA 1GA6A 2VDNB 1TA0A 2WTNA 5CDSA 1M34A 2KPOA 3JRWA 2F17A 1SD1A 1YMUA 5CPFA 3OCVA 2XNJA 1X2EA 1T0HB 4JJGA 1B73A 5AM5A 2G17A 1UL1X 4AVYA 5ITZA 3DLHA 3HXOA 4BFWA 1VHJA 4OJNA 1QC5B 3U3ZA 2R97A 3PQ6A 4HWOA 1U2ZA 4PAWA 2VN8A 2CF5A 2IOQA 3W3AD 1MVLA 1GPBA 4OFBA 4AT1A 1MEEA 4KACA 4RQTA 2WIKA 1NQTA 1IN7A 1KY3A 1CERA 1W30A 1ZOSA 4XYEA 4IHKA 5AW9A 2EG5A 2YQ4A 2FWMX 2ZTMA 3GDHA 2YFYA 1CYDA 5DZSA 3F5QA 3OZSA 5K3AA 4XYLA 1G21E 2HSWA 3IAUA 4P22A 3G2NA 3NOVA 4HLDA 3TBHA 4EZEA 4L8YA 1KEWA 1N2BA 1YA8A 3C5CA 1DBWA 2YY6A 2ACWA 3B3AA 5AQEA 4AUNA 1FB5A 1KEEB 1TIPA 3UOGA 2JGMA 3QFTA 4NBSA 4EVQA 4M9QA 2QLJA 1A2BA 2IYUA 4P4NA 2QF7A 3O73A 4B33A 2HCTA 1U9CA 1JRLA 1NYTA 3GEHA 3RG2A 3K71B 3UBTA 3OIWA 2JCSA 3GZNB 1J07A 3HSYA 2G9UA 4F8JA 4JY7A 4XZ3A 3IVGA 3BJMA 2NPIA 2I7DA 1OLXB 1ZH6A 1H6AA 2NSLA 3PGJA 2AW5A 1G2IA 4BKQA 2Z9BA 1N5MA 4JB8A 1P6XA 1DX4A 1U2RA 5JSZA 5FPHA 4YRIA 3FCAA 1BQEA 1NVGA 5BSTA 4AN0A 3FNQA 2C2HA 2UU9B 1JE1A 1U28A 1ACJA 4AKHA 3HR8A 1CKEA 3IP7A 1XZ8A 3QELB 5JCZA 2NUTA 4S0XA 4X71A 5EXTA 5FPPA 3U3MA 3CS3A 2D2EA 2B8EA 1QIGA 5A3QA 1PVDA 4Y2VA 2ZJ6A 1MOSA 2UZAA 1T2NA 3SYTA 3TD2A 2RB5A 1ZKMA 3QKIA 4KZPA 3IDAA 3TCKA 2C2GA 3DZFA 2XRYA 4GO1A 5F2OA 4OU4A 1HRKA 5E9AA 4BZZA 5EFOA 3B3GA 3IOBA 5ICMA 5IH7A 4U7HA 2BTQA 4CKEA 1XIVA 3ZV3A 1DQSA 4YQZA 4FKMA 2SNIE 4IWYA 4KITB 1TE2A 1AZWA 5EIAA 2Y77A 4UM9D 2FJ0A 5H81A 3VKWA 1BN6A 3E9EA 1BFUA 3RS3A 1RCTE 4R3WA 5IK2A 2IZ6A 4C21A 2ORED 4DARA 1XZNA 4P38A 4A91A 3RNOA 3A10A 4QASA 4ZDIA 4KR0A 3E61A 1PGQA 3SVZA 5KWJA 5THKA 1KRXA 5DLPA 4MMYB 1AOXA 4FNMA 4DLXA 2IKSA 1TQDA 2ZSBA 1FYVA 3VOBA 2IV2X 1E7QA 3TMKA 4F1WA 1H4QA 3OD1A 3LLVA 1PLKA 2O8FA 2XTNA 4OK3A 2FOLA 3A9RA 1E3WB 1IWBB 3HN7A 4HATA 4PFSA 2NP6A 5JJKA 4GX0A 4K6MA 2B36A 3FXAA 4DMCA 5E6SB 2IEAA 1GPYA 1N6RA 4LTMA 1UBHS 1B8UA 2A9QA 2BMFA 4Q3AA 2G67A 1FJ2A 2BEKA 5FLXA 3A3OA 3LU1A 2EX1A 3STHA 5JNRA 1A1VA 1H94A 1WM1A 3ACDA 3ZZ1A 4WD3A 4E03A 4ND2A 1A7AA 1YDMA 3GYGA 3KHUA 4MJ3A 2PK3A 4MVJM 4BP9A 4F72A 1PV4A 4MAFA 1ZZGA 4BGUA 2FPPA 3MJCA 3BX1A 3C39A 4XWKA 4E32A 4CN8A 1K7SN 1OREA 4KO2S 4C4TA 2EWMA 2VZLA 5B37A 4A8TA 1RM5A 3SBOA 5FFNA 4AG5A 3H83A 4R5MA 4NNJA 4RXUA 1JDBC 4DG8A 4C1NA 1J25A 4IDGA 4R98A 5DHRA 1UAGA 2PQ0A 4BVJA 2RI0A 2RHGB 3VZBA 2Q2NA 3O38A 4HAYA 1NI3A 4NJMB 4J94A 4AM8A 1YR9A 4HNGA 4JLWA 1ZUNA 4HPWA 2WZCA 5HZMA 3RKSA 4DY6A 4TUYB 4XYMA 5LP6C 3RTCA 3F78A 1JFTA 3RTDA 1E7YA 2CFOA 5DM2A 3LLSA 1ZIOA 5CCBA 1GEGA 3SAJA 3KZKA 2IYTA 5F9MA 4PVCA 3P2MA 4RJJA 2IH5A 2XYQA 4R1NA 2FOIA 3T9FA 3ODGA 1FVOA 3E15A 4B09A 2NU6A 5A4JA 2PRKA 1W9MA 1I80A 3OU6A 4DMKA 5C8XA 1R5OA 3M5CA 3QOXA 1V6CA 2RHJA 1LJLA 5UKDA 4C4PA 4D26A 4ZODA 2QRNA 1YTUA 4NS1A 1UP7A 2P27A 1DTSA 2H92A 2LV8A 2PS0A 1Y1QA 2ZTUA 2HSEA 4NABA 3CEMA 2ZQZA 2NTYC 4YRDA 3VHQA 4E5MA 4L57A 1AGPA 2JK1A 1ZI6A 2P2NA 2YMMA 1P8AA 3LYLA 4J0FA 1RMQA 4U2EA 3AHEA 1SM4A 4WH0A 3PF8A 3P26A 4J49A 5ESRA 2HF7A 1GCIA 1C30B 5G0SA 3W1VA 4F71A 3I6QA 4FFVA 2NP7A 3PVCA 3OLWA 3RYCB 4L5JA 1X7ZB 3FUXA 5D00A 2AOTA 3I8OA 3WG9A 3TINA 3E1GA 2PT7A 4D3YA 1Q3KA 2ZVPX 3UGQA 4DS3A 1NBMA 3AESA 1KFJB 4HFMA 3F7NA 1BVYF 2ONKA 2BGTA 3OIFA 1ZH4A 2PX5A 3EXHA 3RDPA 2HRZA 1ISHA 4JSYA 4LY3A 4HQ6A 1SUDA 2H7CA 3GUHA 1OT3A 2DUWA 3HJHA 1JAIA 4JQZA 5CD9A 1PJLA 2W4MA 3SYLA 2JFVA 3EW7A 3FIJA 1CETA 3UW3A 3ZZUA 2GNAA 3ETLA 1KQPA 3I6MA 4TZKA 1CZUA 2PUTA 1X9HA 2WJ3A 2YJGA 2ZETA 4S2UA 3D4LA 3SFZA 3ORQA 4CNBA 3VOSA 4BNLA 2Z56A 1TJ4A 2YCBA 3M6FA 2QX9A 2LIPA 2HQ1A 3GLHB 3V2UA 2V74B 1VKOA 3EYWA 5FNVA 4A2WA 1WCV1 5FB3A 1IUOA 1ZIYA 1Q6ZA 4YDQA 1Q7BA 2BI7A 2VSQA 3R7AA 1AS2A 3ZWMA 4RDXA 1KDYA 3PJEA 1XUOA 1WW8A 1IN5A 3BK7A 4RC9A 1MUUA 3BB1A 5AOVA 2WRZA 1XTIA 4OXIA 5T6MA 5IDVA 3E7DA 2QX7A 2FP4B 1K9VF 4GEKA 2HRQA 4X1KA 1AMOA 4N8SA 1LWNA 3LPMA 2BEWB 2WNIA 1PRYA 4DTCA 4ZD6A 4V0SA 2R0QC 3LPCA 4HNHA 1CR6A 4MVYA 3R6GA 2R79A 3OZEA 2X2OA 2ZWMA 3EJWA 4N3GA 3PE3A 3KPVA 2C98A 1RI3A 1QAOA 1A9QA 1Z4OA 2CVZA 2B5WA 3DCNA 2AR0A 5K51A 5IK2D 1KGSA 3PQ5A 4KJZA 1UPXA 3PD0A 4AS3A 3HVKA 1O5IA 1V35A 2ZQYA 1N6LA 1HE5A 4DREA 1XTUA 5IN5A 3K35A 3V34A 4R8RA 2JATA 3CW8X 5L40A 3FZYA 3GQBB 4IJKA 3KT6A 1HPLA 2B9EA 4J90A 1RWXA 4KIWA 5AKGA 5JASA 4E12A 4ED9A 2H2GA 4NZOA 4KXFB 1S2GA 3A7DA 4ZVUA 3Q2KA 1VL0A 1CZOA 1YJCA 2DECA 3N0VA 1PNVA 2WD7B 3ED5A 5ERXA 2V9CA 1Y1LA 3V00A 1RACA 4MR7B 4DNOA 3OJXA 1FJHA 4L5AA 4D5EA 4YXWD 5KWIA 1HE2A 2Q21A 1AHNA 1FTSA 1VDMA 2EJBA 4LKOA 4XARA 4F4FA 3VKVA 4IVQA 1D4OA 1BS1A 1SCUA 4JKOA 5H4HA 1TYZA 4ALJA 5ELXA 2DM6A 1J06A 5LKAA 5J5VA 2UXCB 5HZKA 2UZ1B 2H1OA 1WZ2A 5EXSA 4HVAA 4MGIR 4DEVA 1WXWA 3PNOA 3QVGB 3VYWA 5KDOA 3ITEA 3AKCA 4NG4A 1QB8A 2P2GA 2EGHA 4WVLA 4RPCA 3W1EA 4JZYA 2AOTB 1M76A 3HYCA 2CMDA 2IPOA 4MA0A 4ODIA 4KK4A 1OFTA 5D3MB 3W5SA 5PGMA 1C3OA 10MHA 1U4NA 2PXHA 3DMTA 3JALA 1BRTA 4JL5A 3NATA 1FNMA 2CL6X 2XSZA 1VE1A 2IHUA 2OZPA 5AVRA 4WKNA 3C7CB 2ORIA 4QX6A 4ZOBA 3DAFA 3EEQA 2GN4A 4F38A 2D7CA 2C1EA 3JU3A 1LCIA 4S2EA 1M1UA 2R6JA 1CWUA 4MUXA 3WDMA 3USCS 4TXJA 4KXLA 4ZANA 3I4CA 1HDRA 1WQ3A 4FKZA 4X6YA 3R8XA 1L4NA 3H6HA 1FU8A 5AUNB 1BROA 1GQ2A 1R0CA 1WA5A 3EJ6A 1BS9A 3RLIA 2AWOA 5B1EA 3DV9A 4CMGA 5E3HA 3ZVMA 2DH6A 3UMRA 3D8TA 3OSUA 2QTTA 1CCWA 2PLAA 1F0YA 1V26A 4L9AA 4XE5A 3H5RA 1UEXC 1NXVA 1QG6A 3DMGA 3IPYA 4CT5A 4ZGGA 2XUFA 3KZXA 1Q7CA 1ST3A 4R69A 5ECWA 3WLPA 3VGPA 3PQ8A 1CUAA 3DDSA 3WISA 2FF7A 3AVUA 4X1KB 1Z0AA 4JT2A 1GCAA 4LS3A 1GYRA 5H1YA 2QORA 2Y1GA 4HS9A 4C06A 3CH5A 4KIFA 1THTA 1XZGA 4QEKA 4XIJA 5TS3A 5TVKA 1R6DA 4IW3B 4B45A 5JRZA 5KYVA 2CXXA 4PIMA 3ZVKA 4UM8B 3MCTA 1CP3A 1YVPA 5JWHA 2OV2A 1J1ZA 4PQFA 3U26A 4QIHA 1FFXA 2XUGA 5DK4A 2RBKA 4FFBB 5EN4A 3CX3A 4OXRA 4K05A 3SZGA 4TV9F 2YBDA 3BD7A 1L5OA 3UT6A 2AG1A 4FJ2A 1U3TA 2C31A 2Y1EA 4XJXA 1Z22A 4AMVA 5ALDA 2FW6A 3WMWA 5ADWA 3NGLA 1H05A 1TJPB 2DZDA 3L07A 3FGNA 1KH3A 3ZDFA 3N9IA 3M4JA 1FZTA 1QAMA 2X4GA 2X42A 5A2GA 3IP9A 1OBCA 1VSTA 2PZGA 2V7QA 3P2EA 3FNRA 2AJLI 2EKPA 3QQ5A 1JTEA 5IMSA 3QOWA 2VDMB 4JJ6A 2OBFA 3LLUA 1EVZA 1OPRA 3E9ZA 4TL8A 4UKDA 4ALKA 3R7FA 1E1YA 1AURA 2QP3A 4CXMA 1NUPA 3PQEA 1NASA 2JNWA 1ATIA 3KEQA 4LCEA 4FCWA 3LVFO 4L3VA 2B69A 3H1BA 3DBIA 3PK0A 7AT1A 3GJ3A 4KLAA 4BE9A 3ERCA 1JPNA 4RKRA 2YYAA 1ULAA 3IOMA 5IMBA 3E4DA 3QXSA 3CF4G 2AA3A 1E2KA 1JHYA 1MT3A 3A9WA 3W6PA 1ND5A 4HFRA 2XJ4A 3PKIA 1B74A 5FV4A 3SZ3A 4ZVKA 1YNSA 2KLBA 1E5LA 2ZJAA 5KOYA 5BW4A 1E1RD 1WF6A 3L7JA 3HCPA 4B46A 2FFQA 5JTTA 3TH5A 3KOUA 2O0JA 2G9QA 1A27A 3ZS8A 1LPNA 4QELA 1QS0B 4CIBA 1AHHA 1SHTX 2BFBB 1E2PA 3IBCA 1SUWA 1OFUA 1NYQA 3MK31 1P0PA 4KO1S 3FYTA 3RPEA 1NSFA 3VO2A 3FIUA 4A0HA 4D6XA 1M72A 4MGZR 3T8YA 5INTA 3VJRA 2I29A 3VTKA 3U39A 1U90A 3PA8A 5A4MS 1JHDA 4UHDA 1ZUWA 5AJVB 2AQKA 621PA 2JIZD 3DVAA 1ZESA 3BN3A 4Q16A 2ODBA 1OZ0A 3QWAA 4JQSA 4TV9B 4CF5A 3P9QA 2XAAA 5HHTA 4KL8S 2G25A 5DGXA 3G8BA 5DTMA 4YHHB 3D2AA 3VPCA 1Y8RA 5KQSA 2HIAA 1G7CA 5I48A 1VBMA 3ILHA 2F55A 1JSRA 4L08A 3EN0A 4QRDA 4Q39A 3CNOA 3LJKA 4GRDA 2WVAA 4M1SA 2H08A 1SG9A 2PHZA 3KQNA 4PG7A 5BSWA 1V7CA 4G97A 3CB2A 3ZY6A 3U4QA 4RZIA 5H0IA 3KL2A 5DHQA 2IGTA 1I30A 1I3NA 5AJTA 1C7EA 2VDOB 1G8PA 2Z30A 3P0RA 3TLCA 5GJCA 1NI4A 5IT5A 2WG1A 1KVTA 4JU8A 1ZSNA 5A4DA 3WK6A 1QBGA 4U6NA 2VSOA 4LXGA 1Q19A 5T4EA 4ZJUA 5L4LA 3M9LA 3AKDA 3FWPA 5BV2P 5B57C 1OT5A 1DKNA 2RGNA 3GNSA 1HRDA 1DWUA 1B8VA 1Y33E 2ZTSA 2CNBA 4C08A 5IANA 3FBGA 1WUTA 3N59A 1CBUA 4IIUA 1T3HA 4B2LA 4A2CA 2PUDA 1BDBA 1M5UA 3MSXA 4XB1A 2QW0X 5CR9A 1RIFA 2VPYA 4I6EA 3O2NA 3I6BA 2GPNA 3FCUB 4CM9D 3NWEA 3GEGA 3MAAC 4RNCA 4O33A 1EVQA 2BW0A 4GXNA 4P53A 3FFBA 4XSVA 4A15A 1VPLA 3MGAA 3M5WA 1KI6A 1QCZA 2VQ3A 1R0RE 4F5EA 1N32B 3T41A 2OYSA 2EATA 3MJVA 4Q6WA 4WY5A 3E2PA 1X94A 3HABA 4OY3A 3ZCSA 4J3JA 4R2XA 2W6JA 1S8NA 4MPDA 1GTMA 2H1HA 2VAVA 3AUSA 4HDKA 5EMHA 1CRZA 1DU4A 1MP0A 1EHIA 5FI3A 3I2HA 4RLFA 3WKBA 3OHSX 4LZAA 4ABYA 4OHCA 1C50A 1RWQA 3BTUA 4UBKA 1UR5A 2P9FA 4RV4A 1P3Y1 2YV1A 1NW8A 3EZ9A 4WFIA 5H16A 1FDRA 1CDOA 1UK8A 2QZ9A 4R68A 1XA3A 4MV4A 4BEJA 1BXRB 1D2HA 2W2LD 2NTEA 2BFBA 221PA 1R0BA 2C5LA 2Y0DA 1FUUA 1DDIA 2P67A 2VYVA 1XMQB 3ZCVA 1RTTA 4DDHA 1P8JA 1A95A 4JEIA 3ISVA 2OGTA 3MTIA 4ZOLF 5TEVA 3CLKA 5JY6A 4YDHB 2XLCA 2Q6KA 4AP9A 2VDWB 4EFDA 4JUAA 2XE7A 3CNHA 1YR3A 3TAUA 4ZYVA 2XEDA 3FCCA 1UIRA 1FC0A 2HDOA 3KHTA 5DGHA 2OBYA 5C34B 4JA0A 3O9VA 3ZQ4A 3KR2A 4BRWA 1EQAA 4KB5A 4DYVA 3KOZA 3BIXA 1QPGA 3LGAA 4OQQA 3ZWAA 4ZJYA 1QZZA 3Q0IA 2GBFA 5FWYB 3RV4A 4K88A 1LI7A 5K8IA 1GTJ1 3K0FA 5L3SB 4UUMA 5G0WA 3CF4A 3NEPX 1DIGA 3OD5A 3OPQA 1S7GA 1RAAA 2A33A 3JQBA 1A9YA 1GV1A 3A36A 3OM0A 4K9RA 4NCXA 3ZHBA 4LHSA 1KBZA 1UWVA 3ZE9A 1U2DA 3TLYA 2P6OA 2PD6A 2J4DA 5L6MB 2F8SA 5BYKA 3EFEA 4IZHA 4Y6PA 2WA2A 5GGYA 2O3TA 5BNIA 1U2QA 2FXIA 3KDAA 1U02A 2RGNC 4YH1A 1YVDA 5FT9A 2H06A 2VDLB 5CCDA 2QRLA 2YZ7A 1BO6A 3D0KA 1G21B 2W9XA 4NYJQ 4OXYA 1E6UA 3LHSA 4MK4A 4J2HA 1EVYA 4DBLE 3UJAA 4IG4A 3W3AA 1XZKA 1GXSA 2C2OA 3C7KA 3H9GA 4K81B 2G9NA 2X0JA 1WDLA 2FCRA 1M2KA 4QARA 4GL2A 3QPWA 1O95A 1S2MA 4I3GA 1C9MA 1L5ZA 3PE6A 1QU2A 3ETJA 3T0FA 1FSZA 4R2WA 2TMDA 1ZN2A 1ZW1A 3EARA 1R8YA 3GY0A 4Q4LA 5CFMA 4KWTA 4C4OA 1XCOA 4R84A 2JH3A 1U3FA 4HX5A 1OI3A 4R2KA 4ZALA 4C03A 2B7LA 1OC2A 4X1YA 2RGXA 3TM4A 4BATA 2OGSA 4JQYA 4BP3A 1EFPA 1U99A 2QRHA 4CF4A 4F7DA 4RE6A 4NV0A 3JD2A 1LS6A 2R48A 1JHQA 4DIEA 1UKCA 4BO7A 1PJCA 2EKQA 4QWMA 2DETA 3ST7A 1G6OA 4MQUA 4BV9A 3IQWA 3GLGE 1W36C 4C5AA 4ALLA 1QRTA 1YB6A 2ZJ7A 1TYDE 4QVGA 2NZJA 3BWYA 4IUYA 4WEOA 1ZH0A 4JQOA 3ROQA 1UAYA 2ZXEA 1SZCA 1N25A 3FKSD 1CJSA 5AQ1A 3AEYA 2N47A 2DBYA 1OC4A 1VTKA 4EENA 1OH5A 1OA0A 4PTZA 4U02A 2EHDA 2ZTHA 3AEZA 1G8SA 2IQ5A 4G5QA 2RBGA 4D8YA 4P8RA 4W1QA 5HPYB 3NNNA 5LC1A 4EG7A 1SOMA 3OF5A 1EINA 2DUNA 2YINC 2H5IA 5IKMA 5GONB 5LMUB 1U1EA 2R6FA 1DQNA 4DIUA 3E9QA 1A76A 3W5BA 1XTKA 2ZE6A 2ZJ1A 3DXXA 5LBUA 4LOIA 3GVXA 3AVXA 3G0IA 2VRBA 3M83A 3RF6A 1G8GA 5DN6D 5CNKA 1TYBE 1KK1A 5JC1A 5KMGA 1YB2A 3ZH9B 3NHAA 3NRCA 3TOXA 4KO8A 3UT5A 5B64A 1WULS 1JTFA 5LN1A 3NOXA 1TAHA 2PLWA 3BWBA 3P94A 3QUSA 2JCGA 1E3DA 5DXJA 3WHIA 4E2ZA 2CHFA 4HEA1 2XQVA 1KE2A 3T9DA 4MDEA 2BEVA 3C5WP 4BFYA 3BXGA 5L3SA 5B1DA 4KQGA 4WFKA 4EJSB 4DLZA 3ETEA 2AJCA 3K6RA 5EZYF 1Q84A 3C6XA 1ZO8A 2J09A 1E66A 1U2PA 2Q8PA 5TARA 1SVKA 5IXSA 3V46A 2YJ3A 3FNHA 3GZTB 2VPTA 4EO7A 4AYWA 4CM5A 1UXHA 1GPLA 2AZXA 4Y3UA 1K86A 2FJPA 1E6MA 2WYHA 3E9YA 3PUWA 3UWOA 3VSDA 2DTXA 4RTRA 1XU4A 1ENOA 3Q9NA 5EY5B 1FFSA 3TEJA 3ZHSA 5HNKA 2A3RA 1GT6A 3CZPA 3JQDA 3F5DA 3ANYB 3PXGA 5JZOA 1SUAA 2JKVA 3EWSA 2I2DA 3GHHA 5BMVF 4Y9UA 1UKEA 3D0OA 3V9AA 1IXZA 3ZBTA 2FA9A 2IJGX 3NM6B 3EW9A 2Q3HA 1WABA 4C6TA 4YTEA 2I6FA 4LZJA 1KAHA 3WJ7A 1CR0A 2J6IA 4CQLA 3AR5A 3D8UA 2D3TA 4KIGA 4OCZA 1DKUA 2JC3A 1G19A 4FHZA 5ERYA 4EQ6A 1UT5A 1KBQA 4IMJB 3DBHB 5LWHA 1DMRA 3PNLA 1ORDA 5K8UA 4M89A 2EX4A 4MH0R 5HIAA 3D3QA 1QVZA 1TD1A 2R00C 4DMGA 3E3LA 2H4FA 3NWBA 4YHBA 4B83A 2ERCA 3WO1A 5I6DA 2OHJA 1KAOA 4ZO4A 3PEYA 4JBXA 1U0FA 1E7WA 3OZDA 4UW9A 2QRJA 2Q5QA 4DM3A 5JDIC 2YWJA 3V97A 2PUCA 1Y4ZA 1IVYA 1H8EA 1G3RA 2AOUB 2CFCA 3FCYA 3LV8A 3PI7A 4HWKA 4ZZ1A 4D3XA 4EGFA 4IX9A 4B9AA 4JJAA 1CUEA 3UFBA 2G4LA 1UQRA 2OBBA 2O05A 2V1XA 1B3BA 3GA0A 3ZHVA 2AHRA 3UB2A 2ZDGA 2Q50A 4G0YA 3GCZA 2OL4A 3DLAA 4KWCA 5FAKA 2PR2A 2O7QA 3WL8A 3K70B 3HV0A 5IC6A 3RREA 2F67A 3LVBA 1THGA 2EOAA 2CDNA 2E4WA 1MIOA 5CYOA 2VC2B 3FJ1A 3I5XA 3ZTYA 1DL5A 2GESA 2QD4A 2VNIA 3EG9A 4GU5A 1JSLA 4K6KA 5CJPA 2GRUA 4MR9B 3SSMA 3HRIA 3NAMA 4DZTA 1CDEA 4AROA 1K5GA 2PL1A 2VPZA 2OC4A 4LWOA 3PHLA 1XHEA 3CURA 4UTXA 2BH2A 2FWJA 3K3PA 1KJQA 1HDCA 3NHUA 4M8KA 1WAMA 4DCUA 4XWOA 1N75A 3VAZA 3PICA 4UMEA 4XWYA 1BE0A 4DA7A 5LP1A 1UXOA 2WV7A 2FPUA 3CRW1 1QRUA 4FE7A 4PC1A 3RVBA 2QLNA 3NJRA 4KAFA 4E21A 2AOWA 1ABFA 3NYIA 4D25A 3A3PA 5CDHA 2HNAA 2IPNA 1Z8FA 2PSSA 4JLOA 3QX8A 5CVTA 1S2DA 1U5BB 1WDTA 3UF0A 3UAWA 3WADA 4D56A 4I4CA 3PGXA 3LCUA 1FU4A 1CR2A 2PKYX 2WU4A 1NJ1A 3S2UA 3F5FA 2DSTA 1GSAA 1I32A 1RRFA 5E6UB 3BH6A 3ORFA 4JJEA 4EUHA 3Q98A 4YRGA 2WTBA 3O95A 4PPYA 2QP9X 4KXVA 4KR6A 4G8BA 1XMJA 3K6SA 3T61A 2XY4A 2ZM6B 2XBMA 2NZ2A 3L6BA 1YKGA 4WL0A 4M0KA 4QODA 1WJGA 4TMYA 3NOQA 3C6MA 3NWPA 2C96A 3PYLA 4OXXA 3ZGNA 2PN1A 3GJXC 1L0BA 4I36A 2VNAA 4MWGA 3U56A 3Q5DA 3OCJA 3AXTA 3H99A 4PYRA 5J9FA 2JIRA 2R4UA 4HBZA 1IPEA 2H48A 2MJLA 4FGLA 2Z98A 4AD8A 1W88A 5IX8A 1IXYA 2CVOA 3NGMA 4G01B 4R05A 3D4PA 2WKPA 5AW6A 3FSGA 3AW8A 3KT3A 1KRHA 3FUTA 3DP7A 3HZHA 3MGBA 3MILA 3PQDA 5FOSA 2UZ4A 4QYIB 1L8OA 2GZHA 1EVLA 2D4AA 4NH0A 2VPPA 4JSRA 4DEYA 2IOHA 3KEGA 4RD0A 2P35A 3FMVA 3CVVA 4YAKA 3ETGA 5ALIA 1GN9A 1Y8QA 3VHXB 2AJDA 2OWEA 3G7NA 1OFGA 1U8UA 1DELA 4O4LB 4Q9DA 5CH8A 1T36B 5GGXA 3N28A 4HZUB 1J5XA 2ZI7A 4NE2A 2CMFA 4RFSA 1CS4C 3BL5A 1QWSA 3BXZA 1XVLA 4AO8A 1RBQA 5DB4A 3WWDA 1V95A 5HX7A 4YMGA 5G1OA 3PUHA 2YJTD 1MG0A 2PA0A 2VYQA 1WQ4A 4UZFA 3SXUA 4YR7A 1Q3HA 4DLLA 1DCMA 1MO4A 5CJ2A 5DT9A 2FHPA 1F60A 1SIOA 2XQFA 4CQJA 4B85A 4EBFA 1A5SB 3DTYA 4O2AB 1ZM9A 2ZUWA 1HT0A 4MVJG 3GGSA 1MX5A 3MT9A 1QTIA 1U1FA 3CEPB 3WL4A 1GN8A 3H0KA 3QVSA 1L5FA 3WXMA 1THZA 3VH4A 2W6IA 4OM7A 3L1UA 3PXAA 5FOVA 2ZRGA 4LOLA 4J9VA 4A6DA 2LKDA 4RGBA 4DQVA 4WA8A 1L6IA 1O94D 2AI3A 1NJSA 1W85B 1HYBA 2VSFA 3PENA 2IPLA 1N1DA 3HKEB 1O08A 1WZEA 5KHOC 4UVGA 2E4AA 4XWAA 2AUMA 1ML4A 1NKSA 3OPVA 3G2LA 3F8WA 2X13A 4IFEA 3C2QA 4CQMA 3D3EA 5TIIA 2Y4OA 1R2QA 2X0DA 3DTTA 4O2BA 1J7JA 4RK0A 1L8AA 4Y2QA 3TTXA 3PEUA 3GRKA 1T5DX 3M89A 1LQUA 4DCTA 4B4KA 4L28A 3I3SR 3JYPA 3E03A 3B3JA 4XFDA 5K20A 1PJZA 1VZ2A 1PU2A 3EAQA 5JD4A 4AZ3A 3DFFA 5F33A 1ZGJA 5AVJA 3R75A 2OLJA 4BXOB 1N78A 2A1TS 2R6ZA 1ZEJA 2D4HA 3T99A 5CG1A 1PZFA 1KP2A 3DR5A 4B6QA 2QGFA 3K16A 4X7RA 5E6UA 3SBDA 4IINA 5C5DA 4D4MA 3EWNA 4R8VA 4DJEC 2Z9CA 3H17A 5J2TF 1MVNA 1INLA 1XVAA 3MRSA 1UBNA 2ZI6A 2ZRIA 2HMAA 1C80A 3RSFA 4TL9A 2FAXA 2E87A 4PR3A 5FPSA 4X90A 1T2AA 4OJQA 1S3IA 4DQ0A 4B6PA 1U94A 2GZAA 1A69A 3O4GA 1A2QA 4L16A 1B8NA 4LYJA 2X1VA 3V8RA 1VSQA 2RGBA 3EZFA 5J23A 4FWBA 1RWMA 3GHYA 4Y6OA 2C57A 3FM9A 1V5IA 3ANTA 3H42B 2YNMC 3HDTA 1VRCA 1XKQA 3OFND 4MIEA 4XJTA 5GMOA 1JAHA 4C89A 4CV3A 3ZU2A 1FW8A 1EUYA 1XK6A 2AS0A 2VP3A 2C20A 1N8KA 1VYHA 1K7YA 1CK4A 1Z0IA 3QKWA 2G28A 3FE2A 4LDJA 4NX2A 3L01A 4TS1A 2FR1A 3D4IA 4HN2A 3WIUA 2G06A 3P8ZA 4D79A 2O3SA 3KKLA 3OETA 3M2TA 4NBRA 1X74A 3AJRA 4FSXA 4ARAA 3U3JA 4E2WA 3Q40A 4B9EA 1S1CA 1MTZA 4B2IA 1W47A 2PX0A 3HJCA 3HJTA 3EC7A 1Y3FE 3FMFA 5FWAA 4A5OA 1OILA 1V3UA 4BE4A 1WXEA 3QMWA 4X97A 2X8WA 2OP1A 3RUEA 1X8XA 1A5TA 1AUXA 2JW5A 2ONYA 1IXRC 3IQZA 3JVEA 4HS4A 4GX2A 5HOQA 3DHVA 3EIXA 3QBJA 5ELLA 5FBKA 4H6WA 3KSDO 5C2JB 1I2BA 4GQBA 2NXCA 1SVSA 3QWIA 2XNSA 2XCOA 1I1NA 4ZKEA 4TTSA 3M4ZA 1QJ4A 5CP8A 2A9VA 4UFPA 2GKGA 1HC7A 1DKPA 2OZEA 4C7JA 2AB0A 3X1YA 2CZCA 3CIOA 5HF5A 1OLSB 3HEAA 4KE6A 1YAJA 3BQNB 4CMIB 3U4IA 3LRTA 3IR6A 3TW0A 1QVWA 1VHWA 3ONFA 2RGDA 1UM9A 4L15A 1IN8A 2OO7A 2FPMA 3NFYA 4QKQA 1HR0B 2H5LA 4FI3F 4D9NA 2GPSA 1JVSA 5CTJA 4Y9SA 3FNFA 1RHMA 4TQGA 3RS7A 3K72B 1JB1A 2L69A 2Q9UA 5HFNA 3EGVA 4DQUA 5EUCA 2A9FA 3AK4A 2GN9A 3QU7A 4W7HA 4DMMA 3BHNA 1KK0A 4DCCA 4DVJA 1Y7IA 2Q2QA 3LT1A 4WECA 4C88A 3NTQA 4DDTA 3NH6A 1N9ZA 3D7LA 4TYYA 2FTKE 3CLVA 2ENUA 4QVIA 1FMTA 1MEJA 1SWWA 2I4RA 2YW2A 4U5XA 1BMFA 2PV0A 4I0WB 2NO5A 4BNXA 2ZI9A 1U2TA 4INPA 4NC9A 3QNMA 2X3YA 1EFLA 4IKOA 4QLOA 4MVJA 4CETA 3O8QB 4RK7A 4RVGA 4U9HS 3PTZA 5LLTA 1PR3A 2GD6A 4PRYA 2Y1FA 4QJ5A 3UPTA 3R20A 1KYTA 4K9NA 2DXIA 3QA9A 2O3JA 1ZRSA 4UBNA 4QHYA 1AC5A 4OHKA 4Y67A 4L5CA 4OHVA 2IYQA 4ZVSA 4G0PA 5FPQA 2Q0QA 2P2CA 4ZYYA 1YDWA 2W2XA 1AG9A 1IQUA 3KXDA 4LHWA 4QU0A 1E1LA 1WMDA 4D3ZA 3W5VA 5AM2A 4K3UA 4XWWA 4AKIA 1A9RA 2OMEA 3H87A 4R51A 4DB2A 4N8DA 3H65A 4PGMA 2HB6A 3KAKA 4DLWA 2YZ2A 3QUAA 1ACLA 4IKPA 3FVQA 4MPRA 4KPFC 3ANNA 1SU4A 1S3FA 2OXTA 2WDPA 4EZBA 3VO9A 3A9UA 1VI2A 4CVNA 2XD4A 2UDPA 5DCWA 3EPPA 5C3MA 2QYSA 3DHWC 1ZM3A 1YE5A 4Z9YA 3FYCA 5JH7F 3I62A 1YHNA 4UBJA 2AFHA 1JEAA 3ASVA 1KOGA 1RLTA 2F3QA 2XGMA 5JD5A 4PLHA 2OECA 3NYQA 4P3YA 4TXLA 4UTOA 5EXDA 5EZQA 4EHKA 1J6UA 1FNCA 1BDMA 3HNPA 1KYVA 3UMGA 4RETA 3FOBA 4Q00A 1G3IA 4PCUA 4JT8A 3WSTA 3NWJA 3F2VA 4PZ9A 2AUNA 2V7XA 4U3JB 5HQ3A 5TPZD 1ZJWA 3IUMA 5LBTA 3RUHA 1H9BA 4MQ5A 4C14A 2P7IA 4JNCA 1T8SA 2ESRA 1RW4A 1VE9A 5AHOA 3V1YA 2LPMA 2XA1A 2QQ0A 3UFXA 2GXAA 1SBCA 3GT4A 4I6GA 1EUQA 2ZK7A 1CJUC 1XJ5A 3NVDA 3VRHA 4YV2A 5FBWB 5DMHA 2GPYA 4XD2A 2REXB 3TE7A 2JIDA 1FP2A 2OILA 1JZSA 3A6KA 5JMPA 1A04A 3I23A 1XKTA 2WJIA 3PIIA 4PLFA 4AKTA 1N7GA 2A1IA 1HO3A 4XGNA 4CBVA 1FFHA 1Z08A 2HLDA 4YCMA 5LU8A 2W6JD 2OA0A 4OU5A 4B44A 5KKAA 5HCIA 2D1QA 3IQDB 2M32A 3BTVA 1Z75A 4OKSA 5FI1B 2Z2ZA 4U2KA 3ZHOA 1EHYA 1O4WA 1PS9A 3NVKI 1CIJA 4TMWA 4LMPA 4P83A 1G16A 3OMXA 3HWWA 1ECJA 2J5RA 2IUTA 4LMAA 3THWA 2O2HA 3IVAA 2JLCA 3E3OA 3IAS6 4JB2A 4PX3A 4WZAA 3WYAA 2ZSUA 4G0MA 4ZARA 4PC3A 4BVLA 3N2EA 3N2IA 3UV3A 4ANFA 8OHMA 2GRAA 3VH1A 2FW1A 3EUFA 5HG0A 2NVUB 3FWYA 4BNDB 4WXYB 1OBHA 4X20A 5LUAA 5LQRA 2NU8A 1PN3A 3IKLA 3HJFA 2NVOA 4HXFB 3IUJA 2WM2A 4Y6QA 5FKJA 1G9TA 3DWIA 4FS8A 5GIOE 4FM9A 1MC1A 2AR9A 5B1HA 4EYSA 4TRJA 5ICSA 4KDRA 3SFVA 2PKQP 4QTYA 2X5XA 1Z15A 2AG0A 3FYDA 3UAOA 3WICA 3V8PA 3C3CA 2Q4BA 4YRQA 2IVFA 1TKCA 1WP4A 4HWTA 1DTEA 1EWKA 4K5QA 4AZWA 2DR3A 4DCGA 1B1CA 3HP4A 2YWRA 4UARA 1DOAA 3GYBA 3BVPA 1JKMA 2VPIA 3BA6A 1KIAA 2YMLA 3AKZA 3CJTA 4HEJA 3VR5D 1JQLB 1H0RA 1ZVJA 2H9YA 2VTEA 4LKRA 3DKPA 3ZW7A 3PFHA 1GPWB 1W4BA 1YDGA 4I9FA 2XUQA 4I6JA 4F06A 3Q3CA 1GNVA 2FLKA 3O7MA 1E18A 2H7XA 1XJ0A 2JRCA 4F9EA 4YPOA 1CLEA 4ZYWA 4UUAA 3KAJA 3HC7A 5EE5B 2LUOA 1ZQ9A 4H7PA 2WJZB 1TUBB 2MWMA 3U4HA 2A2ZA 4OQEA 1U0GA 3OE7D 4GBJA 5I4CA 5IZ4A 3ABZA 4R81A 5JAZA 1N2CE 1WSBA 2X76A 3C3YA 2ZSAA 3VPFA 4IIVA 2GXSA 4WN9B 2H8KA 5B30A 1I36A 3IUQA 4O2BF 3NEJA 4MVJD 3L77A 1NF3A 1OV4A 3OX1A 1H0SA 3MTJA 4R6XA 4KR3A 3OCZA 3EDQA 2YJ6A 4QXPA 5SYAA 3SJBA 4NFYA 4QBFA 1OTXA 3E18A 5E4YA 4BMPB 4IVNA 1V6AA 3VZRA 4LYGA 4DCPA 2BPOA 2B3TA 5IS2A 3GNLA 1EXWA 5I9NA 4TUYA 1QE3A 1XALA 3QXGA 5D6NA 3NTOA 4EUSA 1Q6YA 5AUQA 3UFXB 4OP2A 4GDMA 4RENA 2WP8J 4I9GA 1A3CA 2Z5LA 1NURA 2BZSA 3PXXA 2J0UB 2XOEA 4H7EA 2PRJA 1K5HA 2ZE7A 4XVQA 2R00A 3WB0A 4CODB 4MQFB 4R8SA 2D5LA 3GLGB 3E35A 1YL7A 4LTDA 2I80A 4NICA 4OAQA 2WG0A 4GPIB 5AR1A 4TTVA 5GJVC 3DXYA 4ESOA 4J1TA 4F85A 5K3DA 1Q1ZA 1Z5VA 2V0NA 3BD8A 4BKMA 3CG4A 3W5JA 1KZ7B 3UGTA 1TUIA 3AWIA 4UTRA 4JJ8A 2B30A 2XF8A 2FQXA 5T57A 5DNYB 3EIUA 3SC2B 1P2SA 1NSTA 2MCFA 1NE2A 4K28A 5AOBA 3IAHA 4AYXA 4AJEA 4C1BA 3WIVA 1Y0BA 1RKQA 2FZGA 2P78A 3T12A 1Y3BE 2WMDA 3GPIA 4PCAA 2VPQA 1DX6A 2EEZA 4OQYA 4FLMA 3N58A 4WT7A 4GMKA 1KQNA 4M1MA 1MZPA 1LSSA 1DIBA 4HDNB 4A2PA 2C2MA 3BCUA 4ES6A 4B75A 1FMFA 4K9LA 4B73A 3U7FB 3HR4A 3O31A 3UYLA 2VZ9A 3AEKA 3OBBA 1X7ZA 1NF9A 4WUTA 1KTVA 4EGAA 4MW5A 4XOIA 1MCZA 2XUKA 1FCJA 2B4YA 3D43A 1XRQA 4X62B 1C0LA 3F47A 3CYFA 4ZT7A 3AESB 4NZNA 5K0EA 3N2KA 3SS7X 5DNEA 1I4EB 3AB8A 3BZUA 1U31A 2GZ3A 3DOIA 4XEHA 3TBKA 2FZWA 2GT1A 1XVUA 3HA5A 5I5EA 1BVUA 2ABWA 1XMVA 4P4TA 1G9SA 1UP6A 2QM0A 2VHJA 2V7EA 1DAGA 1Z28A 1Z2AA 4O1IA 3RI3A 4WACA 3KQQA 2WQ6A 5FLYA 4GKKB 4WE3A 2BGNA 4Q7LA 4EB8A 1PX2A 3SYKA 5K2OA 1W96A 2FOXA 2I67A 2B6NA 1PZNA 3AZPA 3O4IA 4G4SP 4B7UA 2NU7B 1Z5OA 5ALRA 1TX4B 2GWRA 4IG9A 4J91A 1F7UA 3CZQA 1ZHFA 1SJ9A 4UHCA 1Z4NA 3UGKA 1ISSA 2QMZA 3DDOA 3DBRA 3EPRA 2QRUA 5LDHA 1L3BA 3RWOA 3T1TA 3FF4A 3AP1A 4MOWA 4CM1A 1CUVA 4RA9A 4BNVA 3W5DA 3BGIA 1D8TA 4R7ZA 4C0AC 3PTLA 1J8QA 4KBYA 4MKXA 4YMIA 3W9YA 2ONJA 1KVQA 2CNLA 3O4VA 2ZRCA 1EGQA 1EUZA 2BHTA 3CW2A 3QYJA 4YWJA 3EMVA 3VVMA 2XUOA 1BJKA 2ANCA 3V1NA 1ODSA 1CQIB 3N5CA 2I34A 2VBIA 4FKBA 3BJRA 2HXSA 3HFGA 4X7BA 2DBZA 2O19A 1N7IA 1L3IA 5DGTA 4YQYA 1V71A 3IT0A 3CG0A 2HNKA 4WLNA 2FPWA 1OHHD 4ZU1X 3IVCA 1JFFA 1GPNA 3ZLBA 3UMVA 3FYUC 2IXGA 3A0RB 2GCIA 4TWRA 1UJ6A 4DMRA 2BFFA 2IYAA 4BV3A 1JIIA 1DUIA 1Z4LA 1SKQA 2PA3A 3B5JA 1QFMA 3F0TA 4G1VA 1P1BA 5HCNA 3SYNA 5KX5A 1ZLXA 3CVYA 4NCKA 1KSFX 4D8TA 4J0JA 1K75A 1CT9A 2CNKA 2VJAA 3MJRA 5DGCA 5CCEA 4AAYA 1FZQA 3MERA 3QY9A 2X7XA 3FI9A 3AEUB 4MWZA 4O2LA 4TZ6A 3BKXA 1QX4A 1HTTA 2IU3A 1HETA 1M6HA 3EEYA 2A0UA 3PJDA 5HK8A 4BPBA 4WXEA 1GO2A 4UHBA 3I9FA 3IQXA 4AURA 3WLTA 2O5CA 3RKUA 3O9ZA 3TSZA 1WMSA 2YZGA 4UEWA 2K2WA 2TMKA 1TCAA 3C6BA 3CNLA 4IOKA 4DKJA 4U7DA 1OI2A 1SCUB 4DJAA 3ZVNA 3BZWA 3QENA 4RORA 2AG8A 3N6VA 4ZAGA 3AILA 3SC6A 2D59A 2E82A 2CCJA 3RHFA 5DBHX 5TDHA 1RRGA 1EDDA 2I8AA 2N42A 4LYHA 2W22A 5E3JA 4C07A 4CU5A 1XPUA 3HVUA 3M1YA 4QYMA 5SYMA 3B6EA 3EXG2 3PJGA 1DKLA 4L3OA 5D5HA 4CTMA 5LL6P 2JCXA 2XUDA 4HZGA 1RWNA 3IJEB 1QANA 3JPYA 4DXHA 4A8JA 4B1FA 3NHZA 4KIJA 4TV8A 1RMTA 4ZQIA 3WGVA 1R6UA 3LUHA 1L4HA 3GCDA 2OV4A 4CL8A 3SIPA 3UENA 2IKQA 2XNDA 4ZC8A 2O3QA 2HUNA 2VWQA 1M8JA 5F5LA 4RSRA 3K9FC 3CX6A 5CDGA 4ASUA 2BGRA 1IXSB 1CUDA 3A4IA 2WHQA 4XM2A 2EP8A 2P2YA 1D0VA 3NKFA 1UUFA 4OO3A 2HF8A 4WESA 5CFLA 5AUOB 4WZBA 1WKCA 5CYFA 2C9ZA 4DBLC 2IDMA 5CT5A 1JEQB 1Q12A 5DWVA 3SGLA 4KWEA 1OJ7A 3AR2A 4KQIA 3CWCA 2F64A 1GZHB 3BWMA 1QLHA 4IOMA 4RACA 5CHEA 4G26A 1ISPA 1LFDB 3JD0A 1VXRA 2XVAA 4BKPA 4DPMA 3CN9A 2OXEA 3Q7RA 4QNRA 3MIIA 5AKKA 4X92A 5F7XA 5L9AA 3RK4A 2OM2A 1Y6ZA 4A16A 1R4NA 1VLHA 1WXFA 2PX4A 2SKCA 3DE3X 4PSDA 4CCWA 4F92B 5TQ0B 1QCYA 5HFAA 5C53B 2CFRA 2PJDA 3PC7A 2PJRA 3LWNA 3S55A 4D4IA 4MYSA 1UFVA 1P0MA 1GPKA 2HF9A 2IZ5A 4KAAA 1LZKA 1MO5A 1OYOA 2I87A 3L0IB 2IY9A 1M34B 3CO5A 1GGJA 4X00A 1XZFA 5TY0A 2YJNA 3JVVA 1U9IC 3OE1A 5JO0A 2NU9B 4OK6A 1KJWA 3S8YA 3DOOA 2NX2A 3BBPA 4OL9A 3W8DA 4MIOA 4EG3A 5C1BA 3GCGA 1EQ2A 4A26A 1PFWA 1O8BA 4EA6A 2MOKA 1TVKB 3CCCA 5AI9A 4EOGA 1TAQA 1O77A 1KJNA 4CIYA 1DUSA 2GUGA 3CCBA 2DY1A 4KQ6A 4PQYA 2J59A 2QMYA 5ISMA 2YNMA 3I61A 2VQ6A 1F6BA 2JBAB 5LYYA 3COWA 1SOUA 4HFNA 1NRXA 1B4DA 3NM5A 1U0RA 4V24A 4EUFA 4R9VA 2CFTA 3IXQA 2PH7A 4IJVA 3A6PC 2A9RA 5AW5A 2JRLA 4EG4A 2BGIA 1XP5A 4IRUB 4U7TB 4PSUA 4GWLA 4BFLA 4N41A 5D3QA 2K7ZA 4OATA 3AEUA 4W9NC 4X45A 3RBAA 5BWLA 4REQA 9GPBA 3I1IA 4YCNA 2OBMA 3BMXA 3RRFA 1Y98A 3JQ8B 2OZLB 2EARA 3AHFA 3R3HA 4K03A 3OKCA 2YZKA 2FPKA 3WWYA 1RRCA 5ES3A 4BVEA 2AN4A 2VVTA 3P9CA 4JVOA 2PGXA 3DEJA 1YRYE 4PE5B 4N6OA 2QV7A 1DWOA 3SZUA 4I5DA 1ZM2A 4QD3A 1NNUA 3RO7A 3AG5A 4RE5A 5FV7A 5KX5F 3WOHA 2EX0A 2C5GA 1V8BA 3ZCPA 4ENSA 4PWYA 3EQZA 3VZSA 2W6NA 2WTAA 3EASA 1XEFA 1ADGA 3GZNA 1CNFA 3OOWA 3TMYA 1QQ5A 4KV9A 1P5HA 2IHTA 4IDAA 2H5EA 1EXDA 1ZN9A 3ABRB 1NMQA 1GUBA 1VA4A 1HTWA 1OLXA 3ED1A 4QUIA 3WQRA 1MO3A 3TK1A 1VMIA 1G5TA 1MB0A 2NXJA 3NVAA 3LT5A 3CO0S 3R6DA 2HJHA 3T0IA 1B8OA 3SF0A 1NUSA 1N1MA 1SQ5A 2VHCA 4HADA 2NSJA 3D7RA 4IJQA 4CIWA 2M6RA 2ZWOA 2C1XA 3HJAA 3Q9UA 3PU6A 1DG3A 1RZRA 4XH9B 2QT0A 1CSEE 1X1AA 2H2IA 2R1UA 3WZ2A 3SQXA 3QFRA 1G291 4KG7A 4B3TB 4Q4JB 2XGOA 4FSHA 3V1TC 4YO7A 2GDJA 2W0SA 5E2BA 4A73A 5DIZA 2YKGA 3AETA 2AC7A 4PPNA 1BZYA 1GL9B 4QULA 4XDZA 3ZN2A 4CTKA 4Z4GA 4XUEA 1OWMA 4F12A 3IKMB 4DQXA 1CFJA 2ZBUA 4I50B 2MYUA 3QFHA 4K46A 5EWMB 3THYA 4UAGA 1WNFA 4E5DA 2IXAA 4E7PA 3GLSA 5FXMA 4CR8A 5A5GA 3O5AA 3G1UA 2JJYA 4BB0A 3ADPA 5LXTB 1X39A 2GK6A 2HT6A 3B9BA 3EXAA 4YJGB 3I30X 3KL4A 4UHJA 4CG0A 4D3FA 2NO9A 4HLUA 1MX1A 4US2R 4R31A 2YQZA 1TFRA 3D6JA 3FTNA 4JLSA 3BL6A 4OLJA 5I7SA 1WXHA 4K26A 4JH0A 4FUQA 2IDKA 1PT7A 2BFNA 3VZPA 3TVTA 2BP7B 2Z4SA 2QA5A 1HMYA 4Q82A 4CT0A 1QOQB 1GLVA 3SF8B 1MXHA 2CSUA 3WL5A 4QATA 4R1QA 1I2CA 1O89A 3I45A 2YV3A 5KNLA 1ZR2A 1HEYA 3F6SA 3FMPB 3GRPA 4LOAA 1BYIA 2LR0A 4NFSA 3RVOA 3ZJUA 1VGQA 2D1FA 3V1MA 4BIMA 3RYFA 1DAKA 5I7VA 4TROA 1KEUA 4YK7A 2QBYB 4BVFA 1S2NA 4YN3A 5EXXA 2W42A 1ZNQO 2CXPA 2D2XA 1MB2A 3FMGA 3S2YA 3LF1A 4Q9JA 3R3JA 4ZN6A 1FFYA 2I3GA 1CX9B 1E6KA 1H85A 2Q46A 2LDBA 4MQ4A 1NTRA 4PTLA 5AJXA 1H1DA 2XUHA 4TQ9A 2ONCA 3HG7A 2OUIA 2JGFA 3ZNOA 1Q0LA 5ERGB 3CLTD 1JDPA 3REOA 2O8CB 2GBGA 3MOSA 3WYCA 5I7UA 1JHZA 2L82A 3RSCA 4IHJB 1NPTO 1V1RB 4ARBA 1JIUA 4YO8A 2EJWA 3EIOA 4MR8B 4F8EA 4Z7OB 5KC8A 3ZDAA 3JWJA 4KQ2A 4Q3DA 5ICEA 2ZM5A 3CKLA 5KTNA 5L6LB 3AVQA 5JS6A 4R9NA 4U7FA 2B37A 1Z7YA 3SVLA 1YIDA 4E08A 1E92A 1X1DA 1SXGA 4M21A 5DXAA 5FUWA 2VT6A 4WK6A 4D81A 7GPBA 2GO7A 3UAXA 4C0HA 4NCJA 3KDSE 3KNZA 4OUDA 1BHSA 4D7AA 1A77A 5KSOA 4RVDA 2PMEA 2WICA 4MV7A 4AQDA 1KZGB 1M6VB 3DT8A 4N76A 3SY8A 2R8PA 3NT4A 1V25A 4YECA 4JVMA 4PHTA 2BT4A 2WKQA 4YJ2B 2QRMA 1G9XA 3NAZA 4LE2A 5BQOA 4ZHSA 3ZQJA 4ZHQB 4ZP1A 1Q95A 2WD8A 3BD6A 4WX2B 1PJTA 1QIMA 1UC9A 3LCRA 1OXBB 2EL7A 1XCBA 2RAUA 1AZSC 2W48A 3K9NA 4LNUB 3MWYW 1QUFA 1MDBA 2VSXA 1KQFA 2C2YA 3H75A 4FCVA 4ZXPA 2YW9A 4Z99A 4MULA 2FFJA 4MKHA 3RUCA 2V4UA 1M1ZA 1KL7A 2AQIA 3QH4A 1F8YA 1YONA 2P3OA 2QJOA 4PFKA 1E2JA 1VBKA 5CLQA 2YYZA 3K09A 4DQKA 3THYB 3P0HA 3Q41A 4URFA 1IWOA 2CD9A 1RRKA 2YIJA 4WW0A 3DZBA 3ZIDA 2HHLA 5I7FA 1RRVA 5DLDA 1Q17A 4XQCA 4GI7A 4ZU6X 5G1PA 2QS9A 2JK0A 3TD6A 5IM4F 2YWHA 3E53A 1NYLA 4V2UA 2UYCA 1VDZA 4ENQA 4RTSA 4R7GA 1NBMD 3CR3C 1WCWA 4YMLA 3EXHB 4Q24A 4C4AA 4IZOA 3K8OE 4MS1B 1GAWA 4HC4A 4MMZB 3SEAA 3ESRA 1MFPA 3V4OA 2Y76A 3DO6A 3B12A 4CG2A 2E89A 1HOTA 2O7SA 2QTGA 1IFXA 3PFKA 3E4CA 1L8QA 4LWQA 3NJ4A 4W8HA 3UKDA 2FZCA 1W6RA 1DXQA 3L0CA 2WHRA 2ZRAA 4XKJA 5JT1A 5JYEA 4KO4S 2UVDA 3F46A 4WMLA 3MMXA 4Q3KA 4XCVA 5CA1B 4KW7A 3N3BC 1JU4A 3REQB 1C7ZA 3CRZA 3DUFA 2CUTA 5F21A 4UZSA 1Z2PX 1N2JA 3QG5A 2H1VA 1O0BA 4CKWA 1JIQA 3AM5A 4A5SA 4B6EA 4MVJE 3LECA 5CB4F 4JROA 2XOKA 1Q0TA 4MRSA 4X95A 4AJKA 4MA5A 4C5BA 4O08A 5JSQA 5I9TA 4LJ8A 4KLCA 2FP4A 1L7AA 4KNYA 1MF7A 2GYUA 1KU0A 2O48X 1BDHA 3U19A 5C7YA 1KZ6A 2E0IA 4NZYA 4X1YB 2COEA 2VAMA 4IGAA 1I33A 2JAQA 3M6MD 4IH1A 3X2EA 5AVOA 2R25B 2R85A 1FJXA 2FUKA 4MR8A 2W2TA 5IFLA 4WKOA 3HO1A 4EMBA 4PAQA 1GSHA 4ZQHA 3V6MA 1YHZA 4XVUA 4DJFC 4MKIA 4YLYA 1OQAA 2ZJ2A 1EP2B 1ORTA 1ZOOA 2C5SA 4QBIA 4EI7A 3X1ZA 5ENVA 1X7WA 1KQGA 2GAJA 3KOWA 4MWTA 2E5WA 1OYWA 2VQFB 1Y3DE 4OHRA 3C6QA 4G8DA 2XYVA 4HZIA 4O2AF 4KFSA 1RXCA 1LTQA 1Z47A 1DBSA 2CVFA 4WHMA 5FDFA 3ACCA 2GILA 3PLNA 3TIGA 1H2XA 2QTAA 3CLUC 1M6VA 3EBOA 4JL6A 3HP1A 3K8YA 1P7ZA 1R10A 2Y9PB 3DV2A 3MQFA 1N2CB 3IGFA 2HHCA 3PWSA 4FMPA 5C52B 2NG1A 3C6ZA 5JLJA 3M81A 5EAIA 5JNVA 1BXKA 4I1VA 1P2FA 2V97A 4RFLA 4YQEA 5CB4B 2X86A 4Z4IA 2Q07A 1E3MA 5YASA 4CM8B 1NU8A 1W0KD 1A9XA 1J5EB 1QO9A 2DPGA 3PX2A 2FE1A 4M53A 4NH4A 3BICA 3SMVA 1TZ2A 3RUAA 2OWDA 1TQ4A 2FN9A 4CF6A 2DFTA 5K0ZA 4NCHA 1ZEMA 3ZEAA 5HKKA 3AR8A 4Y18A 1WL8A 1T24A 4PFJA 1UOPA 3DOEA 4I4LA 1ZDMA 2OGZA 5BOVA 4NBWA 4I9UA 4BASA 4WJLA 5F9FA 2OAEA 4YUZA 3LQRA 2O5RA 2W6MA 3T9BA 1P73A 1KE1A 1Z6YA 3IP8A 3KQOA 1EGMB 5HMMA 1PFGA 3H3FA 2H8GA 3WGZA 1L7PA 1M1XB 3W9SA 1EQUA 4BNTA 2PWBA 1L9KA 1Z07A 3DOHA 3GJRA 1QF9A 1P39A 1YZVA 1R64A 2GN0A 3ESDA 2XSZD 3FA2A 4YR9A 1G6KA 4RSMA 3LZDA 3UC9A 1T2UA 5DTJA 4N8EA 1ZUD1 2PE5A 2A35A 2OB1A 2YDXA 4J0IA 3C16C 3NTUA 1AKYA 2H00A 2RC6A 3QMPA 4MO9A 5IJWA 1JU9A 1QQTA 4DA9A 4GM0A 2OV8A 4V0NA 2QXYA 3I9NA 5B2EA 4PYIA 2PUJA 2PUFA 1AK9A 3LNTA 3MT0A 4DNFA 5A7GA 4WZAE 2HV8A 4XRGA 4N3NA 3VR4A 3BSSA 2AK3A 5ITWA 2YDYA 1DRWA 1Z6ZA 4G0OA 5KHAA 4C04A 4W9MC 3DHYA 4D9CA 3HVRA 5J63A 1SO8A 2F90A 5LZ9A 3AKYA 4V0LA 5B3JC 3Q3JB 1H3FA 5JSFA 3ECCA 4MVCA 2QVYX 4QUKA 2ST1A 4MQLA 4YAGA 3LLCA 2J9GA 5HCUA 4Z86A 1C1YA 1CVRA 3H0CA 4Z4EA 1YR6A 4Q3OA 4HH4A 5ALFA 1FXUA 2B4AA 3H2YA 1DTWB 2H31A 4RPLA 1MOZA 1N1GA 3OX4A 4RDIA 1PNQA 2I2BA 1T6BY 1U1IA 2ZBVA 4BZWA 2PWZA 3WVNA 1IL0A 2GGSA 1WNTA 5FUQA 1FSSA 3L7AA 3MB5A 3W5AA 1QG0A 2Q6IA 2ZIFA 2Q5IA 4ZAXA 2QW8A 1L5HB 3MC1A 2BR4A 2PDAA 5C5IA 2JIMA 3TQCA 4WXRA 3DE7X 3LC0A 4XTRA 3L4EA 4CQNA 1URPA 4KX5A 4MUKA 1P4JA 2NYUA 2CB0A 4FDMA 1E1CA 4FFBA 4W82A 3UMJA 5JNWA 4FBLA 1VMEA 2AR7A 4FTWA 1N5RA 2CK3A 3N8IA 1Y1PA 1DRKA 1LPBB 2H07A 1CW2B 5HF6A 1U63A 3FSEA 1YC5A 4LJ5A 2BZ1A 2M1ZA 3TSYA 1PR1A 5KSYA 1K4YA 2ZJ3A 2PT5A 4FDLA 1JG3A 1JXOA 4NOMA 5D2CA 1NULA 1UK6A 4M99A 4YRBA 2WF7A 1GKUB 2ZAYA 1V4BA 5KO2A 2QUZA 3GJ6A 2N1MA 1R9NA 1RSZA 3Q3VA 2V7QD 4O8CA 3VISA 3IRUA 3MWJA 4I9NA 2RH9B 1X80B 4R6WA 2WYOA 1H8HD 2I78A 1BWRA 4B3GA 3DOCA 3CEJA 3LUAA 4YJHB 2NV0A 2YH2A 4RNDB 4YNBA 3WGYA 4EW1A 5KPDA 4PZEA 1RAFA 4YMHA 5IUJC 4M1TA 3Q6MA 4LECA 5CVEA 3EPHA 3DFIA 1TKRA 1VM6A 3P97A 2OR3A 4ID3A 3DLTA 4GPZA 3CIFA 1FUEA 2IUSA 3DMFA 1UPTA 3JVIA 1FLAA 1EX6A 5JAUA 4UE3S 2WDZA 2WU1A 1PCXA 4QE3A 4HEA6 2D2FA 1U0JA 2VDVE 4E94A 1VLQA 3T1OA 2H18A 2Z1DA 3EEOA 3ZGVA 1E1RA 2ROQA 4JYCA 1T4BA 4W5WA 4P9NA 5BR7A 4K40A 4NPAA 1IG0A 4GE3A 1U9YA 4LNHA 2XD9A 3SICE 4RTKA 4BCDA 5KSWB 4Z4FA 1W1IA 3MFYA 3DCIA 1C3JA 3Q8KA 4RDCA 1BVRA 1GUAA 2D13A 1XQYA 1DNPA 1NVAA 2XMQA 3I01M 4P2GA 1BXZA 5B3JA 3HJUA 4HEHA 3K6SB 2P6PA 3DDWA 3MTEA 5DX1A 2J9FB 2JIZA 3QLVA 4OYRA 3T3OA 3QVTA 4IV8A 4Q19A 4O3FA 4Q7JB 4UQPA 4L27A 4EPRA 3I9V1 4B40A 3S8MA 3T7KA 4H1VA 1ZONA 2Z4TA 3FWNA 4LJ7A 4W8OA 5KYGA 1WMAA 2GM9A 1F38A 2DHEA 2ISQA 2QN7A 2A67A 3ZD9A 1WBDA 4BKRA 1PBNA 1V48A 1FFCA 2XQGA 1DQRA 3LQQA 4AY3A 3J7AC 1XJWA 2IV3A 3LIIA 2J5XA 1UFKA 4FGKA 3OPNA 4UD2A 4X3CA 1Q1NA 3WE7A 2BFDA 3EZLA 3PRYA 3FH0A 4ND6A 3UXYA 4DIKA 3T5DA 2IF2A 3JPWA 1M1NA 1C41A 3CXRA 4QYIA 3VC3A 3OZGA 1HH4A 3QJYA 4EK9A 1PJ8A 3EDYA 3U4QB 2P0YA 4Q7QA 3FDZA 1MC5A 2D5IA 1T8WA 2DWOA 2EF1A 3CUSA 3LCMA 3N86A 2ZAIA 4KFUA 4KWHA 1JFLA 1OASA 4K0KB 5DP1A 3WL3A 4C7KA 4EG8A 3G2KA 4G56A 1BXGB 3ADCA 1GT91 3G23A 3GT3A 2M2IA 4CLEA 1C4OA 3IR5A 4MUFA 4X5OA 5EFZA 1IEQA 3TTWA 3HJBA 3V42A 1KDZA 2EW2A 3DOFA 1KAQA 3F7MA 4FXOA 3X43A 3I8SA 4CHTA 1ANKA 5I7WA 3CRRA 4TUYF 3BCSA 4Q1BA 4G2TA 1P2GA 1KMHB 1S0UA 2BAGA 3HY6A 3OVMA 3FLAA 4X6UA 4YUXA 4O25A 4Q18A 1R37A 1JA0A 5IP5A 4A0GA 4F4DA 4QQ8A 5LA6F 4OQNA 1J4AA 1U7PA 4ENPA 1TLLA 3VX4A 4WKPA 4YRSA 3I32A 1EG7A 4BZQA 4L8VA 2CCGA 1A5BB 3ZE8A 2Z2JA 1WHSB 3I0ZA 4YP6A 4B76A 3AEQA 1U1DA 3DMYA 1XBTA 4NAVA 5CXSA 4JOCA 3ENZA 1MB9A 1ADFA 5A9SA 3ZR4B 1B16A 3A6FA 3DO8A 4HDKB 1TZCA 3ICVA 2AX4A 4IF4A 4DANA 2VTBA 4G2NA 4IDHA 3BFJA 1AQYA 3DAHA 3GIDA 1CV2A 4BQRA 2C7BA 2XAUA 2VP9A 2J5QA 3T4PA 2O2DA 4KVGA 4IIBA 4INOA 1DSSG 4MNTA 2EFGA 1W19A 1ZNWA 2QYTA 3LRPA 4WCFC 4LF4B 2AXPA 3B7GA 3H5WA 3L84A 4XYBA 1BTOA 2WPNA 4MLCA 5THXA 1DXHA 4BXOA 4ER5A 5GV7A 3T5MA 2B4QA 1JLLA 4L2IA 4OH1A 2V3VA 1TEZA 2PKXA 1QGYA 4L8GA 5JNUA 1J0XO 4FX5A 1BE8A 3IAEA 4UOQA 1N36B 4FNOA 3DQPA 4EO9A 3O26A 1PT8A 3QFFA 1JEDA 1TEVA 3PDWA 3TZKA 4EB6B 4LDRA 5EIXA 3QI2A 4RD6A 5JECA 1KXZA 1T5IA 2PQ2A 2WWFA 5HE8A 4DSOA 2JEYA 2GVDC 4H7KA 3R8FA 4TM8A 1R0KA 4M9CA 4RJKA 2VRCD 3H5AA 4K9MA 2VK1A 2I71A 3PEFA 1M54A 1YBMA 2EYQA 4LXIA 5H3CA 4CU2A 4JEHA 3HO6A 2DLDA 4TMKA 3EIHA 3E3AA 4IM7A 4GPBA 5FWYA 2IS1A 3AKEA 2QZSA 2Q5OA 3VKUA 2FFRA 3D6TB 5BV0A 3UH0A 3V55A 5KVSA 4AZ0B 1T0UA 5SY9A 1FXWA 1E5QA 5H83A 1CY0A 4K1XA 1KRWA 3M49A 1AIPA 3JD4A 3JV7A 2EW8A 1NWHA 1Y5IA 4ZZ3A 4Y9DA 2C8LA 2I3DA 2EL9A 2WUWE 2D2VA 2ZSDA 3FDXA 1R74A 1C4XA 1IY9A 1W0CA 2B99A 2QXTA