1YFKA

Crystal structure of human b type phosphoglycerate mutase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
243
structure length
243
Chain Sequence
AYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase, hydrolase
molecule keywords Phosphoglycerate mutase 1
publication title Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2005-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1yfkA00
3QPVA 1C80A 2EOAA 1T8PA 3FJYA 5AJZA 5AK0A 2GFIA 3IT2A 4IJ5A 1DKPA 2H52A 3EZNA 2P78A 1C81A 1FBTA 2P79A 5CX4A 4GPIB 1DKQA 2H0QA 3HJGA 1ND5A 5HR5A 2IKQA 1DKLA 3E9DA 3LNTA 2P2ZA 2WNHA 1EBBA 2H4XA 4PZAA 4ARVA 1QFXA 5AJWA 4ARUA 3D8HA 2RFLA 1DKOA 2A9JA 3PGMA 1SKAA 3K4QA 4ARSA 1E59A 2PA0A 1NT4A 3BIFA 5AJVB 2P2YA 3OI7A 4FDTA 1ND6A 1RPAA 2EKBA 1E58A 3GW8A 2P9YA 4AROA 4IJ6A 1H2EA 4JOBA 3K4PA 3R7AA 3GP5A 5AJYA 2AXNA 1SK8A 4D4LA 4MA4A 2P6MA 3MXOA 3FDZA 5AJXA 2DWOA 2WNIA 3GP3A 4GPZA 3EOZA 1H2FA 1BQ4A 2I1VB 1SK9A 1V7QA 2HIAA 3IT0A 1FZTA 4E3WA 3O0TA 1BIFA 1K6MA 3LG2A 2YN2A 2DWPA 3IT1A 2A6PA 2ENWA 3D6AA 3FDZB 3D4IA 4FDUA 3KKKA 5HTKA 1UJCA 3DB1A 5PGMA 2P9ZA 1BQ3A 2HHJA 3NTLA 2YN0A 3QPWA 1V37A 4TSRA 1XQ9A 2QNIA 4QIHA 3MBKA 2HPAA 5CDHA 3NFYA 3E9CA 4JOCA 4PGMA 1YJXA 4EO9A 2P30A 2P75A 2WU0A 3LL4A 1C7ZA 2ENUA 1IHPA 2P77A 4HBZA 2P6OA 4JODA 2OWDA 2EKZA 3E9EA 2F90A 1RPTA 3DCYA 1RIIA 3C7TA 4D4MA 1UJBA 1TIPA 1SKBA 4ODIA 4PZ9A 4D4KA 1QWOA 1DKMA 2BIFA 3ZHCA 1DKNA 4D4JA 3IT3A 2P9FA 3QPUA 4EMBA 1YFKA 3F3KA 1QHFA 5CU7A 1CVIA 2OWEA 3F2IA 2H4ZA
chains in the Genus database with same CATH superfamily
1KKMA 4B2IA 2HPVA 3M5CA 1NR7A 3U1TA 4IQGA 4O1HA 1MW8X 4J0HA 1G20B 3L8CA 1L0BA 1GCGA 2EWMA 3OE4A 1JDBC 1UBJS 3HBAA 4PLHA 2H0QA 5THXA 3U1BA 3G0IA 3DTVD 4G5GA 3CNHA 2JDIA 3PVSA 3DJYA 1EE2A 3HCAA 2XZDA 2F4NA 4NH0A 4IQ4A 1DPFA 5KOYA 3IP1A 4DJAA 4YJHA 2XHZA 4HLCA 4HLUC 2QLBA 2CLEB 5AVKA 1JHUA 2FSFA 1UKCA 2NV2B 4G1FA 1IEVA 3AR8A 2GX6A 3ZQ4A 3FTCA 4A6PA 1NBME 3EIUA 4P4NA 5KOJB 5F1YA 5JI2E 4AFNA 3D3WB 3GROA 1KIFA 4XQEA 2IH2A 2OQIA 3RJTA 3A32A 1BXRA 3GJSA 1TM7E 4HWGA 1E2GA 2CNOA 3AFGA 3HP7A 3KZOA 2W2QA 4X91A 1TM3E 5LQSA 2PX2A 3W5CA 2EKBA 1SXJB 3HYNA 3LGSA 5KSPA 1XL1A 5A9SB 5U9CA 4FXOA 4B40A 3WV5A 4QA9A 3LIPA 5DTMA 2W6ID 4HDSA 4RV9A 2VCHA 4ZAXA 4MS4B 4A8TA 4WKOA 5L6MB 3JQGB 2R6FA 1XELA 1J00A 5F98A 2HPHA 1B6SA 1PFGA 5DI3B 1WSDA 4BO4A 1M0EA 2WDPA 3B2EA 4MPDA 1Z4JA 2BEUA 3ANYB 3AR2A 3WICA 2RD2A 4H9GA 1WTCA 2WTUA 4LJRA 3WL8A 1MJNA 1GD1O 2XZOA 1IHDA 5K0LA 2PGAA 3MQFA 2J85A 3OIDA 4TXNA 1SA0A 2ZUUA 4F5ZA 1L5FA 1KVSA 1U94A 5AI5A 5L3QA 3NDRA 3HBLA 1WMDA 2FZ5A 2NU6A 3FDIA 3IULA 1DEAA 1NXVA 1XGKA 2RHOA 3IT0A 3N58A 4IOLA 5EP3A 4DXDA 3HA3A 1OB5A 1N2BA 1EGVB 5B64A 3S5UA 3WBKA 4F9EA 5HJ7A 1D8AA 4D81A 3AEQB 2F43A 4EGCB 2VQEB 1MJ5A 4EYGA 3QXGA 1GJRA 3BF7A 4PG4A 2PQMA 1RRVA 4R8SA 3UIEA 5I9NA 1X13A 3C24A 2KWIA 3ENKA 3CW8X 5KYWA 3AEYA 3BB3A 1KJ8A 4G1MB 2R97A 3HJNA 2B4QA 5EZYB 4MINA 1OJ7A 2FMXA 1LV7A 5AVUA 1LX6A 1LDNA 4LK3A 4MAFA 4NJEB 1F2TB 3N8KA 3PQEA 2W8BA 4JX9A 5SYMA 4OD0A 1A5ZA 3CRQA 3K8QA 1TE2A 3JQDA 3TTXA 1NDQA 2CBGA 5KSOA 4XIIA 5CIQA 5TMEA 1VC2A 4KQWA 3N74A 4MUKA 3N28A 3OEHA 1UBCA 3P32A 4GAEA 4ID3A 5HXAA 3OE7A 2ZRQA 1GEEA 5IX8A 3OJLA 3RC1A 3Q8XB 4CIDA 1BHO1 4M0MA 4EW6A 3C5HA 3G59A 3IAEA 1J0AA 4B2YA 3KAKA 4JWTA 1QKIA 1EJ2A 2ZULA 3H9GA 4EVIA 4AJOA 1LUAA 2JVIA 3JQBA 3LDAA 3N53A 1QE3A 2O52A 3NDJA 4QNRA 4GI2A 1XZMA 1LLUA 2OXIA 2IYYA 1RYMA 2PGLA 3CF0A 3NAQA 3JQ7B 3AUFA 5ESXA 1CHNA 3DE0X 3ULKA 1E9BA 5EKDA 1GITA 1IDOA 3HB0A 4S0ZA 1I32A 1M2EA 1H0RA 1GGJA 4P4GA 4WESA 5E38A 2JEZA 3MB8A 8ABPA 1B2LA 2XV1A 1N57A 2O9JA 2Z8XA 1QJ4A 1ZD3A 3KSAC 1U8XX 1REQB 3KLNA 4PS0A 2G04A 4QUKA 4OFZA 3HKDB 3WNBA 4R71A 3O2JA 5K09A 1Z8FA 3R40A 2O7NA 1K5PA 2P79A 2C1XA 4K7JA 5SZJA 4P22A 2OUKA 2PN1A 1EK5A 2W6ZA 4BFWA 1EUCA 3NOXA 1NN3A 4M0EA 2XB8A 1GPWB 3QA3E 1COWD 4JJGA 5A4AA 4YJGA 1X19A 3KP1A 1QU3A 1JH9A 3LKVA 2PRKA 4EVRA 4L0MA 4JLKA 4NNPA 3TRJA 1U0RA 4LQLA 3JASB 5JXHA 2PQ6A 3OM9A 2JFNA 3MLAA 3HB5X 3DQQA 4LNUB 5BMVA 4JJ6A 1UQTA 2RJOA 5IMBA 4AP9A 4FUTA 4DPLA 3IH5A 1KF0A 3R5JA 3AXTA 2HDNB 3AF1A 4I36A 1NW8A 2VDNB 3DZFA 1TTPB 3RTAA 5BWNA 1F2UB 4E21A 5J58A 3DT6A 5CB6A 4QWMA 3UGQA 1T1EA 1N0VC 1SU8A 4FYVA 5AQEA 2PMDA 3H9BA 3RYCA 1U3WA 5TVKA 4NARA 5ALMA 5AOBA 4IDNA 2KHZA 2E48A 4F5EA 2ZM6B 4BAGA 5JRJA 2H00A 1EESA 3GRRA 5K0FA 1YC2A 2OFPA 4DKXA 5JJLA 3MT7A 2Y3IA 3OHPA 4JIGA 2ZFUA 2P1ZA 4YIKA 1MT3A 1RP7A 1ODCA 2EIXA 1D3AA 2A0XA 3JARB 2CLIB 3M6WA 4RJKA 3RGGA 5BYKA 2BGJA 2Y68A 4F6LA 1V1MB 1YCHA 3U3KA 1RI4A 4IFTA 1CERA 1TM5E 2GLXA 2ZBVA 3JRXA 1UFKA 3N2YA 4LEIA 3ELDA 3ICVA 3W5HA 1NU8A 1CY2A 3GN1A 1VLJA 2NV0A 4W6ZA 3OCCA 3ORFA 4BXOA 3ZVNA 3N39C 3DEIA 1Y5MA 4I7EA 2DLNA 4RVGA 3RJZA 4EHNA 5BSEA 3UYKA 2AYYA 1FQWA 4WGFA 4OLBA 1QZXA 4U0KA 1XZGA 3RBAA 4NQRA 3B78A 3OQBA 4ECEA 3OQMA 1Z2CA 3NHJA 3T5DA 5GONF 5LMZA 4EITA 3F4LA 1FNSA 3WGMA 4BP1A 1ZH4A 3CEAA 1EP2B 1A9PA 3K31A 2GJ9A 2LXNA 2XNDA 3EEBA 4BLRA 1FW6A 1XXHA 1JL3A 2W58A 2LIPA 3C98A 2YJ3A 4DCCA 1T0HB 1XHFA 1Z0ZA 4M38A 2DJ5A 2AXPA 1NVMB 2G8NA 3STXA 2ZBPA 1R4AA 3A9VA 3QJ5A 3T06B 2GN6A 3ADDA 3E22A 4EHJA 3L4BA 2WRZA 5CB8A 1FNBA 1OW3B 5IEJA 3H11A 1SBQA 1UJ4A 1K27A 2BFDA 4ZMRA 5LN1A 1C0PA 5K3FA 1AZLA 2ANBA 3DBIA 2WUWE 2ODBA 1J0EA 4TV8A 1PJQA 2WFMA 4AJJA 3SIRA 1HE8B 1P6QA 4HNQA 4L5BA 5CDTA 3EQ8A 4XJTA 5L51A 5BR8B 3B2QA 1NQ5A 1OGYA 1F2VA 2C8JA 3DEAA 4G8DA 4Q9HA 4Z4QA 1BE1A 1JR3A 3WIOA 1RQXA 1RTTA 1Q0HA 2C8VA 2Q4DA 3BFVA 3EW7A 2QK4A 3UNXA 5ITZA 3JAMA 4RZIA 1T26A 3K9BA 3F3KA 5CU7A 4OY3A 2OCDA 4C0QC 2XGMA 1EVEA 4RZXA 2B82A 4AY3A 3F2IA 2PXAA 2WHRA 3TLYA 1NSYA 1D7OA 6AT1A 2J3LA 3D0KA 4GXQA 2N46A 4ME6A 1TC1A 3BXFA 3B38A 2B8TA 4IOKA 4PPNA 5E2IA 2WKQA 5ICMA 4Y9TA 1PT9A 3FI9A 4K3UA 1INLA 1B14A 3JWJA 4ZARA 3VJLA 4E12A 3F47A 3T7DA 2RC6A 4DIBA 1UMBB 3AKZA 4IIJA 2QN7A 2UVPB 4MVYA 1AZTA 1XZLA 2FW8A 2TRSB 1HEUA 3MGCA 5CA0A 4E08A 2NUPB 1LB1B 4AIRA 3R5TA 2H59A 3DL4A 4BC1A 3FPHA 4E4RA 1IJKA 1ZJ4A 1AZWA 3DA8A 4AKIA 1ZK2A 2A84A 4WD3A 5DYWA 1D8TA 1HNWB 4RF4A 2J3JA 2XUAA 5FB3A 1OQAA 2H9YA 3GH1A 1ZBQA 3ZX4A 1SEPA 4XRGA 2RHHA 1NXWA 1GPJA 2AQIA 2QE6A 2XECA 4B4WA 3NBYC 2GCOA 4JP5A 1TADA 1T13A 3MVEA 4BDTA 3BCSA 2CVOA 2IC5A 1OV6A 1OBCA 1NWHA 4D45A 4RHUA 1HUQA 2CNLA 5K0GA 4PIMA 4PZDA 5IM4F 1L5LA 2ZUSA 4B8WA 1DBSA 1MBZA 5AK3A 3PGA1 3C97A 3ZKWB 1RXVA 2FP3A 1E2FA 2H2GA 3PC6A 3JR7A 1TPZA 5E7IA 3H1AA 1EQAA 3GPCA 3OECA 3P9XA 3A9WA 2I2XB 3R09A 4M8SA 3L46A 5DCUA 2I9KA 4RAQA 1BCSA 3L4JA 3AEXA 2XDQB 3F4KA 3SC3A 4WMLA 4GMGA 4EY3A 2E4ZA 1GADO 3HDTA 4YCDA 4U2KA 5KS2A 4H7HA 4ISBA 2ERCA 4HAVA 5COQA 1EUYA 1R37A 1UPAA 3RVNA 5TF4A 2VS1A 3WBFA 2RH8A 4D02A 3PD0A 1PNTA 4YDHB 4RTRA 2HFJA 4FCCA 2CJWA 3H1BA 3Q7PA 1QF9A 3IQDB 3DE6X 3QXJA 3W7BA 3KK0A 1ORIA 2GYWA 4UDNA 3IVXA 1VB5A 4PR3A 4DBLC 5AVZA 3W1VA 1B00A 4MS1A 4BKQA 3KV1A 1PYGA 3CINA 3EUAA 2IW1A 4KQJA 5EXTA 3UBMA 2AZXA 4U9HS 2AWOA 2IYAA 4CLHA 3LVBA 4MYSA 2PMBA 1XVAA 5DBHX 4CLRA 1ZCFA 1EUZA 3GJ7A 4IEIA 3B7GA 1QS0A 1U7UA 2BFEB 1JSLA 3SBOA 4EEXA 5BW8A 3FPGA 1HNXB 1WZIA 1Z63A 1EFRD 2YDXA 3KZCA 4YBRA 2VAXA 5CB4B 4HGPA 2J6HA 1P5JA 2BSXA 3E3MA 1IMOA 2HRZA 1X80A 2II6A 3E84A 1WUYA 2ONZA 3I1IA 3NVAA 4MCHA 4YIHA 4TL9A 4ZT4A 4BPBA 4KQFA 1OH6A 3IUJA 1QK5A 3FHCB 1QE5A 4EA6A 3AR9A 3FR7A 3JVEA 4GDFA 4ZVKA 3BWBA 4QYWA 3TEMA 3EY4A 3DFZA 4M53A 5E1DA 5JCOC 2DGDA 1BMDA 1KHTA 1T8YA 2B4TO 3PFKA 5HKBA 1H2RS 2QBYA 1VSBA 2IVFA 3G68A 2GARA 4J3JA 3ZHVA 2GETA 2JB9A 1ULTA 1DQRA 1QVWA 4Q4AA 1YDGA 3PBKA 4Z2AA 2PS9A 3CR3C 3N5KA 3E03A 4DQXA 1SUSA 4J2HA 5ALOA 1EEHA 1KYVA 2YJ4A 3QPVA 1LPSA 3FBGA 4LDZA 1NONA 2FPGB 3VMFA 1QP7A 1ZVJA 1LBEA 1QRTA 5KNCA 3O2QB 1TEXA 3OPQA 4I9NA 3BPSA 2NZUG 1GQOA 3NT5A 4QLBA 4DDUA 3TDMA 4DDWA 3FZNA 3RSGA 5K6RA 5IZ4A 3DUWA 1RPJA 3X2EA 1N4AA 1RMYA 5TNXA 4K88A 2XXAB 3TOXA 3HCBA 1VIAA 1EJ6A 4ZGWA 3ZHYA 3FMFA 4UE2A 4PICA 1EJ0A 1YL7A 3NEPX 1LBHA 1PG2A 3CQ9A 4GR5A 4JC4A 3UJHA 4A16A 1Z8NA 5K45A 4M37A 3HV0A 5HM8A 1DNPA 4I0WB 3CPEA 3TTWA 5K0CA 1B0PA 1WRBA 5FUWA 2JC3A 3EC1A 3WRYC 5IJ9B 3JYPA 4XDHA 1CDEA 5LZ2A 2W43A 3K9CA 4QYMA 2IA5A 3MJRA 2YINC 4RDHA 1AKWA 2GM4A 2HLHA 4IBOA 4X90A 3B1ZA 1QAMA 2W42A 1P31A 4YCCA 2EWWA 1SCJA 2WINI 4DQKA 2BZ0A 4K86A 3GUHA 5EFZA 5A1TA 1FVFA 3ZXYA 2H4HA 5IT0A 4YAIA 3I01A 4LRSB 4UD6A 4X20A 4Y9SA 5EQFA 5KC9A 1F1JA 1G9XA 1MU0A 1PJTA 1YKGA 3B5EA 2WQ6A 2C2XA 2FKNA 1YK1A 3A2MA 4I5DA 4JGBA 2N0SA 1XL0A 2Y27A 1FRQA 4FKBA 4JLMA 4B9EA 1BMFD 3DJFA 2Z2ZA 4IGEA 2CNKA 5K9ZA 2HD4A 5JOQA 1OXSC 1HM5A 4ZU1X 3WIDA 1P2BA 3THWB 1TXGA 1EIZA 3N2ZB 2WWRA 1DIGA 3M33A 1D2GA 3BRQA 4XSHA 3DVAA 4HPXB 3THRA 4AX4A 4QZVA 2J09A 3F5FA 3BB1A 1UPBA 1XKTA 2AX3A 3KB6A 5AW6A 4UVDA 1YQWA 3BYZA 2RBKA 3PT5A 2XTZA 1HT3A 3MTJA 4GZ6A 4R6XA 1MC8A 6Q21A 3NAMA 2V03A 4B76A 1R6TA 1M2KA 4N39A 3ZG6A 5KQMA 2BFBB 5HQ3A 3OU6A 1XA0A 2WD9A 2ZB8A 4J16C 2V65A 4WZBA 5D85A 2PX3A 4KDRA 1GAWA 4HC4A 1SUWA 1QMPA 2A9FA 2ZSKA 3Q9NA 3PD7A 1VBFA 4MRPA 4PCVA 1SIUA 4ZQHA 5G3YA 5AXCA 3WB2A 3BBLA 1V0JA 1ZFNA 1WX1A 4YJ3A 1VG1A 3WAJA 2FQYA 2SKDA 2RJ3A 3MGBA 4NJMA 1JPNA 3SBDA 2WUDA 4R1OA 1XKQA 3NHBA 3KU4A 1U9ZA 4OB7A 2I2CA 4GYWA 2QPAA 4QQRA 3NEJA 3E05A 4UEOA 3V3TA 1EX9A 1K0FA 2GRAA 3L1IA 2C4TA 1SOVA 1OWLA 2AI3A 2AOTA 1FQKA 2JHGA 4GL4A 4HAUA 4K9QA 4UM5A 4BVFA 1QOZA 4HFNA 5F7JA 4C6HA 2GDJA 2OZVA 3MCAA 3SC6A 3PEEA 2CXQA 3LFHA 4HDCA 2W2TA 1ZK3A 1DJQA 4DUYB 4QQNA 2X8JB 3SFZA 2BOVA 1NI3A 3QF4B 1B93A 2RK3A 5ALSA 1QHSA 1CZRA 1NUAA 2VT3A 2ZIFA 3K1AA 5CBKA 1OLXA 5ECGC 4OHXA 1G6HA 3DNFA 3UGKA 2DTDA 3LYHA 2C3PA 4OF4A 3IHTA 4IH4A 1OUMA 1H3EA 3NH9A 3VDXA 3QUAA 2OCAA 4M1SA 4PPQA 4O4HF 4QOIA 1QHHA 4TMYA 1M5RA 4P84A 1JMYA 2C9BA 3HSKA 1NMXA 3CUUA 5LOVB 2OZLA 1BEEA 1K8RA 2QD1A 5B58T 4ER7A 4FQ8A 4B83A 2X4IA 3K0FA 2OV1A 3I2FA 3DWEX 4R69A 1KEEA 3U44B 4NE7A 4B4VA 1A7AA 4KN9S 1J24A 2B92A 1UP4A 2B34A 4GXNA 1XRRA 4H1WA 2PGOA 3MQ4A 3M82A 1DAGA 4GEKA 2PLWA 3JRWA 3OCZA 4KYUA 4NFHA 4PYKA 4PRLA 4QNNA 3WADA 5KMGA 5FFFA 2ADFA 2WKWA 4FD3A 1J97A 1AKUA 4ZT3A 4RPJA 3U4QB 2EX4A 2XAUA 3E3AA 2O8NA 4GVLA 4IXDA 3JVVA 1XMIA 2QQ5A 5DW0A 4P3PA 2AK2A 3SS9X 3ZIAD 1ZK0A 2QENA 3URMA 4CI9A 1S2NA 1C3XA 2X0RA 1DTWB 1Z5VA 3STUA 5EERA 1NXOA 2PWYA 1RWKA 2R3SA 5IAJA 5DNUA 3CKLA 2C2HA 3ZU2A 2QX6A 2MINB 1TAQA 2YOGA 4HYQA 1TVKB 1J1IA 1IAVA 5KHOC 1QLWA 4DGQA 3K70C 4ZEXA 1T9GR 4FNAA 2EQ5A 3CUEF 2AMLA 3IJ5A 4DY4A 4MR7B 5AM1A 4YREA 4CKXA 5A4JA 4S12A 4D92A 4M76B 2BP7A 3MIZA 3MC1A 4OP1A 2RHBA 2XA1A 1HKHA 1R4ZA 3ZW9A 4DS3A 2AN4A 1O6ZA 4LHYA 5GVRA 2G4VA 4J7CA 1RBMA 1XRMA 1W88B 3G8AA 2G40A 2IPMA 2AE1A 4N9WA 3V6MA 4NONA 2VF2A 2RIRA 1OZGA 3RU9A 2XWPA 1YDFA 4FYHA 3E81A 1XT6A 4NS1A 3WYAA 4JBHA 3QYJA 5BVGA 3UBTA 1HORA 3T6KA 1QQBA 1M1UA 3MJDA 2F1JA 3EXHB 1QYWA 2JIZD 3EZ7A 1ESDA 1I3KA 3LWDA 1Q0SA 2Z5LA 3RRZA 3JWHA 2WV9A 1PJZA 1V11B 2FETA 2GBGA 1XRNA 3LX6A 3N6XA 3CLSC 1PJSA 2Q3CA 2W6JD 4LXTA 4F4UA 4CYMA 5CCXA 2WAXA 5AOAA 3M34A 3CRVA 3QWHA 4AG5A 5KPDA 1C14A 3D2CA 3MGGA 4MI6A 3S8YA 3DHNA 1QHYA 3DMGA 2VRCD 1SUPA 2UUOA 5KUTA 3IAS1 2FSVA 1H6DA 4ZTBA 4DQ0A 1DMRA 3JALB 2PWAA 1K06A 1YDHA 4X93A 4UXHA 3I34X 3C4VA 4I81A 4KPUA 4JYCA 2J4DA 1DDOA 2PZKA 5EQTA 2IZ6A 3NBZC 4XFJA 3DFIA 5C5CA 6REQB 3G2JA 4ZT7A 1YBFA 4FINA 2ZBFA 4KDEA 1QB8A 3AB3A 4MGIR 4X1IA 3SQXA 3D81A 4CEJA 1QIIA 5F4ZA 2I6FA 3D1JA 4ND1A 2JJQA 4E2FA 4XEUA 3PC4A 2PBRA 1PNRA 4IDHA 3B1VA 1U28C 2JEOA 4S3MA 4OQLA 1E1KA 2B20A 2QAGB 2Q5OA 1Q7CA 2Z4SA 1P45A 4I4LA 3KDPA 4O6VA 4P7JA 3WX0A 1I4WA 2Q5LA 1Q7TA 1RKBA 2I3ZA 4O4JF 4FMDB 1GNRA 3B1WA 5BSRA 5BT8A 3VBEA 1YFJA 3H75A 2MR6A 4B4OA 4F4IA 4Q9JA 2VEOA 3W8NA 1QRDA 4BMSA 1SCQA 1H6CA 2GWRA 2OY0A 5EY5B 5A4FS 4EARA 5FL3A 1GZUA 4KQ2A 4ACAA 1N9GB 1XZHA 2EW1A 4TGLA 2YYYA 2CWDA 5D1NA 3RV3A 2ZM5A 1LNZA 4QGAA 5LA6B 1YS7A 4ARSA 1Y6GA 1QV9A 4RSMA 4A73A 2GF2A 1WU7A 3CJQA 4OSPA 1CY8A 4EKIA 5DW3A 1W94A 1A72A 8LDHA 3B3AA 4HTFA 1MAUA 3KR0A 1Q14A 2FPMA 3CT6A 3P27A 4TKLA 5HX7A 5EGNA 2J3EA 4B6PA 4KMMA 2ZI4A 3M5WA 5CB4F 1RZVA 4JS0A 4OXNA 3JD1A 2DKFA 2W0MA 5BR1A 3IMKA 3FLEA 1ISJA 1CRWG 1PNVA 1L7AA 4PTYA 3SMVA 2PZMA 3KSDO 3T4PA 5LJLA 1KARA 1TX4B 2BT4A 4TQGA 3V42A 3N2EA 4R68A 1YL6A 5HCNA 2EERA 4UD2A 5IT5A 2XQIA 2R2AA 3GP3A 4EF6A 3KOMA 1MB9A 3RK4A 1TYCA 4NK4A 4P5DA 1D04A 4C20A 5F64A 4WOJA 4GF5A 5EWJA 1KJWA 2DFKB 2PUTA 3QSGA 2QTWB 4KX5A 4KSBA 4EB8A 4K2HA 1U7PA 3RAJA 1N5LA 1PWZA 3QELB 2X76A 1R0RE 2VT6A 1ORDA 4OGKA 4HNRA 1BIFA 4FIDA 4HUJA 5DH9A 5JWOA 7REQB 2PBZA 5KNBD 4EG1A 1YFLA 2QX4A 2P1RA 2XVMA 4FYMA 3QFHA 3AFHA 2DH6A 3S2EA 4WH0A 1A69A 3BJMA 3LBYA 1A4UA 3QKSA 4ZXFA 2WU4A 4F8YA 1BHQ1 1Y7IA 1ZZEA 1P2UA 2RGUA 2EP5A 2O2CA 2VJLA 4QPPA 2O2HA 4B84A 4W63A 3VX3A 4L4ZA 4RY2A 1I4TD 2D54A 4FCWA 3QLTA 2Q0SA 3L3BA 4DM4A 4HAWA 3TUIC 1JIIA 1L5ZA 1L6IA 1S3IA 2WE7A 2OGZA 1NY6A 1JHMA 3ME5A 1Z18A 4FBGA 4FNOA 4G6ZA 4MVJP 5JZ9A 1YOVB 2XPCA 1V8DA 3F49S 5F7ZA 2HXSA 3KWJA 3UJAA 4GPAA 1H66A 4PYLA 1BU8A 1PSWA 1AD2A 3LL4A 4NBTA 1JEOA 5F73A 3RU2A 3VPBA 3KD2A 1WQ1R 2GXUA 4PLCA 5EWMB 1QHGA 1V43A 4Y18A 3PEFA 3NWJA 3GYBA 1GPH1 3CVJA 4I9FA 2C9DA 4NCXA 2K2QB 1N3IA 3UCXA 1QPGA 4G0QA 1H4TA 1AKVA 1J22A 2BKUA 1TPYA 2GBCA 2OMKA 3SZGA 2QOEA 1XZAA 1R12A 2HWKA 1OTXA 3EVBA 4PWZA 5ALTA 5EMHA 3UMYA 4X6LA 1PEAA 1N0IA 3NHKA 1WXEA 2HQRA 1RLOA 3LPLA 1N8SA 1FS4A 3BVPA 2MU1A 1C8KA 2C99A 2QPLA 4BE4A 1EFVA 3QKUA 4V0SA 5LXTB 1L5WA 1Z5OA 1JQJC 3OFKA 3LS2A 1ENZA 2NUBA 3I92A 3RRBA 2ZIAA 3G2HA 1ORHA 5HIKA 3IAFA 3IP6A 4DMRA 4C5BA 4NDZA 4DA9A 5CVUA 3ETHA 2O06A 2ARKA 1UBEA 3EXAA 1F3OA 3ANXA 2PGXA 2C2GA 1LLCA 2ZB4A 4KLZA 4ZRNA 1HETA 3DBLA 1QUEA 2XE6A 1JHDA 1R4NA 2ZWAA 2NVUA 5KYTA 5HE8A 4JT9A 3SOZA 2NAPA 3HA2A 1HYGA 4RKWA 1A2OA 3MT8A 821PA 1HDEA 2IZ5A 4JNCA 3T7TA 2NZYA 3JD4A 4E07A 1RAIA 4HDNA 3VVMA 3FIUA 3HMQA 1HV8A 5K20A 2O8FA 1C7QA 1H23A 3PWKA 4TQUS 4LWOA 4WA8A 5ALEA 3WQQA 2H2HA 5DHRA 1EFPB 1F51E 2WF5A 4BFSA 4GR4A 3FOBA 4PO9A 1DV1A 2NWQA 5AJYA 5BOSB 3VKFA 3GCWA 5JDIC 1PYOA 5CCBA 1N6LA 3Q41A 5LQUA 3O4RA 3K0HA 1BTOA 2HIGA 4JQSA 2FAXA 2W5UA 4HDMA 3QY9A 1JBQA 1YIAA 4OQNA 3FBTA 4AU1A 4JYZA 1JFLA 2BEVA 2I54A 3OFSA 4FR5A 4LZPA 4ZI2A 3EN0A 4WN9B 3CX8A 2IYRA 2VHXA 3GJYA 4MIEA 4B81A 4CM4A 1K4KA 2X0NA 3RRYA 4BQFA 4RLSA 4MWGA 4MV4A 5CGZA 5AI6A 2AF3C 4IUCS 4EDHA 3SZLA 1JQDA 1KAHA 3FY4A 5F5LA 1U1FA 1LNSA 1C7JA 4DXAA 4L3OA 5BY2A 4PX5A 1PN3A 3W6ZA 5KTKA 4RMJA 3ZCUA 4W5OA 3CH6A 1CY0A 3KKZA 3DEKA 2RCYA 2VHQA 3GELA 2V7QD 2BHNA 2D3WA 1NI4A 3KEOA 3MINA 2OD7A 2GN9A 4OUDB 1XKXA 3CV3A 1P7WA 2YOFA 2OR3A 4JY7A 3AONB 2Q1UA 5EJ4A 2IEIA 1I3MA 1EA5A 1UBUS 1HMPA 2XIQA 1BZYA 1H2HA 2V0NA 3OESA 4GM4A 3E58A 4LOIA 4Y2GA 4XI9A 4PC6A 3ROGA 1ZVVA 3NTLA 5HRCA 2OO5C 2X2FA 3LF1A 4MDYA 2O3RA 2RHGB 1UM9B 4UJ5A 5JECA 4RTKA 4DIUA 2GJ4A 3ELYA 1RWQA 2X2EA 3OQ1A 2Q6KA 3DTTA 3B1JA 3HA5A 4LBZA 1Z7WA 1VPLA 2H16A 3MWEA 3NALA 4IMPA 4JL5A 1L7RA 3BJEA 5M5BA 2DFVA 3A31A 2F6RA 1JR6A 3FMPB 1YACA 1U2DC 4FSHA 4I1VA 3SJZA 1JEDA 2Y8EA 3OY2A 4EUEA 5ARBA 4YCLA 2C95A 3PX3A 3WNQA 4XWGA 1IPEA 3HUEA 3RDPA 1JILA 1SXHA 4GI5A 4IGKA 3VI4B 4HSGA 5DLEA 1UXIA 3S0JA 1DWOA 4YFVA 3T3MB 4OFBA 3DDZX 2CWWA 3SM9A 3AETA 3IIKA 3N59A 1ZQ9A 2WAOA 4FX5A 4I1OA 3KLPX 3FFAA 3VO8A 2DCUA 3HWRA 5KYYB 1COZA 4TRJA 1KQNA 1I9CA 2NUTA 4EZBA 1PL7A 2IVZA 3LAWA 2D0PB 3ECAA 2W7TA 4LHXA 2IK8A 3B3GA 1QGZA 1OX4B 3H84A 3DPSA 4J4BA 1P77A 3R9XB 1DQSA 1ESEA 4HDQB 4A7PA 1WB6A 3CONA 4EGSA 5CDFE 5M2QA 1SVWA 2ORIA 3FFTA 4U3JA 2BKAA 5JBIA 5GINE 1FP7A 1XJWA 2A5GA 4G1VA 4HLQB 4OHCA 2BFOA 4XSVA 4YDRA 1N34B 2G82A 2ZUVA 2AMJA 2IHZA 4IW3B 4M88A 1UFQA 1Z88A 4Z6KA 1Y6FA 1GL6A 5EJEA 4RV4A 1SVLA 1H4SA 1HA3A 2EFJA 4HWRA 5DLPA 4EJFA 3E5NA 1RD4A 4KWCA 3A0RB 4DLUA 4JLJA 5EXSA 1VP3A 2HCRA 3W6PA 4EA9A 4CKZA 1N2ZA 2UU9B 4N76A 1Z62A 4D5GA 2OLEA 2VNAA 2JGRA 1N2OA 1UBSB 3NYWA 1VL8A 1HQYE 2BM9A 1NQVA 4B3XA 4EYKA 4F92B 1VOTA 2H1SA 3D3NA 1W29A 1BG6A 3EJWA 2C5LA 4LSWA 3ROXA 5JW6A 2Q5QA 4GZ5A 4N7JA 1ILEA 4BNVA 2O8BB 1E1DA 1L8LA 3ACCA 3WRYA 1GGHA 2YBDA 1P3JA 3PA8A 3L0BA 4NY1A 4L3WA 2H9AA 4HATA 4V2UA 5G40A 4DBZA 3CSUA 1MORA 1Y5RA 2ZIEA 4DBVO 5FH9A 4YUAA 3VR5D 1U0GA 4A9AA 4ZMSA 2BGUA 1JALA 1P2GA 5CT6A 5K7SA 3BIOA 2B37A 5FV7A 1U9IA 2R4QA 2CLSA 1AX9A 2JLCA 4MA4A 3I83A 3DOUA 4TTIA 2CHFA 3UJNA 4OJNA 4Y2XA 1DBRA 1HDRA 2IYXA 1RJWA 1OFHA 3IE2A 1A8SA 3MAJA 4TVSA 3C1UA 5JNUA 1NVFA 4JLOA 1Q20A 2CZQA 3V7UA 4CLEA 1EDOA 1Y6QA 4AZ3A 1JR3D 4V0ME 5A3VA 2WYOA 5AHRA 2D5IA 3O38A 3BS4A 2ZE6A 3DE4X 3FKSA 2GKSA 4M0PA 2YY6A 4ECAA 4B3TB 4ZD6A 3OJOA 4TTPA 3L8YA 1SEVA 3EAGA 1XTBA 4ZVPA 4BFCA 5FTLA 3IE1A 1AH2A 1ZISA 4COKA 1UKAA 1ZM2A 3VNSA 2JGKA 3ZUGA 3UMGA 4A2QA 1OU4A 1OXXK 4WBNB 3C4QA 3LPNA 3S1SA 4J16A 2HXGA 2WZBA 5FWYA 2HMVA 2OFWA 4C4SA 2BN4A 3QX8A 3TIXB 2UZAA 3ET4A 3V1LA 4XVQA 3SSMA 3PKJA 1NPDA 1Z12A 1KZHA 4MRAA 1ZNQO 3VV3A 3STYA 2OSVA 3CEMA 4G5OA 2INGX 2O8DA 4BB6A 1N5JA 1BXGA 2MSCB 1VSTA 3M5DA 3HNPA 1YCDA 1TQ4A 3DAHA 2N75A 4JZYA 1FDIA 3AB7A 3C3XA 4HLNA 1O6CA 4OH7A 4IV8A 3S44A 3IQGX 2HBRA 5FLKA 1GR1A 3ZLVA 3IBSA 1CNMA 1H69A 4DSOA 4GKAA 4EVSA 2X9LA 1VCMA 1JZSA 4OHOA 2FCRA 3V2UA 4ITUA 3CZQA 5K03A 2DM6A 1RJDA 4TTQA 2ZRHA 4C01A 1KEUA 3E3NA 2YMPA 2WK1A 3VNRA 3L77A 3PE3A 1MAWA 1Y5IA 1D2NA 5DJ5A 5FO1A 1Y3BE 4JI5B 4CDRA 3UPTA 1CZHA 1PE0A 1R9GA 3A1CA 3H9QA 3LCUA 3LF2A 4LNHA 5K6AA 2VAVA 2HRBA 4XFKA 3PHIA 4UHEA 3UN1A 2FEKA 3ESRA 2C07A 3F3MA 3GT0A 3K0CA 1X7XB 4RLQA 1JHOA 2VUIB 3IIMA 4WVFA 2AOXA 2ZBDA 1DKLA 1H2ZA 4QQ8A 1EZ4A 2JAWA 2Z6VA 3N2NA 2ZB2A 2WNHA 1NXPA 1NF9A 3E18A 3Q85A 1EUQA 4GMDA 4BX8A 1HPLA 1NX6A 1C0IA 1YK0A 3OG9A 3V33A 4OQQA 3WBBA 2HSGA 4WXMA 1P62B 3UJDA 1V95A 2FOXA 4FJ0A 1M6EX 1T0UA 1QIJA 2H63A 3CGWA 3QEMA 4C9BA 4GKJB 4RH0A 3R3UA 4XQ0A 5EIEA 2JH3A 4AECA 2KPOA 1MO6A 2GO1A 5DYIA 4DEYA 2ISCA 3AF4A 5EP1A 3LBFA 1HDYA 5EYPB 1VMDA 4EGJA 4JEMA 4FM9A 1JMVA 1O0CA 4UQLA 4BKUA 1FUKA 3EXFB 1L7BA 4BQSA 3OVMA 2EFEB 3AHHA 2YXNA 5JY1A 5IF9A 4IICA 4HB4A 3ZDDA 3HHEA 3KL4A 2CVQA 1VP9A 3SBEA 2H0RA 2H1HA 1ZUNB 3WAGA 1LRKA 4MVJD 3E3LA 3H9UA 2D1TA 5LOVF 2PUBA 3HWSA 1LGYA 2K87A 1ZGHA 3WIUA 1Q0QA 2I1VB 1WAMA 1USWA 2BZGA 5HF8A 2BYTA 5JNWA 1NW6A 4GSKA 2DPGA 4DLZA 2JGFA 1GZ5A 1KI6B 2X3UA 1YR6A 2LCIA 3E8MA 3QFCA 1IB0A 2P2NA 4GLBA 2XYVA 4JMPA 4GWLA 3WWPA 3TLCA 4QNMA 5DGXA 3UMCA 3WGQA 3H42B 3COZA 3KL2A 1YHZA 4QFMA 4YGXB 1E2HA 5CFRA 2NU8B 3ZHXA 2R87A 3GZ4A 3SLRA 2XD9A 3HGQA 5AXAA 2AZTA 3ETCA 2PL9A 1HMYA 1NL3A 3OSZA 2PH1A 2GH1A 2Z2KA 2NO9A 1XCOA 4RA6B 4BRZA 4NFYA 4D4GA 4ZICA 4BGDA 5LDGA 1W4CA 1VCHA 1NSFA 1UPTA 2BGNA 1YWGO 5BWBA 1H8HA 5DOZA 5A9TA 1F7UA 1XI2A 3L7LA 3NWBA 1FTYA 4M1QA 2Y0BA 3IQZA 3EEFA 2R6CA 3T3NA 2O54A 4KR2A 4LF6B 1E9SA 1EWTA 2CNDA 3I01M 3FUXA 3MMSA 5D86A 3FCXA 3TM5A 2Z08A 3HB7A 4G01B 2XT0A 3VR4A 1LPMA 1J1ZA 1EUDA 2HUNA 4RUKA 1XK6A 1T0IA 3WLFA 4EO9A 4F1JA 1TO2E 2G17A 4IQ8A 3T94A 4OX9B 1DARA 2PIDA 2PVCA 3INRA 3OBIA 3DL2A 3PX2A 1W5FA 4I3GA 2GAOA 2R6AA 4JGIA 4X54A 4B4UA 1U8AA 3A8TA 3JYHA 5K5EA 2HSWA 2O2EA 4OVKA 5FJIA 3IKTA 4AY6A 3KALA 3V8BA 3PEWA 3BHJA 3P9YA 1KY4A 4AO6A 1U28A 3H2HA 1Y48E 2FVYA 5KCZA 2FZGA 4BDSA 2J6CA 5IVHA 1RWWA 3FUCA 3KRTA 3ISJA 3UZUA 2YNMA 5JLAA 1J8YF 4B7UA 5DPMA 2AJ8A 1JE0A 4EPRA 5ITVA 4ZDIA 3MXTA 1LPNA 1FC0A 2E82A 1Q0TA 4FKZA 3VDRA 1GZ4A 5AI9A 1Q91A 1SC3A 4DLYA 4PM4A 3U09A 3EGEA 3PTZA 3PRJA 4Q9DA 2HU5A 2FEXA 1YR2A 2HO5A 1FP4A 3L6CA 3GLHE 1QRRA 1UFOA 1V47A 4PXAA 4P81A 2G1KA 4BKOA 3ROTA 1VE5A 4RENA 5MFZA 2G67A 5AUQA 4O1IA 3DMDA 2YUIA 1OT5A 3Q0TA 3TINA 1IBSA 2W2LD 3GJ5A 3H17A 4P38A 4QBGB 3UFXA 1R0WA 2HRQA 4C4XA 3UENA 1D1QA 5E1BA 4CKCB 3UTCA 4UAGA 2YV5A 1KORA 1N8NA 3V7WA 1N7IA 4C4PA 5BRNA 4MRMB 4TWZA 2QJRA 3KT0A 1VXOA 2FY8A 4MQ5A 5IG2A 3T3EA 3HN6A 3IERA 2V1UA 1YBAA 1KBZA 5KDLA 4NABA 2CLHB 1LPAB 1JT2A 1QKJA 2PH7A 2X14A 2D0DA 2D7CA 3K72B 4I1UA 4Q1FA 1S1CA 1QAQA 1PJAA 3ZBTA 4RWZA 5JEEA 5I3CA 4IV0A 4FR0A 1QH0A 5EOVA 5GV7A 3ZNQA 1C4WA 2AT1A 4FMDF 5AHKA 4MWBA 2ANCA 2VYVD 2Q3JA 3QOXA 4K1LA 3N0TA 3TJRA 4ZGGA 1D4ZA 2GZ1A 1CY6A 1TD1A 2OG2A 2VH5R 2FN3A 4J29A 3UOWA 1R6BX 4QEKA 1R5NA 1FTGA 2Q07A 1JB9A 1TO1E 2O2GA 1CG6A 1RJGA 2YWCA 4HZIA 4ZEVA 3KEQA 3FNRA 1ZR2A 3VJKA 3TXAA 5LA6F 3U37A 2PZ8A 5LLTA 4LBVA 5GJVC 2OORC 4KH0A 1GNPA 1KQFA 4HLDA 4R2IA 1UIRA 1WB9A 4C21A 3DCIA 3HDHA 3K92A 3TI7A 2EKLA 5INTA 1A9OA 3BL8A 5FPPA 4LVNA 4B75A 1LS6A 5MHTA 2AHOA 4Q21A 2BHRA 3A1TA 1FTWA 1PKEA 3GF4A 3MBOA 4OHFA 4RPLA 1TM2A 1IBLB 3W8EA 3H3JA 1A4XA 1CJMA 1XZEA 1L4LA 3H05A 2O3TA 2ZYHA 1YHNA 1U7OA 1XVVA 3NBKA 3SHQA 3KKPA 1DFIA 2EF0A 1RAFA 2OVBA 2HTEA 3B5IA 4U9UA 3RSFA 4CF4A 2D06A 4G0ZA 4Q24A 3HFGA 4MV0A 3VR5H 1XYVA 2VRNA 3GDHA 4G26A 4RTOA 1DHRA 3OICA 10MHA 2OCPA 1EX7A 5CVEA 3AKYA 5A5FA 1ZSYA 4QTUB 2UUCB 2I7TA 2PMFA 3CVYA 1AHNA 1T35A 1QGAA 1XZNA 1I1QB 3L40A 4URUR 2I1LA 5ER9A 1K1EA 2QJWA 4TMZA 5JZVA 3W04A 1YRLA 2FMFA 1NPYA 2GCNA 1Y8RB 4MB2A 1QX3A 3Q5DA 2W2MA 2O19A 1I6KA 1FYEA 2G83A 4KGZA 2FPWA 2PUVA 4PZ9A 4B4KA 1XN1A 4BEBA 4NZOA 1EVZA 4KXVA 2WPDD 4YRCA 1SHJA 1YFKA 1YAHA 1Y7TA 2IZ7A 3LX5A 4B31A 1YQEA 3B48A 4H27A 2WVHA 4XIFA 3O82A 3TXXA 3Q40A 1GPUA 1PJ2A 3KHUA 4RGYA 2FMIA 1XD9A 1Q15A 5A3RA 2XODA 2YFYA 1G8MA 4KTTE 5K0NA 3AOGA 3VOBA 4DR6B 4BUZA 4BKMA 3AVXA 1BKSB 4FFBA 3K9WA 2DY0A 4M4SA 3SE0A 1ISHA 1NWCA 1OI7A 5LZ9A 3IHKA 3LMKA 1DAHA 2WHPA 4IDPA 1YF3A 4G56A 1GT6A 1K8QA 1XNGA 3GFTA 4RYDA 2VTVA 2QRVA 4E94A 3HCWA 4F9TA 1J2TA 5AK4A 3A6FA 1FFYA 2ZIZA 1DBVO 2QTFA 4OB8A 1XMJA 4IILA 2X15A 2OO7A 2GA8A 3A6HA 1KI3A 3BIXA 1D6JA 3K6KA 4FBLA 3VNBA 2GBPA 3WDMA 3EF3A 5F9HA 4K26A 3I5YA 4I4TB 3IR7A 3REQA 5NLLA 1PNQA 2M2IA 2RHLA 4KU4A 2A1TS 2FW9A 3Q8WA 4FQ7A 3LHKA 4CKEB 2WIJA 3DOOA 4IIFA 3REOA 3Q9LA 2GPNA 1MDBA 2BFFB 1UT8A 3TX2A 3NG1A 4JMLA 1L5RA 4R8KA 1ORRA 5FULA 5JDIA 1WPQA 4MYCA 1NVWQ 1E94E 2O1SA 4PYMA 4NBUA 3WMRA 1T0JB 3S1LA 5LXTF 4CV0A 3GLFB 3IDAA 1VXRA 1C4KA 2ZRCA 4YUWA 3O21A 1PVDA 2HWWA 3KT6A 3D7SA 4U02A 5AHOA 5IW8A 3D0RA 4BZPA 1SUEA 1XKLA 2KM1A 3EA0A 4LW8A 1M83A 1AO3A 3UJBA 3F6YA 2H29A 4QD3A 1AKRA 2NNLD 1GTZA 1QO7A 3SC2B 3AU8A 5KYXA 4M55A 4ER5A 5JANA 3BGSA 1Z6QA 3E61A 4LY9A 4RJ2A 4U6QA 2OV4A 4FFOA 4GLOA 3UB4A 4DM7A 2QZ9A 3AJ8A 3AWIA 3O92A 4UM9D 2FN8A 5EEGA 1EXWA 4PZLA 1H1TA 4JBNA 1TT5B 3UK0A 2GZHA 4DHWA 2FPSA 3EXIB 4B5LA 3WNZA 3FROA 1AB5A 1SH7A 4GGPA 2XI4A 5K4HA 1CIJA 1CUIA 3GPDG 4FN4A 4LHZA 2XE4A 4NEGA 5IUNC 5K8CA 4WCVA 1JMKC 2ZIUB 4PZ0A 1KEKA 3IJPA 1H94A 1W4AA 4LZZA 1EKXA 1IRIA 1PGQA 1HE2A 4N9QA 5HUQA 3G13A 2AFHE 1J0BA 1Z74A 4DDTA 1Q77A 1O77A 1O5TA 3PZBA 4JYPA 1YZTA 5D3QA 5KNDA 1DWUA 5DX1A 3W5UA 2DG2A 4MYTA 4QPNA 5G3ZA 4EYOA 3OPYI 1JPVA 4HOYA 1FMTA 1U2DA 1YE5A 3TK1A 3WK9A 4O3FA 3HM9A 1N6KA 1K63A 1NU6A 3BHNA 3LQ2A 3S40A 3CX4A 4MVJH 5CBPA 5ALZA 4G0VA 3RC7A 2F4VB 5CYOA 4U2FA 3JQCA 4L5IA 3BTVA 3PK0A 1CUYA 4HBGA 3LHDA 3H1GA 2QP3A 2RGXA 4Y2YA 3LA6A 4URFA 3NIWA 2OBLA 3MMZA 3E8XA 2IS1A 4UVIA 3KTOA 1JVBA 5DLYA 4IUYA 5CGQB 2GPSA 3OY7A 5CVCA 2YCBA 4DLAA 2HIHA 3RBZA 5LLSA 2OFOA 3U7JA 5CK4A 2ZXUA 1LQ2A 2QTVB 3HI4A 2W4IA 3DLPX 3FYUB 2HWXA 4WZAE 5C53B 3UG6A 3WGIA 2SNIE 2XRYA 3DZ8A 4LS3A 2H6EA 5EIHA 2IH5A 1JQ5A 1NBOA 5FNVA 1VL5A 1YUMA 3A6PC 2JGDA 4M1KA 1UBMS 1O87A 1W5SA 4Z4EA 4FT4A 1KJIA 4Z7QB 3DE3X 5IK2A 4ZYUA 2E6UX 3NYIA 4RJIA 4YWHA 1D2RA 2QVXX 1LJ8A 1HEIA 2ETXA 2WJ3A 4QARA 1XX6A 3MZ0A 2W6QA 1WCIA 4PO3X 3GX1A 1IJEA 4R2JA 4WT7A 4BNYA 3GEDA 3ER9A 4MR8A 5AM2A 1EFAA 5ALUA 1BX1A 1BRTA 3COPA 4YR7A 5CVJA 1M8JA 4BNZA 5FA5A 1E59A 1OBOA 3ZDYB 3LNCA 3OEEA 5FOXA 3UXEA 4C87A 1C1HA 5AQ1A 2EU8A 2B1RA 3AERA 2H08A 4G3XA 3RYIB 3THXB 5KTNA 1UEIA 3JAWB 3VBCA 1DHTA 1TT7A 4WCDA 4Z9YA 2M98A 2YHBA 3AGQA 3K94A 5HDQA 4B4DA 1CYDA 1M66A 1ZH6A 2Q8NA 2WJGA 3I37X 4J0KA 4EY6A 4QOHA 4B0PA 4DSUA 3VGJA 4KN5A 4O33A 3VR1A 2NO0A 3ED1A 3ZWNA 1M34A 4K0KB 3FDZA 5G1PA 3PNLA 1X77A 4RESA 1J8QA 1WL8A 1YVUA 2KB0A 3R0IA 3ZDQA 3O9MA 2WJHA 4KNYA 2QJTA 1W96A 1OI4A 3P8ZA 3JZDA 4GKVA 2B2CA 2CXHA 2HU2A 5L7YA 1X8LA 2I6XA 2FPKA 1T5BA 2CFOA 4QHSA 1RQLA 1LW7A 4HVTA 3U4AA 3E1SA 4Y2SA 4JJIA 3INGA 4F86A 3K9GA 3OLWA 3QE3A 3FRJA 5ALVA 3ABIA 1N2EA 3SZRA 3C43A 1SIOA 2PUHA 3X2FA 1UJCA 4W5QA 5BYAA 3U7GA 5A0VA 2QW0X 2PKQP 2P3QA 3C2QA 1FXSA 4NOMA 2C4MA 4URWR 1G0NA 1KDOA 5T8KC 2AOWA 1G2IA 4KFUA 1IN7A 1XQVA 4W9RA 4Y0AA 2V6GA 1IOLA 3QWFA 4JLWA 4OGWA 1EB8A 2VN8A 4PC2A 1DG1G 3ROZA 4FMPA 4PGMA 5BO5A 5LD2B 1MRSA 3V4OA 3EARA 1RS0A 3NEAA 4YDSA 1U5AA 1HZZA 1KHHA 3BKXA 1XQWA 3D31A 4DPKA 4O4LA 1U8CB 4HMOA 1BJKA 1VDZA 4EKDA 6GPBA 3W4JA 1UKEA 3ILVA 2GXQA 1OF1A 3SLKA 2SCUA 2W22A 1L5VA 1CJSA 4G1UC 4F4HA 4CIXA 2I65A 2QEQA 4Q47A 5CFOA 1J8MF 1TIPA 2CVZA 4UEKA 1XJCA 1RHUA 2IXEA 4MW2A 2QV7A 3KB2A 3H0CA 9MHTA 3CWZA 1E99A 5FI3A 5A4DA 2VATA 3PFIA 3PYXA 1Q1QA 3DO8A 3V1UA 3CH7A 4U7DA 2YVQA 1IIRA 5CTJA 5BQPA 4BRUA 4PZZA 2NACA 3ZK8A 1E9DA 5JJ5A 3TFOA 3KVRA 4R2WA 4M99A 4F97A 4RY8A 5FLEX 2X0EA 3S7TA 4WBNF 1EX1A 1F2DA 1CS0A 1JSZA 4LMPA 1NZDA 1SVMA 4M1OA 1MA0A 5CB0A 3DE7X 4DCSA 1XTQA 2C2BA 1LWOA 3G2KA 3TH5A 1KSHA 2BHSA 1CJVC 2P35A 2B9VA 2ZIXA 4TTSA 3P9ZA 4X1KB 3VPXA 4M36A 2YYSA 2VZ0A 1CJUC 4BYGA 1A0OA 5FEUA 1JBKA 1FNDA 2IELA 2E3JA 2QDXA 3DVLA 3I1JA 3JQ9C 3OZEA 1ZUWA 4I55F 4INZA 4L9RA 2Z43A 1PEKE 4EB6A 5IUJC 1UAYA 2QJFA 3L5KA 4X45A 3MELA 2R5NA 4D9JA 3DXXA 1KO7A 1O7JA 3JQPA 2JFGA 4ZYLA 3NVMB 1A8HA 2IXAA 3AVVA 5F2KA 1IB6A 1SG0A 4X8LA 5LL6P 4ZJZA 4KE6A 2GILA 4DSZA 1J5EB 5AI0A 4B3HA 2XLCA 2GN4A 1GU0A 1Y0BA 3E27A 4CCYB 3LL7A 3BB4A 5JCJA 4P98A 1BDIA 3C1AA 3REFA 2H4FA 1VI2A 1VKRA 2EEZA 4R5HA 2CDCA 2ID7A 3JZIA 1ICEA 2BDEA 2IEAA 1CBUA 3LY5A 1ILWA 3KOZA 4RXMA 1E1CB 2CLCX 5EHQA 1QKKA 1NN1A 1X1RA 2DUNA 2XUFA 4KMOA 1NRIA 3H99A 3RG2A 4C0WA 3OWXA 5CFLA 1X1AA 3D8UA 3RS5A 4MGZR 3RG8A 2P7HA 4X6UA 4D4LA 3OA0A 1F17A 1ISMA 4V1CA 4J1TC 2WB2A 1CS4C 4W9NC 4C3UA 4NENA 1IHYA 2QTCA 1M73E 4YCJA 4JI4B 4QE3A 5H8WA 1F0PA 3KB8A 1VHJA 1IUKA 2GFHA 2Q6IA 2Q99A 1P9RA 3PRKE 5DCWA 4B46A 4G0MA 4ZQCB 1MIOA 1Q44A 2A0FA 2IP4A 3QLVC 4QJ4A 5BWLA 2Q29A 4HRVA 2VDRB 2NZXA 1B42A 4Z3DA 1TK3A 3OTHA 2RAVA 4DIDA 4ZVOA 3VOAA 1GSAA 3PHLA 1XDGA 4BWFB 5LLDA 2OHGA 2X8LA 2FW6A 2C2YA 1G0OA 1Z0IA 3HSSA 1WXQA 3KT3A 3EZXA 3T4UA 4UM9B 2IW3A 4LXIA 3TLKA 2OKGA 4YMLA 1VBKA 3FRIA 1MAHA 4H7KA 4PYQA 4TKMA 3DD5A 4C3OB 3J7TA 2YASA 1FLDA 4ADSG 5HIJA 2B1QA 3F97A 5I5EA 4RVNA 1QH8B 2R8YA 3M7IA 4JOCA 4F06A 5CG1A 2HR1A 3I2YX 1XU9A 2OL4A 4S1TA 4JI6B 4BB5A 4MI3A 4F3NA 3MHTA 5AW0A 1JWBB 4RK7A 4YY3B 2XKJE 3OD5A 1T5HX 5BW6B 2NO6A 3GU3A 3JTEA 2O0HA 4IVRA 3U2QA 1M6VA 2GF9A 4JP1A 4QM6A 4WFIA 1ZLXA 2C5EA 4WUVA 4QBTA 5H82A 3VSDA 3R6GA 4QGHA 1U8FO 3P9RA 1ST2A 4L4UA 4A36A 3E9MA 1E1QD 3C8DA 4I5FA 1E4EA 1JEYB 1OIWA 2JA2A 3WLIA 4AJNA 2EGUA 4LFBB 2PMCA 2KLHA 2OBNA 1ZW1A 1DKNA 2Z57A 4FYIA 4UFOA 1BC5A 1DRUA 3T1YB 3UC9A 2WAMA 1NYRA 3KAJA 3P2EA 5HOEA 2AEJA 2X8WA 1M54A 1EE1A 1XN4A 4FEYA 5C8YF 3RVDA 3PHJA 1WKCA 4LDRA 2OXCA 4ZO9A 5AWFC 4H1VA 1E2UA 1ODSA 4H3VA 3DL7A 3ZDBA 2PGNA 4OQXA 4A5OA 4RD3A 8MHTA 4BKRA 4P82A 4YALA 4M6WA 1A9YA 1WA5A 3DFKA 3CN7A 3Q3VA 3SNHA 3IIJA 3W1EA 4UFPA 2FJUA 3FNGA 4UQPA 4HFMA 3H1PA 2F3UA 3PB3A 5HUJA 2CEKA 1X1CA 1F8FA 1QVVA 3FDXA 3A58B 4Q4LA 4KWHA 5FEMA 1UZLA 4RGQA 1I7QB 3LV8A 3OQIB 3RSCA 1CE8A 4MS3A 4FCTA 5KREA 2FOIA 3HKBA 2YIVX 2AVNA 2MSDB 5LP6B 3WK6A 3GK3A 2P2CA 4JT4A 4M86A 1KPGA 4TXLA 4V0RA 3PC3A 5BSTA 5I7FA 6NULA 1D2MA 4LF7B 4TWJA 2C5AA 2FK8A 2MSNA 3PLNA 4OKSA 1F20A 1Q0ZA 1L5GB 3ZNOA 4QDZA 2HHAA 3MG9A 4MMYB 2GWHA 3ZXIA 1YNOA 5GIOE 4UJ3A 4ZJUA 4DL9A 1Z5GA 3CRW1 1DOAA 3KXIA 2BRUC 4JKIA 2EFGA 5CNKA 4E7PA 5LNK6 1H4QA 1I3NA 3BGIA 2B94A 1O95A 3NJRA 3NYRA 1UBNA 3O8BA 3QKRB 4TYWA 2I1WA 5AUPB 1JTVA 4HAXA 2FG7C 3C39A 1Z4KA 2Q0XA 4FUQA 2PPLA 1QYIA 4QBFA 1GTSA 2ZTVA 1Y5LA 1TGVA 3AZOA 3FNIA 1T2VA 4WTOA 4FFNA 4ZYWA 4A8JC 3H6GA 5AW9A 4QU8A 1RBYA 3DXZA 4GOLD 1U8TA 1FP2A 3TOCA 5K8TA 1C8VB 1A8QA 3EY9A 3M49A 1BRMA 2YIJA 3JU3A 3CSDA 4FZ3A 2YVKA 2Z3VA 3AR5A 4NMMA 2M9MA 3RYHB 1PT7A 3NS7A 2AYZA 2VJMB 5ANRB 3OUTA 2ATIA 2O2ZA 3D6JA 4ARAA 5IH7A 2IJGX 3BKWA 1WNTA 3FNEA 3N2IA 2IXDA 5CH8A 4ETWA 4DY6A 5J4VA 1OH7A 5FR1A 1DUIA 3NWEA 3KQWA 2OORA 4CLOA 1E1RA 1IEQA 2XJ4A 2QMYA 3KYCB 3WQSB 3SHOA 2FZCA 5DKFA 4UHBA 2ILVA 5GGYA 3S1AA 3L7JA 1YZQA 2WD7A 5FPYA 2DOKA 3NDIA 3QVVA 4ZMBA 2E1RA 3LWNA 5ALNA 1C7IA 1G66A 1JKJA 1RAAA 1RT9A 3QPWA 2XZPA 1KDZA 3UV7A 1VB3A 2XVZA 1DC3A 2EW2A 3HPQA 4O4IB 1TTQB 5CG2A 1MA3A 3WRXA 3TNYA 3MJCA 1JW9B 3O8OB 1P6UA 3EISA 1TO6A 2C2OA 5DEOA 1PV2A 4A6EA 4CTOA 2P75A 2UAGA 4MJ3A 2X1MA 4P36A 1CUHA 4YO8A 3P4YA 4MAAA 3HK2A 3JZFA 1ITZA 1M2OB 2WM2A 5JAIA 3OFNA 1K8YB 1JG2A 3NTQA 5DTEA 2J9ZB 4CFYA 5A4IS 5HZMA 1W4RA 4CFSA 5K01A 5K51A 5GWXA 1L5MA 1FRNA 5CJPA 1RJ9B 1UWCA 2Y99A 4MKFA 1RADA 1I51A 1CQJA 1LKZA 1QZTA 3CT4A 5J63A 2AFIA 4YV1A 4ETIA 3QEAZ 3ZWMA 3WS7A 5HOQA 2PZAA 3VX4A 3C3AA 4GUDA 3H2KA 3NHYA 5DISB 3W5DA 3SHVA 5A3QA 4U5XA 5JC8A 2WYIA 3BMNB 1WDKA 5T67A 1YXMA 2MYNA 5BT9A 4I4NA 1TUIA 2ZDQA 1VJ0A 2AI1A 4P58A 3T5GA 5DTIA 5JBQA 4U0JA 4RK5A 3SEAA 2C4VA 3K70D 1YB5A 4P32A 5ERXA 2NAFA 3TLMA 3CLVA 1E3EA 1DKPA 2QL5A 2VFAA 1F38A 4HG2A 4IJ5A 4D80A 3F74A 3CKKA 1IBMB 1E6WA 4KRXA 1OZAA 2Y1EA 1II0A 2PYZA 3I9MA 2VWQA 1IZZA 4LYYA 5FWXB 1NVXQ 4Y6OA 3ZZNA 2BI7A 4L0CA 4ICIA 3V46A 1KJ9A 5LQMA 1Z6ZA 1G8GA 5F5XA 4ARVA 2PR2A 3DTNA 2V1XA 2ZW9A 3M1YA 3ODGA 2CW5A 4OQMA 4RF3A 2GZDA 5F33A 1E2KA 3NXKA 1T8TA 3VR4H 2XUIA 1PR0A 1RLIA 3HP1A 1AV7A 1XCLA 2EW8A 3V2HA 4B8YA 1FW8A 1ODFA 3OEWA 4ND5A 2CFRA 3IAXA 2BR3A 5C52B 4YRFA 1SKYE 4JYBA 3CLSD 1W0JD 5JAUA 1EDBA 3VU9B 3WLQA 3P96A 3TBKA 2JI7A 2A8YA 3KR1A 1CZOA 1KVRA 3CG0A 2XF2A 5EA2A 3DW1X 2R44A 4L8FA 3CB4A 4QDOA 5FTKA 4NYJR 2GK3A 1VLVA 4DYDA 2ZUTA 4AIIA 2NXJA 1LVHA 3SY8A 2YJ5A 5L3SB 4HZUB 4I1SA 2QD2A 2H9IA 3WZLA 1GPDG 5AVJA 4ZAFA 4YACA 3ZEAA 3IQFA 3EXG2 4FZVA 2WVJA 4P80A 4DQDA 3PDIA 2BI4A 4DA6A 3T1TA 5TQ2B 1KVTA 5JSFA 1ADBA 2QY9A 121PA 1CUBA 2DZDA 2GAJA 5A2QA 4FE3A 3NETA 4YAUA 1YTUA 5EJ9A 3D6NB 2LDXA 5H7XA 2AEMA 5F52A 4PLWA 2UZ1B 4RVSA 3T9FA 4FJ2A 2AR9A 5CM9C 4BNDB 4CEHA 3U3ZA 3PEUA 2PA3A 1B6RA 3CKYA 4FFWA 4I4TF 4C0AC 5C5EA 1XEXA 5HTKA 2OBFA 1XPOA 1Z47A 3LUFA 1E2LA 4NESA 1JJBA 4LYJA 1KY2A 1UKBA 3NCHA 4Q4JB 4D9KA 3HTXA 3CKMA 3CZ4A 1W35A 4QU5A 5EVJA 4RD4A 3HRKA 3LI2A 4XDZA 3RS8A 1IBCA 1U0NA 2R25B 3HNOA 4BFYA 4HN2A 1E9CA 5ALQA 1JG1A 2YWBA 3QOYA 4I2NA 4IEFB 1UEXC 1L4KA 1NN5A 2P6NA 1SJ9A 2ZE5A 4FW8A 1IM2A 4NVRA 4OA5A 3VC2A 1VCOA 4ES6A 1ZD5A 3I3OA 2DU8A 3NHWA 4WERA 1K7YA 2VSFA 2Z2XA 3C1OA 4TMVA 1U5BB 3LDHA 4N3GA 1F6BA 2BGTA 4EH1A 1DWPA 3G02A 3TW6A 1S2DA 1P1CA 1JBEA 2G88A 1XMQB 1Z3CA 5E3JA 3G0GA 5BV8A 1WV0A 1E6LA 2NTJA 1M1YA 2E89A 3EIHA 4NBWA 5FT9A 2C3UA 4E11A 5LQCA 1IY0A 1OYVA 2GAFA 1QC5B 4P0TA 3ZR4B 2DHCA 2Q7XA 1EXMA 1QO0A 3IRVA 4GNRA 3V48A 3FRHA 3NO4A 2F62A 1GQ2A 2FI1A 4NCAA 3H2BA 4H18A 3C7KA 3H04A 1F4LA 2O0MA 5BN5A 3L6DA 2H4YA 3DHVA 1W75A 2GCEA 3EDQA 4IFIA 4QXOA 4LPSA 4LE1A 3AM3A 1ZINA 2DPHA 3GVPA 3F67A 1MABA 1PW7A 2IRWA 2PKEA 3CZMA 3N3AC 4UHFA 3PVZA 3WYCA 4XXHA 5HQTA 3WFJA 1M8KA 2GVZC 3C15C 4MWDA 3EIQA 4UBMA 2O7SA 5I51A 4FE7A 3U4HA 2I8AA 3EVEA 4FTWA 4A8HA 1JNYA 5TGTA 3UMBA 2GHTA 4KQHA 2MT9A 1RWVA 2JI4A 3CTMA 3Q7SA 3NHFA 2YRWA 4Q05A 4UVEA 4AZ0A 4YT8A 1FMFA 5TJHA 1U0BB 2ZRDA 3P52A 3BGWA 4AZTA 3KQVA 2UZIR 4PZUA 4PNZA 4HFRA 1CK4A 3B6KA 4PHCA 1WOYA 2DTEA 5EIOA 1RTKA 1WCXA 4H0NA 4OG2A 1QIDA 1FXUA 4BO1A 4OXXA 2WU8A 3OF5A 2AIRA 1CDOA 4DG9A 2WSBA 5AK6A 5IKXA 1P4SA 1XF1A 3IBCA 5A5DA 2VQ3A 4UHKA 2YRFA 1ZITA 4ZYXA 2O8EB 2H4JA 5CFZA 2W0SA 1CZKA 4CF3A 3PX7A 1SXJC 1G4HA 2G63A 1ZWLA 3HHPA 1RYZA 3FYSA 4RS4A 1VL0A 4ONEA 3WYDA 1YJCA 1SN7A 1YR3A 1LDEA 2ZR0A 4RVHA 5D5HA 5DOVA 9LDBA 1BNCA 5L6LB 1WXFA 3FM9A 1E9RA 2A35A 2DQYA 4YX9A 5C1PA 3GMIA 3MJHA 4NNOA 5TPZA 5NULA 4E5KA 2PX4A 1FFCA 1EFKA 3PXDA 5D8DA 3TIVA 2IIPA 4AJLA 3TOZA 3C8UA 4LJKA 1SC4A 3HEMA 2CJFA 4XJXA 3AF2A 5DV9A 4H3SA 4B47A 1B7GO 1KIMA 1J21A 1NVEA 2GN1A 2ZAYA 1DFGA 4N0QA 4DADA 3NHRA 1RRPA 2OXEA 3B85A 4ABTA 3DLHA 1SVUA 2ZYTX 3OQ6A 3KVVA 1U81A 5JRZA 5EE0A 1S89A 5KYUB 5HS4A 4QVGA 4O5OA 2C3YA 1S8OA 2BLNA 3E15A 3LW7A 1JU3A 1MJFA 3DB1A 3QWBA 4FMCB 2BGKA 4HWOA 4WADA 1C1XA 1RI2A 1VJGA 1XD8A 2ZSHA 4ZFNA 2P90A 3KCQA 4F3YA 1WNFA 1YIDA 3HYTA 2CV2A 4I5IA 4I3FA 4WACA 5KJ6A 2I55A 2IYLD 2VJKA 3KLOA 4JVMA 4LRQA 1N32B 2X6RA 2VSXA 1NMZA 1NQXA 4WLFA 3WY9A 5EKTA 1GZ7A 3D2BA 2O59A 2NN3C 1TRHA 4UVHA 3ZY4A 1QP0A 3L6EA 2GKGA 2VH1A 3H2JA 4NU5A 3FOEC 2VP5A 2OXTA 2ZJAA 3Q7IA 4HBZA 1F8YA 4RMIA 3TKLA 3GCZA 2NU9A 5AKKA 2CDBA 5EVCA 5CEJA 5KX5F 3SKVA 3PT9A 1OFTA 1T2UA 2FGJA 1Y9AA 2VHVA 2WMDA 2X2OA 4M0LA 5EPUA 2IHUA 2CNWD 1SVIA 4AZWA 4HDRA 4Z8XA 4NE9A 4BFVA 3U81A 4D6PA 2CUNA 2WSSD 4ZEMA 1GRRA 2XRMA 3C6BA 3IEUA 1IYZA 1T4CB 2M32A 2IYFA 1U7ZA 4R2XA 3TM4A 2PT6A 2ZYAA 2BV3A 1WDLA 1P60A 3LUPA 5EI5A 2C4KA 1CVIA 5JD3A 5CYFA 3RSZA 1DUSA 2HBZA 3B9QA 3LT0A 4LHEA 4AS2A 4D0GA 3WK4A 2QSUA 1GCOA 1T8PA 4CT5A 1JDZA 2GCIA 4RHYA 5EHNA 1FS6A 2I0FA 4CQMA 2PANA 3ZWCA 1CZUA 3LBAA 4AZVA 1A2BA 1XDWA 3I8OA 3W3AA 1S9DA 2IYZA 1CVLA 2C0CA 4ZANA 2VDJA 5D6OA 2JGEA 3JQ9A 1B73A 3G5UA 3S27A 2P9EA 1T8WA 3OPYB 4QVKA 4I4CA 5FI1B 2CCGA 2FSPA 1K2WA 2PT5A 2XUOA 4ZO8A 5A62A 4YMIA 2ZR8A 2OGSA 3SXUB 4MDHA 3RRMA 4JN6B 1HZJA 1NN0A 1T4GA 2RFLA 4UEWA 4CMEC 2H1WA 3B70A 5B55A 5ADWA 3W5VA 1Y4UA 5LU9A 4EDFA 4L4SA 4P4UA 2H8GA 1GN9A 3EQZA 3RRJA 4JBXA 2N1MA 4HQLA 4G5QA 3OO1A 3FA2A 4WECA 1T8SA 1RQ7A 3ROQA 1VE3A 2X0IA 4JR0A 2YHAA 1AXGA 4P6VF 4OP2A 2CMFA 4PX9A 2AK3A 4W8GA 5GONA 2HYIC 4Q3DA 5COAA 5FL7D 2ZITA 4Z86A 2FPIA 5AM0A 1MH1A 2VHTA 3HB1A 4O29A 4CGZA 4QLAA 1MN6A 1TNDA 2D59A 4J1TA 4U7HA 5KTRA 5J3JA 3C3WA 2R6JA 4RM3A 1VLLA 2GBFA 3HUTA 3ESAA 3O1IC 4BFTA 3UKDA 4Z4HA 4JDPA 1H2FA 1P7ZA 5AW7A 3I9JA 1KK2A 4EJSC 3E2PA 1UOEA 4E5NA 2C97A 1W93A 4HEHA 4MA5A 1G63A 1OAKA 1XAIA 2B98A 3SR0A 3DPUA 2Q0QA 3GZNA 4XEHA 3RU3A 3BD7A 2DYKA 3CX6A 2O1EA 5B2ZA 1V6AA 3OT5A 4HN9A 2GPBA 4DRZA 2FPPA 3E70C 1ONNA 1R0ZA 5LCXA 3Q7QA 5J40A 4CUZA 4AWBA 4LV6A 4BQEA 5EZ5A 4QFBA 3TG2A 4W8OA 1PJ3A 3WKEA 3PFFA 2MR5A 1FVOA 4CLDA 1RZ3A 4FI3F 5CMLA 4KUGA 1RPNA 3ENNA 2WJYA 4X84A 2G09A 3JYNA 1X2BA 4RYLA 3LP5A 4OHWA 5ALLA 4CM1A 4YRBA 4INJA 3R7BA 3UCEA 1T0PA 2JHFA 3LUGA 1U9JA 2YQ4A 1ZXLA 3GT4A 2FZEA 3IUEA 5AHXA 4C7OB 4KJXA 2O07A 4C06A 1SURA 1V7CA 1J09A 5C35A 4IDFA 3EOBI 1VKOA 1YRBA 2ST1A 2R1VB 3BA1A 3T8YA 3SQOA 1DDGA 1SQ5A 4IXMA 5TE9A 4C2UA 3OJWA 3W4IA 4BAZA 3LUHA 4QT0A 3JD2A 4TKVA 4AI6A 2P8JA 2ZSJA 3EVFA 3O4FA 4GC5A 5AR1A 1VI5A 3FWZA 2YHIB 4ESHA 4TYPA 1YB1A 3AEZA 5FRDA 2MYPA 1WXWA 4M7RA 3VHRA 5DB4A 4QDUA 4DWVA 3U26A 2ZZNA 1H1LB 3UM9A 5ILOA 1RLUA 2FV8A 4UHHA 5CVVA 1UL1X 5I9BA 4ZXPA 1PCXA 3JYQA 1NFFA 1D1SA 4HAZA 3FTQA 5FUYA 2Y1GA 5E6SB 1WHTB 2DTXA 1W48A 3GWZA 5E4JA 3M3DA 1GL7A 3F2VA 4B6JA 4P83A 3GUYA 3TDNA 5IM4A 4IHKA 1UDXA 3GPLA 3LXXA 1EM8B 4ARBA 2O8DB 2WU3A 1DKQA 1NJFA 1T5LA 1QBKC 4L6AA 2C42A 4I08A 5L45A 2C00A 2BHLA 1Q83A 2L82A 3AEKA 3ADCA 2EFYA 3WLMA 4Q66C 3VZSA 5L7WA 4B87A 4W7SA 2UYCA 2WPNA 4URYR 1R3UA 4BBPA 1Q0LA 1D0IA 2X0KA 4TYNA 2GM3A 3AP2A 3E23A 2ZUWA 4IGFA 1FIUA 4FGSA 4L8VA 4WXRA 1ZZGA 5CRIA 3T1OA 4BLTA 1G6KA 2J46A 1IZ9A 1DXHA 2BEJA 4MW7A 1J07A 1W49A 4GM0A 3ROMA 1KJNA 4ZODA 1UT6A 3QM1A 4TQ9A 4E30A 2PYIA 1C0EA 2FHPA 5HKLA 3W5IA 5MN6A 2Q2VA 2JCSA 5IDWA 3HYLA 3VZPA 5E7MA 5K8VA 1E3MA 5KVCA 2HA3A 3ETNA 5BSVA 3LLCA 3WYFA 4I1YA 2Z58A 3V2GA 5KVSA 3DGFC 3VA7A 1LPPA 3QHPA 1ZUHA 1WMFA 1QHIA 4XW2A 1DQNA 1PEYA 4CETA 4DV3B 2PNFA 1KU0A 3W5AA 1GZHB 2DWOA 3SFTA 4OPMA 4X94A 3ZCPA 2VF4X 2C83A 4XPIA 1K7CA 4IY1A 3BX1A 3F5DA 2X5JO 3DG9A 4GPBA 1E1YA 3LP8A 1FLNA 2HI0A 2PQ0A 3FN4A 3WVNA 1NULA 4LOKA 3ZE6A 1QXSA 3O9VA 3AP3A 1KBOA 5FPSA 1V1RA 1YULA 1Z33A 2D2XA 4UMDA 5IDVA 2HCJB 4BO7A 5LIRA 1Z73A 1MO5A 1HG1A 1Q12A 4M9XA 4Z99A 3KS9A 1GEGA 3A4LA 2PQ2A 2H3EA 3BSYA 5BWCA 4FWTA 2Z9DA 4A92A 1ZN7A 2VJDA 4DCNA 1O9GA 1O1YA 4DR4B 2ZTSA 4Q00A 2REQA 3W2HA 1UBRS 1RQGA 1NPTO 3F9RA 3AUAA 1Y1QA 3HCRA 1JU9A 1EVIA 1RM4A 2PH5A 3AINA 3HU2A 4NXNB 2P6PA 2GD6A 3NFYA 3T3OA 3DGEC 4JBGA 4KSCA 4B7AA 4I5EA 4LWPA 5H3CA 3T5MA 2DR0A 1V8OA 2DR3A 2OZPA 5LKRA 1JIKA 3CG4A 4UCXA 3MGKA 1CLUA 1NJGA 3FLMA 3LOQA 2DSTA 1FDUA 1TK2A 2IYNA 3ZGXA 3Q4GA 3C7DB 4LF8B 3AHGA 3MCVA 1VL6A 1SHZA 3E9EA 3L4SO 3ZY5A 5EHIA 1RRMA 2RGCA 4ZZ3A 5C8XA 3Q5EA 4RXUA 7ABPA 4PSAA 4HWKA 3WI7A 1Z5UA 4BVJA 1CYEA 5JQWA 3UOAB 3WSWA 1ZUIA 2XUQA 1IY2A 3DMYA 3EPPA 4X7RA 5CX1B 4IIVA 3SJ7A 2HNBA 3ICCA 1H93A 1DEOA 2AB0A 3AHEA 4H2DA 2ZKLA 4JENA 4KK3A 4CM3A 1TCCA 1H8ED 3HXKA 3L18A 4ALJA 3VC7A 3TTYA 3W7AA 3GVCA 4YK7A 1SELA 1ANKA 1IONA 1IATA 1IUPA 2C0QA 2O4CA 2PSDA 4X3OA 3ZU6A 2BUCA 3HWWA 3AL2A 4O4IF 2RKBA 4UU0A 5ABPA 2OGWA 1IU9A 1LY1A 1PU2A 4GQBA 4PPYA 1JQ3A 4KRFA 4ZAWA 2AG5A 4DABA 3C6MA 3E2MA 4MWEA 3DOFA 4ENSA 1XQ6A 4JU8A 4IQ0A 3PFNA 4EFMA 5AHWA 4KR6A 3RVJA 5JZBA 3AH8A 5E8JA 4LECA 1U6JA 2IQIA 1KAMA 4MGHA 3TN7A 1G7CA 4WFJA 4KEAA 1XYYA 4RHTA 3H5WA 1PT6A 2A33A 3HACA 2WUFA 4P8RA 3WFZA 4LF5B 3I0MA 4WLOA 4R1NA 3NHUA 4H35A 1VSVA 3FUUA 4NU6A 1ARZA 4PTZA 4AP6A 1GWNA 2ATEA 2CJXA 4QGFA 1OC4A 3TRHA 5BR4A 3KYJB 2VJYA 2YZNA 5H80A 4EI7A 3UHJA 4I46A 4BJ5A 1OH8A 4LK2A 4YJHB 4PZCA 4XWOA 5JLJA 1I10A 2WWHA 2C58A 2XHEA 5AKYA 5M04A 5DFAA 3C5WP 2XX3A 2C5FA 2GBLC 4L08A 2AJDA 4MQFA 4ASUA 5JXGA 2FFJA 2LNDA 3W9YA 3RUCA 4GXTA 3VVBA 4HD8A 3SF8A 3RR2A 3ICPA 4GI1A 3L5OA 2FE1A 1J5XA 1ZMOA 5CA1B 1LC0A 1KH2A 1YRHA 2B2XA 3KJGA 3M1AA 3ODPA 2J32A 4GVPA 5JC1A 1NZJA 3BWVA 1Z34A 1WUTA 4JT2A 1ZA2A 2CE2X 4LJLA 4MW0A 2REXB 3V1TC 5F7OA 3ZWYA 5BQFA 5JTUA 1KZ4A 3HBNA 1XE3A 2DT8A 1B8UA 3G0DA 1R6VA 3MFYA 4UUNA 4J43A 2OBBA 2VDVE 3U4MA 2ZGVA 3HKCB 1EBUA 3IIEA 3P94A 3QW2A 4CL2A 5LQRA 5TMDA 2BEUB 1KOGA 3FZQA 5DO9A 2CJYA 3IMGA 2J4CA 2Q1WA 3LKDA 3ISTA 3I04A 4HRYA 4IV5A 2CLFB 2V0CA 5K3AA 5PGMA 1SA0B 3M6IA 4KAFA 2J48A 1TAHA 3WZMA 4E22A 4DYVA 5L3QB 3JQAA 5TQVA 1UC8A 3MPOA 1KMCA 3PNSA 4FW9A 2NU6B 2XDAA 1TMYA 3IUMA 1NXSA 5I7AA 2BPOA 1F48A 2QNIA 1DG3A 3AR7A 3L0IB 3OQJA 4J0JA 4QOJA 3AVPA 5ALFA 3PJEA 4D74A 4DCMA 4ZTUB 4HEA6 3NGXA 4GI3A 4P5EA 3LHSA 3EF0A 4JBWA 4O4HA 1H6AA 2HSJA 4NCIA 2F43B 4NMLA 4OL0A 3FGNA 4IINA 3U60B 2DBVO 1I24A 1QIKA 3GA5A 1UZNA 5ENZA 3WLSA 3ZJTA 1JFFA 3NATA 2RH5A 4H4CA 2ZCJA 3ER8A 2DFPA 4E46A 3D0QA 5KYWB 3B1FA 2CL6X 1VI6A 3X2SA 2YMMA 4JA0A 3I76A 1DT5A 5BSGA 3EEQA 4AMBA 2F9FA 2PKXA 2ZSDA 2F90A 5EE9A 1JG4A 4AQDA 4ZHQA 3UTDA 4MUBA 4WCFA 1CUWA 2A0WA 3PQ2A 5JSKA 1MLDA 1XPJA 5I47A 5E4YA 5CDYA 1OAOA 3I5XA 2M6RA 4M1WA 3R8CA 3AXSA 4GZLA 1DI0A 3D3EA 2I4RA 3GUCA 3FSGA 4F2DA 4JP3A 3R77A 4BNFA 1YQDA 3GDOA 2K5UA 3KJQA 3IOEA 1FVHA 2ZR9A 4CV3A 3VSCA 1GAXA 3DUFB 2WG0A 4CGYA 1T5OA 3AY3A 3U7RA 1A9TA 3VH3A 4B6FA 3GFOA 1IXYA 1G20A 1U04A 3HG7A 2P69A 3PWZA 4C6SA 1F4PA 2AC2A 1EWYA 1JB1A 3CSSA 3VKUA 4C1NA 4F60A 5HBGA 2JBAB 3WLRA 5JAPA 2PTGA 1M9NA 1SOUA 3JS5A 3KQSA 4KP7A 2QN3A 4BLUA 2QVZX 4BWYA 5IZCC 4PN7A 3UXYA 1D2EA 2JH8A 2PXXA 3ZTYA 4RFLA 3L9XA 2E85A 5DYTA 1KH3A 2WYHA 1ZONA 4NPAA 2XA9A 3GYGA 1DEXA 4C6TB 3HL4A 5BNTA 1LLQA 5KOJA 5HM6A 2SECE 4PNEA 3ADBA 1MIHA 5G0UA 1EUCB 1PG0A 1YVEI 4K9LA 4PG7A 1VJTA 1Z8DA 3KE9A 4MP8A 2G9NA 4B9AA 5IT9A 1GPBA 1TLLA 3UJPA 1UOQA 3LCMA 4JCCA 4YJGB 4E2WA 4CMCA 3JYLA 1RLTA 1LFAA 5C1IA 4EM6A 2IYTA 2V6IA 5F2EA 3HB9A 2X13A 4R2LA 3SYKA 2WP8J 5A9SA 3RKRA 3EDRA 1Y3AA 5JAQA 4LDPA 3RKSA 5JY6A 5TB5A 2QL9A 2ZT5A 3F9CA 3GDWA 1RW4A 3K7EA 1WUIS 3OFND 4FZRA 2J7PA 4MS4A 5K3DA 4CUJA 3CA8A 5IH3A 2JJYA 3RYFA 5K0EA 3Q6NA 1PQUA 5JAZA 4HGQA 5M29A 5DI3A 2FH5B 2IV2X 4EY4A 3EPHA 3GLVA 3OZTA 5L40A 1BDBA 4UOEA 3CUVA 3OZVA 1OLSB 1JAIA 2ASEA 2HGZA 5FBHA 3GXOA 3U9SA 2J5KA 4WN3A 3GT3A 4KXQA 5C0OE 3LG2A 4MCJA 5DNYB 3QUCA 2O7VA 3HSYA 1ZG3A 2PKQO 1ETHA 2XNCA 4QOGA 3T3IA 5AUOB 4KIUA 4E5UA 4K87A 4BAUA 4HXYA 1S2IA 4FDUA 2YR0A 1DFHA 1HH4A 2RSLA 4TOIA 4RDIA 4DR7B 1AS3A 2RGEA 3AEQA 3AB8A 4MUHA 3KTFA 4FGWA 4X7MA 1JA9A 3V2IA 2IZ0A 1Z3IX 4AUMA 4LF9B 1X8JA 2GPTA 3SQNA 1HFEL 4N5IX 4TSFA 5A7HA 4KMRA 1MVOA 2VPZA 5F5NA 1FFWA 3RQSA 1M8FA 2R8PA 4BNNA 4EKGA 4NATA 4U8GA 3SJUA 2G7MC 2Q6TA 4IJQA 4WAUA 1HTWA 4RWEA 5K2MA 1N92A 1FLVA 2V5UA 4K8RB 4L8WB 4C43A 2JLYA 3DYBA 1JFVA 4JIMA 4NJEA 2VLIA 1F2TA 4Q9NA 1UDAA 4O4JA 2I3DA 5CYGA 3LPAA 1QANA 1WUKS 5CT9A 1I1OA 2DFNA 4IKOA 2QRJA 2H7CA 5KNLA 3CJRA 1MB0A 3D3JA 3K1YA 1E4YA 5E9JA 2HMAA 5E6RA 3FB1A 3FI0A 2QVGA 2WI8A 5JDCC 5AK5A 1GPMA 1Y8QA 4S1VA 2HMUA 2NP6A 4ESOA 4Q4DA 2ZJ1A 3DFUA 1VJDA 4BIMA 5AVVA 3UXMA 4EMBA 3RRNA 2ZPAA 3TR5A 3E22B 1R8SA 2DERA 1ZEJA 3QVMA 3D8TA 2VDLB 1ZKDA 4PG8A 3JQ7A 3H11B 5AIAA 3WKDA 4KQMA 2BFDB 2FF7A 4FMCF 1U0HC 2A7QA 5K3FB 5CB4A 5EJAA 1GRVA 3OMXA 1XZIA 3RUEA 2GT1A 4QUDA 3VKGA 1TKRA 3SEFA 4N49A 1FBTA 4RPKA 4GW3A 2FMKA 4FQ5A 1GG9A 4ER0A 3QBJA 1REQA 3LQRA 3PUYA 1P74A 2QAGC 3HKDA 1PWHA 3VR3A 2GZ2A 5EC8A 4V39A 1YCFA 3TQIA 1CR0A 1WIWA 4H6VA 1OLUB 2RKOA 2X9GA 2Z9BA 5IAKA 1Z75A 1GAQA 4N8EA 1GDTA 1ZK4A 4G41A 2O3JA 4ENRA 2QGFA 4X7PA 4CMEA 1KDRA 6LDHA 3WGTA 4KGDA 3KBBA 3T1NA 4Q4CA 2FX3A 3UAOA 2GK7A 2TSYB 3D2AA 5AKZA 1EK0A 3GQVA 3ONEA 4PLPA 4R05A 1Y9JA 4WLNA 3PQ4A 4AJ1A 4R83A 3RUHA 1IVYA 2POCA 4POOA 3OAAA 1R9NA 1C4XA 1CY1A 4J0GA 4U63A 4BV9A 3ZX5A 4MPRA 4N7RA 5DRYA 4KO4S 3TLZA 2RHRA 4GHWA 5CA0B 2QR2A 4OXQA 3V4FA 4PTLA 4X24A 4AMUA 1E1MA 5DXAA 4EA8A 3HR4A 3ZI4A 1YHYA 3T54A 2NZ2A 3NC0C 4LTDA 2AN3A 3LSTA 3QIVA 3EVDA 5ED4A 3OCJ