3SX2A

Crystal structure of a putative 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium paratuberculosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
268
Chain Sequence
GPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASVPYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDELGRLDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPTLVKQGTGGSIVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNSIHPSGVETPMINNEFTREWLAKMAAATDGAMGNAMPVEVLAPEDVANAVAWLVSDQARYITGVTLPVDAGFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium subsp. paratuberculosis
molecule tags Oxidoreductase
molecule keywords Putative 3-ketoacyl-(acyl-carrier-protein) reductase
total genus 99
structure length 268
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sx2A00
2WYVA 3GHHA 3Q2KA 3V1YA 3ZNNA 2TMDA 3CINA 5L7WA 4EITA 1R37A 2ZTVA 4D3SA 5DCWA 2OMEA 4PN3A 4HWKA 4XGNA 3MZ0A 1I8TA 3ZV4A 3KLPX 1LI4A 1H94A 2Y0CA 2A35A 2H6EA 4XYMA 1UP7A 4J91A 5B4TA 1B8UA 3VPFA 3VH1A 3RUCA 5HM8A 3OJLA 1SMKA 3GLQA 3RC9A 2D4AA 1EE2A 1ORRA 1ZK1A 2VYND 4WLOA 1AHIA 2BFOA 1VKNA 3R6DA 3NJ8A 3DONA 1G0NA 1HZZA 1HEUA 3DZKA 3ASUA 1O0SA 2PZLA 3JQDA 2CDBA 5JAQA 3CSDA 3KLMX 3SJ7A 3V1UA 3AUAA 1K3TA 2I9PA 4CODB 4DUPA 3E82A 6LDHA 1FXSA 4J90A 4ALMA 3ON5A 3BMCA 5IZ4A 4DQXA 1EK5A 2UDPA 2P9GA 3RUIA 3VH2A 4ND3A 4OXYA 1E3IA 3EYWA 3WGZA 2D5CA 4YA6A 1RWBA 4NBTA 2PZKA 4R4JA 1HE2A 1Q2XA 3E18A 1YB5A 4BKRA 1GUFA 1NVGA 3C85A 4BNHA 1UP4A 2GN4A 3ZN2A 5ITWA 4ESOA 5LC1A 3ZWPA 1ZKMA 1P0CA 1YJQA 2Z1MA 3ZNQA 4WASA 3QQPA 4I9NA 4JXKA 1DIGA 4HFJA 1H2BA 1BGVA 2W2KA 2FSSA 3AK4A 3MJVA 4UEKA 4P4NA 2ZCUA 2W4QA 1ENPA 1J0XO 4J7CA 1N8KA 1PJCA 4AJNA 2DPHA 4AJEA 3F4LA 3I9MA 5I8ZA 3JYPA 2WE7A 1GQ2A 2HAEA 4XQEA 2DBVO 3JYLA 4TQGA 4XDZA 3JTMA 1ZK3A 2BI7A 2DTEA 4LVCA 3N7UA 5CEFA 4RV9A 3ZV3A 3V2UA 4B7CA 4DLAA 4PLFA 3S2IA 4CM8A 3NV9A 4FD3A 4KWHA 3C7AA 1EUCA 3RUHA 1Y8RB 3UW3A 2DM6A 2O4UX 3RFVA 4CMBA 3RKUA 3T4EA 3H9UA 4GVXA 3ABIA 1ZNQO 4WECA 1YOVB 2Y05A 3VPSA 3FRJA 1N1GA 1AUPA 2QRLA 4J9UE 2GUGA 1JKFA 1YB4A 3K92A 4QTZA 1O94A 4IJKA 1BSVA 1BXKA 2FR1A 5L45A 1UDCA 1YDEA 2VNAA 2WD8A 1U8XX 3WYBA 4CMKA 4YEDA 3GPIA 1GV0A 3GZ4A 4P22A 4W6ZA 4XZ3A 2JD2A 4CUJA 4GLLA 4XYLA 5FEUA 5TJ9A 2Y1GA 3DBHA 3WIEA 4XB1A 3AOEA 3H9QA 4ZHSA 3JQFC 4U8GA 1VL0A 1IPFA 5T8KC 2X22A 2JFHA 3EAGA 2PA3A 2IXAA 1W6UA 5DCYA 3O4RA 3GG2A 3GGOA 4EEZA 5IZCC 1PZEA 3F47A 4PLCA 4ROSA 7ADHA 4OXKA 4WKGA 3HN2A 4PIVA 4M87A 1QYDA 2Y1CA 4LRTB 3GZNB 2PWZA 5IF3A 1H0KA 2VYVA 3E5MA 1YBVA 5BSHA 4LW8A 5CEJA 3S2GA 3VVCA 1Y81A 5CFZA 1ISIA 4BGEA 3GVXA 4UVGA 4QO7A 3U62A 4W4TA 3TJRA 5ENVA 1HLDA 9LDBA 4D44A 5JAZA 5DN9A 1PGNA 2ZB8A 4K6FA 4ALIA 1HL3A 3QVWA 1LEHA 1UXJA 5FF9A 2CF6A 4NHEA 4ZGWA 2NVWA 2ZQYA 2GGSA 1I2ZA 1LSUA 3DBHB 1HZJA 2FY8A 1YOVA 3O03A 4WE3A 3AM3A 1ADBA 2D5AA 1T4BA 1X1EA 2BGMA 2QRJA 3UVEA 3PRJA 1RM0A 5FI3A 1Q0LA 4WCFA 5L51A 4CMGA 2GPTA 4ILKA 1YXMA 1L7EA 1JVSA 1X14A 2HLPA 4TZKA 1VJ0A 3WB9A 1OAAA 4J0FA 4BNKA 4XB2A 4UUNA 2GO1A 5A9TA 4YPOA 4XA8A 1RPNA 1U7TA 2XPCA 4DA9A 5GY7A 1QYXA 2A4KA 3DZFA 3E9NA 3QWHA 3W4IA 2ZYAA 2YFHA 1T2EA 2O7QA 3IJRA 2EWMA 4HX5A 2Z95A 3BIOA 5I9LA 4R54A 4ND2A 4FGSA 4QT0A 3JQEA 2TMGA 4KTTE 2JCXA 3ADOA 3PHLA 4OSOA 1YVEI 4CR6A 3GOHA 1PIWA 3EY4A 3GUCA 1QLJA 2G76A 3TOXA 5JPIA 1DIHA 3QV1A 3ZWMA 1FJHA 2AEJA 5A02A 4OKNA 1T1RA 3QRWA 4HUJA 2WMDA 2AXQA 3DL2A 3KSDO 4WJZA 4UUMA 4EYEA 4GAEA 3AUTA 4IY1A 4Z0TA 2FN7A 3IUSA 3GVIA 3BMQA 3BHMA 3U4HA 2PFGA 1DFHA 2ZYGA 4AJJA 3HJAA 1ZSYA 2W8ZA 4BMVA 2GR9A 5TRTA 1FF9A 5TSDA 2B69A 1IOLA 3DBRB 5JSFA 2P9CA 1IL0A 3RFTA 5CPBA 1HDRA 5JDIA 1R4NA 3L9XA 3OFSA 3RC2A 5JDIC 1YBMA 1IYZA 1V35A 1UR5A 3D3WA 2WJPA 4KTVE 1SNYA 1OOEA 3TZKA 1NPTO 4B3HA 2GZ1A 4MIOA 1PSDA 3PYLA 4Y6SA 2I3AA 3PFFA 3O8QB 3VAZA 2C5EA 2VZ8A 1KETA 5AYVA 3K2EA 4L76A 5L53A 2PGLA 1ZH8A 4O59O 4RDIA 1BXGB 3D4PA 1GY8A 1BW9B 1M76A 1ZK4A 2E4AA 1GYPA 1OMOA 1MUUA 1EVZA 4WUVA 4E12A 1UUFA 4II2A 1E6EA 3SBOA 4MPDA 4CUKA 5KJEA 2AE2A 5ES3A 2X9GA 2G5CA 3GEDA 1BDBA 1UZMA 2VYNA 4LMRA 3H9JA 2Y66A 1EEHA 3ANMA 4OSPA 2Q1UA 4NNJA 4IIUA 3WFIA 4B4VA 2ZJ1A 4R41A 4GL4A 4R1TA 1I32A 4RVGA 1B7GO 2BGKA 4BGIA 2VT2A 4UVHA 4B7UA 4CLOB 3HQ4O 2PR2A 4XWYA 3BMOB 3ZH2A 1DPGA 3ZWBA 2DPGA 2NACA 5I7EA 2DKNA 4K28A 4MVJD 1EDZA 3PJEA 2WE8A 3Q11A 4YJDA 3DQPA 4DBZA 2BFPA 2X58A 3D64A 3FHLA 3GEGA 3RC7A 4A0SA 1SAYA 2JKVA 3DWFA 4JLWA 4IDEA 4ND4A 1GCUA 4PLWA 1YH3A 5CP8A 4FFRA 4JBHA 4RJTA 4ZICA 1C0LA 1QLHA 4XYEA 1DC6A 3E8XA 2NNLD 5GMOA 3JD0A 4M86A 2EG9A 2OFPA 4HFRA 4Q3NA 1YQXA 3GDGA 2PKQP 1DOHA 2RHCA 3CZMA 5CDYA 4PG6A 1DIAA 2DT5A 2BELA 5G0SA 1Y8RA 4RPJA 4E5KA 1KC1A 3RJ9A 1IHXA 4J1SA 3H2ZA 1WDKA 3TZ6A 1Z74A 1HLPA 4B3JA 3D4OA 4CMCA 3GNQA 4FC6A 2ZJ0A 4IDCA 3GH3A 4M89A 1SEPA 4WLUA 2OO5A 3BMOA 2P91A 4YJHB 1XU9A 2Q49A 5F5LA 3OIDA 5GZ1A 2O2SA 1XQ1A 3KYCA 4A03A 1K5HA 2PY6A 4UEOA 3GG9A 3F9IA 3LC7O 1P1FA 1T2CA 2EIHA 1FDSA 3ANLA 5DULA 5CG2A 3CE6A 1VSUA 2BKAA 2BFMA 3JQ9C 4YT5A 4CLOA 2O7SA 4M54A 1DEHA 3G1TA 4CMEA 5DBGA 2I5PO 4YQYA 3GQVA 3UKOA 4NMHA 4N54A 4YVFA 2PKQO 5AXCA 3DTYA 3ICCA 4PG4A 3PLNA 2O3UA 4TRMA 3QVOA 3R1IA 3QHAA 2VWQA 3PQDA 1R4MB 5T5QA 3NTRA 2FR0A 4G65A 1EZ4A 1B15A 3TSCA 4GQAA 3QLJA 5GZ6A 3O9ZA 1WZIA 3K6JA 3OEWA 4L4RA 3FPLA 4XQGA 3ITKA 1PTJA 4BKPA 3ZW8A 4JBIA 3Q0EA 2FSVA 3WGHA 4W9NC 3VKUA 4CR8A 3PIIA 3TPCA 1Q7BA 1D7OA 2HQ1A 1TT5B 4M1QA 4NG5A 5KTKA 4TRJA 1MC5A 3FR8A 3GDOA 2RH4A 3U0BA 4CMHA 4DIBA 3KTDA 3LZ6A 1I2BA 3AOEC 2E49A 3OQBA 4O6VA 5ICMA 4IMPA 3AI2A 4D79A 4XEHA 1D3AA 2BF7A 5T57A 1JLLA 1Y8QB 2VZ9A 1WNTA 1NX6A 2NUAA 1JDJA 2DTDA 5G4KB 3ETGA 4Q3DA 2IZZA 5CG1A 3OP4A 2HK9A 4E2ZA 1PJBA 1YDWA 5F1OA 5MGBA 2JCVA 1QSGA 2V65A 2PH5A 4I5GA 3HADA 4K26A 1PR9A 3ROKA 2DFDA 4LK3A 4B79A 4XGKA 4E21A 1IUKA 5JC1A 4B8WA 4J1NA 5H83A 2X5OA 5JS6A 2B0JA 3Q1LA 4P38A 1YJ8A 2NVBA 5F1KA 3PYMA 4R5HA 3CMMA 1F14A 1HETA 3BTUA 4IZHA 2PV7A 3EDMA 1X0XA 1JAYA 3RUFA 2O3TA 3PGJA 1CF2O 5CHEA 2OORA 3ADPA 3S55A 1P31A 3V1TC 4DPMA 2B5VA 2Y67A 3JQCA 2CSUA 2O4CA 3H2SA 3PI7A 3PWZA 1IZ0A 4KDEA 4DC0A 4GGPA 2HMUA 3VZSA 1ISJA 4DWVA 1P9LA 1CWUA 4UVIA 3ZWAA 2LDXA 2D8AA 2Q2QA 4UREA 3KSZO 4BKUA 1R4NB 3Q9UA 4CV3A 3ZWWA 4EEXA 4NBRA 4OL9A 1YL6A 3WBBA 3JQFA 1KY5A 1MX3A 4I9HA 5H81A 3PHGA 1SOWA 3OECA 4L4XA 4TMFA 5IZCA 1H5QA 1GZ6A 2AW5A 1FDUA 4MVJH 4ALKA 2EEZA 2OXIA 1HDYA 4GKBA 3GHYA 2H63A 4XX0A 1HYHA 3D7LA 3K9QO 4NJMA 4BO3A 4CQLB 3GR6A 4KQWA 4YXFA 2X0NA 1E3WB 2FR8A 1Q1NA 2NLOA 1LJ8A 3EW7A 3K8ZA 3WYCA 4BL5A 4CLDA 4QUKA 4PLYA 1GEGA 5JLAA 2EKLA 2OOSA 3NDJA 3EUWA 3ZHZA 2YV2A 3HSKA 1P74A 1U3VA 3LQFA 2Y93A 4IPTA 3TZCA 1O95A 3QW2A 1GYRA 3X2FA 3QJ5A 1UZNA 4FB5A 3JQGB 4I8XA 2VHXA 1TI7A 3JD1A 3HZZA 4DYDA 1A27A 3SLGA 5I7VA 2I99A 4U5QA 2X86A 3L77A 1QP8A 2Q4EA 3VOSA 2UUOA 3AUSA 2GZ2A 1E7SA 4ZD6A 1LLQA 1PWZA 2PTGA 4IDAA 4MVJP 1EBUA 3WQRA 1U5AA 1T2DA 2WEKA 1R12A 5FYDA 2E6UX 1KVTA 3BMCB 3ZNPA 4DMLA 3ZU4A 4PFJA 2VWPA 1HKUA 1NQ5A 3I5MA 1FDVA 1Z45A 3D5TA 3GDFA 3L4BC 5DP2A 4FFPA 2HK8A 3ST7A 2NVUA 3WGGA 1T1SA 1YWGO 1TVEA 2YYYA 2NQ8A 1ZEJA 2C82A 2I67A 1WLYA 1E3WA 3JQ7B 5IXSA 1KOLA 2ZTMA 1DHTA 1LC0A 1JTVA 3WJAA 2X0IA 5JDCA 1O89A 1PL7A 3CUKA 1E3SA 1BHSA 5COAA 4R1UA 3W4KA 3U4IA 1JWBB 3F1KA 3FN4A 2GF2A 3PLRA 4YJFA 3GVPA 1ADGA 4MVJM 3NJ4A 1PZGA 3AWDA 3ZW9A 2Q46A 2DLDA 4FS3A 2PLAA 2V6FA 1MG0A 1CIVA 3DOJA 1ULSA 2BGLA 4IDBA 5LCXA 3OIGA 5TT1A 2VQ3A 1JA9A 1W0CA 1YS4A 1OZAA 2X5KO 3KZVA 4KUEA 4N5MA 3VKVA 4E32A 3DOOA 3DMYA 2WD7B 3IL2A 4CR7A 2J5KA 3ENKA 1Y6JA 2DBZA 5IAAA 1VPDA 4CM8B 5BNFA 3WMWA 3DZJA 3NAQA 5TT0A 5U1PA 1IPEA 4E4YA 3GN2A 3DHEA 2J3IA 4I5DA 2Q4BA 1LDYA 4DREA 3ONEA 1PS0A 2O48X 4YAKA 5JYDA 2POQX 3E48A 2YDXA 4EJ0A 2P2SA 5JC8A 3L4BA 3PZRA 1LC3A 2GERA 4A10A 1CDOA 1XEAA 4Q3AA 1DBVO 4MIEA 4GX1A 1HSOA 4YJFB 3RWBA 2HSDA 3I9KA 1H9BA 4L4SA 1C1DA 4INAA 4JGBA 3GT0A 4L74A 1A5ZA 3CXRA 1U3WA 4HFNA 4Y6PA 5JAMA 3KB6A 1ARZA 1J4AA 2GN6A 2VOJA 1ADFA 4ITUA 5TIIA 2Q3EA 4TZTA 3OA0A 2VT3A 3STHA 5TLSA 4PVDA 2Y1FA 3G79A 4WGGA 3SEFA 5U9CA 3RQSA 1NAHA 4RLSA 1L1FA 3C24A 4OM8A 1G1AA 2X5JO 3HDQA 4MIYA 3LSYA 4YJGB 4RCVA 4DPLA 2JCYA 1UAYA 1I3MA 4BB5A 3WX0A 3QA9A 1PGOA 4CLHA 3ZWCA 4AJPA 5B4VA 5TF4A 5I9NA 2QW8A 1MFPA 4YRBA 3RUDA 1PJ3A 2I76A 1UXHA 3OJOA 1MLDA 3M2TA 1U28A 1V8BA 4JJGA 1SBYA 4PLVA 2PH3A 3U09A 1ZSNA 4YTEA 1NASA 4J4TA 5JMPA 4BV9A 1Y8QA 1P44A 3GEMA 1NFRA 3ROMA 2AHRA 2D1YA 4RL6A 5K6AA 3QY9A 4FJ1A 5LDGA 1V3VA 3JSAA 5DT9A 1XIVA 3D1LA 5G4KA 4DMMA 4FN4A 5U4QA 1DXYA 1DC3A 1RYEA 1U8FO 1I3LA 2OBYA 3GY0A 3MJEA 1NHWA 1M75A 4NZ9A 1M67A 3OSUA 1V0JA 1KVSA 1Z75A 3ZZNA 4F6CA 5KJ6A 3ETEA 2GSDA 2X7HA 2QZZA 4WLFA 4BNUA 4BKOA 1R16A 1H6CA 1AN9A 1CQIA 3QE3A 4TKLA 4TRNA 1K2WA 4XCVA 1AXGA 2HU2A 3RJ5A 3OM9A 1HRDA 1EVJA 3U4CA 1KERA 1HDCA 3EC7A 3PXXA 4HXYA 3OJEA 4XYGA 1HDOA 1X1TA 4JX8A 5A9SA 2EGGA 1KBZA 2B4TO 1GADO 3UH1A 1OBFO 2EGHA 4BNLA 3PHJA 4AJIA 4HV4A 4JK3A 1CQJA 4LMPA 3M6IA 3I6QA 3IOYA 4GH5A 4GWKA 5GZ3A 3RASA 4Z9FA 2BD0A 1GFSA 2G82A 3PIDA 1KS9A 2GLXA 4I5FA 3ETDA 2G17A 3AU8A 2GDZA 5C3MA 1NFQA 1H9AA 4C7JA 3BTSA 4CMAA 4Z0HO 1PL8A 1ENOA 3I4FA 1EFLA 3ZI0A 3WDSA 2ZTLA 4Q39A 3FTPA 1UXGA 5A05A 1UJMA 3ZHXA 4TVBA 4BNGA 3O8QA 3VPGA 3KYDB 1BMDA 2YDYA 3SC6A 1N92A 4J4HA 1GYQA 3X2EA 5HS4A 1PWXA 4AICA 4FR5A 1A72A 3IKTA 5JO9A 1UDBA 1Y5RA 3JV7A 4MINA 3WWYA 4EZBA 1A4IA 3IAHA 4FIZA 1U2GA 3PYXA 4NFYA 2W90A 4XYBA 4XDYA 1GEEA 4GVLA 4II3A 3EMKA 1E1MA 2X1HA 1T2AA 1E3LA 1N1EA 1NR1A 3L6EA 3A9WA 1YL7A 2JHFA 3F4BA 3M1AA 2IEBA 2HMVA 3E1KA 4OQZA 2YHIA 4DLBA 5L40A 1GUZA 3I52A 3B70A 4PVCA 1GV1A 3FD8A 5COBA 3F6YA 2HMWA 1QYCA 4G5HA 4BKQA 3JQAD 3PHHA 4XKJA 1DIRA 4BHTA 5IG2A 5C7IO 2WYUA 1TEHA 3JD3A 2NVUB 3PPIA 4YAGA 5JXWA 1DJNA 1R66A 4RDHA 3WGTA 3ZV6A 3R3SA 4GWGA 5IDWA 3OICA 3B1JA 4MO2A 1XYGA 5A3VA 3WJ7A 3FNGA 1CEQA 4NU6A 2CMDA 2NADA 5LDHA 1U9JA 3GK3A 1ZBQA 1IE3A 4D3FA 4U0JA 1NPDA 3MJTA 5L3ZA 3B1KA 1EFKA 4IMRA 4BGVA 3JQAA 2IZ1A 4CMIB 2ZCVA 1ZMOA 3DMTC 1EDOA 4UULA 1HDXA 3BA1A 3SXPA 2NSDA 3VDQA 3WOHA 1QYVA 1FDWA 1UXKA 3EZYA 3IP1A 1HDGO 1U4OA 3C1AA 2HUNA 3N58A 4U6QA 5TC4A 3DO5A 3V2GA 5A5EA 1NVMB 1R0KA 2GN8A 4IJWA 4OXNA 3L6DA 2XF8A 3HWRA 3MEQA 3ZWNA 3KM0A 3OF2A 3INGA 1ZW1A 3LF1A 2FRDA 1A9YA 3VDRA 2QIOA 3N74A 1LRLA 4TKMA 4XJTA 4YJHA 3P2YA 3RVDA 4AFNA 4B7XA 2FOIA 4JJFA 2J3JA 4DTIA 5BSEA 1YE3A 2YHIB 3SX2A 5I7FA 4CM6A 3E6AA 2JFGA 2EXXA 1PJQA 3QVXA 1LA2A 5T8KA 1K6JA 4Y8VA 3JD2A 5IJZA 4TSKA 5A1TA 3AFNA 4QSMA 4NH4A 3PP8A 1X7HA 1V3TA 1WMBA 3GF4A 5T64A 4AJ4A 4BNVA 5KNLA 2Y68A 4DQUA 4KUHA 3I3OA 4M49A 4KDFA 4FOSA 3RFXA 4D42A 2IEDA 4WLEA 1Q0QA 4DL9A 2BMAA 5FWNA 2VRBA 4E5MA 2IYOA 4WLVA 3L6OO 1MV8A 4OKIA 4DIOA 3WXBA 4Y9DA 5TQVA 4IQ0A 4AJLA 2VHVA 1E5QA 2X9NA 4J3FA 1ONPA 1NM5A 1SO8A 1ZUD1 2ET6A 1K89A 4Z9YA 1P1JA 2E48A 1F06A 2BH9A 3WSVA 4EBFA 2DBQA 3DOCA 1C0PA 1QMGA 3A1NA 1XQ6A 5KKAA 3WGQA 4FOOA 1C0IA 2P9EA 1MFZA 1ZSVA 3IP3A 4BV8A 3ROQA 2Q2WA 1XCBA 5EPOA 2DAPA 2EF1A 1R6DA 5AVOA 4Q9NA 3BYZA 4UUPA 2ZB4A 2Q1WA 3ZV5A 4IUYA 3E9QA 4WNIA 1RJWA 1JKIA 1B8VA 3ONDA 1Z7EA 5DF1A 1QRRA 4JP2A 3PWKA 3KRTA 4TVOA 4B4WA 5AXDA 1XU7A 2E82A 1GCOA 2QRKA 4ZA2A 1C3VA 1TLTA 2JAHA 4CM4B 5HTOA 5THKA 4UAGA 4D46A 3DZBA 4NFSA 2OP1A 1OC4A 5L4LA 2V6BA 1OC2A 4IBOA 3WLFA 2H9IA 4GSLA 3AY7A 4XIJA 5JO0A 1MGOA 8LDHA 3FWNA 3WGYA 3AW9A 3EVTA 5JNLA 1KVQA 4Q3BA 4LSMA 3LT1A 5F5NA 1M2WA 2B36A 5C7LO 4E5YA 2F1KA 3HN7A 1LSJA 2CFCA 4ZRMA 2PZMA 4MVJE 1E7MA 1Z7BA 1DHRA 1JAXA 2RCYA 5KVCA 1ZCJA 4EJ6A 3JQBA 4F6LA 4DC1A 1DO8A 1H6BA 2D59A 3CH6A 4AJ1A 1K6XA 3HHPA 4P4LA 1DAOA 4AL4A 3HG7A 2UVDA 1GPDG 2AEFA 1W4ZA 1NQAO 4CL8A 2ILTA 2Y0EA 3PDUA 2AMFA 1VE9A 1ZIDA 3M2PA 2HCTA 3DTTA 1XDWA 4BNZA 3JYNA 4KMSA 2OGUA 1BXGA 3JD4A 1U3UA 4PLZA 3UICA 2J8ZA 1ID1A 3NDIA 1BW9A 2ZKLA 4WCFB 3AI1A 4AJ2A 3GVCA 3WNQA 2D2IA 4BNJA 4A7PA 2EV9A 4IM7A 5JY6A 4NBUA 1X15A 4JJIA 2JL1A 4J4BA 4BO8A 1B16A 1AHHA 4YDRA 3P7MA 4YBZA 2B4RO 5A04A 3H9GA 2PGDA 3BXXA 4K6CA 3V5NA 3ZHYA 1WDMA 5JMWA 3OETA 4LN1A 4RVDA 1I33A 2VOEA 1NFFA 1PR3A 5B37A 1E7WA 3NDRA 1XSEA 1C1XA 3H3FA 1A7KA 4R68A 4OOFA 1A4UA 1JN0A 3BMNA 3PFWO 3U49A 4QQRA 2VHWA 4E3ZA 4DVJA 2OL4A 2C29D 1ONOA 4E5PA 2IDZA 4QO8A 1U3TA 1HWYA 1P1HA 2DFVA 1EQ2A 5I7SA 2VNSA 4B4OA 1Z73A 2UV8A 2E37A 4WLNA 4ZQHA 3LDHA 1RM3A 4U6SA 5CPFA 1KVUA 1ZO8A 4J0EA 1YGYA 5KVVA 1O9BA 3I4CA 1E6UA 3GMSA 4ND1A 3ZU3A 3P2OA 5L7TA 4H16A 3VH3A 2EP7A 1LNQA 2V7PA 4QECA 2A92A 2I3GA 3F3SA 3UXYA 3RKRA 1V6AA 1LTHR 3RBZA 3QVSA 4M8SA 3TL3A 1X0VA 1F12A 2RAFA 3JQ7A 1I24A 1Q7GA 1QG6A 1BDMA 4CMIA 3TN7A 4RVUA 4YB8A 3WGIA 3H5NA 3FPCA 4AG3A 1WZEA 3DAFA 1DB3A 3CMCO 3Q3CA 4HBGA 4Q3EA 4B4UA 2V6GA 2GRAA 3WR5A 4NK4A 1XKQA 1ZVMA 1BTOA 4P4GA 1QXSA 4G81A 5KOIA 2FP4A 4DGSA 5EERA 3T4XA 2YV1A 5ER9A 3BMNB 1E1KA 4GX5A 1DRUA 4FQ8A 3UF0A 4IJUA 4ZVVA 1IHYA 3NYWA 2YZ7A 2C07A 5IDXA 4OJNA 4BIIA 2BHLA 4CM5A 3PK0A 4OGWA 2YFQA 4R69A 3RCBA 5F3RA 2YY7A 3DR3A 1V3UA 2AEMA 1NP3A 4HY3A 2VUUA 2X4GA 2HRBA 4XRRA 2C7GA 1D1TA 2VTEA 7MDHA 4Y67A 2O3QA 3UAGA 5JBIA 3PEFA 4J6FA 1OFGA 2UAGA 2YV3A 4Q3CA 4J1TA 5BT9A 5KVSA 3GAZA 2FMUA 4R51A 3M1LA 3QWFA 5HS6A 4CLRA 1R15A 2DVMA 3DBVO 2J6IA 1ISFA 1E3JA 1SEVA 4I5EA 5ENDA 5EIOA 3KHUA 4PZCA 2YQ4A 4IJVA 1P77A 3D0OA 4AVYA 5BNIA 3GPDG 4XR4A 4BO4A 4D7AA 4QEDA 4PZEA 1L7DA 1WVGA 1ZXBA 3UCFA 2AA3A 3PVZA 3JQ8B 3MTGA 3UUWA 4XIYA 4YQZA 4C4OA 4BS9A 4EGFA 1ADCA 1IB6A 4KZPA 5IN4A 3RU9A 4ZQFA 1EK6A 3NUGA 3C8MA 4LRSB 5TX7A 3DC2A 4W7IA 4MVJA 2Y1OA 3GRKA 3I83A 4ZRNA 4IS2A 1JW9B 4MVJF 4BO7A 3SJUA 3OQ1A 1GPJA 5AXBA 3TQHA 4BNNA 2O2YA 5IDYA 1MP0A 1VJTA 2CDCA 4LSWA 4HNHA 1P1IA 3AU9A 1BVUA 3ZDFA 4PRKA 6ADHA 3WIDA 1PQUA 1SB8A 4WOJA 9LDTA 1NQTA 4PRLA 3WYEA 3KYCB 3C3XA 4DIFA 3RBXA 3MJSA 1NAIA 3DFZA 1DLJA 3ANNA 1HTBA 3BTOA 4FJ2A 2AQKA 3LK7A 2WSBA 3ZWXA 3S1LA 5BNTA 4DLLA 1B3BA 4RF2A 1HSZA 5ER6A 4A27A 3EZLA 1N9GA 2VWHA 2VHZA 4CM4A 2CVOA 3TNLA 3TDKA 3JQ8A 2O50A 1UAGA 3K2BA 4NBWA 4YRAA 1T25A 2AQ8A 4E13A 3OQ6A 3AUUA 3PQEA 2WTBA 4NJOA 4JBGA 5KVQA 3H65A 3UGKA 2P4QA 3TOZA 2B5WA 3PZBA 5CDGA 4KP7A 1ZZEA 2FZEA 3HE3A 4YAJA 3O26A 5JCJD 4N5NA 3KUXA 1E3EA 1PS8A 2R2GA 2WM3A 4OMUA 3K30A 2QG4A 1ZJZA 2VRCA 3I1JA 2HO5A 3H6KA 5DDIP 3CIFA 4BGUA 5DBFA 2W2KB 2DTXA 3NX4A 5CDUA 4N5LA 2ZB3A 3PWSA 4QFCA 3A06A 4MJLA 4E2WA 3IC5A 5EJ2A 5CAEA 3L9WA 3HB5X 4BO1A 5A9SB 4CV0A 3K5PA 1WW8A 2HJSA 3LLVA 3AJRA 3F1LA 3KETA 2NU6A 2CUKA 5C7OO 3PJFA 2IYPA 2VRCD 2XXJA 1A9ZA 4J9VA 3ZWOA 3FF4A 1TXGA 2C5AA 4WK6A 1ZK2A 1B8PA 1R0LA 4KUGA 1E0DA 5JAIA 1I01A 1SPXA 3PHIA 3ORFA 3QVTA 1BWSA 4MP6A 5L4SA 5IXYA 3JQ6A 3R3JA 1B26A 3KXDA 1YQGA 4J16A 2R00C 1JQBA 3MOGA 1E6WA 1MC4A 1MXHA 2I6TA 2JJYA 1U7HA 3HDJA 1LRJA 4FFNA 4PZDA 4WPGA 2CVZA 3QWBA 3QP9A 4FDAA 4H3VA 4CMJA 4MOWA 2AG8A 1LXCA 3ZHBA 2EERA 1XA0A 1PQWA 2Q50A 1VJ1A 3IIEA 4RVSA 1FK8A 4Z6KA 4A5OA 2VUTA 5TJHA 3FTNA 2P5YA 1XLTA 4BO6A 4CLEA 3JQ9A 5DOVA 3VPHA 4NQZA 1QV6A 4JQCA 3PTZA 5HBRA 5FI5A 1LLCA 2QX7A 1WMAA 4Y6RA 2Q2VA 1E1NA 4IQGA 2FHSA 4O1MA 5CDTA 3KEQA 3TL2A 1I10A 3GC6A 2PK3A 2AQIA 1PJTA 2NQTA 3OJ0A 1AXEA 1JWAB 3W1VA 3PJGA 3OHSX 4RF4A 3W4JA 4WOKA 1XELA 3RIHA 2O3JA 2BLLA 1NQOA 4OIMA 4BMSA 5A4DA 2I65A 3NT2A 3FNHA 1DJQA 3OEYA 3VZQA 4OYRA 3F5QA 2QHXA 2RIRA 3COSA 5JDCC 1I30A 3AM4A 1LDGA 5TS3A 5CDSA 1AGNA 4OH1A 3NT4A 1CYDA 4LGVA 3KO8A 2O23A 1EVIA 3NTOA 1LRKA 3IMFA 1I2CA 2GD1O 4ND5A 4RQUA 4NI5A 1Y5MA 3H7AA 3WMXA 3FNEA 2ZTUA 3GNSA 2G1UA 3AM5A 2Y0DA 5EESA 1A71A 3AY6A 3ZU5A 1LLUA 2D3TA 4DQVA 2VZ0A 3QWIA 1QKIA 2JFFA 5C5IA 1U2DA 4FSHA 2HDHA 3AY3A 3W6UA 1KEPA 5DZSA 4BO2A 2Z1NA 4R01A 4MP3A 1C1DB 1TT7A 1HDZA 2H1SA 4MVJI 4Z3KA 5FFFA 2CY0A 4CM7A 4BUCA 1BVRA 4F46A 1VKOA 5BSFA 1YO6A 4YACA 1E5LA 4GSKA 3C1TA 1X13A 1SZJG 4KQXA 3HDHA 5HWSA 3TWOA 2EKPA 3DB2A 4OO3A 4PG8A 2C0CA 2O3RA 4R3NA 1ISGA 4B8ZA 3MOIA 3D3EA 2YW9A 3F46A 3TZQA 5G0UA 1K0UA 3G1UA 2NU8A 5EINA 3L0DA 4WCDA 4R9SA 3LU1A 4CQMA 3JYOA 3QIVA 5CEEA 4XR9A 2GASA 4E0BA 1BRMA 2BFAA 3QSGA 4HADA 2DUUA 4BNFA 3GRPA 3OIFA 1NHGA 4W99A 3LT4A 3PDJA 2OZPA 4XGIA 3ZWYA 4IDGA 4R1NA 4ID9A 1LDMA 2R00A 1EMDA 4OOEA 4RPKA 4YYZA 2FPGA 1UXIA 5KIAA 3DBRA 3H8VA 3HFGA 5JY1A 4KOAA 4GPD1 4GMGA 4CM9A 3FWZA 4D0RA 3ZCXA 1GD1O 3UHAA 2WD7A 3ZNOA 4R16A 3ENNA 1VRWA 3RD5A 4RLHA 4CL3A 2IE0A 4C7KA 2FPIA 4EUEA 5HRUA 3DBLA 3WG9A 4RPHA 1P1KA 1DRWA 4L75A 4HNGA 3UCEA 2GNAA 4W7HA 1EUZA 4UEJA 4YAEA 1VC2A 3S2EA 4CUZA 1P3DA 2FZWA 1CERA 1KYQA 3KV3O 3FSRA 3RUAA 1N2SA 5A5FA 2EJVA 1PEDA 3C1OA 5TNXA 2YUTA 4PLTA 4NDNE 4YR9A 4FFMA 4YAIA 1EVYA 1LSSA 1JVBA 4IQ8A 4O0LA 5C37A 1KEWA 3DHNA 1Z6ZA 3I9NA 2NTVA 3VHRA 4WNCA 3GMDA 3T7EA 5KWEA 3DAPA 3Q2IA 2EHDA 4IGFA 4E33A 1EE9A 4IIVA 4K1LA 2PD6A 4RO0A 5G0WA 3MJ4A 1G6KA 3RUEA 1YKFA 3DDNA 3G17A 2B4QA 4CV2A 1LUAA 3FR7A 2VHYA 4FPXA 2XAAA 3VTFA 4D3DA 2AG5A 1LBEA 3I9OA 3IS3A 1B2LA 1GL3A 3GGGA 3KYDA 3U3XA 1QYWA 1VLLA 3OMLA 4F3YA 3EHEA 4W9NA 4RZHA 4ZU3A 3K96A 2D0IA 5IN5A 1PS9A 3ZU2A 1SOVA 5KKCA 3HB4X 4PG5A 4UUOA 4E30A 1GR0A 2B35A 2Y99A 4J7XA 4ALNA 3RAJA 4N18A 5JCXA 4JROA 1ZXLA 3G49A 4X54A 4L8VA 4LISA 3F5SA 5I9MA 4FCCA 1J5PA 1P33A 1I5RA 2EP5A 5JE8A 2X0RA 3JQBC 1Q7CA 1O5IA 1RKXA 1U4SA 4MKZA 4CM9D 2CNBA 3JCZA 4YT4A 1DLIA 3V8BA 1C14A 1T26A 3I23A 2IODA 2WDZA 2X6TA 4WEQA 1WXDA 1C1XB 5DCUA 4NR0A 3GFBA 4BNYA 3GAFA 3D3WB 3HUDA 4J43A 3JQAB 1J6UA 1ONNA 1UP6A 4GX0A 3TZHA 1GAEO 1PZHA 4IINA 5A3JA 1I3NA 4R1SA 5B12A 2LDBA 2P4HX 2ZK7A 1QV7A 3IDSA 5COQA 2AQHA 1KVRA 1I36A 3GNTA 4U7WA 2O3SA 3RI3A 4EDFA 1UZLA 2YHUA 4EJMA 3SC4A 3JYQA 1GQYA 2VUSA 2JD0A 5G0VA 4GGOA 1LU9A 2PZJA 1HT0A 3INRA 3I9LA 1XR3A 2Y1DA 3CTMA 2JHGA 1HF3A 2DQ4A 1DC5A 2ZQZA 3LC2O 4BOYA 4GBJA 5A03A 1KY4A 4MVJG 1YB1A 4JP3A 4DBVO 5ADHA 1LQUA 3NRCA 1YQDA 1VL6A 2PD4A 1CETA 4R5MA 4JNKA 3LYLA 2JD1A 1T4DA 2NWQA 2PGJA 4BQPA 1DAPA 3GA0A 5T6BA 5A9RA 1KEUA 3PGXA 4BMNA 4RPLA 1W8DA 3H5RA 1K6IA 4FC7A 1NTOA 1TT5A 2XOXA 3G3EA 1SB9A 3UCXA 1B14A 1HE5A 1LDEA 4D45A 4GKVA 5A06A 1XHLA 3QWAA 5F21A 1H93A 4BNTA 2H5LA 3A4VA 4RQTA 3NGXA 2DU8A 1P1RA 1KEVA 8ADHA 4ZN6A 3RU7A 4LCEA 4N7RA 3VH4A 1O6ZA 4IS3A 5KJCA 4IXWA 4K9DA 3DHYA 3GZNA 1E7YA 2GN9A 5ITVA 4Z0PA 4CV1A 5JFOA 5EQDA 4DYVA 4A26A 1H6AA 4EW6A 4BNXA 2XXBA 2X9VA 5JCJA 4MKXA 3BTVA 3GUYA 1GQQA 4BQRA 5HA5A 5B4UA 4S3MA 4J1QA 1A7AA 2CF5A 2Q1SA 3OA2A 4CLRB 4XJSA 1D1SA 2Z5LA 3WBFA 5ICSA 5AXAA 4OQYA 3C7CB 1W73A 3IJPA 4MKRA 1XWFA 3OBBA 1DIBA 1HE4A 1WP4A 1IULA 1VI2A 1GTMA 2NU9A 3K31A 1J49A 2HKIA 4ZQBA 3AOGA 2Q1TA 4J49A 1H2HA 4E2YA 5MDHA 3TFOA 1GUYA 1DC4A 2X8LA 2RH8A 1IZ9A 1YBAA 1EBFA 4D0SA 5KJ1A 3HNPA 1RM5A 2OUIA 4GLOA 3G0OA 1G0OA 1SC6A 3W8DA 3UFXA 3U4DA 4BO9A 2B83A 4CPDA 1VSVA 1LQTA 1X7DA 3VTZA 3RROA 1NXQA 4XQCA 1R4MA 1PX0A 2ZATA 3K73O 3NT5A 1OI7A 3MJCA 5THQA 2IXBA 4NU5A 3E03A 1DFGA 2HJRA 2SCUA 2ZIZA 4I08A 3WSWA 2DC1A 3DBLB 3WFJA 5G4LA 4RORA 2W2LA 4O63O 3NGLA 1C0KA 3B1FA 1ZFNA 3SVTA 4KWIA 5ILOA 3PJDA 1HYGA 4EUHA 1B3RA 4OHUA 3KOUA 5EN4A 4A2CA 2J5QA 1JU9A 4Y98A 3GFGA 2C7VA 1RM4A 2B37A 4M55A 1PQPA 4NBVA 4NFHA 4RGBA 2AE1A 3ITDA 2PNFA 4BNWA 3FCOA 2QQ5A 1M6WA 4GMFA 1O8CA 1V9LA 1TB4A 2HMTA 3JQGA 4MDHA 3WS7A 3LT0A 1MG5A 2WWRA 2YQ5A 3I9JA 3L4SO 3UN1A 3WTBA 3CEAA 5KCZA 2W2LD 2IRWA 2CDAA 4PGFA 5BQFA 2C20A 1HE3A 3ZWVA 3RBVA 4BVAA 4AJKA 4BO5A 3L07A 1R0SA 4S1VA 4CJXA 4G2NA 3U9LA 3AI3A 4IZIA 1NPYA 1KC3A 2G0TA 4PLGA 2J5RA 1UDAA 3BMQB 1N7GA 1U1IA 4FFLA 1NWCA 3KVOA 1XGKA 3Q6IA 3FI9A 4YT8A 1LSOA 2VYVD 2EJWA 5DP1A 4HKTA 4JN6B 2PKRA 3VPXA 1GZ3A 2HK7A 3E9MA 4NPCA 4PCVA 3H5AA 3DZIA 3EVNA 1E7QA 1DDOA 3ZGYA 3V2HA 3IKVA 1PGJA 1D8AA 4YWJA 1ENYA 2IZ0A 2GCGA 1PJSA 3WNVA 5TGDA 1RYDA 2Q45A 3DZGA 1CJCA 3KEOA 2NTJA 3IQDB 2NTNA 1MXFA 5EMHA 4D43A 2OP0A 2C54A 3ASVA 4Z3DA 3ICPA 1MA0A 2VTDA 2RHRA 3WWZA 5L7YA 3W8FA 2VCYA 1SCUA 4P8RA 3INTA 1DSSG 2ZYDA 4L0QA 3B20A 3MTJA 1YL5A 4R3WA 2J3HA 2YJZA 3LT2A 3O38A 4NJMB 2Y1EA 3VZRA 3ROPA 1WWKA 2EKQA 1ZK0A 3BAZA 5DNAA 3S8MA 1LDBA 1QR6A 4ZQGA 1KIFA 5K9ZA 3BHJA 4DPKA 3CKYA 4FGWA 2NV6A 2HMSA 3BHIA 4I9UA 5J23A 5IFLA 5L4NA 3H3JA 3D4NA 2OHXA 4XQ9A 4A73A 1ZJYA 1ULUA 1HXHA 3WQSB 3PQFA 4GX2A 4FBGA 1GDHA 5B1YA 3LF2A 1XG5A 1DRVA 3FBGA 4MP8A 1X7GA 1Y1PA 2A9FA 4E31A 2JAPA 3FBTA 3H9EO 4RF5A 4CQLA 3CZRA 3KSUA 1YRLA 3DAGA 4FW8A 5T67A 5G2OA 5G0TA 4AJOA 4BB6A 4JIGA 4RF3A 1TA4A 1CRWG 1LX6A 1U5CA 3LC1O 4OAQA 1ENZA 1Q0HA 5KJFA 1EUDA 4UVEA 5BSGA 2GYYA 3CPSA 5K0ZA 2J3KA 2CD9A 5DBIA 3A14A 4RPGA 4J2OA 4HP8A 5AOVA 2EW8A 4J7UA 4NK5A 4D41A 4YT2A 1Z82A 3SLKA 3U5TA 2GZ3A 4CMEC 1PZFA 3P5SA 4ZJUA 1D4FA 1DFIA 3IUPA 5AQ1A 2ZB7A 4PLHA 3W6ZA 1ML3A 1YONA 3GN1A 3KBOA 1JKJA 5DOZA 4UVDA 2F00A 1GU7A 1IY8A 2P5UA 4F45A 3DMTA 5EQFA 3DEYX 3RC1A 4YRDA 1FMCA 2R6JA 1VM6A 2BRUA 1N7HA 4YCAA 4Z9XA 1PJLA 2QYTA 1E1LA 3WQQA 1WDLA 3MWEB 1MB4A 5I8WA 1ISHA 1I0ZA 3B6ZA 3EGOA 3P19A 4E6PA 3I6IA 1HYEA 4WCFC 1NNUA 3S2FA 3TF5A 2C2YA 2P68A 3MWDB 4CQMD 3NEPX 3FNFA 3ONFA 2QYSA 1E7RA 4L9RA 4FFOA 3DZHA 1LDNA 4GI2A 1Y7TA 3Q9NA 4E2XA 3H4VA 4EUFA 3R0IA 2C2XA 2FPPA 4LVUA 4O5OA 1ISMA 4RVFA 2V6MA 1BXZA 4RVHA 1Y9AA 4FJ0A 5BR7A 1UH5A 1T24A 1WPQA 1PGQA 1E77A 3VZPA 3WTCA 4H7PA 1LLDA 1PGPA 4BO0A 3LVFO 1NR7A 2CVQA 2W98A 5K6AC 4JCOA 2QZ9A 5H82A 2NU7A 2A94A 1M66A 1H6DA 1M6HA 1F0YA 2DBRA 4CM1A 3UOGA 2UYYA 4PLPA 3NTQA 1PJ2A 3EK2A 4W82A 3WICA 4L73A 5JW6A 3W8EA 4IDDA 2VWGA 2DUWA 1FDTA 3LLSA 1QORA 4IDFA 1PU2A 4CQMB 2BI8A 3T7CA 1N9GB 3OH8A 4QXMA 1E92A 1B0AA 1Y9EA 1WAMA 3VVBA 2OBNA 4ZQEA 5L9AA 1NWHA 1BG6A 2PD3A 4H15A 4ONEA 4XD2A 2VN8A 3D5QA 3WLEA 1P0FA 1NBOA 2WYWA 2CZCA 1T2FA 2X23A 3HDYA 5JYEA 3WGOA 4QX6A 3ULKA 4EI2A 1S7CA 4IXTA 1ZMTA 4BNMA 3TRIA 4LCJA 1NVTA 1GZ4A 3A28A 1S6YA 1PL6A 1NYTA 4CLXA 5ILGA 3DXFA 3GVHA 3KYBA 5EL0A 2X0JA 3C7DB 2UUPA 1AE1A 2I66A 3AFMA 4URFA 4RZIA 4IGEA 3BZUA 4TRRA 2Q99A 2HRZA 1P45A 3MCVA 4YJGA 5IDQA 3DFUA 3GGPA 1VL8A 1F8FA 4PG7A 2EW2A 1I3KA 4CM3A 1ZEMA 4B3IA 4XRGA 1PJ4A 4ALJA 4I1IA 4NIMA 4TWRA 3NKLA 4QFDA 4DXHA 1N5DA 4R9RA 5F1PA 4ALLA 4E5NA 3TFQA 3E5RA 1F8GA 1F17A 4HFMA 4DRYA 1EQUA 4AJHA 2NM0A 3OJFA 5L95A 3VC7A 3RSHA 2C59A 4U0KA 4TROA 4J2HA 4BNIA 2RBEA 3HFSA 4WEOA 2FWMX
chains in the Genus database with same CATH superfamily
2WYVA 3Q2KA 4P3OA 2WJZB 3TEJA 3V1YA 4EM6A 2LPMA 2OG2A 3CINA 1H65A 2SHKA 1KI8A 1R37A 2WF5A 3B12A 1KJQA 2VAMA 3V6MA 3WGUA 4D3SA 3PNPA 4PN3A 3ZV4A 3KLPX 1YRWA 2ZJAA 3KU4A 2CXOA 4Q37A 5I9SA 3TD9A 1E1RA 3E81A 5CXSA 1BH2A 1H8ED 2P79A 1AF7A 1WMSA 5KHAA 2VTVA 3GJ5A 1UKZA 4I1YA 5B4TA 5LZ5A 1B4DA 3OJLA 4H77A 3ZJTA 1PNTA 2MR6A 3RC9A 4IDHA 1WSAA 4MRPA 2WP8J 3MTAA 4WLOA 1VHTA 1AHIA 3K8YA 5SY4A 1F9AA 1PVOA 1OUMA 4F9TA 5KTNA 2XMSA 1HZZA 1YCHA 1CR0A 3CH7A 2QX8A 3AL0C 3S81A 5JAQA 2A7XA 5CMLA 3VR0A 3KLMX 3V1UA 3Q0TA 3NDPA 4DUPA 1Z13A 1JQEA 2PX3A 3L1VA 4YHBA 4ENSA 1QHNA 3CNNA 5C81A 4IX9A 3ES9A 3LBNA 1UKCA 4OP1A 3AV3A 4RKRA 4OXYA 4JP1A 1IWPB 1E3IA 1UJ6A 4HD8A 1A3CA 1TE2A 5JOQA 3GW8A 1EM8B 4TV9B 1MQ8B 2DPMA 4KAFA 4MMXB 4DSOA 2VAXA 1V8ZA 4R4JA 1Y48E 1Q2XA 1OGJA 5TQ0A 2PX2A 1BMTA 3NORA 2FU5C 1FS4A 5F77A 3TRJA 2HN9A 4BKRA 3C85A 4WXEA 1K9VF 5ITWA 1CVRA 2XD9A 3AKDA 3EDQA 1E1QA 1NYQA 2B8TA 2Z1MA 4QARA 4RD6A 4ZOLB 3QQPA 4I9NA 3TJZA 4F3NA 1CJKC 4IICA 1DXOA 4HFJA 5MN4A 3IAEA 3BXOA 1R5JA 4YLGA 1ENPA 2W37A 4ESVA 4J7CA 4JY7A 3K1AA 1VPVA 4KLRA 2PPLA 3R5HA 2EOAA 1EP9A 1BOFA 1JXMA 3F4LA 5I8ZA 2HIGA 3ADKA 3JYPA 5SYNA 4ZDJA 5CAEB 5CFOA 5I6DA 2HAEA 3KTAA 3FVRA 4FFVA 1RMTA 2I1VB 3IAM6 1ZITA 1ZJJA 2R4UA 3S7TA 1ZK3A 3N8IA 3BFKA 3EXFA 2PWBA 4B84A 4N48A 3L06A 3PV0A 4Q4JA 4DEVA 4TLMB 3MAJA 4DLAA 3V2UA 4HYTA 2PX5A 1KK3A 1SOUA 3GAMA 4O4HB 3S2IA 1Z2DA 3FCCA 3HDGA 1BGWA 5BW5A 2G5GX 1JIKA 2O5VA 2X42A 3NV9A 4FD3A 4MR8B 1YSCA 2GZDA 2QPTA 5A5DA 4C9BA 2PT7A 3BJIC 3RKUA 2J9RA 2JVIA 2O2JA 2OBMA 3H9UA 4GVXA 2HBZA 3AEUA 1YOVB 2R5WA 3F6CA 2Y05A 4WECA 4R1MA 4EKYA 4GGMX 3FRJA 1B1AA 1Z2NX 1WUTA 4X7PA 1AUPA 2QRLA 2GUGA 3MT8A 1JKFA 1YB4A 3RRFA 2Z8YA 1O94A 4QGSA 2WLTA 4ZAXA 3AVTA 1YDEA 3QHQA 1UK8A 4CIDA 4OK3A 4LQDA 2WD8A 3F0TA 5J63A 1WU7A 1L5WA 2XLBA 3WYBA 1YZFA 4P22A 4W6ZA 3KZCA 4XYLA 1IK6A 5E2BA 5K51A 1SHJA 3SIRA 5IANA 5JZVA 3SIPA 1DO2A 4YUWA 1F5SA 4EW3A 4X24A 4RXUA 2AF4C 3DMDA 2JFHA 4QFBA 1Z0FA 2O19A 2IXAA 3C1UA 1JEQA 4R7GA 5IT4A 1CY8A 1JFLA 5DCYA 4EEZA 1ID8A 2YWBA 4X9XA 4TL7A 3SS9X 3GFQA 2R5NA 5LLSA 1IATA 7ADHA 1NZDA 1RAIA 4WKGA 3VKHA 4PIVA 5E8JA 4YI3A 1QYDA 1J0EA 1O1YA 2QRVA 2Y1CA 1A7UA 3F6SA 3HU5A 3PPVA 4YRPA 1CQZA 3QLVA 1FS5A 5E6RB 2PWZA 3FUTA 3H2GA 5IF3A 3HU2A 4EG5A 3E5MA 4HAUA 5CEJA 1Y81A 2C04A 2DBYA 5B1DA 3TX6A 4DKJA 4HS4A 4UVGA 3IERA 3I5XA 5ENVA 5JH7F 1F2UB 1JU3A 5DNUA 2B6NA 1XCPA 1B43A 2MJLA 4JUDX 4M9ZA 2NU7B 2W58A 1N7IA 1IVNA 1RJ9A 1JPVA 2NZXA 2F8TA 5KYVA 1YJBA 1H42A 1QHEA 1W1UA 1PGNA 3FZGA 2H0AA 4JHLA 4G4SP 2QE6A 2NUPA 2XRYA 1U0FA 4W5TA 5FF9A 1E8MA 3ZIAD 1Y5IA 4R9NA 1SIWA 4IIGA 3SEQA 3ZOKA 1RZUA 4D9KA 3D8UA 4U1RA 2KWIA 2FY8A 1RZ3A 5HFJA 2V45A 3AM3A 3PUKA 1M33A 3MRXA 3R3UA 2QRJA 2O6HA 1EE1A 4PYNA 2CZQA 1RM0A 4I66A 4IX1A 4WCFA 4ZEWA 3FKQA 3TRHA 1OY1A 1GLNA 4D9BA 4RD0A 5A7GA 1JIJA 2XCTB 1TLLA 1RFGE 2GARA 1POWA 5A5VA 3WZMA 3ABOB 4OBXA 3P32A 1W29A 2HLPA 4FZ5A 1VJ0A 3VNUA 3EOZA 2OB1A 4XB2A 1JBEA 5E6SB 2OCIA 2D2VA 2GO1A 2JLRA 2ZIGA 4K8OA 2NUAB 4LJYA 2O8BA 1A82A 1GZDA 4ZAZA 4P86A 5GY7A 3OWHA 2FB9A 3TZLA 3K0SA 1QYXA 2RE8A 4R6XA 5LA6B 4RSGA 2GHRA 4JKIA 1RLTA 2EWMA 3ZHOA 2Z95A 3BIOA 4GI5A 1P9WA 1ZX1A 1V7PC 5BNZA 1DVRA 1CQJB 3JQEA 2FFRA 3PXAA 3T5AA 1SCKA 1GKKA 4KQ2A 4BLRA 3O5AA 3U3ZA 2IBTA 1WB6A 5LYJB 2QMQA 2WSSA 3CG0A 3CRQA 4HYEA 3R6WA 2JGNA 3VSEA 2R7KA 3GOHA 3BIXA 3KJIA 2CC2A 3GNLA 8MHTA 4UU8A 4HNAB 2O8EA 2YY6A 1PIWA 5KYKA 1E1YA 2YMPA 3CW2A 3ZY2A 4UHKA 4G9BA 2ADMA 3HYCA 4KGDA 1G7SA 4URHA 1DRKA 2D2FA 2JI4A 1W47A 2ZJBA 3L8FA 5DYTA 5E9JA 5LU9A 1FJHA 1RPTA 4JL6A 4MUXA 2M6SA 1T1RA 4FKMA 4KYUA 4OKNA 5EIHA 2VSFA 3DL2A 4A0HA 4WJZA 3RTBA 3WSTA 1T43A 1Z22A 2V4MA 2M9MA 3OLCX 1CUUA 3EF0A 2UVQA 1MHPA 1K68A 3ZLTA 4EYEA 3MN1A 3AUTA 4M0DA 4MQMA 4OMCA 5B57C 2FN7A 2RHOA 3JQRA 2W83A 3N8KA 1YS2X 1E2NA 1Q3TA 2BM8A 2FI1A 2QUAA 4P3YA 4JI8B 2PFGA 3DE1X 5FP0A 2W8ZA 5TRTA 2OGTA 1FF9A 3QTLA 2XBLA 3C5HA 1IOLA 3V34A 4EX6A 2VK1A 3DBRB 3AFOA 4GC9A 1P4SA 1L6IA 2J41A 2IV2X 3RFTA 4EW2A 4Z7OB 1R4NA 1T5TA 5L3VA 3OFSA 1SXIA 3MFQA 2IVZA 3ZDRA 5JDIC 1UJ2A 1I7SB 3VO8A 4PONA 2WJPA 2Z9DA 4KTVE 5HIAA 4IVNA 4PHGA 3M33A 4D4HA 2DSNA 3K5WA 1SNYA 1SXQA 4AWAA 1NPTO 2IH2A 1N9ZA 2GZ1A 4KXMA 1Y89A 2RGNA 4DY4A 4HAOA 1RI1A 3BRCA 3TW4A 1DKQA 2CFTA 2EAUA 4YRIA 2P65A 3K09A 5ALHA 5H1YA 4C1NA 2Z57A 3MILA 5B6PA 2PN1A 4BU1A 4RDIA 1Z35A 1KYIA 1WJGA 2X5XA 3RYHB 1GY8A 1ULTA 3I0ZA 2VUHB 3TL6A 1M76A 1ZK4A 2ZSAA 3QJGA 5NLLA 3WIOA 4M37A 4AMYA 3GJ0A 1ZOPA 2JJMA 1C9NA 2Q5FA 4M0MA 2FMIA 3DYIA 4JOSA 4PAGA 5FB3A 3TM4A 4E12A 4YRGA 4ZYXA 2WMNB 1SXJE 3FGPA 3NONA 4QT4A 5DJ5A 2Y4OA 3BXZA 1ND5A 5KJEA 4YRKA 8GPBA 3ROFA 4LIPD 3HYNA 2OUKA 3WRXA 2HQRA 3T1VA 4X1IA 3IA2A 3OY7A 2Y66A 4RTOA 1ULHA 1EEHA 3FKSA 5A4MS 3C3CA 2FLVA 4NNJA 4X63A 4JBXA 3V4OA 4B4VA 2ZJ1A 4DDUA 4R41A 2JIZA 3R23A 4CCWA 4RVGA 1UBCA 3L4JA 1GGNA 2BGKA 1V5WA 3LECA 3S7ZA 2O05A 4B7UA 3HQ4O 2PR2A 5BQXA 2F9MA 4XD7D 1V7CA 2CHGA 3ZH2A 2FPKA 4C7XA 4DLWA 1DPGA 2I0FA 3AF0A 3RBAA 3V4ZA 5I7EA 5IYZB 2XX3A 4K28A 4NQRA 2V0GA 1AA9A 1EDZA 3PJEA 1Z26A 3Q11A 4WRRA 4MPJA 2DFTA 4O2BF 3QKWA 4IDOA 4MUIA 3GEGA 3FHLA 3KK0A 4DNPA 4KIWA 3AHDA 4IDEA 4IV8A 2GEDA 2H57A 2WRZA 3OIYA 1FVHA 4PLWA 1QUEA 5CP8A 1I5EA 1M72A 4AZ3B 4FM9A 1KRWA 3DVLA 3HR7A 2IHUA 3R9XA 3HCBA 4C0QC 3FYUA 3N53A 1MOSA 2OFPA 3LUAA 4Q3NA 1MNAA 4AN1A 1U8UA 1WULS 2LRHA 1DOHA 4GBGA 1P4JA 4O4IF 3W78A 3N2LA 3ZKWA 1RPJA 3ZG6A 5B58C 5LN1A 2DT5A 3SSMA 2RB4A 4RPJA 5C1OA 4E5KA 2VPWA 1IHXA 3KVYA 4EB0A 1SCQA 1B23P 4CWAA 4ZO4A 2NO0A 3TBFA 4XVCA 5CIWA 3BJZA 1HLPA 3GFRA 2Z09A 4B3JA 3CCFA 3D4OA 3QG1A 4EYQA 4YH1A 3QXGA 2ZVDA 2QT0A 3NH6A 4IDCA 4D0NA 1NW7A 1TF2A 1WA5A 2XQIA 1R6UA 2PL5A 3AIMA 4K3UA 3BMOA 3L2OB 4DMRA 5ITSA 1XU9A 3LDFA 2VT6A 1CQWA 3DD5A 4F1WA 3OIDA 4ZI7A 2G7MC 2H07A 2O2SA 4N7MA 1XQ1A 3FNIA 4MHOA 1WLSA 4FEEA 3X1DA 1K6MA 5JRDS 2LBPA 1TEZA 3IV9A 3FTCA 4H4DA 2ZSHA 3TH5A 3CR8A 1RZRD 1ETUA 3SFVA 2BBSA 3ROEA 3B8EA 1EESA 2VFAA 4LJSA 2VQ6A 2BKUA 3P96A 2HTFA 4EHBA 1ZAYA 4GPAA 4C3VA 1IOWA 3JQ9C 4RA9A 4HH3C 2O7SA 3RTCA 4CLOA 3LPCA 3N8NA 5TS2A 2NO7A 5AP9A 1R6XA 1W0KA 1XCMA 4JOQA 3ZR4B 4EP1A 3U7FB 4YVFA 3PDWA 3EXIB 5FWXB 5AXCA 4BFLA 4F6RB 1VE3A 3D2LA 3N86A 3OT1B 1Z6YA 3FTEA 1GQSA 4MGYR 4PG4A 5LLDA 3E4DA 3PLNA 2ZWAA 3WLLA 1QIJA 4PYMA 1WBBA 2H51A 2O3UA 3QVOA 4TRMA 2XYGA 4PCAA 1LI5A 3QHAA 3ADBA 3L1KA 1FYVA 1KMHA 1I3OA 4KNWA 3NTRA 4I6EA 4G65A 3RTDA 5A3QA 2Q8PA 3QLJA 3EEQA 1E1CA 2IOYA 2Q4TA 3CM0A 3OEWA 4L4RA 4WIAA 3CVYA 2ODQA 5IBRA 5J59A 1J20A 3FPLA 4HB2A 4BB9A 2EG5A 1LPBB 2A59A 2OR3A 4O4JB 3KAPA 4BKPA 2HYIC 4KGZA 3X1XA 2FSVA 4CR8A 4FOLA 5D8DA 4OGLA 2X41A 3TPCA 1Q7BA 2AJDA 1W94A 4MVXA 4NZNA 4M1QA 4OGGA 4UQOA 3ZE8A 1E6MA 4LJ4A 2ZT8A 4EB8A 1B74A 1MC5A 2JJ8A 2W11A 1OD6A 2VK4A 3FDXA 3FR8A 3JTEA 4UCXA 4JI0B 4P4UA 3LJKA 2WSMA 4LQCA 4PICA 2Q3LA 3KTDA 5I7RA 3F4KA 3E2IA 4GPIB 3WA6A 1JHUA 1MTZA 1RQ2A 2E49A 3FCUB 3I42A 3UQYS 3LG2A 4DT1A 3J81k 3GYGA 3MG9A 1UDRA 1T91A 4OA8A 1NVEA 4D79A 1VG9B 1W85B 2VDPB 4TL9A 4XEHA 1U1CA 4ENVA 4WN9A 2IHVA 2BF7A 5JSYA 3VBEA 2IHBA 4MITA 1KOJA 2AI3A 1Z25A 5CTAA 3HEAA 3SQWA 1NX6A 1JMVA 2HSEA 3CZQA 1KTVA 2DTDA 4BTEA 2IZZA 4K9LA 1E5TA 1RD4A 2JAWA 4AP5A 2A1UA 3ESYA 3JPWA 3RIEA 1OXXK 4IAOA 4XIGS 2VK2A 4JUCA 4XVHA 3PI6A 2RGCA 5JXJA 5FFNA 4KPEC 1Q3HA 4EK9A 1LS1A 2WUVA 5EYPB 2CLMB 3OSZA 3HADA 3FZYA 5IM5A 5FLXA 5BW8A 1K8ZB 1TQHA 2ZRBA 5LMCA 4LK3A 2C1EA 4XGKA 1OV4A 1OXMA 2CVPA 4NYJR 5BR1A 4J1NA 4QGAA 2B0JA 3DA8A 4WBXC 1FUEA 4G1UC 4PYOA 4RQBA 5KINB 3VX3A 1O95C 1PN3A 1XYYA 4ZOLF 3PYMA 4R5HA 4GD3Q 5SICE 2GWRA 5JD4A 2QPAA 1GSHA 4BAZA 1F14A 5ILQA 5A6VA 2NO1A 1JAYA 4KG7A 1PDVA 4BVEA 2WV7A 3NBFA 1CFJA 4CFYA 2ZXFA 3ZVRA 5M7EA 2FN4A 3ADPA 2BKEA 4PX3A 4OU4A 3PD7A 2G72A 3IE2A 4FI3F 2EARA 4GXRA 5D87A 5LNK6 3SWWA 2HV8A 3H2SA 4AX8A 2WAXA 4NE9A 3BL6A 4XYGA 4YRJA 4C07A 2C5GA 2HHLA 4ZVQA 4YMHA 4HN9A 2JVJA 1P9LA 1CWUA 1U5BB 3CX6A 4FXOA 5D3ZA 3M3HA 3LQRA 3ZWAA 2LDXA 5HK8A 1P7VA 4CEHB 4EEXA 4EY4A 3I6YA 3LP5A 4ARZB 4OL9A 5DE3A 3FOEC 3ZJVA 5FBVB 1KY5A 3BFVA 4GP7A 1G4AE 2B4AA 3KU1A 1Z5WA 2I6SA 2RGYA 3AUFA 1TVCA 3LCUA 4I9HA 4UJ5A 3ZXXA 1CUVA 1U2DC 2QTHA 2BEJA 3N7TA 3PFKA 4J03A 2UZ3A 4QNRA 2FA9A 3GRYA 1YIAA 5EE9A 4GKBA 4OUKX 1LFDB 2H63A 3GHYA 3K9QO 2JIPA 4Q1CA 3L93A 3JALB 4BO3A 4N65A 3UBTA 3WA7A 4GXTA 4QWWA 3DBIA 4YXFA 2X0NA 1JF8A 5H59A 4O8CA 4BL5A 3EW7A 4QUKA 2WHYA 4IFTA 4P7BA 4P54A 4DM3A 2F1HA 4LPSA 2EKLA 1Q19A 2OOSA 2YN0A 1QWSA 2PMDA 3NDJA 4TKUB 5TPZD 3SHQA 3STTA 1CE8B 1RR6A 4Y2VA 1IM2A 2XJ4A 3TZCA 2BBWA 2GMWA 4QUDA 1X1CA 1O95A 4JBLA 5I5EA 4DR6B 3NI2A 3L4KA 4MLPA 1HQYE 1NMXA 3JQGB 5JQGA 2VHXA 1SCDA 4COOA 2BSQA 1TI7A 4F91B 1P3Y1 3A1CA 1X7ZA 3EVEA 1FFGA 1OVMA 1QHIA 1VDZA 4U5QA 2Q4EA 4RV4A 1ZHOA 3HXOA 1PJRA 4M83A 4EATA 2H54A 1RI2A 1G8AA 1UPFA 1WPGA 3KZNA 5HZGA 3REQB 2GT1A 3WQRA 4DXDA 1U5AA 1T2DA 2WEKA 4YFYA 1KYTA 1O4WA 4N8DA 2FZ4A 2YOGA 2P9FA 2QYOA 5FYDA 1UOPA 1RYMA 5EJIA 3ZU4A 4A0RA 1NQ5A 3M34A 4JJ8A 4RESA 3UK6A 7ABPA 3L4BC 1FFWA 1W46A 4RSMA 3CNHA 3S2ZA 4B2PA 5BOSB 1MJGM 1T1SA 4UHJA 1OBOA 2O2ZA 1TVEA 1YZKA 5EZYB 4P0TA 3O0TA 1M7HA 1ZEJA 1QMPA 4I46A 3OQNA 1WZ2A 2VJNA 2VJPA 3GJ3A 3WDKA 3L46A 4MRAA 4PFQA 1RQGA 3ZDEA 1LC0A 4E3WA 1O89A 2EBFX 2GZAA 3U44B 5FPSA 1VHWA 3G9UA 5D3MB 4W9MC 1IJFA 4R1UA 3KFVA 3U4IA 4BZQA 5E9AA 5CX1B 5TARA 3FN4A 3HR8A 2GF2A 1NVVQ 2Q3FA 2QJRA 3PLRA 2AEEA 1IMJA 3W3AA 2GM9A 4ZJZA 1FXUA 2Q46A 1R8YA 2DLDA 2PLAA 3MHTA 2Y76A 2V6FA 3RG8A 3UJHA 5K5EA 1VPWA 1MG0A 4LMBA 2LCFA 2Q7DA 1Z7WA 3KZMA 4PNHA 5LCXA 4LZNA 1KY3A 4KMOA 5EEGA 4UAJA 2EJTA 3OIGA 5EKSA 5TT1A 3REGA 3UXEA 4RSRA 4EABA 4EA7A 5LWQA 1W4CA 2X5KO 3GJZA 3HM2A 4N5MA 3VKVA 4FCVA 3DOOA 2WD7B 2XUZA 3MS4A 4P2GA 3ENKA 2JBAA 5DM2A 4BQOA 4CM8B 3M49A 3S2SA 5BNFA 7REQA 5JI2E 3TW6A 4JOBA 4MWEA 3OKFA 2ZSJA 4GPTA 1D0SA 5CA1A 3MGAA 4NJEB 2VF5X 2EP8A 1FRNA 1PS0A 2YH2A 5JYDA 2P4UA 2POQX 3WNDA 3U4QB 2O7NA 2P2SA 2P3LA 2MSDB 4J76A 4PU0A 4RD1A 5TVGA 1TUBB 3V2IA 2XWJI 3DTVA 4BVLA 5IAKA 4H7DA 4Q3AA 4AZVA 4YXWD 3TLYA 2PS0A 5IP5A 3PFBA 2TSYB 2XA2A 3LUJA 1SQ0A 4DDKA 3CJRA 4GX1A 4YJFB 3GLFE 1CQIB 2PR7A 1FLVA 3FYHA 4MV9A 1S2DA 1ACLA 5AUQA 1C1DA 3GT0A 3Q7PA 1A5ZA 1U3WA 4Y6PA 2GKSA 1MB0A 3K35A 4O2AF 1OWLA 2IL1A 1XMXA 1SXJC 3KR0A 3MF4A 1MT0A 3OKCA 4N47A 1PWYE 3KSRA 2Q3EA 4ITUA 4TZTA 5BXQC 2WWWA 4B17A 3OA0A 5JTUA 4BLVA 1B6SA 1BE8A 3STHA 5TLSA 4AKTA 5U9CA 1UAAA 1A9OA 2YY5A 1I6KA 5HDBB 2HOQA 1DAMA 1L1FA 1DAIA 1ZNYA 3K94A 1BWQA 1YZGA 1GHTA 3C24A 3L04A 2WK1A 4I1OA 3KQSA 4P5DA 1G1AA 5JUWA 3QVVA 2H9YA 4RE6A 3GJ8A 1UAYA 1I3MA 1VPTA 4BB5A 1TYDE 3QA9A 1KOGA 1D2EA 1PGOA 4G8JA 5HUHA 2FVXA 3IOMA 3PKIA 4UMFA 2BTQB 4YRBA 3K09C 2CCJA 4OBEA 2I76A 2FW1A 1UXHA 2WTNA 3OJOA 3NTVA 3W0LB 3CTPA 4DBLC 1V8BA 1SBYA 2FW6A 4GZ5A 1YRQA 3TINA 4ND6A 2LP4Y 3NKFA 3Q8KA 3KJFA 1ZSNA 1KJ8A 3LCVB 4YTEA 4F06A 4J4TA 2G67A 4BV9A 1Y8QA 4P7KA 3DZCA 4BUJA 1ADJA 3ODPA 3PUJA 3KPVA 3VOAA 2D1YA 4P0PB 3FPHA 4PCUA 4MB2A 3WXMA 4DSZA 4LTDA 1M6NA 2QBYA 2H8GA 4DMMA 1G3IA 4BQSA 1R6TA 2B2CA 1DXYA 1Q3KA 1MAUA 1F0KA 1XRLA 2VL7A 4ITRC 1U8FO 2R7NA 3TEMA 1XO1A 2R87A 1Z5GA 2JGLA 2AN3A 3FNRA 3G2PA 4MYCA 4NZ9A 2AOUA 1M67A 4P3XA 3T1TA 1V0JA 1BH6A 1RMYA 4QGHA 4TKZA 4F6CA 3ETEA 4RFSB 3FUCA 4QOHA 4JI7B 2VP6A 2AW3A 1R0BA 2OHHA 2GVZC 2V6JA 4TRNA 3MGBA 4IKEA 5FL7D 3T7TA 4B6FA 4KO2S 4E09A 2Q9BA 2FWRA 3CLUC 1RQLA 2XGJA 5EC8A 4TMVA 5HCIA 2A30A 4CDRA 1YVUA 3Q3EA 4MQ6A 3ZK7A 1AK2A 2ODAA 3QMMA 2DZDA 4C01A 1U2PA 2PO5A 1TLFA 3EC7A 4HXYA 3B3JA 1X1TA 4JX8A 2B4TO 4K7JA 1CG6A 2Y3IA 3H1AA 4WBNB 1OBFO 2G9ZA 1ZVVA 2B9VA 3DV0A 2QAJA 3PHJA 5CW1A 3HKEB 4NMLA 4FINA 1YJXA 2JGDB 3OEED 2N1MA 2H4ZA 2NO5A 2PVSA 3M6IA 1JQ3A 3EVBA 2QORA 4I36A 1U9YA 3RASA 1GFSA 2G82A 2WTAA 5IS2A 3TX2A 1SUBA 1X19A 3WRWA 4DJDC 3VYTB 3IUYA 3K05A 3IBGA 1Q1ZA 4Z86A 3IE0A 4K6OA 3HWX1 4PINA 4DG8A 1EB8A 2H2GA 5JWOA 4R2JA 4NF2A 4ZP1A 3CVOA 2C4MA 2QN2A 3CF6R 4N0QA 5C3MA 4I2NA 4PZUA 1H4TA 1NFQA 3BL5A 1B76A 4U7TB 4CMAA 1D03A 2VNKA 5C8YA 4CL0A 1PNOA 4O8ZA 1PL8A 2Q62A 2X1VA 2EBWA 3I45A 3ZZUA 3KQLA 1ST2A 3EIFA 1LJLA 4JI3B 1N2EA 3HXTA 1TA9A 2UZ4A 5I4CA 2FQXA 1SBZA 1UBKS 1UJMA 2X0DA 4JJ4A 4TXHA 2QAIA 1DP4A 2O7VA 1WUKS 3KEGA 2PCLA 3HJRA 3O8QA 2W2VA 4BNGA 3EX7C 2GTIA 4D8UA 2C3PA 3RH0A 4MMYB 3WYAA 1GYQA 1Q0TA 5HS4A 1EK0A 3L7YA 1IN7A 3G0IA 4ZANA 5FPHA 4MUNA 1A72A 2FJUA 4L8LA 1UDBA 4QEZA 1RI4A 4IHJA 4RHYA 3RRXA 3RT1A 1I94B 1A4IA 3IAHA 2O59A 4JYMA 1R74A 3AHEA 3P71T 1W2WB 2ZIXB 4KYIB 3TLAA 3UJ9A 3MS7A 1D4AA 1QLWA 1PNVA 4OPMA 4DA4A 3K15A 2DPLA 4KQFA 4PRYA 2GJ4A 2X1HA 2P2ZA 1E3LA 3ONNA 2I34A 4HNRA 5ELLA 4AKEA 2VP3A 1I6LA 1Y3AA 1YL7A 1JXOA 4US0R 1P2GA 1JHOA 2QN6A 2YHIA 1KFCB 4IHJF 4PVCA 1SVKA 1SKBA 3FD8A 4P4SA 1UFRA 1SOAA 4IHQA 5COBA 2JIOA 4AMUA 4BKQA 3JQAD 5LQJA 4WVFA 2VHTA 4Q7JB 4BHTA 2HZBA 5IG2A 5C7IO 2XWPA 2CVFA 1TEHA 2GOYA 4MUEA 4QHTA 3ABQB 1R66A 2GN1A 4RDHA 3VYWA 3ZV6A 4M0PA 1ULBA 2NV2B 3OICA 5LXTF 4C7OA 1XRSB 2BAGA 4MO2A 1XYGA 5A3VA 2LTAA 2FSIA 5AK6A 4QZVA 5C8YF 1CEQA 1C9MA 4NU6A 3OEHA 2NADA 1FNSA 3W9SA 1E6CA 5IUKC 2D0DA 4B0PA 4AXBA 4WFQA 4O2BB 5CBKA 2A86A 2C78A 3MJTA 2V03A 3RK4A 4JOCA 2V8BA 2WD9A 3EIEA 4ND8B 4BGVA 3R2JA 6AT1A 3JQAA 4EPXA 2ZCVA 1ZMOA 2JH9A 4H08A 2PX4A 5SZHB 1ECBA 3H5LA 4R3UC 2BYTA 2XA1A 3SXPA 3HGMA 2ODTX 2WWTA 1NNI1 2EL7A 3VV3A 1NJ2A 1UXKA 3EZYA 3IP1A 1HDGO 2OCDA 5KX5A 1YUMA 4U2DA 1W4LA 3UHOA 2H1FA 1L1RA 1VIYA 2ID7A 2ID4A 4N5HX 5TMEA 1G2QA 2H2AA 2XF8A 3UPUA 3ZWNA 2AX3A 3INGA 4BEBA 2WICA 1MC8A 2I4TA 2YZGA 1II0A 1V1JA 4GWLA 3RABA 4DMHA 2FRDA 3UG6A 3OZAA 1ILEA 1UCFA 2PUHA 3N74A 2WUWE 3R3WA 4D8VA 4K05A 3TCKA 1N25A 1A8SA 1G3RA 3FDJA 4TKMA 4YJHA 4BX3A 1UMCB 3FRIA 4AFNA 3C3JA 3EOBI 5IMSA 5PNTA 4EG7A 3CT6A 4B43A 3UWOA 2WKWA 4DTIA 4CVNA 1UQUA 4LRUA 1FCJA 1YE3A 4HGPA 4C6HA 5IHXA 3SE0A 3SX2A 1E5XA 1WHTB 2GEFA 2QLFA 3E6AA 1NU6A 1FFBA 1PJQA 2DT8A 3QVXA 4DMCA 1JIXA 1KH3A 1UMBB 2BEUB 4Y8VA 5EKXA 1VB5A 4ZVOA 4PXAA 3LUKA 1Q20A 1H8HD 5GONF 4EY5A 5F9HA 2CLDX 2IS2A 2AWNA 4AJ4A 1V3TA 4FYWA 4WFIA 1PP4A 1UBOS 3JZIA 10MHA 2Y68A 1N0UA 3BQMB 3O47A 2C58A 3I3OA 4DCCA 1JU4A 4KDFA 2AMVA 2G9VA 4PW0A 3RFXA 2Z6UA 3KHTA 3QZUA 5FOXA 3R6GA 4QOEA 2J46A 1YA6A 1L8XA 1ZIPA 4Y2SA 3R41A 1CUHA 3I2GA 4QYMA 3TR5A 4RAQA 1YC5A 3ICEA 4B35A 3OEEA 5TQVA 1XDDA 4P5EA 2C0PA 3DLIA 4MUFA 1GAWA 1QAQA 1VB3A 3EZ9A 4CG3A 3Q12A 1ZUD1 5K3FA 2FG7C 4CW7A 2HHJA 2XUGA 1ZOOA 3DT6A 4WX2B 2JZNA 2GTPA 3ZVLA 4Z9YA 1TUGA 3QLUC 1XNHA 4Q0MA 4DHEA 5HF8A 1C0PA 1W8IA 1GZ5A 3PG5A 4AWBA 2EDAA 5BW6B 4KXWA 4C2BA 5ISMA 4FOOA 4TYWA 4C4XA 5CK4A 3IP3A 3RGGA 3VU0A 1G17A 3ROQA 2VIIA 1AMUA 2V4UA 3QOWA 1OA0A 4N6OA 621PA 4MNTA 3OVMA 3AERB 5AVVA 2DAPA 2EF1A 5K03A 5BMVA 4Y7CA 1ICIA 3P9XA 2Q1WA 3CX8A 4C0HA 3PD0A 1NN0A 4IUYA 2FW8A 4B3BA 1Y82A 3SQMA 2Q3CA 3EFOA 4FYMA 1GU1A 4Q4HA 3KIPA 2I2AA 3PWKA 4JJZA 5LP6A 4DSTA 1BRTA 2WUEA 3C0KA 1SG6A 4BQFA 3I61A 4B4WA 2BY4A 2E82A 3GIDA 3ZY6A 5CH3A 1TLTA 4DGQA 2ZRPA 4RLQA 1QRDA 2FPSA 5CXXA 5THKA 3SR0A 4CM4B 4ZYUA 1ECGA 2NNWB 5FTWA 3W7VA 3ZHRA 1OH6A 2OV4A 1OC4A 1AS0A 4KNYA 3CO5A 4MS3B 4G67A 3AY7A 4LGYA 1D9ZA 3EN0A 8LDHA 4TL8A 2QG6A 1ZU4A 2QXYA 2WZBA 3EVTA 3IVMA 4X1KA 3L1IA 1XRJA 3T3IA 3WNZA 5KUTA 1YQQA 4NTZA 4KOEC 5EUCA 3WP0A 3GLGB 4ZRMA 3CKLA 5EHNA 1J7KA 2VSXA 1UWVA 7YASA 1E7MA 2E4WA 4M3NA 1QK4A 1G8GA 1Z7BA 2ECQA 1JAXA 1QOQB 2DWCA 2RCYA 5KVCA 4EJ6A 2EW1A 1I4TD 3GEPA 4OHOA 2D1QA 5A1JA 5A7FA 4O5AA 5EP3A 1Z5PA 2IV3A 4JQSA 2H2DA 4CL8A 2Y0BA 2Y0EA 3E84A 1VE9A 3FWKA 4MS1B 4U2GA 4GMXA 3ADCA 2QXUA 4RK0A 3JYNA 2OGUA 1BXGA 3DVRX 3JD4A 1ID1A 2ZKLA 3LCRA 4LHWA 3AI1A 4YP5A 4HRVA 3KOZA 5CT9A 5B7NA 2D2IA 4M0LA 3CZPA 4A7PA 3O4GA 4JSYA 4LNHA 3N2IA 4NBUA 1UBRS 4BPBA 4UU7A 1ZUWA 3UAVA 4BFWA 4NRDA 3JVEA 4WL0A 5TQ2B 3JXEA 5LOVA 3BXXA 2ZLBA 3V5NA 3DMNA 4NDAA 3HP4A 2DKOA 5JMWA 4EBBA 1G9TA 3VOTA 3MPUA 3IDAA 3GCZA 1YDMA 4A8TA 2UZ1A 1E2DA 4BZZA 4HNTA 1XSEA 2XB9A 1G8YA 4GYJA 4BLOA 1AK1A 1JN0A 5K0LA 3W5BA 2REQA 3B9PA 2WPDA 4HNQA 5EHQA 4QJIA 1M1XB 2ZVJA 4D8XA 3ZHTA 1T6NA 5LP1A 2VHWA 2YV5A 3BK1A 5EIWA 5FPKA 4DVJA 5DN6D 3TKAA 1ONOA 3BKXA 5CLGA 1NF8A 3JAWA 4REOA 2HLHA 4QO8A 2AUMA 2H7XA 3BREA 1U3TA 3C3BA 2DFVA 2C88A 1M2OB 4LXXA 4YR7A 1JHMA 4REQB 2OILA 2UV8A 3GQBA 1AKWA 3B3GA 3OZSA 2ISSD 3K32A 1IJBA 1KVUA 1G16A 1JA0A 1EI9A 5HX7A 2WG2A 1YI1A 4FZJA 1JT9A 3I4CA 4XI9A 2CLIB 2L17A 4TXJA 2YWFA 2ZCJA 3VH3A 2EP7A 2YMQA 4KLNA 5ALQA 4QECA 3GCGA 2IP2A 3IT1A 3RKRA 1C8VB 1CRPA 4ZCPA 2QA5A 3L7OA 3K6SA 1SQGA 1E2QA 3MT9A 1HL7A 2HRCA 3O4FA 4RKFA 1OAOA 4XJVA 5H80A 2I2XB 4XIFA 3RBZA 4BMCA 3QVSA 2A58A 1SD1A 4M8SA 3TL3A 5KO2A 5JTTA 5ED4A 5ALVA 5B7GA 5JD5A 3WGLA 1P39A 1I24A 4X7BA 5IC5A 1FU8A 4EA8A 1FUKA 1Q7GA 1ZESA 4L02A 1BDMA 3BQNB 6REQB 4RVUA 2CD7A 3FHTA 3IHWA 3WGIA 4O25A 3K9GA 2QUJA 2YVAA 3DAFA 5AUPB 1VKRA 3N7AA 1H3EA 3F49S 4ZHQF 1M7GA 2RI0A 2NPOA 1M0SA 4Q3EA 4Q9IA 4OK6A 2V6GA 1QH0A 3N87A 2IC5A 4A23A 1IQPA 1PTJC 1ZGBA 2FEXA 3SAJA 1M0EA 1XKQA 3K5HA 721PA 2VJMA 1T9DA 3FCAA 3OZXA 4R31A 2WIKA 3ZJUA 1NW4A 2FWJA 3CNEA 1R9MA 4X60A 2MU1A 4KFUA 3WLJA 3HFJA 4HR7A 3T4XA 1E79A 1ADYA 2YV1A 4PO9A 5ER9A 5CA0B 1CDZA 4H18A 1HNWB 1PZXA 3UF0A 4ZVVA 3R7WA 2HFJA 2YZ7A 1F2TB 4RQAA 3T7RA 2P40A 1QE5A 5IDXA 4BIIA 5FNVA 3HFRA 1IOVA 2BHLA 1KEEA 5CHYA 3QEMB 3ICOA 3HKDA 3M6MD 4R69A 3LP6A 1IJEA 1TAQA 4EVRA 3ZUGA 2AEMA 3C3EA 4HY3A 4HSEA 3OZRA 2RGEA 2ZU0C 2COKA 2C7GA 4C6SA 2GKGA 4EQ6B 3SYRA 4DC9A 1D1TA 5JBIA 3LGXA 2O3QA 3MMNA 3PEFA 1XEWX 2UAGA 2O07A 3M6UA 5FPQA 1HI9A 5BT9A 4FMDF 1CF9A 3IX7A 2A1TR 2FMUA 2HA3A 2CL7X 3P4YA 4I8IA 4J16C 3RF7A 1HE8B 2W9XA 3UJDA 1SUSA 1Z0IA 1CC1S 2DVMA 1GZHB 4NL4H 4ZU6X 3RADC 3QEBZ 1EHCA 1PFQA 5T3UA 1CQPA 2YICA 5DM4A 2R7LA 1CUYA 1E3JA 1UJ4A 2C4WA 3MWEA 3R5FA 5ENDA 2F3RA 1ZXXA 3W1EA 1X94A 3LKVA 1MENA 2ZREA 3QOFA 1VE6A 4PZCA 1N4AA 1PLLA 4BTLA 5BNIA 2AYZA 5CB0A 4B3RB 3GPDG 2OV8A 4LKRA 4D7AA 5HUJA 3DE6X 1TECE 2WZDA 3OMXA 4PZEA 1IU9A 1Y1KE 1KAEA 1V2HE 2GBCA 3FLMA 4RL4A 4Y1RB 5F52A 4O1HA 1YHNA 5GVRA 4ZHQB 4JI1B 2AA3A 2I87A 3JQ8B 4OK5A 3EXHA 1WCIA 3M5WA 3TLGB 4DJ5X 3L7MA 3KQWA 4C4OA 3TBKA 4BS9A 2RGXA 1M3SA 3COVA 5DGTA 5IN4A 3NTLA 4ZQFA 4BWYA 3TXYA 4HEJA 3NUGA 2P9HA 3VPDA 4LJKA 1R3UA 5TX7A 3DC2A 4NZOA 2B0CA 3I83A 4W9RA 4BAUA 3ZD7A 1OXUA 4ZRNA 4IS2A 3A7EA 2P9JA 1WY5A 2HJWA 4O4IB 3TIGA 5DXAA 4E88A 4LYAA 2ZP1A 1WOMA 3D7KA 3NYRA 4B7AA 2B34A 2SCUB 3PDIB 1YR7A 1DEXA 3JRXA 1BVUA 6ADHA 9LDTA 5C53B 3OZCA 3A6HA 1X8KA 3G02A 4R1OA 2I1WA 3MINA 5FWYB 1CZLA 4DLKA 3NS7A 3C3XA 2FLKA 3AUKA 5B64A 1RQRA 4HYQA 1X7WB 3C6ZA 3BTOA 1IHUA 1ZL2A 4HDKB 1TYCA 5HDQA 2Z8XA 1UPBA 4K46A 1HM5A 4W5WA 1FX1A 3VR3A 3HH8A 5HYVA 1M2GA 3BWYA 2R6CA 3OI7A 4M7RA 1VG8A 1LBIA 5ER6A 2VWHA 1SXJB 5C32A 5EHXA 5JFGA 3X1KA 3I30X 1G3QA 3TDKA 1E9BA 1FOEB 2RJNA 1MGPA 2WLSA 3VV2A 2HCJB 4QSHA 4HNUA 4E11A 3EWSA 3IKJA 4L8GA 4NBWA 1T25A 2AQ8A 4E13A 4XX0B 4YRAA 5AVQA 4AY6A 3VDNB 2JW5A 2PSSA 2Q9AA 4U2FA 4F72A 3GGJA 2IF2A 4HRYA 4N5DA 3I01M 4NJOA 3UGKA 2P4QA 1SQ6A 1GU0A 3D6JA 2NUTA 5CDGA 2FZEA 3QKTA 3O26A 2GLUA 2FW7A 3TTXA 4GHWA 2QY6A 3B1YA 3GWGA 1PBNA 3FOCA 1ZJZA 3LD9A 2NP7A 3H6KA 2ENUA 2CNWD 1OJLA 3E3OA 5DBFA 4NV0A 4L28A 5HF5A 2YOFA 1E62A 1TDJA 1L5QA 3L1UA 3EHDA 2ZI5A 3NM4A 4ZC8A 1GZSA 4IKOA 3VPAA 2QK4A 5CDUA 2BFDA 2OD9A 2XVAA 2GJSA 2ZB3A 3ENVA 3X44A 2WHPB 5LB4A 4OLHA 4QFCA 4PCLA 1Q84A 1J9ZA 3IC5A 3VU8A 3H4IA 5TQJA 2O6LA 4HS9A 5JPCA 5A9SB 2QD3A 2GPSA 3PQCA 3WZLA 4L85A 4CV0A 3HCDA 3FZNA 2HJSA 3LLVA 1ZD8A 4RXTA 3KETA 1TQ8A 3DVAB 1S8OA 4OKSA 1H2WA 2VRCD 1KK0A 3CRNA 4TLDA 4J9VA 3WK5A 1OI3A 1K7XB 2ZBGA 1O9GA 5K3CA 1KO4A 1K5DA