3C7TA

Crystal structure of the ecdysone phosphate phosphatase, eppase, from bombix mori in complex with tungstate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
b'RRWVFALRHGERVDLTYGPWVPHCFENDTYVRKDLNLPLKLAHRAGGKGGYVKDTPLTRLGWFQAQLVGEGMRMAGVSIKHVYASPALRCVETAQGFLDGLRADPSVKIKVEPGLFEFKNWHMPKGIDFMTPIELCKAGLNVDMTYKPYVEMDASAETMDEFFKRGEVAMQAAVNDTEKDGGNVIFIGHAITLDQMVGALHRLRDDMEDVQPYEIGRNLLKVPYCALGAMRGKPWDVVSPPCPPSINSSSGRFDWRILI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ecdysteroid-phosphate phosphatase
molecule tags Hydrolase
source organism Bombyx mori
publication title Structural and functional characterization of the c-terminal domain of the ecdysteroid phosphate phosphatase from Bombyx mori reveals a new enzymatic activity.
pubmed doi rcsb
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3c7tA01
1ND6A 5AJXA 2EKBA 3K4QA 5AJWA 2P9ZA 2OWEA 1DKMA 2YN0A 3O0TA 3E9CA 3IT2A 3EOZA 2A6PA 1H2FA 2EOAA 2ENWA 3GP5A 2P6OA 4FDUA 1RPTA 3OI7A 2BIFA 1SK9A 3MXOA 1DKQA 1RPAA 5CX4A 1SK8A 2P75A 3QPVA 4GPZA 2PA0A 3F3KA 2P79A 5CDHA 4FDTA 2I1VB 3PGMA 3GP3A 5AJZA 5HR5A 2P9FA 1DKPA 1BQ4A 4GPIB 3D8HA 3FJYA 3E9DA 2HPAA 1EBBA 4JOBA 1UJBA 4D4LA 4ARVA 5CU7A 2ENUA 4PZ9A 1DKNA 1C80A 2A9JA 4ODIA 1E58A 2P9YA 1CVIA 2F90A 3IT1A 4IJ6A 5HTKA 1SKAA 1RIIA 1V37A 2H4ZA 2H4XA 4PZAA 1C7ZA 2H0QA 1H2EA 3D6AA 1V7QA 1FZTA 2YN2A 3LG2A 2P77A 2WNIA 2QNIA 1YFKA 1BIFA 3FDZB 4HBZA 3QPUA 3HJGA 1YJXA 1QFXA 2HHJA 1C81A 4E3WA 3DB1A 4D4JA 2RFLA 1SKBA 3IT0A 3BIFA 3QPWA 1NT4A 2DWPA 1QHFA 1IHPA 1XQ9A 3DCYA 1BQ3A 3F2IA 5AJYA 2P2YA 1DKLA 4QIHA 4ARSA 3IT3A 5AK0A 4AROA 3K4PA 4TSRA 2AXNA 5PGMA 3FDZA 2DWOA 3E9EA 3ZHCA 2P30A 4EO9A 4D4MA 2H52A 2P6MA 3NTLA 2GFIA 3D4IA 1E59A 1FBTA 4JODA 4PGMA 3R7AA 2WU0A 2WNHA 3C7TA 1TIPA 1K6MA 3GW8A 3NFYA 3KKKA 2HIAA 4IJ5A 1UJCA 3LL4A 2OWDA 4D4KA 3EZNA 1QWOA 5AJVB 4EMBA 2P2ZA 4JOCA 3LNTA 1T8PA 1DKOA 2P78A 4ARUA 2EKZA 1ND5A 4MA4A 3MBKA 2IKQA
chains in the Genus database with same CATH superfamily
4N01A 4E4YA 4HNVA 5FB3A 4BZZA 5EXXA 3VUEA 5I7WA 2FDCA 2BMAA 2QRKA 3JD2A 2RBEA 3THXA 4NYMQ 4W5HA 2PLNA 1OFUX 4H0CA 1NTOA 1DC7A 2V7QA 1OWLA 1OXBB 4GVXA 1L9KA 1U11A 1ZKMA 2YJ4A 3DWEX 4OBWA 1OILA 3L4BA 1ZOOA 3KAJA 1H2FA 4B3GA 2CMFA 3PRHA 1I24A 2YXNA 3QWIA 4GXNA 1DKQA 3D8SA 4LHYA 1E1YA 1POWA 4OFWA 1KORA 1TX4B 3RVRA 3ZNOA 3G5TA 3L7CA 4AULA 1I10A 2FFBA 2CLFB 3G5MA 1D0IA 4R68A 1KS2A 1J9GA 1OBFO 2W2LA 3KZMA 1J2YA 4PLGA 1H42A 3SZMA 2PD6A 3N39C 5G1PA 5LZ5A 5JZMA 4X7MA 2P91A 3RS3A 2HYDA 1CBUA 2XTZA 3WL3A 3JASA 3EDYA 3JRNA 4PQRA 4MCIA 4W1PA 3ENZA 4EECA 2AWNA 1G5PA 4Y2HA 4K03A 3EXG1 1IM8A 2OBNA 2QLNA 2H1WA 5DLEA 3ZGZA 1L7QA 2BC9A 3ZHTA 1C80A 4MB0A 4JCCA 3T52A 4H4DA 4RESA 1MU0A 1XMXA 2G88A 2ZYUX 2ZIXB 3U9LA 3HH8A 5DMXA 1P3JA 2IHBA 2P11A 2PX4A 2O8EB 1WO8A 1EJ2A 2FW7A 1GZHB 3L6UA 2OAQ1 5DRYA 4YAEA 4ZT7A 1N57A 3ECCA 4R41A 5DOZA 5UKDA 4C2UA 3FMFA 2IYZA 1V45E 3F67A 2WSMA 1E69A 4PX2A 4W9RA 4RY0A 2GLXA 4GKKB 3QJYA 5B6PA 1VHLA 4CDRA 4RIEA 2WIGA 2XYHA 4P5PA 2JCVA 1GITA 1WUIS 2VJAA 1RVDA 2XV1A 1HEUA 2PUGA 3JWPA 3HCEA 3AEQB 3ZDYB 8ABPA 2C3UA 2UYGA 4OMFG 4KXYA 4BMSA 2CYAA 1DBVO 4Q5IA 5AI5A 4D96A 4O4IF 2QM3A 5JJ5A 4QBIA 4R1LA 1IWPB 2EZ9A 4RVDA 1PU2A 1ZW6A 2ZQYA 5EQDA 1QUEA 1MXHA 4GVLA 4JLNA 2ZIEA 5TX7A 1CX9B 5L7YA 3HXQA 1PD1A 1DKRA 5FTLA 4ETIA 2C61A 3BQ9A 4Y2QA 1WHTA 1YE8A 4QOGA 5CMLA 5JEDA 3G9XA 5THKA 2LW7A 3HY4A 4RSHA 2FXIA 3RW9A 1YQWA 4OX9Y 2AXNA 3C0KA 2C04A 2IEZA 1TM7E 2VP6A 4YUZA 1W4AA 1GD1O 1G2IA 2CE2X 3OIWA 4PAGA 5AHXA 2B69A 5CVUA 2FUKA 4NTZA 1BAPA 4PINA 4ZDIA 3OIFA 4C07A 3ZX5A 2I76A 4A6PA 2AJ8A 1XZIA 1IATA 2JH3A 1TQHA 2Z5VA 1X6VA 2HK8A 3R9IA 1DE0A 1G38A 3PI6A 2JGJA 4BTEA 3TI7A 1GQSA 3VO1A 4X6LA 2EQAA 1PK7A 2DQZA 3N6XA 1Y1SA 3R3YA 4QDKA 2OWDA 2GUWA 4JQYA 4W4TA 3UJAA 3GLKA 1UMDB 1U2DA 4M0CA 4F7DA 4AKIA 5CJ2A 3A9WA 4YJFA 1WTAA 3PEUA 5JD5A 1DIAA 3TI9A 1A82A 5GGXA 4BJ5A 3TUZC 4HQFA 1C0EA 3K96A 1A95A 1J5PA 3HUDA 5C1OA 3D2BA 3KEOA 4RSGA 2ATVA 3RTDA 3L0SA 2Z6AA 5FNZA 4MWGA 4PCLA 2I71A 4QFDA 1KDYA 3IQIX 1JXOA 1VL8A 4EY3A 5CFZA 3SXPA 1DEXA 1PR5A 3E9CA 3S1AB 1EX6A 2O07A 1EE9A 2PUVA 5AD1A 5KNBH 1BRMA 2XTAA 4GKJB 2O8VA 3SVZA 4CL3A 4ENTA 3OTIA 2CXHA 1JG7A 3QKWA 1VJGA 3RF7A 1D2RA 2FVYA 3AU8A 4JOQA 3AV0B 1Z5WA 2J9YB 4LDZA 1IUPA 4R84A 1JECA 4JAVC 2DQKA 1YRBA 2D7JA 3DZIA 3FH0A 1QF7A 1TF5A 4EHAA 2D3TA 2LKDA 2VHTA 1P3DA 2REOA 3AM4A 4QD3A 3ERCA 2C59A 4O29A 1VLVA 4B6GA 4PG6A 1VSBA 2P3QA 2P9FA 3ZS9A 4GI5A 4NCHA 4EHFA 2ISQA 4ALMA 2H0AA 1BOOA 1XJWA 2VUIB 3K92A 4G56A 1ZVKA 4L08A 2ONJA 3LK6A 4YMVA 4LOJA 2C8VA 3QZUA 4KR3A 1GZ6A 1NUAA 3WDSA 1CVIA 3CIOA 3TPCA 4ZOQI 4NIMA 2PKQO 2W70A 4EYOA 2PTHA 3BRCA 1P7ZA 1Y6FA 4AZ3A 1ZK1A 3ORYA 3OPYA 1XP8A 1YR7A 1U90A 3BWCA 3DT9A 3O74A 4CMIB 1XRMA 3AWIA 4HWTA 4DWJA 3VSBA 2XXAA 1LNQA 1TYBE 3PFKA 2ZRMA 1DIOB 4Y6QA 1X7XB 1IY2A 3ZY4A 1QVZA 4BUZA 4MWBA 4F3YA 5HJ5A 3LHDA 5CT8A 2G67A 3DE4X 2BFPA 3KSUA 2FEMA 1YZ3A 2GHRA 3B6MA 1NVTA 3HZHA 1FY2A 4ND7A 2FKAA 3SNKA 4Z7OB 5AM3A 4XIIA 3A1VA 4LYJA 1TCBA 4OLJA 4DXDA 4W7IA 3GLGB 1M10A 2WWXA 3P9PA 4DC0A 4YBRA 4EG8A 3AM3A 1KVUA 3P19A 1UOOA 1THTA 1XTUA 2OD2A 1UDXA 1VYUA 2ZYWX 3O1IC 3QRWA 4TUYB 5CCXA 1V5GA 2OT3B 4Q00A 4Z9AA 3SEZA 3U49A 5J2UB 2NPIA 1QYRA 3NIFB 4UQLA 1O77A 3OLXA 2G8LA 4QOHA 3BQNB 2PLWA 4Z86A 5JDIC 1W2GA 4JYZA 1JKFA 1XALA 3GU3A 4K88A 4C30A 4ER0A 2Z8ZA 1AMNA 3WOVA 4TM8A 1LLUA 3VJKA 2V59A 1JAIA 2D2XA 4WCFA 3U4QA 2C42A 3OPQA 3OIDA 1YQTA 4C5CA 2GM5A 4AN0A 3EQ2A 5C32A 5KAPA 5T57A 4PBSA 3BMNA 2JLSA 1UXJA 3L7MA 1RWVA 5DSXA 1FTWA 3F4BA 3L8CA 1Q74A 1LW6E 5JOQA 3DMTA 2BN4A 4DB2A 2GZHA 2B1RA 3MWDA 3PXDA 2GUGA 4I46A 2JKZA 2VRNA 3GBSA 4PXSA 2W9XA 4U9UA 4WUVA 4KXLA 5EEGA 1PX0A 3VDNB 1EFCA 2Y0PA 2A86A 5E9QA 1AUPA 4U2EA 4C0LA 5AQEA 2QAGC 3M1IA 1KJWA 5CG2A 3NG1A 1BHO1 2F3QA 1SVIA 1RAEA 3B1JA 3D2AA 4QXAA 4TLBA 3H2ZA 1AHPA 3KUXA 2ZQZA 3F7MA 4RE5A 4TT3A 5KTTA 4RTKA 5DBFA 3T7IA 5GMOA 3ND7A 3P0HA 4IGAA 3QG1A 4K81B 4Q47A 5DB4A 1PRYA 1FPMA 2NV0A 1X1AA 4AJ9A 1JDJA 1S7GA 4N12A 1JEQB 4C5AA 2I8CA 3PXEA 2IYPA 2BTEA 4G81A 1KK2A 1UPBA 5FKJA 3ZVRA 4B3DA 1E3DA 2O52A 5KVQA 4B73A 5BSVA 1E9RA 2QT0A 4HAXA 1ZLXA 4W5NA 2L0XA 4RHTA 1NUHA 4D9GA 5LU9A 3OUTA 1T5IA 5AHWA 1MQAA 5FPTA 2PPLA 3Q41A 3ST7A 2FW8A 5LP6B 3HVRA 1NUTA 3OE7D 3HLTA 4OAOA 5A4KA 1PJ2A 1YU9A 5KJCA 4XFKA 1KZ4A 4HEJA 2FY8A 1Z2AA 1EBFA 3UKDA 2ZBDA 3FZEA 3NUGA 4QEZA 2B1JA 2ZBVA 4UD2A 1IQUA 1OW3B 4MPRA 1MJ5A 1UZNA 1AGXA 3U3OA 1QIDA 3UB3A 3QVUA 2JBHA 2CXRA 3TLAA 1J9EA 4RMIA 3IESA 4JC5A 4J90A 4KBYA 4JJFA 3FOFC 2A1TS 4Z53A 1RWMA 2X86A 2NVOA 2P5TB 1D03A 1TVKB 3N28A 4XOUA 1GTJ1 3GK3A 4JLVA 5JCJD 3KPYA 3A2MA 2PQ2A 4EFNA 1XMVA 2R84A 2MOKA 1QXSA 1Z0IA 5LC1A 5IWAB 1WY5A 4QQNA 1NC3A 3NEAA 3PVSA 3HJAA 1WPXA 4M0DA 4N6GA 1HETA 2C2BA 2J9FB 2QM0A 3CC8A 3EOAI 3O8DA 1C0KA 5JCOC 1DSSG 1GPH1 2JK0A 2ZT8A 3BCHA 1M1NB 2XNDA 4LN1A 4B45A 1SJ9A 4HBZA 2D0PB 4NZOA 5TQ2A 1KJJA 1NU6A 1UFRA 1L0BA 2Q1WA 2Y92A 1U5CA 4MKXA 4ZV7A 1ODCA 6NULA 3GPBA 3JAWB 2SNIE 4Y7DA 1DU4A 2QZJA 1T9DA 4GP7A 4ZAXA 5KVCA 3THXB 2CDNA 2Y1EA 4II7A 2QVYX 3PICA 2VT7A 4W6QA 1H8ED 4LGYA 3UWSA 2ESRA 2XCUA 5EY5B 4JI0B 1J5XA 2PSFA 2J5XA 3IT0A 1Z9BA 2R8RA 3OSUA 4YMHA 3UXHA 1QIHA 1ECBA 4KSBA 5F1OA 5K0LA 2HF8A 3ESAA 4YJ3A 2DCMA 5IK2A 4BB9A 3QFCA 4QICA 2CT8A 2C3MA 2IC5A 4B4DA 2GTPA 1MB9A 1O0SA 3SMQA 5J2TB 1XTPA 3KB6A 4WN3A 1GHTA 2X2EA 2X76A 1PDOA 2O1WA 5K3CA 3TW8B 4BLUA 2ZI6A 5LA6B 1TJPB 2VJOA 3RRBA 3SIRA 2D5CA 3P20A 3U48A 5CB0A 1EUQA 4HTFA 3UOGA 1N7JA 2QLFA 4FOTA 1XNRB 5HKKD 2I4LA 4YRBA 3MWGA 2JFXA 3CNLA 1FBTA 3CEHA 3Q2IA 4WX2B 5ALQA 4ETNA 5DGHA 3H1FA 1ZH8A 1BC5A 2QVZX 1TADA 4QULA 4ZT3A 5K3FB 5M04A 2O5VA 1ZN8A 1COWD 4CCYB 2GK3A 2WUDA 3M6FA 2AE1A 2VJPA 2GEKA 1KQNA 2X19A 1U6JA 1ZUD1 5JBIA 3EZNA 2O5CA 1PG0A 1VHQA 4RPLA 5FI1B 1YRWA 3MCTA 3OQ1A 4US1R 2VI5A 3MN1A 4N39A 3ZHVA 3HR8A 3VVMA 3A6PC 4UCWA 1WEKA 1NQ5A 4YRNA 3WO0A 4LNUB 2XRZA 1O03A 1CZUA 1NQTA 4YP1A 5EP3A 2OKCA 1JSRA 3RE1A 4EEXA 4RV9A 3ANNA 3FLMA 1E66A 4N5NA 4TL8A 2IYNA 2PM8A 3KXLA 3K1AB 4G5RA 4PO1A 5K8TA 2H31A 4GM0A 2O3TA 3JATB 2OB2A 2IXTA 2X6TA 3DWFA 4XGQA 5AIAA 4DQUA 4AZVA 3LDUA 4NF2A 3Q3JB 5I3CA 1NE2A 4D8TA 2QY9A 4OIFA 2JGNA 1XMIA 2R25B 4KC0A 3HZOA 4OHWA 1USGA 4U3JA 3SYLA 4EZIA 5B7QA 3UT6A 1Y33E 5FORA 1XMQB 1G3RA 3ZXUB 2J9GA 4H27A 2Q3DA 3VUFA 1VCHA 3K31A 4WUTA 4EQ6A 1DP4A 2FUCA 4PLYA 4UZSA 3KV1A 3KEFA 4TXMA 1E7RA 2DBYA 2VHEA 1X3SA 2XMPA 3H18A 4CKBB 3FBGA 2Z5FA 2QM8A 1E7QA 1IHXA 1MRZA 3DD5A 3F6RA 3QHPA 2GJ4A 3KQWA 2H6EA 4J0KA 4LJAA 4YHBA 2BYTA 3OU7A 1BJKA 3G2LA 3KV3O 3AHEA 1QHIA 3K1TA 4OL0A 3WFJA 5BQ3A 4YCJA 4NQRA 4DGSA 1YL7A 1QKJA 2HPAA 4MRNA 1RADA 2RGXA 1CQIB 1USUA 2AHRA 3CSDA 4RKWA 4UHFA 2CLOB 4RH0A 2MU1A 4ZDJA 1OYOA 3KIPA 4I1YA 3C1OA 4IFTA 4O4JB 1AUVA 2HMSA 3UAOA 5ECGC 2LP4Y 3AKZA 4A8JC 3DE0X 3ZKWA 3X1DA 4RMJA 2W6NA 2POCA 1MZVA 2PRSA 3II6X 2O2GA 4TGLA 4WADA 1EGAA 1JR2A 3ZWOA 3TJRA 3FCEA 1SC1A 2RB4A 3PUYA 1QU2A 2CHGA 3TIIA 3CO0S 1UBSB 3V7FA 3WGHA 3NASA 4M86A 5COAA 1QGAA 1SUIA 2ASVA 3P5BA 3WJ7A 4CMJA 8AT1A 1IUOA 1B14A 2Q8NA 4DLUA 1BEUB 3UAXA 2RHRA 5C9ZA 1WQ3A 4MZDA 1VG1A 4H6WA 4JLDA 4QXPA 1SVSA 5FJIA 1GQFA 3FG9A 1KERA 2MDTA 2XT0A 1QH8B 2YCBA 3R3SA 2Q4BA 1T1EA 1H65A 1O2DA 3FN4A 4LMAA 4TMYA 2MSLA 2DG2A 1ADCA 3FOWA 4K5QA 2IDJA 1PZFA 1Y5RA 2ZK7A 4N8SA 4P08A 1CR0A 2CJYA 3QVJA 3AWDA 4NABA 5KYKA 2VQFB 4DJFC 1ENZA 2OFPA 5K99A 1QONA 5TT1A 3G9ZA 1K7EB 1YB2A 3EVGA 1DT3A 5KC8A 1X1TA 4LHVA 2HU2A 1PG2A 2R6R1 2R85A 3EULA 5SZIA 4M22A 1R0CA 4EEZA 1ZVMA 5CITA 1W35A 4HC4A 5HJ2A 1QRUA 2VC2B 2WSLA 4TKVA 3O2NA 3F8TA 3H9BA 3LDAA 1E98A 4RD2A 1GN8A 4WBNA 5CLGA 2YYYA 3EBOA 3NC1C 4EK9A 1QZUA 2QT9A 1XZKA 2GAOA 4AIRA 4MGHA 3NR2A 5CT9A 1F0PA 1MO6A 1O6BA 1JSZA 2RDMA 2QN7A 3BFPA 3F2VA 1EX1A 3HKCB 5B3LA 1DDGA 5BUCA 1R66A 1FDUA 1JU4A 3PXCX 3OPYB 1M67A 1EP2B 4R1PA 3M3HA 2GBCA 3B5JA 1UXGA 3RUCA 3MHPA 1RJDA 4FFMA 1DKOA 3R40A 1U0SY 1HPLA 3A31A 3H4TA 4KAFA 2HQRA 1I7NA 2JIZD 2WWVD 2OMEA 4V2IA 5A5EA 4NCKA 1LTKA 1WZ2A 1DCFA 4OGLA 2I2BA 4AQYB 4HR7A 4RHCA 1MUUA 4YYEA 2GM3A 5EZQA 2GAFA 3X44A 5KJFA 2O4UX 1M74A 4OI4A 2PXXA 4OP1A 1S5PA 4BBAA 3O0TA 4JZKA 4C5BA 4NYIR 1JEQA 3U3XA 3GLGA 3RU9A 2XIQA 1Z83A 2A2ZA 3NQ41 1OT5A 2MSKA 2A6PA 3DBOB 4IDFA 3TQIA 3OCYA 3UK1A 2BFMA 2X8BA 1NQOA 3QNMA 4C1BA 5JC1A 1GZ3A 1PE0A 2P0AA 3DVLA 5CVCA 4Q4DA 1FUIA 3HB7A 2QRVA 5G1OA 3LE8A 5HF5A 2DF8A 3OMWA 1A8SA 1F0KA 3L4KA 3GLHB 2H08A 3OWXA 5FWXA 4S3MA 4MIEA 4QHTA 3B3GA 1JAXA 3ZE8A 4H7KA 4KYVA 1HO3A 4Q1AA 1ZKDA 2G0AA 3K2EA 4MMYB 1QMPA 1I0ZA 5LU8A 2ZS8A 2IHTA 2W5UA 3BHJA 5GTDA 3IKJA 4I55A 1D7OA 1MQ8B 2RK3A 3HCNA 2J45A 3M2TA 4IH4A 1BU5A 5EIFA 4MHSA 1VXRA 5SY6A 1UPXA 6GPBA 1VI2A 1KVTA 4AIIA 2GYWA 1AC5A 3IAM6 2H2IA 3AY7A 3BFJA 4B6SA 4CG2A 1YIAA 2C9DA 1UBMS 2E5FA 2P9JA 3P9YA 4J07A 5DXAA 5B1HA 4ZHQF 1L3BA 3O84A 4XD2A 3ZOKA 1V1JA 2OR3A 3LGXA 1SU8A 1WD5A 2X9LA 1K4YA 1QRTA 1IHUA 2I4TA 1XRJA 3VSEA 1UR5A 2G04A 1ZNYA 2O2JA 5A4DA 2W2MA 1HRKA 3JV7A 4LC1A 5AKGA 2B1IA 1J0EA 4TV9B 4FBGA 1E1RD 1JEDA 3ZV5A 3I0ZA 2V7XA 1O57A 2BSXA 3D7KA 1YTLA 2XNKA 4KO3S 3KSAC 3FTNA 2EL9A 4OUDA 2FP3A 3M7IA 1P6XA 2HCTA 1YMQA 2Q5CA 2CHEA 4QFCA 1KETA 4TQUS 3OEWA 4GPTA 4ZHQB 2O2EA 3FGPA 5F76A 3SHVA 3P9CA 2QV0A 5JSQA 3MTDA 3LQRA 3ZWYA 1A5TA 1CS4C 3MJHA 2X0IA 4ECAA 2RC5A 1JR3D 4R0VA 2AN4A 4WI1A 3V2UA 4PS1A 3QXCA 2R11A 4LC9A 3G8CA 3BRWD 4QVKA 4HGOA 1NXOA 4DYDA 4YCCA 3IR6A 4UQPA 2VQEB 2AA3A 1SBZA 3C87A 3OJXA 4ZIRA 3O8RA 3TMKA 4FD3A 4OHXA 1XCGB 1YCDA 1GQYA 2H07A 4BFZA 1ZAKA 4FE3A 2PJRA 3R24A 4BO8A 3DWGA 3ZH2A 2IS6A 5M34A 1W5TA 3R7AA 4E1BA 1TYCA 4BCDA 2RMKA 2FX5A 4GT1A 4KE7A 2YJ6A 1RYEA 4ZANA 3H2BA 4KQWA 1PSDA 4TSKA 3RVQA 3GPLA 4X3PA 1XD8A 1JE1A 4W1QA 3C8DA 4GX0A 4R69A 5K3FA 3GT0A 4ZV4A 1OR8A 5CYOA 4B34A 1D2MA 1I94B 4C6SA 5EMHA 4BX2A 1ABBA 3GDOA 3PFIA 5CM2Z 3ID6C 3KPWA 3LRPA 4MCJA 4UEJA 3U56A 3BGOS 5KNDH 1AOXA 4YP0A 4Z3OA 2HA0A 3UUFA 4EB3A 4WGGA 1L8XA 5U4QA 2RGNC 4BGDA 1YE3A 2IP2A 1HFWA 1I14A 2J32A 2L69A 3G2QA 4GLJA 4M9RA 4E5MA 1D2AA 2WB4A 3EB9A 3ITDA 4FZ5A 4G4GA 2IKSA 1FP2A 1X13A 1E0DA 3JAWA 3ZJ5A 2A5JA 3SM3A 1I7LA 4TWBA 5H5JA 3GO4A 3FPAA 3FI0A 4ZOLA 2BDTA 2HA5A 1PNTA 2JFBA 3EVEA 1N9GA 5A9TA 3UMJA 2J33A 1P0QA 2A0WA 3CLRD 5HTOA 1DMSA 4EHBA 4EQZA 1V8ZA 1PYGA 1GZ7A 4F06A 4B6RA 2O3RA 5JASA 2ZIZA 2BEJA 1DAMA 1Q22A 1G42A 4OAPA 4U7HA 1MJFA 4WFKA 2WU4A 3KFXA 4KO2S 1JEOA 2G5TA 2VDUE 4XIYA 4OF4A 1A9SA 1IJFA 1IG0A 4WKOA 5CK5A 5F2OA 5C8DA 3WWZA 4HVAA 1CKEA 1ZHHA 2JLVA 3FHCB 2IYTA 2UYCA 4XPZA 2V55B 1VXOA 2C3PA 2JHFA 5SZJA 3TAUA 3GLFB 3OQHA 4KDCA 4KRGA 2XMGA 5AM5A 4MVJE 1RWPA 5FTMA 1G66A 5EJEA 1E58A 1L8LA 3DKPA 1XD9A 4ESVA 1A4RA 1MAAA 4KI7A 4W7HA 2BMWA 1Z0UA 2DUJA 2AFIA 1IUNA 2EHJA 1V37A 1J9ZA 1Z33A 3PR1A 1AKMA 1CY8A 4I8DA 1YZKA 4RMNA 3UK0A 1QX3A 1EGHA 3HDVA 4D9JA 5IF3A 3QVKA 5JZOA 2WIDA 2XQGA 5JSKA 2BKLA 2OCGA 2RAPA 3WLTA 1ZUWA 4WMLA 3IUQA 3V32A 2Y1WA 4TX1A 4RBNA 3RH0A 2YWXA 4AJ4A 4HFRA 3AG5A 1W46A 4J2HA 4US2R 1DOHA 2X42A 1GL7A 3NORA 1G17A 3RC1A 4NU5A 2I22A 3QJGA 2DLCX 4KZPA 1Z16A 4UAGA 2BBSA 5BQPA 3RV3A 4D82A 4KBFA 2QZ9A 1EE1A 1VL5A 5LL6P 1PR0A 2WINI 2X15A 3JWHA 4JT2A 4V39A 1EFVB 2XF8A 4ZT6A 3FFBA 3T9DA 4CPDA 2JF0A 1NMEA 3M2PA 4CKZA 1UKYA 2HDNB 3T99A 3OIGA 3WI7A 4CT5A 4RTSA 2GXUA 1ORRA 1Z82A 4QA9A 2OM2A 1YQQA 4GQBA 3KLOA 4LY0A 3FCOA 4E2WA 3VC2A 4GWKA 1RFGE 1NX9A 4L3VA 4DJEC 5CA1B 1QH8A 4LX0A 4XQEA 1NXQA 2CKDA 2WD8A 1TM5E 4OQLA 3GLTA 4F7WA 4YRCA 3KO8A 1IZZA 1B76A 2PL1A 2AR9A 2XBLA 2VHJA 1M2OA 4R3UC 2XSZA 1UC5B 5D3KA 5BSMA 4FMBB 3H1BA 1KSHA 1EFUA 4WOJA 2XCRB 1D2GA 2YZNA 1SPBS 4U6NA 4JELA 4EELA 4MV3A 3EXEB 1JKMA 4KMOA 4DR1B 4KDFA 1P7PA 3MLEA 1K3UB 4LQ4A 5ALGA 4AFNA 1F2UA 2GPJA 2YL2A 3L1IA 4YTEA 3CQ9A 3DM9B 4YGYA 3A6KA 3BL8A 2WT8A 1U4SA 4CHTA 2PUDA 4QPCA 1P9WA 4XJSA 5PNTA 3TLEA 3VNAA 5M29A 1S2DA 1DPFA 4CV3A 1Y5IA 3IVRA 1ZY2A 3BL5A 4PO9A 3PGLA 4NDAA 3O95A 3R74A 3SS9X 4HUQA 4O2AB 4QOEA 1UC9A 1TTQB 2BKEA 4O2RA 1JKJB 3WGOA 4EGAA 2VNSA 2PG3A 3ASVA 4QO7A 2QN3A 3B6KA 2GYYA 5CPBA 1YHZA 2TMKA 1CRZA 1QQBA 1KO4A 4D9IA 4WD3A 3TTXA 1M1XB 1Y89A 5BYBA 4E6PA 4RFSB 3JR3A 1B00A 1UKEA 2R5WA 2CKMA 4INAA 4N3NA 4UUBA 1U5BA 4F9TA 1AB6A 1M0SA 2V5UA 2NZ2A 3TSWA 1I6WA 2QP3A 3KR2A 4PZLA 1YZFA 5DHTA 1LDBA 4M83A 1ATIA 3V4PB 5HK8A 4B6EA 3HEBA 4V0OA 2DHQA 3ZWWA 2QL7A 4ZHSA 3MMXA 3L02A 1VKNA 2ERYA 2Y1GA 4EPXA 1OB2A 3D8NA 2CVQA 2OHGA 3PUXA 3ROXA 3IEKA 4Z1OA 1W6RA 2PZFA 3MQ2A 2CB9A 4R1SA 4Y3UA 4ZC1A 4ASUA 4BP9A 1X7HA 3S55A 4ZQCB 2D1SA 3EQ7A 4ZYVA 3RUFA 2YIVX 2CV2A 1V4VA 1SHTX 1GEGA 3CONA 1NR1A 4Y2GA 4UU0A 2I6QA 2VOEA 4DV4B 3NUZA 4OKIA 4IRUB 3SZUA 2QZSA 1YS4A 2DUNA 2Z2YA 3JY6A 2XUGA 3NI2A 1M2WA 4PZ9A 1JLKA 1PJRA 4HEHA 2IZ5A 2XVAA 4WTOA 4ZEWA 4EX7A 4DLWA 2PV0A 4JUIA 3B3FA 3AL0C 2FVXA 2ZJ7A 2UXCB 4OHZA 3NDRA 4Q18A 5H9WA 2NOAA 3URKA 1EGVB 3VTAA 4AQDA 4AN4A 3HP1A 1RJFA 3WZMA 3E9QA 2JGIA 4WPGA 2HI0A 3HKCA 1JG4A 3RHFA 4B5LA 4RH3A 1FSGA 4ZI3A 2I29A 2YC2C 1F8YA 1PZNA 1JYEA 3K09A 3Q8XB 1D4ZA 3BXOA 4CUJA 2NQTA 3KJHA 1T13A 2X5OA 4XPIB 4AK9A 1OJLA 4BMOB 3KZCA 4EFKA 2H06A 5ED4A 3IA2A 1ORHA 3HJGA 4YJ2A 3TTVA 3TRJA 2PEYA 2PJUA 3ICVA 1E6WA 3KL2A 4G5OA 3RUDA 4F9EA 2DMRA 5I9NA 1QO9A 2I80A 1U6IA 3G2NA 2HJWA 4K28A 4PFQA 1YVDA 1JAYA 1Y4UA 4ER6A 4YUWA 1S4QA 4Q3DA 1G18A 4DILA 5IS2A 5IP5A 2YIDA 4YASA 3T7RA 1GJRA 2YV4A 1XAIA 5D84A 4K0KB 1FP7A 2ZYSA 5E2AA 4UM7A 3M5WA 4WLNA 2HV9A 3WB2A 3Q8KA 1KJNA 4PLFA 3EZFA 1XLWA 5LZ9A 1G3QA 2PUJA 5A4IS 4M0UA 1CERA 1WE2A 3CFYA 1L5VA 4MYRA 3GH1A 4QGBA 1NTRA 4WXHA 5F33A 1SXIA 2PEZA 4RCZA 2FMKA 2P9QA 3IQWA 4IQ8A 1Q7BA 4EHKA 1SQ0A 2HLPA 1AUXA 2H85A 3BBPA 3WYAA 4BO9A 4UEQA 3F4LA 3DV0A 3GVPA 1CY0A 3HWWA 3P4YA 1CFZA 1R9JA 3R6DA 4LWPA 3WB1A 4L75A 1Y3DE 1HNWB 2WYHA 4IOLA 4FS3A 1LPNA 2EJCA 3QBVA 2ZYGA 4M8IA 4C0AC 2I4RA 3HXPA 1RHQA 1LSUA 3OBBA 3N70A 1N6KA 5JHGB 3NNDA 5CEJA 4Q3BA 4C43A 3Q85A 2ZT6A 5JMPA 3IAEA 5CFLA 4OQZA 4EW3A 5KTYA 3MRSA 3LKVA 1M54A 5E1BA 4ZYLA 1GGFA 5DHAA 3FI9A 2WKWA 4MA4A 5JAHA 1A69A 1FCJA 1HNNA 1RE0A 3A8TA 5HIMA 2X13A 4NE7A 1C0IA 2I6GA 3T95A 4YPVA 3OIVA 2EBFX 3N5CA 3ETGA 3U5TA 4DQVA 4KXMA 2SCUB 3ZCTA 1MEJA 3DJFA 4X93A 5AOCA 4S12A 2YJZA 1SOWA 1JQDA 3PYMA 3JTMA 2C95A 2IDMA 4AB1A 3NHRA 4D80A 1JJFA 5A6SB 2ZUTA 4D44A 4DHWA 4CIBA 2XGSA 3BCSA 4FNAA 1JR3E 5AQ1A 4RDCA 3QE9Y 3QP9A 1ZESA 4Q4AB 3IODA 3EA5A 3ROQA 2F8TA 2UU9B 3UJ7A 4BECA 5BY2A 4LFCB 3U3KA 5HF9A 1IQRA 1JIUA 2VP5A 1RR6A 2CFTA 3UATA 1S3GA 4BKRA 4WAUA 2PUAA 3R7WA 3RVMA 4QGGA 1YKGA 3GP3A 3QW4B 4QEDA 1YQ9A 1RSZA 3SX4A 1SUSA 1W34A 3FXAA 1E0AA 1HC7A 3AERA 3PFFA 2EZTA 3QPDA 4HD8A 5CU7A 3FCCA 3LBFA 3KHUA 1BU8A 3RYFB 4KGVA 3SC2A 1A5SB 2WD9A 2YVKA 3VU0A 3WGZA 3CPEA 4IIXA 1MGOA 4MVJG 4F4FA 1VE6A 3AJEA 1YULA 4ZCMA 4BOYA 5GIOE 1DO0A 1EZZA 2IDKA 2JFUA 2VYNA 4OFBA 4RYLA 1ENPA 2CLLB 1RWQA 4YJHB 4BFLA 3WL5A 1JLLB 1JVBA 1FRQA 1O9GA 3I23A 4R71A 3DAFA 3WYEA 1NN3A 5TPWB 1GNTA 1QHNA 1XF9A 2RGEA 4TMWA 4WFJA 1F06A 2Q6IA 3PFCA 4UFOA 2VXYA 3MJDA 2NM0A 1P5HA 4N7MA 5ENVA 5HBGA 2FMHA 1RCTE 1ZNWA 2CNBA 2OESA 3TOZA 2HF2A 1G6Q1 13PKA 4KFRA 2EP7A 4IIFA 1GUZA 3DWIA 2HA2A 2R1UA 3MZ0A 2FN7A 4GI2A 3FKQA 4GVPA 4UU7A 4XM2A 5BPHA 3CUKA 5KJEA 4KVGA 1Q0TA 3H83A 2ZRGA 4HWSA 3T7JA 3H4IA 3C5CA 2GTHA 1PIWA 3B53X 1AQIA 3F46A 2CXNA 3OH8A 4I8XA 4B17A 1N9GB 3I01M 2R6JA 3CUVA 3PDWA 3I3SR 4OFZA 3W5VA 3F98A 1LV8A 1UWCA 4GPAA 4RNDB 3FTCA 2G9ZA 4DCMA 3B9QA 5LZ4A 2WWRA 2JPDA 2Q9CA 1DXHA 4CM6A 2IW3A 3HA2A 4YS6A 1QZ3A 2I99A 4FP9A 5JSYA 4UFPA 1HNXB 5BSGA 5EJ6A 1MXFA 2FG6C 4R83A 9GPBA 1KWGA 3VR6A 2EEZA 2J9XB 1N33B 1CP3A 1TCUA 1TCCA 3D4PA 2P2CA 3H7AA 5DLQC 3TZCA 1O6FA 3H75A 4B31A 5AVJA 2WNHA 1ONBA 5I8WA 1TAGA 3A3KA 1WXHA 3GMSA 5J4LA 3S44A 1IU9A 1IB6A 1SQ6A 3LIIA 3G6KA 4PV7A 3MSXA 1P2GA 3UH0A 5F7XA 3AVXA 4MI9A 3MWEA 4R2XA 1DELA 1NBHA 5EESA 4OH7A 2QVCA 4BL5A 4CFSA 1TQ6A 2IOHA 2JEZA 4UCFA 4DSNA 1Z7YA 2E1RA 4LF5B 1SB9A 3G2PA 1TOAA 4JOCA 3MIZA 4L9WA 4ZU3A 4QAJA 3W9YA 2NO1A 2PKQP 3WKAA 3ZW8A 4DMMA 1KDOA 1ZM3A 5ITZB 4KRYA 3KZ1E 3O38A 4AP9A 4BE4A 4URZR 1NKTA 1P6QA 1S3FA 1Z45A 3B6EA 5K4AA 1JKJA 3MJ4A 3S8MA 5P21A 1QQTA 3VR1A 2FGKA 3FUXA 3LX8A 2QX6A 2WJJA 3QV1A 4I5IA 5IX8A 5CT6A 4N48A 1H3FA 1KPGA 2W2TA 4CFZA 3MS4A 4N54A 5CLJA 3PNSA 4V1CA 1G59A 1VI6A 2R4QA 4FN4A 3U3ZA 4MUMA 4UUMA 3WV5A 4D46A 3VISA 3ABOB 4QBFA 4J0JA 1O8BA 4MKHA 3KNZA 1ODKA 1NZJA 1V3QE 4KX3A 4AO6A 1ZCFA 3VYRB 5KDDA 1GN9A 1Q84A 1COZA 2HPVA 1QRRA 3EEFA 1HL3A 3I9LA 3ADCA 4YBZA 4HLCA 3BF8A 3A58B 2H54A 3OIUA 1U8TA 1GZSA 1E5TA 1KIFA 1R0ZA 2EBWA 1QAMA 2GXSA 1IB0A 1IEWA 4QC2A 2G08A 4E88A 2FPIB 1XRRA 3QF4B 1BEZA 4X95A 5F4BA 4TTQA 2ZJZA 3NLLA 4G0XA 5DYIA 2BMVA 1LBQA 2HREA 1V8FA 2BFNA 5HKBA 1TQ4A 3M8KA 5EE9A 1C8LA 4JJ4A 4DGQA 2Z56A 1T5DX 5B4TA 1MA0A 3RUHA 2YWCA 4QAQA 5CFPA 1G1MA 3M9XA 4DCUA 3G49A 4LNAA 5AJUA 3ANYB 2WZDA 3RU7A 1Z4MA 1DG1G 1V6AA 3DVQX 1W2HA 1WV1A 4GWLA 4N03A 3W5SA 3WWEA 1MJGA 4YY3B 1GAQA 3CPJB 2QTBA 3COYA 1XRLA 3F7OA 3M4NA 3QTLA 2Z4RA 5L3SA 1B8OA 2Y1LA 3HA7A 3D3EA 5HNKA 3V4LA 2HBQA 5JQWA 1N7IA 4YMIA 3G2JA 1HI9A 3KOOA 3OD1A 7ADHA 1JQJC 3GGOA 1T2NA 5LUBA 3MGGA 4JYBA 1GAXA 2O19A 4DEXA 3R0JA 1Z6PA 4AVYA 1OLOA 2WWGA 3I8SA 4GW3A 1ZJ6A 5D3MB 1DZIA 4ZEMA 5IW8A 4D43A 4JSYA 3QLVC 2UVDA 4DARA 3NVKI 4I3GA 4NAHA 4XGRA 4QL3A 1DNPA 4LDAA 1KSJA 1IM2A 2JAWA 5A5VA 4X92A 2COKA 1TRKA 5BN3B 3ZDCA 3FVVA 1SBIA 1UM9A 5KSWB 4Q3KA 1T1JA 4KXUA 4PYNA 4YC7A 1JQLB 3AUXA 4W6ZA 4NV1A 4RWZA 2VKQA 3U60B 3LUBA 1YS2X 4UW9A 2P30A 5EKTA 2RGBA 1E64A 4COKA 4RDXA 2H2AA 1PQYA 2HMWA 1FUYB 5DKFA 3ZBUA 3G79A 4DZZA 4F85A 4B74A 5JRDS 5KX5A 3WDLA 2HCBA 5T4EA 3VR6H 5KMGA 1NWCA 2CXPA 1VFPA 1P60A 2WYWA 1IPHA 2YHIB 1K6MA 1MW9X 1SXJE 2YW2A 3TBKA 3WLFA 4C6HA 1FMJA 1WM1A 2A3NA 3B8EA 4QO8A 2MR5A 1IY8A 4LY9A 4MR8B 3RK4A 4RETA 3LT5A 4DMFA 5K3EA 2YWDA 1FMFA 4OOFA 2B30A 3IUYA 1H4SA 3AIOA 4QARA 3ZCUA 2F1HA 5HZKA 2OY0A 2AXQA 4QTXA 3HYLA 1GZDA 2JCYA 2IYSA 1MCZA 5MFZA 1EGMB 1ND5A 3VR5A 4LZNA 1MBZA 4YXFA 4HADA 1KXZA 1Y82A 2CDCA 3G2MA 1M5TA 3EPJA 2I6TA 4MX8A 1GUFA 3PHHA 1WKBA 5JMOA 2NO0A 4U9IS 1CG6A 4FQ5A 4KWTA 4MWSA 5IVHA 1E2LA 5EL0A 3BWMA 1GFZA 4A0FA 4DZRA 5A06A 1E4OA 2H59A 4RVHA 3WGTA 8GPBA 1FUKA 1U3DA 1XU4A 5CM8B 1NVDA 3STXA 2SCUA 3P4UA 3CPSA 4GDMA 3VV2A 1X8KA 3WLOA 4YREA 1C7FA 1TF7A 1QTRA 1SVOA 1Z13A 2P2DA 3M33A 3PHJA 4TTAA 4QUIA 1CUVA 5E9AA 3ZTTA 1J2RA 5CDHA 5A02A 2ON6A 5KTNA 3SQXA 1OFGA 1G8GA 1WX1A 1Z0KA 4YXWA 2ACEA 2VLBA 2WR8A 1W0CA 1E2PA 1ODLA 1N2BA 2O3UA 2XD4A 3RJ9A 4DQ0A 5K45A 1KMQA 1VBKA 3RRMA 1HRDA 4CLHA 5E9JA 4UTRA 5ICGA 4KR6A 4KV7A 2A5GA 2L18A 1HMYA 2VDRB 2XH8A 3CKKA 1P62B 1SXHA 2HU7A 4TXHA 4F3KA 2ACWA 3CM0A 4MPTA 1PR4A 3A1TA 3KU1A 4I7EA 2D8MA 1IXRC 3L2OB 3IMCA 4L9AA 4PZAA 1DWQA 3ZU4A 2EL7A 3QW2A 4QBKA 3QBEA 4XX0A 3WZ2A 2AFRA 4X85A 4UTVA 2H4JA 1WQ1R 3I04A 4I4CA 1WLYA 3UXEA 5LFAA 1CUGA 4GNRA 4R8VA 5HJEA 2BPOA 3RRZA 2FFJA 1L4KA 2QJOA 4JV5B 5BW4A 1HOTA 2E4AA 1E4YA 1Z5GA 2GDZA 4EL0A 1YI0A 1KH2A 3KKQA 3UJBA 3B89A 4Z99A 2I2CA 3DBHB 1OB5A 5C0OE 4CR7A 3N3BC 3ZWMA 1AT1A 1Y6QA 1DARA 4EI2A 5JG7A 4JKOA 4HMOA 1WMBA 3KKLA 1Z7EA 3TXYA 5HSGA 1DTSA 4MV4A 2YW9A 5J4KA 3HK2A 2XTMA 2NO6A 3H17A 4I08A 1M7BA 2YWJA 3VPBA 5GVSA 5DYTA 4GBJA 2WWIA 5FA5A 3H2YA 3LW8A 1OV6A 3ADOA 1C9NA 1JBQA 2BJWA 3IBFA 3JTEA 3WYBA 3ZJVA 1TMYA 2P2SA 2VXCA 3I83A 1BWRA 2OENG 3W6NA 3CT4A 1ZI8A 3IOYA 3HO6A 3P52A 4IJVA 5FTJA 4U8HA 4C7MA 2C9CA 1PNQA 1N4AA 3T3DA 1FNNA 3HRKA 3WRYC 1SHJA 3AERB 5P8WA 3SSOA 2XZOA 4ZKEA 2IU0A 4M8NE 4RD0A 1OZHA 1PUJA 3KJXA 1PV4A 1O94C 3OQPA 3VNQA 4BB5A 3RF6A 3M82A 1XNJA 2CZGA 3RG2A 1UKBA 3LLUA 3KHSA 4GH5A 4AJEA 4XRGA 3LDGA 3H5WA 2HNKA 1GZ4A 4FUTA 4OIMA 3SLGA 1Q6ZA 4P81A 1KEUA 1XQXA 4YRLA 2TMDA 3AV3A 4L16A 3K1YA 4K2HA 1DLIA 1EFKA 4JQZA 4UDNA 1E5QA 4DANA 2JH8A 4I2NA 1RKVA 2RKWA 1SQGA 2XOKD 3HWRA 4P53A 4DRYA 1FMCA 5IANA 2CLHB 5AJXA 5C4IA 3RWOA 2VTBA 3R9XB 4CKEA 4PC3A 4FB4A 2X77A 3KFLA 2Q5FA 5DW0A 4RFVA 1YBMA 2JBAB 5K0ZA 3A05A 3CRQA 2JIOA 3PNQA 4HT3B 1COWA 1G41A 2JAOA 4IO1A 1UFQA 1T24A 1VZ2A 1J4AA 3N5KA 3ZVNA 2ROQA 1QGDA 1GQRA 3NVMB 5GJCA 1OH8A 3TRKA 3H42B 4JH0A 4ER3A 4WW0A 3W2HA 1MEOA 1VC2A 5TSDA 3DKRA 5CH8A 3RC3A 5A4FS 2VTDA 1U2ZA 2EFGA 1TD1A 1XYGA 5INTA 4LPSA 5CVDA 1I0LA 3C70A 3IOBA 1JQAA 3CX7A 1BA3A 4PLZA 5KTRA 4MQ4A 1H4VB 4P3NA 2DBVO 2OV1A 2X0RA 3CW2A 4X5OA 3TSOA 3TZLA 4KVAA 3DDWA 2OO5A 4U6QA 1HV8A 4NENB 2OVFA 1ISSA 4XAQA 1P4GA 3AI7A 1CZRA 3G0DA 3ABQB 3E84A 2VN8A 4TTRA 4YAGA 2NYAA 4B87A 2JIRA 2CD7A 2P4UA 2ZYVX 2BGWA 4DKJA 4NFLA 3NKVA 2A1UB 5J2TA 4MQLA 2ZR9A 1HG1A 1Z25A 2C4HA 4HZUB 2DE0X 2G9QA 1E3MA 1VSUA 4OFXA 1V3UA 3I28A 1PR9A 1N6HA 1UBNA 2GNPA 3A28A 5AICA 5SY4A 2IIVA 3MJVA 2ZB4A 4V2UA 4ZCSA 2XUZA 1ZOIA 1T6XA 2DERA 4U63A 3IAUA 2QQGA 3Q2KA 1FOEB 4UJ5A 1RYHA 5BPFA 2YASA 1A88A 1LDMA 3NEJA 4OU5A 5C8YB 1EXMA 5CT4A 1EEHA 4EY6A 4QOSA 1GAEO 3QXGA 3R7SA 5FTKA 1HYQA 1T1GA 3K0SA 1TU3A 3LQFA 1PEYA 2X1VA 1ZM7A 4NYMR 3RS9A 1FYDA 1L5MA 1UJ5A 4J1NA 3ECSA 4PQGA 4CHGA 4QLBA 5FWNA 1L7OA 3T1TA 3PIDA 2RH8A 1E61A 1U63A 2HGSA 1VKOA 5C5IA 1V8BA 1FZQA 2Z2JA 1RZRA 3I5XA 2ZRDA 4B9AA 4Z3KA 1B0AA 1I9CA 4N0DA 4GEKA 1P4AA 3PC2A 5FOQA 2EJVA 2NSLA 3HXLA 5AYVA 4F3TA 3OQJA 3U7QA 3LT0A 3IBCA 1J1UA 2GK7A 1A2OA 4XYEA 1NXVA 1JF8A 4OPMA 4CT4B 2G1UA 1E6UA 1J8DA 3R0ZA 2XRMA 4PTLA 3UWKA 5BN3A 1EUYA 3WICA 2V1UA 1GSAA 4PFKA 4FYHA 4ZXFA 3SZGA 5LUAA 4RK4A 1JQ5A 4TMVA 2BM1A 5E1DA 1PQUA 5D3QA 5THXA 5TVKA 4U3JB 5KAMA 3SR4A 2Q9UA 3RJZA 2HJRA 2B6NA 3NUQA 4KWCA 4PW0A 5KX5F 1CF4A 2OPBA 3PSHA 4UAJA 3D1VA 3CH7A 2R3SA 3ONFA 3Q7PA 4TV8A 2HLDA 2WM2A 5EVJA 3ZPXA 3ROMA 1RQNA 3NX4A 4D4HA 3O9ZA 3RDPA 5KMGB 1QWOA 3L0BA 3ND9A 4BO0A 1S96A 2KMLA 3BF7A 4GLFA 4H9GA 4C0WA 1MRSA 1QB8A 1XVVA 3B82A 2ZUVA 3E03A 3IE0A 3PVZA 3ILHA 4C3VA 4RS4A 1P61B 2CXUA 3OETA 2QTGA 4O6VA 1W36B 3A04A 3FTQA 4EF5A 2B7BA 1XN4A 2P3SA 4EI8A 5JNLA 1QFYA 2XQJA 2ATXA 2W2OA 3DE3X 4MLCA 2XOXA 4TT3D 1EU1A 4A4DA 3KOXA 1JNYA 1NP7A 1N2GA 2J08A 4L4SA 3TL3A 1TD9A 3C43A 3CPHA 3EXHA 4TQ9A 1ULSA 3NV7A 1NYTA 2G4VA 4CMEC 4HLQB 3DA8A 2W90A 3H8JA 4MQEA 4PVDA 1IULA 4JIMA 2G40A 3IIJA 3VQTA 3A4YA 1YK1A 1B3BA 5GZ3A 4IIYA 2DJ5A 2HXGA 2JFNA 1F5NA 1V9CA 3LECA 5JZVA 4FHGA 3TPZA 3FF4A 3TBFA 3AJRA 3BD7A 2WFAA 1JTEA 2XE6A 2XI4A 1NQUA 2V65A 3GEBA 3D1LA 5IABA 4RIGA 1SKYE 2XZPA 2YJTD 3EEYA 4RMHA 5H4GA 4DMRA 2PY6A 1ZEJA 2PZLA 3EGVA 3N58A 2VH1A 2BTOA 3PR2B 2FE4A 4I9NA 3U4HA 3DEZA 4EVQA 5L7WA 4ZAZA 4ZVLA 2EHDA 1QYWA 4LE1A 3AR9A 3HVJA 4WK2B 5I4CA 4HDCA 2RGGA 1RC1A 4YPOA 3FZGA 4I1IA 4TRNA 1EJ0A 4ILKA 1NOKA 4QVIA 4X7RA 2RC6A 1XEWY 3WLLA 2VSFA 2WILA 1QV6A 1TW2A 3F5QA 3L40A 2FWNA 1JPJA 2R751 3RIHA 2Y6VA 4IV0A 2UXDB 3D9QX 1Z5NA 4MIKA 3TLCA 1V1MB 5EC8A 1KDZA 2ODQA 3I9MA 1OGJA 2ID9A 4LI3X 1XL1A 5EI5A 3A11A 1Z4NA 1EFTA 3IP8A 1KYTA 1RQPA 4PX9A 1W0JD 5FTNA 4D3XA 3U62A 5ALNA 2PZGA 4Z3DA 1UPCA 3LP5A 1FMTA 5IKMA 5HMMA 4LQDA 4BJ3A 3CINA 3EJ6A 4WNYA 2EW8A 1QE5A 3DB1A 1FYVA 1R2QA 1A8IA 3V7WA 4DCVA 5E7MA 4PC6A 5ENDA 5ER9A 3WKBA 1A72A 1KJIA 4FXOA 4KDEA 3FNIA 4FHEA 1NIPA 2HJ9A 1Z88A 5DU2A 1DLJA 1NT4A 2X9QA 4WH0A 1RHJA 2WTAA 3MGKA 4XLLA 2CK3D 3OFKA 3S27A 3QPCA 5CLFA 2DTEA 1WZEA 1II0A 1V2GA 2XWJI 5FL7A 1SCDA 4CLOB 5KNBD 5AJTA 1VHDA 2EATA 3P27A 1BMQA 1V47A 2Z9DA 2XQKA 1K9VF 4J3FA 2HK6A 3H86A 2BCEA 1AV6A 3AHGA 2VK2A 1XOIA 1KVQA 2WTBA 4RZIA 5D00A 3TRFA 5EJ8A 1J6UA 1RI4A 2JJ8A 4PGMA 3AP2A 4CXMA 1S01A 2XEXA 5REQA 4E3ZA 2WM8A 3J81k 1U0OC 1KJYA 1WZUA 3DMHA 1MG5A 4Y67A 1H8EA 3PDIA 1YUNA 4IMRA 4YRPA 1FFCA 2K2WA 1WSWA 2GERA 1QYDA 1I13A 3FUUA 2NVUB 4ZAWA 2VCYA 1U0LA 3CNOA 4FE7A 2R6ZA 3IP9A 5K8IA 2ZRCA 2FMIA 1C30B 4NCIA 3HDYA 4BV3A 2R0QC 4CEHA 1SCKA 3BZBA 3KSRA 2M6SA 1U9JA 3QU7A 1TZMA 5FV7A 1N5IA 1P73A 1SAYA 2IU4A 4L4UA 2GCPA 4LEIA 5K0JA 1KAMA 4MV1A 1KY2A 3PZBA 1YR3A 4GWGA 1JHMA 3K0AB 3QVXA 4LSMA 2P0EA 3SZLA 3T7KA 3MJSA 4XARA 2Q9BA 2QVGA 4CQLA 2OEPA 4S0ZA 2ZIUB 3JVUA 2HMVA 4KN8A 1U2TA 3QBTA 3EG9A 4RZSA 4FGZA 4P3KA 1KU0A 4HDOB 4YROA 3F1LA 5H80A 1Z74A 3PNLA 1B1AA 1YB4A 4JLOA 4BP8A 5C7LO 5K01A 1IEXA 3DUFB 3P2JA 1ATZA 1ZW1A 1VJ0A 2X0NA 1Z2PX 3A4MA 4R7ZA 4GMHA 1R15A 4OJMX 5KEIA 1QIFA 4ZCTA 5AM2A 4G67A 1OJ7A 1Y8QB 5C1IA 2FB9A 2FSVA 5EUQB 1LI5A 1ZISA 1SUWA 4GOND 3KLBA 1NP3A 1XB2A 4KOAA 1W49A 2HDWA 4IFEA 2ZRQA 2HMYB 4HH0A 3G7NA 3W8NA 1PJSA 2RHWA 4FGWA 1EBBA 2OLJA 2CFIA 4YQZA 3RIEA 2VJLA 1P74A 5AOAA 2CV0A 5TIIA 1FRFS 2XQFA 4NCJA 2IYXA 2WJAA 1ULBA 3AI1A 5FR2A 1TM3E 3N8GA 5HUJA 3O03A 4TMKA 4XIJA 4DYVA 1P8AA 4YJGA 2V45A 3MB8A 2CNWD 2VYFA 4RA9B 4ZZ0A 4NENA 3FTPA 5EERA 2ZRJA 4NL4H 1XZFA 1H2EA 1HA3A 2AMLA 3ENQA 2I0FA 1EUDA 3CZCA 2WM9B 3OY7A 3E4DA 4EENA 1OWNA 1SCIA 3T5TA 3L43A 5IM4A 5KYXA 4UTNA 4W1RA 1T6ZA 2XGMA 1CDDA 1Q15A 2F3TA 2ID7A 2JD0A 3FVQA 2AH5A 5TE9A 3ROGA 2Q07A 1KI2A 2J5BA 2V4UA 2Z9BA 1TLLA 3LFTA 4DJAA 4YGXB 2Y27A 1P19A 4FHFA 3KC2A 3ZWPA 2JFVA 3GARA 3U7QB 4ZN6A 1XDWA 1T8UA 1XL0A 4RF2A 3U37A 5JY6A 2NU6B 2XE8A 2XGOA 1FNBA 1QV7A 5JAPA 1N0VC 3FAZA 4EG7A 5FLXA 1ZCZA 4BNZA 3EVCA 3REQB 3F2IA 4CM9A 3D5TA 2C7BA 1VYHA 2WM3A 3GJYA 3TN7A 5JYBA 3JASB 4RV4A 4YHHB 4ZPXA 2ZPTX 4UOZA 2PS1A 1Z7WA 4HH4A 2PV7A 2ZRBA 1NG1A 2C9BA 1YBAA 2XLCA 2XYVA 4JQOA 5IHXA 2VG8A 3LUKA 3UK2A 1U8ZA 4DRXA 1I4WA 5KREA 3HO8A 2V8BA 4JIGA 5K8CA 2WHRA 1ML3A 1D4FA 3TR6A 3AK4A 4ESOA 1WV0A 1KRHA 3EUAA 4LGCA 4A27A 2P9EA 5C5EA 2DFVA 3KKKA 5JAOA 4FYMA 1JFLA 4QQ8A 1O4WA 3LL7A 5DM0A 4X84A 1PL0A 1XU9A 1KF0A 4KHZA 4XH9B 3L6BA 4ID9A 1T3TA 2GVNA 3AUKA 1L5QA 1J22A 5K4HA 1LC0A 1C50A 2D0DA 4L07A 1M2VB 4LBYA 4LSGA 4WL0A 5KSOA 2OCAA 4R8RA 3RLIA 5L3RA 3GDGA 1BE1A 1B6RA 4NEHB 3B3JA 4R05A 3SIWA 3WMWA 2FK7A 3SPXA 1US8A 1IE3A 3ILSA 3R0QA 3PRJA 2YXBA 1JXQA 2ILTA 4E2ZA 5TMDA 2VQ3A 2YNMA 5M3BA 3VMFA 3AZPA 3MJEA 3M0EA 4J76A 5K0NA 4TSFD 1N5OX 5DX1A 4XVHA 2HCRA 221PA 3PPYA 1RYFA 1T1IA 1CHDA 4B71A 4F2DA 1GEEA 2J5RA 4BJ6A 5CYGA 1BDMA 5HCNA 5LBIA 3ETLA 4X41A 1E92A 1RPTA 1JDBB 3RNLA 1XTKA 2IGTA 4AXBA 3A4TA 1NOJA 1ZHOA 1NBWB 1OZFA 1DJLA 2D4HA 5FWDA 5CEFA 3HXMA 4FZRA 1LI4A 2HDHA 3I92A 4MGZR 3FVWA 2PMFA 2GYUA 3GQVA 3IDFA 4LXGA 3IEMA 1W4BA 2MMGA 4H2DA 4OXNA 2DR2A 2C97A 5BSFA 1XU7A 2VKTA 3N75A 3DAHA 1GV0A 4MLPA 3GVXA 5CB8A 1A1VA 2FCAA 3KRTA 4E15A 1GY8A 1WSBA 2Y05A 2BCJQ 2GFHA 3P96A 5IVIA 3RLFA 3ZIDA 1CZNA 1Z39A 3WLJA 4CV1A 1EI9A 1WUKS 1NV9A 4KQEA 5TF4A 3EG5A 2VDWA 1FVFA 1UMDA 4WSOA 5EHIA 2QMOA 3OQOA 4HJXA 4ZMRA 1ZITA 1UANA 4BQRA 1WDKA 4Y2VA 1CB7A 1E0JA 2IPMA 1IM5A 3VPXA 1DEOA 3AT1A 4I1UA 4YWHA 4Q0MA 1QIEA 5HGJA 3ROFA 4CIXA 1Y4SA 5AVSA 2WFLA 2ZWPA 5BRJA 1E9CA 1T0UA 2QTZA 4R7TA 3UA4A 1E1MA 2X1MA 2OHXA 4OHFA 1M2OB 4JSTA 4WLVA 4A2QA 5BORA 3OE5A 2J87A 4PIPA 3KSBC 3LWBA 4XUCA 2F55A 1Q91A 2YH2A 1EINA 1PFGA 5ANRB 2OG1A 3K8OE 4L76A 4MEBA 4NBKA 821PA 1U4OA 2PX2A 4J8PA 3TRDA 2OAEA 3E7XA 3EZ2A 5A05A 3TUIC 1DWPA 3Q0IA 1H8HD 4P3XA 4ZREA 1WMFA 5HG0A 3EGWA 1O89A 3AFHA 2WF5A 3ICPA 4Q4CA 3LUCA 2B92A 4XOIA 1SCQA 4JLMA 2UZ0A 4OYLA 1AA6A 2CNKA 4MV5A 2ZSIA 5I7HA 1Y1LA 3FIUA 3GJRA 1W5AA 3RABA 3GIDA 2N9UA 3WAJA 1B2RA 1NZFA 1PWEA 3W06A 2PX6A 1T5SA 4TV9F 1ST2A 4UM5A 4AICA 4MVJD 2XUAA 1NW7A 2P1DA 5EZYA 3ML1A 4DG8A 3DV9A 1RJWA 4D4MA 1D7AA 5TJHA 3ZG6A 1E3LA 2PMDA 4M3NA 2CVPA 3PJFA 1GPBA 1SHLA 4M99A 4JC4A 5KHAA 1GSIA 1MA3A 5FUXA 2O1SA 1J24A 2Q2WA 3DCIA 4NFYA 4Z9XA 4DTIA 5D5QA 3B7GA 1JHZA 4JJ6A 2XXAB 1U2PA 3WBBA 4KVFA 1AQYA 2WIFA 2FHPA 3U3MA 2F9MA 1GDTA 2M6LA 2QDXA 2VOJA 1OSNA 3KQSA 2FMFA 5K3DA 2XMCA 3C2QA 1DDIA 3H4VA 3LL4A 4HV4A 3O8LA 3VNSA 4BQIA 1YJAA 3WE7A 5JNUA 5IBPA 2P2ZA 2Q8PA 2JJ2D 1XNGA 4YMWA 5E6RB 5HQJA 1AKNA 4F97A 2W2KA 5FI0B 4ZO6A 2R1VB 4FCVA 4OHOA 1DQRA 3D4OA 2HYIC 5HQ3A 4PYLA 3LX6A 1DC6A 1VFNA 3PQDA 3WMGA 2BI8A 2XVMA 3GJ8A 4LJSA 1KEKA 5EKDA 2FPPB 5KB3A 4NVRA 2X8AA 5LA6F 1K5PA 3C8HA 3ZGNA 3EGXB 4DV5B 1VPVA 1A7UA 2I7VA 2EQ5A 3T4XA 3EH2A 1RPAA 4HN4B 1DUSA 1LUAA 2AK2A 3OEHD 1TPYA 4CV2A 3CRW1 4PVCA 1K9SA 4ME6A 2WIBA 2FPXA 5ED0A 5CJPA 2YXLA 3HUEA 3NBFA 3OO0A 1N6NA 3STTA 3ZUPA 2GZRA 4X20A 1D2EA 4WNCA 4OSPA 1N6LA 2JB9A 4LHZA 4BAUA 2AD5A 1HE4A 4KXXA 4QXOA 4CTKA 3B51X 1PBTA 1XLVA 2FWRA 2RAUA 1VGRA 2FX3A 1SIUA 3BG5A 2VF8A 1SBYA 3LOUA 1QHYA 1IPEA 3CLKA 4IJKA 4MUIA 2ECPA 4OYHA 4YECA 1JVSA 2I4OA 1IXZA 3K0HA 3TLZA 4DPKA 3AF6A 1ZJYA 2P62A 4HBGA 2A59A 4IXNA 5REQB 3BVPA 2OYCA 3N0TA 3WZLA 3LDHA 1B6TA 4OH1A 2BBTA 3DDNA 4H7IA 3CUUA 1R6XA 1YUMA 2HRCA 3LHFA 4CU2A 2CNNA 1V1RB 3UA3A 1AS2A 1M73E 1YHYA 1ZIXA 1XELA 1JMKC 2AMJA 2AZXA 4LXTA 4FT4A 5BWOA 4GZMA 1YC2A 1M5UA 5F64A 5C8XA 3ZY2A 3BH0A 4DAEA 3UBMA 4K1LA 1USKA 2Y6UA 3BICA 2BBOA 2IPOA 1Z28A 1ZGJA 2PGAA 3THYB 1SUPA 1YS1X 1D8TA 3NNSA 2BJHA 2QG6A 4IUYA 1PN3A 5EXTA 5T6MA 1C14A 1Z37A 3H0CA 2CLDX 2PR7A 3TLGA 5F2KA 3OZIA 2YVAA 3C85A 3KTDA 4Q3AA 4BJHB 2G36A 1UK8A 4N40A 1BKSB 5KYYB 5A0VA 4H1TA 1YRLA 3A7EA 1A9OA 3DXFA 1XYVA 3L7BA 5DI3B 5GPBA 4DOMA 3PK0A 3WIEA 2WJGA 1B3RA 1CF2O 2H2WA 4UXIA 3SN6A 4JOSA 4B7UA 1NMSA 3I09A 4I9HA 4CIVA 4E5SA 4LC0A 1R4NA 1SVWA 3DUFA 5K7SA 5J1TB 2HSEA 3D0QA 4FFSA 5DNDA 5H8WA 1Z2EA 1UXHA 2R2GA 4DCNA 2NMVA 5GJVC 4WOKA 1NIJA 2NO5A 1MF7A 1L1RA 3R4CA 5JR3A 4HLNA 4J16A 4QPZA 3KLPX 5FEUA 1KA9H 1AKWA 4A5OA 2R66A 3GLUA 2W0MA 4NV3A 5TB5A 2IPXA 1JXAA 5JH7B 1U0BB 3HM9A 3UCEA 1HEYA 1VMDA 2HSGA 2C2MA 5DK4A 2NUPA 3IXMA 2JJ1D 2AJBA 4B44A 1KQFA 2ACVA 4RZUA 3E7DA 3NGLA 3NTQA 1NVMB 4P5EA 3WFZA 1U8XX 3ZZNA 2QMZA 4A0RA 1V4BA 4PZ0A 2XCSB 2GS9A 2H65A 4EUKA 2ZI3A 2SHKA 3D43A 1XZGA 2D8AA 4O4HF 1AKEA 2RKBA 4S2UA 1BCRA 1RBZA 3HR7A 2YUTA 1D2CA 2XHZA 4J0GA 2PR2A 4LYFA 4NR0A 1E2DA 4C7XA 4UEOA 1ACMA 2IX9A 1N3YA 2Q2VA 3OT1B 1NY5A 4JJ7A 4HL6A 4QE3A 4QQFA 4HFNA 4YJ3B 1YB7A 3MRXA 4L8GA 1NURA 5AXDA 4BMXA 2Q1YA 1ADBA 5EXPA 4R6XA 4CF6A 4M36A 1W52X 4K1XA 4XWYA 1V3TA 1NM5C 3DXXA 3W2TA 1JJAA 5LA6A 4Y9TA 2BHRA 5JYEA 2R8ZA 4P4GA 4PBRA 1D4OA 2J5QA 3AKDA 5AK3A 2V9PA 3PL5A 3FDXA 2HW8A 3CLSD 3WK8A 4F4HA 3T9CA 3L7OA 5CB4B 2J0QA 2NO4A 1JI3A 2NU6A 1DX9A 1KP9A 1X1DA 2C2ZA 3C97A 3QHAA 5ALXA 4WVLA 1CB0A 2NPOA 1BG6A 1Z7BA 2WF9A 3L0YA 3UHPA 3EEIA 3Q3IA 3VHLB 4KYUA 3W4IA 4BRWA 1DJOA 4LHWA 1LPBB 5TPWA 4CKCA 3KVYA 4FFPA 4TS3A 5DJ5A 4FHDA 5AW4A 3ODPA 1RD4A 1YCFA 1Z3CA 3DFIA 5F7JA 3RVKA 3ZQJA 3T1YB 1JFFB 4B0OA 4YXWD 2NO9A 3ZUGA 2XB8A 5FYDA 3R3HA 5ICFA 1V6CA 3FWNA 4W8OA 3CNNA 3GY0A 4YRTA 4CCYA 3H0EA 3E58A 4WEQA 2EDAA 3EDCA 1A4UA 2OKGA 4O63O 1M8GA 3IVMA 3RSQA 4BNYA 3QLEA 4F93B 3H9CA 3IBYA 3ZDBA 2OV4A 4GOMD 3WJAA 3IUEA 3ESCA 4IXTA 3WGKA 4J9UE 4FFNA 4Z1MA 3EA0A 4HYTA 4N47A 1SKAA 2YN4A 3BMOA 4QUHA 3K6KA 4EW1A 2VDWB 5ABPA 3DNMA 5AHKA 5JAMA 3BXZA 3G85A 1DAFA 3U0BA 1TO2E 5CIWA 4MP8A 4OQ4A 1NRJB 3HKBA 2P68A 1A9TA 4WLFA 2EZ8A 3F6BX 4KE8A 1EFRD 4LZWA 3VSCA 1CTQA 1WPRA 3IAAA 5DNEA 3GCZA 1CWUA 5CW2A 5EPUA 3A1SA 1JG1A 3GA5A 4LDJA 3QG5A 4CEIB 3F0TA 4ZT5A 4HWKA 4UTZA 4G8CA 2IYUA 1L4HA 4ZJZA 1W19A 2ZUUA 1R6VA 1B42A 3K0CA 4R51A 1XTIA 4TT8A 3RFUA 1UPFA 1I2AA 4EQ6B 5IFKA 3I01A 3K2QA 3MM4A 3C15C 3BTUA 2IY7A 2Q4DA 4AX8A 4CTOA 2B4YA 2YICA 3E1SA 1DKUA 1QZTA 3R8FA 5KZMB 4MITA 4HDQB 1ZGCA 2EJBA 5JY1A 3CUSA 1I7SB 4U4AA 3VO8A 2A94A 3L7JA 1TQ2A 1OLSA 3P2MA 3QE3A 1CUIA 4IKPA 5DGTA 1XN1A 3G2HA 5HS6A 2XA1A 5EUMA 4B79A 3ROEA 4EVIA 2QENA 5H82A 4JI2B 4KFCA 4J1QA 1X94A 3M1LA 1XMOB 4KVZA 4EKEA 1AKRA 2V0CA 2YZKA 1E9EA 1JZSA 3ZWXA 4CN9A 4B46A 4DSOA 1Y4AE 1D5WA 5LOVB 3ZKWB 4M60A 2VL7A 3T15A 4G9BA 4J7AA 2AQ8A 2GAAA 2ILVA 4FMCF 3KTAA 5E9WA 4OTZA 2QEQA 1EBUA 3AEUB 2Q7DA 4I5GA 3DMTC 3IAXA 1IOWA 1Q44A 3EMBA 4A6DA 4EMBA 5FFNA 1S02A 4B75A 5K8VA 5KHOC 5TF0A 4GX1A 1YQGA 5CTAA 1E2BA 4QOIA 4LYDA 1YIDA 1ZI9A 1QTIA 1QTNA 2ZU0C 3PB3A 2FTKE 4TMFA 3QMPA 4XYBA 4QSHA 1VGVA 1XDZA 3QX8A 2YMQA 3W9SA 1P77A 1P4HA 4M6WB 3S2UA 3DO5A 2BZSA 3ESBA 4RIIA 3CKLA 2ZPAA 2HLHA 1G2QA 2OWEA 4ZOEA 3PUWA 3HEAA 1N2ZA 2LDBA 4H59A 4HAWA 3ISTA 2AE2A 4YIHA 5AK6A 3VZCA 4J7UA 1SQ5A 4OUKX 5H02A 2FQWA 2V7TA 3AG6A 3CURA 4RKQA 1NC1A 4MO9A 1P3Y1 3KAQA 5E2IA 4ER7A 3JZMA 1Z3IX 2X1HA 4I1SA 4QREA 1JHUA 1NJ6A 1Q2XA 3P8ZA 2KLHA 3TOVA 4C0XA 5EJ2A 4CUKA 2BDEA 1JA1A 4BN0A 1GGHA 2W6OA 4WBNB 5FOVA 2YJ3A 3C3AA 3W5CA 5EZYB 2W6JA 2BHTA 1QG6A 1EVKA 1YL6A 2BKVA 4HMQA 1W30A 4UXHA 2XB4A 4L15A 2ONZA 3DFMA 4XB1A 3G0HA 1EK2A 1U7UA 3D0OA 1B26A 1YZNA 2KX7A 2IH5A 4RULA 2B78A 3A9SA 1QQAA 1TL7C 4DMHA 3LK7A 4YMLA 3PXUA 4YO8A 4XSVA 1GIAA 5BN1A 2YJNA 4IDHA 2QLTA 3U4IA 1WMEA 5CLIA 2W93A 3QFTA 4DWOA 3R6LA 1UXIA 2B25A 1ZXXA 1ZD9A 2ZWVA 3BXEA 3EVZA 3Q3HA 3QLUC 1NRXA 1YC5A 2P9TA 4DG9A 1ZMXA 1R0YA 1X19A 2J48A 3KDPA 3U1BA 5B2FA 1AQ6A 1THGA 3IEPA 4QELA 2EF1A 1M1ZA 2XDYA 1NPDA 4X1KA 5EXSA 1NQWA 1R0SA 4LRQA 2W6CX 2CWWA 1GADO 1A9QA 2P69A 1BQEA 3HVKA 4UEKA 3GLHA 2JFQA 4UNRA 1T9HA 4FSXA 4X3CA 3SLRA 3K5IA 4DT1B 5C7OO 1K5HA 4KNVA 4CETA 4H1WA 4ROSA 3QPWA 5CNIA 1HYEA 2C1XA 4IHAA 2D5LA 1H22A 3F73A 2C77A 3W0LB 4P4LA 4R0MA 2FPLA 1I4OA 1WB4A 1OIXA 2Q3BA 2EP5A 2AWOA 3TJMA 3ZWDA 3EARA 3BFKA 3E2IA 3F5FA 3W9UA 1T5OA 2VAMA 5CVJA 2V0NA 3SVLA 4R8MA 5EHZA 1ESNA 5GVRA 2B5VA 2OO7A 1DHRA 1Z8HA 1QU3A 3QFFA 3V80A 1J5EB 1WUYA 1GA4A 1I5EA 2IEBA 4EG4A 4KR9A 3M4YA 3R5TA 4ARZA 1SU4A 2Z6QA 4BLVA 4OMDA 3JS5A 1A9RA 1C2YA 4OJQA 3WAKA 5LR6A 4NHOA 2JDIA 3N2IA 3U80A 5K3SA 4L6IA 2G9VA 4JYAB 2PGNA 3LTEA 3S2EA 3VR2D 1Z6TA 4B48A 4I0WB 1KH1A 4NZPA 4RGBA 4B8YA 3RAGA 3O92A 4UHEA 4WESB 2Z6VA 2O3QA 2VNAA 3D59A 3KZNA 3AONB 3B36A 4NZMA 1XV5A 5EGSA 2XADA 4BFSA 1IBMB 3DEKA 4MI1A 1YOVA 2FR8A 3IMFA 4B4UA 2AEJA 1SD5A 2KS6A 3GEMA 1S3IA 2CLMB 3SC6A 1NF3A 2WIJA 5AVQA 1LLDA 3WBKA 3DEHA 4B2LA 2ZETA 1IEVA 3MCUA 2PIDA 2R44A 4BWVA 2FFRA 1DINA 1ETHA 3CSUA 3GQBA 3GB9A 3ZGVA 4BNTA 1TRHA 1E2UA 5J4HA 3ANMA 5C34B 4HH1A 5AT1A 2H9IA 2P2GA 3PXAA 4QDTA 5CP8A 1BMTA 3QKRB 2VBGA 4HRYA 2X8WA 4O5AA 1R0WA 4P7FA 2PO5A 1CDOA 2CFOA 2QRMA 2WMYA 3CNBA 5KNBA 4B3MB 2XBMA 4REOA 2OQIA 1E2QA 4RQUA 5AR1A 4FZJA 2WIKA 4YV1A 4BNDB 4LA4A 4L7QA 5JPCA 4UD6A 3P9SA 4LTDA 1KNQA 3AZOA 2GD0A 4P4UA 1GGEA 2NGRA 4RVGA 1FFSA 2ZGVA 1OHHD 2VPWA 4PG7A 1WOMA 2FZEA 2OC9A 1WVIA 1D2NA 2QAIA 3HJRA 1F6BA 2UKDA 2VNJA 3FOAA 3OZXA 2XTJA 2YNMC 3H04A 1R5JA 4B8WA 4IBOA 5BMVA 2IHUA 4PNPA 4MGYR 1A4IA 3REOA 3EIEA 1ZXLA 3MJCA 2G4CA 1ABEA 3WK9A 5BW8A 3PENA 1UUFA 5AI9A 1QR2A 1RZVA 3B20A 1Z2OX 1EHCA 1P91A 5B1YA 3GEGA 4TTTS 1W7AA 3FMOB 1J8VA 3LPAA 1X15A 3A9TA 6PFKA 2DPLA 1BCRB 1SBCA 3VH4A 2XCQA 4A15A 4CE6A 2MMCA 3AB7A 4G36A 1ZUNB 2NYVA 5FPHA 1NI3A 4B2PA 1R6BX 1R0KA 1P2VA 4YP6A 1ZD4A 1TLFA 4L8LA 5HHTA 4DBVO 4AL4A 2V58A 4RACA 3BKWA 1R74A 3UJ8A 4L74A 3TFQA 1XMJA 4US0R 5BV2P 2G82A 2GF9A 4M1KA 3P9QA 3WK4A 4U6SA 5T67A 1NXWA 3VDQA 3WL6A 3WKDA 2J3IA 2DHRA 3SYTA 5JARA 3FHTA 4HATA 4J0HA 3FIJA 3SHWA 1GU1A 2QP4A 4JNCA 4BX0A 1G3MA 3PIIA 2Q46A 2AFIB 3CBGA 3PKZA 5D7NA 1H6BA 1O9HA 3C6QA 1KZ1A 3DOEA 5AVYA 3SDZA 2QXUA 5H4HA 2O14A 5K0EA 3E5HA 4IZIA 3EC7A 5ESDA 2OXIA 3HB5X 4ZVVA 1SNYA 1IBCA 1VMEA 2JIPA 4UHJA 5F78A 4D45A 5J2TF 1WXIA 1YKFA 1OXMA 1B0UA 4FC7A 3V9PA 4M1SA 4JQSA 4QX6A 4O0LA 5HKAA 4QNNA 2JZCA 1N5DA 4JL8A 2K5UA 4N9QA 1BRTA 1GNPA 1H5NA 3MELA 4C0JA 2HL6A 1MC4A 2QORA 3O82A 4OHBA 3Q5EA 1KKUA 1M75A 3OQVA 4FB5A 1G4UR 1NUUA 1UJNA 1KFCB 2VJKA 3CGGA 3HKBB 3SFZA 1JDNA 3F1KA 3G89A 3LZCA 1T8TA 4HLUA 4TLMB 3RVLA 2P6PA 5C1DA 1NNEA 1MAUA 1OKKA 2FQXA 3LUHA 2WW8A 3PFWO 4NBLA 4R3NA 1QR6A 3EMVA 4FSDA 2ZI4A 3CNEA 3W5UA 5A4AA 2ZEJA 3AF4A 2VP0A 3EIQA 3S5JA 3C6MA 2IHKA 3HU3A 3UBTA 4PANA 4KQ9A 5U9CA 2H7VA 2XWSA 4G1EB 5B7NA 2VSNA 4HDMB 3INTA 5T5QA 1LLCA 3DFFA 1YK0A 4REQA 1CEXA 1FDOA 1TB4A 2DFDA 2YFKA 4KN6A 3GNLA 4P58A 4FGLA 1EDBA 1N75A 1QNLA 2GAIA 3LF1A 3X0DA 3MAAC 1O8CA 5H83A 2A0UA 2PQMA 4IGEA 4M7WA 1I33A 4Q48A 1V9SA 5T8KC 4P83A 2PGOA 1RHRA 1EHYA 4GPIB 2QQ0A 3UPTA 3ASUA 2VAXA 4N7JA 2QMHA 3S28A 2FX2A 1PZXA 3CH5A 4I9UA 1A77A 3RVJA 4AECA 1AHNA 2D1FA 5G4KA 3C3PA 2GPSA 3QK7A 2C31A 4OA5A 4OJTA 3NWPA 1T4CB 3PJEA 1J7KA 1DS6A 1PNOA 1XVIA 4IEFB 2BGRA 4A3SA 4TN5A 3TIGA 5J3JA 3I4FA 3O2QB 3RRJA 1Y6JA 3TRHA 4RD3A 2A5YB 4Z7QB 1I1HA 4D9FA 2ZLBA 1YGYA 4OGWA 4B35A 3OY2A 4DCOA 2NV6A 4JASB 3JD3A 1KDVA 1NJGA 4NZZA 2DM6A 4BMNA 4YH1A 2ODEA 3HI4A 4PQFA 4BKOA 2GEJA 2UZ4A 4KH1A 3W7AA 1AVTA 5C5CA 3V42A 2BZ0A 1BX1A 4R7GA 1ECFA 1QS0B 4Y18A 3WL8A 1C4OA 3BSFA 1XPJA 3NPMA 2WQ6A 2I2XB 1EXWA 4NYIQ 3UMYA 3NWEA 2RFLA 1GG9A 4B6OA 4YRRA 1EQUA 1RWXA 4EUHA 1KOGA 4OP2A 4M9XA 1TO1E 2IIQA 1IWOA 1ZN9A 3ISJA 1UK6A 3M1YA 3G1UA 4KREA 4MR7A 5AKKA 3QWAA 2ZTVA 2O57A 5D7BA 1AKQA 3H11A 2IEGA 4OBXA 1CUWA 4PSVA 1YCHA 4NBWA 2PUCA 1NW6A 2XSZD 4EUEA 2DQYA 2WVHA 2Q9AA 4ZVPA 1UJ6A 5C51B 4GF5A 2FUEA 1F0NA 3WQRA 3ZHCA 2F8MA 1NI4A 3NTLA 4L9RA 5FADA 2A9FA 4JMLA 1XIVA 1RI2A 4K9SA 4QT0A 3TZQA 2DP4E 4ZEXA 1K4MA 3NKFA 1MZPA 2OXEA 3ZK9A 1Y9AA 2JANA 3CHYA 4O5OA 3IERA 4Q3LA 4BV9A 1GGNA 4GLLA 4RKEA 5BVHA 2UUAB 3BFVA 2QTFA 2TSYB 3RUEA 1QVAA 5AVRA 1B8PA 1DEAA 4YAWA 4OHMA 5FFMA 5DP1A 3DEAA 4XPIA 4CM1A 1CETA 9LDTA 4J94A 2RG1A 1BX3A 1XEWX 3L0OA 5DN6D 1TKCA 2WD7A 2XZLA 1WCIA 1ZH2A 4LJYA 3COPA 5DWQA 2M1XA 2D2FA 5LBUA 4EHNA 3ECAA 4MSUA 4CKYA 2HPHA 4I36A 1HDCA 3PGKA 4EGCB 4KQIA 2JA1A 1HK7A 1MH9A 3TS1A 1QHHA 4IHJB 4M98A 1MW8X 2LCQA 1RVV1 3P0RA 4R4JA 2WC1A 2HU5A 3NEPX 3PL1A 4PPGA 3KVOA 4WKGA 5BNZA 3X1XA 2B4AA 4NI5A 1XRSB 1T4MA 5LWQA 1YOVB 1I3CA 2QRHA 3OZRA 3Q9SA 2HIMA 3ONDA 1KMIY 3MW8A 1TU0A 2WABA 1L4LA 3KVNA 3QA3E 2DT5A 2YWFA 2ZSHA 3DV0B 4IDGA 3L3BA 4Q39A 2Q4EA 4P2BA 1GTG1 3C48A 4DV1B 4BPRA 4H1UA 1PK9A 3RRNA 3WHLA 2NXNA 3RC9A 1JBEA 1Z5UA 2QW1A 3FHLA 3C39A 2C7RA 2BR5A 3HGMA 3ULKA 5IYZB 1BQ4A 3GLHE 2DWCA 4RZHA 4KWHA 3QKRA 4MYTA 2HF7A 3TIXB 4Q4JA 3UFXB 2WB2A 4UMVA 2AJDA 1XWIA 4OKSA 3VOBA 4FK8A 2OCYC 3QX7A 4W99A 1WU7A 3VBEA 3R76A 3FYSA 1TA0A 3GUZA 5EP1A 3PDCA 3A6LA 4EG0A 4TYQA 1E2JA 4BNDA 5HM8A 3DPUA 3A70A 3SHOA 5ADWA 1IG3A 4ZPJA 5C8ZA 5BNIA 5DCYA 1H2AS 4L4ZA 3BE4A 1GR1A 1TVMA 4UVGA 4KIJA 3IA7A 1PJAA 1U1EA 1KIAA 1S2LA 1Y7HA 4JI6B 2ORWA 2QROA 4QOFA 4WJLA 3HCDA 4BVAA 1C7RA 2CBXA 1V35A 1OMOA 1U1GA 2ZYIA 5IULC 2WFZA 1A76A 3IO3A 4Q4AA 5ALZA 2MYUA 1G20A 3RRXA 2OZVA 3PYLA 3VPCA 3LS2A 4RLHA 3E35A 3AEXA 4PSKA 5K20A 1E6EA 3CF2A 1M34A 2Y0CA 1IZ8A 3BK7A 4OLBA 4FZVA 4MQMA 1R0LA 4TMTA 1T43A 4OK6A 3BZUA 1ZUNA 2OQ2A 1G9TA 2XIJA 1XZPA 2VWGA 3PE6A 4Q82A 4XJXA 5FRDA 2NT4A 1ZYUA 1UT5A 1LPAB 2VUHB 3DAYA 4TRMA 2R8BA 2BEWA 4L6AA 4IICA 3S2YA 3MGAA 3GA0A 2CY0A 3RKRA 2BM9A 3HSYA 1BFKA 3SEAA 4DJTA 2Q28A 4LGMA 4YRMA 5HX7A 1NAHA 1RNLA 1OPRA 3C7DB 4LDNA 1X92A 4XUEA 5E1OA 2MSCB 3UG7A 1XR3A 3DC7A 4Q03A 1NONA 1MOZA 2CXOA 2HJVA 3L1JA 3H3FA 3K9CA 3QI2A 1G5FA 2I9KA 1LDYA 1JKXA 1I51A 3D6VA 1RDFA 4WBSA 4TRRA 1RXUA 1G8SA 1BEEA 2M98A 5C37A 1JPUA 2VTKA 1QFJA 1WW8A 2R60A 3DONA 3KD2A 3CE9A 2R6HA 1Q6YA 5EG5A 1TIPA 1AXRA 1PZEA 5F77A 2FOIA 5T64A 5JXHA 4XE5A 4IV8A 5CIQA 3D3JA 2VRWA 4K6KA 3WNQA 1XBTA 2PUFA 1XT6A 4BX9A 4GDFA 1QHSA 2QX8A 4BVBA 5CAEA 3RC8A 2VPQA 4YVFA 3M83A 3K0CC 1I2ZA 3F7TA 1S1CA 2B82A 4LF7B 1NM5A 1AZSC 4EH1A 2WEKA 5L6LB 5BNFA 4ETMA 3WHIA 2Y0DA 2RJNA 5F1PA 1QE0A 2VWQA 2WZQA 3OUUA 1GL3A 3WWOA 3WWPA 4LCBA 3RC7A 3K9FC 1OREA 1QM5A 4K9MA 1NDQA 1YR9A 1Y7TA 2RI0A 3TW6A 3EUEA 4JBYA 3DZGA 1SA0B 3FUTA 4BQOA 1E2EA 3SKVA 4H17A 1P8JA 1TUIA 1D8AA 4MYCA 3FMGA 2NYUA 1JZQA 1RJEA 1HORA 2WYVA 2X6QA 2GEBA 3L6RA 3QOXA 3TLBA 3OG9A 1ZIYA 2DFKB 3D6TB 3MINA 4O2BB 2WWYA 3Q0EA 2A0KA 3GT3A 3GEDA 5I9SA 4LNHA 1S8NA 2PQ6A 4GPD1 4J1SA 3VAZA 4HAUA 3U4MA 4UNIA 3M5PA 4B6JA 1CY2A 5AXBA 4EKYA 3BE8A 4GOXA 1MEEA 4HAZA 5YASA 1KMMA 1RAHA 4CKBA 3QEKA 4PONA 2H1CA 2PYIA 1DQNA 3C7AA 3G1TA 4GQAA 4NFHA 2P40A 4JOBA 1VBNA 2LE0A 3MWEB 3RK0A 1Z4IA 4M37A 1VL2A 3UAZA 3VZRA 3DHEA 3E9NA 3IPAA 4PHTA 4IO0A 4P4SA 1QKIA 3FCAA 3I9NA 4BV2A 3RGGA 3V3KA 3IE1A 1NVXQ 2J7PA 1VJDA 3WNZA 3ZCQA 1AMOA 2CDAA 2GILA 5EIXA 4D3SA 4U5QA 1R0BA 3I32A 4WJZA 3LBNA 3LCRA 3CLRC 4I50A 5G4KB 4KEAA