3SX2A

Crystal structure of a putative 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium paratuberculosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
268
Chain Sequence
GPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASVPYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDELGRLDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPTLVKQGTGGSIVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNSIHPSGVETPMINNEFTREWLAKMAAATDGAMGNAMPVEVLAPEDVANAVAWLVSDQARYITGVTLPVDAGFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 3-ketoacyl-(acyl-carrier-protein) reductase
publication title Mycofactocin-associated mycobacterial dehydrogenases with non-exchangeable NAD cofactors.
pubmed doi rcsb
source organism Mycobacterium avium subsp. paratuberculosis
molecule tags Oxidoreductase
total genus 99
structure length 268
sequence length 270
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sx2A00
1C1XB 2IZZA 2O2YA 3H8VA 5CPBA 4BNYA 4QO7A 2Y1DA 3L9XA 3KETA 2FN7A 2OBNA 1QYDA 2EEZA 1D1SA 4BKOA 1YBMA 5MGBA 5FWNA 4UULA 2PV7A 3HFGA 1SB9A 5GY7A 2GN6A 3KBOA 2P5UA 4O6VA 1LXCA 3KYCA 2NLOA 2P4QA 3VAZA 1H9BA 3G79A 4DXHA 4FGWA 4DYVA 3BAZA 4ITUA 3V2GA 2W2KA 2ZB8A 1PZEA 1E1MA 3DAFA 2CD9A 4CM4B 2HRBA 1HT0A 3TJRA 1O94A 1ISFA 4ONEA 2FPGA 2EP5A 3CE6A 1Y9EA 1DIBA 3OBBA 2IZ1A 1LRJA 4XDYA 3I23A 2F00A 5CG1A 3HWRA 1SNYA 3HFSA 4I9HA 3WWZA 4AG3A 1J0XO 2YYYA 4H15A 1IULA 1ZZEA 1X0VA 4NFHA 1R16A 1JKFA 3A14A 1PJ2A 3H6KA 3JQEA 1HDZA 3DOCA 4GLOA 3E9MA 5CEFA 5TC4A 4P22A 4A0SA 1QRRA 4LCEA 1KYQA 3DBVO 3LF2A 2YZ7A 3WQRA 3HB5X 1N7GA 2E6UX 3FTNA 3VPGA 3NGXA 3EC7A 2UVDA 1J5PA 1EEHA 1Y8RB 3I83A 4LW8A 5K6AA 2R6JA 1C14A 5HS6A 1I01A 5B4UA 5AXCA 5CP8A 1PEDA 3OECA 5B1YA 4DBVO 4NR0A 2FWMX 1EZ4A 1N92A 3GNTA 5JAQA 1TVEA 3VZQA 1KBZA 2POQX 1VJ1A 1HE5A 2NVUA 3GG2A 3GAZA 3PFWO 3AUAA 1HDCA 3F1KA 1H6BA 3ADOA 3CTMA 3ANNA 3I6IA 4PZDA 1QLHA 1CDOA 1NPYA 4WLOA 3K31A 2NV6A 1M6WA 1E3LA 1V9LA 4D7AA 5KJ6A 4RF2A 2ZTUA 2SCUA 4BGVA 1YQGA 3RC2A 1Q2XA 4DBZA 1EVIA 4HV4A 5MDHA 1ZSVA 3D7LA 3MJSA 5A3VA 3UGKA 5F3RA 1A9YA 1DRVA 3CH6A 5CPFA 2JD2A 3DHEA 4YT2A 5C7OO 3E9NA 1XA0A 4YJDA 4TRMA 4PLZA 3GN2A 1YGYA 3HDJA 1U3WA 3NTOA 1A71A 4CM9A 2X7HA 4TMFA 4KUEA 3E1KA 3SX2A 1NHGA 1LC0A 3L4BC 4NJMA 4LCJA 4KZPA 3RUEA 1BXZA 1PL8A 3ZWNA 1SMKA 3AWDA 4IDAA 5B37A 4XYMA 1AXGA 3RFXA 3GZ4A 4YJFA 1KVSA 1RM3A 1Q7CA 2I66A 5JE8A 5ILOA 2I3AA 4B7CA 5I9MA 3KLMX 4OSOA 4RO0A 3JQ7B 5LCXA 1UXIA 1NWHA 5HTOA 4MO2A 2V65A 2R2GA 4FIZA 4W7IA 2IODA 3SJUA 4YJGB 3LC2O 2FZEA 1YL5A 3HN7A 4EDFA 1JAXA 5KIAA 4J7CA 4IJUA 2VUTA 2YDXA 4ZICA 2GO1A 3ZV5A 4CM3A 4KUHA 2RBEA 4CV1A 1NX6A 4XYBA 3W4IA 1GR0A 5KOIA 4MVJG 1K5HA 1U1IA 5JMPA 2PKRA 2B4QA 1P74A 3PVZA 4BB6A 3JD2A 4U5QA 5JDCC 3NT5A 1I24A 1WP4A 3SLKA 1Y1PA 4WPGA 1CYDA 3TZ6A 5KKAA 1TA4A 3VZRA 1VE9A 3TF5A 3H2SA 3WGGA 4B3HA 2Z1NA 1ONOA 1E3JA 1IPEA 1NQOA 3FBGA 3U4CA 1B15A 1E6EA 3RAJA 4G5HA 3FTPA 2NM0A 4FQ8A 1KC3A 3GVCA 1PZFA 2GN9A 3A06A 4RF3A 3OIGA 4BQRA 1SEVA 2PK3A 1K3TA 1TEHA 3AU9A 3UH1A 3H3JA 3AOGA 4WK6A 4XYGA 4CQMB 5A9SB 4D44A 3GEDA 4U7WA 3WX0A 4ZJUA 4NFSA 3QA9A 1F14A 3C7CB 4F46A 1VJ0A 5JCJD 2WD7A 4WEQA 1KEPA 3SEFA 3UCEA 2YHUA 1XHLA 5JXWA 5TJHA 3U49A 3U62A 3T7EA 2CY0A 1EE9A 3PIIA 5CDYA 2PH5A 1CIVA 1E3EA 2JL1A 3ZWCA 3F4LA 1B0AA 3GC6A 3VDQA 1E7MA 1LSSA 1OOEA 3W6ZA 8LDHA 1JAYA 1FMCA 1H9AA 1A5ZA 5DZSA 4QQRA 4IDBA 4R3WA 2YW9A 5L51A 5F1PA 2EWMA 1R4MA 2H63A 2XPCA 3D5QA 1IY8A 1QR6A 2BFPA 2Z5LA 4BNIA 4RQTA 1DDOA 1ML3A 3Q9UA 4I5GA 2HAEA 1YB4A 4L8VA 5EERA 3SBOA 4E5NA 3WNQA 5A06A 5BQFA 3ENNA 4MVJD 1NAIA 4I9UA 3WYCA 4K6FA 3S2GA 4QTZA 2FOIA 3UKOA 4DPMA 5L4SA 4NG5A 4P4GA 4PLWA 2WYVA 4KWHA 3F4BA 4CMIB 1GD1O 2OFPA 3M1LA 4HADA 2D5CA 4WLEA 2HMWA 3WLEA 4BO5A 3ZWXA 4FPXA 4U0JA 1CERA 1PQWA 1Y9AA 4K6CA 5DCYA 4AJOA 2O3JA 4BOYA 3PIDA 1Y7TA 2J8ZA 1EVJA 3EDMA 3GDFA 1ONPA 3JQ8A 1ORRA 1E6WA 1XEAA 2XXBA 3AM5A 3H9JA 4OKIA 4RDHA 1ISHA 1FDSA 3GGOA 1RPNA 4XGKA 1EUDA 2VOJA 2Q4EA 1N5DA 2D2IA 3OM9A 2QYTA 4PZEA 3DZHA 3OP4A 1UXHA 3PJGA 5A05A 3ZZNA 2AXQA 4WCFA 4NQZA 1DB3A 2X1HA 2AG5A 3AM3A 1ZNQO 4KUGA 1ADFA 1QV6A 4IQ8A 1P44A 3GMDA 1B2LA 3M1AA 1NM5A 4MVJM 4XKJA 2FR8A 5TJ9A 2QX7A 1PGOA 2IEBA 1VL0A 4BV8A 4HFJA 5JC8A 3CXRA 5CG2A 4PCVA 1UJMA 3V5NA 4ZQEA 3KV3O 4R54A 5JFOA 5AXDA 1ZMOA 5L4NA 9LDBA 2WYWA 3JQ6A 1BW9A 4XGIA 3F9IA 4YT4A 4GX1A 4E2WA 4J3FA 3CINA 1BXGB 2OORA 4MP6A 3ETGA 3W4JA 1PS8A 1UDAA 4F6LA 2VN8A 5IN5A 5LDGA 3IC5A 4BQPA 5FEUA 1Y5MA 3H5RA 1R12A 4CLRB 4EEXA 1H93A 3OFSA 3W8DA 4HFMA 4B4OA 1DJNA 3KEQA 4S3MA 3FSRA 3PYMA 1LSOA 4B3IA 2EW8A 4J2HA 4R1SA 2EP7A 5IG2A 5TGDA 1UZNA 4Y67A 3IUSA 4AJKA 5ADHA 3LDHA 1EQUA 4AJHA 1N9GB 3QVOA 3DZFA 4FDAA 4RDIA 4H3VA 4B4WA 2PWZA 2OP0A 4CM9D 5C37A 1JQBA 4PLFA 3ENKA 1Y8QA 2HU2A 4IY1A 3QWIA 1T24A 2G76A 3K2BA 4OL9A 3I9KA 4CMBA 3DONA 4MOWA 4HX5A 5F1KA 1C0IA 3P19A 3K9QO 4AJEA 2DAPA 4UVHA 4GX2A 1S7CA 3BMOB 3C24A 4CM6A 1P31A 2WJPA 1VL8A 4RPLA 3D0OA 3LT0A 4AJPA 4DLAA 4Z6KA 3GPDG 5C5IA 1FK8A 2J3KA 3A4VA 3VZSA 3KSZO 2VZ8A 1R66A 3L4SO 2IXAA 3MJVA 3NTQA 4N5NA 4OOEA 4B79A 1W0CA 3L6DA 4FCCA 2PGDA 2NU7A 3HNPA 3DBRA 5IZ4A 1CF2O 4DLBA 4A26A 4RZIA 3Q2IA 1E7QA 4Z0TA 1QMGA 3JQGA 2BH9A 1ZK2A 4PLVA 4L75A 1DFIA 4UUPA 4RGBA 1M6HA 2VHYA 4B4VA 2DTEA 4EUEA 2O7SA 1VPDA 4WE3A 1ZK3A 3PWKA 1NNUA 2EGGA 1NFFA 1R0SA 3Q2KA 1UXJA 1BG6A 4YQZA 1GZ6A 1Y5RA 3ZU5A 1U8FO 1DC6A 4D46A 1E7WA 4JLWA 4OQZA 2EJWA 3H9GA 1H2HA 1MFZA 2Y0CA 3LYLA 4CUJA 1YQXA 2CFCA 3RWBA 3TZKA 1CWUA 4C7JA 1ULSA 4ESOA 1GPJA 4CLXA 1KS9A 4NIMA 4R68A 1BRMA 1HYHA 4XD2A 4WCFC 1LLQA 3U9LA 3LF1A 3I5MA 2C7VA 2GGSA 3RUAA 2I65A 2X5OA 1LSJA 5I9LA 1M76A 1E1LA 1SOWA 3JD3A 3L6OO 3GLQA 1U28A 5J23A 3PP8A 4OHUA 2G0TA 5ER9A 4RVDA 3WFJA 3GUCA 4IZHA 2WD8A 2FR1A 3AY3A 4XWYA 2FSSA 4N5LA 4WASA 3LT4A 3MOGA 3JD0A 1PGPA 4ZGWA 3WIEA 3TPCA 4FJ2A 5IDQA 1X1TA 4BO3A 3CMMA 2HK7A 4ALIA 4J2OA 4Z9YA 1A7KA 2OMEA 1YKFA 1GV0A 3KM0A 5HWSA 4WLNA 2O50A 3ITDA 3QIVA 2JD0A 3NT4A 4JP2A 3GQVA 4R16A 2UUPA 3LT2A 3CKYA 4IDEA 2GR9A 5DBIA 5H81A 1FDVA 3S2FA 4DC1A 4A2CA 3U4IA 4JP3A 4IQ0A 1TB4A 3H65A 1B8VA 1TLTA 1GZ4A 1YDEA 3DBLB 1BW9B 3NJ4A 1JN0A 3JSAA 2B36A 2V6GA 1ZEMA 4GSLA 4D3FA 3WJAA 1JVBA 4HFRA 1XYGA 3LLSA 1HDOA 3PQFA 4W99A 2R00C 2GSDA 2IE0A 3GPIA 1YS4A 1E3SA 2QRJA 1K6XA 1NBOA 5JPIA 2W8ZA 2ZKLA 4J6FA 1BGVA 3QVXA 3ICPA 4MVJP 3IKTA 1KVRA 1EMDA 3MTGA 4PVCA 3WGYA 3GN1A 3O8QB 3SXPA 1SZJG 4ZQFA 3PGJA 4IDCA 2CVOA 2DLDA 5COQA 2VYNA 4A5OA 2VWGA 4RV9A 3RVDA 2FMUA 4Q3EA 1EBFA 3PLRA 3E48A 1SB8A 4UUMA 5BSHA 1ZW1A 4YJHA 3TZHA 1HRDA 3OEWA 2PNFA 3F3SA 3N74A 1GCUA 4JNKA 4DYDA 4NH4A 2QRKA 4L4SA 1M2WA 1LU9A 3OF2A 1GV1A 2DPGA 4E31A 1U3TA 2YHIB 1OFGA 4CM5A 1PZGA 3VH2A 4I5DA 4JROA 2J5KA 3K30A 4ALJA 3UCXA 3PHJA 2VT2A 4XZ3A 1NPDA 5DOVA 3K92A 4BKPA 4HUJA 3NJ8A 3TSCA 1T2EA 3WDSA 2GZ1A 5EIOA 5FFFA 1FDWA 1E5LA 4J9VA 1KERA 3GG9A 4Z9XA 1DFHA 2A4KA 2G82A 3WYBA 4L0QA 1GQYA 2PZKA 2F1KA 4HP8A 3HJAA 4A03A 4ND5A 1WAMA 1HE3A 4RL6A 4WLFA 1VI2A 1DIAA 2E48A 4J0FA 2JFFA 4R1NA 1O6ZA 4N54A 1LLCA 1L1FA 1PTJA 2P4HX 4D42A 1NASA 4ND4A 5IXSA 4CR6A 3JQGB 4IDGA 4DPLA 4CQLA 1IHXA 1NP3A 2ZK7A 3EVTA 3G17A 4R9SA 4BUCA 1GY8A 4R3NA 1DRWA 3FBTA 1XIVA 3PWZA 4WGGA 2OUIA 1ISIA 2PD6A 4R41A 2GN8A 3GGPA 4OXNA 5JDIC 2YV2A 3IJRA 4XA8A 3C1AA 1E3WA 1LLUA 3UVEA 4ALKA 1XCBA 1J6UA 4ZHSA 4KQWA 4M49A 3BMQB 4UUOA 3DC2A 3DTTA 3ZHXA 1I2BA 1YJQA 1RWBA 4DWVA 4B3JA 4Z0PA 4YT5A 4JJIA 1P9LA 2QQ5A 2OGUA 3O38A 4AJJA 1E7YA 5L4LA 4O0LA 4XCVA 2O2SA 1PJ3A 1O0SA 3K6JA 4FFNA 3H9EO 1C1DA 4PGFA 2VHZA 3RC1A 5B12A 1HDRA 5JY6A 3PYLA 3LVFO 5ENVA 4YCAA 1Q7BA 2HCTA 2O3RA 1OMOA 1XQ1A 2NQ8A 4R5HA 4CJXA 3UUWA 4DC0A 5C3MA 3WSVA 5HRUA 5KVSA 5I7FA 1T26A 4J7UA 3BTOA 1R4NA 4O59O 1E3IA 3L4BA 2NU6A 5ENDA 4DVJA 3M6IA 3D64A 1KVTA 2H1SA 4WJZA 1H0KA 2J5RA 1Z7BA 1RM0A 1EUZA 2AQKA 1LRKA 3HQ4O 3PJEA 3I9NA 4NHEA 3WWYA 3WLFA 2Q1TA 3WGHA 3QWFA 3NYWA 3CSDA 5HA5A 4J90A 2UYYA 1PJTA 1T4DA 2H5LA 2J3JA 2Z95A 2ZCUA 3RUIA 1ZJZA 1H94A 1MXFA 5JLAA 2O4UX 3UHAA 3LC7O 5L9AA 2EG9A 3AY6A 2VOEA 4KWIA 4YRAA 1ZH8A 3MTJA 4BNLA 4OM8A 3O03A 2XOXA 4YAJA 2C07A 3BTVA 5DP2A 5IJZA 4ND3A 3TOZA 1HE2A 2TMDA 3BXXA 3BHJA 3I3OA 4FN4A 1DXYA 5JDCA 1I2CA 2Q1UA 2Y05A 2EHDA 1GUZA 1FF9A 4KP7A 3RUDA 3NAQA 3ZI0A 3DMYA 3FD8A 1YO6A 4AJ1A 1A4UA 1XU9A 3QLJA 1E92A 2WYUA 1XGKA 5FI3A 3AM4A 1RYDA 3GVPA 4JBIA 4Q9NA 4IXTA 3AUUA 2AEMA 2WE8A 5DULA 4I1IA 1YOVB 1QV7A 1I3LA 3PWSA 2FY8A 4E5PA 4J7XA 1O5IA 1WDKA 1B26A 3ZU3A 1SEPA 4J9UE 1DIRA 4ZQBA 2DBZA 1I33A 4J1TA 4J1QA 5GMOA 3BZUA 3K8ZA 1A4IA 4NBWA 1FXSA 1YQDA 3GT0A 4YYZA 5EESA 5JY1A 1UP4A 1HSOA 3F1LA 3UFXA 4ALNA 1ONNA 3WG9A 4BMVA 4KDFA 4Z3KA 4OH1A 4R1TA 2PD4A 3V1TC 1BMDA 3NV9A 2FHSA 3GOHA 3HE3A 5BSFA 2AMFA 1OC2A 3MJ4A 2HMVA 4L74A 4AJLA 5C7LO 3ST7A 3BTUA 4MKZA 3E82A 3QRWA 1G1AA 4M89A 2OXIA 4BO6A 3R6DA 4YR9A 5T67A 1JWBB 2C5EA 3B1FA 4OGWA 3PHHA 2Q4BA 3RCBA 4MP8A 3OA0A 5JO9A 4JGBA 1CETA 2I3GA 1DSSG 1NAHA 1Z45A 1JKJA 3BMNA 4OO3A 3D3WB 3R1IA 2VNAA 3CIFA 4JX8A 1M66A 4FR5A 4CM8A 5JNLA 3TOXA 4NZ9A 3C7AA 4OQYA 4HBGA 4E2YA 4YDRA 4IGEA 3E5MA 3C1TA 4FOOA 4B7XA 4PG7A 1GCOA 4HY3A 3ZH2A 4LRTB 1SCUA 3IIEA 2VRBA 3WNVA 1ULUA 3ZNNA 3IL2A 4IXWA 5FI5A 2JCXA 2V6BA 4PG4A 1G6KA 2ZTLA 1BVUA 3WGOA 5L40A 1YH3A 1E5QA 4CLDA 1I3MA 1YB1A 2VZ0A 2IZ0A 2VZ9A 5F21A 3OIFA 1AUPA 4FC7A 3ON5A 3QVSA 4XIYA 2JCYA 1GL3A 1I2ZA 2BGKA 3RJ9A 2G1UA 2HO5A 1T4BA 3PPIA 3EMKA 4OSPA 4LRSB 2VT3A 2YQ4A 5L7TA 4M86A 1B3RA 4PLGA 5AVOA 3W1VA 4W7HA 4QECA 1YONA 4CLOB 1LDNA 1V8BA 3E9QA 4TWRA 1QXSA 2E49A 3RFTA 5THQA 3ZDFA 4BO8A 1GTMA 2CF6A 1JKIA 4U6SA 4GKBA 1U5AA 1UUFA 4LVUA 2O7QA 2D59A 4GPD1 4RVGA 4RCVA 4EJ6A 2BRUA 4W82A 4Q3CA 4R01A 4PN3A 2UDPA 5G0UA 1D8AA 1IOLA 3WBBA 1HE4A 1B3BA 1C0PA 1BVRA 2GNAA 4EYEA 2X4GA 5B4VA 1QYWA 3CPSA 4EJ0A 3MCVA 1EDZA 2UV8A 1EK5A 2G17A 1LJ8A 1Z74A 1NVTA 2P68A 3Q3CA 4LISA 3KHUA 2Z1MA 3ULKA 3GVIA 2Y1EA 5HS4A 3N58A 4A7PA 5A1TA 1OI7A 1J4AA 3IJPA 5DF1A 2O3TA 3PHLA 2J3HA 4X54A 3ZU2A 4DLLA 6LDHA 4KQXA 4BO0A 4AICA 3DMTC 2WM3A 3TWOA 4XX0A 3QW2A 3KYDB 1GYPA 4ND2A 4P4NA 2Q49A 3NRCA 3SVTA 4DTIA 1NPTO 4HKTA 1KETA 1M75A 4UUNA 4MVJI 1PJSA 1SC6A 4XB2A 5JC1A 1UP7A 4CODB 4E33A 4B8WA 3OEYA 2Y67A 1AE1A 4WCDA 4WNCA 5TX7A 4C4OA 2PLAA 1P3DA 4GL4A 1X7DA 4IIVA 3RFVA 3R3SA 3RBXA 3LK7A 2NVWA 3KYCB 3TZCA 1F17A 3U09A 4XJTA 2W2LD 5COAA 2W2KB 1ADBA 2ZIZA 2G5CA 4Q3BA 1S6YA 1DBVO 2QYSA 4FFLA 3WTBA 5U4QA 2EKPA 3NDRA 4XQ9A 3ZCXA 4BVAA 1UP6A 1WXDA 3TL2A 4PRKA 2I67A 3WOHA 2B35A 1V3UA 2X5JO 5JYDA 5C7IO 4CMKA 5U9CA 3IDSA 7ADHA 5KWEA 1Q0QA 4WEOA 3BIOA 3EHEA 3HUDA 5B4TA 3GZNA 2Y66A 1U5CA 3GF4A 2HRZA 3E18A 3I52A 4QUKA 2OP1A 2NADA 1XR3A 3RBZA 1ENOA 2Q50A 1HXHA 4ZQHA 4NDNE 4I9NA 1PJQA 1AXEA 4S1VA 3VKVA 5L53A 1B7GO 3GH3A 3KO8A 2Q46A 4RLHA 3DFUA 4JCOA 1P0CA 1YJ8A 3M2TA 3G1UA 1ZMTA 3BMNB 4GX5A 2O3UA 2FPIA 4CMAA 5I8ZA 4GBJA 2NVUB 1BWSA 2D3TA 1GDHA 1IYZA 1Z75A 4CV0A 4BKUA 3T4XA 1C0LA 2A94A 5H83A 1YRLA 1YBAA 2B83A 4Y6RA 3WMWA 2NU9A 3GY0A 4NJOA 5G0WA 3W6UA 2C5AA 2JKVA 3NKLA 1R6DA 2JAHA 4ALLA 2C29D 3BMCA 4WKGA 3CZRA 1LUAA 3GVHA 3NX4A 4IDDA 3S2EA 4XRGA 5GZ6A 2PKQO 4CUKA 3LT1A 4HXYA 3TNLA 2PFGA 1KY4A 4IM7A 3C85A 2CSUA 1MC5A 1K2WA 3U3XA 3FR8A 4JJGA 2C2XA 2BGMA 5A5EA 3ROQA 1K89A 2PZJA 1EVZA 4TRNA 1WDLA 3R0IA 3WJ7A 4NJMB 4Y6SA 3U4DA 4PLYA 4LMPA 3RKRA 4CLHA 1SPXA 3NDJA 4YJFB 3B70A 4DIOA 1P1HA 5EQFA 1Q7GA 2W90A 4FFMA 1SOVA 3QVTA 1UDCA 5HBRA 4J91A 3U0BA 2JJYA 1KVUA 4IGFA 1R37A 3D1LA 1DC5A 1I36A 2HDHA 1E7SA 2Q1WA 1JU9A 4W9NA 1GFSA 2E82A 4TRRA 5EPOA 3ZWWA 1TT5A 5KJFA 2I99A 1DEHA 3QE3A 5DNAA 5GZ1A 1A27A 4CL3A 2ZB7A 1ZO8A 3GMSA 4EI2A 4BO4A 1NR7A 2R00A 3DR3A 5EL0A 1Z6ZA 3MJTA 5A5FA 3IS3A 4GH5A 5ITVA 1AGNA 1H2BA 2DT5A 4UEOA 3KVOA 5G2OA 3A28A 5G4KA 3PRJA 1DRUA 4NBVA 4L76A 3PK0A 4GMFA 2NTVA 4NBRA 5IAAA 3P5SA 3E6AA 1NVMB 2X8LA 3IAHA 3HB4X 4OAQA 3CUKA 3ZHBA 2NACA 3ANMA 1C0KA 3IP1A 2AEFA 3I6QA 3WYEA 2DU8A 4MKXA 3GUYA 4M54A 2IDZA 3D4NA 1B8UA 4XQCA 3ZV4A 3ZHYA 1PQPA 4N7RA 2B5VA 3TQHA 2UUOA 3DEYX 1X0XA 2GF2A 2JFGA 1AN9A 2X58A 3DZJA 5KVVA 5BT9A 4OIMA 4Z0HO 4D43A 3LSYA 3S55A 2Y0DA 1TXGA 3RUHA 3OICA 5A03A 2WD7B 4IMPA 4CL8A 1PSDA 4OXKA 1P1FA 1RKXA 4PFJA 4NBUA 3SC4A 2BD0A 4BS9A 1MXHA 4BL5A 3W8EA 5ICMA 2X0RA 5DBGA 1YDWA 2BGLA 5L7YA 4BGUA 4GGOA 3QSGA 5TQVA 3WSWA 2VYVA 2E37A 4J1NA 3RQSA 1Q0HA 3GNQA 1L7DA 2HMTA 3ZNQA 3ZV6A 9LDTA 4PVDA 3CMCO 2EJVA 3G1TA 3RU9A 1GU7A 4NFYA 3PHGA 2DUWA 5T6BA 1R4MB 1WW8A 2GRAA 3QWHA 3WXBA 1HLPA 1U2GA 3RU7A 2GZ2A 4IS2A 3VH4A 1ENPA 5KNLA 1ZEJA 3WBFA 1ZSYA 1EVYA 3JQAA 1P77A 4J43A 2P91A 3AU8A 1D1TA 2P9EA 2P5YA 4DMLA 3MEQA 4AVYA 3ZNOA 2NVBA 5CFZA 3HDHA 4GAEA 4TQGA 5JDIA 4XRRA 3ZWAA 1U4SA 1N8KA 4FW8A 3H5NA 3BHMA 3PJFA 4XR4A 1FDUA 3GAFA 3EK2A 4Y8VA 1TT7A 3O4RA 5GZ3A 1YB5A 1PX0A 3GFBA 2YV3A 2V6FA 3VPXA 4BO7A 5L7WA 3JQ8B 3ROMA 5CHEA 4ILKA 3PZBA 1U3VA 1UR5A 3PQEA 1LC3A 3RI3A 1U8XX 2ZYGA 4E0BA 4E2ZA 4G2NA 4CM7A 3D3EA 4ZA2A 1ZCJA 5K9ZA 3ZV3A 3DBHA 4WCFB 3RC9A 3PQDA 2DFVA 1YWGO 1X13A 1T1RA 1WVGA 1PL6A 4RVFA 1NR1A 4G81A 4JN6B 2CZCA 1W8DA 5DCWA 2CVQA 1HZZA 3NTRA 5IFLA 2XAAA 4F6CA 2W98A 1HF3A 1IZ9A 3U5TA 4RF5A 3ZNPA 1DC4A 3L9WA 3ONDA 3PTZA 4KMSA 4XYEA 4WECA 3ZWPA 5TSDA 4R4JA 4RZHA 5A9RA 3ROPA 4W9NC 4R5MA 1P1JA 5L95A 4IBOA 4E5KA 5DOZA 4IJKA 2B4TO 1JW9B 1PWXA 4I5EA 3HZZA 1NHWA 3GK3A 3I9MA 1ADCA 4PLHA 4GKVA 4ZQGA 3VKUA 2YV1A 4UVDA 5KCZA 2JHFA 4GLLA 3RKUA 3QV1A 3OHSX 4BNKA 4E5MA 4BNXA 2WWRA 2EERA 1GUFA 4URFA 3LQFA 1MB4A 2FPPA 4MVJH 1C1XA 1ZJYA 1LA2A 3ZN2A 4DIFA 4HWKA 1U9JA 5T8KC 4CMHA 4NPCA 4LMRA 1ZIDA 3U4HA 1JA9A 4L4XA 3DHYA 1OZAA 1O89A 4IJWA 1LI4A 3JYLA 3OETA 3WTCA 2AEJA 3VDRA 1PJCA 1M67A 3EAGA 1MA0A 4UEKA 5G4KB 1PU2A 1FJHA 2Y99A 1Y8QB 3QQPA 1U7HA 2DTDA 2DM6A 1ZBQA 2WTBA 4MVJF 4INAA 3BHIA 4PRLA 1PJLA 2Y1OA 4CM4A 4D3SA 4GX0A 3K2EA 3GDOA 3PGXA 1PZHA 2PZLA 1HSZA 1MFPA 5IN4A 3OIDA 2VWHA 2BFOA 4DGSA 1VJTA 3SC6A 7MDHA 3JQFA 2HKIA 4BB5A 5HM8A 1QORA 4XB1A 4K9DA 2RIRA 2XXJA 1ZXLA 5IZCC 1T2AA 1WZIA 1XLTA 2GUGA 1W4ZA 1LDEA 1A72A 1K0UA 4YA6A 1R15A 3EUWA 3E03A 4ZD6A 3DBRB 4WUVA 1WNTA 3OH8A 1XG5A 3CEAA 1LDBA 1Z73A 1GEEA 4EUFA 4II3A 2A92A 4JJFA 2NNLD 1Y8RA 3H3FA 3ZWOA 3DQPA 4GWGA 3OQBA 3HG7A 2PR2A 1JTVA 4AL4A 5AXAA 3WGQA 1IZ0A 3E5RA 5A4DA 1DHRA 3UN1A 4L73A 3LZ6A 1F8FA 4Y9DA 4B8ZA 1P1RA 3QY9A 4HNGA 4BHTA 4OMUA 3HADA 1DPGA 1V3VA 4Y6PA 3V1YA 1SBYA 3ZWYA 4QEDA 2AQ8A 4TRJA 4BNMA 4JK3A 3SJ7A 2GD1O 4FGSA 1EFKA 3G3EA 5I7EA 1ISMA 3KSDO 2PZMA 5CDTA 2O3QA 1ID1A 1SAYA 2E4AA 5EN4A 3DWFA 1XU7A 2OO5A 2FZWA 1ZSNA 3WQQA 2HLPA 1BHSA 3ADPA 2BHLA 4AFNA 2FSVA 1T2CA 1XDWA 4PG5A 4BNVA 2PKQP 4YEDA 1E0DA 2AHRA 1P33A 1RM5A 5BNFA 2JCVA 1IL0A 2X23A 4AJNA 4CM1A 3WIDA 1KEWA 1LEHA 2VYVD 4BNFA 1O8CA 4YTEA 3UW3A 4OYRA 1JLLA 1PS0A 3JQCA 4NK5A 2O23A 3HSKA 3VOSA 1QKIA 1BTOA 3V1UA 2NTJA 4CMEC 4BMNA 4D79A 1PL7A 3FWZA 1E1KA 1U7TA 2HJSA 3AI1A 4M87A 1XWFA 3JQ7A 1IHYA 2UAGA 3WGTA 2AQHA 3VPSA 4TROA 3ORFA 5JBIA 1JVSA 3K73O 4ND1A 4PLPA 3P7MA 1I3NA 2EV9A 3ZU4A 4YJGA 1EFLA 1ENYA 3AOEA 2I5PO 3STHA 1I8TA 4A10A 3C3XA 2Q1SA 3I9JA 1B8PA 2Q99A 3EZYA 2CNBA 2IRWA 4RPJA 2D5AA 1K6JA 1UAGA 3RUCA 5ER6A 2Q3EA 3DDNA 1JDJA 4YACA 3L0DA 2DPHA 4GVXA 2BFAA 5T64A 2YQ5A 3H2ZA 1ADGA 5F1OA 3MJEA 1PR3A 1MX3A 1EK6A 4KTVE 2I76A 2ZJ1A 4N18A 4DIBA 3DMTA 4JIGA 4J16A 1HWYA 1ISGA 3Q1LA 1HTBA 1L7EA 5DT9A 3V8BA 4MVJE 1CQJA 4OJNA 3F46A 3I1JA 4LN1A 5G0SA 4FFPA 3VHRA 1ZXBA 2X6TA 2ZTVA 2Y0EA 4RVUA 5IF3A 1YBVA 3Q11A 4MVJA 4E4YA 4QFDA 4CQMA 5A9SA 3PI7A 1DFGA 3JQFC 4OKNA 1NQAO 4WLUA 4YJHB 4TVOA 5A04A 1NWCA 2DKNA 2IYPA 5JAIA 4M55A 2FRDA 4YT8A 3O26A 2J6IA 1KC1A 3NEPX 3VPFA 2GERA 3F47A 2ZYAA 4Q3DA 3L07A 4TZKA 4NBTA 4TSKA 3AI2A 1PJ4A 4LK3A 2HMSA 4CMGA 5JS6A 3OJEA 1ZUD1 2VUUA 1GUYA 3Q9NA 5JO0A 1WDMA 4YPOA 3OSUA 1LDYA 4KDEA 4N5MA 1DHTA 4I08A 3B6ZA 3WS7A 2VWQA 2B5WA 3D4PA 4R51A 2GLXA 3UICA 2BFMA 5LC1A 3GNSA 2OHXA 5CEEA 3TFQA 1VM6A 3IP3A 2VYND 3D5TA 3OMLA 1OBFO 4WOKA 4IIUA 3ROKA 4CR7A 4ZU3A 1DIHA 2VHWA 1PJBA 3I4CA 4L4RA 3PHIA 4CQLB 1I5RA 1GPDG 3FF4A 4CMIA 3WQSB 2VUSA 4YAKA 4EZBA 3VVBA 1QYXA 4GVLA 4RQUA 1C3VA 3ETEA 5FF9A 2DC1A 4YQYA 4BV9A 2DFDA 2I6TA 1G0OA 2X22A 1Z82A 1VSVA 3AUTA 4GGPA 1E3WB 3DAGA 4K26A 5EQDA 2H9IA 1P1KA 3DZKA 3ZW9A 1HKUA 2NQTA 1GAEO 1UZMA 4U0KA 3QWBA 4BGIA 2Y1FA 2NU8A 3RASA 3W4KA 4O1MA 1X1EA 1HLDA 4HFNA 5A9TA 1R0KA 1NQ5A 4MJLA 3GEGA 2IXBA 2YFQA 3TRIA 4B7UA 1Z7EA 3I4FA 3F6YA 5DN9A 1C1DB 2PGJA 4GMGA 1HYGA 4CUZA 4D3DA 4E13A 4IDFA 5JW6A 3A9WA 3UXYA 4LGVA 4YAIA 4W6ZA 1N1GA 3QHAA 3A1NA 4M8SA 1VC2A 3EW7A 3S1LA 3NT2A 4BIIA 2ZCVA 5CEJA 1PR9A 1ZK1A 1R4NB 4J4TA 1ZVMA 4WNIA 5EMHA 3AOEC 5AOVA 1LDGA 1E77A 4E6PA 2P2SA 5DCUA 1VKNA 4DA9A 2DVMA 3HN2A 5JAMA 3BTSA 1BXGA 2CDBA 2ZATA 4YAEA 2CDCA 3IMFA 2AG8A 1H5QA 4W4TA 2P9GA 3AUSA 2X0NA 3ONFA 4IS3A 1X14A 3AI3A 4QFCA 4EJMA 1DIGA 3G0OA 4TVBA 4R9RA 1MV8A 3TL3A 3PLNA 2EIHA 5TS3A 1MGOA 5TLSA 1A9ZA 1LX6A 4CLRA 2OL4A 2RH8A 4B4UA 2Y1GA 2ZQYA 4DUPA 6ADHA 3COSA 1NYTA 2HK8A 2RHCA 5AQ1A 5CDSA 4ZRNA 3JD1A 5G0TA 5TT1A 4FOSA 4DMMA 2CF5A 4DQXA 2PGLA 4IJVA 3ONEA 2V7PA 3Q6IA 2AE1A 3S8MA 1N7HA 1KEUA 1N9GA 2VTEA 3PDUA 5L45A 3SLGA 3JTMA 2ZTMA 3FNHA 4RF4A 2RH4A 4GQAA 3HHPA 1CRWG 1O95A 4UVEA 1LQTA 5KJEA 4PG8A 2NWQA 5CDUA 2ET6A 2HK9A 2ZQZA 5H82A 4KOAA 5G0VA 3I9LA 2CUKA 1MUUA 3DFZA 4D0RA 5AYVA 2B0JA 5T57A 4ZRMA 5BR7A 3BMOA 2DBQA 1U2DA 4FFRA 1IUKA 1IB6A 3H9QA 5JAZA 2VHVA 3RBVA 3GEMA 3JYQA 4AJ4A 4FB5A 1AHIA 5A3JA 4U6QA 3RSHA 3ASVA 1GYRA 3EYWA 3OA2A 4I8XA 5COBA 3AW9A 4CR8A 4MPDA 4QXMA 4E12A 4UREA 2A35A 1P1IA 2A9FA 3QVWA 1RM4A 5KTKA 2OBYA 2V6MA 2Q2VA 4II2A 1PIWA 5JSFA 1T2FA 2RHRA 2J5QA 1GZ3A 2Y1CA 3C7DB 3P2OA 3RIHA 1LBEA 1E1NA 1DLJA 1TI7A 5T5QA 3WR5A 4FFOA 1DO8A 4JXKA 2X86A 4ZVVA 5DDIP 2BI8A 2D1YA 5IXYA 4MINA 1U4OA 1PGJA 1X7GA 2AQIA 3C8MA 3N7UA 1N2SA 2YFHA 3GHYA 3KLPX 1WZEA 5K6AC 1G0NA 1DOHA 3JQDA 4CMJA 3RC7A 3M2PA 3AFMA 1O9BA 4H16A 4J1SA 3C1OA 5BSGA 2DQ4A 4FJ1A 4DQVA 4D41A 4PZCA 4ID9A 3MOIA 4NNJA 4CM8B 1V0JA 4CQMD 4XDZA 2X9NA 3VTFA 1UAYA 5G4LA 5I9NA 1CEQA 5DP1A 3T4EA 2DBRA 3WICA 3PZRA 3K5PA 1F0YA 3HDYA 2B4RO 2DUUA 2O48X 2NSDA 4JBGA 1MG0A 3KEOA 4QT0A 1DC3A 3EY4A 4MIOA 4R69A 5TRTA 3S2IA 1GQQA 4BNHA 1ARZA 2O3SA 3V2HA 4JQCA 2OZPA 3X2FA 3RROA 3UAGA 3MJCA 3VC7A 1LSUA 1UH5A 4OOFA 3H4VA 3ZWVA 1P45A 2X5KO 3DTYA 4BKRA 3DZGA 2CVZA 2GN4A 4YRBA 1V3TA 1QG6A 1YVEI 1DLIA 1P0FA 1ZKMA 2QW8A 4NU5A 2DBVO 2NUAA 1ZK4A 1NFQA 2YY7A 3GVXA 4IUYA 2ZB3A 5I8WA 5THKA 4D45A 3ZW8A 4P4LA 3BA1A 2X9VA 4J0EA 3WGIA 5TT0A 3MWEB 3ANLA 3V2UA 3DL2A 1OC4A 3FR7A 4E3ZA 4DL9A 1Q0LA 3FWNA 4PG6A 2RAFA 1MC4A 3DBLA 4YXFA 3IKVA 1PGQA 1T1SA 2FR0A 1D4FA 3KUXA 2D4AA 1H6DA 1KIFA 2HSDA 2JD1A 4LSMA 1HL3A 3NDIA 3VH3A 3ZWMA 4BNZA 4TKMA 1YE3A 4BNJA 3ITKA 4BNTA 3KZVA 1EDOA 1QP8A 1UDBA 4C7KA 2VHXA 4UEJA 4XEHA 3RD5A 1KVQA 3RJ5A 3O9ZA 5TNXA 1LNQA 1DJQA 1HETA 1Y6JA 2WSBA 3WMXA 1FDTA 2VQ3A 1UXKA 1HYEA 3O8QA 2Y68A 2YUTA 4O5OA 5T8KA 2HMUA 3GRKA 3PYXA 3TDKA 1LLDA 3FCOA 2GDZA 5U1PA 2LDXA 4BGEA 1T2DA 4E32A 5JMWA 3BYZA 3GHHA 4XIJA 3RUFA 4GSKA 4JBHA 4U8GA 3DB2A 3JQ9A 3MZ0A 2B37A 4O63O 3X2EA 4AJ2A 1JWAB 1ZK0A 2VRCA 4NK4A 4E21A 2GYYA 3KYBA 1MG5A 2YHIA 3INRA 4NMHA 3KB6A 1R0LA 4J4BA 5KJCA 2GCGA 3VPHA 4BO1A 4R1UA 1ZFNA 5FYDA 3T7CA 2QG4A 2DTXA 1WPQA 4MDHA 1KY5A 4CMCA 3OJFA 4I5FA 2C0CA 1OAAA 4YRDA 1HZJA 3OQ6A 1XSEA 4A73A 4IMRA 1NQTA 3KOUA 3AJRA 4G65A 5IZCA 2AW5A 4FJ0A 3VH1A 1RJWA 1A7AA 1ISJA 4CLEA 4CPDA 4P38A 5IDXA 1LDMA 3GZNB 4PLCA 4OXYA 1VSUA 5LDHA 2VCYA 2Q45A 4WOJA 2BELA 1T25A 4FBGA 2C7GA 3VZPA 1UZLA 2O4CA 8ADHA 4EUHA 2VTDA 3UCFA 1MP0A 1NTOA 4D0SA 1X15A 3JQBA 1HDGO 4KTTE 1GQ2A 1EBUA 1DAOA 4EEZA 3W8FA 1MLDA 2GZ3A 2VNSA 3BMQA 1E7RA 2HJRA 1W73A 1ENZA 2PY6A 4E30A 4BNUA 1QYVA 3AY7A 3KTDA 1I30A 3TN7A 1LTHR 2HQ1A 3WGZA 1HEUA 2PD3A 1D3AA 1GYQA 2C54A 3FNFA 5JYEA 3VVCA 5K0ZA 1XQ6A 4UAGA 1LQUA 3LLVA 2WEKA 1N1EA 4GWKA 2PA3A 4QO8A 3Q0EA 3ABIA 3GDGA 1SO8A 3BMCB 4RORA 3QP9A 4IZIA 2D8AA 4MP3A 4EITA 1NVGA 1WWKA 2WE7A 3EZLA 4XYLA 1AHHA 1BSVA 2JFHA 3H7AA 4H7PA 4DRYA 1DAPA 2QZ9A 4EBFA 5L3ZA 3H9UA 3WFIA 4RPHA 4CMEA 1CJCA 1I10A 1XKQA 2XF8A 1EUCA 4BNGA 1QSGA 3KRTA 4AJIA 2X9GA 2Q2WA 5I7VA 5KJ1A 4RPKA 2WMDA 1IPFA 4WLVA 4DPKA 5JCXA 3KYDA 2C59A 1F12A 3ZGYA 4ZN6A 3FI9A 1U3UA 1PQUA 4EW6A 4GI2A 3PFFA 3QJ5A 5BNTA 4IPTA 3LU1A 1K6IA 1RYEA 1WLYA 1V6AA 1F8GA 1YL6A 1LRLA 4J49A 1PGNA 1VLLA 3DOJA 3FPCA 1GADO 1TT5B 4BO9A 2X0IA 2AE2A 2BF7A 2JAPA 3GA0A 3ZHZA 5ILGA 4RVHA 2PTGA 2EKLA 4IINA 4NU6A 1I3KA 1VKOA 2QHXA 3DZBA 4Z9FA 1KEVA 3FPLA 3JQ9C 3DXFA 3ASUA 3INTA 1KOLA 3WB9A 4YB8A 5BNIA 2J3IA 3DAPA 3KSUA 2VWPA 1BDBA 4PIVA 2W4QA 1VRWA 2GPTA 5KVCA 4LSWA 2CDAA 5KKCA 3L77A 4L9RA 5I7SA 3ZWBA 3G49A 2TMGA 4QSMA 1YOVA 5IDYA 2OOSA 3PDJA 3MWDB 3PJDA 5AXBA 2EXXA 3F5SA 4LVCA 3GR6A 2QRLA 4ROSA 4XR9A 5EJ2A 1PWZA 3EGOA 3DHNA 3OJ0A 3VTZA 1Y81A 3FHLA 1HDYA 2GASA 5KVQA 2BKAA 4F3YA 5CAEA 3FNEA 4FS3A 2EKQA 2PH3A 4TKLA 1B16A 2B69A 3PEFA 3ETDA 3P2YA 4BNWA 4UVIA 4XJSA 1D7OA 2LDBA 3I9OA 4MKRA 3AK4A 1CQIA 2QIOA 5TF4A 4RJTA 3OQ1A 5ITWA 5EINA 3HDQA 4XGNA 2BLLA 3JV7A 2IEDA 3LC1O 1X7HA 5CDGA 2I9PA 4Q3NA 2BI7A 3JCZA 3DZIA 1IE3A 1BXKA 2EF1A 3DOOA 3JQBC 3AFNA 4MIYA 4BMSA 2D0IA 2Q2QA 3D3WA 3GRPA 1H6CA 3EVNA 3IQDB 5DBFA 4UVGA 2EW2A 2BMAA 4Q39A 3FRJA 1F06A 3KXDA 4NI5A 4PLTA 2NTNA 3DO5A 4RVSA 3GGGA 3TZQA 3UF0A 3H5AA 3IUPA 4M1QA 4P8RA 1QLJA 2FP4A 2ZB4A 4K1LA 5F5NA 2VRCD 3L6EA 3R3JA 3JQAB 4Y98A 2HUNA 1UXGA 4DQUA 2WDZA 1W6UA 2AA3A 4YBZA 5ICSA 1V35A 1PS9A 4BO2A 4ALMA 1HDXA 4YVFA 3FN4A 3B1JA 4RPGA 4BKQA 1J49A 1YL7A 4K28A 4XQGA 3B1KA 3NUGA 4FC6A 4F45A 1B14A 1EQ2A 5BSEA 3E8XA 1EE2A 2ZYDA 4FSHA 1WMBA 4RLSA 3JYPA 3F5QA 3JYOA 4Q3AA 5IDWA 1I0ZA 3DBHB 4XQEA 4CLOA 3CZMA 2YJZA 3PXXA 5F5LA 2Y93A 2JHGA 3INGA 4MIEA 4E5YA 1E6UA 2YDYA 5A02A 1GEGA 3TFOA 4EGFA 3JQAD 4E2XA 3NGLA 4DREA 3B20A 1I32A 3JYNA 4CV2A 3ICCA 3UOGA 1Q1NA 2C2YA 1H6AA 3K96A 1NXQA 2C20A 1BDMA 2IYOA 3OJOA 3JD4A 5JCJA 2QZZA 4TZTA 1XELA 3FNGA 2W2LA 1QYCA 2P9CA 2ILTA 4J4HA 3GFGA 5ES3A 2H6EA 4BNNA 4YWJA 4YAGA 2CMDA 2C82A 2X0JA 2EGHA 4A27A 4Z3DA 1WMAA 5TIIA 4CV3A 3QWAA 2ZJ0A 1VL6A 3IOYA 3OJLA 3D4OA 4FD3A 4HNHA 4IQGA 4QX6A 2RCYA 1YXMA 1NFRA
chains in the Genus database with same CATH superfamily
2IZZA 1WXEA 1FMLA 3DC7A 3H8VA 2Z2JA 3UWOA 3TMYA 4PNZA 4U4AA 4AF8A 1V6CA 4BNYA 1Z39A 1JR3E 1V8PA 1ZZGA 3GFQA 1NBMD 1QYDA 2JAUA 4QU5A 5FL3A 4BUZA 3REQA 2TECE 4ABYA 3OBIA 2OCDA 1REQB 1LGYA 4M83A 1D5CA 2PV7A 3HFGA 3BORA 2QWXA 5GY7A 5EHNA 1KYVA 1USIA 2P5UA 3FRHA 2XD4A 3U7HB 4O6VA 2F1RA 1Z5WA 3S2YA 2A9PA 3VU1A 3K1AB 3VAZA 3NHSA 2AJCA 1L0BA 5ITSA 4DYVA 2AC2A 1L7NA 4RLFA 5F12A 5F78A 5GTDA 2FZGA 1DZ3A 1E1MA 4GRAA 1HUQA 2C84A 3DAFA 4X90A 2G0AA 2Z4SA 2HRBA 1LPBB 3EZ2A 4BJHB 3F6CA 4OAPA 2D2EA 2VJOA 2NO5A 2JJ1D 2EP5A 4L22A 1J0AA 3CE6A 2BJHA 1XAJA 1AU9A 3IPRA 3OT1B 3IQWA 2IZ1A 1LRJA 1NZFA 2YW2A 4FLFA 4GICA 2D1TA 3LRXA 5CG1A 2PUCA 3GV0A 1NE2A 3B1VA 1SNYA 3HFSA 3QNUA 1MO2A 1MU0A 2VXBA 4I9HA 5EXDA 4AG3A 4Z3KA 1RCUA 4OYLA 5DNYB 1JF8A 4UZEA 1QO9A 3BZWA 2DPLA 4EJ2A 1JKFA 1RAAA 3H6KA 3CX6A 2XTNA 3E9MA 1DWPA 2V59A 4FOLA 1E66A 3EXG1 2HADA 4DR5B 2ID7A 1AKEA 3DDUA 4AG5A 2AH5A 1KYQA 2FRVA 5KHAA 1MAWA 1PTJC 2Y3IA 3LF2A 3H5WA 4I14A 5DO9A 1N7GA 2E6UX 2AYXA 4ZAXA 1QTNA 2FEMA 3EC7A 4L72A 3PS9A 4GI5A 4J76A 4LW8A 4QIHA 2OLEA 1JT2A 1QQ5A 3CJRA 4GEGA 1CNMA 4JJKA 4TWJA 1I01A 2ZPAA 3FKJA 3ZTWA 5AXCA 2ZWVA 1QHHB 1QC5B 3RBAA 4KGDA 3U48A 5B1YA 4DBVO 1JWLA 3KPVA 3EOZA 1CNFA 1CVLA 1WKBA 3NUZA 4ZPJA 5JAQA 1TVEA 3T5TA 3UK7A 1HPLA 2GJ9A 1JDBB 3I2HA 1QJ4A 5F76A 1RE0A 3G2HA 3BXHA 1LF5A 1Z4PX 2FQ1A 3K9GA 5JR3A 4DXAA 4EYOA 3N3AC 1QLHA 2IBSA 2NIPA 4KXWA 5BWNA 4X3OA 1NPYA 4AMYA 3K31A 2NV6A 2PXAA 2QMUA 1NW9B 1M6WA 1Q11A 1I7PA 2XB9A 4RF2A 1SZPA 4AAYA 1XZPA 2SCUA 3UJHA 4Z7JA 3GA5A 3C0KA 1Q2XA 1UANA 3OX3A 3PXUA 4DBZA 5I3CA 3QX8A 2GZHA 2R7NA 3TNJA 3KQLA 3D7LA 1D2GA 1L4HA 2H1CA 4NENB 5AICA 3WQBA 2R7MA 3UGKA 3Q6MA 2O1WA 3LD9A 5D3MA 5KBYA 3L79A 4KAAA 2HXYA 2NO6A 5CPFA 2VNHA 4YT2A 2IA5A 1QO0A 2YHBA 3E9NA 2SICE 1MV5A 3NHJA 3QVVA 3GN2A 1YGYA 3HDJA 3ZJ4A 4CM9A 1A71A 3LDGA 4Z2AA 1GN8A 4I36A 5CYGA 3E1KA 3O0DA 4GO1A 3SX2A 1NHGA 3AF3A 4NJMA 3D7NA 3VAAA 1X86B 1WETA 4KZPA 5BXQC 1BXZA 4EYKA 2R87A 4HPJB 4CG1A 3GLTA 1SMKA 3DW1X 3G85A 3OFJA 4MULA 5B37A 4Z3OA 1CKEA 1A8HA 2G40A 1AXGA 2JNWA 3GZ4A 4XYMA 3T9AA 4YJFA 2I66A 4B3DA 1Q7CA 5ILOA 3F8SA 2I6UA 4LV8B 4HRVA 1UDWA 4WW0A 2EOAA 4AZTA 2J30A 1GCIA 1LPOA 3PHCA 3C8DA 4YV2A 1M2GA 4MI1A 2V65A 3PV0A 4FIZA 1CSEE 2CUNA 2Q8PA 4CTMA 3KPWA 1AGRA 5AHXA 1IRIA 2UXBB 1LV7A 1OA1A 1YL5A 4FS8A 3PFHA 4C3UA 4PNHA 2HY7A 4A6PA 2PN1A 4KK4A 3WNZA 2VUTA 1GXSB 2EVWX 4P58A 4PXSA 4CDRA 4TLBA 3AZQA 1KWKA 4OLJA 1FTNA 2RBEA 4HDNB 3VKFA 4AMZA 3AX6A 2OQVA 2ZUDA 4PR3A 4RHCA 4Y0VA 1V45E 4BB6A 1O97D 2JC3A 4H7HA 4U5QA 3ANXA 1XNGA 4CN9A 3SLKA 3NT5A 1L7BA 1WUIS 2UUAB 3L1IA 4WPGA 4A6DA 3ACCA 4KQ2A 4Z86A 1WD5A 2VUHB 1SC1A 5KKAA 3VZRA 3L1KA 3NC1C 2HFJA 3FDZB 4QPJC 2REXB 3H2SA 1GGKA 4L2IB 4O2AB 3MN1A 1DQSA 2PEZA 4FHFA 3V6LA 2EKBA 4RA9A 5BP7A 1E3JA 2IUUA 1NQOA 2NAFA 1I51A 4DWJA 1EVQA 2WWWA 1QK4A 4TV9B 2OHVA 1E6EA 1T6YA 3EXFB 3MTIA 4M1ZA 2QL5A 1CQJB 5CK5A 1L5NA 4P4UA 1G41A 1FFEA 2NM0A 1SWWA 3C48A 2AG0A 1KC3A 1Q0UA 3GVCA 3GXOA 3IVMA 4L3VA 4ZT7A 2J3MA 3VXKA 1DRJA 4EHBA 1QZTA 4RMGA 5EMJA 4ETNA 5IJXA 3EAFA 1TEHA 3UH1A 4L5BA 4EUSA 3NR2A 4JBLA 3PRHA 4X62B 4CQMB 4DILA 5AVZA 3GEDA 4D3YA 3SJZA 4PONA 4ZJUA 4GYKA 1B93A 3QA9A 3C7CB 4WNYA 4H08A 1YC5A 1VJ0A 2WSIA 1N34B 3NHZA 3OIUA 2WD7A 4I50B 4OI1A 2B98A 1QHNA 1UC8A 2YHUA 3FOAA 3L46A 3QENA 3UMSA 2KSQA 1CHNA 5FWDA 4DDUA 4NXNB 1SUDA 3PQ8A 3NXSA 4ZI5A 3U62A 4F8JA 5CDYA 4JLDA 2PH5A 2D13A 2C4WA 5ALIA 2E5FA 4HAOA 3KTOA 4J0HA 1ONSA 4LNUB 3GC6A 3UHPA 3ZOKA 4DDKA 2UXCB 3LLMA 4QGHA 3PUYA 5AI0A 1KSFX 3CXUA 3KSMA 4HJRA 4YX9A 1B73A 3ZVRA 5HUHA 1SJ9A 2NTEA 3PUHA 4R3WA 4CIAA 1FFDA 4JC0A 4JGIA 3VTKA 5L51A 4ZVQA 2A14A 3W3AD 2D00A 1R4MA 2H63A 3BCUA 1POXA 2CXUA 2PRZA 4GC5A 1QR6A 4GZ3A 2QGZA 4IO0A 3WL7A 3BSSA 3ZZ1A 3KQSA 1DDOA 4I5GA 2B1JA 3OZGA 3A6GA 1E2PA 5DXFA 3UENA 4ZV7A 2YTZA 3WNQA 2QRQA 4RLQA 1NN5A 5SY4A 1OXUA 5EC8A 1TAHA 2C99A 4QOFA 3Q40A 3S2GA 3WYCA 4ZTUB 5EIFA 4Q4JB 4MQ4A 4RNDB 4UTRA 5K8IA 2YFYA 5L4SA 2G5PA 4NG5A 4P4GA 1H1TA 3NMUF 1AKTA 2OHHA 2R44A 4KWHA 2ADMA 3BFPA 3F4BA 3MILA 3MLAA 5K8LA 1T4CA 4CMIB 3M1LA 4CHGA 3NVMB 2HMWA 5C18A 1P75A 1G8JA 3TE7A 3WLEA 1Y1LA 4BO5A 1E69A 2GCOA 4EG0A 5CB0A 2QLJA 2EKDA 3IBTA 3HKEA 3MW8A 1ZP6A 2OD9A 4EL5A 4G1EB 4C87A 2VQDA 2O3JA 1FP4A 3GDFA 4Y2TA 3OM8A 2FKNA 2O2IA 3IMEA 1E6WA 1XEAA 2XXBA 1OXBB 3A25A 4HDRB 3SHOA 4WZBA 2YC4C 4F85A 5M04A 1DUIA 1PJRA 5LP6A 4WACA 1EUDA 1QAMA 2OC9A 2VOJA 2D2IA 2XQVA 1DDGA 1VKHA 4FGKA 4M37A 3F8WA 4PZEA 2HYDA 3DBIA 5A05A 3RYCA 2AXQA 4WCFA 5DLEA 4EB3A 4YJ3F 2Q9UA 5FO0A 3AM3A 3GFSA 4KUGA 4TTJA 2WHPA 1NUHA 4FE7A 4O2BB 1KEKA 3R2JA 1O0CA 4J29A 3HZRA 1NM5A 3UOWA 3PR1A 2PZAA 4OBBA 4KQFA 1NMZA 4H1HA 3TEFA 4Y2GA 5BQ3A 4KGZA 1RWMA 4BV8A 5FX2A 1DBSA 4G25A 3NS7A 4M7WA 4K6OA 1E1RD 2I6SA 2QJOA 3UGQA 5K3OA 3GZJA 5FQNA 1LB1B 1P18A 4DZZA 4KQEA 4LHZA 5JAOA 1R6AA 4JJEA 3STXA 2C00A 5DI3B 3V5NA 1HE1C 4R54A 5B3JA 5AXDA 1XPUA 4O4JA 5L4NA 3QI7A 1NT4A 4DIEA 3U16A 3LDUA 1BE0A 3FLMA 1NKVA 1TUBB 4XGIA 1FX1A 3F9IA 4B6JA 3V6MA 2N0SA 4HNVA 5BVGB 3N8GA 4IICA 1UBRS 5DPMA 4MP6A 3RANA 3W7AA 3O8LA 4CHTA 3MAJA 4F1JA 3A4LA 3L1HA 4OREX 5H80A 3BXPA 3AFIA 5FBZA 3MA0A 2XB2A 3KS9A 4GPAA 1G8HA 4EAQA 2IK8A 3RTDA 4F71A 4OFZA 1UJBA 1ZNZA 3KOOA 4EEXA 3IYLW 1OLXB 3OHMA 4X97A 4HFMA 5EQJB 3KEQA 1BX0A 3I01M 4H35A 2O19A 3V32A 3ED5A 2EW8A 2VSOA 4D97A 2N46A 1PP4A 1S9DA 3AB3A 3KKEA 4R1SA 2JLWA 1C41A 2O8EB 1T0JB 1FW6A 5IG2A 2Y71A 4JJAA 6CHYA 4Q01A 1NLUA 1V5WA 1UZNA 1Q1EA 4M7OA 1XWWA 4G0NA 1EAYA 1ZD8A 1PVOA 1BIFA 1D1PA 1E0SA 3VPCA 1M2OB 3PFNA 4AJHA 4KMRA 1QZ3A 4FDAA 3DZFA 4RDIA 2O8DB 4B4WA 4XJVA 4QGFA 2OP0A 1CS0B 1IONA 4CM9D 3ISJA 4REOA 4DIKA 5C37A 3ENKA 1T8RA 1Y8QA 4C4AA 3VA7A 2XUOA 5DH9A 1PWEA 5CIWA 3HGTA 1F2UA 1UBEA 4CEJA 1IK6A 3RS9A 3IELA 4M38A 4MCAA 4OL9A 4CMBA 2QVXX 1JHDA 2ZYVX 2YWCA 3TLCA 2GHRA 3JAWB 3P19A 2FUNB 4AJEA 3R0JA 2DAPA 4UVHA 1R6BX 4CF3A 4DR1B 5DM4A 5F3WB 5LWQA 2AI1A 2W6CX 4CM6A 9ATCA 1ZHFA 3JARB 4Z6KA 1DU4A 3MS7A 3NB0A 1NBIA 5E9WA 1OV4A 2CLLB 3NOQA 1BKYA 5REQB 5EUQB 1OASA 1N3LA 3OM0A 4BMYA 1ODFA 2IXAA 3N59A 3NTQA 4OOEA 3SFVA 3X0DA 4B79A 3AKDA 1W0CA 4WNAA 4DA7A 4Y2JA 3H11A 5LXTB 1CRZA 3LDFA 2NU7A 2VSYA 2RI0A 3C3AA 1SQ5A 5IZ4A 2AOWA 3KZ1E 3U3OA 1CF2O 3K20A 5HNKA 1T9HA 1PRYA 1TIBA 4IXMA 3JQGA 1SGWA 2W2QA 2FE1A 2X76A 2IXFA 2PX0A 2ZIFA 3IESA 1O95D 3NBUA 1KORA 1P7PA 1R88A 3SHVA 4CTJA 1M6HA 2ORVA 1RHRA 1XLUA 1HM5A 1GUBA 3GIWA 1N6LA 3MMNA 4P4TA 3QU2A 4X41A 1Q50A 2W2OA 3O92A 4B47A 3QFHA 3N2KB 621PA 2FVYA 1VPDA 3CPEA 3EEQA 3FVVA 3T7KA 4B71A 3FMPB 4RVCA 5J2TA 2Z8ZA 2UU9B 1RQGA 3Q2KA 2IY7A 5E2IA 1U7PA 5AVXA 3ZZUA 2W00A 3ZU5A 1JNYA 5SY9A 3B7PA 5JHGB 2VDMB 4D46A 1D8TA 4Q0MA 1E7WA 5C3UA 2P8SA 1QH8A 1RI1A 2WP8J 3O8OB 4NBNA 2EJWA 2O1SA 3H9GA 1H2HA 4X7RA 4IHJA 3S40A 4DUGD 4UAJA 6Q21A 1BEUB 1EM8B 1OPRA 1DXHA 1Z8FA 2VDOB 3RWBA 3VNBA 1JE1A 2F9FA 5M5BA 4EY8A 4QJ3A 2QAIA 3RYFB 4F8YA 1Z2EA 1KS9A 1S3GA 2C5GA 2WTNA 3ZCPA 4K0KB 3A36A 4Q4LA 2FX2A 3ZDRA 4D92A 3I5MA 4JAVC 1NMEA 1VYHA 2C7VA 2H1LA 2XYVA 2YWJA 4KIWA 3DWGA 1OX6A 4EY7A 3DKIA 4X1YA 5BWLA 1I6MA 4HR7A 4X7PA 1W93A 2ZWMA 2BFCA 3QPUA 5ERYA 1D1QA 3R7SA 1X39A 2A78A 4ZPXA 4EPYA 1JHRA 2I34A 3EFOA 2I3ZA 5CVDA 3JD3A 3KSAC 3L7AA 1U28A 2B1IA 1UKZA 4HSEA 3MUEA 1SUAA 1LVHA 3WFJA 5JRJA 2WD8A 1E2HA 2FR1A 4CI9A 3E4CA 1CR4A 4XSHA 4GYYA 4YI5A 2C94A 3JW8A 2XMPA 3G5AA 1IOZA 4ZGWA 4Q7QA 3AV0B 1XV5A 4ARVA 1MORA 2MIIA 3Q3IA 4LY3A 3UJ3X 4F2PA 1GZ7A 2Z4RA 2P6RA 3VKHA 3QLUA 4ALIA 1A88A 3QM1A 1A7KA 1C7RA 1EB8A 2OMEA 4JDUA 3KM0A 4KQCA 4QPPA 3NPAA 5ESWA 2XYPA 2MR6A 5KU1A 3ITDA 1WQ3A 3CVWA 4LDAA 3NT4A 3KUDA 4JP2A 4UJ5A 4R16A 3LT2A 5DBIA 1WBDA 2YRWA 3S2FA 2C1XA 4A2CA 2ORED 4TS9A 5ALWA 4M1OA 5FIUA 4BFSA 2W6PA 3ZWQA 5JI3E 3H65A 3ML1A 1G8MA 3ZC3A 1B8VA 1L4GA 3QA3E 4CFSA 3DBLB 3IBYA 4LE1A 4N7MA 4C7OA 1HV8A 2MJLA 5IJ0A 1Y6ZA 2QT9A 3X1JA 5JS1A 1BX1A 4KRYA 4FGJA 1XYGA 1JBEA 5HRAA 2JEOA 4OGFA 2NQ2C 5CJ2A 1EFUA 4LZNA 1UJCA 4ZCLA 4HDMB 4RXMA 4CXMA 1O5TA 4GKAA 1H2YA 2NGRA 1R0BA 1K6XA 2XTZA 3BJMA 1KH2A 3WBJA 2WSMA 3A1DA 3ICPA 3OPMA 3GFFA 3IKTA 1EMDA 2IXDA 4PVCA 5TY0A 2B6NA 4LAFA 5TEWA 3TLBA 2A1TR 3U1TA 1N6PA 4RE5A 5B7NA 4DLXA 4EKEA 2ZUUA 2P27A 5AD1A 2BEKA 5KDDA 1Z4MA 3SXUA 4JITA 1ZD1A 3JX9A 3AHDA 5IMBA 4A5OA 1H5UA 2IP1A 2JLQA 2PEYA 5CXUA 4ZC8A 4Q3EA 4ZQIA 3TLZA 2PRSA 3AONB 2HA7A 5HFNA 1L5HB 3AXTA 2IF0A 1BYIA 5EHZA 3TZHA 1HRDA 1M34A 2PNFA 3F3SA 4DYDA 1N2XA 1AZTA 4Z0NA 1LU9A 1P91A 3RVRA 3MHPA 5ALZA 3BB1A 2DPGA 1OYWA 1RHUA 2YHIB 3H99A 4MQFB 2WNSA 4S0ZA 3WYAA 4BFLA 1NMSA 4E15A 3K30A 2Y76A 2BKLA 3UCXA 1RKQA 1PR1A 2ADOA 3AHGA 2LP4Y 3KVNA 3M4XA 3MT8A 4KO4S 5DOVA 2HCBA 1MDFA 4HUJA 3O8NA 2OVFA 4G24A 1E5LA 1N2OA 2HMYB 3G9XA 5T4BA 3AZPA 2OHIA 3AESA 3O47A 1R0CA 2G82A 2I7CA 2VXCA 5FL7A 5H1YA 2JLVA 2H4XA 4RV4A 1U04A 3WIUA 2Q8QA 5EJFA 3QFRA 4G86A 3H0KA 2XE8A 4UARA 1G64A 4ZDWA 2ZIAA 1HE3A 4PHGA 3EDOA 3WRVA 1VI2A 4J0FA 4R1NA 3H8SA 5J1TB 1L1FA 3NRBA 4G0ZA 3VOBA 4S05A 3PXBA 3SC2B 4QAQA 3AFOA 3JQGB 3P45A 4KX3A 2G9VA 1L1QA 2DKOA 1GGVA 2PZ8A 3OJWA 3HYCA 3LHSA 1XD8A 4U1RA 4RIFA 5E6RA 3ELWA 3FBTA 2IFTA 4YMTA 1XIVA 4K9NA 2PUJA 4R3UC 1VI5A 3PWZA 3J7AC 4P5EA 3FSGA 4JLJA 4F7DA 5ALYA 2RGBA 2FPRA 2OILA 1Z6YA 3CRVA 3F6EX 4PYMA 3C1AA 5ANRB 2QUHA 3T1OA 1N32B 1LLUA 1UZAA 4YRCA 4TLAA 3UVEA 5JNSA 1XCBA 4C0SA 4JUAA 3S3TA 2X5NA 4HTFB 1QKKA 4KQWA 3T4UA 3WYNA 4UUOA 3DC2A 1C9KA 3HA2A 2BGTA 3DXYA 2C88A 3M82A 4B3JA 4LOKA 3L5OA 4AWAA 2OGUA 3L1JA 3FCEA 2UZ3A 2JF0A 3O38A 5KWJA 3PJRA 4L9SA 3RWOA 1R6UA 2I8CA 4L5JA 3KJNA 4XCVA 2ZI7A 3RTBA 4EM6A 5BRNA 2NP7A 2XCOA 2QI9F 4FFNA 2QTLA 3BB4A 4S1OA 4PGFA 3RC1A 3V4SA 4A8HA 3HBMA 721PA 4F92B 3CNEA 3AW8A 1EFVB 3PYLA 4ETWA 2KE5A 3LVFO 3K6SA 4KH0A 1XD2A 2OB2A 2HCTA 1R74A 4FZ3A 4CJXA 4KNWA 2ZT8A 2CFSA 2JLYA 4Q6WA 5KYYA 3KTAA 5KVSA 1T26A 3QHQA 4J7UA 3DM9B 1JLSA 4G8CA 5B7PA 1U2QA 3ZDCA 5FWYA 4O59O 5EEGA 2NU6A 1HZZC 2UYQA 4DVJA 5ITZB 4GG1A 3EPRA 2H1SA 3PENA 4O08A 4MI9A 2OECA 5IUNC 2AVDA 3NJRA 3A4MA 3ORYA 1WHSA 1UEXC 3CLVA 3FBWA 3SNHA 3OWOA 1NR5A 1C4WA 3I9NA 3WWYA 1P4SA 1U2ZA 3ZIUA 1EI9A 2WHQA 2Q1YA 3AJAA 3UYLA 3OF5A 5E1OA 4UOEA 1DBRA 3ITNA 3NYWA 3RYTC 3E7FA 2WWYA 4C0HA 2L2QA 2CXQA 4J90A 1TRHA 2J4FA 3LQ2A 4AWXA 3RK4A 1JEOA 3E3AA 3RUIA 3KZNA 1X7XB 5K3BA 1E8MA 4UBMA 1MPXA 3KJGA 5A4KA 4F4CA 3OIYA 4XM1A 5FBLB 2ZYTX 3I8SA 2OA0A 4DWOA 4BRWA 2VOEA 2WHXA 3IALA 4KWIA 5BVHB 1ZH8A 2XMDA 4UBNA 2UVPB 1ZA1A 2PS0A 2YVLA 3BILA 4BNLA 1BROA 2C07A 2ZXUA 1PDWA 3BTVA 2XBLA 3EIQA 4LI0A 3W6OA 4V1CA 4PCUA 1E5DA 2TMDA 3QG5A 4IIFA 1RYHA 3V4FA 4A3SA 5HIIA 4PFKA 3KLNA 4A15A 2C03A 2REOA 4JOCA 1I2CA 3UMGA 2Y05A 2ATEA 2EHDA 5CLFA 4MRMA 1GUZA 1W76A 4U6NA 1JFFA 3ZI0A 4B6SA 4UBLA 1JR3A 2WZBA 3QLJA 1N2CB 3EXEA 1E92A 3FVWA 2IUEA 1ST3A 1Q0RA 4RE6A 5K0BA 1YQTA 4JQZA 2RGUA 2WT4A 5AW6A 3OZXA 3QE0A 4Q9NA 4AG6A 2G88A 5DULA 2WIJA 2IUFA 1WM1A 3QKRB 4MUNA 3B89A 4PC1A 1X70A 2IYYA 3HCRA 2I33A 4MMZB 3TK1A 4E5PA 1ZJWA 3A3OA 3H05A 5KO2A 1QYRA 2VPPA 1O5IA 4P0TA 4ENSA 2XUAA 1WDKA 3N9IA 4BC1A 2Z6QA 3FGOA 5KTRA 2QDKA 3QBJA 2O5RA 1U9YA 3BZUA 4ESVA 4Y0NA 3LQ4A 4GZ5A 1YJ5A 3UFBA 1YQDA 2XW6A 1IMOA 1W581 1C7EA 1GZVA 1H23A 3KZMA 1HSOA 2ZVQX 3IPYA 3B9BA 4TT8A 3SE0A 1ONNA 1XALA 1CJKC 2AZ4A 4L9WA 4RY2A 4ENPA 1NVAA 4MWBA 2PD4A 1SVNA 3BIXA 1BMDA 1G8FA 3NV9A 3RYHA 5J47A 4XH9B 3OG9A 3WFZA 2IYNA 3U44B 1VYUA 3SQWA 5C7LO 4QQ8A 3BTUA 3CLUC 4TL8A 2J32A 3E82A 2BOVA 1XF1A 4H31A 1KZ1A 2JHCA 4M89A 5D00A 4BB9A 5T67A 2C5EA 2PMDA 2Q4BA 1N2GA 4HDKB 1E9SA 4TGLA 1CETA 3ZQJA 1CJTC 2YZGA 3BMNA 4H59A 4ODIA 5DM2A 2G07A 4OO3A 2WIDA 5F5XA 3V9AA 4DMFA 3Q3GE 2IW3A 3P0JA 2H1RA 2PBLA 1VGVA 2VBFA 2VNAA 4HQKA 1Z7GA 3V2IA 4CNBA 3HA5A 4XIFA 4FQ7A 1NY6A 4O3MA 1M2FA 4GOKA 3EVZA 2OGZA 4GPZA 3O4HA 4I2VA 4HXGA 4Z7QB 1Q0PA 4FOOA 3C1TA 4HWSA 1GCOA 3I04M 5H9VA 3WRWA 4HVAA 4K86A 3G8CA 3ZH2A 3UKDA 1NLYA 2AI3A 3K1TA 3TBFA 3HLKA 3NYIA 1GU1A 2XBMA 3C3MA 5EUCA 2FZLA 4IIHA 4I4IA 2JCXA 1JLKA 2V6BA 4MRPA 2ZTLA 4PG4A 3WGOA 3HY6A 2GLTA 2OO5C 1XC7A 3BFJA 4CLDA 5DYNA 1YFLA 1S2OA 4PF1A 2HA2A 1K66A 2IH5A 5LOVF 3VKGA 1YCHA 2VZ9A 1PZXA 3MQ2A 5F21A 4GOND 3CF4A 5FL7D 4FC7A 4CF7A 3QVSA 3TM5A 2Z8XA 4PYJA 1GL3A 2BGKA 3RJ9A 2NXJA 3G9TA 2G1UA 3R3VA 3PPIA 2B8TA 4Y3UA 3EMKA 4GGMX 4OSPA 4EGCB 4NJEB 1KAGA 2YQ4A 3N05A 4FYPA 3W8NA 3QPCA 1SC4A 2P9TA 4O4JF 4M0UA 4WY8A 1WCWA 5I01A 1FMTA 4C0KA 4X6UA 2GD6A 3TKYA 3VSDA 1VLVA 5LQUA 4RZUA 1HNZB 2E49A 4P5DA 1ORIA 4WN9B 2OCPA 1FSZA 1O9HA 3KX2A 3O1JC 4L8YA 5IP5A 3FYSA 1UUFA 2QT0A 4GKBA 3UPTA 3HXKA 1YK0A 3AILA 3IA2A 4LXQA 4CNQA 5K03A 1O87A 2V7VA 3KQPA 4TT3A 4LF9B 1F5NA 3KJHA 4H17A 3FSGD 4ZODA 3G0GA 2F3TA 3BWDD 5DV9A 1UL1X 1BVRA 1AHNA 4UM8B 2PYDA 5AKJA 4EYEA 1QTQA 2C97A 1IUPA 4W8OA 1OCEA 2X4GA 2ZWPA 4EB0A 1CUVA 2NUPA 1ZGJA 3BRWA 1W96A 2QS9A 1K27A 2ZYSA 2UV8A 1LJ8A 1Z74A 3T5BA 2MMGA 1QGYA 4LISA 3LW7A 4QOIA 2Z1MA 4KNYA 1H5NA 4HYTA 1S7GA 2Y1EA 5JV5A 1XN4A 2YKGA 2JAQA 3M5PA 4QOJA 5A1TA 3VPDA 5HYVA 5IAKA 5DF1A 2O3TA 1SH7A 4RPIA 4X54A 3TTXA 1YK1A 4WKNA 4DLLA 6LDHA 1LTQA 1FQKA 5JEDA 1BMFA 3EGWA 4NS1A 5EWMA 4AICA 2LD4A 1JMKC 1JDPA 1K5GA 2WJAA 4BO0A 3LQ1A 4OQMA 5HFAA 1E1QA 4YCSA 2GFIA 1G59A 4UHHA 4QBHA 3U56A 3NRCA 3SVTA 2KQUA 2OV1A 1NPTO 3JWPA 5SZJA 4HKTA 3ZHRA 5AVRA 5GJBA 5E6UA 4UUNA 4CG3A 1J70A 1PJSA 4PTYA 3QNWA 2IPAB 1Y98A 4XLTA 4XB2A 1CIJA 2COEA 1WPXA 3AETA 3HBFA 4F4FA 1YQEA 4BY9E 4LF5B 3OEYA 5EPEA 2O2GA 2Y67A 2G4VA 1AE1A 4NYMR 3DMFA 4RXUA 3K8QA 4P82A 2XX3A 5TX7A 1SUFA 2HPHA 4H7KA 5HUQA 2MU1A 3R3SA 5JQGF 1QV9A 1MOZA 3OJXA 3Q7RA 4PZZA 1HDIA 4HYEA 3VJRA 4RS4A 1U98A 2C9CA 3U09A 2FEXA 2QMZA 2W2LD 4BQIA 4I1PA 1O6FA 4AMBA 1UADA 5JWHA 4KV9A 3WMRA 3ZHQA 4DCVA 3LRPA 1QGUB 3IUQA 5MFPA 3NETA 3DWIA 2YS6A 1SKQA 3WTBA 1TZBA 2QY9A 1DJPA 4KYVA 3ZCXA 2W4MA 2OAGA 4H6VA 4OFWA 4HX9A 1KFCB 1SBHA 4BJ3A 2B35A 5JVDA 1VL5A 5U9CA 1Z5ZA 5F3DA 3IDSA 2E4VA 3T7IA 1U9IA 2XTMA 3OQHA 1G60A 3AEKB 3AERB 3CIOA 4UTPA 1ACJA 1T8TA 4BQFA 2ATXA 3K6RA 3I2JA 4OHBA 4QXAA 5E38A 3A6PC 3M1IA 1E1CB 4MWOA 3E18A 2OP1A 2WZQA 4GBED 2NADA 1OZ0A 2GFHA 2ZM6B 1XR3A 3S5JA 4L57A 1WPRA 5FNVF 2IEAA 4ZQHA 3LYUA 2AJBA 4NDNE 1U7OA 1SBNE 2JHAA 3NHPA 1IEVA 1JR3D 4INZA 3GH3A 2PUVA 3AVXA 3L0PA 4RLHA 2VTVA 4O4IA 4X1IB 4AUNA 1KAOA 1YJ8A 1P19A 5C1IA 3J80A 3INYA 8AT1A 4FFBA 2R6FA 1ZMTA 5HOEA 3BMNB 4GX5A 1RI3A 3BH7A 1HK7A 4N40A 1L5LA 5EHGA 2V5UA 1UMBB 3VZCA 2DUNA 5JCZA 1ZI9A 4Z4GA 1NRJB 1ZW6A 4HWTA 4CV0A 3QBEA 4BKUA 3T4XA 2RGAA 3PDCA 3QEKA 5LL6P 4OPMA 3ELUA 1WBBA 1BDIA 5A4JA 2HV9A 4MV1A 5JNVA 2HF8A 2ZTHA 1K7CA 1XVLA 2C1ZA 2BT4A 3E1SA 5EFZA 1K7FB 1LD3A 2GAIA 5DYWA 3CG0A 3WMWA 3CZ9A 2JKVA 3K0CC 3NKLA 5A3RA 3PICA 2OKGA 1TLFA 3L8HA 4CF4A 2JAHA 2PLNA 1FB5A 2W9XA 1KU0A 3ER9A 3DFIA 3CZRA 1KAEA 2ZDHA 2QTCA 3QEAZ 1IY2A 3IQGX 3NU1A 4RNCA 4C2BA 3G9ZA 2PO5A 4XRGA 4JUCA 4IM7A 1Z36A 4G4SO 1W88B 2CSUA 1MC5A 2Q29A 3F5MA 4PFSA 4KN8A 4R7GA 3TTWA 1WIWA 2N3ZA 5JD5A 4K03A 3WI7A 3ROQA 1EVZA 4TRNA 5FO1A 3ZJTA 4E08A 5FP0A 3WJ7A 1FDRA 4ZZ3A 3HYLA 1B0UA 2VJLA 5H16A 1T1EA 5CYFA 3U4DA 3N2YA 4PLYA 1CF9A 3MPUA 3G0HA 4JFRA 1OA0A 3UYKA 2ZUSA 5AJHA 4ZGGA 1ORHA 1ZRNA 3JATB 2D1FA 3DEHA 2RKWA 3EBOA 1UEJA 1UPUA 3C5HA 4FI3F 5E9JA 3NDJA 5DWVA 1MQSA 1P61B 3FGZA 1A8SA 3H0EA 1UDRA 4DIOA 3SYRA 3T3OA 3N6XA 1Q77A 1P1HA 2WQ7A 3GD5A 1PWYE 2P5TB 4LS3A 4REMA 2JPDA 4C0BA 1KVUA 2Z3WA 3OQPA 4A2QA 2AFIA 2FPMA 1ZM9A 3OCWA 1DC5A 4MWEA 2M6LA 3S1AB 4BVBA 5EJ8A 2KI5A 5EPOA 3ZWWA 4UXJA 1R8YA 3LT5A 1FTSA 3QE3A 4G9EA 4NU8X 1KJ8A 1A27A 2A0YA 4CL3A 1MJGA 2PZEA 2ZB7A 2CLFB 4RD1A 1Y37A 3S27A 3VSAA 4C14A 3HV0A 5EUBA 5EL0A 3SYTA 1FVHA 5A5FA 1XA3A 3HVKA 3L40A 4CKBB 1WVIA 3I2GA 4G1MB 1Y4ZA 5ADUS 4UEOA 3KVOA 2IGBA 2OWEA 3GELA 2NT4A 3PRJA 1DRUA 5CURA 2P2DA 5L3QB 4B0PA 1H8HD 4Y2RA 3PK0A 5CA0A 3OPYA 4WK4B 1ADYA 3VYWA 5IAAA 6AT1A 1BE1A 3CUEF 3I72A 4ZMBA 2WNIA 4UATA 2WLTA 4XTCS 2NSJA 3C39A 1V48A 3TJZA 1N5OX 1KI6B 3IAHA 1HQCA 3CUKA 3ROEA 3TQCA 3ZHBA 4ZK2A 2G77B 3U60B 2GRJA 3ANMA 1DOZA 5BUZA 2CLDX 4C7BA 2CDNA 3HR4A 2JZOA 3WYEA 2DU8A 4WDQA 1XEXB 3ACBA 3NIWA 3U7IA 2XVMA 2C5LA 1ZIOA 1TKAA 2JGEA 2H4YA 4UDYX 3ZV4A 2VS1A 5AIBA 4O29A 2K6GA 3SKYA 1PQPA 1V9SA 1FSPA 3DEYX 3TR6A 1X0XA 2JFGA 2SBTA 3BD8A 2C98A 4B35A 3WGJA 4AI6A 1EP9A 4U2DA 2H65A 2BGGA 1OT3A 3HU1A 5BT9A 5JJLA 4D43A 4Z0HO 3ZEAA 3LSYA 3CF6R 4D3XA 3W2FA 1TXGA 1OT5A 2E21A 5E3JA 3RUHA 1SC3A 2BEWB 2C2HA 4FP9A 2ISSD 4MW6A 1PSDA 1VPLA 2ZJ3A 4X60A 3R5KA 5T4HA 3I9FA 1ABBA 3TG2A 5HFJA 2WM9B 1TUEA 2BD0A 1DQYA 5EHIA 4MLPA 4BL5A 1KI7A 3KOMA 1YDWA 2AD5A 5L7YA 4BGUA 1GAXA 4DCTA 3QSGA 3HA3A 2BE9A 3OP1A 3SFTA 5BWBA 2E37A 1GNPA 3JWGA 1V1RB 2OBLA 1X8XA 1Z0DA 3GNQA 1BMFD 1M8GA 4HTAA 2OYCA 1FSGA 1TTHA 3G1TA 3GYBA 3PHGA 3NBMA 4HX2A 4MSUA 2Y6VA 2DUWA 4F9EA 3EGDB 4JNCA 5T6BA 4UEWA 2QXTA 3TW4A 4WZAA 1JG1A 3NC0C 4WK0B 2HTEA 3RU7A 5KSOA 3V8VA 4BN4A 4YIHA 4C21A 1E63A 4D9JA 2DFNA 4YXWD 5KNLA 3AIOA 3ZHOA 1ZSYA 3CNLA 1EVYA 1IN7A 1P77A 4RSGA 1I7QB 2P91A 3G2KA 3NKFA 2E1RA 4JU9A 2P9EA 2EG5A 2P5YA 2P9QA 2B7CA 4R83A 4AVYA 5F7XA 1XI2A 3I0MA 3ZE7A 2NVBA 5I45A 4JJ4A 2FH5B 3RIXA 1E3MA 3RRMA 3M5CA 1W36C 5EE1A 2H7YA 2ARKA 1ZN7A 1U4SA 1N8KA 3D6VA 1WTCA 3M6FA 3PJFA 4FW8A 4XR4A 1DKLA 1MR3F 3C1UA 2Z5GA 3OPNA 4NMXB 1PX0A 2ZUVA 2VF2A 3E9DA 3DV0B 1WULS 2XQIA 1XUOA 2CWWA 3DYBA 1K97A 2NVOA 3ZYCA 4CTNA 3A6JA 3JQ8B 2XNHA 4DSUA 2Q4OA 3FWYA 5HSGA 3QU7A 3SI7A 3LGXA 2OZLB 4I3FA 3RI3A 3HUFA 2ZYGA 3I0NA 3I42A 3ROGA 4E0BA 5BV0A 2ZRIA 4ZA2A 3ZV3A 4PXAA 3PQDA 4KFTA 4YROA 4N48A 2DFLA 2IHUA 2WVHA 1WVGA 1PL6A 1RKBA 1TJ4A 3WLSA 3SFZA 1DAKA 5BOSB 1YFZA 1W8DA 2BMEA 2O06A 5EXSA 1QBKC 5BQ5A 3HSSA 1XU4A 2O8CA 1CG6A 4UNQA 2IOQA 1EJ6A 1V1JA 4MW5A 4DR6B 4HVCA 1DQZA 1E2LA 1IZ9A 1FDOA 1HF3A 2APJA 4CL0A 3FOFC 1JZTA 4NYJR 1OIXA 1WEKA 4RBNA 3RSCA 3ZWPA 3ONDA 2HU8A 5TDHA 4ENWA 5BWMA 2ODWA 1GVHA 1SHTX 2AG1A 1IWOA 4G56A 2XZTA 3CV3A 4OL0A 3SDZA 5JWRA 3DE0X 4IBOA 3MUOA 4FYXA 5JJ5A 1J2RA 1ONBA 1HH4A 3C6MA 4PQYA 2B4TO 2EARA 4I5EA 3E22B 1LBQA 3HZZA 4NY1A 2FUG6 4X84A 3TINA 5DNWA 4N3GA 2QVGA 4XGRA 2ZVPX 5BWOA 3E27A 1JECA 2YV1A 4EVSA 3LP6A 4ZAWA 1XKXA 4Q1EA 2BGWA 1J8VA 4F6RB 3OHSX 2QORA 3QVGB 4BRUA 4CFZA 3O75A 4RULA 3NONA 4M0KA 1ADJA 1UFVA 5A4FS 3KKQA 3EX7C 1V4VA 2CJYA 821PA 1IJFA 5EZ6B 1U9JA 3I5UA 4RFSA 3HWSA 2B99A 3OEHA 4PFQA 4F4JA 3FYCA 4F9FA 1QCDA 4JR2A 4OQNA 4X7MA 3U4HA 1Z0SA 3NOVA 3DHYA 2CBGA 2NPOA 3WTCA 5TPZA 5FOUA 3MJFA 2G4LA 3VDRA 1PJCA 4YCMA 3MJDA 1PG5A 4UD2A 3HLTA 4I1SA 1MA0A 4ITVA 4MDEA 1PU2A 1XFDA 2KS6A 1FJHA 2Y99A 1NNI1 1U99A 2DTDA 2DM6A 2J4DA 3ECSA 1LF0A 2Y2VA 1DT5A 2FFJA 4MVJF 3X44A 1FFSA 3BHIA 4PRLA 2QSUA 1SCNE 2RHDA 4L85A 5M29A 3BS4A 1I1QB 1U2TA 2MYPA 2F3RA 3ZD9A 3NM6B 2E18A 1PZHA 1XTUA 3LPCA 1SKYE 5J2UB 3CONA 3OIDA 4HVLA 2FG7C 2WI8A 1JSXA 3PEYA 2WSYB 5CLJA 3F97A 2GN0A 2WMYA 3GP5A 2ZXFA 3OFKA 1W9HA 4RAOA 1CY6A 7MDHA 2QZJA 4M0CA 2TYSB 5ESXA 3SIRA 1Z2CA 3COPA 1KMQA 4QBIA 5GPBA 2RIRA 1N5JA 3B8HA 4X63A 1KYWA 4TKVB 1NXTA 1XZBA 1T2AA 1QM5A 1XLTA 3T0GA 1NOJA 1W4ZA 3D9QX 1E96A 3ORHA 1QE3A 2R65A 4HN9A 3UANA 4XWWA 5KYWB 1R15A 3RU3A 4B6EA 2H1IA 3E03A 4G97A 1WSBA 1T9KA 1U2EA 2QN9A 2VCHA 3BJRA 1WNTA 2OLKA 1XG5A 3CZ5A 4HO1X 4MCHA 2ECQA 1QR2A 1Z73A 3Q5EA 5BSMA 3UB4A 4BLSA 1U2GC 3N28A 2VPYA 4GZ6A 3BQNB 1DUSA 3KQNA 2BGRA 3X1XA 1F60A 2J41A 2B2NA 4QDKA 1FXUA 3OQBA 4R2HA 2OR3A 2Z9BA 3BPSA 4W63A 5D87A 5KSYA 4M7PA 4CEHA 4JB8A 4LE2A 1NXPA 4OP2A 5FORA 5A4DA 2HIGA 2WZDA 3NOXA 3ZXXA 5KSWB 3ND6A 5KX5B 4Y9DA 4AZ0B 4Q7MB 4R84A 2C78A 4B8ZA 2H7XA 4HMQA 4E4RA 4HNGA 4BHTA 3SKVA 1NKTA 1VJCA 2CEKA 4OMUA 1D2RA 4IVQA 3HADA 1KZYC 3IE1A