3SX2A

Crystal structure of a putative 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium paratuberculosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
268
Chain Sequence
GPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASVPYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDELGRLDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPTLVKQGTGGSIVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNSIHPSGVETPMINNEFTREWLAKMAAATDGAMGNAMPVEVLAPEDVANAVAWLVSDQARYITGVTLPVDAGFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 3-ketoacyl-(acyl-carrier-protein) reductase
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium subsp. paratuberculosis
molecule tags Oxidoreductase
total genus 99
structure length 268
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sx2A00
4WOJA 1GDHA 3L4SO 4A26A 4A73A 1I3MA 4RLHA 1MFPA 3B1KA 2FZEA 5ES3A 4GSKA 1A9YA 5T57A 4BNTA 3GLQA 4LVUA 1IB6A 4BO3A 2AG8A 1CETA 2ZB3A 2QYTA 2P4QA 4XA8A 5AXDA 1IE3A 1H6DA 4BIIA 1LLQA 1WP4A 3I9NA 4GLOA 2NQ8A 1GADO 4R1SA 3H8VA 4XRGA 4PRLA 1V6AA 3OBBA 4BB5A 3JTMA 4N5MA 2NU6A 5CDYA 3TRIA 1N5DA 4UVIA 5G0TA 3OJ0A 1C0IA 3JQ9A 1P1FA 3VPFA 2PWZA 3H9QA 1YL7A 1DRUA 4RVDA 3HHPA 1Z7BA 2CDCA 3I5MA 4OSOA 4PGFA 4ZU3A 3V2HA 2GN9A 4K6FA 4K9DA 4E32A 4I9UA 5KJFA 4DIFA 2ZQYA 4I8XA 4NFHA 4CLOA 2XOXA 1B16A 1G0OA 3K92A 3S2FA 3ABIA 1J0XO 3MJEA 3ZW9A 1CJCA 1DBVO 1Z45A 4RZHA 4GPD1 2GN6A 3CTMA 1DC5A 1I01A 3WGHA 4AJOA 3U09A 4J16A 3QRWA 1ZEJA 2BGKA 3LT0A 3QVWA 4ND2A 3GOHA 2TMDA 2DPHA 1NQTA 2OP0A 3W6UA 1TT7A 4RDIA 4E5NA 1ISHA 1BDMA 1LA2A 4B3HA 1I24A 4R54A 2Y1CA 1JQBA 3ZHXA 2AXQA 5CEJA 2AEFA 4I9NA 3BTUA 1DLJA 4BKPA 3KV3O 1EFKA 4YRDA 5BSGA 5T5QA 1CF2O 5B4TA 2WE8A 4F6LA 5GMOA 1SBYA 4H3VA 1IHYA 1YBAA 3DHNA 4YT2A 5IJZA 4NPCA 3D3WA 2P2SA 4J43A 1O6ZA 1E7YA 3WXBA 1LNQA 3DL2A 4IQ0A 4RVGA 4D3DA 4IXTA 4O1MA 3S55A 1RJWA 1ZK4A 4D3FA 4PG5A 3QSGA 4FB5A 4GKVA 3JQFA 4AJPA 1PWXA 1M6WA 1HZJA 2X0NA 1R0LA 4EW6A 1PGQA 1NPYA 2ZK7A 4HY3A 2VNSA 3GMDA 3QA9A 5HA5A 2F00A 4MVJP 2B83A 5A4DA 2GZ1A 2ZIZA 1IUKA 4NU6A 3WMXA 3Q0EA 1U3TA 1YGYA 4CL3A 3BIOA 4OQYA 1GYRA 3SJ7A 4IS3A 1Q2XA 1HYGA 1K6IA 4MP3A 3W4KA 4FN4A 4KTVE 5KKCA 3CUKA 4G81A 4U0JA 2A4KA 4CMEA 4DRYA 4QXMA 4DQVA 2W8ZA 4EZBA 1KC3A 3OA0A 1PJTA 2Q46A 1KC1A 3WLFA 2VYVD 1WVGA 1EUDA 2DBZA 4CMHA 2D4AA 1KS9A 3D3EA 4UVHA 3AOGA 3MEQA 1YOVA 1HZZA 3DZIA 3QP9A 5AXBA 1QR6A 4Q3DA 1PQWA 4J7UA 1FDTA 2QRLA 1PJ4A 2C29D 3F47A 3Q6IA 1A71A 4WCFB 2D3TA 4GWGA 3K8ZA 5G4KA 5KTKA 4JX8A 2B5WA 2FMUA 3MOGA 2HMSA 2BGMA 1FJHA 1W73A 2GGSA 3C85A 4L75A 2X9VA 4Y6PA 4C7JA 1ONPA 4UUMA 4C7KA 4OHUA 1F17A 2WD7B 4E33A 1ISFA 1EQ2A 2WEKA 3AM4A 3OJFA 5I9LA 4IJKA 1F12A 2EGHA 1SOVA 4J90A 4U8GA 4DIBA 4B4OA 3DMTA 1NWHA 3NTQA 1PTJA 3GR6A 3NRCA 1AXGA 4OXKA 5HWSA 2YDXA 2O3RA 3NV9A 1UUFA 2NUAA 3HDHA 3WMWA 1BHSA 1P0FA 2X9NA 4TZTA 1AHHA 5EPOA 2R00A 2H9IA 4XJSA 2O2SA 3VKVA 5AQ1A 3ZWPA 3VZQA 4KOAA 1TXGA 2IXBA 1CRWG 2C82A 4BKUA 2V6FA 4WNIA 1JKFA 5T67A 4XYEA 1E7WA 1PS0A 4NQZA 1E5LA 1TVEA 3FWNA 3WX0A 4P4NA 2GF2A 4R1NA 1HL3A 1U8XX 4WGGA 3UN1A 2OZPA 1Q0LA 1DOHA 3PGJA 1AGNA 1HRDA 5K0ZA 3A14A 1HKUA 3F9IA 2HK7A 3TJRA 1OAAA 3UCFA 4BGEA 1LQUA 2NVWA 4JJGA 1KERA 3WGQA 5G0WA 3N7UA 2O48X 3F46A 5JC8A 3KYDB 1N9GB 1TI7A 1E7SA 1RYDA 4BNUA 4GX0A 3MJ4A 1PGPA 1IL0A 4MVJH 4AFNA 2CMDA 5CEEA 2HMVA 4D41A 4TVBA 4BNGA 4CM8B 4OOEA 4WKGA 3PVZA 2HQ1A 4OYRA 1YVEI 2FOIA 2VOJA 3VC7A 2OP1A 2Y67A 2Y68A 3W8FA 3E5MA 2JAHA 1NFQA 2GERA 3TNLA 3TWOA 4NJOA 1V3UA 3IIEA 2Y1GA 1E92A 4UEOA 3GGPA 1E3SA 5JCJD 3GNTA 3OIDA 4LK3A 4JIGA 2VHYA 3PJEA 2NU8A 4YJFA 3DQPA 1BMDA 3OQBA 4IDAA 3EUWA 1Y1PA 3EGOA 1HWYA 1HE2A 5CP8A 1YQGA 4GH5A 2PZKA 3ZNPA 1ZVMA 4CL8A 3QQPA 5K6AC 1DO8A 1OC4A 3FNFA 4BMSA 1VI2A 1R37A 4DLAA 4R4JA 4E6PA 3AUSA 3KTDA 4Q3BA 1E5QA 2HK9A 3ENNA 1LRKA 2Y1EA 4JROA 1L1FA 4NFYA 1T26A 1TT5B 1U5CA 2Q2VA 1E3WB 1OZAA 2ZYGA 1P31A 2HMUA 2EEZA 2QW8A 1ZSVA 4TVOA 3Q1LA 4EITA 4J49A 5AVOA 4F6CA 3K5PA 4PLHA 2EW2A 1GY8A 3VH1A 5FWNA 4R68A 1NFFA 4OGWA 4CLRB 3LC1O 3S2GA 4I1IA 3WBFA 1XQ1A 3JQGB 5KOIA 5DP2A 4B8ZA 3BMOB 2AMFA 3H7AA 4NHEA 4A03A 3HADA 2W90A 2E4AA 5JAMA 1HT0A 2OBNA 4N54A 3OQ6A 3RBXA 4AICA 4ZVVA 2VQ3A 2YYYA 1TB4A 1T2DA 4FGWA 4GLLA 3OETA 2P9EA 3TZHA 4R01A 5TRTA 1P33A 3P5SA 5JO9A 1F0YA 3PQDA 4J0EA 4WLFA 5A9SA 2J8ZA 1IPEA 3CE6A 4L73A 4BNWA 3AFNA 3DONA 1TLTA 2AW5A 4HFRA 4OXYA 4WCFC 4FS3A 5BSEA 2FSSA 2HJRA 2EKLA 1U28A 2X5OA 3RBVA 3KO8A 4J0FA 1NM5A 4KUGA 3ADOA 3GZNA 4YA6A 4TRRA 1WMAA 1AN9A 4ONEA 3GGOA 1A4IA 1QLJA 1Y8QB 1L7EA 3GVXA 3EVNA 1I2ZA 2PKRA 2EIHA 3OEWA 4D0RA 3RKRA 4OMUA 2IYPA 2GRAA 3GF4A 4D79A 1PJQA 4XEHA 4BO6A 2VTDA 4AJ1A 4IDEA 1SB9A 3RSHA 2D2IA 1I3NA 5B4VA 4B7XA 1FF9A 4M54A 3RUHA 4JBIA 2W2KA 4Q3EA 5BT9A 3Q2KA 3D7LA 3RC2A 5DOVA 3PYMA 4RVFA 4Y9DA 2OHXA 4R5MA 3GY0A 2WYWA 3CXRA 3DAGA 2AEJA 3HB5X 3OFSA 4UEKA 4AJ2A 4RPHA 4CLEA 3LLSA 2H63A 2Y0CA 4GQAA 2PY6A 3TZQA 4D3SA 2CF5A 3I83A 5HS4A 2CVQA 1VM6A 4W82A 4Y6RA 4URFA 5DNAA 4WASA 3HE3A 4UUNA 2FZWA 2VYNA 1QLHA 3ITDA 3SXPA 1DC6A 5ENVA 3KLMX 3FI9A 1OMOA 2DTEA 3L6EA 4E21A 2YQ5A 3I3OA 4BNNA 5IXYA 5TIIA 3BTVA 4DLLA 2JCXA 1VL0A 1UXIA 3AOEA 1X7HA 2VWPA 3OQ1A 5TSDA 1CYDA 1SPXA 1UP4A 4M87A 2VWQA 4J7CA 4JNKA 5L45A 3RUAA 4Z3DA 4GWKA 5FF9A 1NWCA 2C0CA 3A9WA 3GFGA 3RQSA 2EWMA 4CM6A 2A94A 3KUXA 4E5YA 1H5QA 5JDCA 1SO8A 1OBFO 4IJVA 1ZUD1 4YB8A 4E2WA 5F3RA 2EP7A 3CEAA 3JQ7B 1KEUA 4B3IA 4YWJA 3JQ8B 4OKNA 3AWDA 5FYDA 2O50A 3IQDB 3D5TA 3EVTA 5C7IO 4S3MA 3HFGA 1UP6A 1R15A 3DZKA 1VE9A 3VAZA 4CODB 5TX7A 3EZLA 2ILTA 2DU8A 2BELA 4MDHA 3NTRA 3AI1A 4JJIA 1ZMOA 1YONA 3LT2A 2EJVA 3WWYA 2GUGA 2VNAA 3EC7A 1VJTA 4BO9A 1HLPA 1SNYA 2EW8A 4KWIA 3VZRA 1GUFA 3GHYA 1NHGA 3C8MA 4GL4A 3DBHA 3ONDA 1XKQA 4R16A 3DXFA 1G0NA 3KRTA 2P91A 4XJTA 1UZLA 2IEBA 4FQ8A 5L4LA 4EUEA 2NQTA 3ZU2A 3BXXA 3K9QO 4M1QA 3CMCO 3UGKA 1KEPA 1KY5A 1Y9EA 4B3JA 2J6IA 1WAMA 1E6WA 2PGLA 4CMIA 3MZ0A 2VOEA 3DC2A 2JKVA 2RIRA 1MG0A 3D4PA 3G1UA 4LGVA 1K89A 3JD2A 4CM4B 3TF5A 3JV7A 2EP5A 1JN0A 5EERA 4R69A 3V1TC 1RM5A 3I9KA 2PR2A 4BNHA 4G5HA 1U1IA 4MIOA 2VUTA 1M2WA 4AJKA 4OXNA 1A9ZA 3NT2A 2R6JA 1J6UA 4NBUA 2FPGA 1I2BA 1JLLA 4RQUA 2XF8A 1A7AA 1IY8A 3KZVA 3RC1A 4OJNA 1G1AA 4GMGA 2Z1NA 2I5PO 4KQWA 4ND4A 5G0SA 1UAGA 3ULKA 4ESOA 1DSSG 1E3JA 1HF3A 3GGGA 1UXKA 1KVRA 5U1PA 3ZCXA 3HUDA 2PH3A 1LLCA 3ANNA 5EIOA 4J4TA 1V3VA 2W2LA 4BL5A 3VZSA 4CLDA 1PJSA 1VSVA 3B1JA 3OA2A 3QVXA 4NH4A 5C7LO 4PG6A 1P45A 3TOXA 5IG2A 3IL2A 1R0SA 3QWIA 4GX5A 3JQBC 4CMKA 3ASVA 4J2OA 2B36A 1QYXA 4XR4A 2QYSA 2YY7A 4PIVA 4LN1A 4YJGA 1PJCA 3ZWYA 2PD4A 4YVFA 2BGLA 5JNLA 3HQ4O 3SC4A 1LUAA 1PZEA 1ZJYA 3M6IA 1P0CA 5ADHA 1JKIA 1PU2A 1P74A 4U0KA 3GRPA 3A28A 4XQ9A 1QMGA 2JD0A 2OMEA 4J1TA 2ZYDA 4PLFA 1HYEA 3SVTA 3ZN2A 1OI7A 4J1SA 3VH3A 4RLSA 1V0JA 3E8XA 1FDWA 2C59A 3GZ4A 1CWUA 3I9OA 3ORFA 2I66A 5FI5A 3ROKA 4DC1A 3ZHZA 3KSZO 2HO5A 4JJFA 5G0VA 2E82A 3JYLA 4BO1A 1FXSA 1T2FA 1VKOA 2CVOA 3L9XA 1V35A 1WDKA 2ZATA 2G5CA 3RUDA 4M8SA 1EK5A 5J23A 3GFBA 3F1KA 4NI5A 2OBYA 1WMBA 1FMCA 1ONOA 3ZGYA 3M2TA 4OH1A 3H65A 3VH2A 3DEYX 4TRMA 5A3JA 2UUOA 1GYPA 2NNLD 2NVBA 1NTOA 1J5PA 4YRAA 3HN7A 4Y8VA 5JYDA 4PLVA 3BMCB 1GV1A 5JDIA 2RH8A 4MPDA 3AY7A 3WB9A 1MX3A 2Q2QA 4XYLA 1GEEA 4R3NA 2GD1O 3AK4A 1H6AA 5AYVA 1HE4A 4DMLA 1YWGO 4AG3A 3EW7A 4PZEA 4FFLA 1C0KA 1K0UA 3C3XA 3ZHBA 8LDHA 3NDRA 5A3VA 3TPCA 1N1GA 4R9RA 1S6YA 2Q99A 3S1LA 1PEDA 3U9LA 1BSVA 3QWFA 1M75A 5GY7A 1UAYA 2A9FA 3NDJA 1P1JA 4A5OA 3L77A 4I9HA 4LCEA 2C54A 3FBTA 3JCZA 1RWBA 4PFJA 4CMAA 3ONFA 2IXAA 1HDZA 2DKNA 1EUCA 1HLDA 3PXXA 1YDEA 2X5KO 3PPIA 3RUEA 1MXFA 2Z1MA 2YDYA 1LTHR 3EDMA 5KJ1A 2YFHA 2FPIA 1KYQA 4GX2A 3RC7A 4CM9A 1I5RA 4D44A 1P1RA 1PGNA 4XZ3A 5EINA 4IDCA 4NJMB 3D64A 1LQTA 4RF4A 1SCUA 2BFAA 4JXKA 1HSOA 1RPNA 2Y66A 4YQZA 4I5EA 4MKZA 5DBIA 5HS6A 3HWRA 4PLYA 2NLOA 2Q1WA 2RHCA 3HSKA 3AW9A 2PKQO 3M1LA 3F6YA 2EV9A 2HU2A 2I3AA 3WFIA 3H9UA 2B4RO 3LSYA 3F4BA 1CERA 4DMMA 3GAZA 4A10A 4XDYA 3UICA 1YL6A 3KVOA 2C7VA 1UXJA 3KEQA 3HB4X 1EE9A 1B0AA 4YJDA 4DIOA 5JFOA 3K96A 4TWRA 1EVJA 2X0JA 2Y99A 1RKXA 1LEHA 3DZFA 2G82A 4NK5A 1ISIA 3MOIA 3SX2A 5TC4A 2DUUA 1ULUA 4WE3A 1ZBQA 2O7SA 4FPXA 1QP8A 2GDZA 1GQYA 3KOUA 2Q4EA 3Q9UA 1I2CA 3L6OO 2VHXA 3OECA 1OFGA 1ADBA 4MINA 5DCUA 4XGKA 1E7MA 4BO0A 1EVZA 1AUPA 4PCVA 4Z9XA 3DTTA 3HDQA 4ZQBA 4DQXA 4BVAA 3G49A 4UVEA 1T4DA 2OGUA 1LDBA 4FFRA 4X54A 2PGJA 3LT4A 1YS4A 2VT3A 2IZ0A 4ZICA 3DTYA 4LMRA 1A5ZA 2QZZA 2YHIA 4FW8A 2DBRA 3GHHA 4AL4A 4DLBA 2JFGA 3LC7O 3GPIA 2E49A 2NVUA 1GCOA 4PG4A 4QECA 4BMVA 1R4NA 1UDAA 4CLOB 5ICMA 4NMHA 2HJSA 1H2HA 1IPFA 4Q3CA 2EGGA 2P5UA 5T8KC 3DWFA 4J4BA 5JW6A 1N2SA 1XEAA 5A9TA 3HN2A 1BXGA 5EL0A 2E6UX 3RIHA 1QSGA 3RFVA 1ONNA 2VHZA 4FIZA 4UEJA 1D1TA 3OIFA 3HDJA 4RV9A 1WZEA 1FDUA 3E5RA 1CQIA 5TJHA 3OJOA 4J9UE 1HDCA 4MVJE 1PL8A 4XKJA 4DYVA 3O38A 2NVUB 2ZYAA 2QRJA 4IUYA 1YJ8A 1P1HA 3BZUA 4WCDA 2Y0DA 4GSLA 4MKXA 4TMFA 2FSVA 1EBFA 1NNUA 3VKUA 3G17A 4EJ6A 4R1TA 1E3IA 5DT9A 4CMGA 3TFOA 2XPCA 3IKTA 1Z75A 1ZO8A 2IE0A 3D3WB 4M55A 4EEZA 4MO2A 4JQCA 4WNCA 2BI8A 3S2EA 5MDHA 4F46A 2DLDA 2ZTMA 1LSSA 3GN2A 2P9GA 3GEDA 4TZKA 4DC0A 2NTVA 1GAEO 1P1KA 2Q45A 4DBZA 2P4HX 3IJRA 3PHGA 4ZJUA 2VHWA 3ZHYA 4CQLA 3C1TA 3ANLA 1LSJA 4GGOA 1DPGA 3OHSX 5IN4A 1PJBA 2FPPA 3ZWAA 5F1PA 4ZRNA 1N8KA 4FFOA 1MC4A 1O95A 3WYCA 3VDRA 2WDZA 1DEHA 3WGIA 1LX6A 4AJNA 4DTIA 5GZ6A 1WWKA 4CUZA 4EBFA 1BW9A 1Q7GA 2IDZA 5IDWA 1GUZA 3PJFA 1ZXBA 1A27A 1BG6A 1IULA 4E2ZA 1NBOA 4FJ0A 4JBHA 3GNSA 4WLOA 4YT5A 3L6DA 3W6ZA 3OH8A 4YJHA 3SBOA 1YOVB 3E18A 4ND1A 3IP1A 2D59A 1B3RA 1U7TA 1X15A 4Q3NA 1Y5MA 3LZ6A 2PD6A 1E0DA 1DLIA 3CZMA 2Q49A 5G4KB 1IYZA 3Q2IA 4IXWA 4OAQA 3TZ6A 5B12A 2PNFA 1SAYA 2C2XA 3JD1A 3U3XA 3JYQA 4JGBA 3UAGA 5LDGA 1Q0HA 2UUPA 4TQGA 3Q9NA 3ANMA 3GUCA 5IFLA 1GPDG 1LRJA 3ZW8A 4E3ZA 1PZGA 3P2OA 4XYMA 4RJTA 4Q9NA 2RHRA 2NWQA 3PIDA 3L4BA 2DAPA 2ZB4A 2NACA 3AY3A 2DTDA 3AM3A 1F14A 1EZ4A 3DBLA 3QWHA 4PLTA 2C7GA 5L3ZA 1JWAB 4YR9A 2PZLA 4DA9A 4W9NA 2D8AA 4J4HA 2CZCA 1HEUA 2G17A 1X0XA 4MIYA 3NT5A 1V3TA 4R3WA 1DB3A 3T4EA 4FGSA 1E1KA 4LISA 2HAEA 1YDWA 2O7QA 3HZZA 4WLEA 4EUFA 1GCUA 4LRTB 3JQAA 2O3QA 4YYZA 2B69A 2LDXA 2YW9A 3NDIA 1JVBA 4J3FA 2Y1FA 3GG9A 2B5VA 4NBTA 4C4OA 3D5QA 4DVJA 2HKIA 2BMAA 4AJLA 1PJ2A 1UH5A 3DBLB 1HDOA 3D0OA 2FR0A 2QZ9A 4FR5A 4ND5A 2WYUA 4CM3A 2G76A 2J3HA 5F21A 1N92A 3AUUA 2IZZA 4UULA 4AJJA 2J5RA 3N58A 2Q4BA 3JQ9C 1AXEA 1FK8A 4EGFA 4CV3A 5AXAA 1LDNA 4BQRA 1GEGA 2V6BA 2X0RA 4ZA2A 3C7AA 3BMQA 3TFQA 3U4CA 1SEPA 3ETEA 3DFUA 1ISGA 1L7DA 1T4BA 3K6JA 4NBWA 5L40A 1ENOA 5L7YA 3E6AA 4HBGA 4GGPA 3INGA 4UREA 3KB6A 1NHWA 1SEVA 1XSEA 1PWZA 3DHEA 3G79A 3PWSA 4CV2A 4QT0A 3BTSA 5COQA 4MVJM 2C07A 1UJMA 4D46A 1X13A 2AE2A 4ALIA 1IOLA 3QWAA 4IIUA 4E12A 3PYXA 4YJFB 1BDBA 2Y0EA 3F1LA 1WDLA 3FR8A 2PTGA 3I1JA 1E77A 3O8QA 3BYZA 1Y81A 4RF2A 1QRRA 4QUKA 4PVDA 2I67A 4IMPA 1QYCA 4BGVA 3RUIA 5CDGA 4IMRA 3AFMA 5I7EA 4A0SA 1PGJA 2GN4A 4BNXA 1MP0A 2JFFA 2AQKA 1GZ3A 5HBRA 3M1AA 1LRLA 1DDOA 4FJ2A 1D3AA 4KZPA 3IKVA 2RCYA 3VZPA 4NK4A 2HCTA 2J5QA 2VUUA 2BFPA 4NBRA 1R12A 4B7CA 4BNJA 4WJZA 1KBZA 4DBVO 3JQDA 3TOZA 1XG5A 1Y9AA 1MXHA 4UUPA 5KVQA 3JYOA 2FP4A 5TJ9A 2YV3A 1H0KA 1JDJA 1NFRA 4J1NA 2DPGA 4KTTE 5A05A 4LSWA 3PQEA 1P9LA 2Q50A 5JCXA 3JQFC 1ZKMA 2A92A 3JYNA 1DHTA 3IC5A 4IIVA 2NM0A 3WG9A 3JD0A 3R1IA 4NNJA 4RPJA 1GUYA 2QRKA 3M2PA 2B4TO 5CDSA 5DBGA 5MGBA 3ETGA 3F4LA 3AU9A 1JW9B 2D1YA 1ENYA 4R41A 3QHAA 1YBVA 2ZTVA 4ZQGA 3DDNA 4QFCA 1FDSA 3I9MA 1KOLA 2BF7A 3OM9A 5T6BA 1TEHA 1YRLA 3FSRA 5JLAA 5ILGA 1VJ1A 3KYBA 3SLGA 4CMEC 4AJ4A 4ROSA 2TMGA 4L8VA 1ZK1A 4XGNA 2VWGA 3MJCA 1DIBA 1BVUA 4J91A 2O23A 5U4QA 1DAOA 1EEHA 1JVSA 3JQEA 4EDFA 1NXQA 1JAYA 5A9SB 2Q1UA 4P38A 2XXBA 3WJAA 1VL8A 5FFFA 5CPFA 1YH3A 2O3JA 3RJ9A 2B0JA 1GYQA 2JFHA 3QVTA 4MVJF 4NFSA 4CQMA 3KETA 4L4RA 3DZGA 3KYCA 2CVZA 4E13A 2B37A 3GC6A 2ZTLA 1KY4A 1U8FO 3GZNB 3OEYA 2H6EA 3DZBA 3NX4A 3DAPA 2QX7A 3VDQA 4CLXA 4QEDA 9LDTA 1NQ5A 2O3UA 3K2EA 1Z6ZA 3DMTC 1QYDA 4MKRA 3SJUA 2X7HA 5DN9A 1ZK0A 4IGFA 2NU9A 4DXHA 3FD8A 1J4AA 1YB5A 4P8RA 3KEOA 3K73O 2X4GA 4I5GA 3RFXA 1H6BA 3PFWO 3ZWXA 1NVGA 4GI2A 2W2KB 4ALMA 4B4WA 2CY0A 2R00C 4J7XA 4OO3A 3FCOA 1EVIA 1R16A 5ER6A 4DREA 3JD3A 2VYND 1BVRA 1YQDA 5F5LA 2QQ5A 5I7VA 4PLZA 1D4FA 3DFZA 1QYVA 3GQVA 1KVUA 1JKJA 3LC2O 4AJIA 1JAXA 4RPGA 1DXYA 3VHRA 3FHLA 3INTA 1HXHA 5L95A 1HDYA 4I5FA 4F45A 2NADA 5JY1A 2JHFA 4EEXA 1J49A 3GVCA 4WLVA 1GFSA 1NPTO 3MJSA 3WGTA 3RCBA 1C1XA 1T2AA 3JSAA 4J1QA 4BMNA 1Y8RA 1MLDA 5L4SA 1GU7A 3CSDA 5F1KA 3W4IA 5A04A 2HK8A 3O03A 3I4FA 5I8WA 4W7IA 1ISJA 3CPSA 5EMHA 5TQVA 4EJMA 2Q2WA 1LDEA 5B1YA 5KJ6A 1HTBA 3RUCA 2A35A 1MV8A 2OOSA 2VWHA 4U7WA 5L9AA 4TKMA 4XB1A 3EY4A 5I8ZA 5IZCA 1VSUA 1ZXLA 3HDYA 2GNAA 3X2EA 1KVTA 3GN1A 5A9RA 3I6IA 3ON5A 5L51A 3ZV5A 4BS9A 3G0OA 5ER9A 5L7WA 4GKBA 4E31A 1XELA 5A5EA 3TZKA 3PYLA 1DFIA 3FWZA 1ADFA 4HNGA 4P22A 4JLWA 3JQ6A 4XB2A 1VL6A 3PHIA 3VH4A 1YB4A 2WWRA 4CR7A 5GZ1A 1GL3A 3QVSA 4PLPA 3BMNA 2AQ8A 2OORA 2C2YA 2DTXA 3FN4A 4IBOA 4FBGA 3C24A 3DBHB 2B4QA 2YZ7A 5CAEA 1HDRA 3OF2A 1LBEA 2HUNA 2UVDA 1Q7CA 1T2CA 4EI2A 4IPTA 1QORA 2I65A 3IUPA 1DC4A 4HFNA 4TROA 1QXSA 3E03A 3GAFA 1D8AA 4ZQHA 2OXIA 1U2GA 4RL6A 1D1SA 4YAEA 4CMIB 4QO8A 1B3BA 4B7UA 4PZCA 5I7SA 9LDBA 3PHLA 4B4UA 3LYLA 4FOOA 3WYEA 3UF0A 2O3TA 4K26A 3GH3A 2PA3A 1C1DA 1EMDA 1UP7A 2ZB8A 4OKIA 3RVDA 4RDHA 2VN8A 5JAIA 5EJ2A 2VRBA 3EK2A 5KIAA 5THKA 2BHLA 4BNIA 3I52A 3PK0A 3DZHA 3WIEA 1NQOA 3E9NA 1GTMA 1B14A 1RYEA 3WOHA 3CH6A 2AEMA 2ZCUA 2P68A 2GR9A 3K2BA 4BGUA 1XQ6A 3VVCA 3VPXA 1RM4A 3PP8A 4RORA 4ALKA 2W2LD 1BXKA 3STHA 1T2EA 4HFMA 1SC6A 4ALJA 3V8BA 4L74A 1EDZA 2HSDA 3U4HA 4YBZA 3BHJA 2WJPA 1XR3A 3FR7A 2ZB7A 4WUVA 1F06A 4NU5A 5I9NA 2DQ4A 4W99A 4CM7A 4RVHA 4BNKA 4RVUA 1Q0QA 1VKNA 1EE2A 4YJGB 3ZWOA 1BXZA 5A02A 4YCAA 3JYPA 3CKYA 1NVMB 1UXHA 1AHIA 4FFMA 1ZW1A 4BNZA 5A06A 1EQUA 4NBVA 5JAQA 4YAIA 4KWHA 1M67A 1PIWA 2X0IA 2DFVA 4Y6SA 1O89A 3DBRA 3ZU3A 2WD8A 3DB2A 4FFNA 4QTZA 1H2BA 1XIVA 3KBOA 4XIYA 5FI3A 1B2LA 3COSA 2D5AA 1O8CA 4R9SA 1U4SA 4D43A 1KEWA 4CM1A 1RM0A 3O26A 2Z5LA 2W4QA 1ULSA 2D5CA 3IUSA 4LRSB 3E9QA 1DHRA 2H5LA 3GRKA 3PQFA 4CMBA 1PZHA 3S8MA 3WNVA 1LXCA 4BO8A 3QWBA 4MP8A 5BNTA 4OSPA 3G3EA 4JCOA 3UCEA 1Y7TA 4O6VA 4WK6A 1WLYA 1WDMA 3ZNQA 3GA0A 3TL2A 4KDFA 1Z73A 4IDGA 4BB6A 2WM3A 2BH9A 1PZFA 1X7GA 1U3WA 1C3VA 3AJRA 3DO5A 5A5FA 3V2GA 1E1LA 2V7PA 4YDRA 1R4MA 5K9ZA 4KQXA 4RF3A 4IJWA 2X22A 3NKLA 3RROA 4AJEA 2BFMA 5CG2A 4CLHA 2BFOA 2WE7A 4R5HA 4MIEA 4Z9YA 1Z82A 2JD2A 3U49A 1PX0A 5JAZA 1U7HA 2HRZA 4KP7A 5U9CA 5JDCC 4CR8A 3TL3A 1W4ZA 4DWVA 1GV0A 4YT4A 1YQXA 5JO0A 3E48A 4BKOA 3PZRA 1V9LA 4CV1A 3WSVA 4Z3KA 4XYBA 4DUPA 2DFDA 5C5IA 2HLPA 1QKIA 1LI4A 2DBQA 4J2HA 1N7GA 1WW8A 2ZKLA 5EQFA 3MCVA 3UUWA 2GASA 4CM9D 1UDCA 3KSDO 2VZ9A 2PKQP 3WGZA 2X23A 3WYBA 4B4VA 2JL1A 1Q1NA 2YFQA 4IQGA 4N5LA 4NR0A 5BQFA 4HFJA 3QVOA 3QY9A 5COBA 3LT1A 1B26A 4R51A 2LDBA 3FNGA 2P5YA 5KVSA 2WSBA 3CMMA 4KUEA 1U2DA 4MP6A 3NJ8A 2E48A 3T7EA 3LU1A 3NUGA 4L4XA 4BKRA 2DT5A 3ZWMA 5IDQA 4IDFA 1LDYA 4XRRA 3X2FA 1H93A 4MJLA 4O0LA 3WQSB 5L7TA 3H2ZA 2XAAA 5DULA 3WLEA 2RBEA 1PS9A 3A1NA 4H16A 4P4GA 2NTNA 5GZ3A 2CUKA 3O4RA 4Q39A 1H9BA 4RGBA 1PS8A 3EZYA 4D7AA 3V5NA 1EDOA 3CIFA 3AI2A 3IJPA 4GMFA 4ND3A 2PFGA 2CF6A 1PJ3A 3K30A 3BHMA 4PLCA 4YTEA 4PG8A 1SOWA 3H4VA 1ZZEA 2NSDA 3FTNA 5K6AA 2GZ2A 1XYGA 3NT4A 4FJ1A 2F1KA 1LDMA 1ZEMA 1XDWA 3C7DB 4YAJA 2GCGA 3ASUA 3UKOA 3KXDA 2SCUA 3MTGA 4ID9A 5BNIA 1WZIA 1U3UA 2X86A 1C14A 2JAPA 3EYWA 4W7HA 4D45A 4Z0PA 4EUHA 3NGLA 3LK7A 4HXYA 4RO0A 2Y1DA 5DCYA 1NR7A 1T1SA 1HYHA 4WLNA 3OSUA 2EJWA 3C1AA 1LSUA 1GZ6A 2AQIA 2FWMX 4BNFA 3LQFA 4IQ8A 2YHIB 1LLUA 5DZSA 3GK3A 3I9LA 4GAEA 5HTOA 4M89A 1R4NB 3WQRA 2X1HA 3RD5A 3GPDG 4INAA 5TLSA 2CDAA 1ZK2A 3H6KA 3KSUA 1IZ9A 3K31A 3PJGA 1X7DA 1MB4A 5IDXA 1K3TA 2Q3EA 4MVJG 5I9MA 4BO2A 4D0SA 2XXJA 3B20A 1M76A 1W0CA 1BXGB 5G4LA 2R2GA 4TRNA 3JD4A 3NEPX 1LC3A 3L0DA 4JBGA 3ROMA 1NASA 1PGOA 3RBZA 4NZ9A 3VPHA 1PQPA 3GDGA 3MTJA 3WR5A 1GQQA 4E5PA 2J3IA 2IZ1A 4WOKA 5ILOA 4IDDA 1NAIA 1NQAO 4QQRA 4IJUA 2Y93A 3TSCA 1ENZA 3PDJA 2VYVA 2O3SA 3FRJA 2PV7A 3E9MA 4FCCA 3PZBA 3RJ5A 3UXYA 2CDBA 2X58A 4WCFA 4YPOA 5BSFA 5JYEA 1Q7BA 1WXDA 4BUCA 1QG6A 3IDSA 3ONEA 3RASA 4U6SA 5KWEA 4FFPA 1W6UA 1D7OA 4Y98A 5CFZA 1UXGA 1ZSNA 3HG7A 2VCYA 2WD7A 1ARZA 1K5HA 2FHSA 2FR8A 8ADHA 4HWKA 5JMWA 3F5QA 3LF2A 3SLKA 5IF3A 3WGGA 4CQLB 3P19A 3W1VA 4CUKA 5KNLA 3QW2A 5JDIC 5JC1A 4RZIA 3IS3A 3WWZA 1NVTA 5DP1A 4D42A 1O9BA 3B1FA 3I9JA 4LVCA 5AXCA 1XA0A 2GYYA 3UFXA 5EN4A 4DYDA 1ZFNA 2X5JO 3VTZA 5IAAA 1JWBB 4ZQEA 4J6FA 2UYYA 1O5IA 1DIAA 1KVQA 1BW9B 2BD0A 1A4UA 2YQ4A 1PL7A 3L9WA 4BKQA 2FRDA 3AM5A 3WTBA 1ADCA 3LF1A 1VRWA 4R1UA 1ML3A 5B4UA 4DQUA 4J9VA 4L9RA 4Z0TA 3FPLA 4RCVA 1DFHA 1NX6A 5KJEA 3RUFA 4E30A 7MDHA 4YJHB 1HDGO 5ITVA 3WTCA 4O63O 4CV0A 2DC1A 3PEFA 3OIGA 4IS2A 5KJCA 4ZHSA 4O59O 4RPKA 5C3MA 2W98A 5CG1A 2Q1SA 4UVGA 2B35A 4HP8A 4GVXA 3U4DA 2PD3A 3RU9A 3PWZA 5BNFA 2QG4A 4QX6A 1I32A 2YHUA 1X0VA 3KYDA 1N9GA 4KUHA 2QHXA 1GZ4A 1EBUA 4KMSA 3GDFA 5DDIP 4GVLA 4UVDA 3UCXA 3NGXA 2Q1TA 5CDTA 3DAFA 3U5TA 4CM8A 1I0ZA 2GPTA 2J3JA 3NTOA 3DR3A 3QJ5A 2P9CA 4OIMA 3ZH2A 3QLJA 1VC2A 1MG5A 2GZ3A 3BA1A 5H81A 1O94A 3H9JA 1ZIDA 4ZD6A 1A7KA 2BKAA 4HV4A 1GD1O 4MVJA 2Y1OA 2E37A 1O0SA 3H5RA 1U4OA 3WSWA 5HRUA 1BGVA 1DRWA 1I10A 1SB8A 3D4OA 4PVCA 3U0BA 4A27A 4YAGA 5F1OA 2EF1A 5A1TA 1HETA 4NDNE 2J3KA 3JQAD 2DM6A 4CMCA 4DL9A 3BAZA 3FNEA 3T4XA 1M66A 4E2YA 2IYOA 3WFJA 3GVPA 5JCJA 3W8EA 4OL9A 2JHGA 4CUJA 1E7QA 1U5AA 4MVJD 3CZRA 3PWKA 3JQAB 1XU9A 3B70A 3WGYA 4ZGWA 4IDBA 1MA0A 3DOJA 1QV7A 2EHDA 3ROPA 4BNLA 3H9GA 2O4UX 3PTZA 3ROQA 1DIHA 3VPGA 2CFCA 1TT5A 3FPCA 5TF4A 1V8BA 3PI7A 1RM3A 1E3WA 4QO7A 4WPGA 3V1YA 4BOYA 5TS3A 1LSOA 3VTFA 1GR0A 1N7HA 1ADGA 1DIGA 4JN6B 3T7CA 5JMPA 1C0LA 1JU9A 3PJDA 1DRVA 2AHRA 2ZJ0A 4AJHA 3BMQB 3QE3A 4M49A 1F8FA 2HMWA 3GT0A 2D0IA 1B8UA 1ZSYA 4PZDA 4LSMA 4CLRA 2ZTUA 4GBJA 4K6CA 1XLTA 1KIFA 4CPDA 3RC9A 4HUJA 3ETDA 3JQGA 1CIVA 3BMOA 1WPQA 5TGDA 1CDOA 3O9ZA 4HKTA 4WEQA 4ZQFA 4XX0A 3FF4A 2EG9A 3NYWA 1K2WA 1XGKA 5G0UA 3R0IA 2POQX 5CEFA 3RU7A 1R0KA 2WMDA 1E6UA 3U4IA 3H3FA 3O8QB 1NAHA 3MJVA 5IDYA 1YE3A 2JJYA 3UOGA 1E1NA 4XGIA 4IM7A 1H94A 3WGOA 3DZJA 1I33A 2BI7A 1UR5A 2EKPA 3A4VA 6LDHA 1PL6A 1T1RA 3WJ7A 2Y05A 1KEVA 4WLUA 3IMFA 3JQBA 2VHVA 4FC6A 2NTJA 4CMJA 2GO1A 1ZH8A 3I4CA 3TQHA 3H5AA 2PGDA 1Y8QA 1MUUA 5KVVA 3GMSA 3GVHA 2PZMA 2V65A 4EJ0A 4TKLA 2AG5A 4HX5A 5H83A 4B79A 3AI3A 4XQGA 4XR9A 1XWFA 2G0TA 4WECA 5DCWA 2YJZA 3GDOA 5JPIA 3GUYA 1DJNA 3ICCA 3OJLA 3UVEA 2C5AA 2YV2A 1NYTA 6ADHA 4BNMA 1DC3A 1MC5A 1IHXA 4BGIA 2VZ8A 1N1EA 4BO4A 3H5NA 2RH4A 4G65A 2GN8A 1ZCJA 2HDHA 1YL5A 1B8VA 4L0QA 3WBBA 3PRJA 5CHEA 2PH5A 4M86A 5IXSA 3E1KA 5LDHA 4LMPA 2CNBA 1DAPA 4RPLA 3ZWCA 3KLPX 2YUTA 3AUAA 1YO6A 1WNTA 1I36A 2DBVO 2VRCA 3H2SA 1B7GO 3ZNOA 2X6TA 4II3A 3ZNNA 3L07A 4CQMD 5H82A 3RFTA 3IP3A 2I99A 4E4YA 1XHLA 3WICA 3GEGA 1I3KA 3C1OA 1LDGA 1K6XA 2O2YA 3PGXA 4IY1A 4O5OA 5JE8A 4CQMB 3RAJA 3KYCB 4NIMA 3H3JA 2VRCD 1B15A 1R66A 1S7CA 1I3LA 4W4TA 3W8DA 4CR6A 2EKQA 3WDSA 1Z7EA 2JCYA 1A72A 4FC7A 4YRBA 4G2NA 2VTEA 1HSZA 5FEUA 4MOWA 4XIJA 1CQJA 5I7FA 2OFPA 3BTOA 2AE1A 3D1LA 4H15A 3ZWWA 4E0BA 3L4BC 2CSUA 3JQ7A 5EESA 3VOSA 4E2XA 3JQ8A 4JP2A 3MWEB 2V6MA 2C5EA 2NU7A 1AE1A 4DPLA 4N5NA 2UV8A 3ZWVA 2J5KA 1X14A 1F8GA 3GEMA 3OICA 4W9NC 4YEDA 4Z0HO 4Z9FA 3PDUA 3D4NA 3PIIA 4H7PA 4UUOA 3OMLA 1EUZA 5EQDA 1E3EA 1ZJZA 1ORRA 5JS6A 1E1MA 4S1VA 2O4CA 4CM5A 3PFFA 1DJQA 4A7PA 2I76A 4OM8A 1GQ2A 3CINA 4RQTA 3ZI0A 1HE5A 1YXMA 3FNHA 2OUIA 5C37A 2RAFA 1C1XB 5JXWA 1DFGA 1GPJA 2YV1A 3AU8A 1PR3A 1Y8RB 1E3LA 3I6QA 3ZDFA 4BO7A 1U9JA 4JP3A 4BV8A 3EAGA 3B6ZA 1ENPA 1FDVA 3RI3A 1BWSA 5THQA 4CM4A 5T64A 4UAGA 1NR1A 2UAGA 3LDHA 1KVSA 1P77A 3WS7A 5ITWA 3JQCA 2Z95A 3ICPA 1B8PA 3TZCA 4L4SA 3PLRA 4I5DA 4RF5A 1UZNA 3DOOA 2VZ0A 3WNQA 3PLNA 1JA9A 3QIVA 5L53A 5DF1A 1E6EA 2ZJ1A 1ZNQO 4YAKA 5HM8A 1ISMA 3FTPA 3TDKA 3UH1A 4F3YA 5LC1A 1BTOA 3INRA 1EK6A 3VPSA 3NAQA 4BHTA 2ZQZA 2HMTA 3ITKA 3LLVA 2EXXA 4HNHA 1C0PA 4KDEA 4OOFA 4TRJA 5COAA 1PR9A 3ZV6A 3R6DA 4ALNA 5A03A 4IZHA 3OJEA 2PK3A 3BMNB 4ILKA 4A2CA 3PHJA 4II2A 2V6GA 3UHAA 1YBMA 3W4JA 2NV6A 1OC2A 3R3SA 3IAHA 4BNVA 3UW3A 4E5MA 4DPMA 2X9GA 4XQCA 4MVJI 5DBFA 4YXFA 4XYGA 4IZIA 1LU9A 3P7MA 2ET6A 1UDBA 2X8LA 2GLXA 5T8KA 3FBGA 4XWYA 3ZU4A 4IINA 3R3JA 4L76A 4B8WA 1JTVA 1HDXA 1YB1A 1R6DA 3ENKA 5AOVA 5F5NA 3Q11A 2DVMA 1P1IA 4P4LA 1Z74A 4JK3A 3EHEA 2JD1A 4DGSA 3VVBA 5L4NA 3RWBA 5TT0A 5G2OA 5JY6A 3F3SA 1C1DB 4NG5A 4BV9A 1U3VA 4OQZA 1P3DA 2OO5A 3ZU5A 5IZ4A 2PLAA 1LC0A 1LLDA 1OOEA 3HFSA 5KKAA 3KHUA 4AVYA 4BQPA 3DHYA 2I6TA 5LCXA 5ICSA 2I9PA 4ZN6A 3HNPA 3SC6A 4Y67A 5JBIA 3U62A 2BLLA 5KCZA 2HRBA 3ZWNA 1YJQA 2IRWA 3EMKA 1EVYA 1MGOA 1M6HA 3ZZNA 4HADA 5B37A 3PHHA 4N18A 2G1UA 1T24A 3HJAA 1PJLA 3AUTA 3I23A 4RVSA 4N7RA 4PRKA 4Q3AA 4PLWA 3QV1A 1XCBA 2WTBA 2AQHA 1T25A 4FD3A 2I3GA 3IOYA 3BMCA 1X1EA 1X1TA 1TA4A 1YKFA 1SMKA 1PSDA 2C20A 5BR7A 5BSHA 5CDUA 1NPDA 4QFDA 1W8DA 4DPKA 1G6KA 3MWDB 3WQQA 1NP3A 1E7RA 1QV6A 1ZMTA 2UDPA 4QSMA 2EERA 5IN5A 4U5QA 4ALLA 2AA3A 5CPBA 1MFZA 4YT8A 2WYVA 5KVCA 4BNYA 3ZV3A 1SZJG 2GSDA 4Z6KA 3DBRB 3F5SA 5JSFA 2CD9A 2FR1A 1P44A 2QIOA 2FY8A 3Q3CA 1ZK3A 4GX1A 1VJ0A 3DOCA 5TT1A 1H6CA 3V1UA 2IEDA 4YQYA 1VLLA 2IODA 4ITUA 4XDZA 1KETA 4YACA 1PQUA 4CJXA 4U6QA 1K6JA 2VUSA 3BHIA 3H9EO 4XCVA 4ZRMA 4E5KA 3A06A 2JCVA 3AOEC 3SEFA 3TN7A 1Y6JA 1DIRA 2H1SA 5ENDA 1CEQA 1LJ8A 3KM0A 3LVFO 3OP4A 2OL4A 2FN7A 3DBVO 3ST7A 5C7OO 1H9AA 1QYWA 3V2UA 4PG7A 4LCJA 3ADPA 4EYEA 1UZMA 1VPDA 3GNQA 4LW8A 3AY6A 4NJMA 1HE3A 3MJTA 1EFLA 1I30A 3E82A 4K28A 4XD2A 5TNXA 3GG2A 3ZV4A 4FSHA 3RKUA 3C7CB 2PZJA 4K1LA 1R4MB 1Y5RA 1XU7A 4IGEA 3P2YA 3G1TA 2BRUA 3NJ4A 3N74A 3DMYA 1ID1A 3GVIA 3ZWBA 1BRMA 4TSKA 4FOSA 4BO5A 4I08A 7ADHA 1IZ0A 3WIDA 2VT2A 4W6ZA 2DUWA 4FDAA 4PLGA 3S2IA 4WEOA 2ZCVA 1I8TA 5DOZA 5IZCC 4PN3A 4XQEA
chains in the Genus database with same CATH superfamily
5J1TB 4QPCA 2NOAA 3F78A 1JPVA 1F2UA 2LZ0A 2ZBDA 2UYQA 2BCJQ 3QFHA 4QQNA 5ES3A 3ROGA 3TW6A 2PKWA 3EVBA 3UK6A 4UASA 5K8JB 2RGDA 1WXFA 2CVHA 2IPNA 3LKZA 1F51E 2CLMB 1B42A 1PYGA 2GESA 4RXTA 3K9CA 4ZC8A 1CETA 3ZXUB 5KZMB 1Q0UA 3HP7A 5AXDA 3SHQA 3C16C 1H6DA 4BIIA 1Z7GA 5ALFA 4QTYA 4NE7A 3ZQKA 3KWLA 3A31A 3ESXA 4PXAA 3HFRA 3LDUA 3NANA 4BC1A 1NLFA 1V6AA 3RNLA 4BB5A 3JTMA 1N78A 2NU6A 4UAVA 2P67A 3QEKA 1OB2A 1EWKA 3K4QA 5G0TA 3EASA 3X1DA 3OJ0A 3JQ9A 5HILA 1P1FA 4OI1A 4DN6A 1QAOA 2C7OA 3H9QA 1P2UA 3ED5A 4O4HF 1Z7BA 3PT9A 4K9DA 4O4JA 3BICA 4I9UA 2Z2KA 5AJVB 4DIFA 3G2IA 1T8SA 5JSYA 3SEZA 1GPYA 4CLOA 3OZAA 4G24A 1QOZA 1G0OA 2JFOA 4FCWA 3OC0A 5M34A 3K92A 4R3UC 3U56A 3AIMA 3S2FA 1J0XO 5J5CA 1SQ5A 2JS7A 4S1PA 1DUIA 3ZW9A 1JF8A 3VC2A 2P79A 4PQYA 3R7SA 1K7SN 3BCUA 3AGPA 1CVIA 2VDVE 3RFFA 4B6QA 3C8UA 3P9SA 3R5FA 2G07A 1L6RA 3QVWA 4ND2A 3TMAA 4P7KA 3TPFA 4YRKA 2MJLA 3KOWA 3MGKA 3G2MA 2C2MA 2KQUA 3NFRA 1NUTA 1ISHA 4RDIA 4CNBA 4E5NA 2DPLA 1GGVA 3A10A 1CZHA 2Q6IA 2ONCA 3VO1A 3HSSA 4JENA 1Z2CA 2ZZMA 1WV1A 5CLGA 2WU0A 4MI6A 4LI0A 4DTCA 3N86A 3AJEA 2GPWA 1TF5A 2R2AA 1W94A 5BSGA 5B4TA 1C9EA 2PJZA 5DYIA 5GMOA 3HV0A 1SBYA 3V2IA 2QJOA 1IHYA 4QOSA 4U2BA 1DKQA 3NBFA 5IJZA 3IURA 3UJ3X 1FVXA 4NPCA 3D3WA 3DLPX 4HS9A 2XUGA 2P6MA 4MWOA 4RAQA 4ENPA 2E89A 1O6ZA 4J43A 4KGDA 5LYJA 2WJZB 2H8GA 2VKTA 4AMVA 2P5TB 2XE4A 1GGHA 3QXJA 3ZLBA 1CY4A 2REXB 3M3DA 5M3BA 4D3DA 4E2FA 4L22A 4OLFA 1AKYA 3C87A 3P9YA 4GPEA 1RJWA 4JAVC 4JEHA 4UZEA 4X5OA 3SS7X 1ZK4A 5ALGA 5GOZA 3TLEA 3RIMA 3G6WA 3ZCSA 5KYWB 3R7DA 5LP1A 1GP2A 1V1MB 1N2CE 3FZYA 1HOTA 2B61A 2WMYA 4I81A 1L8XA 1JEQB 1JTFA 2X0NA 3R20A 4EW6A 3EMBA 3AF4A 4L95C 1NPYA 2ZK7A 4HWGA 5K51A 3IUBA 5D3QA 4OHPA 2BHRA 3D3KA 1XCJA 4MVJP 1BX1A 4DSTA 5A4DA 2GZ1A 2JA1A 1CS0B 4NU6A 1J07A 5DN6D 1LS1A 3Q0EA 1W7AA 3WQHA 2WG0A 4CL3A 4OX9Y 4DE5A 1N6RA 5IX8A 1KIAA 1CY8A 4QOJA 5CB4A 3W4KA 3MT9A 3LP6A 5LLTA 2VK8A 2IITA 4YMGA 1JNYA 1VXOA 2W8ZA 2YTZA 1GTG1 4EZBA 1KC3A 1J1IA 4X63A 1PJTA 1K9VF 4BB9A 2DBZA 2ODPA 2P0AA 4ZYUA 2GILA 3D3EA 3KKZA 2HSGA 3KT6A 1F8YA 3DZIA 4MTCA 3ZLJA 2ZROA 1GL7A 2ROQA 1PQWA 2X15A 3NI2A 4J7UA 3W34A 5K8CA 1DBPA 2GXAA 1M8PA 3Q6IA 4MWBA 1A71A 4OU4A 2QNIA 1PVVA 4M83A 1EM6A 1MB9A 2CV0A 2FMUA 3MOGA 4N7MA 4CRWB 5CTJA 2ORIA 1XEWX 2GGSA 4CGYA 3A4LA 4OB8A 2MOKA 3NNNA 1JAHA 3FMOB 3WLQA 1CR6A 1N3BA 4Y6PA 5DLQC 3T3PB 4E33A 2B7CA 1NKSA 3L84A 4RM2A 3U3RA 1QRAA 2WEKA 5A3QA 5I9LA 5L3VA 3NM4A 4IQ4A 4J90A 5CA0A 1P4JA 3CB2A 4U8GA 4DIBA 2FW6A 4ZO7A 4B4OA 1P7WA 4IIEA 5DNCA 5HZHA 3VJRA 4HNQA 2ZYUX 4OXKA 1EWVA 1JECA 5KOJA 3HKBA 4N0DA 4K87A 4X92A 3DW3X 2AW3A 5I4CA 3DOFA 2VZLA 4O3FA 3OE7A 2W58A 1U99A 4QEKA 3WBKA 1RP7A 4MRVA 5EXEA 4FMBB 4JYCA 2QX8A 4QC2A 2PU5A 3BD6A 5AJUA 3S1AA 1KTIA 2Z3WA 4RBNA 3CY6A 2O2SA 3PHCA 4S1WA 2YZNA 3A4IA 2AOVA 4GYYA 4KOAA 4YUXA 1M2JA 1VGRA 1CRWG 1M0TA 2C82A 4HEQA 5KYNA 2IPOA 1C4XA 4NPAA 2IZ5A 2ZAGA 1D6JA 1JKFA 1CUZA 5AVXA 2VJYA 1PS0A 4C5CA 4ETIA 3PC3A 4KRXA 4P4NA 4UJ3A 1YJ5A 4DV4B 1HL3A 5E1OA 1Z2OX 4O08A 3ORQA 3Q72A 2C1XA 5H02A 2OZPA 1Q0LA 4X6YA 3MUOA 1OIXA 1DOHA 4PCUA 1AGNA 1XMOB 3UMCA 3H3XA 4CXMA 4OP3A 4ABTA 2JGKA 2KI5A 4HB0A 1V4VA 2Q5EA 2VA9A 4YO8A 1C81A 1TQDA 2IXEA 4BGEA 1CG6A 1LQUA 3WE7A 1LTQA 1P5JA 1JPJA 5D3KA 3EXAA 2I4MA 1QZZA 3A2MA 4UNSA 3N7UA 5G0WA 5LYJF 1IAQA 1T3GA 2X5NA 3KYDB 4ENUA 1XT6A 4QXQA 1E7SA 1RYDA 4BNUA 5BWBA 1TU3A 2P5SA 5K0BA 1E89A 2Z5GA 5AHRA 1HRKA 4TKUA 3B6EA 1ABFA 2V4UA 4FMCB 4CF4A 2CMDA 1JA1A 2AC4A 3C5WP 1I7SB 3QVGB 5I47A 4TVBA 5CD1A 5CJJA 4CM8B 5B1IA 3GCDA 4WERA 5B5SA 2HQ1A 4JD5A 3UAGA 3PUJA 1SXQA 1YVEI 1X77A 2QL9A 2AF4C 3VC7A 5CT6A 4BVGA 4MUGA 3EEYA 1VFPA 3W8FA 1SD2A 2UU9B 3M70A 1JZQA 2ZP1A 1ND5A 3NIFB 3IIEA 1NY5A 5D86A 5HQ3B 1FYXA 2ATXA 1E92A 2Z56A 3IMEA 4UHHA 3K1AB 5SZHB 1Z8DA 1QPBA 3GNTA 3LJKA 2I62A 3OIDA 4J76A 2HSZA 4LYAA 3REQA 4INPA 4YJFA 3DQPA 3LPNA 2NU8A 4B17A 3MAJA 4M9RA 3TIIA 1Y1PA 3G5LA 3MJFA 1KDTA 1YULA 4GH5A 1MAUA 3FDXA 3RW9A 1DO8A 2ZIXB 3ME5A 3OE4A 1T9GS 3RSLA 1VI2A 1Y4AE 4AF7A 3S8YA 4DLAA 3M1IA 2WSIA 1E2KA 1NBAA 3C5VA 3FZQA 4R4JA 4TLCA 5B3JC 1V1RB 2R11A 3B9PA 2YZGA 3BH0A 2VCHA 2Q6LA 1E5QA 1PR0A 1R27A 3PFKA 5AVJA 3BQNB 4FNAA 2CT8A 3B1WA 3GP3A 1L1FA 2GCOA 3GLRA 4CDGA 4PEVA 3ZX5A 2G1PA 5KHAA 1T26A 5A5GA 2Q2VA 4Q9JA 2BPOA 3PVSA 3OPXA 2O6LA 5LA6A 1DKLA 1OZAA 5DVZA 5CCDA 3LNTA 5AW7A 1QZXA 1GNRA 2QM8A 2V4ZA 4IRMA 2NSYA 3A37A 4TVOA 3Q1LA 2J5XA 4J49A 2PRSA 2WKRA 1SA0A 1SU8A 3BORA 3R0ZA 4FWTA 1E9CA 3QEMA 1TUBA 3NVMB 4IGIA 5FWNA 5CA0F 2CFOA 2P1ZA 1N25A 4OGWA 1PHPA 4GKKB 2PUHA 1AMUA 2LWIA 4LS3A 9GPBA 3K20A 2ZRQA 3FOCA 1GFZA 4CCWA 3OEHA 3WRYA 3G2JA 4CQJA 4IIHA 4GLJA 1WUYA 3DF9A 5KOIA 3HYCA 2O5CA 3WDMA 4KI0A 2GWRA 2Z5FA 4NHEA 3RT7A 2PS3A 1ZH2A 2HPAA 2NAFA 2W90A 3LKBA 3MK31 4GR5A 4IIFA 4TYQA 5AOBA 2QG9A 3OQ6A 2FRXA 1X87A 4EB3A 4DZRA 2GK7A 4PAWA 3NG1A 4NBLA 4EAQA 4I66A 1B0PA 1Y1SA 4GLLA 1RRKA 1I4DD 2P9EA 3D6VA 2C31A 4IUDS 1NTRA 3BFVA 2WTAA 4KWEA 2EL9A 4J0EA 5A9SA 3LYHA 3FNRA 1H2YA 1N6IA 3FMPB 3IDAA 1QH1B 2P2LA 3MW8A 3D6AA 1TLTA 4OXYA 1TECE 1OA0A 2IUTA 2PVSA 3PF9A 4D9BA 4TYYA 4RTKA 2EKLA 3W5DA 2X5OA 1CZNA 1W36B 5BOVA 1F8XA 1TIBA 1TKAA 4JC0A 1JXAA 4PNEA 5MFPA 1OX6A 4FGZA 1K9SA 3EULA 1KOGA 2F62A 3SD7A 3MMXA 1QLJA 2R6CA 1SH7A 3GVXA 2G5PA 3I2FA 5BYBA 1RZRA 1ZYUA 4R71A 3RKRA 9ATCA 4OMUA 2IY7A 3GF4A 3ER9A 1PJQA 3A3NA 4S0XA 3RC8A 2VTDA 1CB0A 3HL4A 3RSHA 1DTEA 1VMKA 5CLHA 3BK2A 2P78A 1U8UA 2I2AA 3FOAA 4NYIQ 3VV3A 4KVFA 2A1UB 4M54A 4CHTA 4IOJA 2C94A 3RAFC 1M10A 3JZDA 5ISMA 5HKLA 4H27A 4N0QA 2JLZA 1RZRD 4RH0A 3PYMA 2QBYA 1FYVA 4JT4A 1XVVA 1FDOA 3EYAA 3QF7A 4G5GA 5JNTA 3E3AA 5J2UF 1P9WA 4I2NA 4PC2A 2A8YA 2L2QA 1NNSA 3DE2X 3GLHE 4UM7A 4CLEA 5LZ4A 4F5YA 2H63A 3H75A 2Q1YA 2PY6A 1XZBA 2FEAA 1E79A 1OTHA 4UATA 3OX2A 3GCXA 1NMYA 5FRDA 3T6KA 4AIRA 3BE8A 3N0WA 5FBKA 5HM6A 5HS4A 5KYYA 2EAUA 3FCYA 2DUMA 4UUNA 5F9HA 4JI5B 4AN1A 1FTQA 3S99A 2MSDB 1OV4A 1ZJ6A 5C8YA 1B6GA 1DC6A 3ROEA 2DTEA 3VHQA 4Z7JA 5KNBD 1O4VA 1UZUA 1ZD8A 2IOFA 3I3OA 5A7GA 3IVMA 5IXYA 2Z8ZA 5IUKC 4BASA 3F7OA 3H05A 5DGCA 3MAAC 1PWHA 4FDVA 5DXJA 4IDNA 1X7HA 3WISA 1Z3IX 2VWPA 2OYRA 2F8TA 5TSDA 1CYDA 3CX7A 4J7CA 5LA6F 4Z3DA 1Z15A 1U94A 4HG2A 4OTZA 2ALJA 3BGVA 1KI3A 2E18A 2PVCA 2VKQA 3KWJA 4MB6A 4P81A 5HGJA 1L4BA 4AZ3A 3NCHA 3RQSA 2WJIA 3DWGA 3DE1X 1VJ5A 2AUNA 1IRXA 1ZRHA 4LIPD 1SO8A 1RHKA 3RTBA 1Y7PA 1ZUD1 1SBZA 1Q1EA 1V48A 2EP7A 3PX2A 5F3RA 3EOAI 1A5AB 4D9IA 1ATIA 4E2WA 3PD1A 1WBDA 2FEWB 3CKKA 2B1IA 1XOIA 1JT9A 3JQ8B 4LG1A 4D8VA 1TM4E 1QC5A 5DNVA 1A88A 1S3GA 4Q16A 4TYWA 3W7VA 2GB4A 4AU1A 5LNK6 3EVTA 3QIAA 1SG6A 1UP6A 3WKEA 3FDZB 2AK2A 5EWJA 1QFXA 1VE9A 3U3MA 5JAPA 1XTBA 2X7JA 4EELA 2RI6A 3AI1A 2PMFA 4XI9A 3TTYA 2EJVA 5IJWA 2GUGA 2VNAA 1NRWA 1D0SA 4ENTA 3NOQA 3ORSA 2Q5IA 3R5KA 3TVDA 4BO9A 1XVUA 4BYGA 2EW8A 4YRTA 5FV4A 1NHGA 3QBVA 5CFLA 3K71B 3GLFB 3UIEA 4MV1A 3U6KA 1UPUA 3DBHA 3ONDA 4CWAA 1XKQA 3E9YA 4TMTA 1G0NA 2QVBA 2P91A 1X38A 3KRTA 4D97A 3QJGA 3D6JA 3EEBA 3PNOA 3QLVA 3R4VA 1XXHA 3ZU2A 1ZIYA 3U3KA 3K9QO 3UGKA 3CMCO 4W9RA 4R31A 5CU7A 2BJHA 3OQMA 3PC6A 3E4DA 1Y9EA 3LVRE 2J6IA 2JFQA 4YMUA 5JWHA 3ZJYA 2VSOA 3E9CA 2N42A 2QL6A 1U6KA 3DC2A 2JKVA 2RIRA 3E22B 4LGVA 5EQTA 1L5HA 4GXNA 3HBFA 3VR4H 4DRXB 4EL0A 5F23A 3OKAA 3BEDA 3D8UA 4R69A 2WFAA 5EE1A 2PR2A 2FQ1A 2J6CA 2OV6A 4G5HA 1U1IA 4JOSA 2VUTA 1CVRA 3IB3A 1O03A 1FSPA 1NW9B 4ZK6A 1OH8A 3LKVA 1Z8FA 4LBWA 3LBHA 1BYIA 1W88A 1W44A 3K5IA 4GI1A 4YPVA 1I3OA 3HEMA 4OJTA 2CHVA 3MPOA 4NEHB 4RQUA 2CHUA 5FI0B 3GLGE 1GTZA 3V55A 4ZOLF 1DTWB 1I0IA 3KZVA 2QD2A 4WFQA 3NKVA 5K8UA 1LPSA 4OJNA 1FL9A 4GMGA 4KR0A 2Z1NA 4ND4A 4CIXA 4ZVPA 2VDQB 4TLMB 1M2GA 3WP0A 1ZG3A 4ESOA 1DSSG 1L3CA 1TKRA 2R6R1 3GGGA 3P9QA 4BGDA 1TK3A 2FW8A 4O2BB 1VGVA 2ID9A 3OQOA 2GI4A 3WRXA 4A8TA 2G40A 1KVRA 4EBBA 5LP6A 4UHKA 4Y6QA 3DE6X 3G9XA 2P0YA 1T1GA 1Y33E 3F67A 4G1UC 4I46A 1E8DA 1UMKA 2G88A 2PH3A 2XMQA 5HTKA 3UJCA 3Q7PA 4QDZA 5EIOA 1V7PC 2M98A 4ZODA 1EDDA 2VBCA 3VZSA 1PJSA 1RQXA 3OA2A 3QVXA 4NH4A 5IG2A 4PG6A 1P45A 1NVXQ 4F4DA 3ICEA 3VJKA 1XWWA 4EUSA 4LFCB 4CMKA 2VNHA 1Y6FA 1W36C 2XGJA 3ASVA 1KYTA 3ZDEA 5M7EA 1KFJB 2I55A 2JBAA 5IASA 4XR4A 3ZWYA 4AZWA 4KI7A 1YASA 1DQRA 2PD4A 5K3SA 3FZNA 3HCAA 2OSBA 3HQ4O 4M1KA 2B6NA 1L8LA 4NS1A 5CM2Z 2OYSA 1FPQA 4U0KA 4OXRA 1RQLA 3TB6A 4N76A 3AF3A 2G63A 1PNVA 3M5CA 3CF0A 1TYEB 1N8SA 2CJYA 2VXCA 4KGVA 3H11A 4OJMX 2EGUA 1TAQA 3REGA 1NJGA 1NURA 3VH3A 4MAAA 1UFVA 3IKLA 1NW6A 4G1MB 1OFHA 3GFVA 4B6OA 1CWUA 3GUHA 5FI5A 4H3HB 2WKWA 3WHIA 3KPUA 5EZYA 3F6CA 1WULS 1JQ5A 3G5TA 1M5TA 2XF2A 1T2FA 5KNDA 1N6PA 2D6FA 1VKOA 1VKHA 3L9XA 4M9XA 4B0PA 3TIXB 2FETA 3TB4A 3VHXA 2ZI5A 3MT0A 2RGRA 3W79A 1DAHA 3J81k 1Q3KA 2G3YA 4K03A 3JZFA 3F3YA 1F5SA 4KE9A 5J23A 2WPNA 4BP8A 4DR4B 3P4YA 1YHNA 3ACDA 3ZGYA 3U4MA 2HTFA 4OH1A 2BISA 1K0FA 3FUVA 1Q6YA 2B7BA 1PFQA 1U7XA 4GRIA 4ZCQA 4ZHQA 2VF8A 4QGHA 3D6NB 1J5PA 3V34A 4YRAA 1RCUA 1P8AA 4PYQA 5EJ6A 5JYDA 2FRVA 4I4LA 3BMCB 1GV1A 3I1YA 1JEEA 5JDIA 4FDUA 4MPDA 3GRFA 4YI5A 3V8EA 3VYUB 3AKZA 1XEFA 1GEEA 2HDOA 2GD1O 4ARVA 2CLHB 5AYVA 1HE4A 2CHQA 1GRCA 4Y1RA 2G5TA 3CS3A 2QDXA 3RJZA 3ZHVA 1YWGO 4OI0A 1TC1A 5C5DA 1GN8A 2WNSA 3B7GA 3EW7A 3PPWA 4FFLA 4F71A 2VK4A 4HRVA 1KSHA 2WAYA 3LPAA 1REQB 3NDRA 4P3NA 5LYYA 1QX4A 2PXHA 3A9RA 3CWCA 4R9RA 4BP9A 3A6DA 3T9CA 1JX6A 1K6EA 4MPTA 1JV2B 1GPLA 3INNA 1Y80A 4TV8A 3C8ZA 1M75A 4I5IA 5BYJA 1BN6A 3EBLA 1JKXA 2A9FA 3S2UA 4BLVA 2B8JA 4I9HA 2JFZA 1AU9A 1ELOA 3CB4A 2JLYA 2UZAA 4PN7A 4YCBA 4CMAA 1ZI9A 1VA5A 3WB1A 3T1HB 2IU3A 3AR2A 2EVWX 2JARA 3PPIA 3RUEA 5CB6A 4HI0E 3X1KA 2W6IA 1K5DA 1LTHR 3R77A 3ZGVA 2J67A 4UBMA 1U3GA 3MFYA 1WOMA 4KFTA 4ZO6A 3QOWA 4I6GA 4NCKA 4D44A 5LP6F 1P1RA 3IVCA 4KOEC 5CYGA 3EF3A 1JHPA 2ZJ2A 4RF4A 4GS5A 4KPGA 5LUBA 1E2IA 4MKZA 1GITA 3HWRA 1XHFA 2NLOA 2RHCA 2CLFB 1R0CA 3EOBI 4XLZA 2PKQO 1PD0A 1AV6A 1RLTA 1O54A 2FGJA 2EV9A 1POWA 5EYPA 2NMVA 2I3AA 3SZOA 3H9UA 1Y3BE 3H1FA 1NVKA 3L8EA 3NHLA 4XD7D 4DMMA 1UC5B 2EP8A 5DWQA 2QSYA 1JDPA 5IVPA 1BS2A 4XDYA 4QSHA 1XZQA 4EYGA 2F1IA 3PUVA 3KWMA 4MH0R 3HB4X 4ZWNA 3C5CA 3HKEA 4FLFA 1BGWA 1JFFA 1YD7A 3CUUA 3P8ZA 1K8RA 1T2UA 3MINB 4FVTA 3KHTA 1APBA 2PCLA 2OCAA 2Y99A 3T7AA 2HF2A 3GIWA 1P5FA 2G82A 4JT8A 3SX2A 5JD4A 2I7DA 5BQ5A 2DUUA 4KJXA 5DT2A 2HJ9A 4PWZA 3GNLA 1ZBQA 4HWSA 3TLGB 4EX6A 4FPXA 1HG0A 3LE8A 4CN9A 1CZRA 1QP8A 5TV2A 4M1YA 2XODA 2QTGA 5DXAA 4RESA 5AO9A 4BNDB 2VZEA 3LHSA 3MCUA 1H4QA 4O25A 5I7RA 3C41J 1GGEA 1I2CA 1KPGA 3W6PA 1NSFA 3H8WA 2KPOA 1JZSA 3HGQA 1OFGA 5EWLA 4EOGA 5BW4A 1XMQB 2OZLB 1ADBA 4D26A 2XBMA 1YBHA 2C2KA 2QTNA 3FI0A 1PQ4A 1SZPA 2C98A 5DCUA 4FP9A 3AB7A 5BWCA 5JAOA 1PI3A 2RDMA 5ESXA 1YR2A 3FVVA 3V4ZA 3CGGA 1CE8A 3DTTA 2QTLA 1TYCA 3ONNA 4DQXA 2EQBA 1SIBE 1E5XA 4TXMA 3SYKA 4BVAA 3G49A 4UVEA 1MOQA 4FFRA 4BMCA 2G80A 2VT3A 2IZ0A 5AIBA 3PEEA 3EGDB 3VNUA 4FHEA 5J5VA 4LMRA 3RQIA 2JIBA 2QZZA 3PQ8A 1YRAA 2WTEA 4G56A 4C30A 4DLBA 1B6SA 2JFGA 3LC7O 4UU0A 4LY9A 5KX5A 3H2BA 2E49A 4PG4A 4S35A 2RGXA 1JQ3A 2W9XA 1MX9A 2JAWA 4R1OA 4TWIA 2M6RA 5ICMA 2VYFA 4JVSB 1WXHA 5A7HA 1IPFA 1I14A 2COKA 2LUOA 4HAVA 2XMPA 3HVJA 3A4TA 3DWFA 3TSYA 3SXUA 1CDZA 1HT2E 3R3VA 2Y2UA 3AXSA 4TKVA 3UUGA 3ZTTA 4KNYA 3T9EA 3PXBA 1QDLB 2IHYA 4CF6A 4OMDA 3RFVA 1N5JA 3E53A 1D1TA 1ODCA 4Q1FA 4RV9A 1WZEA 1FDUA 4AG6A 1FRVA 4CIDA 2ZDHA 2BFEB 1CQIA 1SC1A 2AFIB 2LPMA 4B6SA 3FPKA 5ETJA 1HNWB 1QO9A 1TZJA 1PL8A 2H1CA 3MB5A 3PT5A 3L92A 1YZGA 3O38A 3H1BA 2NVUB 4AX4A 3UK2A 1I7PA 4DLUA 4WCDA 4WBNB 4CKEA 3RSOA 4MKXA 2SKCA 1DKNA 4MQFA 3TM4A 4JI2B 1HT3A 1ZGGA 2WU3A 1CJMA 5IJAA 1SXGA 4EHBA 1LBSA 1NNUA 1O3YA 1Z0IA 3D02A 3G17A 1CEYA 1SIOA 1AKEA 2I2CA 3TFOA 3EXHB 2XPCA 4NH0A 3S68A 3BH7A 2IE0A 5E1MA 1R4AA 4M55A 1Y3AA 2ASEA 4FD2A 1AV7A 1RMTA 1RRGA 4U4AA 3S2EA 4CCYA 4BVEA 3CCBA 2R8ZA 5MDHA 3DS8A 4C6TB 4YP9A 3PEWA 4MYTA 5KTSA 4W5TA 3U7FB 1KFEB 3GEDA 4IDQA 3WRWA 4UNQA 1PUXA 1DJMA 1SD1A 2D13A 1GAEO 1P1KA 2IDMA 2NTVA 1T13A 3ESAA 4LZNA 3THWA 1I7DA 2FPUA 2D2VA 1YMQA 3DEIA 4RKEA 3U4AA 4IFTA 2JJ8A 4ZJUA 4I55B 2VHWA 1VB5A 2YXEA 4TL8A 3C1TA 1YRWA 5LL6P 2I2WA 3PTAA 3RTDA 3R0JA 1M1ZA 2EJBA 2IF2A 4IEFB 4PANA 3ELUA 1KO4A 4QYMA 1U1CA 4LOHA 3ZWAA 4KLAA 4TN5A 4NOMA 1IVNA 1W93A 4D4LA 3HPRA 1N8KA 1WCV1 4ZRNA 2J5BA 2PIAA 3ZBTA 4WGFA 3VDRA 2HLDA 4UE6A 4ZP1A 1LX6A 3W0LB 5JZMA 1VE1A 3WGIA 5GZ6A 4C3UA 2CDRA 1WWKA 4CUZA 4EBFA 2F90A 2FEMA 2IDZA 4LY0A 5I7AA 1GUZA 2YXPX 5JHGB 2E1PA 2GEKA 2X6QA 3LQYA 1Z0DA 3UHJA 2Q0HA 1B74A 4HATA 3ASZA 4GR9A 5U4XA 4GYJA 3P52A 4FJ0A 1MIOB 4JBHA 1CY6A 4WLOA 3W6ZA 1AH2A 1Q0SA 3E15A 3FJYA 5IH3A 5K05A 1J39A 4PZUA 3X1YA 3IP1A 3T9AA 3A70A 1C3OA 1U7TA 2ADFA 3PNPA 4JQZA 2IS1A 1NF8A 1POXA 1Y5MA 3LZ6A 1UBEA 3SC3A 5JXJA 1TZMA 5IVIA 1TNDA 2X8JB 2Z6QA 3TCNA 1QANA 4X44A 4DAOA 7AT1A 5ITZB 4HF7A 1IYZA 4GRAA 2C9YA 4IXWA 3TZ6A 3IP7A 3NFYA 1GNTA 3MIZA 2PNFA 1XQYA 1ZESA 1JSRA 2F3SA 1SBNE 3JD1A 3O92A 4YAWA 1P5RA 3OFJA 1VPVA 1Q0HA 1YCGA 5LDGA 3TYXA 4CG3A 1C0EA 2H5JA 3ANMA 2R1VB 1XAHA 3ZY5A 3DLCA 5IFLA 2BM8A 1HG1A 4HDCA 3ICOA 4RS3A 1R6VA 2HHLA 3TNYA 3ZW8A 1HORA 4KN5A 3JVVA 4XYMA 3U7QB 1VBNA 4ZO8A 1CUBA 3IDZA 1BH2A 4W7SA 3LRXA 1COWA 4DMCA 4F56A 3L4BA 2QL5A 1JFTA 2ZJ5A 2ZB4A 3IIJA 1UKAA 1JLKA 3CV3A 5KWIA 1YZLA 1GGNA 1EHCA 3MS7A 1U2PA 2FEOA 2GAOA 2ONZA 2A0YA 3I4LA 2C7GA 5L3QB 3PUZA 2LIVA 4UMEA 721PA 4GE0A 1ZOIA 2FPSA 1H85A 1V2HE 1D6SA 3LL7A 4OK3A 4W9NA 2CZCA 2AYYA 2IU6A 2AX4A 3FLBA 1COWD 3MGCA 1X0XA 1ZVJA 5AKEA 4DY4A 2ZRCA 2OD7A 5JPDA 2C7PA 1DB3A 3IB6A 5EZ5A 5IVKA 1OASA 1U8CB 4LISA 4LZAA 4D57A 4EUFA 2V7QD 1F5NA 1XRNA 1Z5ZA 3HZZA 1GCUA 3PA8A 5ELMA 2CV2A 4QAQA 3VGJA 3JQAA 2IUYA 4YYZA 2WU8A 2LDXA 4QULA 3GP8A 3CEJA 2WTUA 4GPTA 2YW9A 2HADA 3NDIA 4JLNA 5KQMA 1DCTA 2JIMA 4B6GA 1CYEA 4HDSB 3DKRA 1C4KA 1K3FA 1CS4C 2AK3A 4NAHA 2J85A 3TOSA 3UOAB 1DAGA 2P65A 4V0QA 2BMAA 1FP2A 1ZD2P 1MJGM 1PJ2A 1UH5A 4LRXA 4AJLA 3D0OA 3TTUA 5GONF 1KRXA 4KODA 1PFKA 4ND5A 2WYUA 3VOAA 1N2CA 4N03A 5B7NA 2YIJA 2QXUA 5F77A 2PZAA 4UULA 3AL2A 1XDSA 5EJ7A 1WVIA 1ZVQA 3V4RA 5DHAA 5AXAA 3AP3A 4V0OA 4BQRA 2JLCA 3BEOA 4Y7CA 2X0RA 5CM8B 4ZA2A 3SE0A 1W5AA 1SEPA 4F7DA 2PXCA 3DFUA 4KO1S 4UAUA 1C4OA 2QPOA 1ISGA 3K6JA 4YCCA 1ENOA 5L7YA 1XDGA 1GDDA 3LG2A 3O8OA 3QUQA 3HVUA 4GGPA 2H07A 1JT2A 1WCXA 3IV6A 2QU8A 5EJFA 1J20A 1HTTA 2YBDA 3B7WA 1EK1A 5DGHA 2ISQA 5J63A 1NHWA 1XSEA 7YASA 1EGMB 3G7SA 1J00A 1QHFA 5EEGA 4QT0A 4R2HA 1ZWLA 2IYEA 4TUYB 2FFJA 5COQA 4MVJM 4L1KA 2Q5JA 4D46A 4WL0A 1PSZA 2BMJA 1IOLA 2FQXA 4FYJA 1Z22A 4WZBB 2JI6A 1NBEA 4OGLA 3G8AA 1QS0B 3KTFA 5ECWA 1C8VB 3VO2A 3VZBA 4PBSA 3AFIA 4V0LA 2ZI6A 2UVQA 1ORTA 2OQIA 1I4EB 3EA4A 4LZOA 4RF2A 3OPYA 2H2GA 5CTAA 3K9BA 1ZHFA 4YLEA 4BNDA 2F1JA 2WJJA 4X0EA 5EMJA 1OW3B 3TDMA 2HA4A 2OVFA 3HJTA 1R5JA 4IMPA 4BGVA 5JJCA 4B6EA 2XZOA 1U3DA 4GICA 2FU5C 4IMRA 4W8GA 1RYHA 3LA8A 5EPEA 3RLIA 1YU6A 2VJNA 1M73E 2F1RA 3EXHC 1WSAA 2JFFA 4P4TA 4QM7A 1DDOA 5HQJA 1U2EA 2HDWA 2HU7A 2HV8A 2RCYA 2HCTA 2VUUA 4B1FA 3GLFE 4PU0A 1XZKA 3K05A 2X3UA 4TMZA 4UXJA 3JQDA 4MICA 2K2WA 1N8TA 1XG5A 5LB2A 3TOZA 3MS2A 4DJJA 2OCGA 3FWKA 5FL7D 1OLSB 2BW0A 4J1NA 3PQEA 1AKWA 3C3PA 1ZKMA 3B51X 3HFJA 1TJ5A 3JQFC 4RFSA 4X20A 3NH9A 4MS4B 2CMHA 3RB8A 3SQWA 1ZRSA 2XHZA 2BKXA 6PFKA 3JD0A 3IEVA 4RA6A 1IEWA 2FSIA 3R0QA 4RPJA 3UATA 3ZIAA 3N6VA 2QRKA 5I9BA 2B4TO 3FVRA 2F9FA 5MGBA 3F4LA 2E5FA 4C2AA 1JW9B 4HGPA 4NARA 2D1YA 2DLNA 3W2IA 5EIBD 5JJ5A 5FKJA 1YBVA 2ZTVA 5E7MA 3HA2A 3DDNA 1Q2UA 2OO3A 1KOLA 4ER5A 3S0JA 2Q5OA 4JB0A 4YUWA 3KYBA 3AETA 4JB8A 4KQ1A 1UADA 3C3BA 3BREA 3P2JA 3DZDA 2GEBA 3ZIAD 4G9BA 1QGYA 3O8BA 3R7WA 3ZIUA 4QU8A 2DG2A 1EEHA 3EJWA 1KYWA 1E2HA 4EO7A 2Z30A 5IHXA 4B43A 4EDFA 1RI2A 2CW5A 3TLCA 4H4DA 4P38A 2AKEA 1ID8A 4L6CA 3WJAA 5ICEA 4G2TA 1VL8A 1XYVA 3IDOA 4K05A 4V1CA 1YHZA 4IR7A 3UH0A 1ZIOA 3FGNA 2AHOA 3L7IA 3PQ6A 4NFSA 4PHHA 3KETA 1TTTA 2ZB2A 1MTZA 4FK8A 2ZYHA 4LYEA 2R62A 1PG0A 3PNBA 4I19A 1XZ8A 2WY2D 4JV5B 3B8HA 3C45A 2ZJOA 5AKHA 3LTEA 3SEQA 4PC6A 5C8VA 5TQ0B 2OC9A 5IDXA 3IRVA 1F2TA 2L0XA 2QX7A 3GWZA 3R5HA 4CLXA 5HUHA 1NQ5A 1UPAA 3A1FA 3NIBA 3FIJA 1NQUA 2F43B 4H2DA 3E7DA 1NC1A 3K2EA 5IKXA 3K4HA 1PTJC 3HUUA 5C8XA 1Z06A 1SCBA 2QGFA 1ZK0A 3AO0B 3PE6A 4KXLA 5JVDF 3AYXB 1EE1A 4DXHA 4BLQA 4F3KA 1N8NA 2WUDA 1A9TA 1QWSA 3K73O 4L7QA 3RFXA 5B58C 1HNZB 4W1QA 4HRAA 3NXKA 1KBQA 4TL7A 1D5WA 5J5AA 4J0KA 1Q12A 4WA7A 3C6MA 1QNLA 4LOIA 4KXNA 3WK4A 1AO0A 4GD3Q 2R00C 3I2GA 5LLDA 1N77A 4J7XA 3TQFA 2J31A 4ZREA 4PPGA 1Y8ZA 3ZBPA 1UWLA 4MPPA 1EVIA 1OZFA 2ZAMA 4ZOCA 4BAUA 4LXHA 1I4LD 2FZLA 2DSNA 3L01A 5FBQB 4LDRA 3N2KB 3Q7RA 2YJ4A 2QQ5A 1NXOA 5F5LA 3TBFA 4PLZA 3DFZA 1QYVA 1A9PA 1JDNA 1JKJA 2OLEA 4XOIA 5FPQA 4AJIA 3EXEB 1JAXA 5DO9A 5CFMA 3FHLA 2VFAA 3TSWA 4I5FA 3NM6B 3O73A 4IIJB 4TMKA 5BSRA 4F45A 1N5KA 4DDUA 4YJ2A 4V2UA 3ZZMA 5FOTA 4D9CA 3N59A 3LI2A 2IYNA 2HA0A 1RC0A 3E70C 3PFCA 3WLPA 3MJHA 2WSMA 3FHOA 2DPYA 2FUG1 3LAWA 4PX3A 4Q4HB 3TKAA 3IUNA 3DXXA 3MMSA 5I8WA 3OQIB 2AFHB 3BPSA 1XMIA 3NTXA 3OKFA 4KMMA 5TQVA 3A2KA 2SNIE 4R98A 1MOSA 3LPLA 3O75A 1NOIA 4Y6GB 1GPKA 5HMMA 1EVLA 3D8HA 1RI3A 4C0HA 2VWHA 1L7AA 2XIJA 1GN9A 4TKMA 1H1DA 2QNBA 4XB1A 1QRDA 4MRMA 4KXWA 2AFVA 1D1QA 1SCDA 1A3CA 1VSUA 1ZXLA 3DUWA 5I8ZA 4C0XA 4RSMA 3PNVA 2DB3A 4M9SA 4LRWA 3OT1A 5A4AA 5K7SA 5ITSA 2CFSA 1QQBA 3DLHA 3G0OA 4RD0A 5ER9A 5L7WA 5H0IA 5A5EA 2XOKD 3TG2A 2FHPA 4J7AA 2ZBRA 4QYSA 1LVHA 3GRUA 1S8OA 2VBIA 3JVEA 3PQ3A 3TZKA 3RWMB 1M2EA 1DFIA 4P22A 2OYCA 2CXNA 1XPUA 4JLWA 1P2DA 3HYRA 3VH4A 1AZSC 3ZDXB 2C83A 2WWRA 4NBSA 5CR9A 2AXPA 4FGUA 3SFVA 2WJGA 1GL3A 1IRIA 1O6BA 3QVSA 1KDPA 2V1UA 4AB1A 1WXQA 4ZOQI 3HYLA 3ROFA 1X7WB 2DTXA 2XE6A 4C04A 4FBGA 1FTGA 2G0NA 3C24A 3L8DA 1ZC3A 3ZY6A 4YUYA 4KW7A 5CAEA 4URYR 4ZVOA 1E4VA 1S2OA 3KDPA 4HZGA 5C34B 1KP3A 2LCFA 1PYOA 2XCIA 2A9OA 3AESB 1DC4A 3BJRA 1G4HA 1QXSA 3BCSA 4LYDA 3E03A 1PK7A 1THGA 3GAFA 4XX1A 5MF6A 1D8AA 1TVCA 3D31A 1M0EA 2JG3A 1V39A 3GJRA 1UPXA 2HYIC 4RL6A 1D1SA 2CEKA 2G8LA 2P8SA 5D6NA 4EO4A 2XT9A 1ZUNB 4YAEA 1HEYA 1KJZA 2ZU6A 4IO1A 4JKOA 1B3BA 4N6GA 2BBWA 2XVMA 1WF6A 1P62B 1E69A 3OM1A 3R3YA 4R2JA 1CTQA 3C8DA 5LVAA 1AMNA 3GH3A 1SVOA 2PA3A 4HBZA 5AH0A 4DA8A 2ZSUA 2HQOA 1S4QA 4Y9UA 3DWIA 3GLHA 2ZWIA 4RDHA 4CT5A 1Z62A 2VN8A 2R1UA 1NRJB 1JS1X 4IHQA 1M2VB 3EK2A 5EJ2A 3RREA 2FPGB 3GJTA 1JLLB 3OLXA 2NSLA 2BHLA 5K3DA 1KK3A 1J2YA 3PK0A 1HE8B 1AA6A 2BR3A 1N32B 2UKDA 1Q22A 2B4YA 4FYWA 3CH6A 2ZCUA 4B3HA 2HJHA 3RK4A 4BQOA 5GPBA 4PGHA 3VPXA 4M1TA 3SICE 1EFVA 3H5TA 3TO5A 3NOVA 2W2LD 5GJCA 1EX9A 4PTLA 2QRZA 1QHHB 1CUJA 2J46A 1W59A 2MU1A 3KU1A 4ALJA 4Q4AA 3V8BA 3BRQA 3LP8A 1FP4A 3ICVA 2ZU0C 3F96A 4F2WA 4Q24A 3GEBA 4L72A 1ESMA 2VSNA 3FR7A 2ZB7A 4WUVA 2B34A 2DQ4A 3K0KA 1BYUA 4W99A 3H5VA 1N0WA 4RVHA 5CT8A 4CM7A 4DQLA 6NULA 3DKKA 1QVAA 1VKNA 1CUEA 1JPNA 5SZIA 5K0GA 4KQMA 4YJGB 3ZWOA 4GC5A 3Q88A 3NMUF 3RVSA 5C3UA 4P93A 2XBUA 2JIOA 3I01M 4CL0A 1AHIA 1KZ4A 4LRQA 5DKFA 3EFHA 3RM3A 3RV3A 2BYTA 1KI6A 5H70A 5JAQA 4MW6A 4YAUA 3BWDD 2OOKA 5LMNB 4KWHA 1M67A 3OD5A 4HLCA 4Q7KA 1TLLA 4QELA 2HRQA 1O89A 3L40A 1I5OA 3MTEA 4J94A 4RH3A 1D2MA 4XIYA 4DRZA 2OXEA 2AMVA 2D5AA 2ZSJA 3L3BA 4PYLA 4OHMA 1JJ7A 2Y77A 4QYIB 1JBEA 4XOUA 4D43A 3QH4A 1PFWA 3DG9A 5AESA 1MRNA 5EEHA 3KTOA 5BRAA 1KDYA 4CM1A 3EE6A 2AOTB 4FR0A 1ULSA 2AFIE 4FZRA 2R86A 3AZOA 3V8MA 4CMBA 2JGLA 3M5DA 4YRSA 1NUSA 3BWMA 2ZSHA 1PZHA 5F2NA 2H17A 5EJGA 3NPMA 3D7KA 1MGPA 2OCYC 1BOOA 1IU9A 4IDPA 4BO8A 4GR4A 3ZJVA 2E6KA 1ZI8A 1X2EA 2N3ZA 2VDWB 3RHZA 4E1AA 1J5EB 4FEAA 2OBMA 1NXWA 3GA0A 5KSZA 2PBLA 1DE0A 4TN1A 4KDFA 4U7FA 3N39C