3C3MA

Crystal structure of the n-terminal domain of response regulator receiver protein from methanoculleus marisnigri jr1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
123
structure length
123
Chain Sequence
b'SLYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDPATRDIPVLMLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver protein
molecule tags Signaling protein
source organism Methanoculleus marisnigri jr1
publication title Crystal structure of the N-terminal domain of response regulator receiver protein from Methanoculleus marisnigri JR1.
rcsb
total genus 35
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c3mA00
2FN9A 5EWJB 1I3CA 4MS4B 1LJUA 5D2CA 2I6FA 3GWGA 3IDOA 2QSJA 3SY8A 5KI6A 1EAYA 4RXUA 4CBVA 3T8YA 4JB2A 1J56A 2B1JA 2IPLA 4LE2A 1YMUA 1M2FA 2PUCA 2M98A 1PNTA 3D02A 4OBBA 5FWXA 2WJWA 4F3TA 3JTEA 2JK1A 5KQLA 2JB9A 5FWXB 4G0MA 1MIHA 1E2BA 4NCAA 4WUTA 3N0WA 1YS6A 4IILA 3QLVA 3IP9A 1QPZA 4IRXA 4YGXB 3RVOA 2HQRA 4QICA 4YRZA 5IEJA 4OLAA 1D2AA 4S04A 4ETMA 3C3MA 3CG0A 3KTOA 1ZGZA 2FSPA 1P8AA 3DZDA 4MS4A 1B00A 4DADA 3H5TA 3LUKA 2CD7A 3BRQA 4RK5A 2R47A 2HQBA 2LP4Y 2GKGA 3QLUA 3QELA 5CNKA 4Z9BA 4MPTA 1DRJA 3LFTA 4JA2A 3H75A 3KKEA 5E3JA 3C97A 1U2PA 2KYRA 1L5ZA 3CS3A 5JNRA 4LX8A 4RXMA 1PUXA 2FVYA 4NCBA 2ID9A 2FMIA 3QLVC 5I4CA 5T3YA 3HVRA 1W9HA 4MS3A 4D6XA 3M9XA 3N8IA 5TPZD 3HO1A 5TPWA 1DRKA 1ZGGA 2WY2D 2QVGA 3H1FA 3TO5A 3D8UA 4MRMA 3TMYA 2PUEA 3SQNA 3SG0A 1JDPA 2FQWA 3FMVA 2IOYA 3OLVA 1DBQA 1TMYA 1KMIY 3QX9A 4F06A 3G85A 1KGSA 3BREA 2MYPA 2IKSA 3QEKA 4ZMSA 1JF8A 4F12A 4RY8A 2FQYA 3N53A 4G97A 3HK2A 1JH9A 1FSPA 2XDYA 3LUJA 1A0OA 1VLZA 1ZY2A 1ZESA 5CNJA 2L17A 2QVCA 4KNYA 1USKA 2IPNA 1U8TA 2RJOA 1JLKA 5JNTA 5TQJA 2PKXA 3URMA 4XARA 5DKFA 1Z13A 2PE5A 1NY5A 1RNLA 2B4AA 3O1IC 3ROTA 3CZCA 3LUAA 3NNNA 3HV2A 1YIOA 4YP9A 4RK0A 3KLOA 3HM9A 1S8NA 2PUBA 3KYJB 3F73A 3DLHA 3T38A 2CWDA 4Q6WA 1XHEA 3H5LA 2H3HA 5KQPA 3FFTA 5IC5A 1P6UA 3JVDA 1QQBA 3DGEC 5KWSA 5HQJA 1PHRA 4QYMA 4YV7A 2IPMA 3QELB 5FBKA 4FE4A 1FFGA 5DCLA 3JVIA 4MR8B 3QLUC 1XWWA 3CLKA 4TLMB 3E61A 1M5UA 2RDMA 3M9WA 2FLKA 2QW1A 4N03A 3GA5A 3MF4A 3NBMA 3NNSA 1U0SY 1DC8A 5KC9A 3EQZA 1GCGA 5BR1A 5TPWB 1JL3A 1U2QA 1ISSA 1PNRA 3IPAA 4GPAA 3Q7RA 8ABPA 1L5YA 1W25A 1YK1A 1BDJA 4RKRA 1JYEA 5CHYA 1A2OA 4MYRA 4YS6A 4Z9AA 5GQSA 4NQRA 1VRVA 3GL9A 4EVQA 1MAVA 3F6CA 3I42A 1WETA 2Q5CA 1QP7A 5EWLA 3LOPA 1BDHA 3FFXA 4KK3A 4D6YA 1NXWA 3A0UA 3BBLA 2R4QA 3W9SA 2E4XA 1DBWA 1QO0D 4KZKA 3UK0A 1QP4A 3Q15C 3OLYA 2NT4A 5JS2A 2VK2A 4EGSA 5TPZA 1P6QA 1NXXA 1DCMA 4PICA 5DTEA 3O1HB 2JRLA 1M5TA 2WWVD 3S99A 1R8JA 3MM4A 1JBEA 2JVKA 2ZWMA 1ZDMA 4ZYLA 4MR7A 3O21A 4Z0NA 2FLWA 4GNRA 4MR7B 2J48A 2A9QA 1DCKA 1SXIA 3O2QB 2QV0A 1ZAYA 1NXVA 1YVUA 3CHYA 1JHZA 1YTUA 1TM2A 4FB4A 2YHBA 1TVMA 1SD5A 2FMFA 2PL9A 4Q7EA 3CRNA 4XFKA 2VYCA 4KREA 1M2EA 2HQOA 3EAFA 5TQ0A 2LPMA 2A9PA 1BDIA 3L6UA 2OENG 3H5IA 4S05A 2E4YA 1C4WA 3KCNA 3QEMB 2LBPA 1Y1LA 3N0RA 2PL1A 3H6HA 5KC8A 3SM9A 2FXIA 4O1HA 5JNVA 2R25B 3JPWA 1JDNA 3LTEA 4KK4A 5FBHA 4H3HB 3IP6A 1ABFA 1CEYA 1KRXA 4WWHA 1USGA 3HS3A 1ZN2A 1ZH4A 1RZRA 2PAFA 4LE0A 4XASA 3VNBA 1ZITA 3NHMA 4YLEA 3CTPA 4MAAA 3QX8A 5TQ2B 1RXEA 1JFTA 3JPYA 3HUUA 3LKBA 3RVSA 4ETNA 2FEKA 3Q41A 4QPJC 1H9CA 5TE9A 4JOQA 4RU1A 1DP4A 1GLGA 3EGCA 2WB4A 1QO0A 3DLBA 1Z12A 4XAQA 1BAPA 1KRWA 3HDGA 5JS1A 2HSGA 1RPJA 1MB3A 4Z4HA 1QP0A 5IX8A 3RVMA 1F4VA 4IGAA 4F8JA 5HKOA 1E6MA 2P9HA 5GOTA 3H5OA 4RS3A 4UHKA 1HEYA 3CU5A 3EJWA 2V0NA 3FFWA 3LUFA 5PNTA 4LE1A 2FMHA 2AYZA 4NV3A 4RK7A 3IPCA 4RSMA 3F7NA 4EY3A 4RKQA 2A9RA 1YMVA 3O1JC 4H3KB 4MLDA 4MS3B 1C0EA 2L2QA 3RVQA 1NATA 4LZLA 2P4UA 3FGZA 4KFCA 4Z4FA 4PZ0A 4RZSA 5HM6A 3L49A 3TD9A 2E4ZA 3LUGA 4YCSA 1JFSA 2DRIA 2MYUA 6ABPA 3C3WA 1IIBA 4W5QA 3KLNA 1BA2A 3M6MD 3ROFA 2F8SA 4TN5A 3RQIA 2LUOA 1FFSA 5ABPA 4OG2A 3RVLA 3DGFC 2QXYA 4LDAA 4WXMA 3HZHA 3SNKA 3I5AA 3GYBA 3EQ2A 3T6KA 4G0OA 4KQCA 2GBPA 2E4WA 3JY6A 4Z4EA 3GRCA 4EYGA 4RXTA 3DBIA 4MS1A 4QYWA 4N47A 3B2NA 3BILA 2IDMA 3MQ4A 1PEAA 1JYFA 3A10A 5DLEA 5EWMA 1RXIA 2H0AA 5IUJC 5IUKC 5EWMB 5CNMA 3N6VA 2PUFA 2IPAB 1Z18A 1D5WA 2JCGA 1CHNA 2QU7A 3NHZA 3H5VA 4HNSA 4O1IA 5HSGA 4DQDA 1QQAA 3H1EA 2NZVG 1E6LA 3OM0A 2L19A 4KQ9A 1LBIA 1OXKB 1UDRA 2VUIB 2MYTA 2E4VA 3CZ5A 3H6GA 4JP1A 4ZJPA 3G1WA 2R48A 3MMNA 2WJAA 1T34A 1Z2DA 1GCAA 3OMXA 1P2FA 4NICA 3HCWA 4W5TA 2JVJA 3HSYA 2ID7A 4P1ZA 3OLXA 4YWHA 3KYIB 3KG2A 4KRFA 3ILYA 3O74A 5B3JA 2IYNA 2QZJA 4TMYA 3MIZA 3LUDA 2JBAB 1AB6A 3GT7A 1AB5A 3RVJA 2WRZA 4EYKA 4MR9A 5BQ3A 4ML3A 1OXBB 3EULA 3Q7TA 2FMKA 1YK0A 3CFYA 3Q9SA 4MR9B 4MRMB 4B09A 3HEBA 3HJFA 4JB0A 4M88A 3N0XA 5FWYA 4KPYA 2QR3A 4G0YA 3TB6A 4E7OA 2M1ZA 4XXHA 3RVKA 1NTRA 1QKKA 3NNDA 3BRSA 2E4UA 2NT3A 5DGCA 3GBPA 4Z4CA 4LDZA 4W5RA 6CHYA 5EWJA 1DJMA 3HXMA 3OMWA 4WXEA 1A04A 3CG4A 3E3MA 4F11A 2X7XA 3KJXA 3C6QA 1EHCA 1QMPA 2GI4A 2JVIA 3LKVA 3QLTA 4YR7A 4KMRA 4MS1B 4JASB 1GUBA 4P98A 2PLNA 1APBA 2BGGA 4EVSA 4G0XA 4MQEA 1Z26A 1URPA 5C5EA 2LIVA 2MSKA 1D1QA 1TLFA 2N9UA 3KS9A 4MQEB 4PYRA 5JNWA 2F8TA 1Z2EA 3HUTA 4TLLB 2HJ9A 3IP5A 1MB0A 2GX6A 4PEVA 3RVRA 4H60A 4WT7A 2A9OA 3OQMA 3OQNA 4IMJB 3LMKA 2O20A 4G0QA 4N0PA 4Z99A 3RVNA 4EYOA 2YHAA 2W42A 2PUDA 4OLBA 4G0ZA 2GWRA 2PMCA 3EODA 4KV7A 3KHTA 4MGEA 4RV5A 1Z15A 3MA0A 1EWKA 4ZPJA 3OQOA 3O75A 1EFAA 1K68A 1PEYA 1E6KA 1XHFA 2HPHA 3F6PA 3Q7SA 5BRJA 1Z16A 1U04A 4N0QA 5KQGA 3QK7A 2WMYA 4FE7A 2JBAA 1ISRA 2TMYA 1USIA 1ZH2A 5TQ2A 3UKJA 1ABEA 1VPWA 5IULC 1ZVVA 2VUHB 3K9CA 4ETIA 1TJYA 3CKMA 1NXPA 3OLZA 4G86A 3T95A 4E7PA 5TQ0B 4MQFB 1EWVA 3O2SB 4RK1A 5IUNC 2RGYA 1LK0A 3OLWA 3P9YA 1EWTA 1MVOA 4Z4IA 1F51E 1SXGA 4MLCA 3VNAA 5T7BA 4RDCA 4O5AA 1ZHHA 4IMIB 2NZUG 3QEMA 3C3KA 2MYNA 4HNQA 4RY9A 3ILHA 2FEPA 5F64A 5B3JC 3N75A 1DC7A 2FKAA 1DBPA 4RK6A 2CHEA 3FDFA 1Z25A 2FW0A 3H5WA 3MYYA 5KQMA 4Z4GA 5C5CA 3JS5A 2L18A 4HYEA 3GBVA 1DCFA 5JNSA 4N76A 4L85A 4PE5B 4YO7A 4ZMRA 1RZRD 4OATA 1VKRA 4EVRA 4W5NA 2NUBA 2FEWB 3SAJA 1DG9A 4OTZA 3I09A 1NXOA 1LBHA 1FQWA 4G0PA 3IP7A 2CHFA 1JX6A 4WZZA 3EDCA 4L4UA 2AYXA 3A3KA 2FN8A 4N41A 2RJNA 1JWLA 4MQFA 1D4ZA 4RY0A 3TX6A 9ABPA 3OO1A 5BRAA 3A0RB 3K4HA 3KSMA 4JAVC 4RWEA 5EWLB 5IEBA 7ABPA 1SXHA 5IBQA 1NXTA 1D1PA 3O2JA 4RK4A 5CNIA 3GV0A 4Y9TA 4XLTA 4Q6BA 4D74A 3RH0A 4EYQA 1YS7A 3LUHA 3RVPA 4LRQA 2PUGA 2PJUA 1JFVA 3UUGA 2PUAA 2MSLA 2ZAYA 1Z17A 4IF4A 4MR8A 3HDVA 5ED4A 4EUKA 1BVHA 3R0JA 1DZ3A 3H1GA 1QNLA 5JNUA 1K66A 1FFWA 4UHJA 3OO0A 4W5OA 1LJLA 1NXSA 2FTKE 2MSWA 1SRRA 4KVFA 4DN6A 4HNRA 3CNBA 1CYEA 5FWYB 2FQXA 2OQRA 1GUDA 3I45A 3LUCA 3OM1A
chains in the Genus database with same CATH superfamily
1OGYA 2FN9A 2JCSA 3CR8A 1T8TA 3K1JA 1E8MA 4HH4A 3R3UA 1PI3A 2PKEA 2PWBA 4XTCS 4CM5A 3E9YA 2FPPB 3N0VA 4WOPA 4WLUA 3GUYA 2C4MA 4D9BA 3A1VA 1B8UA 4NL4H 2B1JA 1UM8A 1TO6A 1YJCA 4B35A 2XVAA 4CM4A 2CFOA 2ZSBA 1KJYA 5IM4F 2M98A 1ZONA 1NSYA 3FY4A 4OBBA 4I4TA 3UNXA 2WKQA 1GQRA 2XQJA 5ALSA 2I4OA 3VZBA 5CT8A 4LBYA 5LL6P 1EK1A 2PXHA 4QWMA 1R9MA 2QRPA 2POQX 1QFJA 4UDOA 3LHIA 5AW8A 2V03A 2IEIA 3QI7A 2XITA 4J4TA 5JWRA 2RHTA 2WWHA 3FNBA 4Y98A 3N7AA 1I1NA 1B2LA 3B5IA 4CLRB 2WQ6A 4IQ0A 5DHUA 4REMA 2ZXFA 3ZS9A 4OQNA 3WZLA 1DB3A 1ZVJA 3R3YA 5L3QA 2ZT5A 3STHA 4DCPA 4DPLA 2BFEB 4Y1GA 3K0BA 4OO3A 2HQBA 3FPBA 1NOJA 3GXBA 5GGYA 3RHFA 3F9CA 2BMWA 5BSEA 4G26A 2RHCA 3D7MA 3I2JA 4MPTA 1YASA 1L5VA 1JU4A 2Z2XA 3H75A 3KXDA 1TZMA 3SWWA 5JNRA 1MT0A 5CUQA 1KPHA 1QIDA 4W6QA 2JAUA 4EI2A 2BFPA 2FVYA 4J0DA 4EB0A 3FJYA 2ADMA 3QLVC 2BM8A 4M99A 4C0HA 3HVRA 1B0ZA 1U3VA 2NVBA 1R6BX 4YRNA 3JQBA 4MUBA 1P9OA 2PA3A 1M2VA 5TPWA 1VL0A 3F4KA 5ALDA 2W93A 5IT0A 3ANMA 2QVGA 1TM5E 3C5HA 4MRMA 4B4OA 4DTCA 3K6KA 4WN3A 2EIHA 2DB3A 1CZHA 1WUKS 1U5CA 2XY4A 3BTSA 3WB1A 1JZTA 4TLDA 4OOFA 2G08A 4CMAA 1PFGA 5I3CA 4G41A 1BS9A 4R1NA 1WHTB 2IZOA 1BMTA 3EARA 3PC3A 5T8KA 2EAUA 2IS4A 2IYUA 3WZMA 1XQVA 1Z5WA 2UVQA 4ZMSA 5KCZA 1IK6A 3OQVA 3U49A 5K8UA 3FOZA 1CIJA 2XUJA 4JUCA 3K31A 4URWR 4I14A 4I0WB 4UU8A 3ABQB 5E7JA 4ZO6A 1N4AA 4MI3A 1L5NA 4GE0A 5JNLA 1KSGA 2KB0A 2XCQA 4KQEA 3HYRA 4GICA 3WHKA 1I7SB 3ZN2A 3G79A 4C3ZA 2EG5A 5U4QA 2ZSJA 5TXGA 4GDFA 3GEDA 3OURA 3D0RA 5FPKA 2AG8A 4B7UA 1U0LA 1L7PA 2H2GA 3R3ZA 4WXPA 1Z34A 2YOHA 1Y80A 1YBAA 1AGNA 2H1FA 2PGLA 2D8AA 3P9NA 3ZHBA 3VYTB 4JJFA 4CKBB 4PFSA 1M33A 1YVRA 4GXNA 4RX1A 2H2WA 4WBNB 3URKA 4OUDA 4XEUA 4EKIA 2WSYB 2QXUA 1MAHA 3MFQA 4YBZA 4AMBA 3QYFA 3B6JA 1L7QA 1U8FO 3QV2A 4RHTA 4LWQA 2VDKB 4IOLA 2QM7A 4QUGA 2ISSD 4XIFA 2IPMA 3T1VA 4TWIA 5LQJA 2ONCA 3ELYA 3MTEA 2AWOA 3E1GA 2C2HA 4M38A 4BIIA 4NOJA 1C7FA 1O96A 3ZWOA 1IH8A 4DIUA 4MKHA 3M5PA 4GOJA 4KQ1A 3BIFA 4RADA 2ZUSA 1ODCA 3TLZA 4YMHA 1AZTA 3GPLA 3L4SO 1EXDA 1RXCA 1DC8A 2BZGA 5BR1A 1Y42X 1XVAA 2IEYA 3SOZA 4GX5A 4RKRA 3LCJA 2GD6A 4FX5A 1P5RA 4EJSB 2ECOA 4FJ0A 3NIDB 3RLFA 3ZJVA 3SS7X 4IYRA 2ZUWA 4E07A 1TUGA 5HZGA 3OQIA 1MEOA 4N6NA 4Z9XA 1LRLA 1UWCA 3DBRB 2VCHA 3FMIA 4ZDIA 1BOFA 1IC6A 2XT9A 3K4QA 4D92A 1ML3A 4TRRA 2YWBA 1XKLA 5CYOA 3AESA 4Y2SA 5JS2A 2WJZB 5DBOA 1S02A 1VOTA 1X7ZA 2OC4A 1H3NA 3O1HB 4Y2HA 3RABA 4X3OA 1JECA 4IJ6A 1QOQB 1WF3A 1T8RA 2JVKA 2WUGA 2A94A 2QGNA 4MTLA 1O94A 4L0DA 3R8XA 1NKSA 5CYGA 1M0TA 1LBEA 3QVXA 4F97A 3T3NA 3ACBA 4KHPB 4WNCA 1RVV1 3VR2A 5ECYA 2J48A 5CFNA 3QU7A 2A6PA 4J76A 3UK6A 4CEHA 5JSKA 2D1TA 3M6FA 5NLLA 2QJOA 2JFQA 2Z4RA 3R76A 4MP8A 2G07A 1E18A 1TQHA 1LBSA 2YIMA 4IX1A 5K45A 4CM3A 4Z5XA 3I9JA 4QHYA 4YY3B 2CD9A 3FTNA 1LFAA 5CX1A 1GU7A 4J0GA 4EG5A 3IVAA 1QR2A 2DE0X 3NASA 2HPZA 1NUPA 4X24A 4GOKA 4GOND 2RHGB 3JZAA 5JQWA 4XR9A 4H7JA 4GXTA 4BFYA 4WDQA 1J70A 1LC0A 1VB5A 3BZBA 5HCUA 3F8TA 5IKEA 4H6XA 1XLWA 2KQUA 4UBMA 2XHZA 3OT1B 2BHRA 4JX8A 5LJIA 3RTBA 4UFPA 3FB1A 5LSAA 3NWOA 1F0PA 1CEYA 4QUJA 3ELBA 5B12A 1G8PA 1L1EA 1XYGA 3E3NA 3UMRA 1M76A 4YVFA 1QWOA 4RCZA 4CEJB 2GZHA 2W2NA 4KWIA 2YOGA 3W6ZA 3KU1A 2W71A 4KRXA 4WFQA 3F1LA 3W8DA 1VRCA 2JAWA 3KVNA 3QX8A 3FOFC 2WYOA 4BKOA 5IZCC 1BRMA 2YJTD 1ZUNB 4UBLA 3QHPA 2V4MA 3DTNA 4WZAA 3UMFA 4BGVA 4JOQA 4PFJA 3EGCA 2WB4A 1W34A 3PQ4A 4NOKA 4LBVA 5FR1A 5CA0A 1YVEI 2C5BA 2P3LA 3GLFA 1XAGA 3PLAE 2BMJA 4ES6A 4IFEA 3OU2A 1HG1A 4I46A 1G66A 4E5PA 3AIMA 5KSWB 2FOXA 1Z07A 4PG6A 3STYA 1ODTC 3TE7A 3LVRE 2P8SA 3KYBA 5KS2A 4Y6PA 5A9SA 2YVLA 4HS4A 1KPIA 2WF6A 1QCZA 4G24A 4Z9YA 4B2IA 3FOWA 4NHEA 4WA7A 1EGHA 4Z0PA 1N33B 3RC1A 4G1FA 1G60A 3L40A 4JI1B 2BZ1A 1AQUA 2OILA 3PP8A 4EFMA 2PR7A 1QM5A 4OREX 4G1MB 4QL3A 5B2ZA 4AF8A 5EQTA 1RAFA 4Q3LA 4QNMA 2IHJA 3OP1A 4LSWA 4EBFA 1NJ1A 2NUPB 2FUG6 3FKSD 1GNQA 4HZGA 2HWWA 3H2JA 4HYTA 4TVKA 4DMHA 2O3UA 3KWFA 4TXHA 3DS8A 1MQSA 2I1VB 2QWXA 2FSVA 3WIOA 2VHCA 4O8CA 3A28A 4PLFA 4IO1A 4EHFA 4HUTA 3G17A 5E3IA 4W5QA 4I66A 1RE1A 1UEIA 2V97A 3UW3A 5E0KB 3N2LA 4RQBA 2G5GX 3G5LA 3QTLA 4TN5A 4EJMA 5GZ3A 5HX7A 5K8JB 2UVPA 3AY7A 1NBMD 4PTLA 4OG2A 4OHWA 2EBFX 3DGFC 3FZYA 2V7BA 4KFRA 3VPAA 4DF3A 1A2KC 3I5AA 1FPQA 5BSKA 5EE3A 1W35A 3ZE8A 3FOEC 4KACA 1H66A 1RLOA 3WC4A 1K8ZB 4RNDB 4M0LA 5EINA 4NPCA 3C6MA 3VPXA 1Z83A 4CMIA 5HCIA 1COWD 2J7PA 2W2VA 4GP6A 2BLLA 3A70A 4Q39A 4Q01A 4UOEA 1DEKA 4RC9A 4RXTA 1VL2A 5BOVA 3KJEA 3V1YA 5FP0A 3A2NA 2W6JA 3S1LA 4JYCA 5JADA 3T3GA 4P9NA 2OAQ1 1P2GA 1X7WB 3N8KA 2FPGA 5IYZB 1OB5A 3WKEA 3EIEA 3HFGA 4U6SA 4RIFA 3UUEA 5L7TA 3W5DA 1QTNA 4HNSA 3DEKA 2A9VA 4DIOA 3A4IA 4DXHA 1TF2A 5FPHA 4OK6A 1NUTA 3DBLB 1ZD5A 5JSUA 3SJCA 5K1ZA 1ST2A 2IS1A 2E4VA 3QYAA 1E7WA 3K9GA 4YFYA 3AOGA 1WY5A 2IK8A 2V0CA 1YMQA 1T34A 1RAHA 1FDUA 4PYNA 5K9ZA 4TVSA 4QTTB 1FQOA 3IQIX 1B0AA 3QV1A 5CA0F 5U4XA 2OORA 2I9KA 3RJMA 4MQUA 4AZWA 2JFOA 3AGQA 1UMCB 4X1KA 3KG2A 4LY0A 8MHTA 1SC3A 3WSVA 5IHPA 1PR2A 1G17A 1NE2A 2VPQA 2YYSA 2QJWA 1IMOA 1AM4D 1W30A 1EP3B 2PU7A 3B7PA 3BMNB 4H4EA 1RRGA 4UUQA 4C6RA 5CA1A 2BGMA 2JS7A 1R4MA 1H1DA 4EUNA 1LDMA 3ZDFA 3UBMA 3NALA 5IJWA 4G84A 2BAGA 1OXBB 3EULA 4HHEA 2R2AA 3RYCB 2XI4A 1RXWA 2A4KA 4B8WA 4MTCA 3AB7A 3ND5A 1QGAA 1XNGA 3ZV4A 4TMVA 2D2XA 4BMOB 1WABA 3RS9A 4Z4CA 2DUWA 3AFMA 4E4YA 2JGLA 1IQ0A 1EUDA 1R0LA 3BX1A 4IOJA 1OYYA 1YBMA 1XP5A 4PGHA 3PHGA 2C5SA 1MEJA 2P2SA 1A04A 1TVEA 4YI3A 5KKNB 2JGNA 3C3JA 3PI7A 4B3IA 4YR7A 2R11A 4GSYA 1J20A 1IWBB 4OQFA 3UAXA 1H4TA 4YRTA 5C80A 2OXCA 3QFTA 4HWPA 2G6BA 4LC0A 3PUVA 5TT0A 1AN9A 4WIAA 2ZIZA 3JWJA 3NETA 2LIVA 3DZHA 3TSZA 3ZXXA 3U6BA 2OCIA 3WXMA 1ONSA 1RHKA 2V7VA 1KDPA 1S2DA 3K5PA 4FDTA 4F2GA 1H2ZA 2O5CA 1VP9A 4BQRA 1HYGA 5CAEA 2IZ5A 1VYTA 4ER5A 3J80A 4K9QA 3ZCSA 1AO3A 2EOAA 4ZQBA 4AN1A 4JLAA 1V7QA 4G0QA 3Q3GE 4EGFA 3R6DA 4K6FA 4RF2A 1HKUA 2VF2A 4YREA 4K5QA 1JG1A 1JU3A 5D3QA 4C04A 1BYUA 2H4ZA 4ZO8A 5H83A 3RB8A 3VUFA 4ER0A 4AQDA 3O75A 1LZLA 1EFAA 2A1IA 1AU9A 1BGVA 2O3JA 2V6JA 3E9MA 3MS2A 2FWBA 4L4ZA 1C1YA 1U04A 4N0QA 2YQZA 3PQEA 4OM8A 3VC3A 4BNDA 4F38A 1J2JA 1YFZA 1AIPA 5BY2A 2WU3A 3DOEA 10MHA 4X64B 4XYGA 3TIFA 4DBZA 2CXSA 3MCAA 1L7AA 1Y4UA 2PWAA 1MN6A 2OR3A 1HOTA 4OFBA 3ECSA 5T6MA 4CQMA 3I61A 1C9YA 4HFNA 1JS1X 4IIHA 4TS1A 2FR1A 4D26A 1U7ZA 2HMVA 3F1KA 4HWGA 1GG9A 4QPDA 3O47A 2VT2A 2P5TB 3UXMA 4R69A 1JLLB 1ZICA 4MKIA 1XDSA 2G9RA 4IS2A 3S44A 4AJEA 1CR0A 4CLDA 3IMKA 3CO5A 4RPGA 5TJ9A 4MGYR 1G8SA 3WYFA 4BNVA 2VAVA 1SUEA 1SWVA 4NFSA 3WNZA 2I7CA 1R8SA 1P4SA 2H2HA 3A32A 3RAGA 1MABA 5T4BA 1Z25A 3RJ5A 2R60A 1FXWA 4DLTA 3OPYI 4EB6B 1Y9ZA 2L18A 3D1JA 3PC8C 4U2EA 3GBVA 1HRDA 2OPHA 2O19A 5JNSA 4ZI2A 4Y9RA 1QYXA 2AC7A 4TYWA 2C7GA 1OX4B 3P7MA 1TTQB 3UGQA 1IY2A 3C41J 1ESDA 2I33A 3U4IA 4IIJF 4MQ4A 4E2YA 1WCXA 4QLBA 1JX6A 4L27A 3L5OA 1LW6E 4L4UA 1GXSB 2HMWA 1M1XB 3IDAA 3KEMA 3CRRA 5FJJA 1W36D 3IUEA 4MQFA 4M76B 4O4IF 5AUNB 1OVGA 2ZKLA 3TQCA 4A2CA 4YMLA 3HCRA 1HO3A 1GKUB 1ZN9A 1OWPA 3P9CA 4I36A 3NYQA 1QIEA 2CXXA 2H11A 2ZIXA 3WLLA 4WJKB 5IVDA 4C2BA 4FFVA 5AK5A 2DPLA 3F8WA 3P4YA 1NXTA 2WJ4A 2W6IA 3KYDB 4V0SA 4BASA 1R1DA 1ZIPA 2OO5A 4AXBA 4RHCA 5TT1A 4XLTA 4GYWA 2RKWA 1W73A 5IBCA 3Q8MA 1XMOB 1JFVA 1K9SA 2QYOA 4RBNA 1GZSA 4N8SA 2GBLC 2J3QA 2X41A 2AW3A 1NVUQ 4UNRA 2PGXA 2PL5A 3JAWA 5I6DA 1QH8A 3L9WA 1BSVA 3WDSA 2AI1A 1UKZA 2PT9A 3T3DA 1ISJA 2V6MA 4Q1AA 4RZXA 5SZJA 5FD8A 4QBIA 3I9FA 3ORSA 1LS6A 1VJTA 4CV0A 4QGAA 4RSRA 3BK7A 1G8FA 1E2IA 4GPIB 5HE9A 1E5XA 1UBHS 2V7XA 4KP7A 4Q66C 2QNIA 6NULA 2PGIA 4B3BA 3DDCA 1KZ1A 4NYMR 2FP4B 1EZZA 3W1WA 4FC7A 2ZSIA 3G9ZA 3L8YA 5FWYB 3RUFA 5BSMA 5GP1A 3BBPA 2IJGX 1VI5A 3PWZA 4FS8A 2JPDA 3UG6A 3TE6A 1K7SN 2PEYA 1FUUA 1RYBA 4QNNA 1UINA 5AK4A 1XLTC 5JT1A 2JLQA 1JZSA 1SUIA 1KJ8A 4DNOA 4J2OA 3QU9A 3GZTB 3VXKA 2QP4A 2N1BA 2Y27A 4LOJA 3QY0A 1N9GA 3IKLA 3LCMA 4DWVA 1YMUA 1OJ7A 2F1HA 4HCJA 5KQRA 2WLSA 1GA1A 3HMKA 3HSSA 4KVGA 2VK8A 2HK6A 3P9XA 1DFIA 3BWEA 3FRHA 4JFAA 5DN6A 3H4TA 1W4LA 1ENYA 2VQ3A 4W8GA 4NG5A 3NBZC 4GQBA 2OD9A 2OV4A 3GG2A 3TUIC 2PZFA 3OOEA 4ZICA 1BDBA 1OV6A 4JK3A 5G02A 4ZOEA 2CZGA 5K0SA 4N8DA 2H1LA 1H65A 1H8HD 3DVRX 2Z6UA 4FILA 4KE8A 1D2AA 1LSUA 4CIYA 4TM7A 1O95A 3Q4GA 2BJHA 4B3JA 4NCHA 4EJSC 4HWOA 4OHRA 1OVMA 3AM1A 1CJMA 3AU8A 4I5IA 3ZGOA 4DADA 1W7AA 1TYEB 3ICQB 2W11A 4ZCMA 3ZWWA 4B3HA 4W99A 4NJMB 5AD1A 2GKGA 5DBEX 4ILKA 5I9IA 3CE6A 2XUHA 1BW9B 1XQ9A 3MQFA 1JVBA 4PG7A 4J03A 3LQFA 4BO2A 1P1JA 2IHZA 2VOEA 4JUBA 5M7EA 5K2OA 1HNXB 3DHEA 4OXQA 1T1EA 4BNTA 2FX5A 5CVUA 4B2LA 1SUAA 1F12A 3NFYA 2QTVB 3PK0A 1HQYE 3EIFA 1PV2A 3MMXA 3MD0A 2WY2D 2LGJA 4EL0A 1W52X 4QDKA 1YAJA 2D00A 2PKYX 4BO9A 2F43B 3TW4A 4DNQA 4DAEA 4CFYA 4INJA 9MHTA 4R3UC 1PTKA 1J5EB 2WB2A 1YRHA 2GZMA 3DKIA 4M0PA 5JCXA 3EVBA 4XA8A 1M1YE 3WHPA 4HB3A 2IIVA 5DXFA 1DBQA 3STVA 2NOAA 2N42A 4Z49A 1N0IA 3QX9A 1OWMA 3WMEA 1EK0A 4AECA 3R44A 4FP9A 5TV2A 4F56A 4YIKA 1UWKA 1JF8A 1VCIA 3RANA 3IOMA 4F12A 2VC2B 5KX5F 5MN6A 3NVKI 2O0LA 1NVVQ 4Y9UA 3B3JA 2C77A 2FG7C 2XDYA 4DZZA 3D6VA 5GJVC 2QLBA 3V6MA 1HX7A 5LFAA 1VIAA 4CR7A 2QVCA 2BFAA 3ELUA 1W5TA 1GKLA 1E2KA 1X2EA 2PMDA 4E33A 2GM4A 4Q18A 4RVCA 1L1RA 3IEXA 4GSLA 3PIRA 3WNQA 2V6FA 4EY5A 1UAAA 1KO4A 4DYVA 2YMQA 4FHCA 1XZBA 4OMDA 2EW2A 1VECA 3DMTC 5TS2A 5JFOA 3USCS 4FE3A 1HYBA 3NYRA 4NPHA 3IV6A 4ZCTA 3GLUA 4EKYA 2Z9CA 4YCLA 5IC4A 4HEQA 4QU8A 1RABA 2YC4C 4LUCA 1L7XA 1P1FA 1U6IA 3LPMA 1SD1A 1W0JD 3E3AA 1XDBA 1QRUA 3JYPA 1PO7A 4DRXA 2BMAA 2VTDA 3JALA 3HK2A 5EOVA 4ZGBA 1EJ6A 2FWJA 4M4SA 4L5YA 4C0LA 1NQXA 3ABSB 1UBCA 5HGJA 1WBDA 4WCFA 2X9QA 5K3OA 1NRJB 3PE6A 4JUAA 1KOFA 3R1IA 4L08A 3FNGA 3U60B 3N59A 2BMDA 3TYXA 2BT4A 1IWPB 1Q57A 1NF2A 4GVXA 4RSHA 1U0SY 4I3FA 3KETA 1M2VB 5TPWB 4Q9HA 5ER6A 2OVBA 4REOA 4RHUA 1QGED 4UHDA 4AFNA 4TYNA 3C6XA 5I8PA 3S2IA 2B8WA 5HUHA 1A27A 1G3MA 2JK0A 1FA9A 2W2PA 3F6CA 1LA2A 4B3FX 2JIRA 1P0PA 3F6EX 1JWAB 2VCYA 5BO5A 1BDHA 2JLXA 2D5AA 1WVIA 1BHJA 1VG9B 1XEFA 3LSTA 3OZRA 2RI0A 1DBWA 1NW9B 3LQ2A 1LLUA 3OLYA 1OFTA 1FBNA 3AVQA 2FPPA 5EZYA 4QGGA 1I6MA 5H81A 3KQKA 3I2IA 4M86A 4JLBA 4CN8A 1NGSA 2QTAA 4WK4B 4FWTA 1UXGA 3MM4A 3GFQA 3COZA 3PC7A 2D4HA 5BRNA 3KT0A 2I8LA 5H7XA 5AW5A 1IJFA 3NX4A 1SY7A 3GCGA 4A3SA 3PGXA 3RSZA 2WIAA 4JBIA 8OHMA 5LNK6 4ZTBA 5B53A 2OFXA 2GFHA 5HRCA 2WSSA 3I8SA 3E9QA 4P3PA 2VQ6A 4WEOA 2WKWA 4E3WA 1JNYA 1ZNYA 7MHTA 4Q34A 4AYWA 1E6WA 1F5SA 1R5NA 2JDIA 2Q3EA 3F67A 4MRNA 5IN4A 2Y3IA 1NMXA 2C9YA 3F7OA 2GFIA 4KC0A 1Y5LA 3ZDQA 1EFRA 1XGKA 4DWWA 4AS1A 1HDXA 3FWHA 3OCJA 2JDID 3O26A 1XJ0A 2WYUA 1MAWA 4L76A 4FR5A 5KC8A 3R0XA 2IFTA 1E5TA 1TZKA 2NAPA 4M0KA 2D1SA 2FXIA 3JQFA 5E38A 1WW3A 3E70C 2VQFB 4I55F 4I1VA 3ZE6A 1DC6A 3H9UA 3BB4A 2VRWA 1EVIA 2NZJA 1GL9B 3AO0B 4FMBB 4KK4A 4MV8A 5PGMA 1CJCA 2VAWA 4P5EA 5TRTA 9ATCA 4JQSA 1DUIA 1K4YA 4CMGA 4PG8A 4B74A 3LBHA 4G4GA 1COWA 1W4AA 2J7PD 2PAFA 3H6KA 4CW7A 4P0PB 1XLUA 3Q88A 4MAAA 2Q99A 3JRWA 4BNYA 1V4VA 2QE7D 3HKDB 5T67A 4EEXA 1FRVA 1O57A 3AVUA 1H9CA 4P83A 1T25A 2ZJ1A 4MYDA 5ERGB 3TTSA 3K5IA 1WDKA 3JQGB 1L8QA 5C46F 3KQLA 1ZIOA 5THKA 1NG1A 2O3TA 2VTEA 1JPJA 3AETB 3BF7A 3IR7A 3ENQA 2C7OA 3CEPB 1QMGA 1QP0A 1HFKA 1KI7A 3W2GA 1WXDA 1DIHA 2YWGA 5C4MA 1SEPA 4DE5A 1TVKA 2I1LA 2ZJ0A 2R1ZA 1R0CA 3OEEA 5DTJA 4RS3A 4UHKA 3ZHYA 3ZVMA 2XNDA 3QEBZ 4LE1A 2QTBA 5E9JA 3GFOA 3QYPA 1O6GA 3KOXA 5CHEA 3AF1A 3ZHZA 1I01A 3ROKA 3GD5A 4LXGA 3UUFA 2ECPA 4C6HA 2A9RA 3RS7A 4ZYYA 4OI0A 2PKRA 3UJDA 2NTJA 3PDUA 1YB2A 1KO1A 4BFCA 3PFIA 4HXYA 5J9FA 1N1EA 1NP7A 2A1UA 2BTOA 4KTTE 4R40A 2X2OA 3BA6A 5I7VA 1FBTA 1PR1A 3RFXA 2NUPA 4P36A 4XCXA 1SM4A 1EXMA 1CF9A 1NLZA 3A9VA 4KTVE 4MV0A 1PGJA 4XYMA 4AJHA 3VH4A 3SIXA 1Z4LA 1Z8NA 2Y8EA 4BO1A 3SYMA 4HPXB 2AOWA 1DGQA 3SSNA 2WKPA 2PX8A 4GOLD 3WHIA 4D46A 1RI3A 1WV1A 5CXXA 1MA0A 5ERXA 2HGSA 3SXPA 2VDUE 1TYCA 2C0QA 5DTIA 3IOEA 4TL8A 4D4HA 5JSFA 1ZIYA 4BY9E 3SFZA 1ZMOA 3OT1A 1K1EA 5JAHA 2F59A 1V3VA 4LJAA 2PSDA 4H35A 1USVA 1B6SA 1LU9A 2HCRA 2ZPUA 4DV2B 4QQKA 1SOMA 3DDUA 3IHLA 3EAGA 2XVZA 3WP0A 3PBKA 2XUPA 4O4JA 3WMFA 1TTPB 5LU8A 1PDWA 1DI0A 1WRBA 4YROA 2QTLA 3GDWA 2YMMA 2X5NA 2BFDA 4YTEA 1Q3TA 4CDGA 2DBVO 3AF6A 4HSGA 1I4TD 3BB3A 1EM6A 4PV7A 3T1NA 5HDBB 1VIVA 4G23A 1CRZA 2QX8A 3MXTA 3P9PA 1XQXA 3K5WA 3TFWA 2JJ2A 4UDYX 1H1TA 2ODTX 2YWXA 2SCUA 4UAUA 4TMFA 4UPVA 2BTQB 4EELA 4BZPA 3ZWVA 1UDCA 4Y0AA 1ML4A 4LNHA 4BJ6A 5TIIA 2JAXA 4KLAA 1M2JA 1E9EA 2OD2A 1YDMA 1U3CA 1L5SA 5H70A 4QM7A 3OLXA 3ZK7A 5AKKA 4OHPA 3FPSA 5KU1A 3DTVB 1OR8A 4EG6A 4C7OA 3WWEA 5LD2B 4YMUA 5D1HA 3QVWA 5ALHA 3U80A 5B3LA 2Y2UA 5F7XA 3H9GA 1R0YA 2Z58A 1CP2A 1AQYA 4RLSA 1UPCA 4YIHA 5AW7A 1R0BA 1A3CA 4WERA 5E2AA 2CK3D 4XUCA 4YRPA 3BJMA 1XTUA 3QXHA 4RMJA 3TKYA 5JD4A 1AC5A 3HJFA 2ECKA 1M75A 1PE0A 2VJBA 3A37A 1WSDA 5BVHA 2WUFA 3SBDA 3W5VA 2Z08A 5BUSA 3TZ6A 1KYXA 1I4EB 1NIJA 2ZJ2A 1Z0KA 3BE4A 3C1UA 2PGOA 1PQWA 4YJKA 5J2TF 1OBHA 3CLTC 3ORQA 4NYIQ 5ULLA 3NKFA 2IW3A 3VAYA 4MGHA 4LDZA 2IQIA 5EWJA 1RVDA 2X1HA 3S7TA 1VHJA 1CDZA 3ZDEA 4LPSA 4ZVQA 5K0GA 4I4TF 2DWOA 1KI6B 4D0RA 1Q7TA 2P9EA 3U9SA 1JEOA 3TZKA 3TR6A 2BR4A 4QX6A 1RQLA 4JLNA 3L7JA 1Z2NX 5LZ7A 3WYNA 1X42A 3ZU4A 2GN0A 1B6TA 3IMGA 4IIEA 4DVGA 2X76A 1K3TA 2WTEA 5KDDA 2VZLA 1DG3A 4Q9LA 3M83A 3PL5A 5CG1A 5JNWA 4CF5A 2JA2A 2XDQB 5BUZA 4LBWA 1AA9A 1TL7C 4QG3A 4DC1A 2ZG6A 2HJ9A 2XF8A 3LYHA 2BSXA 5HOQA 3T5AA 4OFWA 4KAXA 1U4OA 2LRHA 3H8WA 3RHTA 3KB1A 4YCCA 2W42A 1FFBA 4F0JA 2PK3A 1RW4A 3DLPX 1M6YA 3PLRA 5J59A 2X8BA 2H48A 5B1IA 1V43A 5F1PA 5HG0A 2VG8A 2DKNA 1ADFA 3E7XA 4WCDA 5D7BA 1UJCA 2CFTA 2G8LA 4OMUA 3K6SA 3EC1A 2PWZA 4FXOA 4EEKA 2QG6A 5I51A 2IBMA 2QQFA 3VYUB 5KNCH 3L0BA 4CKEB 1UQTA 4B79A 1EFDN 1GFWA 2XE7A 1Y5MA 4R81A 4A6PA 4M6WB 5K05A 3J81A 3FNQA 2QMEA 1I0LA 4H15A 2VDRB 4INAA 3SN6A 1XTZA 4UOQA 3VO8A 4F96A 1FMLA 3ISVA 4HRVA 4IDHA 4YJ2B 1XZKA 4B6RA 4JQOA 3W7VA 5BNTA 1EGQA 4EHNA 3QE9Y 5DNAA 1G20E 1DOHA 1YRBA 3DKPA 3FVRA 3KL4A 4PCAA 5A4FS 3C39A 2FW7A 1D04A 1ZHHA 2BE9A 2XKAA 3WADA 1EUCB 1G8KA 3QEMA 3TQTA 4A6DA 3HKEA 3P0JA 3K4PA 3ITEA 4IHQA 5ADWA 3O92A 3N75A 4OMCA 1Z6PA 1RRCA 1OU0A 2VTBA 2QD2A 4FMDF 3WNCA 3R5HA 1MABB 4JX9A 1EB8A 4CL3A 3HUDA 7REQA 2C2GA 3FBWA 4D9HA 3B12A 1SQ5A 3I2KA 3ZWXA 4CI0B 2FCAA 4K7JA 4FCTA 4LBZA 2FEWB 4Q0MA 2GF0A 3IP7A 4NDNE 4EOGA 1U02A 2QTHA 1T15A 1UBEA 2I6UA 2QD4A 5I9SA 1RDFA 5EYPB 1V9SA 2AYXA 3I9LA 4OXYA 2FN8A 2A8YA 1THMA 3AZQA 5FL7D 1QHHB 3TL3A 3GLGE 4Q3CA 1LPAB 2JLRA 1G21E 1T26A 3TX6A 4MWBA 4YYEA 4M1WA 1RWXA 3I01A 2BH9A 3BGVA 3PSHA 3PFBA 1H0RA 1N7IA 1SVSA 1VPTA 1RLTA 4IOMA 2BZ0A 2JIMA 3QVKA 5EVJA 1RXVA 1DRWA 2G40A 5HF5A 4I8XA 3P71T 4NC9A 3U09A 2PJRA 3HP7A 1XB2A 2AFIB 3PC8A 5CDFA 4AIRA 4E4TA 1T6ZA 4HNTA 1T8UA 2VNJA 5DYGA 1HGXA 4NJEB 4DRXB 4IWNA 1U9YA 5IARA 1T0UA 1CUJA 2H52A 3A9WA 4IVNA 4K88A 4JI3B 4OX9Y 4FLMA 4YJ3F 2OCGA 2VJMB 2ZAYA 4M87A 4R8RA 3T9CA 1R4MB 3BXZA 2XGJA 2AQKA 3D6NB 4ZVNA 1SXPA 3FCEA 5E8RA 4BB0A 3GJ7A 3FRIA 2JCXA 5HVNA 4QBFA 1XZNA 3OO0A 4W5OA 4F9FA 3BFKA 5HZHA 4RNCA 2JRCA 2O2SA 4HQRA 4II2A 4J0HA 1C14A 2R62A 1GTJ1 3QBEA 1LPMA 2I7XA 3UPDA 1W2GA 3A1EA 3AFOA 4GGPA 5T3UA 3W05A 4HNRA 3S29A 2M1XA 3C1OA 1RU3A 2C4TA 4MW6A 3FAKA 1N25A 3AIKA 1CWUA 4V0OA 3ETGA 3HFRA 2GPWA 3QWIA 4ZV7A 2B5OA 4FIDA 4YA6A 1KYZA 4MS4B 2GR9A 2JGDA 3MIIA 3Q3JB 1BGWA 2I62A 3G8BA 2F3SA 1M72A 1VGRA 3BL6A 3IVXA 4RXUA 1O77A 1TADA 2ZJFA 1JMKC 2HNAA 3QVGA 4M21A 4OLJA 2OQVA 5AK0A 1T1RA 5HP4A 4KIUA 1VJCA 2PUCA 2W8ZA 2VPTA 4DLNA 3HCFA 4BTEA 1A9OA 1HDYA 1YIDA 2CFRA 4B43A 4DQXA 3JTEA 2H4JA 3KKPA 3TDKA 2D54A 3ANYB 2CV0A 4R2IA 5K3FA 2ZB2A 5J5CA 2FSHA 4EJ6A 2BDUA 2XBLA 4IILA 3QUQA 4OSEA 5JBQA 7AT1A 3ZH2A 1QH0A 3IJPA 1ADYA 1SC4A 4K81B 5F9FA 4LYAA 2QMYA 4F4FA 5IEJA 4V3BA 3K0KA 3B6KA 3T3HA 4WKOA 3C3MA 3QW2A 4U8HA 4U00A 4LYGA 5AW9A 4D1YA 1V47A 1FLAA 2D1QA 1G5FA 1E5LA 1QLJA 4S2UA 5DTMA 5JC8A 3QLUA 3ODGA 4XDYA 1N0UA 2NVUB 2KS6A 1QANA 4C5BA 1DAIA 2WG0A 2QT0A 3N05A 4M49A 3NZEA 2B7BA 4PRZA 4URHA 4V0LA 3WBJA 1U2PA 2QMHA 3AFNA 3OPNA 3T9DA 1H0SA 1V9LA 1VYHA 1M6EX 3IQWA 4J1SA 2GM3A 4WLEA 1UDBA 5FFMA 3TXXA 3EZLA 2RIRA 2E6UX 1E1QD 4YCNA 1E6CA 3D6JA 3PCTA 3CPHA 1UK7A 3JYLA 1W59A 1DKRA 4H2DA 4GPEA 4MYTA 5GJWC 1NP6A 4RABA 2W70A 3WLIA 4JL6A 3TKLA 4CR6A 4YXWD 1Z0UA 2IZ6A 2J9GA 3K0HA 2JIPA 3NW9A 2CNKA 4MVJF 3TL6A 3TMYA 3V5NA 1L6RA 5JCZA 3NMUF 1VE5A 1PJ3A 2ADOA 2NZWA 1G8MA 1LDNA 1UXOA 3GUUA 5T6BA 2WSIA 4FFBB 2HDHA 3IDSA 2XYQA 4IX9A 4P3YA 1KJQA 4PO1A 2UXBB 1JE0A 1S2LA 2AHRA 2FWMX 3DQPA 2NU9B 2R8ZA 2C5HA 2Q1UA 2A9JA 5JJBA 3H9BA 3BHNA 3UGTA 5IH7A 1PWEA 1RWBA 3WLKX 5GZ6A 4BZZA 4CCSA 2ANBA 4JI4B 4LQLA 4PPNA 2KX7A 2NSDA 5K0EA 4MWEA 5A4DA 3OFNA 4DMCA 3MJCA 1J25A 3D2AA 4P5DA 2SKDA 3MS7A 1O9BA 1ODKA 1TAQA 4C08A 1U8EA 5AVKA 3F5MA 1XQ6A 3KUKA 1USKA 1E1QA 4KHZA 3U3JA 4WNAA 4OD0A 4RFVA 4DDHA 3TRJA 3U48A 4EGJA 1AKRA 2PKXA 2XE8A 5I9LA 1NUQA 1F06A 1Z47A 1DO2A 1ETHA 3RJZA 1RNLA 2YV5A 4P35A 2A5JA 4RK0A 3REGA 1P1RA 5TF4A 4D9NA 4ZARA 1TEHA 2FPXA 2P65A 5F33A 4YJDA 1YB4A 3F73A 5IC6A 2PUBA 2BFCA 4DDWA 4F4CA 1ZRHA 1U8ZA 3LQ1A 4Y6OA 3CCCA 1KAEA 3FFTA 1QK4A 3DXFA 2M6LA 4KVAA 2ZSEA 2CJPA 1D7AA 1ECFA 1Y3CE 2QYSA 2WAOA 4X1IA 2X2EA 1KJ9A 3MSXA 4JXKA 3H99A 4Y2QA 5SY4A 2G72A 3RRYA 2H1WA 4PR3A 4ZQFA 1M2WA 1SZPA 3EYWA 3WYEA 2AX3A 1EE2A 4NXMB 5IJ9B 1Q17A 3T52A 3D4OA 2XD4A 1EH5A 1Z0IA 2Z56A 3O31A 5F1KA 1Y9EA 4G1CA 3RS0A 2XGMA 2BKUA 2FLKA 2HF2A 2UZ0A 1CS4C 3QXCA 4N49A 3ITDA 3NH6A 1I7QB 2CMFA 3NBMA 4IXDA 1NC3A 3GUCA 2WM9B 4MICA 4TV8A 4MIEA 3ZJTA 4PLWA 4N0EA 1NN1A 3LC0A 8ABPA 4LJ5A 5H4HA 1RHUA 3C3XA 5ALMA 4HDOB 3OZGA 3V1KA 3PJDA 4LDRA 4B44A 4BBPA 3KDAA 3UMMA 1D6NA 5C9ZA 3LLSA 1YDHA 2F00A 4ALIA 1BVYF 1SELA 4WACA 4ADSG 1KS2A 4KXQA 4XFDA 3TDMA 4KK3A 3C43A 3IQDB 4PC1A 5EJ2A 5LQAA 3BBLA 1ADCA 4B40A 4K1XA 4AS3A 4UBIA 3ZV6A 1QO0D 4DDKA 1QP4A 1ORRA 1P7CA 3TPCA 4D56A 2NT4A 1E69A 2HTEA 2IVFA 2P3OA 2YC2C 3MG9A 3IV9A 1NXXA 2RBEA 2G7ZA 1KKUA 2IPXA 1ARZA 2JI4A 4DIFA 5CTJA 2FDRA 3EYAA 5IVKA 3KRTA 4ZYLA 5L6MB 1T9DA 1UM9B 2EKBA 2PVSA 4WY8A 5DSZA 1WXXA 2B9EA 3OTQA 2A9QA 5CIQA 1JXMA 4LXHA 4AZVA 3BD6A 4BJ3A 2Q27A 1DINA 2Q9BA 2QUBA 3OTHA 4IS3A 3WVNA 1XPUA 2BMVA 4RTOA 4PHHA 4B1FA 4QQRA 1AKTA 4NHOA 1J0BA 3LKZA 1OH5A 3ZD7A 3EGVA 2RHBA 3HKCB 2GT1A 3UVEA 4BJ5A 1DNPA 1ZZGA 2GLXA 1PJRA 2OE2A 2K2QB 3EVCA 3NBXX 3EAFA 3ZTTA 4BMZA 4EY6A 3JYOA 2YIJA 3FDZA 4ENUA 4PX9A 4CE6A 1ADJA 4M0EA 1KTVA 3OIGA 1ZH6A 1UZNA 2V7QD 2WP0A 4MB6A 4YJ3A 2OV3A 4DA7A 1II8B 5ILQA 4RSGA 4MEJA 4QKQA 2XQIA 5J4HA 3IIKA 1YB6A 2NUTB 1TCUA 2WC1A 3KWJA 4NYIR 1P61B 5H0IA 1J39A 3H6HA 3IB3A 1HK7A 2ENUA 1ISPA 1POXA 2HWUA 2HJSA 2A35A 3HJGA 3T7JA 3AJ8A 1S89A 2RGCA 3L7LA 2FFQA 4NBLA 3WJ1A 2FPMA 1TT5A 2DHEA 3NGLA 4OKSA 5AKZA 1WA5A 2B9VA 3IP6A 5EC8A 4E32A 1KRXA 3I9KA 3QF4A 1YZGA 3P9ZA 1H4SA 3D7KA 2GARA 1C9KA 2OZEA 1DBIA 2AD1A 1ZH4A 3FKJA 3GDHA 4R2MA 3QJYA 3VNBA 1C3LA 3L8EA 9LDBA 5C7YA 1VZ2A 1JFTA 1DXHA 1ZN8A 5C7IO 2VYFA 3NPAA 1ZK3A 4G67A 3U31A 1UCFA 3DFKA 4Q3DA 4QC2A 3IILA 4Y30A 2WQZA 1DP4A 3UOAB 5BSVA 2HQ1A 1XI2A 4HLQB 3BGDA 4RVGA 4FYHA 3NHJA 4AIIA 4CM8B 5REQA 4BLQA 4JVMA 4M9UA 4QODA 3IT0A 3UWMA 2Q2NA 3ZEAA 2GBFA 4TTVA 4F1WA 5G0VA 2ZWPA 3BQNB 3OWOA 2ACEA 1W4CA 2PX6A 2W2XA 3HBNA 2Z2ZA 3W1VA 5J4YA 3H5OA 3K8OE 4CG3A 4MDEA 2CEAA 1CVIA 2LV8A 1SBYA 3TNYA 4LXTA 2W00A 4I99A 1S2GA 3BA1A 1UKVY 2YVUA 2ZI7A 1YCHA 3G0OA 4ZQCB 2QGFA 3GJYA 1C9JA 4FYMA 1SBQA 4LC9A 4V39A 1VL8A 2ZVPX 3RVQA 5C81A 2KBEA 2IYEA 3VFDA 4EFLA 1CUIA 1OXTA 4IDFA 3T15A 1IZ9A 1K4KA 2Y0DA 3NBFA 5KU7A 4RGBA 3I6QA 4YCSA 2DTDA 4LDPA 1HG0A 2ECQA 3KR2A 5IBPA 4HDKB 4WXHA 3EGWA 4ZN6A 4UULA 4MIKA 5BPFA 1IIBA 3IB6A 1V11B 3PEUA 5BWMA 4GZ6A 1SFRA 2AKAB 2X8JB 4PR0A 1E79A 1TAHA 4Q4DA 3ZY5A 4ENVA 3PT5A 2PL3A 3RQIA 1UWLA 1DTEA 2YJZA 3LECA 4I4NA 3RVLA 3NHLA 5LZ2A 2AFVA 2QRVA 2IGTA 4N3CA 1A50B 3CUYA 4G0OA 4J4BA 5DCUA 3RYHA 1WZ2A 2GTIA 2ZB8A 4RWZA 3VQTA 2PT7A 3AR3A 3I5YA 2FJPA 2Y9MB 3C8UA 3P9SA 2CJWB 1X1QA 2B37A 1KL7A 2AN1A 3A1TA 1YJBA 3H17A 4FOPA 4LDQA 3ZHOA 4JR0A 4NS4A 1SB9A 3E48A 3N8GA 3QPAA 2GJKA 3EVFA 2CT8A 3GPDG 2RFLA 3A9UA 2EQBA 4UM7A 1C9NA 3A10A 4J2TA 1K8QA 2IS2A 1QF7A 2J9RA 3K9NA 1GRVA 4UHHA 3ROZA 1FDOA 1DAPA 2QTCA 2ODWA 5DHQA 2BGWA 3LWZA 3PGMA 4LHWA 3QFFA 5FR2A 2R1TA 3B1WA 4EPVA 4GR4A 5A62A 3LDAA 4MX8A 1CB0A 3I0NA 3RT9A 3HBFA 5LP6C 3OF2A 3G1WA 1UBLS 1TVKB 2R48A 3D1VA 4KH0A 3Q6NA 5CBPB 1W29A 2AXQA 2Q8NA 2AF4C 2BTQA 3GLGB 1R4ZA 1P5ZB 2COKA 4LWPA 1OIXA 1NI4A 2R7KA 4YUAA 1AKWA 3D7SA 1BHQ1 1RWNA 3PYXA 4HSEA 4CM6A 3MIZA 2EF1A 2IELA 3F98A 4C21A 3V8PA 4EY7A 4HPJB 1UEJA 3A2LA 4BQSA 1AB5A 4NECA 1WW2A 3RVJA 1J33A 4J0KA 1E5QA 2JFUA 3R23A 3KQNA 3PKZA 1V1RB 2YS7A 3WSTA 1YKGA 3T41A 1PU2A 5EHNA 3V4SA 2Q3FA 2ZB7A 2C3OA 3R7LA 1XVVA 5GGXA 4JKOA 2R6GA 4W5JA 2QY9A 4V1CA 4ER3A 2FETA 3PFWO 2HJVA 1P7YA 4BLUA 1CU1A 1I2ZA 3EISA 2NSYA 2XAAA 4FBLA 2GO7A 5GV8A 2J5BA 4YJHB 1B1AA 2BGIA 3K0AB 3H3JA 3L77A 1NTRA 3C3PA 3NGMA 4M83A 4WLNA 4Z3DA 3USZA 6REQA 5J43A 3KHUA 5HEKA 3UBTA 4LFAB 1IG3A 2CMGA 1R8YA 1U3GA 2H29A 2QL7A 2ZRIA 3B9QA 3GBPA 2VRBA 5ALIA 5FA6A 4CMBA 4YR9A 1Y8QA 4TZ6A 2JFPA 1QIMA 2IIQA 4C9BA 4M9SA 2WFAA 2Z8YA 5B6IA 3SDSA 3U3XA 3KJXA 1YDWA 4Q9JA 4FR2A 1OZ0A 3NWJA 2Z57A 3C7CB 3EQ7A 4PZPA 1SA0B 2A0FA 4JASB 4JSTA 4ONEA 5DIZA 2BGGA 1UDXA 2VPZA 4LPKA 1KZHA 1A7UA 4GI5A 1N75A 1HWYA 2D1YA 3NFRA 4BV9A 1SCNE 3QJGA 1Z8HA 2AMJA 3BD8A 4G5YA 3AF0A 1I2DA 3KS9A 3LT2A 3OD5A 5D3MB 3TI9A 4AW9A 5JC1A 3W6NA 1E60A 4L16A 1UF9A 1EMDA 3WKAA 4K9LA 1MVLA 2PMWB 3W6UA 4TTTS 1N36B 3FBTA 3EXIB 1JJ7A 1U0NA 4R9RA 3GG9A 1EFHA 2ASVA 4B87A 4JMPA 1XFDA 3RG2A 1X0VA 1KMQA 3A3YA 3MBOA 1AKUA 2YHSA 2IH2A 5TMDA 2VSOA 5CYPA 2Q2VA 4P3KA 3RIHA 2WIJA 2YHAA 4RE6A 2M6KA 2GWRA 2C57A 1PUIA 2HCJB 4PZDA 5D3ZA 3UEOA 4PNHA 4X7RA 2G1PA 4GWKA 2AG5A 4V0MA 5TMPA 1BIFA 1PEYA 2AN5A 2IYPA 5T4HA 4F4JA 1LLDA 1CTQA 1W4BA 3FFAA 1Y0BA 3Q8KA 2QTFA 3PU6A 1EVKA 4G5OA 4IZIA 3T9BA 1E4VA 2WNIA 3CONA 3M81A 5KQSA 3I62A 5EJMA 2VKQA 4QTUB 1PJTA 5K3SA 6ADHA 3QPVA 4WN9B 1D2RA 5AWFC 4BXOA 1IZ8A 3OLZA 1HYHA 1XNHA 2B4QA 3LD9A 1ZI6A 3TLJA 2YMPA 5A06A 5J1TB 2MT9A 2ZT8A 2CLCX 4BFVA 4OBXA 2JJ8A 2P11A 3I6ZA 3P2YA 2YV1A 4C4AA 1RJWA 1L7OA 2H1VA 2NZUG 3BD7A 3SJZA 2WFMA 2P62A 3ZWDA 4KGXA 4F1KA 2HR1A 4GU5A 4LK2A 5B3JC 3G0HA 4JKYA 2HY7A 3WTCA 4AZ3A 4DBLC 3G2HA 1KVQA 4BNFA 2H2IA 3FDFA 1NQAO 5DW0A 3Q2IA 4AM8A 1U9CA 4FSDA 4GRIA 4BKQA 2P9JA 4HAUA 1U7UA 2ZROA 4L51A 4AU1A 1V5FA 3NAZA 1VC2A 4ZMRA 1RZRD 3PV0A 2ZE8A 1Z2AA 2EP7A 2X8AA 3BK2A 4GQAA 4W5NA 2P1DA 4KOAA 1UJBA 3DDSA 1ZSVA 2QAGA 5CB4B 1S6YA 1WP4A 3HCPA 1V2HE 2NXWA 1K3UB 2YXLA 1BQEA 3AXTA 4C3VA 4HO1X 3EG9B 1T4GA 2XCLA 1XJQA 3RCBA 2FG6C 3ONVA 2RJNA 4HR7A 4YQEA 5BQ5A 5K0JA 1X70A 4PHGA 1BWQA 1I0ZA 1EGMB 1LX7A 2GCGA 1NFFA 3B1FA 4PIPA 3QPUA 1ZKMA 3MWFA 3KTFA 4UPDA 5E1OA 2ZYWX 4BJ1A 2HNBA 1DIRA 4R8MA 3EOBI 3MUNA 1XRLA 4QE3A 4PGMA 1F38A 1S3GA 1MGOA 3O2JA 4NCJA 4D7AA 4RK4A 1J21A 4DM7A 5A5FA 3L7BA 5JSZB 4P8RA 3LSYA 3NC0C 3LTNC 1DKUA 3AW8A 3TLGB 4EYQA 2ZFUA 1D9ZA 5DOVA 3BGSA 4G4JA 4W1QA 1Q1AA 2H9YA 1U2GA 2GH1A 1WDWB 1XLTA 2PUAA 4JQZA 4YASA 3MQ2A 3WWCA 4M22A 4RV9A 3DA8A 5F76A 4MAFA 3I0MA 1GPWB 4URYR 5IDWA 1IRXA 2YWRA 1SU7A 3PHBE 4LOAA 1P72A 3EFHA 1KJIA 3HRHA 1V9CA 4I4LA 2Y1CA 3PT9A 1BGXT 4N82A 2MSWA 2G80A 1SRRA 5AR1A 1QGOA 3UMSA 1ZJWA 1L5MA 4Z1OA 4ZRNA 2GPBA 4I55B 3V34A 1UAGA 2BBTA 5B1HA 2ZM6B 4JXXA 3CNBA 3KJFA 4MCIA 3BG5A 3MWEB 3OQPA 4KIFA 1GUDA 3ANSA 3OKAA 3TLYA 5F7JA 2Z4SA 3BUSA 1OHHD 2ZIGA 2X19A 4FLFA 4N5IX 4MYHA 1YHNA 5EWJB 3PSAA 1U3DA 5D2CA 4D9CA 1EUQA 1OXUA 3LDGA 3FSJX 1IIRA 1HMYA 2O7NA 3IA7A 3SXUA 1JG4A 5LNK1 1KI6A 3V8NA 3ZVNA 2O1WA 3CUKA 3T5BA 1FDSA 1YU6A 3S5UA 3DT9A 3QVGB 3ORYA 4R3WA 5F73A 2BHNA 3Q2KA 1GGJA 3R6TA 4DR7B 4C03A 2PGAA 3OPYA 1Y9AA 2HYIC 5AUPB 2GPNA 5B57C 3JQBC 5C2JB 1J23A 5CTAA 4RF4A 2A0XA 3F96A 3G5UA 3KFXA 4C78A 4HZIA 2V54A 3T7TA 3WE7A 2I7VA 2D2EA 1Y8AA 4PAOA 4W4TA 3NHKA 1GAEO 1DEAA 2Y1GA 4DC0A 4US0R 1E2PA 5FOQA 3I05A 1DX9A 5EP1A 1L1QA 1SZCA 2B94A 2O2EA 4I2NA 5AHKA 4PPYA 3TZEA 3H83A 5DRTA 4ZJYA 2CVZA 4HGRA 2PO5A 4RK5A 4GX2A 1HSOA 4XLZA 2LP4Y 4C0JA 2ATIA 1J24A 3GJ6A 5DLPA 1KBQA 4UOZA 3ZXSA 1KYVA 1RFLA 1HETA 4LHVA 3ZIDA 1A4XA 1Q92A 3EF0A 5BV8A 5CDTA 4W9RA 4DUGD 4Q00A 1HEUA 2QUAA 3HNRA 4U7HA 3GAFA 4M0UA 1X2BA 5AVYA 4KKXB 2JL1A 5E0OA 2HV8A 1EX9A 2XMRA 4BGIA 4DJJA 4F8YA 1EX7A 2G9ZA 3RUPA 1W9HA 4HXFB 3VZPA 1DRKA 4W1RA 2REQB 3VDNB 1IXYA 4R2XA 4I2VA 3Q1LA 1WQ1R 1HMPA 1K63A 3AUTA 4RHEA 5KYWA 4DMLA 1QG4A 3IVCA 2HA4A 4S0ZA 3B8EA 3DZIA 5AXCA 4G81A 4BUZA 4AYXA 1ZMBA 4V1CI 1HQCA 2IOYA 1JDBB 4KCGA 4KPFC 2OMKA 5JZBA 2DUNA 5JO0A 1AO0A 3D5TA 5DI9A 1G0NA 3BL8A 1UC8A 1YR6A 4YRLA 1FMJA 4Q1BA 3LXRA 4HQLA 5JYDA 2XKKA 3BMQB 4RHFA 3RC7A 4C7VA 1KVUA 2OXRA 2Q6LA 3NT5A 4JDUA 5CRIA 4RY8A 2QBYA 7REQB 3EGOA 1JSCA 3A7DA 2PFGA 2W83A 1JG6A 1VLZA 1KK2A 3MD9A 1YIAA 1PW5A 1Z9BA 1JDSA 1NJ8A 3AM5A 2WYWA 4PGFA 2J0UB 4AZTA 3NTRA 1MMFB 2P1RA 3AP3A 3VSBA 4WK6A 4D4LA 1DAOA 5IZ4A 3PA8A 5KAPA 3GLHA 4WNAB 1QK3A 3NVMB 1CW2B 1NY5A 1XMVA 3CZCA 1W0JA 1V8PA 3NNNA 5I7UA 3PQ7A 2AYYA 4WDRA 3SC4A 1QGYA 3WJ2A 5JH7A 2CLKB 1SURA 2CWDA 4NV1A 2QD1A 5KEIA 2H7YA 5D5HA 2AOVA 2XTNA 5EXDA 3MILA 2BYTA 1RYHA 2O8BA 2X5KO 1CUAA 3SGLA 2D2VA 1RP7A 3NR2A 4BLVA 5EVCA 2Z9DA 1DFGA 4WOJA 5HQJA 4YV7A 2GEBA 5ITWA 3HQ4O 3HVJA 5BWBA 4LZOA 1P7WA 4MMYB 3L7IA 5ICCA 1VG8A 3IALA 1M0EA 2MMGA 4DMGA 4FHDA 1POWA 3C48A 4WVFA 1XWWA 5DJ5A 5DBGA 1YSCA 1I80A 821PA 4CKCB 3M9WA 3RFFA 5CM9C 2MOKA 2R3SA 5AM2A 5BQFA 5K6AA 3QBTA 1T0PA 3K1TA 3SKVA 3SX2A 1GCGA 2ILTA 2CNWA 4KMSA 2JANA 4FGSA 4TV8B 3I4CA 2GGSA 4AMYA 5KKCA 2PBZA 1HKHA 1R5BA 3WIUA 2A86A 4F4DA 4RZ3A 3L7YA 4FI3C 2ZJ8A 1RBZA 3BMOA 5FO1A 3UMJA 3FYUA 3NCHA 4RVOA 4U7GA 2J3LA 5DF1A 4C0SA 3GH3A 3H97A 1TC1A 3HB9A 3OKFA 1JHRA 4NDZA 5JYBA 4KZKA 4QHTA 3CWCA 1WF6A 3DW3X 3QMPA 4MJ7A 4PTZA 3SC6A 1NRXA 3X44A 3BPSA 3Q8XB 5TPZA 3R5TA 5HM8A 1L7DA 4K3VA 1HZZC 2J09A 2ZR0A 4M9CA 4HN4B 1G4UR 1T9GS 1SHUX 1CJUC 2IYSA 1YVDA 3FUTA 4JOBA 4TYMA 4JC5A 2V7WA 1MTZA 1IPHA 1VSQA 3UFXB 2VNHA 4J0FA 2SKEA 3CPSA 1SXJE 3KPJA 5AXDA 3B7GA 1DV1A 2H16A 4LISA 1E3LA 1T4MA 4FDUA 4TV8F 3V2IA 3ZK9A 1ZISA 4A73A 5K09A 3SQMA 2WWYA 4XUGB 5HFJA 4RYLA 2RAFA 1Q1QA 1UBSB 2G7MC 2QTTA 3LVFO 3E4DA 4PG4A 2RB5A 5ICFA 3E18A 3KV1A 3W1EA 4MW1A 1JN0A 1AGPA 3ZQ6A 3KAQA 4JCCA 1JEYB 1NP3A 1M7GA 1G19A 1O95D 2KI5A 2GD0A 5ESDA 4NMHA 2VYCA 4XFKA 1BVUA 1JAZA 1W0KD 2VUSA 4DPKA 1MO5A 2V3CC 1WQ3A 4FKBA 4MUMA 2QJRA 3WIBA 1BDIA 3DDZX 3PDIA 1SKYE 2Y66A 3KSDO 4HQOA 4L75A 4UPEA 4B3SB 4NU0A 1R9NA 4RFSB 3I3OA 4AT1A 3H2GA 4AX4A 4YJ3B 2OM2A 4TROA 4KR7A 1DCTA 1EEXB 3N0RA 3RBXA 4PG5A 2WUEA 4KQMA 1P60A 5L51A 2CV1A 1J0CA 3ZCVA 1XXLA 2B5WA 3NOXA 3TBKA 3IBGA 4JITA 5FBHA 3RUIA 4WJLA 1V25A 2GRAA 1D6JA 3GY0A 4KGVA 1QLHA 4KO4S 5CLHA 4DMKA 4E5YA 5AW0A 5DP2A 2HD4A 1ZUIA 1ZN2A 3LVBA 1TUBB 4EFKA 2GOYA 4OB6A 5B7PA 1XDUA 1E1CA 5CVCA 4F3KA 4LF9B 2KW5A 3QVOA 3N2NA 2OEPA 1QGUA 4Q9KA 5AM0A 1V4NA 2R79A 4RU1A 1QO0A 3OEED 3E81A 2D5IA 1FRFS 2QZ4A 4Y2GA 1Z3IX 1Z4QA 2XVXA 3GFFA 4OP3A 4ZALA 4I6GA 1YFLA 2NIPA 1LLFA 3DF7A 4JA0A 2ATXA 1N1GA 4J7CA 1F4VA 1OTYA 5LU9A 2OAGA 4K26A 2QV7A 3HHEA 4OY3A 5T4FA 4PPFA 3L43A 1R37A 2GD2A 2O0KA 1O87A 2EZ4A 1ZXLA 1S01A 1WOMA 4RK7A 1KYYA 3IPCA 4Y1EA 4I50A 1MUUA 3PZRA 4HQFA 2BGJA 4DNXA 3FPCA 4Y2JA 4EO7A 2X9GA 4DVJA 5M29A 3FYDA 1DAKA 2WT4A 4MS3B 3PR1A 2VHWA 4JLPA 4HDSA 2VFAA 1DMRA 2FKNA 2J6IA 2EJUA 2DKFA 3AVOA 4JUIA 3UGKA 1IBKB 3LUGA 1P9RA 4YUVA 3VOAA 4R9VA 2WUDA 3SR4A 5HIKA 4IIBA 4M46A 5DNCA 1VHQA 3RV3A 3ON5A 4NZNA 2B69A 3AL0C 4WBXC 3K1AB 2A5FA 3OTOB 5LMZA 3RLIA 3ZLJA 2ERXA 1II8A 3IX7A 3JYQA 2B99A 3MT9A 3N2IA 4N7RA 5FB3A 2O4UX 3IODA 4HKTA 2EKPA 2HLHA 4TXLA 1V37A 1G2OA 1UBRS 5LJLA 2B1GA 1ODIA 3ZCXA 4YHBA 3E8MA 4RGYA 4A0QA 3DVQX 3ASUA 4Z51A 2H65A 4E4RA 4KWHA 4ZOQI 3I5XA 4R3NA 4A10A 3QKWA 3MQ4A 1S5PA 4LW8A 3GMTA 1NUHA 4YI5A 4DSUA 3TRDA 1I2MA 1W47A 3GC6A 4WD3A 5LUAA 3KDSE 1MHTA 4LXUA 3K1ZA 2ZCUA 3JX9A 3CF4G 1E9SA 1XNQB 1ZRNA 1BXGA 2P6PA 2QVLA 2RCNA 3D5QA 3H1EA 3OIVA 2ONJA 4EA7A 2FP3A 5BW4A 1CQZA 4NU6A 3QPBA 3HB0A 4AQ7A 5IMSA 5JBNA 2GAJA 1TA9A 1TEXA 2EJVA 3P0RA 4K0RA 3RRFA 5A4JA 1X39A 3L01A 3MOSA 5HR5A 1UFQA 2ZRDA 2QN3A 4TT3A 4LJYA 4P33A 1GU1A 4CLOB 5K8VA 1PNQA 3OJLA 5LIPA 2F4VB 1LKZA 3VJMA 1REQA 4QJ4A 4ZXFA 1LVUA 1X7ZB 4V0KA 4X54A 1T6YA 5F4BA 4FWIB 2QPTA 2C20A 2HIGA 1AQJA 1D2MA 3ROGA 1RQXA 4S3MA 4N3AA 2J6BA 2ZRQA 3DEHA 2OP1A 1Z88A 2Z8ZA 3FPFA 4YP7A 1YJ8A 2BF7A 3NTOA 1Y3DE 3T61A 2RGUA 2IEZA 4PPGA 4TTSA 5JSQA 4HDAA 3EXEA 4ML3A 4OUKX 4R05A 5B58C 4ZI5A 1WTAA 1C3OA 3FTCA 3P45A 4MWTA 2WD9A 1NR5A 2YFYA 4WX2B 1TPZA 4RJKA 3WZ2A 4CKBA 4X8HA 3O8NA 2BI7A 5BUCA 5C4IA 1U3FA 1B1CA 2HDNB 5ERYA 4QFBA 4A6XA 1JHYA 5G1OA 1PKXA 3GJTA 1M2KA 5BT8A 1KVTA 4MVJI 3VSCA 3A31A 4BU1A 4NOMA 4YQFA 5AW6A 3O8BA 3PIDA 5LZ9A 1NM5A 3R3JA 3QU4A 4W5RA 1DJMA 3K7EA 3DYIA 3PLNA 4LCEA 4P7KA 1VSBA 1WMFA 3DWFA 4N7MA 1XCGB 3E9ZA 3IP8A 5K8CA 2X0JA 3UG7A 4F11A 4MW5A 4FTWA 4QU9A 3O4HA 3BJEA 4G89A 3IEKA 2DBYA 2V58A 2G0TA 4IF6A 3QENA 1YL7A 4YRGA 1NVFA 3I32A 3O73A 1KQFA 2WHPB 3ZGZA 5DX1A 2MSKA 1XFAA 3P4UA 3R7WB 1IE3A 2EZ9A 2WA1A 3U26A 1Z2EA 3A1DA 3OCUA 4TLLB 2C8VA 2DF8A 3JV7A 5BN1A 2AJCA 4M1MA 3DB1A 4BAZA 5CA0B 3E5MA 4WE3A 1QYRA 1RM5A 2BEWA 2VBIA 1KI2A 3T9AA 1DMSA 2HEIA 3NT2A 4QA9A 4WV3A 3OMLA 2XXAA 2VDMB 2ZRNA 3I37X 4LMRA 5AHXA 5DW3A 1GKIA 3O90A 4FYKA 1UK6A 1EVEA 3E8SA 2N3ZA 3RHSA 1GR1A 5IRCD 4ZV9A 2J3HA 3GZNB 4JVSB 5A9SB 5CH3A 4OHMA 3VTKA 1YS1X 1NVTA 2NG1A 4ZRMA 3AHFA 4BO0A 4ZYWA 1YE8A 3FVWA 3OPVA 4HUQA 3Q5DA 2PTHA 4FE7A 4JSRA 1XQYA 3NM6B 3ZY2A 1ISGA 1LI5A 1N5IA 3M9LA 3AB8A 5TQ2A 2C2MA 1Y5NA 4QOHA 1A9YA 2O6HA 3OZWA 4BCDA 5JASA 2PYZA 1KH3A 5JFTA 4HYYA 5CB8A 1ZG3A 3GW8A 1E94E 2I65A 3ZWQA 3ZLVA 4HAWA 4RZQA 3HYNA 1EWVA 3UATA 5KSPA 1KIAA 1WQ4A 3OLWA 2P9FA 2PS3A 3IS3A 4FKMA 4Z86A 2JAOA 3EXFB 1DPGA 2YYYA 3GPBA 4HL6A 3RYHB 1TA4A 1BFUA 4G9BA 3PE3A 3ABOB 5CD9A 1HE8B 1WVGA 4PHCA 3ZBPA 2QT1A 2J0QA 5GY7A 1Z5GA 5BSWA 4OJYA 4C7MA 2I55A 4DSTA 4CM9D 2ZRJA 2QSZA 5LN1A 2A58A 1AGXA 1U7OA 4EX7A 2JIQA 3A3OA 2WWIA 5JHGB 3KQPA 2B1IA 2GJ9A 1JPUA 1T8WA 3RBVA 2OMEA 1ULZA 1WL8A 3RT7A 4TLEA 1A7AA 2OFFA 4FC6A 2WD8A 3G2IA 4ZVSA 4UE2A 4WZAB 3VPDA 1N0HA 3X0DA 1WUYA 2HRQA 4L07A 1YC5A 1KQPA 1L4HA 2AZMA 4YRFA 4KXXA 5ELMA 5FA8A 4GM4A 1QHXA 1MV8A 2C95A 4MSUA 4AULA 3PA6A 2NO0A 2QW8A 4PVDA 4L15A 1IY8A 3SU8A 4B6GA 2Z8XA 1GFZA 2AMYA 4YXWA 5TVKA 1RMQA 4YP6A 4YV1A 2RMKA 3K05A 3AQ4A 4ZYXA 3AEZA 3W3AH 4LOHA 1U63A 2AR0A 3COJA 4F3RA 1F2UA 1P6XA 1GNVA 1K0FA 1I2BA 1UOEA 2NTYC 3GV0A 4KKVA 4KNWA 4E3ZA 3DKRA 2IBTA 4ERXA 4NF2A 1WU8A 3FI0A 3K70D 4LRQA 4MVJM 3C3EA 3IAS6 3FN4A 1A4RA 3BHMA 3ZIUA 2QVZX 4FYYA 4GRDA 3GFVA 1M6NA 3LXMA 1RXSA 5HE8A 4Q7QA 2QMZA 2JH9A 5CA1B 3SSAA 3ZQJA 5JNUA 4ZHQF 1PNOA 2Q9AA 3D31A 5CVEA 3HCOA 4PLVA 4BLSA 1KFBB 3K8ZA 3V4RA 2A84A 1MRZA 1ULTA 4DXAA 4LTMA 2ZU0C 1PZGA 3FX2A 5IFLA 3ASVA 1KAQA 2FQ1A 2XPCA 4KFUA 1EFCA 5JATA 2VQEB 2OECA 3AHJA 3MHPA 4O5OA 4X92A 5CURA 1ULAA 3ZY4A 1FQKA 3ZY3A 4ZEWA 4E1VA 5F2KA 1NY6A 3L5KA 1FB5A 2BFWA 1L4EA 2Y0EA 4S24A 1E9BA 1JQKA 4WOCA 5F2OA 4HEJA 5AI0A 4E08A 3KOUA 3RSLA 2I91A 1C80A 1I3CA 2PBRA 3C8ZA 3HR7A 4YMSA 3VYWA 1IFXA 3T5TA 1ZNWA 2K7ZA 1GGNA 3GWGA 2YTZA 1FK8A 5DM2A 4YRCA 2P0YA 3IKJA 2A33A 2RAUA 3V2HA 2UZ4A 1X9HA 1UL1X 4CDRA 5DN6D 5AVUA 1I3KA 1NI3A 1KZ9A 1CLEA 1ZQ9A 3IAXA 4RHXA 2NSJA 4UBOA 5COAA 3V7FA 3WBBA 4RPCA 2ZYDA 3C3AA 4D2IA 1SQ6A 4UJ3A 2FZGA 2DPXA 4CNQA 1T0BA 3KDPA 3ZZMA 4KQ2A 1FXWF 5FTLA 3H9CA 3G1UA 3BULA 3GA7A 5AESA 3ZD6A 4WCVA 2O3RA 2W2TA 4BUJA 5HCNA 2FWPA 4I3HA 2QX9A 3L46A 3WGVA 4QVIA 1CUEA 4ND8A 2PR2A 4L78A 3QUCA 3N7UA 3ONWA 4MNTA 4YAUA 3ND6A 4KQKA 3QFRA 5CR9A 5HOEA 1W36B 5CAEB 1A8UA 3CG0A 3NHPA 3OZTA 4H31A 3BICA 3FIUA 3SR0A 2D7DA 4QFCA 3M1IA 3U44B 4XWKA 2VT7A 3FCOA 3PUZA 4WJZA 2WVAA 1F1JA 4LFBB 1J5XA 2C7VA 2Q29A 3PNMA 5LDDC 1NVBA 2B8EA 3N9IA 4G07A 2WZDA 4OVKA 4F45A 5U1PA 1I10A 1E66A 1X14A 4L22A 3FNHA 3KKEA 5ALZA 3R5KA 3C97A 3ZE1B 3CF6R 1G2QA 2HJHA 4MVJG 5C4GB 1DOZA 2QL9A 3D43A 1AQNA 3AUXA 4DUYB 2FGKA 1OTHA 4B34A 3LXXA 2QTGA 2C8JA 3GT4A 4DBVO 5F1YA 1KNXA 2W6OA 4YP0A 1NWHA 1A9RA 4M0CA 1TB4A 2BE7A 3OZDA 2ESRA 3RFUA 3WJ7A 3PUWA 3U81A 4FINA 2ZRGA 3UV7A 3PUXA 2DGDA 3LC2O 3N2KB 4JEIA 4X8OA 1OA1A 2XDWA 2Q1SA 4ZZ1A 3E58A 2JLVA 4UNQA 5K4HA 1KZ6A 4N5NA 1EP1B 1XRJA 3EC2A 3ECCA 4QWWA 3W06A 2JLUA 1U5BB 1BS2A 2FQYA 2FZVA 3FTFA 1A8SA 1YCGA 1LNSA 1A0OA 1YUMA 1D2EA 2P67A 1T9KA 3AK4A 3GJ3A 3KYCA 3BSWA 5LZ8A 1BG6A 1I3OA 5JISA 4HNGA 1DIGA 5ALGA 2A1TR 4G6ZA 3UO8B 4DRZA 1XZGA 2MSEB 5H68A 5IKXA 2ZCJA 2CBZA 1OX4A 3FHOA 3GQBB 3QWBA 4PAGA 3K0SA 2Z9BA 2G9VA 2XNKA 1BMDA 4A8JC 4E5VA 1P7VA 2AJBA 3RTGA 4C43A 5L3ZA 5JS8A 1YZ3A 4JBNA 1JIUA 2X0FA 2H6EA 1JTEA 2QLMA 4IGEA 1DLIA 1FP6A 1INLA 3ESCA 3OOHA 4GT1A 5BSUA 3HM9A 4N5DA 1C4XA 2K87A 5HTOA 4WNYA 2P2ZA 3GDGA 5CK5A 5EKUA 1G3UA 1YH3A 3Q8LA 1O6BA 5G1NA 3JR3A 2W98A 1U1DA 2ZIXB 3JVDA 1S4QA 5TF0A 3KPYA 5LMCA 1F0KA 1IOLA 2V3WA 1JTVA 2H59A 3IVMA 4QREA 4R1TA 3CX7A 5BOSB 1XU7A 2AJ8A 3O94A 5GIPE 4N12A 4DZTA 1IQUA 4JYAB 1CYEA 4J91A 1Z62A 1DJQA 2FK7A 4ZVLA 1M5UA 4A2PA 1QIGA 4QTYA 2ZRPA 4JB3A 5D01A 1J42A 2C3PA 1WIWA 2W6NA 3GLFE 1K2VN 2F7SA 2VHUA 1HL7A 2H1SA 3QXJA 4JT2A 3IJ5A 5MN4A 1XMPA 5IZCA 2QMUA 2JLSA 2Q46A 3BWBA 2RCYA 3JQAA 4FFRA 2C9BA 2PRKA 4YS6A 3DEJA 4Z9AA 3ZYCA 4NQRA 3D3QA 3PNKA 4GHWA 4GVLA 4M7RA 3W3AD 1IEWA 1WETA 1QP7A 1TCVA 2FPLA 2HHAA 1E8DA 3AL3A 2IHVA 4EZBA 4D6YA 3B1XA 3O8CA 4ZPXA 1M2GA 3AR7A 2CLOB 1GRQA 3QUAA 4PFKA 5DNEA 4YONB 2I4TA 1FXSA 1T0JB 2FXVA 1ZEJA 4EGSA 4HC4A 2HF8A 3BWXA 4PICA 3WGUA 2PRJA 2IC5A 3SM3A 1SVNA 1ECJA 1A4IA 4EG0A 3CC8A 4XGNA 3BCSA 5HKLA 4CKZA 3COVA 1MH9A 2VDLB 4MR7A 4YPFA 1N9GB 2W6CX 2Q62A 2R7MA 1QOZA 2I03A 4KQ6A 1A2BA 1XSEA 2QRZA 1DCKA 3DMFA 4N7BA 5F21A 5F52A 5F2EA 3GLHB 4PZUA 2ZI3A 1JHUA 3I4FA 1AQ6A 3AKDA 1E4YA 2OESA 2YWEA 2F1RA 1IRIA 1KH1A 2V7QA 4FB4A 2PL9A 1YTUA 5HWSA 1L4LA 1V3UA 2G0AA 3UAWA 1ZM2A 2H1CA 2VHYA 2Z04A 1ZD2P 3E0XA 4GMHA 1XQ1A 2LPMA 3ESDA 4H08A 4R54A 3EGDA 1QRAA 3W0LB 1J00A 2HC9A 2ZBRA 3B1JA 3C3DA 4QJ3A 5LKAA 3AGPA 4ZGWA 2RH4A 3V1NA 4RD3A 1RD4A 2F3UA 3BTOA 2IW1A 4IDAA 1EHIA 4BWGA 1Y1LA 4IRMA 3SM9A 4OAQA 5JNVA 1C1DA 5ES4B 1JEAA 3CKLA 1QVVA 4RMGA 4DV7B 3B36A 2ZVJA 4O29A 4EB3A 1Y1SA 1J0AA 4ZI7F 5I4BA 3L4KA 1MV5A 4CKCA 1JHDA 3PUKA 4P54A 4MMZB 1YQGA 1XQWA 2ZZKA 1SOVA 4JHXA 4M60A 1P73A 1K2WA 2QM3A 2XZTA 3LM8A 4KVZA 1Z6GA 1ZMTA 3NKLA 4BMCA 5BVGA 4D43A 4BQEA 1X7GA 3GXOA 3IQZA 4BO7A 2AQ8A 4TZTA 4YN3A 5LXTB 3AFIA 3FYCA 1QOPB 3VX4A 3MUEA 4C0XA 4BVAA 5L3SB 2CXRA 4D80A 1LFDB 1XRRA 1MB3A 3S2YA 1IUKA 5LQNA 1TA0A 2YCBA 3SF0A 4HY3A 2IF2A 3C5EA 4XGQA 5KDLA 3VH1A 4Z3OA 1HF3A 4U2BA 1VE6A 2QXTA 2P9HA 2VJAA 5GOTA 4Z7QB 1XCMA 2IVZA 2DPMA 3GLHE 5PNTA 4F8EA 3DXXA 5E8JA 1VBNA 2OO3A 2EX4A 5E6UB 2AYZA 3PQ8A 4NV3A 3T4XA 3THRA 2V1UA 2HF9A 2B3D<