3SX2A

Crystal structure of a putative 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium paratuberculosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
268
Chain Sequence
b'GPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASVPYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDELGRLDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPTLVKQGTGGSIVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNSIHPSGVETPMINNEFTREWLAKMAAATDGAMGNAMPVEVLAPEDVANAVAWLVSDQARYITGVTLPVDAGFLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 3-ketoacyl-(acyl-carrier-protein) reductase
molecule tags Oxidoreductase
source organism Mycobacterium avium subsp. paratuberculosis
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
total genus 99
structure length 268
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sx2A00
4BIIA 1X7GA 5KCZA 1WWKA 2EV9A 3WDSA 2Y0DA 4R01A 1P45A 1O89A 1R12A 3HB4X 4CMHA 5T67A 2IEBA 3VTZA 3L4BC 3AY7A 2JCVA 4CPDA 3EMKA 3LT2A 1YBAA 2Q2WA 3KV3O 2DBQA 4Y9DA 5F5LA 5IXSA 4H16A 2VCYA 2FZEA 4XIYA 2EG9A 5CEJA 2D8AA 1EFKA 4IUYA 3GRPA 4PLCA 1O95A 5CDUA 1MXFA 1UDAA 2GF2A 4XRRA 3E5RA 3UN1A 4BO6A 2J3HA 1YO6A 5AQ1A 3WGHA 3GVCA 4QSMA 3I5MA 1I3NA 4NR0A 4CLDA 3TOXA 2W2LA 4DIOA 5KTKA 1NBOA 3S2IA 3WBBA 3PWKA 4LVCA 3PGXA 4YJHA 1C1DB 2EF1A 4XYEA 1EE2A 3KYDA 4BHTA 2FR8A 2X1HA 4HWKA 1ZW1A 1X14A 4E5YA 5MDHA 1KEUA 1R4NB 2VUUA 2WE7A 2JFGA 4R41A 2C20A 1PZHA 2B35A 3S2EA 4BV8A 2I67A 1FDWA 4IXTA 3OF2A 5AOVA 2V7PA 2BELA 4W4TA 4B3JA 4KQXA 4BKOA 3E48A 1H9BA 5FF9A 2CMDA 2DPGA 2X22A 1I36A 3JQ9C 1MFZA 1VKNA 3WGQA 1ZK4A 3TJRA 1DO8A 1AN9A 4GX5A 1YQXA 3F6YA 1DXYA 4PZEA 2OBYA 5JCJD 2NVUA 5GZ3A 1UXJA 2H63A 5L51A 1G6KA 4FOSA 3KETA 1VL8A 1AE1A 4A0SA 2UAGA 1ADCA 1ZKMA 2V65A 4XD2A 1H93A 3IUSA 2EHDA 1LLCA 2JD1A 1QSGA 4R3WA 1NAHA 1F0YA 2ZTMA 2VNSA 4Y67A 3BMCB 2JFFA 4JP3A 1A7KA 3ZWBA 5JXWA 5BR7A 2O2SA 5JW6A 1IYZA 1QKIA 4J0EA 1RM4A 3OEYA 2G82A 5GY7A 3TPCA 3UUWA 3UGKA 4RVUA 5BNIA 2NACA 1XGKA 1GTMA 1MUUA 2Y99A 4KZPA 3WMWA 3K6JA 2VYND 3NTOA 3H2ZA 3F1LA 4QT0A 1DRVA 2NU6A 4K6FA 1PJBA 3QLJA 4QXMA 4CMEC 1QYVA 2VHYA 5JC8A 4MVJG 4GWGA 4LGVA 1G0NA 2XAAA 4Y98A 2POQX 5I7VA 2BMAA 3K9QO 4BNMA 3ZWXA 4J49A 1VI2A 3GPIA 2B37A 3VVCA 2BGMA 4FFPA 5FWNA 4J1NA 2FZWA 3I3OA 1LSSA 3QY9A 3UW3A 4ND5A 3HZZA 2YJZA 4RF5A 3SXPA 4J3FA 2GN6A 4E30A 5K0ZA 1E7MA 3DQPA 3FWZA 3WGOA 3FSRA 3W4KA 3DEYX 4BKQA 4DYDA 1GPJA 2Y1CA 3TZCA 3C8MA 2DFVA 5ICMA 2YW9A 3LYLA 5FEUA 5TNXA 1E5QA 3ZGYA 4WCDA 5LC1A 1M6HA 4R69A 4R16A 2B0JA 3W4JA 4ID9A 2IODA 4CLRA 3WYCA 1B15A 2R2GA 3JQGB 1TLTA 4DLAA 2Z5LA 4NJOA 1A71A 1YL6A 1K89A 5EESA 3PI7A 1R0LA 1YXMA 1JVSA 5G4LA 3BYZA 2VRCA 2J5RA 3GOHA 5CDYA 4A26A 2VZ0A 3MWDB 4S1VA 2C2YA 2EGGA 3DOJA 3IMFA 3JQFA 4OKNA 5AYVA 4DMMA 3JQDA 1N92A 2VWQA 3D3EA 3PJFA 4FFLA 4MVJM 6ADHA 1GZ6A 1ZMOA 3EW7A 2PWZA 4OOFA 3TFQA 3BTUA 4YJGA 1PGOA 3E9QA 3DHEA 3D4NA 4J9UE 2GD1O 1TT5A 3LDHA 4J1SA 1Q0QA 3PYLA 5BSGA 4BNJA 4GGOA 3MCVA 5A9SA 1KEVA 3U09A 1JU9A 2O7SA 4JQCA 1PU2A 3ZCXA 4YT4A 2C7GA 3AW9A 5KJCA 2X5OA 1TEHA 4PGFA 5U9CA 2Q1UA 2AA3A 3COSA 3ZHXA 3DBHB 4BO2A 2VYNA 2FSVA 4MDHA 1OC2A 2HRBA 3E18A 3ASUA 2QYSA 4JP2A 4LISA 4OGWA 5DDIP 3QRWA 1BRMA 4M87A 4NJMA 2CF6A 4CR6A 5K6AC 2A4KA 2WD8A 4DBZA 1QLHA 3H9QA 3G49A 3K2EA 1DEHA 4AJIA 4HX5A 3PLNA 3PHJA 4LCEA 5LDHA 3NDIA 3H6KA 2PTGA 4QEDA 3BHIA 3ZN2A 4RLHA 1VSUA 5HBRA 4CV3A 5JAIA 3OBBA 4BV9A 4LMPA 3DZBA 8LDHA 4BVAA 1ZK2A 3ON5A 4CUZA 5CG2A 4NBUA 1YBMA 3L77A 4IZHA 4GL4A 3FI9A 4IZIA 4Y6RA 2E6UX 3DBLB 4N5MA 1LC0A 2GZ1A 1WW8A 2HMVA 2LDBA 1GV0A 3BTVA 9LDBA 5C7IO 3E8XA 5BNTA 1X15A 5I7FA 1DAPA 2HMUA 1Z82A 4E0BA 3ASVA 5JNLA 4HNHA 1YQGA 4L76A 1JN0A 4YDRA 4J7CA 3E9NA 1I3LA 2OP1A 2VQ3A 1E1MA 1FDTA 2VZ8A 4E3ZA 4BKUA 5KVSA 4TVBA 2YV1A 4F46A 3M2TA 2PK3A 4PG4A 5FI5A 2FP4A 4IXWA 3C1AA 3EAGA 3VPFA 4OXKA 4UAGA 1NHGA 1P1FA 1PX0A 3DAFA 4JNKA 5JAQA 3ZWCA 2DBRA 4XR4A 1Z7EA 5BSHA 2UUOA 4PRLA 1P3DA 3PHHA 1KY4A 2X7HA 2Y0CA 3EVTA 4IJVA 2P9GA 3RUDA 1YB4A 4W9NA 5DCWA 1Q7GA 4IS3A 5KKCA 2NTNA 2YV2A 5TGDA 3ROQA 3STHA 2GNAA 2BI7A 3DBRA 4GMGA 3ONFA 4INAA 1S7CA 2GYYA 4RPHA 4Y6SA 2TMDA 4Q9NA 3PEFA 4LN1A 3WYEA 2YDXA 4EJ6A 5C37A 3SC6A 2J3KA 1BTOA 3MJSA 4PLZA 4YJDA 1C0IA 1MG0A 1T24A 2G0TA 3DXFA 1N9GB 5TIIA 4EUFA 2OORA 3PDUA 3FR7A 5A4DA 1BXGA 3MWEB 3CPSA 3JQ8B 4F6LA 4L0QA 1KYQA 1D1TA 1MV8A 3DFUA 4GX2A 3AJRA 1GQ2A 4JGBA 3AY3A 3LF1A 3TL3A 1JLLA 1NTOA 2D2IA 4RVSA 1H6AA 3JSAA 4EYEA 2O3UA 4RJTA 1DFGA 3LSYA 5JLAA 4MIEA 4IDGA 1PL8A 4ZQFA 4CM1A 3WICA 1GEEA 5IF3A 2Z95A 4TRMA 1ZUD1 1BXZA 5DNAA 1T4DA 3WLFA 3JYLA 3DBVO 3PQFA 5L95A 5EQFA 3RUHA 2JJYA 3RJ5A 4BB6A 2C5AA 1P1KA 5J23A 2BD0A 1Y8RA 3K30A 2WEKA 3Q11A 4ND1A 5A9TA 2PZKA 5HM8A 2JL1A 2YHUA 5G4KA 3F9IA 3ZDFA 4GMFA 4IDEA 3RU9A 1XA0A 5AXAA 3NV9A 3L9XA 4CLOA 4MP8A 4RGBA 4FJ0A 1VM6A 2R00A 3V1UA 1AXGA 3PZRA 1H2HA 3MTGA 4MVJH 4D3DA 2AG5A 3PK0A 3U4HA 4AJOA 5IN5A 3VPSA 4DPMA 2Y0EA 5L40A 4CQLB 1J0XO 3JD0A 5I7EA 4GH5A 3FCOA 1MLDA 4JBHA 2WM3A 3H5RA 4J7UA 5JPIA 2DBVO 4PN3A 4GPD1 1IHXA 1X13A 1WXDA 5ADHA 5EL0A 3WR5A 4E12A 3CUKA 1LDGA 1C0PA 2IYPA 3RUEA 2DC1A 5BSEA 4OSPA 4RPGA 1FK8A 3HG7A 2E37A 1VLLA 1LDBA 4URFA 3ROMA 4DIFA 2YQ5A 1HYGA 3SLKA 4BO1A 5JMWA 3P19A 5L53A 2PY6A 3IP1A 4M55A 1E3LA 1U28A 5KKAA 3JD3A 5T57A 5CFZA 4OYRA 3SBOA 3WMXA 3ZV5A 3VC7A 3G0OA 1X1TA 1UUFA 2BFOA 4J2OA 4XJSA 4YAGA 2W90A 1LC3A 3TNLA 3H7AA 1XIVA 4DL9A 4YCAA 1NQOA 5EERA 3WGGA 3UHAA 1Z45A 4YJFA 1U7HA 4KMSA 1E1NA 2GPTA 4HBGA 4OJNA 1E3WA 1EE9A 1RKXA 3OQBA 5I7SA 2WJPA 1PZEA 1PZGA 1QYXA 2CD9A 3PGJA 3D0OA 3DZFA 3ONDA 1HL3A 4WK6A 3FNGA 3FNHA 3H9GA 4MVJF 4ALNA 2I9PA 4YBZA 4Q3AA 1A72A 4DC1A 1NP3A 4OSOA 3JQEA 1QXSA 1DFHA 2GASA 2AG8A 5TT0A 1CERA 3W6UA 2VOEA 4E2WA 3AWDA 5EPOA 3SJ7A 2V6MA 3VPHA 1EZ4A 5ITVA 3BTSA 1DIBA 4IJWA 2AXQA 4IDFA 1LRJA 4HY3A 2O3QA 1CYDA 2J3JA 2ZCUA 4WJZA 3L4SO 1GEGA 4KDEA 4RDIA 2CF5A 4EGFA 2DUUA 1U2DA 4O63O 1BW9A 1M66A 2Y68A 3FRJA 3LLSA 3RSHA 3VZPA 3PWSA 3F5QA 4BO0A 2NM0A 4BMVA 2W2LD 3GEDA 3QIVA 1NVGA 1Y7TA 3KSUA 1OBFO 2Y93A 2Q2QA 4DLLA 3OSUA 1XDWA 4WLNA 4UVGA 2FWMX 2DQ4A 2UDPA 1ZNQO 1EFLA 4D3FA 2R6JA 2QZZA 3GZNA 1QP8A 1I8TA 3JTMA 1SC6A 2ZYDA 1ENPA 3JQ9A 3WTCA 4B79A 5DBGA 4J7XA 2ZJ1A 1E6UA 1UXGA 3TSCA 1HEUA 1B3RA 3PJDA 4PCVA 3G17A 1I5RA 4K6CA 3U9LA 3I52A 4U7WA 3GF4A 2ZB3A 3ZU5A 2DTXA 1HRDA 4G65A 1U9JA 1BMDA 4M49A 3DAGA 3JQ7A 2X58A 4DYVA 3R3SA 3RC2A 4AJEA 3LLVA 1UXKA 2X0JA 4ZN6A 3HNPA 3HB5X 1X1EA 3RAJA 3K73O 3V2HA 3ANLA 4BGVA 2DAPA 2FPIA 4YT2A 3M1LA 4B3IA 1PGQA 1NPDA 4XA8A 3ROKA 5HRUA 3OJFA 3G79A 2GDZA 1B3BA 3OJLA 3T4EA 4XRGA 1DHTA 5ILGA 1Z7BA 3I1JA 1VPDA 2JD2A 4IDCA 1P1JA 2P9CA 1WZIA 3GDGA 3NX4A 4U8GA 5ENDA 1KERA 1EUZA 2WE8A 3AK4A 3DC2A 4J9VA 5JFOA 1DC5A 3ADPA 2D5AA 3GVPA 1Q2XA 1PS8A 1LSOA 3U3XA 4XDYA 1E6EA 5F1KA 3R6DA 1R66A 3F3SA 1V3TA 3PDJA 1F8FA 1Q0HA 2GO1A 3N58A 2RBEA 4GBJA 1C0LA 1EUDA 1UAGA 4R4JA 4LRTB 1IPEA 2WYWA 4L73A 5IDXA 3CMCO 1ISIA 1RJWA 2GN4A 3L4BA 3O8QB 4P4NA 1SOWA 1FJHA 1K6XA 1ISFA 2EEZA 5FYDA 1DPGA 3UVEA 3QJ5A 2XXJA 3V1TC 2DUWA 4XEHA 2PH3A 3I6QA 2PA3A 4CMCA 1M76A 1WDKA 3GFGA 3WGIA 2C54A 2C2XA 3DMTA 5B37A 2NVUB 3AM3A 4ZQEA 2C29D 3O9ZA 3FNEA 2CVOA 1PR3A 3E6AA 3ENKA 3RUIA 1I2ZA 2OUIA 2PZJA 1LTHR 3LT0A 3C1OA 4MOWA 1ISJA 1R4MB 2VYVD 3DZGA 4P4LA 4WGGA 1LDNA 4TWRA 4LK3A 2F00A 2Q3EA 3C24A 4OL9A 5TS3A 4A7PA 4CLHA 3DONA 3DZIA 3A1NA 1IZ9A 3HDHA 3DWFA 4OH1A 4JJGA 5IZ4A 1TXGA 3Q9UA 1VKOA 1DIGA 2E4AA 1NFFA 4A5OA 2NU8A 1Z74A 4QECA 3ZHZA 3ZU2A 1BGVA 1SB8A 4MVJA 4BNUA 3MJCA 1IOLA 1SPXA 4DQUA 4FQ8A 5T8KC 3QVOA 3RROA 4L75A 4CL8A 3QWFA 2WD7B 5IJZA 5ENVA 5LCXA 1M6WA 2ZK7A 5L4SA 4ZJUA 3NT4A 4AICA 2VOJA 5H81A 2OL4A 5F21A 4O6VA 3DMYA 3RI3A 1Z75A 4RVFA 1PJCA 4BQRA 2QX7A 3TZQA 1E77A 3HFGA 3OETA 3VZRA 4LVUA 1MXHA 3OHSX 4D43A 2G1UA 3IS3A 4TRJA 5DOZA 2X4GA 4AJLA 2ZB4A 2CFCA 2ZTLA 1EK5A 3IJRA 3AM4A 4PLGA 4YT8A 5KJ1A 1OZAA 5DZSA 3TZHA 3IIEA 1CEQA 3CXRA 3QVTA 2E49A 2OMEA 3PHLA 1YDWA 2DVMA 1D3AA 4L8VA 5JAMA 3ZWPA 3C85A 3LC7O 2CUKA 2RIRA 4N5LA 3FPLA 1FXSA 4WKGA 3ANNA 1ADBA 2HDHA 3JQAD 4JK3A 4JBIA 4D79A 1HLPA 4RQUA 4NDNE 2ZKLA 3GUCA 2PD3A 3M2PA 3KTDA 3GNQA 4IBOA 2D1YA 4DA9A 4D44A 3AI3A 2IYOA 1WDMA 4CV1A 3OJ0A 2D0IA 3B1FA 2RH4A 4WPGA 1PWXA 1LEHA 1KEPA 3VH1A 3CKYA 4MIOA 4LCJA 2WYUA 4J4BA 4AL4A 3NGLA 2W2KA 3TFOA 3UOGA 5DBFA 1TB4A 3KEQA 4KTTE 3NRCA 5GMOA 4CMIA 5IAAA 3KOUA 3NDRA 5ER6A 4LRSB 5JMPA 3DTTA 3EHEA 4KUGA 4YB8A 3AUSA 3CEAA 3RC1A 3CZRA 2VUTA 5TX7A 2IZZA 1Y5MA 5JS6A 3OIGA 4QFCA 5KNLA 4E33A 3I9JA 1OAAA 1ADFA 4XB1A 3V5NA 3PQEA 4MVJP 4NJMB 3U4IA 4XQGA 3GLQA 4YT5A 4ND4A 1GUYA 1ZJYA 4QTZA 2NTVA 2PH5A 1IHYA 1Y81A 3HADA 2BGKA 2P4HX 4F6CA 4HFMA 4D45A 4G5HA 4WOJA 2C0CA 2HMWA 1HKUA 3S2GA 5TLSA 1D1SA 2DT5A 3O38A 4NBRA 2OOSA 5G2OA 1PS9A 1JKIA 4P8RA 3QVXA 1SEPA 3GDOA 4F45A 2HMTA 1J6UA 1RM0A 1XG5A 4RCVA 3AU9A 3NUGA 4NBVA 4UEKA 3PJGA 1ENYA 3DBLA 4PLYA 3KO8A 1IZ0A 1GZ4A 2Q2VA 4CM5A 1P1HA 4FGWA 4RORA 1ORRA 4FC6A 4FIZA 4FS3A 1QR6A 5DOVA 2VHWA 4Z3DA 4D0RA 1EMDA 3R1IA 3RBZA 5AXDA 1W4ZA 3GQVA 3FF4A 1B0AA 4XGIA 2GRAA 3UXYA 3UCXA 4HXYA 1XKQA 3PP8A 4DBVO 3RFVA 1Y8QB 4AJ4A 4GLOA 4M54A 3LC1O 1RPNA 5H83A 2CVZA 2O3TA 3VHRA 3EY4A 1LQUA 1BXKA 2JCXA 3AM5A 4K26A 4WLEA 2NUAA 4ZA2A 2Q50A 1U5CA 2DM6A 1UXHA 1R6DA 4WASA 3BMOA 7ADHA 4IY1A 4NBWA 4ROSA 4AG3A 1GY8A 5A5EA 1N2SA 4PIVA 2O3RA 3GC6A 1AHHA 2EKLA 4Z9YA 3I9KA 3RBXA 3EC7A 3WNQA 1XEAA 1CDOA 3E03A 1LLDA 2HO5A 1YOVB 3FTNA 2V6BA 1LQTA 1HE4A 4EDFA 1NWHA 3ABIA 2NADA 5JO0A 1KBZA 4BNIA 5JDIA 1IULA 3AI2A 3D3WB 4H15A 1NASA 1N1EA 4FD3A 1DOHA 1MP0A 3MJ4A 4FFNA 2ZTUA 3JYQA 4IJKA 5IDYA 5GZ1A 2CSUA 2PV7A 4TKLA 1ZEJA 1E7SA 1BWSA 4NZ9A 3WG9A 1WPQA 1PGPA 3H5NA 3ROPA 1ONPA 1PR9A 2Q4EA 4KUEA 3HFSA 3QVSA 1V3VA 2X9VA 4K9DA 5DULA 3JQAA 1F17A 4D0SA 2VN8A 1EDOA 1L1FA 3KYCB 4A03A 2BF7A 1K0UA 2JHFA 3A14A 4DLBA 3AFMA 2HUNA 1Y6JA 2FPPA 4BO8A 4C7KA 3K92A 4WEQA 2QZ9A 4FN4A 2FR1A 3O26A 1X7HA 1F14A 3JV7A 2IXAA 4GX0A 1QORA 4RF3A 1C1XB 5DP1A 3U5TA 2O2YA 2DTEA 3KB6A 2AEMA 1KS9A 3ZNQA 1LU9A 2EIHA 4FBGA 2QRJA 2Q99A 3FBTA 3CE6A 3H9UA 4ALKA 1DC4A 5JY1A 3RUFA 4CJXA 4DIBA 2ZB7A 4FGSA 3QP9A 5ES3A 3HHPA 1PQUA 1MA0A 1NAIA 2P9EA 3GN2A 3DZHA 1XLTA 2AQ8A 2E48A 2UVDA 4I5FA 4CM8B 4ESOA 1O6ZA 4J4TA 3M1AA 3OECA 2B4QA 2EKQA 5BT9A 3UAGA 4B4UA 4CQMA 3BTOA 1W8DA 3LQFA 4ZGWA 5IFLA 1FDUA 1Q0LA 3FWNA 3GN1A 3RFTA 1R0SA 5IXYA 4YWJA 4C4OA 1LLQA 5DBIA 3W8DA 4A2CA 4CQLA 2NU7A 1YS4A 1U3WA 4UVIA 5F3RA 3K31A 1B16A 2CZCA 4YQYA 5KJEA 1HTBA 2GN8A 1P0CA 4YPOA 1HDOA 3WJAA 1HDYA 1GL3A 5HA5A 5A5FA 5KVCA 3JYOA 1UZLA 5CDTA 1ONOA 2X0IA 4IMRA 5COQA 1D7OA 4K28A 1F06A 1RYEA 2CDCA 3OP4A 5L7TA 2FR0A 1M75A 2NVBA 3OFSA 1AGNA 5TC4A 5AXCA 4FFOA 4DGSA 4GSKA 5HS6A 3ZNNA 1QYWA 1R37A 2FY8A 3D7LA 5CEEA 5JCXA 5L3ZA 3S1LA 2CDBA 3LF2A 1PWZA 5DCYA 3WOHA 3BMNB 3TQHA 5TJHA 2HKIA 3NJ4A 2CVQA 3ZWNA 2ZTVA 4TMFA 3WX0A 2Q1WA 3EUWA 1P74A 4BKPA 3WIEA 2H5LA 4IQ8A 2AW5A 1HZZA 4BO3A 3S8MA 1HE2A 2I65A 2O50A 3Q1LA 1TA4A 1K2WA 3WGYA 4EEXA 1Y1PA 2HLPA 5ITWA 3GA0A 3P7MA 3EK2A 3RU7A 1JDJA 1GYQA 3L9WA 5C3MA 3GG9A 2HK9A 1U2GA 2B83A 3FNFA 4NFYA 4AJ1A 4BGUA 4XYBA 1E3WB 1SZJG 3RCBA 1IPFA 2AQIA 4R51A 4EJMA 3ZHYA 1VRWA 2FRDA 1WP4A 3IP3A 2RH8A 1E3SA 3H9EO 2JCYA 1YB5A 1U8XX 4FW8A 3KLMX 2BLLA 2NVWA 1LSJA 1EK6A 1YJ8A 4AJPA 4CUJA 4WOKA 1AHIA 1JW9B 1Q7BA 4U0JA 3ZZNA 1VJ1A 1UDCA 1U3VA 5U1PA 4Q3DA 4RPJA 6LDHA 2GERA 1P33A 1Y5RA 4M86A 1P44A 3KLPX 4BQPA 3JQBA 1WDLA 3QWBA 1DLIA 4M89A 4P22A 4U6QA 1LJ8A 4M8SA 4OKIA 4BNTA 4CMEA 2VRCD 2O7QA 5KJ6A 2P5UA 5IDWA 2JD0A 1E5LA 5F1PA 4OXYA 4JROA 5B12A 1XCBA 3S55A 4E32A 3GMDA 1MG5A 1NQAO 1PQPA 1X0VA 1ARZA 4U6SA 4YJHB 4O0LA 3T7EA 4CL3A 5BSFA 1EQUA 1NXQA 3G1TA 5L4LA 2RCYA 1R4NA 3VTFA 4FFRA 5CPBA 1UP4A 1DHRA 2NV6A 2O4CA 1ZJZA 3W4IA 2VZ9A 4DQVA 3OJOA 5JDCC 5IZCA 3S2FA 3W6ZA 1LXCA 4DXHA 2J6IA 5T8KA 4CM6A 1QLJA 2P91A 4Q3NA 2H6EA 5JY6A 1U8FO 4PFJA 5L9AA 4BO9A 2X23A 5C5IA 1DRUA 3IAHA 1OFGA 4OO3A 4BL5A 1HE3A 3H2SA 1YJQA 4NK4A 4GSLA 2C59A 2XPCA 1PZFA 3IC5A 4I5GA 2DPHA 1PJTA 4YAIA 4IPTA 4ALMA 2BH9A 1PL7A 3RD5A 5EINA 4WNIA 5KWEA 1Y9EA 4H7PA 3KSZO 2VNAA 1DIRA 1ZMTA 5G0TA 3HDQA 3JQ7B 4W7HA 3WYBA 1H6BA 5BNFA 1ISGA 1VL0A 1C1DA 1E92A 2B5VA 4BNHA 2XXBA 2QQ5A 1NNUA 3MTJA 4PZCA 2DBZA 4E13A 3HN2A 4WCFB 1ZZEA 3A06A 2R00C 3VOSA 5EMHA 5CEFA 3SVTA 5K9ZA 5B4UA 3HUDA 4O1MA 4L4RA 1B26A 4PLTA 1LDYA 4GKBA 2W8ZA 1K3TA 3JD2A 2QG4A 4MO2A 2NQTA 2GZ3A 1ISMA 3UH1A 1U5AA 1JA9A 1EUCA 2PKRA 1JKFA 1SAYA 4D41A 4IGFA 3GUYA 3FPCA 3UCFA 1CWUA 2AQKA 4CM4B 2PLAA 4NNJA 5G0VA 4XYMA 1NR7A 3DOOA 1MX3A 4O59O 4R1NA 1QRRA 4RVGA 3I9MA 3FHLA 1B8UA 5CHEA 4D46A 3AFNA 4E2ZA 4PG8A 2A35A 1YL7A 3BMCA 2X5KO 3CINA 5IG2A 4ZHSA 3PIIA 2BKAA 3I9LA 3JD1A 4TRNA 1XQ1A 2XF8A 3AUUA 3RKRA 4E21A 1PJ3A 2B36A 2B4TO 2X86A 4U0KA 4TZTA 2A9FA 1LSUA 1NX6A 1PJLA 1QMGA 1DIHA 1FDSA 2UUPA 1V35A 4G81A 3JQGA 4Z9FA 4EUEA 1ZO8A 4BS9A 4MVJE 1B14A 1C0KA 2P68A 1E3IA 1N7GA 3LU1A 1DAOA 4CMGA 3CSDA 3ULKA 4IQ0A 3U4CA 3BMQB 1PS0A 3DFZA 4Y8VA 1NM5A 4HP8A 5B4TA 2VWGA 3DL2A 3P2OA 4FOOA 1ONNA 3ZHBA 1XYGA 3B20A 4DQXA 1Q1NA 4YJGB 3F47A 1LBEA 2BFAA 3VZSA 3C7CB 3F5SA 2X5JO 4AJJA 2UYYA 3GGOA 5JAZA 1LNQA 4UUNA 1S6YA 1PJSA 4YXFA 4YYZA 3BHJA 2HSDA 3A9WA 3PWZA 4CODB 1UZNA 4N5NA 1DC6A 2J5KA 4K1LA 3SLGA 3WGTA 2X0NA 1I3MA 3F4LA 2UV8A 2YYYA 4BNWA 4CLRB 2EW8A 4E2XA 3WB9A 1A9YA 2EW2A 3I6IA 3DHYA 4PVCA 3HN7A 3EVNA 3NT2A 3WQQA 3NYWA 1A5ZA 1UZMA 3LK7A 4L4XA 4X54A 4XKJA 3BA1A 4PVDA 2ZJ0A 2PD4A 4BNKA 4BMSA 3ZWOA 3VPGA 3W8FA 3BZUA 3RUCA 4I9UA 3VKVA 3ZWMA 3W1VA 3KM0A 5TJ9A 2A94A 1IB6A 3GVIA 1E7YA 3WNVA 3ZI0A 1RYDA 4FSHA 3RWBA 4FJ2A 1EVIA 1MC5A 3LZ6A 1I2BA 2IZ0A 3H9JA 4AJ2A 4ONEA 3TDKA 4YRAA 1PJ4A 2IZ1A 2EWMA 2Y1DA 5T64A 2DU8A 4ZICA 1Y9AA 3ANMA 1J4AA 4EJ0A 4W82A 1IE3A 2FPGA 3RKUA 3UCEA 1SCUA 2IEDA 4CR7A 1LDEA 5B4VA 3DMTC 2WMDA 3L6DA 4WEOA 2QYTA 2VUSA 1GYPA 1F12A 2VT3A 2Y1GA 4XQ9A 2YFHA 3ICCA 4W9NC 4Z0TA 3GRKA 1ZK0A 4Y6PA 3LT4A 4IQGA 4QO7A 5JCJA 3GVHA 3Q2KA 4HFJA 2GLXA 2WWRA 4XDZA 4UVEA 2HAEA 1SO8A 1IY8A 4NPCA 1CRWG 2O23A 4WLUA 3SEFA 5L7WA 2X8LA 1JKJA 4YRBA 4YQZA 1K5HA 1T2DA 1EVJA 1HWYA 4S3MA 2C7VA 5JSFA 4NIMA 1DB3A 3PJEA 1TI7A 1DBVO 1KVQA 1ZSNA 3HE3A 3TWOA 1N1GA 1G0OA 2GCGA 4CLEA 4OMUA 1FMCA 4AJKA 4I5DA 3B1JA 1NQTA 1PGJA 2Y1EA 2FN7A 4ALJA 4MPDA 1ZFNA 4JJFA 4L4SA 1X7DA 3X2EA 3VZQA 1XR3A 2W4QA 4PG5A 2AHRA 4R68A 4E5MA 4GLLA 1BVUA 1P1RA 4WECA 4HNGA 3GAFA 3DBRB 1WMAA 1ZXLA 3F1KA 3MJTA 4IGEA 3JYPA 1MB4A 2XOXA 4U5QA 4R9RA 2OZPA 3AUAA 2JAHA 4WE3A 1CIVA 1QYCA 1O0SA 4A10A 1RWBA 1ULUA 2JFHA 2OP0A 3DR3A 2BHLA 4PZDA 3QWAA 3GPDG 1CF2O 1DIAA 1HT0A 1PJ2A 4W99A 5F1OA 4A27A 4DC0A 1E1LA 1N9GA 3P5SA 3L0DA 1J5PA 4QO8A 1BXGB 1KY5A 2GGSA 4BO4A 4IIUA 3NKLA 1TVEA 5A1TA 4G2NA 4I8XA 4ZVVA 5A06A 1UP7A 1VC2A 5FI3A 2F1KA 4RV9A 1GQYA 3CMMA 3OQ6A 2Y1FA 1M2WA 1Y8QA 2VRBA 2FSSA 1V6AA 4CM3A 3D64A 3BIOA 1ZIDA 2NU9A 4RQTA 3VDQA 2PFGA 4BNXA 1EBFA 4UULA 1KETA 2D59A 2HMSA 4BOYA 4I1IA 3QW2A 1LRLA 4CV2A 4UEOA 4E5KA 4R3NA 4PLWA 4ZQHA 1V0JA 5ER9A 4YVFA 4EITA 2WSBA 3A28A 2VWPA 3LVFO 5EIOA 2VWHA 4FR5A 1U3TA 5I9MA 3WQSB 4TZKA 1T2CA 2PZMA 1EEHA 2AMFA 3KBOA 1I33A 3F4BA 1YDEA 2HRZA 3RC9A 4CM9A 3WIDA 4UUMA 2NSDA 3PZBA 5G4KB 3C7AA 2TMGA 3JQ8A 4OM8A 1KIFA 3KVOA 1U4OA 4RF2A 1ENZA 4LSMA 2I66A 4UUPA 3D1LA 1UP6A 4OIMA 4B7CA 4NU6A 3JQFC 4YAEA 3BXXA 4XYLA 4ALIA 2VHXA 3B70A 4YTEA 3GDFA 3K8ZA 2D5CA 3ENNA 5JC1A 4YEDA 1GQQA 4KTVE 4QFDA 3DB2A 1ZSYA 1E7RA 4CM7A 4BO5A 3RC7A 1WNTA 3H8VA 3E1KA 1XHLA 5KIAA 3JYNA 1JAYA 4Q3CA 3RQSA 1V3UA 2O3SA 1PTJA 2W98A 2Q49A 3OH8A 5A03A 4EUHA 2BRUA 1PGNA 4B4WA 3FBGA 3VKUA 5TF4A 1YKFA 4E4YA 2X9GA 3WWZA 3CH6A 3VVBA 4DREA 4B7UA 1QV6A 2HU2A 3Q6IA 1EQ2A 4E5PA 1ML3A 4YAKA 5THKA 1H6DA 5AVOA 4R5HA 1SBYA 3VH2A 1UH5A 5BQFA 4JLWA 3SC4A 1BHSA 2VHVA 2GN9A 4RVDA 3ETEA 1F8GA 2Z1MA 3PTZA 1O5IA 3H5AA 1O8CA 4GAEA 5KVVA 4II2A 1C14A 3GNTA 1YL5A 4MKRA 1JTVA 4ILKA 3TZ6A 4EW6A 2LDXA 3WFIA 1ZK3A 3IUPA 3OICA 4ZU3A 4B4OA 4AVYA 1J49A 2NWQA 5I8WA 5JE8A 4JX8A 1JQBA 4RDHA 4YJFB 4WLVA 3WSVA 4IJUA 1JWAB 4JN6B 3DZKA 1E3JA 2QIOA 4AJHA 3ITKA 1ZEMA 2YY7A 3TRIA 1V9LA 3D5QA 1YBVA 4BNGA 3WS7A 4ND2A 1HSOA 3IKTA 2OXIA 4HADA 1Z6ZA 3X2FA 3TZKA 1ENOA 1BDMA 2AE1A 5TSDA 3LC2O 2I3GA 3JQBC 4FDAA 3FN4A 1EDZA 3VH4A 4YRDA 1YB1A 2PD6A 3QSGA 4WLFA 1GCUA 4XR9A 4IS2A 1HXHA 4ND3A 3V8BA 2CDAA 4E5NA 2Y05A 4KQWA 2NQ8A 1HDGO 4PLPA 4QX6A 4II3A 2OGUA 4CUKA 5ICSA 1KC3A 1D4FA 1K6JA 5F5NA 2PKQO 1YWGO 4B7XA 1ZBQA 4ZRMA 2YHIB 1BW9B 3ETGA 5K6AA 1U3UA 2ZYGA 3ETDA 4IM7A 3E5MA 4J91A 3BMNA 1OMOA 2NTJA 3U62A 3QVWA 2WDZA 1E0DA 4WCFC 5KOIA 2OBNA 3EZLA 3LT1A 3ZWAA 4D7AA 1NFRA 1EVZA 3AU8A 2DTDA 2Q46A 4CMJA 2PZLA 2ILTA 1BVRA 4IIVA 1N7HA 5FFFA 3BAZA 4IDDA 2HCTA 3GFBA 3H65A 3HQ4O 3OIFA 3OEWA 1CETA 1YONA 2EJWA 3OIDA 3GZNB 4BNYA 3ADOA 3DDNA 1KVUA 1GADO 4GQAA 3GHYA 5IDQA 2FOIA 4DUPA 1SEVA 2Y67A 1KVTA 2D4AA 2AQHA 3JCZA 3PHGA 1T4BA 2HJSA 1NPTO 3ZNOA 2C5EA 1UDBA 1HDXA 3UKOA 5JO9A 4N18A 4HKTA 1O94A 4JBGA 2VHZA 4KOAA 2RAFA 1WAMA 5L4NA 2ZB8A 3OA0A 3I83A 3EYWA 5L7YA 3IJPA 4I5EA 5EQDA 5TT1A 3WJ7A 2VYVA 3M6IA 4R5MA 3KYDB 1MGOA 3PFWO 3AOEA 4OQZA 4J1QA 3NGXA 3VAZA 2BI8A 3MOGA 2ZIZA 3PLRA 5G0SA 2GUGA 1XSEA 3NDJA 4R1UA 4FPXA 3ZNPA 4J90A 4ZD6A 1P31A 3PQDA 1B2LA 1DC3A 1GU7A 3MJVA 3VPXA 1HDZA 4NG5A 1JAXA 2G76A 3KRTA 1T2FA 2P4QA 3HWRA 4Q3BA 3TN7A 3DHNA 5G0WA 2ZYAA 4NH4A 2I3AA 3GVXA 1W0CA 4HFRA 1NVMB 4Q39A 4FFMA 1ZH8A 2ET6A 2OFPA 1GZ3A 1UJMA 3ST7A 3U49A 1CQJA 1OOEA 1ZK1A 3D5TA 4YACA 3QA9A 2HQ1A 1KVSA 1YVEI 3MOIA 4MIYA 3O4RA 1P1IA 2FMUA 2IDZA 5A05A 4CM9D 3ZU3A 4PRKA 2EGHA 2V6GA 1NHWA 3GMSA 4PG6A 4R1SA 2HK7A 2PKQP 4Q3EA 3MZ0A 3PRJA 1L7DA 1SNYA 4IDAA 1QG6A 3NTRA 1MC4A 4TVOA 2BGLA 2QW8A 3PHIA 5C7LO 4DWVA 1P9LA 1P0FA 1NPYA 2Q4BA 3IQDB 3HSKA 2G5CA 1KOLA 1VJTA 4Z9XA 1HLDA 5TQVA 1A4IA 3PIDA 1E6WA 1G1AA 1I0ZA 5JBIA 2PGJA 1UXIA 1H94A 2HK8A 5ILOA 1DLJA 4ITUA 1CJCA 2G17A 4CMKA 4HUJA 2VTDA 2EXXA 4WCFA 4J16A 4OXNA 1LA2A 1W6UA 3KZVA 1DSSG 2P5YA 3HDJA 3O8QA 3JD4A 1U1IA 1E3EA 2Q1SA 1K6IA 3HDYA 5I9NA 1PIWA 2DFDA 3GZ4A 2YV3A 4MP6A 3AY6A 4WNCA 1A4UA 1TT7A 2JKVA 3RBVA 4DPLA 4KP7A 4CMBA 5A02A 3IKVA 4I08A 4RPKA 4Z0HO 2WD7A 3WBFA 3WTBA 1ZSVA 2ZATA 3ZV6A 2GSDA 4MVJI 4CM4A 3DTYA 4D42A 1NR1A 4XIJA 2Q45A 5CAEA 4RF4A 1A9ZA 1R4MA 3G1UA 1JWBB 4IMPA 4B8WA 4MJLA 2B69A 3SX2A 3H4VA 5CDGA 1P77A 3WXBA 3GY0A 2C07A 4B8ZA 3ITDA 1XU7A 4R1TA 3JQCA 2NNLD 2Q1TA 4NQZA 4NFSA 3DAPA 5IZCC 3H3FA 3FTPA 1GV1A 3QWHA 1X0XA 3U4DA 5HTOA 2YQ4A 3TL2A 5COBA 4UEJA 2J5QA 1HSZA 2GR9A 1AXEA 1TT5B 2EERA 3GEGA 5U4QA 3RUAA 1B8VA 1U4SA 4UVHA 2SCUA 4CV0A 4N7RA 1PEDA 5A9SB 2YDYA 2BFPA 1PSDA 2EP7A 1LUAA 1AUPA 1I32A 4GVLA 3BMQA 5CG1A 1HE5A 1GCOA 4N54A 1MFPA 4QQRA 4RL6A 3KSDO 4BO7A 4DRYA 1T1RA 5L45A 4TQGA 3TF5A 3SJUA 2X9NA 4EEZA 3NEPX 4KDFA 3DBHA 5AXBA 4O5OA 4CQMD 4KWHA 1Z73A 2IE0A 3A4VA 3DZJA 4J6FA 2DLDA 5TRTA 1HDCA 4YA6A 4NMHA 4GWKA 4CMIB 4NK5A 1T26A 1DFIA 3AI1A 5T5QA 4JCOA 2O48X 3BHMA 3EDMA 1PL6A 3K2BA 4QUKA 2P2SA 2B4RO 2RHCA 3UF0A 3JQ6A 2EKPA 4NFHA 4WUVA 2C82A 4KUHA 1D8AA 5A3JA 5DN9A 2OHXA 1GR0A 4I9HA 4L74A 4TSKA 1H2BA 4BMNA 1E7QA 2J3IA 4TKMA 1KVRA 1YQDA 3PPIA 4XGNA 3ZW9A 2YUTA 4E2YA 3NT5A 4LMRA 4KWIA 4XGKA 1U7TA 3W8EA 4OQYA 1OI7A 2Y66A 3TOZA 3E82A 2RHRA 2O3JA 9LDTA 1ZVMA 3K96A 4J4HA 1GPDG 5C7OO 2W2KB 4MVJD 2PR2A 1IL0A 1R16A 4MINA 4B4VA 4AJNA 4DPKA 1O9BA 4RVHA 2X0RA 3FR8A 2V6FA 2I76A 2QHXA 5HWSA 2Z1NA 3PYMA 3GK3A 5I9LA 4M1QA 3I23A 4DMLA 5CP8A 2ZCVA 1EBUA 3OA2A 4NU5A 3V1YA 1ULSA 3GR6A 1YGYA 5GZ6A 4F3YA 1BG6A 1C3VA 3IDSA 3ZH2A 2H9IA 4OHUA 3CZMA 4J1TA 4FC7A 3RVDA 3C1TA 4A73A 1HYEA 3WSWA 1YE3A 5JYEA 3MJEA 1N5DA 1L7EA 3OMLA 4ZQGA 3AOEC 3D4PA 3WGZA 1YRLA 1OC4A 3I9NA 1FDVA 3QWIA 4Z3KA 2QRKA 3GEMA 3NTQA 4NHEA 4ALLA 3BMOB 3C7DB 4XQCA 5H82A 5JDCA 4BNNA 4XYGA 2GZ2A 4BNVA 1WLYA 4BGEA 1DDOA 4J43A 3EZYA 3T7CA 3GH3A 1NVTA 4D3SA 2YFQA 3E9MA 4CR8A 4RZHA 1QYDA 2ZQYA 1UAYA 5MGBA 1YOVA 3NJ8A 2VT2A 4J2HA 2IXBA 3ONEA 1KEWA 5HS4A 4IDBA 1E7WA 4ZRNA 2B5WA 2JAPA 3GNSA 3F46A 4PLHA 3OQ1A 3INGA 3IL2A 3D3WA 1EVYA 1ID1A 1I24A 1IUKA 4XB2A 1DRWA 1M67A 1VJ0A 1NYTA 4LSWA 4MKZA 2AEJA 1GYRA 4NBTA 5DF1A 5CPFA 3I9OA 3RIHA 4MKXA 3RJ9A 4TRRA 3ZV3A 1I01A 1HETA 4OOEA 4P38A 1E1KA 3H3JA 4EBFA 3PYXA 3ICPA 1LLUA 1QV7A 3GAZA 3L6EA 4JIGA 2CNBA 4RLSA 1GFSA 3JQAB 4BB5A 2ZQZA 5A9RA 3GHHA 1BSVA 3AOGA 4W6ZA 1CQIA 1A7AA 1DJQA 1I10A 3KYCA 3OM9A 4BKRA 5DP2A 3N7UA 1XWFA 1N8KA 3KUXA 3ZWYA 1WZEA 2QRLA 4WLOA 2I5PO 4BNFA 3ZW8A 3MEQA 4YR9A 4XCVA 4XQEA 1UR5A 4RZIA 3PXXA 1I3KA 4XWYA 1T1SA 4DVJA 5LDGA 1T2AA 2FHSA 1ZCJA 4UREA 3L6OO 1Y8RB 2O4UX 2Y1OA 2CY0A 1GAEO 3IOYA 4FCCA 1KC1A 3WWYA 4NI5A 3ZU4A 5CDSA 2PGDA 4RPLA 1A27A 1C1XA 1H5QA 1RM5A 4JXKA 1SOVA 2OO5A 5A3VA 3WLEA 4CLOB 3PFFA 4YAJA 3UICA 4BGIA 4CMAA 1ISHA 5KJFA 3ORFA 2IRWA 1B7GO 3WQRA 3V2GA 4EZBA 4HV4A 1H6CA 4H3VA 1DJNA 1VE9A 4MP3A 4AFNA 5KVQA 5JYDA 3RFXA 4UUOA 4R9SA 1R15A 4P4GA 1LDMA 1Q7CA 1H9AA 3I4CA 3O03A 1WVGA 1R0KA 4GVXA 3ZV4A 7MDHA 3Q0EA 5EN4A 3GG2A 1YH3A 3NAQA 2I6TA 1NWCA 1BDBA 4GX1A 3G3EA 4R54A 2NLOA 3R3JA 1GUZA 1LI4A 4XX0A 1PQWA 3B1KA 1W73A 4L9RA 1SB9A 3P2YA 4GI2A 4C7JA 2AEFA 2EJVA 8ADHA 3N74A 1JVBA 3DO5A 1I2CA 1T25A 4IINA 4W7IA 5DT9A 4PG7A 1VSVA 1HYHA 3QV1A 4E31A 5T6BA 1RM3A 4Z6KA 1GD1O 3K5PA 2EP5A 3I4FA 4JJIA 4CLXA 2PNFA 5COAA 3D4OA 3ZWVA 3Q9NA 4CM8A 1PJQA 4ZQBA 5B1YA 2J8ZA 3UFXA 3FD8A 4CQMB 4XJTA 3GGGA 1XQ6A 2JHGA 1XELA 3KXDA 3CIFA 4LW8A 1SMKA 5IN4A 5DCUA 3Q2IA 1GUFA 3HJAA 3INRA 2H1SA 5JDIC 3PVZA 5I8ZA 1WMBA 3Q3CA 4EI2A 1LRKA 2YZ7A 2PGLA 1XU9A 2VTEA 4GKVA 3ZWWA 3KYBA 1NFQA 1T2EA 3WFJA 4BUCA 3OJEA 2E82A 5A04A 3INTA 3V2UA 1I30A 1LX6A 2DKNA 4XZ3A 3B6ZA 4BNLA 3R0IA 3DOCA 2BFMA 3EGOA 3T4XA 3QHAA 2AE2A 3QE3A 1ADGA 4GGPA 2HJRA 2D3TA 4UVDA 3GGPA 5G0UA 4E6PA 1B8PA 1FF9A 2A92A 4DTIA 4B3HA 4HFNA 4Z0PA 5THQA 3KHUA 1HF3A 2WYVA 3CTMA 3QQPA 3RASA 4BNZA 3KEOA 1H0KA 5EJ2A 4J0FA 1V8BA 2I99A 2X6TA 3GT0A 4RO0A 3C3XA 3U0BA 4FB5A 4OAQA 4FJ1A 4TROA 3AUTA 1NQ5A 3VH3A 1HZJA 4PLVA 1HDRA 2WTBA 1GDHA 1ZXBA 4I9NA 2YHIA 4PLFA 3VDRA 3L07A 1VL6A
chains in the Genus database with same CATH superfamily
1JFSA 4S35A 4JWTA 2EV9A 3WDSA 4R01A 4OQ4A 4B0PA 3AP2A 3GO4A 1R12A 1FU8A 4UM5A 421PA 3WP0A 1JTEA 1Z5NA 4CCWA 5BWMA 3VC1A 3UGJA 2FQXA 3OESA 3GA5A 4PZLA 2VHTA 2GARA 4MCHA 2DBQA 3RVRA 1ZITA 5FL7D 3ODPA 5B57C 2G70A 2VYFA 2VCYA 3OG9A 1L6IA 4MPJA 4OUDA 3KQKA 2FZEA 1J2EA 5CEJA 4C6TA 1EFTA 3E15A 3G5LA 4GPZA 4IUYA 2UYGA 3GRPA 2WIAA 1J8FA 1CG6A 4X7BA 4QBHA 1D2HA 3IUBA 5AKEA 3ZIAA 4RIIA 2F8MA 5SYAA 3UNXA 1EG2A 3AV0B 3AW8A 1GRVA 4WA8A 1F2TA 1W75A 2OV1A 2J3HA 4BO6A 5A3QA 2CUNA 5C8YB 5FAKA 1N4DA 4QSMA 1SKAA 1I3NA 3P0HA 3SBDA 4NR0A 4AY4A 2ODEA 4AO6A 3RLFA 3TOXA 1KI2A 3K0EA 3ZCVA 1E9EA 4HL6A 3GNLA 2R6R1 3CR8A 1XAIA 1NBOA 4F93B 5CLIA 2NXCA 3PWKA 4YPFA 4NCXA 2IHZA 4O2BB 1E79D 3HPQA 2EF1A 4I2NA 2FEMA 2JHAA 5FAXA 3KYDA 4H0NA 4OP2A 3TB4A 2Z8YA 1N2IA 3V4SA 4ZCTA 1JBQA 1X6VA 1T3ZA 1W0JD 1M1YB 1X14A 4GUAA 5E8JA 1HL7A 3AMVA 4DCPA 1U5BB 1R4NB 1UT8A 2OXEA 2WE7A 2JFGA 4G8DA 1H66A 2R86A 2C20A 1RS0A 2B35A 4U2FA 3S2EA 4BKMA 5IPFA 5AOVA 1QKKA 2ZRIA 2V7PA 2XUFA 4I6JA 1J09A 4LDZA 5HX7A 5J2TA 2F90A 3F7MA 5CVEA 2L69A 4W4TA 1Z12A 1A96A 4MXDA 1GUBA 3FHCB 2YIVX 4UBMA 3E48A 1H9BA 1N5IA 4I1SA 1Q74A 1KSFX 1OZHA 4LJLA 4TGLA 4BQFA 1I36A 4JU8A 1U31A 1VKNA 1KFEB 3F6EX 2H16A 2FFAA 4GX5A 1E5TA 1YQXA 1YRQA 3GGSA 1UBSB 4ABTA 3DEJA 5TR9A 3N2GA 1G3RA 3QXHA 3EXG1 4EPVA 1SHJA 4IO1A 4KN8A 2ZE8A 3TQFA 2VF5X 1UXJA 3DVAA 5DBOA 2H63A 5BR8B 3PJRA 4ZT3A 1XEWX 2NT3A 3RT7A 3KETA 3EGEA 1AE1A 1XD2B 3PSAA 3ZHOA 3A6PC 2IU0A 1T2VA 4HT3B 1ZHFA 4FGZA 2IIQA 4DCVA 3VSAA 5HOEA 1M34B 4GUDA 3ZCQA 4EL0A 2LD4A 1CB7A 4MWCA 4EWLA 1P5ZB 3TM4A 1LPMA 3KTAA 3L7YA 3NHMA 2VNSA 3L8HA 4I4NA 3BMCB 1J8YF 2JFFA 5CIYA 2OV3A 4MB6A 4NATA 2JFWA 4UUQA 1RWMA 2G82A 4LXXA 1CJUC 3UGKA 2BL4A 3F97A 2Q8QA 2ZFUA 3ABOB 4M88A 2FSIA 2NAPA 4MYTA 5CCDA 3UWMA 1QGYA 4QPJC 4JC5A 2Y99A 4P7BA 4E14A 3A2NA 2F1IA 3QMWA 5EPUA 5I45A 1VHDA 4RCYA 3S0JA 3K6JA 5K45A 4B3BA 2WJGA 2XQGA 1TIPA 2FXVA 3RWOA 4ETNA 2VH1A 2EGUA 1YA6A 4QT0A 1W9MA 3AKCA 4BJHB 1B00A 3U7JA 3TQSA 3W90A 3ZOKA 4KNYA 4I55F 1EEXB 1N6RA 3LW8A 1Q7TA 4LGVA 4M1WA 3LLMA 4Z2YA 4F1KA 3EX7C 2C96A 2POQX 3EMDA 1KKMA 1QH9A 1Z5WA 2BMAA 2BUCA 1JSCA 2A5DA 2XWBF 2ZRLA 4LYJA 4DMCA 3ADDA 3UJ3X 2PQ0A 1BVYF 3DE2X 4ZU1X 2H3EA 1E0AA 3IV6A 4FFPA 5FWNA 2BFBA 3GV0A 5DNYB 1UM9A 1M2GA 4MEBA 3IMCA 1H8ED 4O3FA 1J7KA 4B09A 4K9SA 2GN6A 4QYMA 3ILHA 1T6YA 3B3QA 1JHYA 2CNNA 3DQPA 4L28A 4TKVB 1KZ7B 4ARZB 2X4DA 4BKQA 4DRZA 1G7TA 5C9ZA 1T1EA 2R1VB 2Y6VA 2YW9A 2R60A 4NECA 1Z06A 4S2EA 3AHIA 1BS2A 4MW1A 4L9SA 3TQTA 3DFKA 4WCDA 2QTGA 1WXEA 1M6HA 2RIPA 2QE7D 1ZGZA 4JDPA 4R16A 3WK7A 1Y89A 3SZUA 1KP9A 2I4OA 3WYCA 1PT7A 2R2GA 1WDWB 1E4EA 3GA7A 3V32A 5EJ9A 2EX0A 1JYSA 4OJQA 3F67A 4TLAA 4DA4A 2Z5LA 4NJOA 4LA4A 4F1WA 3OURA 4EF5A 1FVXA 1FTWA 2MSWA 3CNLA 5K8JB 1AMOA 2Z09A 2FHPA 1S3IA 2UZ0A 3CURA 3L06A 1DGQA 5MN5A 3MWDB 1H05A 4RKFA 3DOJA 1FLDA 4OKNA 5AYVA 1T5HX 2IVZA 3JQDA 2J33A 3M6FA 3D3EA 4XB6B 3JWHA 4RD1A 1A9PA 1VBMA 1A82A 1YRBA 2A5FA 2BI4A 2HPVA 2ZXEA 3EW7A 3IUNA 3O9VA 3P8ZA 3BTUA 4OOFA 4P80A 4RKQA 3PXEA 5HF9A 3T3OA 3R3ZA 1XCGB 3LDHA 4AG6A 1E2PA 4B6JA 3ZHRA 5CK4A 4DSUA 2R7AA 2ZUCA 4BNJA 3VBEA 5KEIA 3BSWA 1E18A 5L6LB 1MW9X 5ECDA 3KR1A 4TUYF 3WB0A 4BGDA 4YT4A 3VYUB 1T3HA 4K9QA 2ES4A 2X6QA 2ZBQA 2ZYTX 4WIAA 2X5OA 3FROA 4HNVA 5K3AA 3NOQA 2QL7A 1TEHA 2QPAA 1P2DA 1WBBA 3ZHXA 2C3UA 2VDWB 3DBHB 4KDRA 2VYNA 4JQZA 4YDSA 3TBKA 3UWSA 3WRWA 4BLQA 1DKUA 4IGKA 1EUQA 1D2AA 1OC2A 1RRMA 4DRXA 2QYSA 3D9QX 4HVCA 1UDXA 4BVGA 4UCFA 3OHMA 4QOSA 4FYPA 4Q02A 5BMVA 3QVGA 3REQB 4KK3A 1SQSA 4WZBE 3ZZTA 1VE3A 4DBZA 4RFVA 3RRZA 2GDJA 3G49A 3N2NA 4FHZA 2GETA 2OE2A 2EWWA 2PL3A 3PICA 1DBQA 2OVBA 4LS3A 2BHNA 1C7JA 3L8EA 4I7EA 1G6HA 3NDIA 5LDHA 3ILYA 3EPKA 1YRHA 3BHIA 1L5WA 4M98A 4QYIB 3TRKA 4UATA 4WKPA 3V9PA 4PCLA 1NVAA 5HBRA 4CV3A 2N46A 2XUJA 5ITSA 4HGQA 1RHQA 3NAZA 5F73A 4C04A 8LDHA 3VX3A 1P4SA 1FP7A 1ZK2A 2ASVA 3EG5A 3LM8A 2YWRA 3PX2A 3V8RA 3I45A 4BBJA 4W9MC 3W7AA 1G8YA 5A4KA 1YBMA 3W5BA 1M34E 1KWGA 3L77A 5IC6A 3CUVA 3FI9A 2B4KA 4N5MA 4Y6RA 2GZ1A 3BN3A 1NF8A 1QP0A 4MS1B 3M6AA 2HXSA 2H3HA 2PRZA 4NMXB 1C4OA 3E8XA 1VIYA 5ALOA 2RGNA 5BNTA 1DAPA 4L3VA 5BVHA 4E5SA 4F9TA 2YHAA 1GGHA 3GCZA 3EJ6A 3S1SA 2XXAB 4HNHA 3SXUA 2W6JD 1SCKA 2HA3A 1D7AA 2ZSHA 4L76A 4BX9A 4ZYWA 4MIKA 4NEGA 4AYWA 5DSTA 4O4LB 3ABZA 4YDRA 1G4AE 3IXLA 3NIFB 4JL8A 2VQ3A 1YDFA 3ZC3A 1O95C 5JARA 2IS4A 3HB7A 3TI7A 5HXAA 4LXQA 2QMQA 2PCLA 3UAOA 5KYUB 5DN6A 5FI5A 2FP4A 3FDXA 2BY4A 4IXWA 1KE1A 4WKBA 2FN4A 1FP1D 3VPFA 4HR7A 2YWCA 1CSEE 5EWMB 4O2RA 4PC3A 3ZCUA 4MB0A 4IIXA 4JNKA 4H4EA 1M0SA 5JAQA 2X0DA 4FFBB 3S2SA 4ZT2A 3FE2A 5BSHA 1N78A 1SXJE 3WMFA 4CHGA 4JQSA 5KYYB 2E4WA 2X7HA 2QRVB 2Y0CA 4UTVA 2OV6A 1Z0UA 2OOKA 2P9GA 4KIWA 4WXRA 8MHTA 1KMIY 2EX1A 5IWCA 1QP7A 2GX6A 1MU0A 3MMZA 2GNAA 2GRJA 3DBRA 2YW2A 5FUYA 2EZ4A 4GMGA 2JLUA 4EIWA 2VSOA 4HZUA 4N40A 1X9GA 4OTZA 2TMDA 3O4FA 1EP2B 4KGDA 2D62A 1Y4ZA 3IOBA 1SVOA 2WSMA 3H5WA 3PEFA 4AF8A 1E3QA 1GHTA 1KAGA 1KMNA 1XDBA 3BULA 3NW9A 3WL4A 3SX0A 4BFZA 2QGZA 4MUGA 3ZDRA 1G8JA 4WZAE 2IOQA 3VGJA 1I0IA 5D6OA 3MJSA 3B2NA 4PLZA 3MBIA 3TD6A 4H7KA 1T24A 4GM1A 1Y42X 1Y8CA 1CY0A 3N87A 4RK0A 3PDUA 5DI3A 3HB1A 2H85A 3M33A 4PSCA 3KVRA 3K0HA 4TN1A 1BXGA 3AFGA 3P2EA 1NRJB 3OM0A 4QGBA 2C7OA 2GBLC 4JHLA 4GX2A 5CHYA 1F6BA 2YWDA 3SE0A 4B6EA 1KBQA 3FIUA 1NTOA 5ALWA 5HIIA 1H6AA 3B8HA 1XBTA 3JSAA 4IIHA 5K05A 3N5CA 4EYEA 4FFWA 5JLAA 4E4RA 1W85B 4NPAA 3QG1A 4ZQFA 1RMQA 2AD1A 1HZZC 5IF3A 4KGXA 2Q5OA 4ZZIA 4UDNA 3IKJA 3W78A 4Y1GA 5K03A 1T4DA 2W11A 4D9JA 1BWPA 1SU8A 4ZK6A 2YOHA 2QPOA 4IRMA 1B0ZA 1N2BA 1NXPA 1ZUHA 2JFNA 4RVNA 4U02A 5EQFA 5DCLA 2AN1A 3ONVA 4N12A 4X71A 3DQZA 1UODA 1XU4A 2WYIA 3LLCA 4B40A 2DERA 4D25A 2C5AA 3K5WA 4DF3A 4FDMA 4IKPA 4DJEC 1FDOA 2HIHA 3UC5A 4LFBB 5A9TA 1JR3A 1TF7A 2PZKA 3K0CC 2JL1A 4N8DA 5G4KA 3UJBA 1JWLA 3AF6A 1AKEA 4DR7B 2GPNA 1Z25A 2O1EA 2ZRCA 4B83A 2C4MA 3T35A 2CJWA 4QREA 3U5ZB 3IP9A 1X1RA 2IP4A 4D9GA 3ZDZB 4W5HA 2P0YA 3PZRA 4IQFA 3ZEAA 5GJWC 4EGCB 1MQSA 5EYPB 3MTGA 2L2QA 3RAFC 4H7IA 4IZ6A 4B3CA 3WNZA 1QX4A 3U60B 4CQLB 5I7EA 5IM4F 4UEQA 5D8DA 2H65A 3P0FA 3NHBA 4J07A 1I2DA 4B31A 4C7MA 4BCBA 2J9GA 1KJWA 3F9CA 4KSCA 5JPIA 2WK1A 4DCJA 4CTMA 2IUYA 3QMPA 4L8LA 3DMDA 1IHXA 1D6MA 1WXDA 1KMQA 1X1BA 2QG9A 1YNSA 3AX6A 4GXRA 3T5BA 1RYHA 1AUQA 3AQIA 1Z3IX 5DWDA 3WR5A 1BDHA 5JZBA 4KB5A 4RPGA 1N5RA 3MBKA 3NIBA 2O57A 4LJSA 2NO7A 3NP7A 2FPUA 5B6JA 4H7DA 3SDBA 1VLLA 2AFIB 3GBVA 4URFA 4DXDA 3IBCA 4ZI2A 5I5EA 2YQ5A 1VE7A 5FORA 5FBQB 5EJ5A 3AR3A 3C14C 3G9ZA 5KNBD 1ATZA 3RABA 2O9JA 3SLKA 2Z5VA 1HDEA 1KFBB 3IP1A 1JEEA 4QXAA 3TCNA 5L53A 4DUYB 1P4AA 1Y3AA 2JLBA 2GI4A 1E3LA 4L72A 5KKAA 3A6EA 4MJXA 2R6DA 3S99A 4XWTA 3SBOA 1G3IA 3ZH9B 3HYRA 1QGED 1QH8B 4BP9A 4PC1A 1UKYA 5CX1B 1OI2A 1UUFA 2KPOA 2NAFA 4GOLD 3CVUA 2O19A 1KYZA 1U9IC 2W90A 3EQ2A 5JH7F 3GXOA 4EY5A 1IIRA 5L45A 3H7AA 4C05A 5DBHX 4DAOA 4DM3A 3STWA 1SVNA 2VP4A 3NPMA 3WGGA 1G5RA 1FPQA 3UHAA 3A6HA 4OXRA 1U0EA 2EFDB 4B9EA 4OJNA 1ZIOA 2XMPA 4NBKA 5IJ9A 1RKXA 3DO6A 3OQBA 3CLRC 3L49A 2Z9BA 1QF6A 1PZGA 1T15A 4C4TA 3OKAA 2OB2A 4DWJA 1Q20A 3QA3E 4EECA 3LCVB 4YCLA 4H6XA 2XQVA 1MB2A 1V45E 4Y1EA 3ONDA 4LHXA 3FNGA 1JR4A 2W6CX 3W5DA 2QMZA 1O8BA 3TAHA 3H2KA 1A72A 4Q3AA 1YR7A 1CLUA 5EXEA 1UIRA 2JCBA 3HMKA 4YR7A 5CIQA 4PHGA 4ASUA 4AX4A 1Y7HA 1EXVA 4C6HA 4R8MA 5E0OA 2RI6A 3WGLA 2XCRB 3TLGB 3VPHA 5HGJA 5IVKA 3JQPA 3FFAA 1LFDB 3FYDA 1YIOA 3HGMA 2AXQA 4UQLA 2IUFA 5CLLA 1LRJA 1Z5ZA 4RK5A 3LCUA 3DBIA 4BPRA 1VMKA 1FRFS 1BKSB 1ZINA 1M73E 4JBXA 4LNAA 2BTQA 2SKCA 3UHFA 1ZD8A 4ZT7A 1FJGB 4JNCA 4RDIA 3QMMA 4EGFA 2A9QA 5CFRA 1JJAA 4PHCA 5J2TF 3UK7A 3FRJA 1BHQ1 1PTKA 1UOOA 4ATNA 3ILXA 5FPSA 3Q8LA 1YS2X 2VI5A 8ABPA 2YXDA 4QU8A 4RKWA 5AW5A 1XZKA 4YHBA 2NM0A 1IONA 4BO0A 1CR6A 2OM2A 4L0MA 4LRUA 3QKSA 3KSUA 3UQZA 2BHSA 2Y93A 1ODTC 2FFJA 2Z3VA 3AKEA 1T34A 2XT9A 4OK5A 1WUKS 1QGZA 4H2DA 4UVGA 2DQ4A 5EHNA 3QUBA 2UDPA 1JEQB 1QWSA 3O3CA 3T1NA 3ROGA 1A50B 1J0EA 2ZREA 1LF5A 1TM3E 4KE6A 5DIZA 3T34A 2BHRA 1U3GA 2R6JA 3FCUB 4P2GA 2IWHA 2YR0A 2XB6A 1KRHA 3JTMA 5A7GA 3Q8XB 5LMUB 5F2KA 4N9WA 4LXYA 3QY0A 1H1DA 1X87A 2IYZA 2XV1A 3OPXA 4J7XA 2Z4TA 3ANSA 1VYTA 1HEUA 5CB4F 4KQIA 3U4AA 5EI5A 3G17A 3AERB 1GLGA 2NZUG 1VCIA 3I52A 3FG9A 4X61A 1QC5B 1XRMA 3VSBA 2C3PA 4TTSA 1PWYE 2PU5A 3LWDA 3S8YA 3VR6H 4UTOA 2WTUA 1J90A 4YP9A 1HRDA 2UZ1A 1KORA 1BMDA 4M49A 4BBPA 3DAGA 4MWBA 1YK1A 3KKQA 4BLSA 4ZKDA 2P2NA 3DMPA 1X1EA 2FZKA 4D74A 1PBNA 2IYQA 1KK2A 3FZYA 3K73O 3RAJA 1AKTA 2DAPA 2FPIA 2Y92A 3V2HA 4YT2A 5LZ2A 3VM6A 2YJ5A 1EP9A 3G79A 2Z57A 1QFJA 1DHTA 3OFJA 3PD7A 4HQLA 4PO1A 2GHQA 3M5WA 4HPJB 1WS6A 3PXAA 3ZI7A 3G5MA 1CVLA 1E9DA 1QQ5A 1Y4AE 4F92B 2YN4A 3KWLA 2BJVA 1V11B 2YWEA 1LBQA 4FGUA 4MQ6A 2WE8A 3THOA 3DC2A 5TQ0B 5JSUA 1WM1A 2W43A 1PS8A 1X1DA 3JYHA 1LVGA 3KL4A 1M1UA 3FOAA 3LH5A 3RW9A 1XPRA 1V3TA 3JR7A 1Q0HA 1LI7A 1PT9A 3BWMA 3ZDAA 2F3SA 1SUDA 4MGEA 4TTPA 4L73A 2PVCA 3BJEA 3K9LA 3QX9A 1AY0A 1O03A 4HC4A 3CMCO 3OTWA 2GN4A 4W8GA 5EE5B 4PEVA 1J97A 1SOWA 2ZUUA 3EXIA 3O82A 3OCVA 1F1BA 1MJFA 2JLRA 4MYCA 3GX1A 4TQUS 3UVEA 2C9BA 2HV8A 1SK8A 3QOWA 1E1RD 3KXLA 2PH3A 4UUAA 1FQOA 1TK2A 1QIFA 1G9XA 4CFSA 1M76A 3CT6A 1C41A 1WZCA 1XQ9A 1GSAA 4G6ZA 1TUIA 1ORIA 1TQ6A 5B37A 3MXOA 3G88A 4FZ3A 3Q8MA 10MHA 3RSGA 3IT0A 4Y9TA 4C5BA 1L3CA 2JNWA 2NVOA 1V26A 1WHTB 2CVOA 3E6AA 4RY8A 2BFNA 2D2XA 1VMEA 4RENA 1I1OA 1ZJ5A 4NYIQ 4B2YA 4AKHA 4GM4A 4P4LA 5LZ7A 4O4JA 3SHTA 4BCDA 3L02A 4RE5A 4TWRA 4LK3A 3IE2A 3GPCA 1YTLA 2M2IA 2CL7X 2FU5C 2B4AA 4FYKA 3TOSA 3A1NA 1IZ9A 5REQB 2YL2A 4R2IA 3DR5A 4IOJA 4RKYA 2Q21A 5HOQA 1GUDA 3OWXA 4B73A 5HIKA 1WUIS 1JHUA 4DMKA 2NW6A 1QBGA 5JROA 5H4GA 3HV2A 3RANA 1YUNA 2J9RA 3V9AA 2F43A 5ALHA 1H2EA 3LO8A 1LS6A 2YJTD 3OOEA 1VFNA 1Y3FE 4X3CA 4E15A 5B6IA 4DQUA 1FDRA 4KX5A 1AKUA 3MHPA 3PC8C 3RROA 3CCBA 3QWFA 4MUFA 5IJZA 2CK3D 3CY6A 1Y63A 4EHDA 3R9WA 2ID8A 4KQHA 1VG1A 4KIUA 4TTAA 3NT4A 3RS7A 3T1QA 3ZLVA 4ZJUA 4G1VA 5H81A 4DKXA 5CAEB 4E2FA 3PXGA 3U9TA 1W0KD 4O6VA 5AI6A 5AKGA 1Z75A 4LSZA 4RVFA 3OIUA 3UT6A 1MKYA 4C14A 3EXAA 3FGOA 5ALQA 3VZRA 4EHFA 2O8EB 4ESHA 2VP9A 1SBZA 4AJLA 1XKTA 2J1LA 1MIHA 2R6AA 1CVIA 2VF8A 4Z8XA 3L7KA 2GVDC 3AM4A 1WB5A 3QSYA 2YVUA 1E89A 1H2YA 1YZFA 3OT5A 5ALRA 3VR6A 1II8A 3JRWA 4HWGA 1FU7A 1IG0A 2IYFA 4ZO8A 3R9KA 3U4QA 3AUYA 1D3AA 2DCMA 3DZDA 1K88A 3ZWPA 3C85A 3HK2A 3ZW7A 5G3ZA 5J3JA 3D6JA 5L3RA 3EEBA 1Z28A 1FXSA 3KXIA 4WKGA 1JFLA 2PX4A 3FWYA 4JK3A 1HLPA 3KX2A 5ELXA 1ES9A 2CNKA 4TM8A 4FE4A 2ZKLA 3VVMA 1JA1A 3M2PA 3AVVA 1M8KA 5JNUA 1GA1A 4RULA 4DA9A 5EXSA 5HZKA 1U94A 1N34B 3JASB 2KLBA 3EOAI 2G4VA 4E94A 4CV1A 3OJ0A 2OC4A 3TPZA 1UF9A 3P45A 4O4HF 1RJGA 4OQNA 1PWXA 4WPGA 4US2R 4WY2A 5ALYA 3SLRA 1KEPA 4CT5A 5CK5A 3SMQA 4CU2A 2G77B 1BMTA 3MAJA 3P9SA 4AL4A 3TFOA 1OWLA 5TGTA 4UHFA 4ZO9A 4MRVA 1Z17A 4MYRA 1Y80A 3UOGA 4E7OA 1TB4A 1IATA 2BGNA 4YC7A 4CMIA 2XNJA 3G6KA 1D2RA 3KOUA 5AKKA 4B6PA 5EZQA 4LRSB 2QM8A 3KQTA 2NPOA 2OBXA 4AY6A 1T0BA 3DTTA 4WXMA 4YB8A 3PFNA 2CHEA 1EFUA 3CEAA 3IRUA 4KQ6A 5EEHA 8GPBA 1MX1A 4L51A 1ZM2A 2IFTA 1ZIYA 1RWPA 2IZZA 4MWZA 3GRVA 2PKXA 5TDHA 4QFCA 4M6WB 4BMXA 4MROA 5J5AA 4PS1A 2J4FA 2CDRA 3DE3X 2PR7A 4RK7A 4ZC8A 4HF7A 2NNWB 1P91A 4IDHA 4XQGA 4ND4A 1EGAA 1YV9A 3W2TA 4ENSA 3BE8A 5FHRA 1TK3A 2AMLA 4QTZA 2NTVA 5JSZB 3LCJA 4QUEA 3SQXA 1SG9A 1VLQA 1MJGM 3PR2B 4Y0VA 2R97A 1HBJA 1IHYA 2BFCB 1B8NA 2XGMA 5E6RA 4QVIA 1H4QA 3GCDA 4F6CA 2XB9A 4HFMA 2YXEA 3BK2A 4G5HA 4NABA 3JWJA 1L9XA 4JQOA 2IHKA 3S2GA 2DT5A 4NBRA 1YZKA 3UJCA 1BJRE 1JKIA 2QDXA 2IS6A 3SQLA 1MJGA 5BW4A 4V3BA 3CUEF 1YQTA 3WNBA 4B87A 5K2MA 2OGZA 2OCLA 1U9IA 2C1ZA 2FJ0A 5C34B 2X2PA 1N3YA 2XYHA 3DBLA 4LMBA 2EJCA 1MJNA 5BP7A 5LZ8A 1P1HA 2XCQA 1ORRA 3CPJB 2GPBA 1E63A 4FIZA 4FS3A 5FO1A 3VTKA 2G8NA 4QHSA 1H69A 1CFZA 1QIKA 1YRYE 4JLSA 1OW3B 1XK6A 1EMDA 2OT3B 1DC8A 4JB8A 3RBZA 2PIDA 2QTMA 1ZH4A 1EGMB 2AI1A 1W4ZA 2CVPA 3PR1A 1B0AA 2GK6A 3NYQA 4OHVA 2I6UA 4QUJA 5G1PA 4C5AA 1K75A 2R11A 3LUFA 1Y8ZA 5K01A 2YMPA 4M54A 3TLCA 1FSGA 1RPNA 3H05A 4KAAA 1OLXB 2O3TA 5LU8A 2BMVA 4V0SA 2NU9B 1T10A 3TDMA 1BXKA 2R8ZA 2A9KA 4M9SA 1F3LA 4X20B 3U31A 4WLEA 2NUAA 4DQ0A 1RFLA 3EJWA 4D9BA 1U5CA 1UXHA 1R6DA 4P93A 1Q1AA 4AJ9A 3B6IA 3SS9X 1E5VA 2NV0A 2HC9A 1T2UA 4OF4A 5AHRA 5I7AA 2PVSA 4AG3A 2XITA 5TQ2B 4JVMA 3U37A 2D5LA 2EKLA 3ZDYB 2HEGA 5HE8A 4RPIA 4J03A 3E03A 4KMMA 4N8SA 4PYMA 1SA0A 2J4CA 2QOEA 2Z6AA 4BWGA 1YOVB 4OQXA 1PBTA 2C1EA 5DKFA 3LS2A 1NWHA 1H22A 1QG2A 2QZ4A 3ABIA 1T4GA 1KBZA 1U1GA 3P9YA 3R41A 4L2IB 1L5LA 4BNIA 4RTKA 3DF9A 1RQPA 3EGIA 5FOUA 1R10A 2Y2VA 2DQSA 3D3WB 3VX4A 4EATA 4KRXA 3EFOB 4H08A 5HMLA 4ZCSA 5SZHB 4BLTA 2R7MA 3OAAA 4JI3B 2PSDA 3JYQA 1ZEJA 2A59A 1HNWB 5CIWA 1WPQA 4CGZA 4JYCA 3EGCA 1PR9A 2Q4EA 4EKIA 3FIJA 3GIDA 3WLNA 1OBVA 4N0EA 4OBEA 1V3VA 3EXHB 3T54A 4NY1A 3KB8A 5DULA 3NBFA 1CRLA 1NRXA 5CD9A 3NEAA 2Q3DA 3GFRA 3K05A 2VN8A 1L1FA 4A03A 2R5NA 3QLEA 3X1XA 1T13A 2IZ7A 2JHFA 4AF6A 4B1FA 3CVYA 3VXKA 1SCIA 3QIAA 2W2QA 1OAOA 1CV2A 2WJAA 2C9MA 2H2WA 3OFNA 3PS9A 3QEMA 3WLPA 3K92A 5A71A 2P9JA 3OLZA 2Q4OA 1QF7A 5BOSA 3O26A 1X7HA 3BE5A 3PD1A 3PNQA 1GTG1 2XUIA 4KFSA 5EG5A 3OO1A 1CUGA 4HYTA 3WIBA 4PQEA 3JV7A 4FZVA 3IPYA 4GX0A 2B7CA 2HYDA 2WVGA 3IX7A 4AZ0A 1C1XB 1OSNA 1WXIA 5DP1A 5B3AA 3UMSA 1NURA 3GLFE 1QZUA 2JFBA 2DTEA 3ZYCA 3NASA 3EC2A 1NYRA 3DUWA 3P4XA 2DB3A 1G4UR 4YRTA 3WGUA 1DKQA 3C6MA 1PLJA 1SUEA 1SPBS 1ILEA 5EHXA 5SY9A 1E58A 4MMXB 1JVNA 4DIBA 2ODBA 3IUJA 1Z0SA 3V80A 3T5AA 2P9EA 1OV6A 3E81A 2VEOA 4F12A 2AQ8A 2QX6A 4Q1EA 1P7PA 3C5HA 4FU0A 2P2DA 4FXOA 3UAGA 2HA7A 2QWXA 3EIQA 5BT9A 1W8DA 2ADFA 2JKYA 4BN5A 5IFLA 4JJEA 1K7YA 3K70D 3A1UA 4ENVA 1P9WA 2XDAA 3UUGA 3K5HA 2NTEA 2FK8A 3COZA 3CUYA 3NJRA 1U6JA 3D2LA 4XW2A 4RTMA 1SD1A 1F2UB 2I6FA 2X2OA 3R8FA 3DVLA 5DBIA 5FP0A 3AVUA 5AVZA 4DMHA 3OPVA 1U3WA 4K3UA 1KPIA 2BBTA 4UVIA 3QPDA 3K31A 4HBZA 1QGUA 4RHYA 5KJEA 3SCZA 1G2QA 1Z16A 4ZOLB 5IAGA 1PLLA 4PX5A 5FL7A 5LA6B 4A8TA 1RQ7A 4FZJA 5HA5A 1QOQB 5A5FA 5KVCA 4QNNA 3L6UA 1QANA 4ZOLF 2HHCA 1U0HC 1ONOA 5COQA 4YAUA 1LVUA 1AB6A 3EUFA 1CEXA 2NVBA 1UIMA 2IGTA 3UB3A 4F5DA 5TC4A 5TQJA 5KNCA 1M2FA 1S7GA 4D56A 6YASA 3TB6A 2WF5A 2ZU0C 2WJYA 2F3UA 3C5WP 5A7FA 5JCXA 3S1LA 5FJIA 5C53B 4EVRA 1DRKA 1K63A 1CDDA 5SY4A 1SXJC 4R1QA 4AIIA 2PUAA 3DKIA 2DWQA 2VAMA 3L3BA 2HKIA 1MAAA 2EBUA 3NJ4A 2CVQA 4HQFA 3ZWNA 3V8QA 2XKAA 4MWGA 3DFFA 1T4CB 4DJ5X 1W47A 3OCXA 3AGPA 3R24A 1V2HE 1SQFA 3PBKA 2OHOA 4TSFA 2Q7XA 2LV8A 3G2NA 3QM1A 1JYEA 1HZZA 1V1JA 3ZJYA 4BO3A 4IICA 1IOWA 4ZMRA 5CXQA 1Z4MA 3B12A 4EELA 1G59A 2O50A 1TA4A 1K2WA 3BRCA 3PFKA 4FILA 2QTAA 3GA0A 4J8PA 3M8KA 3EK2A 3RU7A 1GYQA 2FSUA 3KOYA 3TZEA 4AJ1A 1OWPA 1ZHOA 1L7VC 1E3WB 4Y30A 1SZJG 3RCBA 4LY6A 4MLDA 1X38A 3O8OB 4Y8VA 3LPAA 3ZHYA 3S6JA 2H48A 1W9HA 2FRDA 1PEYA 1WP4A 1O4VA 1T6XA 3H9EO 2JCYA 2DPMA 3ER6A 3H97A 1G8AA 3MRTA 4OFZA 5C81A 1HEIA 4U3JA 1U8XX 5DX8A 2KS6A 2O2ZA 1GPNA 2J7PD 5SYNA 3V46A 3GI1A 1GXSB 1FRNA 4MITA 3ZZNA 4CEJB 1OGYA 3A27A 3HV0A 4ED9A 5SZJA 1YGPA 4TL9A 2APJA 3LY5A 1G2IA 1Q77A 4RPJA 5U1PA 4I4CA 6LDHA 2GERA 3AEKA 1I7SB 1P44A 4BQPA 3IMKA 4QIHA 1JEJA 2R8XA 1SIBE 4EYGA 2W6ZA 4KREA 1I80A 1PZNA 4IUCS 4P22A 2QEQA 3OY7A 5FKJA 3ES9A 4HGRA 3CLSD 4HPXB 5F9MA 1XVIA 5BYBA 3TK1A 3TL6A 3FCEA 2Z2KA 1P17A 4G0YA 2P5UA 5IDWA 4W63A 3Q7RA 4HH4A 3UG6A 5CA0B 4N5IX 2ZWPA 4BBAA 3ZBPA 4YLEA 3GCXA 4IF6A 2MSEB 2VJLA 4AXBA 1IXYA 3MVEA 2ZYUX 4U6SA 1NQAO 1KDOA 3DSRA 2PO7A 2JF0A 1DAFA 1XD8A 3I04A 3X1KA 4A2PA 1NXQA 3G1TA 2OXTA 3RJTA 2Q5IA 5D86A 2WT4A 2IF2A 4FFRA 3AQ4A 1I4WA 1V5EA 2R3SA 4V0ME 4COOA 4KO8A 1E4OA 1ZJZA 2OMKA 4M9XA 4KXLA 3OJOA 5IZCA 3GRYA 1JXQA 1SXJB 2XBUA 2NYRA 3UOAB 3QUSA 4DG8A 5T8KA 2GA9A 4Q3NA 3VUFA 5JY6A 4KV9A 1ID8A 5EIBD 4PFJA 4N0PA 4WXHA 5AD1A 4ZCPA 2GUWA 3ICEA 2WIFA 3IVGA 4OO3A 1HE3A 2HDNB 2NPFA 1NMQA 4JI4B 4R98A 4JMPA 2GPWA 3FCCA 1XAHA 1YASA 2JGFA 2ZVPX 2Q62A 3F5DA 4NARA 4ZODA 3IC5A 5D51S 2VLBA 5EWLB 1H4SA 4D3YA 4Y2RA 4OMCA 1WF6A 2VF2A 1PL7A 5DGXA 1ZOLA 4RFSA 1O2DA 5EINA 5D5HA 4DT1B 4EX7A 5KWEA 2DE0X 2PRIA 3AHGA 4Y2UA 2WMYA 4Q4AA 4F7DA 2EDAA 3I4LA 1YAJA 2BRUC 3CLTC 3FMFA 4HXEB 4W7HA 5F3DA 3UKJA 1R6TA 1KDTA 1SIOA 1VL0A 3IUQA 4IXMA 4JOQA 4PQFA 1RBZA 4PYOA 4QQ8A 4C3ZA 2B5VA 1JBEA 2FQYA 4FYJA 1NNUA 1XO1A 3FSGD 3MTJA 4TXMA 3T3EA 1U5BA 4KKXB 2BE9A 1RQNA 2GHIA 5CGQB 2OCAA 1VJRA 1F0NA 1ZZEA 4QM6A 2R00C 4JJKA 1B2RA 2R4QA 2O8BB 1PDOA 2WWGA 1TQ4A 1WSAA 3JATB 3K1YA 1R4AA 3VSDA 3AHHA 3WRYA 5B4UA 5BN4A 3HUDA 3VMMA 5HKAA 3SKVA 4PLTA 1SKYE 4YJ2A 3LG2A 3EG9B 1K3TA 1EJBA 1WUTA 2NQTA 3RAGA 1ORDA 1Q1ZA 3PLAE 1H9CA 2EZ8A 2WILA 3W5HA 5FBRB 1DOZA 4BRSA 4IGFA 3N2GB 1F9EA 2BP7A 4FMCB 5K0JA 1YR1A 2GILA 1CUSA 4W5QA 5AM2A 2HPZA 2XBLA 3EB9A 4TL6A 2H5IA 5BYAA 3ESRA 4I9GA 4BVHA 1WV0A 4QG7A 2H2IA 5G0VA 4MI3A 3TVTA 3DOOA 3S1AA 4O59O 1RQ2A 1M34A 2B9EA 3LKBA 1WB9A 4PG8A 1B8UA 1XD9A 4LHEA 4O08A 1YL7A 1VBNA 4YDHB 1KAQA 4RHEA 3BMCA 4DM4A 3T1OA 3W9UA 1X39A 5BSTA 3U3JA 4ZHSA 1W7AA 1NI4A 3ACBA 3JD1A 3NOVA 3E22A 3U3MA 4EGAA 3AUUA 1BXRB 4Q18A 2J7KA 4E08A 4E21A 1NJ2A 2B36A 3TW8A 2A58A 1H65A 3SM9A 2IUTA 3DEKA 3O83A 1QMGA 3HY3A 1DIHA 1ZYUA 4KIFA 4OYYA 4PZ9A 3JQGA 1IHUA 4MHSA 4LF6B 1Y7LA 5DLEA 4ARUA 3ND8A 1QIJA 1WSBA 2OG1A 1CZRA 1E3IA 1WEKA 2XEDA 3GL9A 3HEMA 3LU1A 3MCWA 4P9NA 2WU3A 1ZICA 3IMEA 3PHCA 3ULKA 4ZYUA 1QUEA 3LUDA 3NEYA 4RZXA 2IPAB 4Z9BA 5JMOA 3HU2A 3CUTA 3HCCA 1Q7RA 4YDQA 1FNBA 3P2OA 5AJHA 4C0QC 1CNFA 1E64A 1ONNA 3LXMA 1XYGA 1Z3CA 4S12A 2ECKA 4YJGB 1T6NA 2LWIA 1LBEA 2BFAA 5FPYA 3VZSA 3F5SA 3KQVA 3NHZA 4JGIA 5ENZA 2HYIC 2OBMA 2AN4A 3NHSA 4RJLA 1J0BA 1S6YA 4OLJA 3P96A 1XDZA 3BHJA 3SSOA 3QPBA 5C1OA 3I1FA 4IIBA 2GN0A 3A2LA 4EO4A 1IY1A 3EMBA 2GZSA 4FFVA 4RL4A 5A4AA 4BNDA 2GFIA 2J5KA 2WJVA 3EH2A 2X0NA 2E1RA 3ZOZA 4KNVA 4RKEA 2X41A 4R6XA 2J59A 2EW8A 2HF8A 4E2XA 4F60A 3FMVA 1C30B 3I6IA 3DHYA 1IWOA 3EVNA 3HN7A 3BFXA 1NVEA 3LK7A 2WOJA 5LIPA 4X54A 2OCKA 3N7AA 3C1UA 4G0WA 1GVNB 2HA6A 1XROA 2ZJ0A 5FUBA 1DJOA 1EGVB 3K4PA 5JAOA 2HD4A 5DU2A 4BMSA 1A2QA 4KQKA 3CM0A 1A97A 1G20E 4X66B 1RWNA 2FPSA 3OOSA 3PRHA 2CL6X 1OREA 3W1VA 3KM0A 4KR3A 3H8WA 3VYTB 3R9IA 2M1ZA 3B82A 2PUTA 4NBLA 2R8BA 1E79A 2XQJA 4FSHA 4X1YA 3NC4A 1DT5A 3DOUA 1MC5A 3I8SA 2QIPA 2JZCA 4QSHA 3DAHA 2H31A 4EHJA 4DDVA 3T9AA 3KLBA 3NOOA 1KH1A 1V4BA 3I01A 1QNLA 3DL7A 5LUBA 5TMDA 4ONEA 3WRYC 4EK9A 1K27A 2O5VA 2IZ1A 3UO8B 821PA 2V4MA 2YWGA 1HRKA 2HHJA 4HB0A 4QEZA 1P39A 2H29A 2Q3HA 3FLEA 4XPZA 3LUKA 3TMKA 4JLBA 3PENA 3K8YA 1NX9A 4W82A 1UJ4A 2QD5A 3I09A 3LYAA 4M0CA 4NQRA 2QJFA 3G8YA 1GL6A 3BGOS 3RRXA 1LDEA 1PYOA 3PEEA 1NC3A 3DMTC 1M7GA 2G5PA 3O4IA 4WNAA 2JBHA 4AKGA 2QYTA 1NIJA 3EW9A 3FYCA 3HI6A 3Q0IA 3Q7SA 4XQ9A 2V4ZA 2PIAA 4QHTA 3T94A 2C97A 2QPTA 2YFHA 3PDIA 2N75A 1OTYA 4W9NC 2C3MA 2DETA 3GEIA 3F5MA 3LVRE 3M5CA 4Z0TA 3RS8A 1ZK0A 2D06A 1YA4A 2CLMB 1WTCA 2XRFA 4HFJA 3B3GA 4B6SA 1D4ZA 1OXVA 4XAQA 5BQ5A 4NULA 4UVEA 2GKOA 3GXBA 2WP0A 5TARA 3CE9A 1X8XA 2O23A 4JFAA 1A9SA 3RKSA 3SEFA 3LY8A 1DQPA 1VLMA 2J09A 2K87A 1B8OA 2FX2A 2W83A 1DU4A 4MLPA 1G1MA 1CZLA 4YQZA 1UK9A 1T2DA 4WN9A 3O4HA 4YCJA 2BR4A 4NIMA 3RS2A 5LP6F 4EG6A 2WJ6A 3UB2A 3NBKA 4LYGA 3CRNA 4Q9JA 5AFSA 1ZRHA 2RG7A 1ZSNA 2IYWA 3N8NA 3HE3A 3DWEX 3KQWA 2ZDHA 3OBIA 5AM4A 4UPVA 3ROZA 4AUNA 1FMCA 1ZNYA 1TRHA 1K3UB 2FPKA 3B1JA 1NQTA 2H2DA 5GJBA 1MHTA 4MPDA 4KVZA 4JJFA 2GEUA 2C78A 1BJKA 4G1CA 1XR3A 4LOAA 2O8NA 5ITZB 3LQ1A 2X0FA 2PS3A 1BVUA 2IYSA 3N53A 1FIUA 4HNGA 2D2EA 1JILA 1HFKA 2WT8A 3EOZA 3ZWWA 3DHWC 3ORQA 1P8AA 3F1KA 3MJTA 2AXEA 1JJ7A 3GZJA 5AI9A