3C7TA

Crystal structure of the ecdysone phosphate phosphatase, eppase, from bombix mori in complex with tungstate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RRWVFALRHGERVDLTYGPWVPHCFENDTYVRKDLNLPLKLAHRAGGKGGYVKDTPLTRLGWFQAQLVGEGMRMAGVSIKHVYASPALRCVETAQGFLDGLRADPSVKIKVEPGLFEFKNWHMPKGIDFMTPIELCKAGLNVDMTYKPYVEMDASAETMDEFFKRGEVAMQAAVNDTEKDGGNVIFIGHAITLDQMVGALHRLRDDMEDVQPYEIGRNLLKVPYCALGAMRGKPWDVVSPPCPPSINSSSGRFDWRILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ecdysteroid-phosphate phosphatase
publication title Structural and functional characterization of the c-terminal domain of the ecdysteroid phosphate phosphatase from Bombyx mori reveals a new enzymatic activity.
pubmed doi rcsb
source organism Bombyx mori
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3c7tA01
4D4KA 3F2IA 2H0QA 2P2YA 3EOZA 5AJYA 3F3KA 4FDTA 5HTKA 3BIFA 2HIAA 3MXOA 2ENUA 1T8PA 2DWPA 1C80A 2EOAA 3DCYA 2P77A 2P30A 1C81A 1SK9A 1UJBA 1C7ZA 1EBBA 5AJXA 3QPWA 2WNHA 4ARSA 3D6AA 3FDZA 3QPVA 5AK0A 2F90A 4JOBA 3LNTA 1QWOA 2P79A 1FZTA 5CU7A 3FJYA 1ND5A 4JODA 2P78A 3D4IA 2HHJA 3OI7A 4FDUA 3IT2A 3IT3A 4D4LA 1E59A 1H2FA 4EO9A 4JOCA 2H4XA 5AJZA 4IJ6A 1DKMA 3LG2A 2P6MA 4GPZA 2GFIA 3QPUA 2OWEA 4MA4A 5PGMA 3MBKA 3E9EA 3K4PA 1YFKA 3EZNA 1RIIA 1QFXA 3HJGA 3D8HA 2EKBA 2A9JA 2A6PA 4E3WA 3C7TA 2I1VB 3ZHCA 4D4JA 2EKZA 1V7QA 1DKLA 2P75A 5CDHA 2WU0A 1E58A 3NFYA 2P9YA 2PA0A 1RPAA 5HR5A 3LL4A 2H4ZA 2OWDA 1ND6A 4PZAA 2P9ZA 2RFLA 2P2ZA 5AJWA 3E9DA 1QHFA 1UJCA 4HBZA 1V37A 2AXNA 4IJ5A 4ARVA 1H2EA 4ODIA 3KKKA 3GP3A 1BIFA 2YN2A 1FBTA 1DKPA 4PGMA 3O0TA 3E9CA 4QIHA 1XQ9A 2YN0A 3DB1A 4TSRA 2QNIA 3R7AA 4AROA 4D4MA 3PGMA 1SKBA 3FDZB 1SKAA 4PZ9A 3K4QA 5AJVB 4ARUA 1TIPA 1BQ4A 1DKQA 1DKNA 1NT4A 2ENWA 2WNIA 1K6MA 1DKOA 1CVIA 3GP5A 3GW8A 3NTLA 2DWOA 1SK8A 4GPIB 1IHPA 4EMBA 2H52A 1RPTA 2HPAA 2IKQA 1BQ3A 2BIFA 5CX4A 2P9FA 2P6OA 3IT1A 1YJXA 3IT0A
chains in the Genus database with same CATH superfamily
1BN6A 1MR3F 1M6WA 3OZBA 4WPGA 3MMNA 3IQDB 4L4RA 1TTTA 1WE2A 3VU9A 1SOWA 3GXBA 4MW4A 3FOBA 4OIFA 2FW7A 3HRIA 2VAWA 4ZQGA 4AJ4A 4B2LA 4D4GA 2VWGA 2JHPA 1WKVA 3TW8A 2B4AA 4UVDA 5JBNA 2R44A 1V9SA 1WSDA 2W8BB 1IOLA 1U8FO 1ZDMA 3EZ6A 1ZGZA 3FKJA 5A0FA 4JSRA 2VK1A 4FIDA 1TIBA 1U2GA 3RPEA 4Y9SA 3TOXA 4C2BA 4RXTA 5MHTA 3ZYCA 4JJGA 3GARA 5CJ2A 1N0VC 4L9AA 4U7GA 3TBFA 4CFYA 4XRGA 3Q7IA 3FZGA 3KJXA 5KB3A 3UICA 4HAZA 1BE1A 4C0KA 2B2NA 1N3BA 2NXCA 2J7PA 3CNEA 2YYYA 3IHWA 5EY5B 2FUCA 2OFPA 3OEEA 5ENVA 1PQPA 4GZ5A 1OJ7A 2QX6A 2OP0A 3FDXA 3NOOA 4ABYA 5HE9A 1F7VA 4QGBA 4LTDA 3WC4A 5DRTA 4CIAA 1SXIA 4L2IB 3WLNA 1NQVA 1HQDA 821PA 1ESZA 2N1BA 3QX3A 1X8KA 4PZPA 3K9QO 1JFRA 3B52X 4FDLA 4YCDA 4BRUA 3A7EA 5J2UB 3TVYA 3P45A 2EW1A 4CT4B 1JL3A 4MQ6A 4C7OA 2KBEA 1P18A 3EBOA 3LQ2A 3L41A 1W4RA 1VCMA 1NXWA 1ZGHA 3EA4A 3T54A 4FJ1A 5C8VA 3TI7A 2W6CX 1RHMA 1PZGA 1UDAA 2NZVG 5TPZD 2FR0A 3MWEA 3UXEA 3TNFA 3R0VA 2CJWA 3EXIB 4L27A 1AK2A 4UHFA 3KSBC 4O2AF 3IIEA 1G8GA 3E3LA 4PC7A 4UREA 1R88A 1E5DA 2XBUA 2GBCA 2GZMA 3B3FA 3W3AD 1WDTA 2FPPA 3RFCA 4MKRA 1T0IA 3A70A 2QTVA 2AJBA 4OQXA 4E5MA 2FJ0A 3UYLA 2HK8A 2HHAA 4OQMA 4UARA 3QLVC 1NOJA 1G41A 2NUTA 4BECA 3KX2A 1HY3A 4BNKA 4K6GA 3R7FA 4RKEA 1T3TA 3TTVA 2PUHA 2VDWB 1QZXA 3PNKA 5I01A 5EJ9A 3HG7A 5IYZB 1VBKA 3QG1A 2QRJA 3B1ZA 4CEJA 5BUQA 1U0LA 3V8QA 4JVLA 4YRTA 1H2RS 2OG2A 1PJ8A 2WICA 3MLAA 3LGSA 1II9A 1SBHA 5DSZA 1CS4C 3RHZA 4ZO9A 1AMOA 1SCAA 2HCTA 2R6HA 3HSSA 4B7AA 1QU2A 1NPDA 2NUAA 1AKYA 1FDWA 4G4JA 2N1MA 4B34A 3HXQA 3NQ41 5F4BA 4JGBA 2OO7A 3GP5A 1WL8A 4JC8A 3EEYA 4KDFA 3O8CA 1JLLA 2NACA 2R25B 2LIPA 1TJYA 4Q66C 2PNJA 1DFIA 3A6EA 4TV8F 2PCLA 3LUKA 5FNVB 4GRDA 2XYHA 1WV1A 1EVIA 3OD1A 1N1DA 1QHIA 1IM2A 2XIQA 5BYAA 4FFPA 3PFCA 5B53A 1QIHA 1UEXC 2B1RA 3PITA 1SXJB 2Y1EA 5D6NA 4ENUA 2FW6A 1UBUS 1J20A 2FCAA 1ORDA 2RK4A 1PDOA 5CH3A 2RH5A 3JY6A 3Q3GE 5IJAA 3VYVA 1G4UR 1G21A 4BWYA 2WYOA 3V2IA 1CUWA 3N8IA 3D1JA 5FBWB 5JZSA 3TGLA 1PLKA 3ZD6A 3MHPA 1V0JA 1T13A 3C8MA 2XWJI 2HDWA 4KAXA 4W1SA 5EXEA 4KV7A 4K3VA 3T5MA 1XXLA 1EBBA 2G07A 5ADHA 1YZYA 3U2QA 4OXKA 2NPIA 4HYYA 4NU6A 1KDPA 2J9GA 4CUKA 3KC2A 3JZIA 1LRJA 3P9YA 3WLPA 4EPTA 3T5CA 3L1UA 3D7NA 1PG5A 4KI0A 3SDZA 3JQEA 4E51A 3AU9A 2OENG 1AQYA 5BN4B 1O6BA 3IH5A 4CKEB 4DLLA 3QZUA 2R2AA 2QRMA 2WJ4A 4JQYA 4GM1A 4RNDB 3A3YA 4JJ6A 2XTJA 3F6PA 3HKCA 4DJEC 2JGIA 5TB5A 5GINE 3D02A 3QVUA 1CR6A 3G0BA 4RHXA 4D0LB 5EE1A 1YACA 5AUOB 1MUUA 4TTVA 2AXQA 1PBTA 1SBNE 4QLAA 4ARAA 3WKDA 1DO2A 3U5TA 2GN0A 3KOUA 3ENQA 4IEEA 5BOSA 3L2OB 4QATA 4LG1A 4QUEA 5EEHA 2X15A 4YRCA 7REQA 2IH5A 4P54A 3H2SA 1B4DA 3D8TA 1KGDA 2XUFA 2QN1A 3SE7A 3ROFA 4DWWA 2I3ZA 3PPIA 3Q41A 1F8GA 3TKYA 5I7OA 3E22A 5F1KA 1NXPA 2P9YA 4ZKDA 2W11A 4YC7A 5LBIA 2PGOA 3LHDA 2GK4A 1OHHA 4AU1A 3R5HA 1RYNA 3HXPA 1XOIA 1ORWA 1G66A 5BUCA 2Q5FA 3AFNA 1Z6PA 2R6GA 3NB0A 3BE6A 2P2ZA 5TARA 2CBGA 1SURA 4Z9AA 1WM1A 3ZXUB 2GEBA 4TKVB 1VYTA 4M0EA 1FX0B 1ZVKA 5DTEA 3UCXA 1SNYA 3L04A 4CG3A 5K4AA 3L7MA 2W22A 2LCIA 1I0LA 2RKOA 1ST3A 2B4QA 2Q8NA 3L7YA 1NVEA 2CGEA 1AT1A 1KARA 1SGWA 2D2IA 4M2LA 5A3SA 3OPXA 2FN8A 5LQCA 2W2QA 3PCXA 1CBUA 2QY9A 2X8LA 5EWJB 4AJOA 5KX5A 1IEVA 4ZANA 1TEVA 1E4YA 1PZXA 1UP7A 5H68A 3MT0A 3VHXA 2QYOA 4Y0VA 5DYNA 3U13A 4FE4A 5K20A 1TMKA 1X7YA 3KPYA 1TIPA 1K8RA 2XB8A 2I2BA 3N3BC 3IAUA 2PL3A 3R5XA 2EZ4A 4WKGA 1QAQA 3EWSA 3AHFA 1ISHA 1FUUA 3IUEA 2BGWA 3T3NA 1W88A 3AHDA 2G7MC 3QELB 1T0UA 4MS4B 5CFOA 1VE5A 1QPGA 3DEJA 5EZYB 1I01A 2NYRA 3T7EA 1OROA 3KLNA 3QU5A 3OQMA 2X2PA 4ZI7F 4CIBA 2BFFA 2V58A 2FETA 2OCBA 3FYDA 3A6ZA 3G68A 4QJ3A 5A06A 1IBRA 1PFVA 1R0WA 3QVVA 2GASA 3PL1A 5GONF 4G4GA 4MEBA 1BX3A 1KKLA 1WF6A 1T8RA 2OEPA 2CLKB 3TW0A 1QM5A 3BIFA 1D2RA 3LUGA 1LH0A 3TZKA 4FI3C 1LPBB 2DUJA 4G67A 4AWBA 3KEQA 4II7A 2VK8A 1UFVA 4LDPA 1QRTA 3LBHA 2FFHA 3I9V6 3OTQA 3TINA 1JEQB 2FRVA 3GRUA 4LGYA 4LFAB 1DC3A 4UAGA 3I52A 1LEHA 5G3YA 3KU1A 5CBPA 1JVNA 2BZ1A 2FI1A 4OFBA 2B61A 2CL7X 4K6FA 3R75A 3V8RA 2LXNA 2QNBA 3LNTA 2GDZA 1GRRA 2MINA 5CP8A 3S1AB 4YX9A 1Q17A 2GAFA 2RKBA 2ZEJA 3W4JA 2NO5A 3GB9A 3H13A 4J2OA 2D5BA 4WECA 1VIMA 2IXDA 3PNMA 4X3PA 4AO6A 1NBMA 2YY7A 3CX7A 2D8AA 4DDMA 3IE0A 4Q7LA 4Q48A 2IS4A 4G0YA 3C7DB 5KWEA 3V2UA 1EFAA 3OF5A 3FCXA 5CTAA 1AKVA 4EGQA 4HFNA 3OLCX 4JVNA 2IHTA 4BBPA 4DMCA 1E7RA 4ZRNA 2IGBA 3DMTA 4DQKA 1SVWA 4KYIB 2GAOA 1PDWA 1TVCA 3ZH9B 1E89A 4EGFA 3DLPX 3Q7PA 3W2HA 3H3XA 4OL9A 1EBFA 4QUKA 1QHNA 3Q11A 2B8NA 4CKWB 1RYEA 2QMEA 1KOLA 1TAHA 1GQ2A 3K9BA 3USZA 4BMVA 5JJBA 2BMJA 2NLOA 1JE0A 4U1RA 2BM0A 2ZZNA 5FA5A 5F9HA 2IZZA 1QFZA 5CX1B 3EG9A 1NXXA 1YDFA 4JI8B 5EIXA 1LLFA 2O59A 2GBIA 2GUWA 2JFQA 2OK8A 1ZRMA 3I12A 5AUNB 4URZR 2ZYDA 4AD8A 4TMZA 4QPDA 3CURA 1CQXA 2OY0A 2WZQA 2IS6A 1P0PA 5E3IA 1XX6A 5HCNA 4L8LA 4DXDA 2CKMA 2PUDA 1GL7A 5IKEA 4JLJA 2OGWA 4GL4A 4C2AA 2I33A 1ETHA 2EL7A 5AW7A 4QYWA 4RA6B 1L5YA 3L4BC 3E0XA 2OCGA 5K8CA 2VT6A 3Q3IA 5A7GA 4U2CA 1PR9A 2GEDA 2GEUA 2YOFA 4QYIB 1B74A 5KDDA 4C5CA 1TFUA 1SEPA 3F9RA 1KVUA 2CB9A 1OXKB 3EZGA 1K5PA 3AY7A 5E4FA 4D26A 4MGZR 5CLGA 3OCZA 1UMBB 3PNQA 1KP3A 3PQ2A 4U00A 3RUDA 3ZHYA 3AVXA 3DC7A 3E3AA 3WGZA 1Y48E 4FW9A 4LJKA 2DT8A 1L5SA 3UAOA 3C3YA 2I71A 1GZ7A 2YHSA 3DZKA 2GFQA 3KAPA 2ATVA 4V02A 5K6RA 1G8YA 3TL2A 1EUDA 1F1JA 2GO1A 4D41A 4AY5A 3EXHB 1V8FA 1QVRA 2OZPA 4TMXA 2P6UA 1KP9A 3ELYA 3MUEA 2H3EA 2Q27A 4JHXA 2W6PA 1LI4A 1W4ZA 4OQPA 4W99A 3SBDA 3WRYC 4JBGA 5KHLB 2DTXA 2XDQA 4LYEA 4PZLA 4W8GA 1K66A 3QWFA 5AJYA 3FOZA 2PJUA 2IHZA 3ANMA 3ZCSA 4O4HA 4C05A 1UJ4A 5FWXA 2I80A 1YL5A 1U7ZA 1FUKA 1J33A 5REQA 4BLQA 1KAHA 2GF9A 2W42A 4RULA 1UOQA 1LBEA 1NASA 1ZVQA 4BCBA 3PLAE 2G17A 4IO0A 1P3JA 1PTKA 2FQYA 2FZ4A 1TJPB 2Q9AA 3IPYA 1FU8A 1NN0A 2VJCA 4HB0A 4P7FA 4MI1A 5EVCA 2J8ZA 3U4AA 1SH7A 2FPUA 4J7UA 5AOAA 2XD4A 5I9LA 3TTUA 3W5HA 4HFRA 4FT2A 2H2DA 2YH2A 3M4XA 1QK4A 4BZPA 5MN6A 5DISB 2PR7A 1WY7A 1Y1KE 3SYNA 2A4MA 3CW9A 4TQGA 2WHXA 1RWWA 1CK4A 1EPUA 1JHAA 1F38A 3IT3A 4ZHQF 2HLDA 1A96A 3SYLA 1XEFA 2FRDA 2BEJA 2P4EA 2ZQYA 2YINC 3T9FA 1B73A 5CXQA 1E5LA 2JARA 3QY9A 5T3YA 3ZZMA 2F3PA 3INNA 3UJ6A 1TYBE 1FLDA 4E4RA 3PENA 3Q12A 3AJRA 3ETCA 2YJ5A 2I6TA 4NCHA 1KJYA 5B4UA 5JS7A 3K3PA 4AW9A 1E3LA 2E2WA 4KLZA 1O9HA 2J9FB 3D6TB 2LE0A 1DEHA 2P3OA 3FAZA 3I2IA 1JA1A 4HPJB 4YDSA 5I5GA 3U48A 5KQGA 2OBBA 3VUEA 1UDRA 4LMBA 5KJEA 3ZVLA 3QPCA 5BR4A 1SD2A 3BFXA 4V1CA 2RG7A 4DHWA 1P4AA 1T25A 2ZBUA 1EE2A 3FNGA 4LYGA 5L7YA 5JFOA 1CDZA 2BLLA 2VF2A 3FJ1A 4X6YA 3ZWDA 1XQWA 3BJMA 4BNJA 3WWEA 3VDMA 2QX4A 4U7WA 2W6NA 2ZJ0A 3RGGA 4MDYA 1ABEA 1QCDA 1Y3AA 2AUMA 2A1UA 1VB3A 1IZ9A 4Q1AA 5G02A 1V8BA 5TE9A 3AR3A 2RHGB 2XMCA 5J1SB 2FUKA 4II2A 5LBUA 1B3BA 5JCOC 3DS8A 1E1RA 1M6VB 2PYIA 4J03A 4LWQA 1Q0ZA 3R44A 3ETEA 4MWDA 4NOKA 2DJIA 4NIMA 5BMVF 1EK0A 2GF2A 3NCTA 4L4SA 4OHKA 3W9SA 1E3TA 1NSYA 4UU1A 2C31A 4V0LA 1DAHA 3WIUA 1NQWA 2XTNA 4IIJB 2I3DA 4X97A 1XAIA 1PW5A 2XUGA 3PRYA 3FCAA 2OCKA 4BFSA 1PSZA 1CEEA 2Y1GA 2ZYUX 4PRYA 2Q3MA 4ZIRB 1QJ4A 3OE7D 1EGAA 4TMYA 5IDXA 5JYBA 1SFRA 4LFCB 2Q6LA 4HVTA 3AI7A 4OH7A 1M2NA 5TRTA 3SQOA 4L6IA 5KEIA 1LI7A 1TYDE 2GM5A 3DFFA 3RNOA 1CV2A 1XZMA 3Q1KA 1HEYA 2VKTA 4AY6A 3BYZA 1YK1A 2BBTA 1LQ2A 1Z88A 4UBLA 4PPFA 4I50B 5B37A 3AVPA 3M1AA 2ZWOA 4TLDA 1EP1B 2A9QA 3VYRB 4A03A 3H11B 1AKMA 3IB6A 1CFZA 2I8AA 4EB6B 5C7OO 3AKCA 3P9CA 4UE2A 3SK0A 4C7BA 4DG8A 1NY6A 4OYLA 2F1RA 1TXGA 1B8NA 2P6OA 3FA2A 1O77A 5TR9A 2ZI5A 4JB0A 3QUBA 4D79A 4YAIA 5KJCA 4TWAA 4AURA 4QHTA 1N78A 3IUMA 3HM9A 3JYPA 4ZOQI 1U65A 3P0FA 5DZSA 3PNOA 1R18A 3BIOA 4IQFA 4DKXA 1AXGA 3S4YA 1K7YA 4E2WA 3FAKA 3WGIA 1NZFA 2G67A 2ZBVA 1T8PA 1ORIA 2DU8A 2RBGA 5CFLA 1CIPA 1YASA 2X22A 3PIDA 4EGJA 2HN9A 2BI4A 4P82A 2W70A 3WP0A 1JG2A 1PE0A 1XDDA 3LDAA 2VNIA 4BWGA 5I45A 4WASA 1T5HX 4CN9A 3ELWA 3ZQ4A 5SZJA 2DR3A 3FVRA 1E63A 5KAMA 1F0KA 3KRTA 4XGNA 2P79A 4M0CA 1NVKA 4IIGA 4U0KA 1CCWA 2XVAA 5KYYA 2UUAB 1IHDA 2DOKA 5LA6A 2XCQA 4EF5A 1XGKA 2VP3A 1EM6A 1G8PA 2VTEA 4O08A 1ZGGA 4K26A 4NG4A 1WU8A 3CNOA 3EEBA 1CKEA 2VAXA 3ISTA 4EK9A 5JBIA 3PR2B 1X7XB 3EVEA 5TMBA 1IBKB 4AL4A 1H4QA 1G5IA 2QD5A 1BHSA 3EFOB 3SEQA 5J5VA 1VI2A 1OLUA 1TM5E 2QD1A 1TZMA 3TZLA 4IWXA 2O2ZA 5BV7A 4ARBA 4B3CA 4XCQA 1OFIA 2QRQA 1RIIA 4X92A 1CQPA 1GGHA 2O3QA 1A2OA 4OKNA 4BJ5A 1NQTA 4G5QA 3DW1X 3NAGA 1T3ZA 3GIDA 5CEEA 4YAUA 2CYAA 5CHEA 5GADl 1J23A 1J99A 2VRWA 4J1NA 4P4UA 5AHKA 3VSEA 4QLBA 1N7JA 2BELA 3CYFA 4YMIA 5JNUA 3JQRA 1UFQA 2EZUA 5IN4A 1LF5A 2WAOA 4DR6B 4ZI5A 2LNDA 5FLEX 5KOHB 2JFOA 2BR3A 2JAUA 1WPGA 3NFYA 4I1IA 2JA2A 5E8RA 2F9LA 3B6JA 1XYGA 2ZAOA 3AKEA 4R05A 3JQ9A 3VTZA 1J70A 3W3AH 2JRLA 2YZMA 3AZQA 3IKJA 1DDGA 2WKWA 1V6AA 2FEAA 2TMYA 3AR9A 1N1MA 3KZMA 4J0KA 5EQJB 3YASA 3X2EA 1FPQA 3BTSA 4S3MA 1JAZA 1DBWA 4KV9A 1HSOA 4J0HA 3GPDG 4GIBA 3D54D 1MHTA 4OQEA 4M4SA 1QPBA 5B7PA 3Q8MA 3UOAB 4ZO7A 5AM0A 4LWPA 5LIRA 1WOYA 3AT1A 3CO5A 5F12A 2VQ6A 2XTMA 2GJ4A 2PJZA 3JAWA 3SJ7A 1B6TA 1U7UA 2X7XA 3BGDA 3U26A 3D3KA 3M4JA 5AOVA 1B8VA 3NTRA 3L8FA 3FYTA 2ZIGA 3HNOA 4PYQA 3J81k 1H1DA 1FFSA 2EARA 3LPCA 4AZTA 5LDGA 1ZGCA 2QTTA 2PN1A 4MW2A 1ZNZA 1FQJA 2EG5A 4GI2A 4JR2A 1MBZA 3ZK8A 1SHJA 4F2WA 4FOLA 5K0NA 2AA3A 2XV1A 3ZW8A 2HA6A 3N2IA 4QTXA 3UMGA 5K0BA 2J5BA 2PKWA 3G7UA 2C82A 1M6YA 4FFSA 4HP8A 4JP5A 3IHKA 4JUIA 1YDMA 4Q4AB 5FBKA 2GTIA 3TX6A 1UPCA 1KSJA 2O7NA 1JFFA 5GY7A 4FFBA 3I83A 1W8DA 4CR7A 4C0LA 5JS2A 4UZFA 3TJZA 1QR6A 5KCMA 1N7IA 4G8JA 2TMGA 4MW0A 3B36A 2J46A 2FUG1 2Y1LA 3F3SA 1ULSA 3O8BA 4Q3KA 1FUEA 3PZRA 3U3OA 3VTFA 4AF8A 5C9ZA 1JSRA 2QVCA 1S89A 1RYDA 4C30A 1RCFA 5ALFA 3UHPA 1R9MA 4CM6A 2C8JA 3U31A 4UM8B 5DO9A 4TLBA 1V8OA 2X1LA 1JFLA 1XXHA 1E6WA 2HDNB 2P9QA 3KQYA 3PUKA 1OAOC 2JI8A 2WY2D 4AJ9A 5LU8A 4BLSA 1SBCA 3AK4A 2BHLA 4XSHA 3ZQJA 1C9EA 5JE8A 4Z1OA 4QPCA 2RHMA 5EUCA 2BEKA 1G8FA 4H18A 4E6EA 5KVVA 3O3MB 3EGIA 1RI1A 4X6LA 2JFNA 4B75A 2X5NA 3GDHA 4Q1CA 5FUQA 5HHTA 1YR6A 4ITVA 3FB4A 2P9TA 3NT5A 4M88A 4WBNA 1Z68A 2I4LA 2UUPA 1EUCB 2ZRFA 3T35A 4WDRA 2QIPA 2AWOA 5TS2A 4BZZA 3KQSA 3M6VA 4HPXB 2QXUA 1G291 1I4OA 3TQFA 5B64A 2CT8A 2I22A 3G2OA 4Q0MA 1KZ6A 1SB8A 4D46A 4P80A 2MCFA 3PQ5A 3DOOA 3UG6A 1JQJC 3N1UA 4F4JA 2OGSA 3ZU5A 4GHWA 1JEYA 4LTMA 3RROA 5DI3A 2GBGA 4LZWA 2W2XA 2O8CA 1E6MA 2PD3A 1V9CA 2QPAA 3QVWA 1F4PA 2AQ8A 3BOSA 5E4YA 1XTPA 1UKYA 1F2DA 5G4KA 2OBMA 4WK4B 3AJDA 1OYOA 1IBCA 3B5JA 4XIFA 2JFHA 2CY0A 3X43A 5JWRA 4JEMA 1SXQA 1IPEA 3ZWWA 2R96A 3CCCA 3X1ZA 5FBRB 1MB4A 1U9JA 5HUQA 3T5AA 4ZV7A 4LOLA 4HUTA 5M29A 3FYUC 2MYPA 2W2OA 4F6LA 2FGKA 3IP6A 4JUDX 4AVYA 2ZSBA 4GVLA 1KAQA 3BHIA 4JUFA 4C0BA 2J3EA 4NYMQ 4O1HA 1D2AA 5IKMA 4I6GA 4BAUA 2YNMD 1UBMS 3HEAA 3M49A 1D6NA 4UQLA 2IELA 5BN4A 1PTJA 1JLMA 3CNBA 1JHOA 3QV1A 1X19A 2OO5A 3K2EA 3N2GB 4JB3A 4UMVA 5FBLB 1OZHA 1SVUA 3GIWA 1ATZA 2ZJYA 3DB1A 4ARZB 2WP0A 4TS1A 1OJLA 2E21A 3KS9A 2A86A 1O6GA 1BE0A 4ZMBA 4C21A 3P97A 1DUIA 4EARA 1T4GA 3HMKA 4LDNA 1DL5A 4XGIA 3C39A 4UM5A 1JJIA 2RGEA 5PNTA 4BGDA 2FEXA 3TLZA 5CLLA 2CJFA 5DEIA 1IN4A 3R7SA 3VRHA 3CNLA 4M8NE 3OPYB 1K6XA 4R2HA 2OV2A 4ND7A 4E15A 4PX2A 2WJGA 4E2ZA 2E9SA 3PLNA 4J4HA 1T1EA 4TXLA 1PJCA 1KXZA 4EKEA 2NZJA 2GCEA 4IH1A 1SZJG 1ZNQO 4D92A 3QXGA 1NRJB 2B1QA 5B4TA 3S28A 3A4NA 4BXOA 4KXNA 2O8BB 4GR5A 3L79A 4ZMSA 1SQSA 4LJRA 2BGIA 5HCIA 3TQTA 4B3XA 2EFHB 4YJGA 1IYZA 4JJ7A 3HUEA 4XLTA 4YIKA 2GXQA 3CEPB 1BWQA 4PINA 2QDXA 1H69A 4UTPA 2W90A 3ZLVA 4ZREA 2WWFA 2LCFA 1M8KA 5AVYA 1AKEA 4MV4A 2CXNA 3SBXA 1HYEA 1QB8A 1A4XA 2EWWA 4IMPA 5LB4A 1JKIA 4JYMA 3W5IA 5IJ9B 4P0PB 3NYRA 4TTSA 3VVMA 4E4TA 2XNSA 4GLFA 3CVUA 1V8PA 3G23A 3LVBA 3NWJA 3WQRA 2COEA 2EF1A 1IJFA 3AYZB 3DBRA 4MUEA 2QZPA 3RVPA 3BJIC 1PGJA 4HQLA 5IBQA 4A2QA 2GM9A 2GBLC 4KR9A 2YL2A 3MMZA 4H59A 5JSUA 1C1XB 3K1AB 3B70A 2R84A 2GSWA 4NEGA 3IBYA 4TOIA 1A9SA 5ALMA 3EIHA 1TT7A 2RGYA 3NGMA 1RAGA 4RVFA 3TLCA 4PAGA 1P19A 4QODA 5KYUA 4UCFA 5C2JB 1KJQA 5C37A 4ONEA 2UZAA 1H0KA 4ZV9A 1Q84A 1ZEMA 5KTKA 3WL3A 2XNDD 3SC3A 5M2QA 2G4CA 1BXRA 3KIPA 2IYRA 3Q9UA 2HJGA 2JVKA 2IGTA 2CHUA 1BNCA 1UWCA 2AMFA 2X23A 3G5LA 3HCWA 3KKMA 4E22A 5KTOA 1P8JA 1IN6A 1N3LA 2CWDA 2R60A 1C4XA 3MCAA 5FF9A 3F97A 2BD0A 4REQA 3PDJA 5IH7A 1XK7A 1AGXA 3FTCA 1M1XB 3INYA 3IEMA 1RWXA 1QIKA 3IUYA 4V3BA 2JKYA 3ABSB 4B40A 5DTMA 1PNOA 3ILYA 2YXNA 4KVAA 3AERA 3JQCA 3QGMA 3R3ZA 3GUHA 4CQLB 4J91A 1DUSA 1HTWA 3QVGB 2WAMA 3VDXA 1Y8ZA 3GD5A 1U3CA 2XMSA 4RK4A 1ESMA 1AHPA 1TX4B 2ZUDA 1KEEA 2H7VA 3EEQA 1JTVA 1OFUA 4CTJA 4ZQCB 5H16A 2Q5JA 3W5JA 4Q4HB 2GM3A 4BO1A 2EQBA 1M0EA 3EVTA 1GUFA 5AVJA 4CXMA 2PRIA 1S1CA 1A88A 1YH3A 4I55A 4EFKA 1X86B 1G8MA 3D2BA 4MV9A 1RJDA 3VISA 1PJTA 4XD7A 3UFXB 4DB4A 2UYQA 5D7BA 2QM3A 2GXUA 2VDVE 3D3JA 2ZIEA 2NZXA 5EPOA 4ECAA 3LGXA 3DDSA 3Q7RA 3O1JC 5HM6A 1JWBB 2CHGA 4Q82A 1AHIA 2R00C 4GRAA 4ILKA 4TTIA 2OBYA 1XNHA 2BTOA 1CUIA 1SD5A 4TUYF 5BR7A 3LIPA 4HEQA 2OC4A 1JHUA 4EABA 4PZUA 1OYVA 1APBA 3ZVNA 5EUBA 1YS9A 4FUQA 3UXHA 1KJWA 4FGZA 4LN1A 1GGFA 1JR4A 5KOIA 1QHEA 1DELA 4Z4QA 1KJNA 2H52A 2P4HX 4OB7A 4A23A 6NULA 3OLWA 3ZE2B 1L5NA 5CDFA 3S0JA 3M6MD 1FZQA 3IT1A 2CXTA 4NI5A 5G4LA 5IRCD 2QSYA 3NM6B 5FT9A 4FYJA 3RVDA 5KJ1A 3F4KA 1CY0A 3G0HA 4WKNA 1DX4A 1S9DA 3TXAA 2XBLA 1QSGA 1AQLA 3PC8C 1YQXA 5E95A 4GH5A 5HKBA 5DHSA 5ENDA 1EBUA 2HIAA 1WMDA 5DNDA 2CNBA 2DHQA 4HRAA 3S2ZA 4DCJA 4KVGA 1J2UA 3O8DA 4A26A 4EUKA 1SXPA 3L0DA 3KLOA 1WMSA 1BX0A 1KZYC 1Z17A 3R76A 3S8YA 3CTPA 1DNPA 3K20A 4GPBA 1CPYA 4PRZA 2BHNA 2Q41A 1U3GA 4C89A 3PXUA 3VNVA 5GVSA 3KHTA 1CRQA 1V4VA 3AHHA 1B42A 4RL6A 4D9BA 4X95A 2FEMA 4FB4A 4CE6A 5I4IA 1Y9ZA 1ND5A 1Z3IX 4GT1A 2QW0X 4NAVA 4CEIA 5IVIA 3BMQB 3JVIA 3CT4A 3KELA 2VHCA 3MRXA 5E7MA 3RS9A 3RTEA 3BMOB 3FNBA 3A1NA 1K8YB 4A5SA 2VJDA 3CKLA 3WIVA 1L2TA 1M6HA 4NENA 3VR2D 1KTVA 2CVHA 2D1TA 1NSTA 2VO1A 2ZE6A 3FUXA 3MSXA 4I66A 4B82A 2DUNA 2NO1A 2FK7A 2DY0A 3EUEA 4I36A 4PYKA 3USES 5JFTA 1Q0PA 1ZD1A 2PT5A 3CLTD 3ZGNA 4AY3A 1RXVA 1P2SA 3A6PC 2JH9A 2H51A 5K0JA 1KDYA 1WUHS 5I4BA 1T36B 3O47A 3OQIB 1QG0A 1ZNXA 2P4QA 2DG2A 4NEHB 4DQVA 4YRFA 4B8ZA 3K6JA 4C0XA 2ONJA 4RTJA 4LXYA 1XMVA 4QTYA 4QVIA 4JKYA 1BAPA 4XGQA 5I7EA 5KNDD 4L1KA 4KKVA 1L5FA 3DMDA 5H7XA 5DVZA 5IJ0B 5BV8A 3I73A 4QPNA 4MJ3A 2V7XA 3LT2A 5JSQA 1SCDA 2C96A 1ZONA 1UIMA 3NH9A 4XB2A 3ZQ6A 5EOVA 4AKHA 4EAQA 1JBEA 2G9ZA 4CIVA 2PX4A 2CF6A 4LBZA 4LPKA 4NYIR 3L4KA 4ARIA 2P9ZA 3IMGA 2MJLA 4A4DA 1CUYA 2ZYSA 1U1GA 3X3HA 2QT9A 1BU5A 1C29B 4CF7A 3AOEC 3PXGA 1JR2A 4X91A 4EITA 4OHRA 1U2SA 1UPAA 2IBSA 3ZIDA 1VE1A 1Z25A 1II8A 2Z56A 1U8UA 4QBHA 2A88A 2YMMA 4PV7A 5KTYA 3OCJA 1AXEA 4UHHA 2RBEA 3KZVA 1IXYA 1Y3IA 2UAGA 2ZS8A 3FCOA 3PGXA 3QW2A 4FX5A 1PDVA 4HG2A 4L0DA 2DKOA 7ABPA 3GH3A 4YS6A 5CDTA 4KJZA 4PZDA 1W73A 5C3MA 1ZN2A 3UMMA 3CVXA 5T6BA 1XTSA 1KJIA 1XU4A 5IP5A 3UANA 1MZVA 1SIUA 2AD1A 2RGAA 5BSGA 2NVUA 4QWMA 4UJ3A 3PQDA 3AEQB 1YBHA 4ND6A 3WGHA 2FRXA 3WZLA 4ARUA 1AM4D 5K3EA 1GDTA 2IHBA 1WQ4A 5ALEA 1QIEA 2G04A 1H2XA 3B9PA 3CJTA 5IC6A 2I6QA 3MWLA 5AI0A 4WN9B 1T2CA 4CUJA 3B9RA 1LRLA 1RC8A 3PGVA 4NZMA 4CM8B 3DCJA 5E2AA 4GNRA 2YVLA 2ATXA 3BSFA 2WKPA 3MFQA 4ZEXA 3PBKA 3SVTA 1H8EA 3H5RA 4JR0A 3O4FA 1G5PA 2BAGA 4IKPA 2XIJA 4NCXA 2IU0A 3WHKA 4G5RA 3P52A 4Z5XA 3GT0A 4BIMA 1ZH4A 1DBVO 4TL6A 1L7VC 1RACA 2GWRA 4QUHA 3W78A 1GDHA 2LUOA 5TGZA 2DFNA 3MRVA 4YR7A 1L7XA 4H1WA 3HVIA 2XUPA 1DOAA 1PL6A 3LCMA 2CK3A 3JCZA 3FROA 4COOA 1EP9A 3HLTA 3V80A 2V6JA 1NYQA 1LW6E 1BCRA 1TJ3A 2FXVA 1GPWB 4HDSB 3HCNA 1XT6A 4YCLA 1QQ6A 2MSDB 4L5BA 2IOFK 2VF7A 3QEMA 1D1SA 1YA4A 2ABWA 3CLRD 3DLCA 4KSCA 4RVHA 1WXQA 3EIFA 4RIFA 5DXAA 1GHTA 4YP1A 4CF5A 4CYMA 5JMTA 5ISMA 3MS4A 4UUQA 2ZQZA 1GT6A 2H59A 1VXRA 1E2BA 4I4IA 4A0GA 5K3BA 4EUNA 3F9CA 4N3BA 1DG9A 4XJXA 3LK6A 3SC2B 5C8ZA 2OQIA 5L3QB 1GPMA 1K0UA 1SHKA 1TF5A 4PONA 3V8NA 4JT9A 2BFCA 3WLEA 3IBGA 4IUCS 4U5XA 2D3WA 1ZI9A 4Z0NA 4YUWA 2ILVA 4HUQB 4L0CA 2PRKA 1CNFA 1R4MB 3OZGA 1ECLA 3HU1A 1NYTA 1DZ3A 1TQ4A 2BL4A 2HA0A 3C3AA 4JAVC 4HSGA 1DQSA 5CH8A 1JKFA 5AHOA 1HZZC 5DYYA 4IGIA 1PAUA 1V96A 5C8YF 1KEUA 4LHEA 1H9BA 3CBGA 2QRVA 3BXFA 3FCEA 3KT0A 3FCSB 4DV2B 1R6UA 2AOUB 2C7GA 2X0DA 1K9VF 2QRKA 4IMJB 4RKRA 3ANNA 3I72A 4RM3A 4CLRA 1JDSA 1Z28A 3AF4A 4Q9AA 2WIJA 1SC3A 3JQPA 3JWEA 3GLFE 1SN7A 1M7BA 4R98A 1K7SN 1R9GA 4JLDA 4TZTA 3UAVA 3MELA 3OJFA 4AMYA 1J0EA 5ICEA 1I7DA 4YRBA 3CH7A 1O57A 1DTEA 3REGA 3UAWA 3SZOA 4OTZA 1OBHA 3KSAC 1RW4A 2YBEA 1OREA 2LWIA 5JEEA 4XIJA 3UOGA 3MS7A 3LV8A 4N03A 1PX0A 2H4ZA 3GVHA 1MAWA 4ZDIA 3U7FB 4MAAA 5LZ5A 1R6AA 4R6XA 3A1VA 1UBOS 1RYYA 1FP4A 3OM8A 1BFUA 1K3TA 3AV3A 3B2EA 3BWYA 3Q9NA 1R5JA 2E4AA 4MO2A 1VL5A 3HCEA 1OFHA 2WR8A 2XUJA 4Z9FA 5AESA 1XCPA 2CE7A 2BFOA 4DV1B 4TKMA 2ZTMA 1IZ8A 1M6NA 1NPYA 3HA3A 4TS3A 3PD7A 5BQOA 4NS4A 3R7BA 1ZD8A 1MNAA 3WWOA 1OAAA 3UJPA 3PE4A 4R0VA 5DHUA 1VBNA 1HC7A 4C78A 1WVIA 1T9CA 3G9ZA 4BO9A 1AO3A 1L7MA 3O38A 3H6KA 3FVVA 3G7SA 3P8ZA 2X4DA 4K2AA 5HQ3A 3E9YA 1JA9A 4KW7A 2AYYA 3GQVA 1ZN7A 4M60A 3TUIC 1XPUA 3VOSA 2B3TA 2DKNA 1SIOA 3EGDA 3KKQA 4U9IS 2NT3A 2F55A 5TVGA 1J21A 3ZEAA 4WZBA 5F2NA 3AEUB 3OQPA 2IRWA 3GY0A 4JLMA 4C22A 2GH1A 4DBLC 2J0SA 4N8EA 1T5BA 2PJRA 3MCUA 3ILSA 1W85B 1ZJZA 1B00A 4IZ6A 5LQJA 4HTFB 3DV2A 1CD5A 2YV1A 1N1EA 4LF8B 1SKMA 3ZY4A 1LNZA 3ASVA 4J1SA 4GDMA 4M0UA 5C1DA 1NG1A 3O2JA 2OHIA 3C3PA 3GF4A 5CVJA 3VAZA 3VJLA 2ZETA 3BGVA 5T8KC 4KQ9A 3RNLA 5K6AA 3AWDA 4HI0E 3WSVA 3A3NA 5D2CA 3WICA 3PQ8A 2QZJA 2UZIR 3RU7A 4B43A 4UDOA 4XARA 1JX6A 2XEXA 3CW2A 5LNK6 2JCBA 4A92A 3E6AA 1S02A 3IOYA 4CVNA 2WEKA 3OX4A 1KSFX 3IAM1 1PN3A 2EWMA 2W71A 1TCCA 1CUHA 2ZBRA 4J0GA 3SC6A 1OI7A 1U1FA 2VRCA 2K6GA 3GFGA 4WOJA 5F7XA 5KWSA 2VXOA 5CU7A 5LOVA 2G08A 3MAAC 5J9FA 1UXGA 3OLYA 4GLBA 2OYSA 3K92A 2HHJA 3NANA 2OHHA 4ZCPA 4Y2HA 2PYDA 5JNSA 3HFJA 2ERYA 1JT9A 5JI3E 2WILA 3NIBA 3QTBA 4J8PA 4RJJA 3LC7O 3UHOA 3NYIA 4RMGA 4DJAA 3JWPA 8MHTA 1MZPA 1P2DA 1VIAA 3Q7EA 2X9GA 1RP7A 4RPLA 2WPDD 5A05A 1EWKA 2ZRCA 4LNHA 2ESRA 4MA4A 4LY0A 2AUTA 2IZ7A 4CV1A 2JBHA 3KUKA 2K2WA 5F98A 3MOSA 3UXYA 3V46A 2F3TA 1YVDA 5FTNA 2QL9A 1B0PA 1LVGA 2HQ1A 5FRDA 1MRNA 2VJAA 2C98A 1O95D 1Y1SA 2H2GA 1M33A 3KTOA 4HYQA 2JD0A 2Y4OA 1PWXA 3GFFA 2IVZA 4D1YA 4D5GA 4F1JA 1XKTA 2O0HA 3OH8A 1QAMA 4FK8A 3N5CA 4OPMA 4X60A 5I7HA 1DVRA 1M0WA 1XHLA 3CRNA 3UAYA 3KXLA 2IBTA 2X0FA 4JUCA 3ECCA 4M46A 3WRWA 4JI4B 1CF4A 2OD2A 1J49A 2QL6A 3HB5X 4MGHA 5CB6A 2HJHA 2ONYA 4KJXA 4RVUA 4HL6A 2RHHA 3BD6A 3BJZA 5T5QA 3V7YA 2AS0A 2CXQA 2ZBEA 3AY3A 3VHRA 2RFLA 4JJEA 3W34A 3R9KA 4C0HA 3TNYA 4MV8A 4C01A 5E1BA 1HV8A 1OLOA 2C0QA 2H3HA 3CXUA 3ESYA 5GMOA 1A8QA 2X0JA 1PJAA 3PJFA 4MEJA 5A2GA 3HQ4O 3P9SA 2AMYA 2GCIA 3ZZ1A 3TG8A 4B7CA 3PPVA 1GRQA 2YN0A 4N5HX 4GW3A 2WAXA 3IMEA 2P8SA 4KR0A 2I7DA 1XLTC 4LJYA 4H3VA 1RVDA 3A1UA 3C24A 5EJAA 4DG5A 3WAGA 3E3MA 2G8LA 4F1KA 2YIJA 1LV7A 3N2LA 5IJXA 2B37A 4G3XA 2EL9A 1FVXA 3G0DA 4HXYA 1C4KA 4OX9Y 1CQIB 4QRIA 3KYIB 1EZ1A 1U5BB 3KKNA 4PSAA 1MU0A 1UPBA 2WG2A 3B3JA 3C87A 3FSGD 1J0CA 4XX0B 5HPYB 4OHFA 2ROQA 5CCEA 1XP5A 2YOHA 2YJ6A 3AUUA 3WBJA 2YOGA 3G0GA 3KXKA 4XA8A 1ESNA 2QE7D 4UHDA 4XLZA 4FVTA 4BKOA 3HCBA 4Z6KA 3UATA 3ANSA 4BO3A 1ZJYA 1HO3A 1UJMA 1D09A 3MT7A 5COBA 4Y6SA 3U39A 1W87A 3BRQA 2YWFA 2V1XA 3IUBA 3QKWA 4LMAA 4X71A 5ESXA 1ZIXA 2POQX 2PSEA 4PAMA 1EX7A 1NUUA 4BFLA 3CR8A 4RESA 3QKRA 2E87A 4ABTA 5KQRA 2PX5A 3TZBA 3U0BA 2XUHA 3BWVA 3AHEA 4F9FA 2QQGA 1ECPA 1PVVA 4BMNA 2CE2X 4C87A 1J24A 3ORHA 4XJTA 5AHRA 5EAIA 4YRZA 5LJIA 1V5EA 3QUCA 3D0KA 3RTDA 3TNDA 1NVUQ 1NQUA 5KS2A 1FYVA 4KX3A 1YZUA 5DT2A 4R7ZA 1WB5A 2JJMA 3T1NA 1DC8A 4FYPA 2PX0A 4JOBA 4ER6A 2BEWA 4GGOA 4BMPB 4D96A 4IBOA 2ADMA 1BVRA 1Y33E 4BJHB 2YJTD 3OFNA 4CNQA 3Q1LA 2G25A 2PMCA 1SULA 3F46A 2BJWA 3C6XA 4UXJA 1YZ3A 3PXXA 4DTCA 4E4YA 3PDWA 5JJIA 2D1FA 3PIRA 1IN1A 1TL7C 2GESA 1LDBA 1TYAE 3PRKE 3UFBA 4EYEA 1I4TD 4US0R 2G0AA 1TK3A 2G0NA 3ZWXA 1WXXA 2RI6A 2VDUE 2BMFA 3EE6A 1XMIA 3EODA 3HWX1 3NTXA 3IPRA 3RRXA 1BG6A 1HORA 3KBBA 4UMDA 4YT8A 1US8B 4I6JA 3V1NA 1R4NB 2QJFA 5EINA 2IS1A 2YV2A 2B92A 2P5YA 3FFBA 4RU1A 3W1VA 4ALMA 3NM5A 4CMAA 2AN3A 3B7GA 1U7OA 1ZCAA 2O8NA 3KFVA 4DLWA 1X77A 3RGWS 4PY2A 3MBOA 4KQXA 3SAJA 3WYEA 4J2TA 5M7EA 4CQMB 1ESCA 1ZLXA 3EOAI 1WB9A 4O63O 1FVOA 2G06A 3BWEA 4PZCA 3A4YA 1DEOA 4UM7A 3U1TA 1JLRA 4K8RB 1JPVA 1RZRA 1E9AA 2QU7A 5JSYA 2RC5A 3JVVA 1BKDR 1DPFA 3I92A 4LNAA 2VYCA 4BQSA 4JLKA 1JZSA 5D5PA 2P68A 1TQ6A 3ISJA 3H75A 3G2NA 4DG9A 4DMUB 5BWCA 1TKRA 4QLOA 3IURA 3R3WA 2F1HA 5JO9A 5IDQA 4WXYB 4EG8A 3AJAA 2J3IA 4DLUA 1L4BA 2UVQA 3D5QA 5C0OE 2R2GA 3WLAA 3FJOA 4B2PA 4HBGA 4FMCB 3ZS9A 3GGPA 1NM5C 4U7HA 1H6DA 2UZ1A 2NXJA 3PJRA 1PIWA 3EX7C 2YRFA 4EIWA 2IHVA 2TECE 3FNQA 3LWZA 2GPYA 3GZNA 1L5ZA 4FEEA 1CZKA 1JWAB 3PGMA 3CN7A 4IIUA 1WG8A 4N3GA 4NZNA 1PFUA 5F78A 1OV6A 2OQRA 3DA8A 2V65A 1RI2A 3ENNA 1RWOA 1RBYA 2QAJA 1JIQA 3VOTA 4Z0HO 1Y6GA 1U04A 2JLRA 2I2XB 4JJIA 1YCHA 4XIYA 4D6XA 3A2KA 4L28A 2OHXA 1Y3FE 1K7FB 1GWNA 1W6RA 4H7PA 1YV9A 2AQKA 2WNIA 3HBNA 1Q7CA 4FQ5A 3AF2A 5DM2A 3PG5A 2XRZA 3DL0A 3NUZA 3L77A 4RZIA 3M6FA 3ZBPA 2FH5B 4EHIA 3JTMA 5LQUA 2FK8A 3MCZA 1W75A 2QTAA 5FHRA 2RHCA 1OGJA 3E7WA 3AUSA 1KKMA 1ZINA 4O4JF 2DC1A 2H2HA 3PUXA 4NVRA 3F8TA 4TV8A 3KPVA 5BW8A 4BNTA 2BEVB 3R0XA 2GNOA 2Q2VA 1XQYA 1PR3A 2Q2WA 3H5NA 3LO5A 1I51A 3H5AA 1GAQA 4QEZA 3RG8A 2Q5CA 1HFEL 2ZULA 1RD4A 3C6ZA 1UCFA 3MGBA 1SWWA 4WINA 2YYZA 3E3NA 4JI2B 2AMJA 3PVCA 5DLPA 1FRVA 1VECA 1LX7A 2Z04A 3FF4A 1U9YA 3CNQS 1SCKA 3GVIA 4G1FA 4AICA 3L84A 3RRJA 4B2IA 1MA0A 2G28A 1FTSA 3EVBA 3T61A 4CKCB 4XX1A 3ZZUA 3T41A 1TW3A 1F3OA 2R6DA 5CYOA 3VHLB 2ZJ7A 3D1VA 4IIHA 4PQRA 5FR2A 5AVZA 1QHHA 4KQWA 4LKOA 1YZVA 2OXTA 3G2JA 1NUTA 4E2YA 1A1VA 2FPWA 3K4HA 5E3JA 4LGMA 4I5GA 4ZICA 3NBQA 1S4MA 3SY8A 1PGPA 1VHDA 3O3CA 4Y1RB 3TSZA 4MUFA 1IZ7A 4K9NA 5FTMA 1J1IA 1ZP6A 2GFIA 4DV7B 2B35A 2A9FA 2Q3DA 4QVKA 4ICIA 3D7RA 3ICQB 3UWMA 2BFBB 4G63A 3B1VA 3THXA 4HWRA 4YIHA 4ZYYA 1P73A 5TQVA 2I7XA 2VUSA 1ZA2A 4E2XA 4TVSA 3IE1A 2C5GA 1A72A 1Y42X 3WWDA 1BE8A 1ARZA 4CCYB 5JQGA 2Z2JA 5KNDH 3AUAA 5FFNA 1MABB 1DJQA 3IIIA 3X2SA 4NYJR 3WS7A 2OXRA 1P0MA 1T1JA 5EMKA 4MWZA 4S2EA 1Z5WA 4M0DA 2P5UA 1G19A 1GPYA 3UC9A 4EI8A 3I2KA 1S2GA 3V8PA 2REBA 3GRKA 3OZEA 4LDAA 2OZLA 4RTNA 3GLIA 1Z63A 4HATA 3FFAA 3WLRA 2V96A 4RA9A 1UMCA 3B20A 1IOVA 5ALWA 2HA3A 4MVJH 3TEFA 1HOXA 2GN4A 1T8UA 2WMDA 1NDQA 2YWHA 3DCNA 3G88A 4WQMA 3U19A 4BNLA 3D3QA 2BZ0A 3CUEF 3PWKA 4IW3B 3L7AA 2YN2A 4JB2A 2AJCA 5FWYA 1BJKA 4HRVA 4ITRC 2OA0A 3KQKA 3B8EA 1ZUIA 1JKMA 1W52X 4Y2YA 4CF6A 4EVRA 3ZIUA 1IC6A 1L4YA 3GCWA 3A9RA 3LCJA 1QFYA 3D1LA 3FUWA 4RZSA 2FZEA 2ETVA 3QEKA 3E18A 3RC2A 3QXJA 4MVJA 5A4AA 5CMLA 3PQ3A 3P2KA 1NBEA 5JYEA 4QU5A 4Y98A 3R40A 3W04A 3KR0A 2C83A 4MP8A 1ICIA 1E5VA 4J0FA 4OIMA 4CPDA 1QP0A 2JLCA 2PX6A 4YCNA 1PW7A 4GWLA 3AEZA 2X4IA 3L0SA 3IDFA 1PEYA 3RLIA 2IH2A 2GHIA 1CW2B 1XA3A 4F3YA 3TOZA 2XBMA 4WRRA 2NUPB 5JVDB 3NG1A 5FOVA 4E11A 2P7IA 4W6QA 1IHXA 3L8DA 4M9ZA 4L2IA 1OXSC 1GADO 4AXBA 3O8NA 4EYKA 4UOEA 2Y99A 3BDVA 3H2HA 4ZI7A 4NAUA 1ZHOA 2LGJA 4RZUA 3V4ZA 5HJ2A 5HK9A 3MJVA 2H54A 4DNQA 5JSHA 2M98A 1F8UA 2EAUA 1LSSA 3V7WA 2WF8A 1SUPA 1JDPA 2XYVA 4MLCA 1T1GA 1T3SA 2PUJA 4CU2A 5BV2P 3QOYA 3UMSA 1IUKA 3MT8A 5BW5A 2OPHA 4A1OA 1FMCA 1YS1X 2Q07A 3U4CA 5H59A 1NVAA 3N9IA 2A9VA 1NE2A 1W581 3JRWA 4FPXA 1AUXA 3I1YA 4R8SA 2AZTA 2J33A 2VDMB 2OM2A 3JAKB 1MDBA 4Z1MD 4EFLA 1U8AA 2XQGA 3NHWA 4M1YA 4YMHA 2BHTA 1ZJ6A 4BLVA 1RI5A 3MWJA 2VSOA 1N4AA 2QYSA 3NIFB 1X7GA 2F8MA 1NUAA 1YE5A 3DEFA 1NHGA 3C3CA 1HK7A 1YC2A 3AZOA 3SS9X 4ZHSA 1ZJWA 1I13A 2N9UA 4YRKA 4M9SA 1JEOA 2JI9A 1VOTA 4LJ6A 2IYAA 4LWOA 5CYGA 2IZOA 3MB8A 3JVUA 5K4HA 5ILQA 2AW5A 5TGDA 1JHRA 4QGGA 6CHYA 1A97A 4ZQHA 1WMEA 1PK8A 2B8EA 3KYCB 1L9XA 2B78A 2VDWA 3FTPA 4FSXA 4I3GA 4RFLA 3W8FA 1KOGA 2ID7A 4YJ3F 3NALA 2P2LA 3H0EA 2GSDA 2YBDA 4X5OA 5DGHA 2I3AA 4NJMA 4HQRA 5ALTA 3EGEA 2QJRA 5KNBD 2VZ8A 2ECKA 5A4MS 3JQGA 3WNZA 3OPNA 3ZS8A 3ZHCA 5FV4A 5IAAA 2C1XA 1Z3CA 1MX5A 3A25A 5CM2Z 4C0SA 5IAOA 4KQIA 3KZCA 4RELA 3TTYA 4M0MA 2AOVA 3F1KA 4QU0A 4K9MA 3KSDO 4HH3C 2VUTA 3BIWA 4JS0A 4JVSB 2F1OA 3THOA 4D0NA 4E03A 2A9RA 4MIOA 3LY8A 4OO3A 2WB2A 2V0GA 1P77A 1T8WA 4IVRA 4MXDA 3TEJA 2CJPA 4L3WA 4G5XA 1XVVA 1WEKA 2C07A 3RVJA 1CJVC 4JL5A 4TV9B 5AW9A 5ALGA 5FNVA 4LZOA 3GLHA 3CIFA 5CGZA 1YSCA 2ZPAA 3EDCA 5DHFA 4NWIA 2JH3A 4Q47A 2NTYC 2ZWAA 1YB1A 4M1SA 5GAJA 1SXJA 2CL6X 4G0MA 1PR0A 2ATIA 3F74A 3BXZA 3PQ7A 3KFXA 4GI3A 1C2YA 1X7ZB 3K72B 5F3RA 2FG7C 1WMBA 1B0AA 5G40A 4AMUA 3CVYA 1CUGA 1LBIA 2EQAA 3EUFA 3L8YA 1BDHA 2OAQ1 1W29A 2Q21A 2M6LA 4YDHB 4B0PA 2NP7A 1XV5A 4R8VA 2JKVA 1P45A 2QE6A 3EZ2A 5BVHA 3UA3A 3V33A 1R5NA 1J8MF 2WU8A 1U7XA 4Y9UA 2BFPA 2WHPA 5AT1A 5BMOA 4O5OA 4R7GA 1MLDA 3F5SA 1Z33A 1YB6A 3GELA 4MRNA 4RJ2A 3ZWPA 5KO2A 1BW9B 3MA0A 4Y2SA 2I54A 1UFKA 1Y5LA 3VOAA 1XD2B 3BCUA 4MUYA 1FXUA 2XMDA 1W4BA 1XLUA 3V97A 1I7SB 4ZYZA 1Z8HA 3I1JA 1Z6TA 3EC7A 2QD2A 5H3CA 3USCS 2RH8A 4H7JA 1TKBA 2QYHA 1YR3A 2P9FA 4UOQA 3IT0A 5G1PA 2NG1A 3U40A 3FTNA 3GEIA 1OGYA 3DE6X 3GMIA 4NZYA 4MHSA 5DWVA 3QI7A 1KHTA 1ODCA 3RASA 4CMEA 3VDRA 4YWHA 2XXJA 2N46A 3ENVA 4GNKA 1PK9A 4B83A 1QF9A 1VI6A 3VKUA 1C80A 4KXMA 4NS1A 2FZVA 2GD1O 4KP7A 3QXCA 3NEYA 4HB4A 1YF3A 1W48A 5FL7D 3ILXA 2VP5A 4GOOD 5CA1B 1T8SA 3BDIA 4H77A 3JD4A 2ODPA 2W43A 3HCCA 3IYLW 3MFYA 2K2QB 2F7SA 1G9XA 3AF1A 4HAOA 1FTYA 1GV0A 4XWYA 5ARCA 1LXCA 3KZKA 1VZ3A 4GWKA 3R7DA 1XLWA 5C52B 3HXOA 2ZPUA 1M2VB 3AEKA 5J3JA 3QPBA 5AJHA 2DUWA 2YMQA 1AC5A 3V9PA 2QTZA 2VYNA 4MVJG 5D6OA 1RNLA 4D4LA 2VZEA 4GC9A 2BGGA 4E3ZA 3N2KB 4ZHQA 3NGLA 2FW1A 4X54A 1B0ZA 1B76A 1FX0A 4JP3A 1YDEA 3VO9A 3FYUB 4A8JA 2MHCA 3V34A 3UN1A 3TFWA 1QE0A 3FMGA 4EJSA 1F2VA 3B5IA 2GHTA 3C5HA 2OYRA 1DAPA 3NDJA 1U7HA 1I94B 3GR6A 2VSNA 1B8OA 5EJ4A 1IUNA 3GUYA 1NJ8A 5JROA 4KFCA 4TYPA 3W5AA 4ZK2A 4KREA 3FUTA 1JA0A 3UC5A 3WO0A 2ZR9A 3L0IB 1GKUB 1XZQA 4OQQA 4JP2A 2BHRA 1FDOA 3SR4A 1ORTA 3JSXA 4L8VA 1W5BA 3RWMB 3U7HB 3HV2A 2VTKA 5DBGA 2SKCA 4MITA 4YT2A 2YICA 4J0QA 2J4DA 3UG7A 5I4KA 3QQ5A 4HDQB 4IHJA 1NJGA 5ANRB 4INOA 2H1LA 4EVQA 3EAQA 4M1KA 1YS7A 2GZ2A 1QZZA 3QA3E 1JQ5A 4XSGA 1C30B 3AETA 4GC5A 4DRXB 5B2EA 4URYR 2VL7A 5JAQA 3ZQKA 4DT1B 4M38A 4LZZA 2ZSFA 3QFCA 5IXSA 3VVLA 2EFCB 1MC4A 5AKIA 3ZN2A 5JO0A 3HY3A 1H3NA 3ER6A 4RPJA 5J4YA 3DZHA 3NHRA 3AHJA 4MICA 4Q1EA 3VVCA 4DXAA 1IY0A 1GVNB 2QS9A 4LBVA 4NL4H 3WGTA 2FHSA 3OQNA 3OTOB 4G5HA 2IL1A 2IF0A 4ZVTA 4GI5A 5ERGB 4JEHA 3R9WA 1RWNA 3LUHA 3M7IA 4WNCA 3FDJA 2AV6A 1GU0A 1H3FA 2QPOA 4L8GA 2SKEA 3ANXA 4D4IA 4JQSA 5FTJA 5F2KA 4GR4A 2TMDA 4KXVA 2J87A 5EZSA 1F5NA 3S2YA 1I5RA 1NV8A 1MH9A 3AM5A 4KO3S 2NN3C 1E1DA 4BS9A 1S6YA 1T91A 2D7JA 3MTQA 3QKUA 4GZ3A 5CA0A 2KLHA 1Q0TA 4UXIA 4ZU3A 4D9NA 1E6LA 2CLEB 2NNWB 3BAZA 3BA1A 4MVJM 4XUDA 2OZKA 1ULHA 1UM9B 4ZPJA 1XLVA 4JD5A 4RV9A 4QEKA 2A7QA 4BQEA 1P75A 1XZLA 2LTAA 3MXTA 2VLIA 4HLUA 3D4LA 4LVCA 3K73O 4DUGA 5FUWA 1XYYA 1LS1A 3BMCB 3GA0A 3RODA 1PJZA 3PVZA 4LDQA 3OC0A 3QSGA 1V9LA 4EUFA 3UJNA 3A9UA 2NU6A 3VR4A 2W7TA 4QPZA 1Y7PA 2ILTA 4K46A 4EB3A 3CLSD 2PUEA 5HKOA 3M9XA 2HPVA 3CH5A 2X76A 2HCFA 3KLPX 1E6EA 1QAOA 4TKUB 3L0PA 3OM1A 3IQFA 3RSGA 1GGJA 3GCGA 5IANA 1MIOB 3DO8A 5FPTA 4EHHA 3RYCB 4O2BA 3DD1A 3IXLA 2WM2A 5CFRA 3ISVA 4BNIA 2DPGA 2FWAA 5HS4A 5IJZA 1JZQA 2O06A 5JNRA 1QRSA 3VKVA 4XPIA 5BV1A 5H3HA 5IMBA 1URPA 1L6RA 3PC4A 3QE0A 3GJYA 1WR8A 4KUHA 3S1LA 1VYHA 2H85A 1YR9A 1JR3D 2A58A 1FF9A 4B8YA 1YAHA 4G0WA 3HBAA 1WZ2A 3AUFA 1E92A 1IDN1 3GDGA 1H9AA 3WI7A 3E58A 4YP5A 3EZ9A 2ONZA 3E5MA 4GSKA 3VJRA 1WJGA 1TC2A 3NHPA 1V11B 5H83A 1NLMA 2JI6A 5I7VA 3ETJA 3TOSA 1DIAA 4LE2A 2DLDA 4Q4DA 5H80A 5KMGA 4C2TA 2YQ4A 2P2GA 5BSRA 4GX2A 4W5HA 2XNCA 4RLFA 5CT6A 3NUGA 2Y1XA 3E53A 1NI4B 3UHAA 4C4AA 4ZVQA 4ZT7A 3BVPA 3HUFA 4E2FA 2PZBA 3MCWA 3ER8A 2JLSA 4MI6A 1LPMA 2ZG6A 3TUJC 4W5QA 4X84A 2ZYTX 3DHNA 3NPAA 2FWRA 4RZXA 1YZLA 3H2YA 3OT4A 1VIDA 4RZ3A 3RS4A 4KWHA 2JFVA 4LZAA 2RHJA 1Z38A 2X1MA 4V0RA 4YP0A 3TRJA 2B2CA 3WJ2A 1FS6A 2Q3LA 2VNAA 4BMDA 3N59A 1NVTA 4E32A 5I3CA 1D2NA 2QROA 3HFRA 4OJNA 1E9VA 1U7DA 1WDLA 2FX3A 1XYVA 2OO3A 4RHTA 4KLNA 1HR0B 3K1JA 2QTRA 1XTBA 2YHAA 4YJ2B 5F7JA 3EXHA 3KD2A 4KG7A 2OXCA 1KPGA 4ZVPA 1W59A 4YLEA 4IFIA 4RADA 1AGRA 2YWCA 2YWBA 3ANLA 3T3MB 3COWA 1VG8A 2HCBA 1PG2A 4NCIA 4NH4A 1E1LA 1ATIA 3FMPB 2XT0A 3DE3X 3AL3A 2TYSB 4EVIA 1G4HA 5FTWA 3VPSA 4A82A 3ZHTA 4IV5A 4I1UA 4N7BA 1UDXA 2VPYA 3NTQA 4M36A 3AF3A 4YJHB 4BO6A 1NVXQ 2GPTA 1G2PA 1LX6A 1O9BA 4FOTA 1U7TA 2F17A 3X2FA 1JMKC 1CNMA 2ZVDA 1JVBA 1A9YA 5JZOA 4BVHA 2HWKA 4JLUA 4LIPD 1NN5A 4QFDA 1JIXA 1S0UA 3N2YA 1MJNA 5F76A 1V5GA 4LJSA 1TJNA 5G1NA 5E9JA 2MSLA 1EFVB 3CRZA 1OWOA 5IVHA 3FNIA 2XKBA 5LIPA 3B8HA 4ZRMA 4B71A 2WVGA 3Q87B 1OFVA 3WB2A 1DC7A 1QUEA 1K63A 2XUKA 3DBLB 2G82A 3Q5DA 1EG7A 5GJVC 3EXFA 3TB6A 3W05A 5J4KA 4C07A 4H08A 2DFLA 2XOXA 4FGJA 4N12A 2QTGA 2ZT6A 4DA4A 2V74B 4NC9A 1S2OA 1FCJA 2QRGA 5A5FA 3FHTA 4PSCA 2FEPA 1MQSA 2OECA 2VHEA 2A9OA 3WQHA 3IEVA 1V1RB 4CMIA 3COJA 4IDQA 2DLNA 4ZRDA 1BCSB 2CN1A 2MSEB 1KZGB 2AFIB 1COWA 1ZVJA 4RO0A 5E6RA 5ECWA 2Q50A 2X8JB 4B3BA 4ER5A 1N9ZA 2QN7A 2WM3A 3ON5A 5GJBA 1N5KA 2KI5A 3C97A 4MGKR 1UJBA 5K0EA 5FAKA 1BMFA 3JQQA 5B58C 4KLCA 3LE8A 3NHKA 1IHOA 1TT5A 4FLMA 4DLNA 1Z4KA 1NVGA 3BHJA 3HKBB 3MTIA 1GTMA 3PYXA 4IQGA 2QX7A 3PQ6A 2QEQA 4B84A 1QWOA 2B20A 2H11A 1YQEA 5AH0A 1C0PA 4RKQA 3Q98A 4K6CA 4C6TB 4ZOBA 3R7WB 1BA3A 4P5EA 4RH1A 1BXGA 3JQ8A 3DKVA 4QNMA 3O2NA 4QQRA 3DPSA 2OGZA 4QYSA 1SVIA 3ZKAA 3HBLA 2F3SA 3OZCA 2JGRA 5IG2A 5KVCA 1JQKA 3IMCA 3LYAA 4HJXA 1G7SA 4I5EA 1M6VA 3DGEC 3OMLA 3SSNA 1Z22A 2HREA 3SMQA 3D4PA 4HUJA 3VNQA 1ILEA 1XQ1A 2I4IA 3CPHA 2C99A 3H8JA 2VRBA 2J67A 3B9QA 2PUAA 2IDJA 1ODKA 1V4NA 4CBVA 5DV9A 2G76A 1M1NA 3C1TA 4MWEA 2J5RA 4RGQA 4UE3S 2RJNA 5TQ2A 3U7QA 3B13B 2Q9CA 4KFRA 3ICCA 3I76A 1WA5A 4R2KA 4DHEA 5FH9A 1LRKA 5E7IA 5HKKA 3VYWA 4QVGA 4WAUA 5KDOA 5FEMA 5BXQC 1M67A 5H3LA 3WRXA 2H1SA 3HU3A 3CEJA 2ACWA 1ULAA 2Q3FA 3E0QA 3IAEA 4YREA 1U8XX 1E2KA 2LDBA 4I50A 2AHOA 4MS1A 4Q6WA 4MB6A 3I09A 4QOIA 3LY7A 5DTIA 1TLLA 4C7VA 2Q5LA 3VKFA 4D5EA 4Z53A 5A0VA 1VGQA 4N65A 3UAGA 1DFGA 3H11A 1GN9A 4P3NA 2X86A 5FUMA 1QHFA 5DLYA 1N34B 4F9GA 1G38A 4CI9A 3SS7X 1H5QA 1WWKA 3SFVA 5C46F 3F67A 2H63A 4DV0B 4KYUA 4HZUB 1TQ2A 3PLRA 1E6UA 3KALA 4QBKA 2VP0A 3TF5A 4BDSA 2CVQA 4YRSA 4GRIA 4R68A 1YZHA 2V9CA 3R5KA 5L3SB 1DINA 2GARA 1MQ9A 3RABA 4JI0B 3C74A 2AMLA 2O8EB 3K70B 2G40A 1EJ0A 1LC3A 5LXTF 2JRCA 4YYZA 5FUYA 3A36A 3CGGA 2A0UA 3GBSA 4Y18A 2ZGVA 1YBVA 2PZAA 3BB1A 3O9MA 1NVBA 1GAEO 4YUAA 4I4LA 3G9QA 3K16A 1GKIA 2JJ1A 3ND9A 4EMTA 1NF2A 4Q3DA 2B94A 1YU6A 1WCIB 2PK3A 3QVLA 1BE6A 1QQ5A 1EVLA 4PICA 3V9AA 1CERA 1WPRA 4FT4A 4B3TB 3QJYA 1ADFA 2IIVA 1VJRA 2W0MA 1VE9A 5AVQA 1NN3A 1QCZA 3A4IA 1UXJA 3TE6A 2W2LD 4IYRA 2F43B 1L4HA 2JIQA 2O7RA 2W5UA 2V3CC 1Q22A 1IZZA 2CNWD 3OOEA 2RMKA 4WCFC 3OPYI 1KAOA 1RSZA 1VA4A 4N3NA 5JXIA 1S4QA 4CKBB 1QDLB 4GPAA 4ME6A 5I8WA 1IWPB 2B4TO 2BLNA 2QJOA 2WFLA 3EC1A 1RZ3A 3PIIA 4CL8A 4M8KA 1TJ4A 1GG5A 1OZAA 1TVMA 4O6VA 3SEZA 5GJCA 4L5YA 2JLUA 4DLSA 5TX7A 5KOHA 2YXLA 4EW2A 3KDSE 1VRWA 2NZ2A 2C9BA 3LX6A 1Q15A 3MNFA 2B3DA 4JWTA 5AJXA 5JH7B 3NEPX 1RWVA 1MN6A 4LCJA 3U4HA 2ECQA 1C0LA 1EDEA 1Z13A 2Q3JA 2MSCB 5EHGA 1L5HA 4BO7A 4HB3A 2XWBF 1ZX1A 2FAXA 3B78A 3OUTA 4DDVA 1E2HA 1S2NA 4HXGA 1D6JA 1VLHA 1E79D 2YFKA 3MQ2A 2I6XA 2Q99A 4L8YA 4MUIA 2OKCA 2QXYA 4WCVA 3TEMA 5K7SA 2G6BA 3BTOA 5C51B 1UBEA 1JLKA 1WD7A 4Y2PA 3WWCA 1FDUA 3P5BA 5PGMA 1NBHA 1H23A 1PV4A 2Z5VA 1KY2A 3JX9A 4EA8A 1HQKA 2GEFA 2PL9A 4YRNA 1Z5GA 4G4SO 3F73A 3RVQA 3OFKA 2FSVC 1O3YA 5EP1A 5EMNA 1YNOA 2X77A 2AJTA 3ETGA 4BNHA 3PR3A 4GKBA 1LDEA 1JHPA 3GFRA 2G80A 3SQMA 2EKZA 3K9LA 2VAMA 5GOZA 4WW0A 4ENSA 5I51A 4JJ4A 1UMDB 5BYKA 1T2DA 5JU6A 3AOEA 2J5KA 5AM4A 1UL1X 4PYMA 2IC5A 1IN7A 1AU9A 4G0UA 2PL1A 3A37A 3M34A 1N5MA 1QIDA 2FSFA 2ZVQX 1V41E 2OPBA 2G4VA 4FCWA 2YFHA 4HGOA 2O8FA 2H4FA 4G85A 4DDKA 1M2EA 3ENZA 2BCJQ 4Q4AA 1Z12A 4YUYA 1NW9B 3HN2A 4Q3CA 4QC2A 3DT8A 2WBLC 1W34A 4FSHA 3M70A 1HI9A 4PU0A 1WHTB 4WK2B 1MV8A 1NR1A 2IYFA 3KTAA 3A31A 1IXSB 1SMKA 5ALQA 1RU3A 4JXJA 5I7AA 1L5WA 2XB2A 1Z8DA 3JYNA 3KSUA 1RJGA 4LSMA 1FOEB 4AF7A 3TXYA 3UB3A 2HSJA 3DVAB 2WKSA 2V4MA 5CNJA 2VHVA 4A6DA 3JYOA 4EI2A 2CNOA 3DTTA 2Y0EA 4IYJA 2DR2A 3MN1A 2PNFA 2QW8A 3ESXA 4PC3A 4BNFA 4CM4A 4HEHA 2YDXA 4OM8A 5T3UA 1WXWA 2ZT7A 3BRWA 1IXZA 5EJMA 1CTQA 1SUFA 4N4AA 1YDHA 1UZNA 4KZKA 4LJ4A 5ECGC 1YB4A 1C9JA 3A3OA 3ZKWB 2QRUA 2VWHA 2GZHA 1BHJA 1P62B 4P08A 4Q7EA 3WIOA 2ADOA 5EXTA 4V39A 4BB5A 2XOKD 2ZOSA 1E9RA 3L6BA 2PDAA 1MAVA 1ADCA 2GTHA 2IYNA 2X0KA 2VJNA 5DCLA 1NTRA 2BZSA 5LZ8A 2Z6AA 5JJ5A 2ZUTA 1L4UA 3LYUA 1NTOA 2AHRA 5CX4A 5B1YA 3L7IA 2YZ2A 5H8WA 3B6KA 5BYBA 3HGMA 1D2MA 4F3NA 5LYJB 2PAFA 2O5RA 2C7QA 4BPBA 2WSSA 4KXXA 1NR7A 2V4UA 1CQJA 1JIVA 1U7WA 2VCYA 3ESDA 1E2FA 1E5TA 2P90A 3UJ9A 3Q3VA 2ZUSA 1CG6A 3QXSA 5DM60 4BKRA 4DSZA 2BRUC 3SF0A 4EFNA 5KU1A 1LTQA 2B8JA 3BB3A 1OW3B 1RMYA 3WYBA 2JFGA 6AT1A 5CM9C 1EJ6A 2A5YB 3MAGA 3OJOA 3EVGA 4BMSA 5CLFA 3FYCA 3B2NA 4TLMB 2C0PA 2MOKA 2RHDA 4NARA 1DBSA 2ZJAA 1QH0A 1BS2A 2ODTX 1NNI1 3E9MA 3HVHA 4JBHA 5BURA 5LUAA 1FB5A 3ZUGA 4DGSA 3IILA 2PH3A 4KYVA 5DLQC 5KNCD 3ZYZA 4D9KA 4URVR 1DRUA 4YBZA 4CFSA 5ALVA 3ILHA 3TLBA 1HDEA 2NSDA 3X1KA 1JDTA 4WZAB 1HDZA 2AYZA 1WBBA 1YXMA 2WWVD 1ZOIA 2ZRJA 3MLEA 4DVJA 1N6OA 2GT1A 1J4AA 2P91A 2VWQA 3DVLA 3FYHA 4FBGA 1L4FA 3CEAA 4EP1A 1GLVA 4NR0A 1JB1A 2M9MA 4ZYXA 5BRJA 4F6RB 3SS8A 2LP4Y 3JATA 2LZ0A 1P9NA 3N2GA 1U90A 2VOJA 3WGLA 2BW0A 1NOIA 3OZWA 3SEFA 1GSHA 2WDPA 3U6KA 3KYDB 3AIOA 1ODFA 2CBXA 2YZNA 3O26A 3VSDA 3RIGA 3P9QA 1RYMA 4GX1A 4KRXA 2W2MA 3IPAA 4JI3B 4GSLA 3UK6A 3FNHA 1ZZEA 1WSAA 1V7QA 1M34E 2ZUVA 1D7OA 3VX4A 2EIHA 2GEJA 3W6OA 2C9MA 1T29A 3T12A 2UUBB 3PC2A 1MX3A 1E58A 3GJ0A 4KR6A 4TX1A 2XVZA 4M0KA 1P4RA 2QVXX 3FETA 1AA9A 3M8KA 4HN9A 2ZR0A 2FUEA 1AKNA 4BJ3A 2IYSA 3R3SA 3CR3C 4C4RA 4OLJA 1FFXB 2QAGC 4QD3A 1P5RA 2V6FA 2UVPB 4LYYA 4D3YA 2AZMA 3NFRA 4PYLA 4TRJA 1PQUA 1TCBA 4GP7A 4ID9A 1XZAA 2NVOA 4OJKA 4XFJA 1L3BA 1QXSA 2JGNA 1ZBQA 1DLIA 1OR8A 2VUIB 4NBTA 3ND7A 1REQA 2WTNA 4PTYA 4ZVOA 1TVEA 1SOAA 4J16C 5JWOA 3FH0A 3MWDB 3EEIA 4KUGA 1ZK0A 3HU2A 4IFTA 4EHDA 2NVBA 1O2DA 3G2PA 3LQ1A 1YCFA 4GYKA 1N0IA 1HRKA 4M0PA 4CL0A 5AXBA 5BW6B 4JLBA 3VI3B 5E6UB 4XWKA 1YIAA 1BFDA 4D8XA 2G9UA 4HOYA 2XE4A 4CI0B 3W5CA 2NU9B 4RTSA 2R7KA 3WLIA 5KTSA 1XEXB 1S1MA 4WY5A 3CKKA 1HLFA 3ITNA 4Y6RA 3OA2A 5AICA 4B6JA 4C76A 3OEHA 4ZYWA 3NTOA 1GGMA 4JT4A 4OF4A 4R8RA 5GZ6A 1QV9A 2E1RA 1ZXBA 2XI4A 2R8ZA 1FNMA 3I2FA 4PIMA 1N7HA 1U8EA 1RLOA 1H2WA 3LFTA 2QN8A 3UMRA 4RLHA 4COKA 2Y92A 4BE7B 2H17A 1A4UA 4NBLA 3GAMA 4NOJA 1O97C 1CRLA 1T6XA 1T4BA 3HDHA 4LS3A 4KXWA 1XKQA 1ENZA 3KCNA 4KRFA 1A9QA 3EK2A 2IYYA 1NVFA 2HBQA 2XNHA 3C16C 2Z1NA 3DQQA 4ZAGA 5HKAA 1VSVA 5FA8A 1YE8A 4LCEA 4CQMD 4L07A 1E61A 4MPDA 2C4NA 3VYUB 4F9EA 1UPXA 2JHCA 3K0KA 5KKCA 4BN0A 1ULTA 2FEOA 1FVFA 5CPBA 5CCDA 1BFKA 1MPTA 1VLLA 4F5EA 4YP9A 3BB4A 1UH5A 2C3UA 4PSDA 4QDUA 3K9FC 2QLBA 1MB2A 2ID9A 4RD0A 3IE2A 4Y6QA 3LHKA 5EQTA 4NBUA 5FB3A 1EIZA 1JU3A 1X0VA 3KJQA 1P5JA 2WSIA 4ZOCA 5C4IA 4YP7A 5GP1A 1VKOA 1RXEA 1EHCA 1G5QA 1ZITA 4JQCA 1NBAA 1TA4A 4FFVA 4DRZA 4NX2A 4NAHA 5EKUA 1RADA 1KRXA 2P78A 2A3NA 3ZCTA 4HEA1 4CIXA 4K1LA 2C1ZA 4YRGA 4OFWA 2QORA 5HQTA 3O74A 4R51A 4B31A 5TGTA 3GT3A 1U02A 3LX8A 3M6IA 1T2EA 2P6MA 5CNIA 3L0ZA 1N2CA 2I29A 2OOKA 1JV2B 5A6SA 2HQSA 3IL2A 3LP6A 2HWUA 4F5WA 2W6JA 1VMAA 3I9NA 1CRWG 1ZFNA 2NO0A 5CD1A 1BOOA 2A57A 1KDOA 2V59A 4ER7A 3CN9A 2UU9B 2JLXA 3H5WA 5BPHA 2C03A 3A6HA 3QVMA 5H0IA 4DLYA 2QRLA 3UHJA 4LRWA 1GZVA 3FMIA 2VJOA 1PJ3A 3PQCA 5KX5F 3HK2A 2CNLA 1G20B 3C7TA 2YW9A 3F98A 4MRRA 4TLEA 3FTDA 4ZEVA 4FWTA 4RPIA 1EAYA 2FWMX 1XWIA 2ZYAA 1YZFA 2P3SA 2P4SA 3LZCA 5D3KA 4B5LA 2ZTHA 3CZMA 3RLFA 1ESDA 1ECGA 2AEJA 2VDJA 3GRYA 4NPCA 3DLBA 2Q6OA 1JSLA 2VQDA 5G53C 221PA 1KS9A 1GG2A 1ZH8A 2G1JA 3ZG6A 1Y8RB 1QIJA 2A5JA 1QYIA 2FQQA 5HR5A 1HBJA 2BKLA 3QLJA 2A3RA 3WHPA 4NYIQ 4Q4JA 2D0OB 1IE3A 4RTQA 3AESA 4MR7B 4CGYA 1KYIA 3UJ7A 4ZJYA 1DXQA 1N6NA 1LI5A 2XSZA 4KN5A 5FOWA 1GL3A 1RR6A 1Z6XA 1KEZA 2R8YA 2V6GA 3HUTA 3RH0A 5TLSA 2E55A 4BUJA 4DIOA 5HA5A 3VPGA 3HS3A 4BAZA 3H9GA 1QVZA 2AT1A 1JNXX 4ZAXA 1O6ZA 3WMFA 1GYPA 5I5EA 1E9DA 2ZUCA 5EHIA 1QLHA 1X70A 5FPQA 1JG6A 3R24A 1D4OA 1P2UA 2BFEA 4QBFA 4IXDA 1XROA 3QX8A 4OP3A 5H9VA 3VR5A 3LD9A 1CSEE 4BQQA 1Q0LA 3L40A 5AKHA 3KETA 1NZDA 2AFVA 4B35A 2H57A 1EA5A 1VLQA 3CRQA 3KJZA 3QH4A 4KO1S 4MYTA 5KYXB 2A1TS 3EDOA 4C4YA 3BFPA 4DE5A 1THMA 4KTVE 4QO7A 1GCAA 1Z5ZA 3GQBB 2B7BA 1IHPA 2VH1A 4UJ5A 2XQVA 3BMQA 3LT4A 2ZI3A 1LLQA 3AOGA 2ZYRA 1T8YA 2V5AA 3CLUC 1JJFA 3N76A 2HXSA 5D3QA 5C5IA 1ZOPA 3R2JA 4LQLA 2XGSA 1G6HA 3JQAB 4JI6B 5K0LA 3WTCA 1R50A 3JD1A 2P4UA 4TLAA 2Z6VA 2BYTA 3CF6R 1JI3A 1UKAA 1Z5UA 1FBNA 4UMEA 4Y3UA 1KZ1A 3HV0A 3V1YA 1QO0D 3AW8A 1EM8A 1QE3A 1K7XB 1JTFA 3V7UA 1QMPA 1E2GA 2XDAA 3C85A 4YDRA 4GLLA 1DAEA 3VYSB 4H9GA 3DONA 2XUQA 5I9NA 3ETHA 2IZ1A 1EK1A 1I7LA 1S8FA 2DPLA 3A06A 4OOFA 4OXYA 3N2ZB 1YKFA 4G2NA 4ZOEA 5JNTA 2BFDB 3G2QA 2C4HA 3SIWA 4XQ9A 2NU7B 1SELA 1YZGA 4U5QA 2A35A 1X87A 1YD7A 3O5AA 4ZCSA 5JJLA 1C0IA 4LXGA 3WIDA 2HRRA 1NA5A 1UXOA 3IVGA 3M3HA 1GFSA 1OFUX 3EWNA 3DV9A 5KREA 3IOEA 3CKMA 5JC1A 2WF9A 2EXXA 2AN5A 1Z07A 2WFAA 4KO8A 4LV6A 4M1TA 2GX6A 2NV6A 3FTQA 1QHGA 3ULKA 2BR4A 4I7EA 4OK6A 4JI5B 4W5TA 2XGJA 4OYYA 1J2TA 4UKDA 4X7PA 1T24A 2X0IA 4FZRA 1JYEA 1UZUA 1L5RA 4P3XA 1O94C 2AG0A 3JVDA 1L0BA 2GVDC 3QP9A 4WJKB 1YULA 2E5LB 4KFSA 1C9KA 5E4JA 2P9JA 5B57C 4AQYB 2I66A 1NOKA 2X14A 4M86A 5CA1F 2P40A 1QYWA 3DPUA 4RFSB 1TK2A 1IY2A 1EVKA 2O0MA 3O84A 5IBRA 3ICEA 2C7OA 1U2EA 5BSVA 4BNXA 2PUCA 3W06A 6LDHA 2PA0A 5K5EA 3NDRA 3ADKA 2FZWA 1IIBA 2PCJA 1QZ3A 3G9TA 5BOVA 1GCUA 2JFUA 1Y9JA 3PFFA 4Q00A 1E4VA 2NU8B 3WNDA 1IG0A 3C48A 4R1LA 2PR2A 5AJWA 4FHDA 2VP2A 3U4QA 4PLVA 1VXOA 4LPSA 5B58T 3UMJA 1PT8A 1QPZA 1EDOA 2O2GA 3N6XA 3AIKA 1CULC 3DTVB 1ETUA 1HMPA 4U2BA 4WNAB 4WL0A 2QPLA 2A92A 2AX3A 2VYQA 2WSLA 5ERXA 1U0BB 3L1HA 1LCIA 1LTHR 3HY4A 1NBWB 8ADHA 1IMJA 4FEGA 4C29A 4DADA 1GXSB 1ZW1A 3OX2A 1Z26A 4GX5A 1OKKA 3LYLA 4KNWA 1DZIA 1TB4A 1QGUA 3E1KA 3DTNA 2YHUA 4Q03A 4J9VA 5DX0A 4MUJA 4OGKA 2H18A 3HJBA 4L4UA 4DPLA 4UPDA 2BMWA 1T43A 1H8HA 1BQ4A 4DY6A 4IPTA 5KPJA 4TYNA 3CZAA 5MFZA 3KR2A 1RQRA 4F46A 1Z4OA 4BGEA 5G0SA 1Z18A 4B17A 4KQEA 3ETNA 4OAPA 3I6MA 3NTLA 1DS6A 5JCJA 4YAWA 3WHIA 1XWWA 5CEFA 3WK5A 2JEZA 3K0FA 3OM0A 4M1ZA 3CX8A 1GTRA 2RHBA 2Y1WA 3Q6IA 3IHTA 1DJMA 4X1KB 1R12A 1Z2EA 5AKJA 3WKAA 1SXHA 1M1YB 3F6CA 4M7RA 2GUGA 4M53A 4UAUA 3ZX5A 1I1QB 4DLZA 4L15A 2D54A 2JLYA 1JIIA 1F0YA 3QFFA 1ES9A 3EIUA 4AJIA 1NDUA 2NTVA 3B9BA 3K05A 2QG6A 3NR2A 1X80A 3IKMB 4FFMA 2HZBA 1TU0A 1VJ5A 4M9QA 4UTXA 4F7WA 4PLFA 4EA9A 2I6SA 2HYIC 3HB4X 4M0LA 1WV0A 4H3KB 2PUFA 4L75A 3NC0C 3J7TA 3DE0X 4R54A 4HH4A 4WLOA 4MOWA 3TTSA 3IJ5A 4KQ2A 3DMTC 2X7JA 4QE3A 3KJIA 4WJZA 1LB1B 3BMNA 4TZ6A 3AXTA 4MS3A 4P34A 1C1YA 2Q3EA 3WR5A 2R62A 4GYWA 4HQKA 2DMRA 2J0UA 1NX6A 2B0CA 2HUNA 1Q0RA 1I9CA 2XMQA 2QTBA 2AFHA 4MRMB 1CR0A 1UBKS 3TSOA 2WA1A 2P27A 1P4JA 4B47A 1NNUA 3RVLA 2HCJB 5HGXA 1TMGE 1HLDA 3LFUA 1MCZA 3SR0A 1AZSC 2CFSA 2XE8A 3IBTA 4FSDA 2GB4A 1C3VA 1G5FA 4IEFB 5ELLA 1RP1A 4EATA 4MDEA 4RIHA 2GLTA 3PPWA 1IPFA 4I0WB 4RW0A 3UQZA 4Q1FA 3N39C 5H70A 5TPWB 3ZDYB 3RS0A 2XXBA 1C7IA 1UT8A 2HK7A 3KJNA 3OIFA 5DM0A 1K75A 1QHXA 5IF9A 4UVHA 3S6JA 4IS3A 2H9YA 2FEKA 3OSZA 3PUJA 2B25A 2TMKA 3IA7A 3KV1A 4DLRA 2HLPA 3VR6A 4BDTA 1V35A 4Q39A 5DGCA 3WV4A 2IOHA 4OU4A 3HP1A 2Q4RA 4TMFA 4EDFA 4I9NA 2Z3VA 2A5GA 3LAWA 2H0RA 5J40A 2Q6IA 4EFDA 5NLLA 1W85A 2YYSA 4I1RA 1BEZA 3KR9A 3I5YA 4LHYA 3CCFA 4G0NA 2ZCUA