3C7TA

Crystal structure of the ecdysone phosphate phosphatase, eppase, from bombix mori in complex with tungstate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
259
structure length
259
Chain Sequence
RRWVFALRHGERVDLTYGPWVPHCFENDTYVRKDLNLPLKLAHRAGGKGGYVKDTPLTRLGWFQAQLVGEGMRMAGVSIKHVYASPALRCVETAQGFLDGLRADPSVKIKVEPGLFEFKNWHMPKGIDFMTPIELCKAGLNVDMTYKPYVEMDASAETMDEFFKRGEVAMQAAVNDTEKDGGNVIFIGHAITLDQMVGALHRLRDDMEDVQPYEIGRNLLKVPYCALGAMRGKPWDVVSPPCPPSINSSSGRFDWRILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the c-terminal domain of the ecdysteroid phosphate phosphatase from Bombyx mori reveals a new enzymatic activity.
pubmed doi rcsb
source organism Bombyx mori
molecule tags Hydrolase
molecule keywords Ecdysteroid-phosphate phosphatase
total genus 85
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3c7tA01
3QPUA 4D4KA 2EOAA 3QPWA 1TIPA 3HJGA 4JODA 1DKOA 2P30A 4MA4A 4HBZA 3DB1A 1C81A 3MXOA 4JOBA 5AJWA 2YN2A 3LL4A 1BQ3A 2H4ZA 1NT4A 4GPIB 3D8HA 4EO9A 3GP3A 1SK9A 3IT0A 2ENUA 3IT2A 4TSRA 4ARSA 2A9JA 1V7QA 3FJYA 4IJ6A 5CDHA 3KKKA 4IJ5A 2WNIA 2P78A 2P2YA 1C80A 4PZ9A 2EKBA 1EBBA 4EMBA 2H4XA 2EKZA 2F90A 1DKQA 4PZAA 1H2EA 3EOZA 3K4QA 2PA0A 4D4LA 1FBTA 3D4IA 1QWOA 3K4PA 4GPZA 5AJZA 5CU7A 2P75A 1T8PA 2H0QA 2HHJA 4E3WA 2P9FA 3BIFA 2I1VB 4JOCA 3QPVA 3C7TA 3GP5A 2P6OA 2P9YA 3O0TA 2H52A 5CX4A 5HTKA 2P2ZA 1YJXA 2WNHA 3GW8A 5AJXA 2YN0A 1IHPA 2A6PA 5PGMA 4ARUA 3F3KA 2P79A 2OWDA 1E59A 1SKAA 4D4MA 3F2IA 4AROA 2QNIA 3IT1A 1DKNA 3IT3A 1RPAA 2AXNA 1CVIA 5AK0A 1E58A 2GFIA 2P77A 3DCYA 1DKLA 1DKPA 2P9ZA 3E9EA 1BQ4A 5AJYA 1H2FA 1UJCA 1C7ZA 2WU0A 3EZNA 3LNTA 1YFKA 1ND6A 1V37A 3E9DA 4QIHA 1RIIA 5HR5A 1UJBA 1QHFA 1DKMA 1SKBA 3NTLA 4FDUA 2HIAA 3FDZA 1RPTA 3MBKA 3ZHCA 1SK8A 4ARVA 3R7AA 2DWOA 3LG2A 2P6MA 2HPAA 4PGMA 5AJVB 2IKQA 2OWEA 3OI7A 1BIFA 1XQ9A 1FZTA 3FDZB 3E9CA 2BIFA 1ND5A 3PGMA 1QFXA 2RFLA 4FDTA 3D6AA 3NFYA 1K6MA 2DWPA 4D4JA 4ODIA 2ENWA
chains in the Genus database with same CATH superfamily
3I37X 4Q3BA 2DC1A 3FWHA 3OFSA 3GEEA 2H6EA 3GT0A 1A2KC 4A10A 2PS9A 2AD5A 2WAMA 4H7KA 1WMFA 4Q21A 3WC4A 5FPTA 1AMUA 3LC0A 1ZOSA 1KMCA 4KKVA 4X7RA 4CODB 5KTPA 2CXXA 3CW2A 4J0CA 4YCLA 2GN6A 1FFGA 4CT4B 5IXJA 3EPJA 1NOIA 1JHRA 2H2FA 1PUIA 3CIOA 2FW0A 2FFAA 4RHUA 1N3IA 2WG0A 4U3JA 4PF1A 2VJCA 4BZXA 1RVDA 3C5EA 1V6SA 5L51A 4TQUS 3VZBA 5EXPA 4CTMA 4GICA 5FQNA 1LSJA 5GGYA 4W5QA 5TR9A 2W58A 3VQTA 4IXMA 2HGSA 4DLWA 2DFTA 1XT6A 4LHWA 3R0XA 2VDOB 4TKLA 3QFSA 1PTJA 3QU2A 4NMXB 3HKEB 3EZ2A 2DHQA 3NWEA 4L95C 2WMNB 4YGYA 4K9QA 4B5LA 2C0CA 2G3YA 2QZSA 4MYDA 2V45A 5H80A 2WJAA 1F2UA 1Z16A 2PCJA 1LXCA 2O1WA 4WFQA 1U7TA 2ZYSA 4DL9A 5I7FA 5IZCA 4E4YA 3FSGA 4PZAA 7REQB 1E3DA 2W2TA 2J09A 4WADA 4RA9B 1A9RA 5AVVA 5F9FA 3RYCB 5CVCA 2W90A 1NLMA 5G0WA 3ZV7A 4DT1B 1FQOA 1NW8A 3WGOA 5I9LA 3OJEA 3R3ZA 5TQ2A 4OSOA 3H2BA 4YECA 4CMEC 3OFVA 4HNUA 1VDMA 2ECPA 5EJEA 1MOQA 2BFOA 1E5QA 3EQ8A 1NI5A 2W0SA 3CJTA 1SM4A 1QVAA 2ZDHA 4LF5B 1MRSA 2RI6A 3TIFA 3EBOA 8GPBA 3B53X 3QE9Y 1EWQA 3KTDA 3DDUA 2HA2A 1WUIS 2NZ8A 3I4CA 1UMCA 3FDFA 2CCGA 3N9IA 2OWDA 2PFGA 2GZ2A 2JJ1A 2ZI3A 3F71A 2L2QA 4OK3A 2E1RA 1X1CA 1QPBA 1SPXA 2RKBA 3PT9A 1JLSA 4K9RA 3VR4D 4LSGA 5CX1B 3W7VA 4ZRMA 2IEIA 1Z38A 3ME5A 4HRXA 3HP4A 2XUIA 1N3LA 1E1MA 4LHZA 4A0SA 1YDEA 4I1VA 4WOPA 2H2DA 3W8RA 3WNDA 2WKWA 1GRVA 5DBFA 2VXBA 1PR0A 1Z68A 2W2QA 3OBIA 4F6CA 1L7NA 1FA9A 4HNAA 4A0RA 2IYTA 1TZMA 3FLEA 4YC7A 3K6SB 2GO7A 3KQVA 3OMXA 4ARAA 1YR8A 2ZJ4A 4JP5A 4K6MA 4NMLA 4DE5A 2ZCJA 1QORA 3Q12A 4GECA 1ODIA 5AVOA 3S68A 3UT5A 4V0SA 3UW3A 1XQWA 3CU5A 1HZJA 1VLHA 2NYAA 3AO0B 2ZJ8A 1IL0A 1M8PA 1OA0A 3DUWA 4KMRA 4L15A 3H75A 2DHDA 2ONJA 1HBJA 3IPXA 5CNIA 3ZXIA 1T0BA 2O48X 1DRUA 1NBHA 1X7XB 1EK5A 1Y6RA 2JFOA 2WVJA 4J16C 5KHOC 2GHQA 4IDEA 2O2GA 4JBIA 2IYZA 2DFPA 4YH1A 2UVPB 3L43A 4R5MA 3RFXA 2PKRA 1HE2A 2RFLA 1MJ5A 2Q5IA 3D6AA 4U2DA 5JSKA 4O8CA 5HFJA 1GPAA 5CA1A 1TVKA 4BMNA 4XTCS 2OBNA 1UKCA 3T3NA 3E23A 3ZG6A 4A8JC 4ZMRA 3KPWA 4NV3A 2XI4A 3MF4A 4N18A 3AFGA 3L79A 5ESRA 3JAWB 5AHXA 2EZ8A 2FPXA 1HA3A 5M3BA 2P41A 1IBMB 2I2DA 1QYVA 4D9MA 3MJHA 4Q4CA 2DVMA 1RQ2A 2BMAA 5FT9A 4ZEOA 2WG2A 2FE4A 2BM1A 3R5SA 5C5DA 4N4AA 5JZOA 1R5JA 3VR6D 2CBGA 2FVXA 2XDAA 2H4ZA 1N6PA 3GJ3A 1L4LA 1L5OA 3QPDA 3JQ7B 2RHOA 2PVCA 2WM3A 3FPLA 4GMXA 4OHPA 1J42A 4TSRA 3R75A 2HCJB 2V7QD 3GHHA 4IXNA 3PVCA 1HURA 1XTVA 4JYBA 2H54A 4LV6A 4GF5A 4W7SA 1JKJB 3N8DA 2G9QA 3PNBA 1TPZA 4PYQA 4D82A 2IITA 1K7CA 3BD9A 5FWNA 5AT1A 1WV0A 1UDAA 3B2QA 3I52A 3A0RB 1GRNA 2AJDA 2H4XA 4UHBA 4EKIA 1AQYA 2C1ZA 4KAFA 5E8JA 2MHCA 2C5GA 5CFZA 4OO3A 4X8MA 4MICA 5K2MA 4M54A 3UPTA 2WAAA 3LVQE 1YBMA 2W6ID 3K1YA 4GGMX 4URXR 3GFPA 3T7TA 1LV7A 4D9FA 3LL7A 4UBLA 3RQIA 4B75A 5LP6F 2PZKA 1Q7BA 4F3KA 2UYOA 4R1MA 1TLLA 4BMVA 4IG4A 2HSJA 3CWZA 4NG5A 2Z95A 3EIHA 1CG6A 3W6OA 3R0ZA 2PX6A 4JC8A 4ZV7A 5JO0A 5DI3B 4D46A 1IEWA 2W8ZA 3JAKA 4K87A 5DIFA 5HTKA 3TG8A 1C3JA 3FHTA 1EX9A 1G6HA 4NBVA 2EFEB 2WNHA 3E7PA 1E6MA 4E5MA 3T1YB 3T3PB 4X8LA 3EGXB 3EGIA 1AU9A 1ISIA 1EKXA 4IZHA 3QVSA 4J16A 3UGJA 1KDVA 2GBCA 1VLQA 3EUFA 2B30A 1AGXA 4QNRA 4JI4B 1S1CA 1REQA 1MB3A 3V8VA 4Z4IA 1DQNA 3KB6A 2WD8A 5A4FS 1FSGA 4M3NA 2HJHA 2GD1O 4IDNA 5A6SA 3BGDA 5TF0A 3O03A 1VMAA 2RC6A 1GV0A 5TGDA 4DQXA 2PV0A 4WOKA 2PDAA 2WKPA 3V7UA 4ERXA 2YWEA 1X7ZB 4YO8A 3TLEA 2PRZA 3NT5A 1W87A 3L0IB 1J07A 2R2GA 2GFQA 3CF4G 2BWJA 4MB2A 3LZCA 4H7JA 1U28A 3EE6A 3OZVA 4P32A 4WA8A 2BYTA 1KEKA 1SQ6A 4I19A 4INJA 4O63O 4ZAYA 5CDGA 3CURA 1XTIA 3WLTA 1A27A 2O9JA 4R8SA 3WA7A 4OGGA 1XUOA 1TPYA 1AZWA 2F6RA 2G0AA 2A1UB 1P9OA 1TT5A 5CDYA 2I4RA 2BZGA 3CF4A 2CL6X 2JFFA 3USZA 1I24A 1G1MA 4RJIA 4IF4A 1KQPA 2IRWA 1CLEA 4W1PA 4C0QC 5JXHA 4LFCB 1ZISA 1ZCFA 3C8DA 3NDRA 3RVNA 1V9LA 1LK5A 3IKTA 5B5SA 5JLJA 3ND7A 2ZE7A 1NJ6A 3H1TA 4ZCQA 3GRFA 3P9YA 3CSDA 3TTVA 5C37A 2P6RA 1CZUA 4Q6WA 1JALA 1WDTA 3Q9LA 1PBTA 2R1UA 4HDAA 4CN8A 2C82A 1R16A 2E0IA 3FOAA 3GRAA 3JQ9A 3MWDA 4X63A 4DDKA 4YPVA 3GVHA 3KU1A 4X20A 3DP9A 5CFMA 3DOEA 4MR8A 1FSFA 1OKKA 4NCHA 3EIQA 5INTA 4MVJD 1PNOA 3A9UA 3OE4A 1FS5A 3AERA 1FYVA 4RQTA 3LFTA 3RT9A 4FNMA 3HJNA 3A1WA 5BXQC 2I1QA 1M33A 2R87A 4B4WA 1Q2UA 1QO0D 1DC5A 2WP0A 4D8UA 2IHYA 3EA0A 4U7WA 4HDSB 1OQAA 3DPIA 1AHHA 4MARA 1Z5PA 2DTXA 1AF4A 3E5NA 3M3DA 3S7ZA 2VF8A 4BNLA 1KI8A 1Z7GA 2XQFA 3B6EA 4TKZA 5TRTA 3MTBA 4FDAA 3JS5A 4BNYA 4KZKA 4UNNA 4N76A 4LYDA 5FUQA 3TOSA 1TUEA 2BUBA 2E3JA 3K71B 4IIXA 1C4KA 4R1PA 1E2PA 3I6BA 3KPJA 5ICSA 1KOGA 4EEZA 4IICA 1LDGA 1ZA2A 4QQ8A 5SYNA 3ZPXA 4LF4B 4OX9Y 1ML4A 3OFND 4BQIA 1QG4A 5AI5A 1N5IA 3V55A 5DN9A 5HF6A 1FP7A 2GB4A 2HZBA 1V3TA 3AXTA 4MI3A 2JLVA 4IMPA 4K9KA 5DRTA 1GZ3A 1QH1B 2GRJA 4B32A 4C78A 2HCBA 3WLFA 3UJCA 4EYOA 3KVOA 5K4HA 1LI7A 3NWPA 1FDOA 2CEKA 3R6TA 2DAPA 5DW0A 2YS7A 4L8GA 1GCOA 4UXHA 5CB4A 3HN2A 4I6EA 3LDGA 5BV7A 3L4JA 4WY2A 1LSUA 5HIIA 3WIEA 3VTAA 4NK5A 3OLXA 4BLWA 3LPMA 3T9AA 4Z54A 4ZI7F 4ZN6A 4LWPA 4CIWA 3ER9A 1T9ZA 3I42A 4FW9A 3W1WA 5IANA 4PYIA 3RBVA 1IY1A 1PWZA 1RWBA 4WOCA 4LV8B 1JG7A 5FO1A 1OWNA 3ZOZA 4X3CA 3B7PA 5CUQA 2GPNA 1K2VN 1R0KA 1UM9A 3EW7A 3LKZA 4XZ3A 2XCRB 3ZE9A 5ES4B 3HSSA 2J3MA 2K7FA 1X2BA 2GRAA 1VP3A 3OQIB 1RE1A 4LMAA 3TEJA 1N3YA 2W71A 4WDRA 1VL2A 3LIPA 4YV7A 3ZJTA 4DPMA 3LP5A 4BPRA 4LZWA 4DMKA 5CG1A 2ZE8A 4HDOB 4MUAA 3EF0A 2JLRA 3SNKA 2XKKA 4V0NA 1SMKA 4WLVA 2XXJA 3BTVA 1DC8A 1Z8HA 1K75A 3JD3A 4B3HA 2IHZA 4LSMA 3HABA 2Q3LA 3VHXA 3W6NA 3RVMA 3QU4A 4YHHB 4Z4GA 5FUWA 4RESA 1D6MA 4M36A 2PZLA 1VCNA 4YJ3A 4MQMA 5KWVA 1JHMA 1B6TA 1NULA 3HB1A 3DLBA 3P71T 4I1SA 3LDHA 4ZHQB 4L9RA 3MJEA 3PWTA 4ZI7B 5IYZA 3A6HA 4OU4A 3PNMA 4F8YA 1GUBA 1B1CA 5JPCA 2VDMB 2VPTA 3G82C 3P5BA 1H0SA 1MB0A 1P2GA 4OYLA 4Z8YA 4M0UA 1KO7A 1MENA 2AOTB 2JRCA 3E0XA 4GI5A 5F1PA 3SR3A 4NQZA 1EUYA 1MX3A 3THXA 3ZDDA 5J4LA 2GVZC 4XDYA 1TAQA 2PLFA 2IUEA 2PT9A 4ODIA 3PRHA 2CZGA 3JAMA 2VHEA 5FI3A 5IN5A 3CNHA 5HKKA 2DBQA 4QVIA 4CMHA 3NAMA 3RBAA 4UHCA 3LXXA 1P1RA 4URWR 3N8NA 1CUUA 3HJGA 4J75A 3UA3A 2DR2A 1C7JA 1K7XB 3ZBTA 3U7GA 3FJ1A 3RT7A 3AZPA 2PMEA 5C53B 4NBTA 1Y5RA 1G2OA 4WKCA 3JQBA 4JOBA 5HX7A 1HNWB 2O1XA 4UBKA 2H1LA 2PJDA 1ZUNB 1P19A 3VV2A 2AN4A 4UBJA 1CS0A 3BK1A 3V8RA 1ZSNA 3RPEA 2FN8A 3G9TA 3ZHBA 3IO5A 1FDIA 1ULZA 4OYYA 3ZYZA 5DP2A 4MP8A 3N0RA 1FTQA 1OT5A 3KKOA 1ES9A 3EODA 3ZHYA 3KC2A 1M7BA 1A9YA 1KKUA 2POQX 2WFLB 3DE4X 4IRUB 4OA8A 2JBAA 2ZRDA 5FWXA 1WCWA 3PD1A 4E12A 1U02A 2LTAA 1E6KA 2X8WA 4O2AB 3UMFA 4D4HA 4P98A 3OM8A 5SZHB 4C3OB 5JS7A 2FKAA 3VHXB 2F90A 2HK8A 3H8JA 4IQGA 5SZIA 1L7VC 4OGLA 2ISCA 2OFXA 1D04A 2QYOA 1H9CA 3PLAE 4PC3A 1MABB 3LYLA 2RKWA 4PYNA 1CRLA 1NXXA 4ZAFA 2VP6A 4IEEA 4RJTA 4ZZ1A 3X1WA 1MFPA 3H84A 1L7EA 1I2MA 1IQUA 2AYXA 3DTVB 3CR3C 4LFBB 1E9DA 2B3DA 2VEDA 4B34A 2RH4A 4GOOD 4N6NA 3U60B 4X7PA 2ZKIA 3OAAA 4YFYA 2FQQA 2ZBDA 2A92A 1P17A 2E7ZA 1G7TA 1V5EA 2F59A 2LWIA 3F9IA 1DNPA 2PT6A 5AXBA 5F7OA 5EZYF 2POCA 2L18A 4IFBA 4N1AA 5DKFA 4RU1A 1C7EA 2PG3A 3V3TA 1D5WA 4DNXA 2WOJA 3S2FA 1QHHA 1U1DA 1V25A 2Y1FA 1D03A 3V4SA 1X7YB 1N2XA 2ZT8A 1B3BA 4OH1A 4ZQIA 1CVIA 3SBOA 4E08A 4HEA1 1M6WA 3IAS1 1X7WB 2XADA 4KW7A 3AVQA 2NU6A 5CM9C 3ZDZB 1BJRE 4MQFA 4OUDA 1H2FA 1VPWA 1YD7A 2H85A 3ND6A 1QH1A 1CDOA 2IZ7A 1GZUA 5KHAA 4D9BA 3HDVA 1Q16A 1RIIA 4CL3A 1RTKA 5DGHA 4AX4A 2GPSA 1RI1A 4J03A 1KEWA 4RMGA 1JHXA 2VK2A 4UHJA 3I32A 1O96A 3TM4A 3IEKA 1QOQB 1ZW1A 1X7YA 3BK7A 4B6JA 4DMLA 4B3MB 1N7IA 1NBAA 2HYIC 1KNQA 1Y5IA 2WHPA 3NM5A 3WIUA 4PGMA 4XQ9A 1H3NA 4IQFA 1ZSYA 4Y0AA 1LF0A 3FWNA 2DEUA 3TMAA 5EIEA 3FDXA 2IU0A 4F5EA 1FLAA 2BIFA 2AW3A 1G5RA 3QUCA 2KMLA 2FSGA 4I3GA 4R1QA 1CQJB 3G0HA 4FILA 1NQTA 1TJYA 3L8CA 1MT0A 2V7VA 3LX4A 4UTZA 5DOVA 5FNVF 3E4DA 1FP1D 3F5SA 4U00A 4GI7A 1NP6A 1H0KA 3RYHA 3SC3A 1M67A 1X7GA 4KQEA 1AMNA 1ETHA 2NZYA 5CB6A 3K0FB 1EMDA 2OCGA 3DPSA 2Z8XA 2ZRGA 2QQGA 3ILSA 5JROA 3L7BA 2XMQA 4OD0A 3VKUA 3QE4A 3SSAA 4BAUA 4B7ZA 4CG3A 4GXNA 2IYYA 4DILA 2VWQA 1BGVA 3OUZA 3L4SO 3OD1A 3R5FA 5EVJA 4BCCA 1LLFA 4MKGA 1AA6A 1TFUA 3L8MA 4I9FA 4I55B 1CUHA 2QAGA 1VIDA 2PRYA 4CFZA 1LJLA 1NT4A 1JILA 5IVIA 4KXLA 1XN4A 3ZV6A 4BUZA 4I36A 1DJNA 5ARDA 3U16A 2ERYA 1N77A 2W2LA 4U0KA 2B5VA 2JBAB 2W6NA 1TA0A 4KO8A 4MGKR 3I01A 4YJ2A 1JP7A 1NUSA 1G7RA 4JQYA 3IESA 1UDXA 3G23A 2XQKA 3KHUA 1ONBA 1NU6A 2KLBA 1RJ9A 4G84A 5IZCC 4JEMA 3AI3A 4B3JA 5BV8A 2R0QC 5IAKA 4GM0A 2QTCA 3OESA 2HM7A 4GE0A 3PHHA 3SZLA 1D2RA 1ZUNA 4UCWA 3WBFA 2WTEA 3JALA 1H42A 3DDOA 1JLLB 1N4AA 3ZK9A 2TMKA 1COZA 4G09A 1L7XA 3D7LA 3T8YA 4TMWA 4EB6A 1E2BA 1IHXA 1YCHA 2RHCA 3ZE0B 3HNPA 1P9LA 3NVDA 7YASA 5JBIA 3QVOA 1Z18A 3W8EA 3VR5D 2QUBA 2XF2A 4IP0A 1I0LA 4IJUA 2L69A 1HRKA 1C0LA 3K8ZA 3GX1A 3M3PA 4NZZA 4DJ5X 3GVCA 5JFTA 2GEDA 2ISQA 1K3UB 2X6RA 3I2IA 4LBWA 5EJ4A 3VGPA 1O9GA 1CETA 1YGPA 4XYGA 2GRUA 1NT2A 3DDZX 1LPAB 5JATA 5AHOA 1KZYC 2V3WA 4ZC1A 5J9FA 5FV4A 5KKCA 4LGMA 3B8EA 4IDBA 2B78A 1CUXA 4DNFA 1Z5NA 5IAJA 5CA1F 3OQPA 1C29B 3AUUA 3L4BC 1IHDA 3TF5A 4CM3A 1UC5B 1FFWA 3KZOA 4WBSA 2O2JA 5ALXA 1MJHA 4JXKA 4S2EA 3UIEA 3JWGA 3JYNA 1M2HA 4NSNA 5C5IA 4B44A 2WZBA 221PA 5LPNA 4Q5IA 2ORED 4YT5A 4OTZA 4L5YA 4C6TB 1OB2A 5DMHA 3AF5A 1QGOA 4OHKA 4V02A 4BAGA 4K9MA 1QTQA 3GJQA 1W75A 3OLWA 2ZUSA 5C35A 4PIPA 1PJLA 3CVJA 4BXOB 1MQAA 4J76A 2R8PA 4F46A 3K1JA 2GK3A 2WD7A 3A7EA 4BE9A 1DUIA 2OWEA 1E6EA 4OQDA 1LRKA 4KUHA 1MT3A 5B7PA 2FNAA 2VPYA 1T9HA 3ENKA 3FBTA 3O84A 1UOOA 5CLGA 4AECA 4L0QA 3JYLA 2BC9A 5FLYA 1C30A 4P4NA 2AL7A 2ZU6A 2H2HA 3IQFA 3TW0A 4BZPA 4ENWA 2ZIZA 2NYRA 3G2QA 1XEWX 2PH7A 3CX3A 4QBIA 4M22A 2J7PA 3Q8KA 5CK5A 2A33A 3LXRA 2NZJA 1S3IA 1YVUA 3JD1A 4DJEC 5JEEA 3MELA 3NOQA 3FTDA 3O3CA 5K45A 3PUJA 3WO0A 4QD3A 3QVVA 1MPTA 4HRYA 3TNFA 3T3HA 1P4HA 1XFAA 3FZNA 4QT0A 3JAWA 3KIPA 3GG9A 1JLMA 2VJQA 1IUOA 3RVKA 1T5HX 1JTEA 4MV1A 1UANA 4MRRA 3IBCA 3RTCA 4E1AA 2GM9A 4ZTZB 2FSFA 2RGRA 3JYPA 3LWDA 3PTAA 1WB4A 3UGKA 1ICIA 2NUTB 3STYA 4DV1B 1X7XA 2GS9A 2ZJ5A 4OHOA 1OU0A 1EX7A 3TN7A 4IINA 4QYMA 1R4ZA 2FQYA 3E3AA 4MV7A 4MW7A 4KPEC 2WFMA 2PHZA 1OFHA 4CLOB 3IAAA 5HUQA 1RPNA 3GLKA 3HB9A 4B6FA 2NYVA 4XD7A 3TG2A 1D2GA 2AVDA 1Y6ZA 2B35A 3G5MA 1RI3A 5C0OE 1SKYE 3Q1KA 2IEBA 1XCPA 4Z4QA 3AOEC 2A9VA 3B78A 4HQ6A 3OCXA 3TNDA 1H8HA 5DLQC 4B3GA 1EUDA 1UJ4A 2DZDA 4AIIA 3VNAA 4MVJE 2OXRA 2DJ5A 3EA5A 4H1VA 5IT5A 1XCOA 1OFIA 2X8BA 4JKYA 3DXZA 1WHSA 4AMYA 3IEMA 3W6UA 5GY7A 4EAAA 3ZWDA 1UCFA 2HJRA 1WPQA 3WGMA 2PKEA 3FR7A 2WB4A 4A8TA 2QEQA 3PITA 3T0IA 2IPMA 4P2BA 4PZ0A 1YT5A 3T95A 1NW3A 3HP7A 3RVRA 2A6PA 2ZI9A 4Z9AA 3BBLA 3QYAA 4TQGA 3K94A 4J6FA 4RCVA 1ECPA 5D6OA 3JQFC 1LBEA 2ZJ6A 5F33A 2XECA 4V38A 4YN3A 4XVCA 2CXTA 2DSNA 2XTJA 4LJ9A 3DLIA 3Q3VA 4UPVA 2GF2A 3GEHA 4AZTA 5C46F 2C9OA 4WN9A 3BRWD 4Y8VA 3L0YA 4UEWA 3WLQA 1VCIA 1A71A 3LUBA 1QIJA 4Q4HA 5JTTA 1DKPA 1HYEA 3F3SA 1HE3A 3LQFA 4V0ME 3TLJA 4BB9A 1N25A 1RC1A 1XJQA 3LD9A 3WLAA 2IS1A 2WVGA 2V03A 2YZGA 3JATA 1UPCA 1ZVKA 2J5QA 4GI2A 4ITRC 1RXEA 1WXWA 1ND6A 1ZD3A 3JTEA 4Q9KA 2IYOA 5JH7F 1FFAA 1TVCA 3X1DA 4IJKA 3D43A 4RSHA 2EJTA 1PQ4A 2B8NA 3KSUA 4DNOA 1JEAA 3B3JA 4ZAZA 3NBMA 5FLXA 4RV5A 3HFRA 4FYPA 1E2MA 5AK3A 1WUYA 1IZ0A 2GFHA 3R8CA 5BQ3A 1QH0A 2EFHB 1WD5A 4MWDA 2XV1A 3RNLA 1IMOA 4BFLA 4PO8A 4AF6A 2ZRBA 4EUKA 1SVNA 1MB9A 1Q1GA 1RRVA 4O2AF 5GAJA 4UNRA 4AY6A 1MX9A 5AKZA 1REQB 2W5UA 2XA9A 4TWAA 2WKQA 2VS1A 2YZMA 1EUZA 1SU6A 2FFJA 1V9SA 3BE5A 3H8VA 5GQSA 3TLYA 3CVWA 2P8SA 3GAAA 1NLUA 3ADDA 3EGXA 3EJ6A 1GGNA 4R2LA 5CR9A 1ZRMA 3I9LA 2XMBA 1GNTA 1RRGA 3HU3A 3LF2A 4ZU1X 5T8KC 3CV3A 4A0HA 4J1SA 3CVYA 3MCVA 1NQAO 1IY0A 1J2RA 4DIMA 1UPUA 1TM7E 2NUBA 3RANA 4A03A 4N7BA 1QX3A 2PMFA 3QKRA 1M34A 2SKEA 1YAJA 1JJIA 1OI4A 1V5FA 3G13A 1SB8A 9GPBA 3C98A 4P4GA 2GX6A 1YAHA 1Z26A 4FTWA 1EFPB 1RM0A 4AU1A 4KO3S 3KQTA 4BQQA 1E96A 1E7SA 5H81A 2K7ZA 4WNCA 4TT3A 5FI5A 1J0EA 2QOEA 1J2EA 4ACAA 3N7TA 3PQ2A 2JS7A 2HA4A 2ZTLA 3OE7D 4IVNA 1G291 4GRAA 3RH0A 3DBVO 3QKTA 2RKOA 1ZO8A 2I55A 3P9SA 4XX1A 2VJYA 5H3CA 4MEAA 1TK3A 4BJHB 2IHJA 4DJFC 2D6FA 1G8YA 2UV8A 3FJYA 1CZLA 2FPLA 3IBYA 4TM7A 4KRGA 2ZUTA 3SVZA 4HC4A 4YAGA 4C7JA 1FNDA 1W581 2FPWA 2ODTX 3L1UA 3Q10A 2B9EA 1AGRA 2Y1CA 1SA0A 3P45A 1Q0HA 4X24A 4GX1A 4W6QA 2QE6A 2V8BA 1CQPA 2ZQZA 4PBRA 3EASA 3IPRA 3SDZA 2NNLD 4BX9A 3S55A 3U7QA 2YKGA 2P5TB 2BKLA 2NV6A 2W6PA 3DAPA 3DFUA 4G97A 5TMEA 2VH2A 5ALYA 4XYLA 1PL0A 2RAVA 2YW9A 1W5FA 4RA6A 2NZ2A 1ZN9A 2WYHA 2Y3IA 5EMLA 4ZD6A 2PX8A 3RT1A 4B83A 4DM4A 5AVYA 4B81A 5KQRA 4HB3A 5ANRB 4HLNA 1YS2X 2IHNA 5BSUA 2CB9A 5BWMA 3S29A 1P3DA 1CY4A 2VSXA 1JLKA 4CKWA 1M0TA 2Q5OA 3MTIA 2VIIA 4HPWA 1JIJA 1L5YA 1KDOA 1OREA 4PZEA 4X85A 5IW8A 3NGMA 5IH3A 3F3KA 2HPVA 2VQ6A 1FC0A 3FOCA 1QB8A 2ADFA 1N8NA 1OAOA 3AM3A 1QOZA 3HCCA 2JGNA 3NHUA 1M1YE 3TO5A 3WLSA 1QYIA 4RGQA 3OQ6A 5FKJA 1OLUB 1E2LA 5KSPA 4FBGA 3E7WA 4NX2A 3L40A 4OAPA 4AROA 3D3WB 4D9EA 4YGXB 1S8FA 1KNXA 2UUAB 4DZTA 3BJZA 1D09A 1KY4A 2WUGA 3UGTA 1D2MA 3UJBA 3VO2A 1LEHA 821PA 2P77A 1FNSA 2YN4A 4KSCA 4KRXA 4L7VA 1Q7GA 1ONSA 5F98A 1EFRD 2QR5A 4BN5A 5HCNA 3IIIA 3TIIA 1V37A 3STTA 3DEIA 3VAYA 3ZWPA 5L3VA 1USKA 2HA7A 5AI8A 5KYTA 4DVGA 4YBRA 3U3OA 3HSKA 4PN7A 3A10A 3HEMA 1XL0A 3SBDA 1CK4A 1ESCA 2V4UA 5HCUA 2PGJA 1KH1A 4CLHA 1SOWA 1PTJC 2G5PA 5L53A 3QFCA 4FZ3A 3PKIA 4KJZA 2C1EA 5CX1A 4QEZA 1AGYA 1Y8AA 4MXDA 5AKKA 4R51A 3T1OA 5FWYA 3MRTA 3G9ZA 1P0IA 2WA1A 5E2AA 5CFOA 1TTPB 3IURA 1M8FA 2YZ2A 5K8VA 1DP4A 5CJJA 4QDZA 1T1EA 5LB4A 3ZGNA 1FX0A 3LGSA 1ACJA 3U56A 1J5EB 1SXQA 1X1QA 2GZ3A 4AF7A 5I7EA 1QJ4A 1QXSA 1JDUA 1SCDA 2D0DA 2C4MA 1GZ7A 1SNYA 4B2YA 1U9YA 2EIHA 4WNIA 1EDOA 2F1JA 5HJ7A 4GKVA 5IVKA 3LIIA 4FN5A 2PQ0A 1GLNA 3FKSD 3V6MA 1U3WA 2HHCA 1BVYF 3HUFA 4ZZ2A 5TQJA 3NNNA 3A28A 4Y0NA 2I6SA 4BIMA 1KJQA 1YKSA 4ALIA 2IOHA 1HETA 1DKOA 1X2EA 2ARKA 2J67A 5LIPA 2YXPX 5TS3A 2HWWA 5JXGA 3HSYA 1YDMA 1ZJ6A 4F7DA 3E22A 3ITEA 4KIGA 2YINC 3KELA 2FSVA 4LX0A 1XDZA 4R2JA 4MLCA 1W0CA 4RHCA 3KQKA 2ZAOA 3C45A 1A9QA 3ETEA 5AKJA 2FOLA 1IBSA 1VIVA 1CJVC 4UD2A 4MQ5A 4ZXFA 4K9NA 4ZICA 3K2EA 1NGSA 5HHTA 4ZEWA 5LIRA 1P1HA 1DADA 4YMIA 1X8XA 2ZSKA 5EJ6A 1JXOA 4R9NA 3TRHA 1W36B 1EB9A 2JGLA 5GV8A 1PNVA 1PKEA 2AFIA 3D3EA 1W4LA 4C0BA 4DUPA 1A8IA 1Y8ZA 1WDLA 3BPSA 3EWNA 1AB6A 2XYQA 2EKZA 4RZSA 1GSAA 1LWNA 1U8TA 3DWGA 3IUPA 4NMHA 4DDVA 1B2LA 4AO8A 3ET4A 1ZAYA 5KTTA 4AURA 5JYCA 4W9RA 1ZCZA 4HKTA 5CT9A 3NHBA 1T1SA 1TLTA 3G0CA 4WZZA 1ULAA 5AQ1A 3IMKA 4KDEA 5JMPA 4L57A 5KPJA 4YPFA 2OFOA 5HOQA 1G63A 2XRMA 1BS2A 2YHAA 2Z08A 4OKSA 3OEYA 4EWLA 4C2TA 5AW6A 1N6RA 2ZWVA 3TXXA 3AL2A 1ZJ4A 2B2NA 1T9KA 3AJAA 2GBFA 2FHSA 5JAPA 4B8WA 3MLAA 4W63A 4D0LB 2HIHA 1V16B 2GD6A 5E4TA 3TPZA 2ECKA 5E6UB 1DZIA 3GGGA 1L6RA 5DYNA 3UJ3X 3CLRD 3HO6A 1N8SA 2GF0A 2HU8A 3L0ZA 5AK6A 1JJFA 4KXVA 4UBNA 4RTNA 3QFHA 1JLHA 4MKRA 4RFVA 2OEPA 1HFKA 1VA4A 2A4MA 2FHPA 1Z4PX 4GPTA 8LDHA 5DTRA 4JVNA 5BYJA 1U1IA 1WE2A 3BGWA 2CV2A 3IP9A 5TE9A 4J6EA 3MPOA 4XW2A 5BNTA 3KHTA 1QS0B 4Z8XA 1E4YA 3RUFA 4BVHA 2ZYAA 5IBPA 5GOTA 1BX0A 3HPRA 5FHRA 2A0YA 2P7IA 3GLUA 5THXA 1KSFX 3CHYA 5A3JA 4EPTA 2ZR7A 2E4ZA 4HG2A 4AMZA 3OUTA 2UUOA 2EQAA 3KB1A 3UMBA 3X2SA 4L8WB 1XV5A 3WE7A 1OLXA 2ZM6B 3D7SA 5ADWA 1SG0A 2CDBA 3NTVA 3TR6A 3TMKA 1XGKA 1YQEA 2ID4A 1SUFA 1Z3IX 1KO5A 1JNYA 4KGDA 4NBSA 1U81A 3ZE7A 1L7MA 4F93B 3LPCA 1P9RA 4IDQA 3RJTA 1THTA 4J0KA 2G9NA 1XROA 3MBKA 4YT2A 5ILOA 2ADMA 2ZSAA 3O8OB 4Q1AA 4ZCLA 2HA0A 2DFNA 1P1FA 3V1KA 4L5JA 5E9QA 3Q9NA 4D9KA 4DPLA 5GZ6A 1NUQA 2P27A 3EVEA 4ZQFA 3T52A 1ABBA 2Q3HA 4CQMA 3EIUA 5MN5A 3FFBA 3WV4A 4TSFD 3C0KA 1SUBA 1TQHA 4EGFA 3ZQUA 1XWIA 2E21A 1JWBB 4KMSA 3IUSA 2DWPA 2ZDQA 1CRZA 1U2SA 3K31A 2JGDB 3KOWA 3BFPA 4XPIA 3TTWA 1L4KA 4XM2A 4IMIB 1M6VB 3V4RA 4F2WA 1WD7A 4LTMA 1EP2B 5DDIP 5G02A 2CDNA 1B41A 1ESZA 3HVJA 3MT8A 2RJ3A 1T10A 3Q5DA 1MA3A 3AHHA 1ZH0A 1Z22A 2PLAA 1NP3A 4CDGA 1V3UA 3CR7A 4EMSA 3KOYA 5BOSA 1UZMA 5LQUA 4ER5A 1GD1O 3T1NA 2GJAA 4MZXA 1QZ3A 2HK9A 2XF8A 3GJXC 1FXWF 4RKFA 2GARA 3LHIA 2PR7A 4LHSA 2FUKA 4CW7A 4E7PA 2HQSA 4ACBA 1PFYA 3UHAA 2LNDA 1TC2A 3NRBA 4LHVA 1WOMA 3U3ZA 2ZJ2A 1YH3A 2QG9A 1W4BA 3V3KA 3PNSA 1N7JA 3PQ4A 3O4JA 3RVDA 3KFVA 3TB6A 2YVQA 1LBSA 5KTMA 1ZLXA 3HYRA 4QSHA 3VKVA 5ALHA 2C2KA 3NFRA 4EBBA 2PXAA 4JASB 2FX5A 2EFCB 3GJ5A 4BU0A 1YZQA 1VJ0A 3LK6A 2X0NA 3L4KA 2Z6AA 3A32A 2Q62A 3DZKA 1NA5A 2C4UA 3JWJA 5D84A 3KYCA 1N1GA 1FDWA 4Q4DA 2DLDA 3KSRA 3P2OA 1WDMA 3T7SA 3WGTA 4F60A 4L2IB 5E7IA 5CU7A 5BPFA 1L5WA 1E0SA 2TYSB 4NENA 5H82A 2BFWA 3GEIA 4OHUA 1Q15A 2W8BA 2HRZA 3KE9A 4KYIB 3X1YA 2C9MA 2H3EA 3KLOA 1V4BA 4U7TB 1FP6A 4Y6LA 1YE8A 1ZU5A 3RUIA 3GARA 3VR6H 4E5VA 3E84A 3VDRA 2JZCA 3AX6A 5D87A 4LJ7A 2PT5A 4ZYTA 2CMHA 4C0WA 1C4XA 1GQOA 1S3GA 1YZHA 2HYDA 2PYZA 4XUCA 4JB2A 5CYPA 4ZA2A 2I91A 1W44A 2FZVA 1Y1PA 1VZ3A 5G1PA 4WZ6A 5KI6A 4JDUA 4R41A 1NMEA 1RJWA 4QG7A 3SLKA 1JDVA 3I6QA 1QG2A 2PNFA 3BG5A 2D1QA 4M1YA 1GAQA 3K0EA 2FW7A 3I4FA 5HIAA 1WETA 1JF8A 4NC9A 3ZZMA 1XTKA 2C57A 1NI4A 3I72A 3EW9A 5K0ZA 3GJRA 4XLLA 4ZZIA 1ZY2A 2VHVA 4F2DA 5CDFE 1TW2A 1YRQA 1H94A 3ZS9A 5FBWB 5LOVA 2QTMA 2O3QA 3NTQA 1CR6A 1HMYA 3HY6A 4ENTA 4D8WA 1IEVA 1VE6A 3K0CA 2HNBA 2OL4A 4Q47A 4KNYA 1L8QA 1DDGA 3BE6A 5JJBA 2H59A 1SN7A 5A9TA 1SIBE 2G5GX 3AHJA 1R0SA 3V2IA 1Z8FA 2CT8A 5COQA 1TF7A 4R2XA 3ISJA 2FN7A 4OYHA 3R7AA 1NP7A 2ES4A 2XITA 3PNVA 4PU0A 2GXAA 1SU7A 2IXFA 3AU8A 4TX1A 4M7WA 4EKDA 2OTCA 1YZUA 3GEBA 3I53A 3ZDAA 4JZYA 4OX9B 4C6RA 1CU1A 2HRCA 3D7NA 3IUEA 1QIDA 3PXUA 2VRCA 4S1PA 1K27A 2FG5A 2G40A 2ZUCA 2HCTA 4IR7A 3TS1A 3CEMA 3U7EB 1KRWA 1XF9A 1FJGB 4WY8A 2WIFA 1I3MA 3CISA 4KOAA 2R25B 2WJZB 4NMMA 3NS7A 2ZE5A 3CO5A 4DBLE 4PPYA 3URKA 4RDXA 4DA8A 3A37A 3M81A 3KWFA 4EF6A 2CNWD 1GIAA 1P73A 2WJVA 3LY8A 4D3XA 1L9XA 4ROTA 5A7HA 4CEJA 2I33A 1SC6A 1P29A 4TS9A 1NLFA 1T2UA 4TTVA 4U9UA 1M72A 1O7JA 2PXXA 5LL6P 4I5FA 3ZUPA 4EJ6A 2R5WA 1QK5A 3GA7A 4JUIA 4BVFA 1GL6A 2G4CA 2VLIA 4AYXA 1GL3A 4ETIA 4AK9A 1KZ1A 2G88A 3HBNA 5P8WA 3ZWKA 4N03A 4U63A 3QTBA 4BLTA 3TD2A 4F1KA 2ZR8A 2VP2A 2ZW9A 2D00A 3H97A 1OVMA 2AI1A 5FFFA 4V0OA 1OAKA 1QGED 4IXWA 3S70A 1M2KA 4EFMA 1AV7A 1UJ5A 1QO7A 4G8JA 3S44A 4EJFA 1NZJA 3BTUA 3LBAA 4F96A 4HUTA 3N87A 2GK6A 3DKKA 3A9TA 2RBGA 3U2QA 1BH2A 3GJ7A 3UUWA 1Y6JA 3OIVA 1CZNA 1P7VA 1DHRA 2OPBA 3N1UA 3O21A 3ZWVA 1HLPA 4M1QA 3PR3A 4Q3DA 1PL8A 1NMXA 3AR5A 3QXJA 2WF7A 5KDDA 1EVZA 1QV9A 3DULA 5DI9A 3WK7A 4FFLA 1T8RA 4L5CA 4IILA 2DPGA 2R86A 2WILA 1N2ZA 1Z0AA 3FNQA 3BMNA 3NNDA 4RF5A 2B5WA 2C4TA 1ZL0A 3HLKA 3VDQA 4AC9A 1YA4A 2XNSA 3LO5A 2UZ0A 1HG0A 1TEXA 4ISCA 3WFJA 3DEJA 4BEWA 4G23A 1U7DA 1K3TA 3QG1A 1U0BB 1Z4LA 2Z56A 5JBQA 1NXWA 3O9VA 2MU1A 3EBLA 4NPCA 3T15A 3UXEA 2F8TA 1E0AA 1B8VA 4F0JA 3KKEA 1BCRB 5HBGA 3UOGA 2D7CA 3K8QA 4G1EB 2ZVQX 2IYLD 2VP0A 3O2SB 5J5VA 5CDTA 4BFSA 4XB6B 1A9TA 2P9ZA 2Y0PA 3SOPA 1RAEA 1WABA 2O57A 1Y4SA 4I55F 2F00A 3RE1A 4B2IA 4UM9B 1K8ZB 2IOFA 2C2GA 5IDVA 4UVEA 3H0CA 3UV7A 2H29A 1GKKA 1YA6A 3CEHA 4GZMA 1PX2A 3KD2A 3O8DA 3QVGA 4JU8A 4S3MA 3OZWA 1DG3A 2DUUA 3BJMA 1IN4A 5JYDA 1GKLA 3QEMB 3NH9A 1KK3A 1GDDA 3NGLA 4ZAWA 3GA5A 4KIFA 3TD9A 1F0KA 2A67A 2ZPTX 4AJHA 3ORHA 5KOHB 4NCAA 1E1RD 1M1ZA 6ADHA 2ONKA 5EHZA 2E4YA 2A59A 4J1TA 5E4FA 2WE7A 1E8NA 3PWKA 1TKRA 3RFCA 1E1RA 3AHDA 3RYTC 1CYDA 1RKQA 2B9VA 1GNQA 1V5IA 3L7CA 3DHYA 4LN1A 3KALA 4HDSA 3UJDA 1UEXC 1F3OA 1O9HA 2B61A 2RGAA 1AH2A 2YV5A 4OQLA 2BY4A 4FW8A 1SURA 3CR8A 3DZJA 3BJIC 2H1IA 4A82A 2IE0A 3NC0C 1G3QA 3RAJA 3TLCA 4C14A 2PZEA 4M1KA 1HI9A 4OLHA 3SMQA 2RE8A 2KE5A 4BNTA 4AUNA 5CG2A 2YRWA 5HCIA 3K9WA 1W5SA 4DRXA 1UT6A 4FT2A 5B6IA 2H0AA 4MKZA 2NMVA 1O6CA 1U6JA 3TL2A 3V1TC 5EG5A 3JW8A 4KQHA 3NNSA 3EZLA 4K6FA 3U31A 2OP0A 3R44A 4BNMA 4E5KA 3H4VA 1JEEA 4FGUA 4MYRA 2CEAA 4IUBS 1KYWA 4DHWA 3VNVA 1EVQA 1JMKC 2PY6A 3B5JA 2RGGA 4EPXA 5JARA 1Y4AE 4NV1A 4ZT5A 3GDWA 3NYWA 3GNTA 4YASA 6YASA 1GU0A 1BOFA 4XUEA 2WBLC 3EAFA 2WQ7A 3EQ9A 1CKEA 2QE7A 3OFKA 5EGNA 5TQ2B 1Y7TA 2Z9CA 1WPRA 3G8YA 4MB6A 3N7AA 1PV4A 5LQMA 5SYMA 2JLWA 2HJ9A 4YP5A 2MINB 3T5MA 3NASA 3JQPA 4A2CA 1KFCB 1VMIA 3VI4B 4NHOA 3T6KA 1G64A 4PFQA 2OUIA 3EXFA 3Q8WA 4OHWA 1DUSA 5DBEX 3WWEA 1KDPA 1DXHA 1PNTA 1RM3A 1XKLA 2PUTA 3K5PA 2HHHB 4OFBA 3MMPA 1Y1QA 2QR3A 5IMSA 3GP5A 3A4NA 1DL5A 4QPDA 1EIZA 4M0MA 5IKMA 2JASA 4UMFA 3O2QB 3PFGA 1G2PA 1IMJA 4MYHA 1E3QA 4RHEA 3SDBA 1LLCA 3E3OA 5ECGC 2P9JA 2W37A 2GJ9A 3B2NA 3ZJYA 1U1EA 3D81A 1XTSA 3O92A 2VP5A 4R81A 5KDOA 1XXHE 1QC5B 3GRVA 4RBNA 4RYLA 3OY2A 3RTGA 1QYWA 3FYUB 2Q3DA 4UW9A 3FPAA 4LJ4A 1POXA 4F3RA 2WPNA 2IY9A 1QGYA 1IJBA 2NU7B 3CH6A 3JPYA 4P08A 1HC7A 3F0TA 4TQAA 3P4UA 2XMDA 5LA6F 4G5SA 1WL8A 2HF7A 3T9CA 4BMOB 1VOTA 3RSLA 3GLGE 4UULA 2OBYA 2WDZA 3WYBA 3GZNB 2BKEA 5G1NA 1TQ6A 4F4HA 1RPZA 4RFLA 2Z5LA 4IQ8A 2EKPA 2FEWB 1X94A 1UT5A 3CZ9A 3JTMA 3L7AA 2HGZA 1RACA 3P0EA 3HJFA 3I6ZA 1T36A 1LRJA 1FJXA 3G6WA 3OE1A 2C3MA 3FYUA 2XBMA 3G1WA 3R41A 4DSZA 1VKJA 2DOKA 4LDRA 4Y9TA 1PP4A 1TJPB 2REQB 4US0R 1XIVA 4D9NA 4MHTA 4ZI7A 2VAXA 4JI5B 4Q12A 1L5FA 3SQWA 3WP1B 3K1AA 1JKJA 4FJ0A 4E09A 1BX3A 3DV0B 3IVGA 2J46A 3CZ4A 2ZIWB 1E4VA 1Y0BA 1KERA 4G25A 1Y9DA 3PUVA 3R2JA 2D2VA 2J6BA 3KE8A 5CD9A 1IN7A 3QV2A 2P6PA 5EJ2A 1F1JA 4E51A 4AJEA 4EB6B 1J49A 3OP4A 1CE8A 1R9NA 5ESXA 1H3FA 2CW5A 1BCRA 1V7PC 5H16A 4QA9A 3C1OA 5F23A 2PUFA 4JR1A 4TS3A 1T9CA 3UB3A 3IUYA 3FOZA 1UK6A 3ITNA 5EN4A 2P2GA 3EY4A 1JQDA 4HB0A 2BHSA 5DNCA 4QARA 3EPKA 2NVOA 3IJPA 1XTBA 4BVLA 3KWLA 5J2TB 1UAAA 4G8CA 4ZVMA 2QQFA 3O31A 2J87A 1GSHA 4I5EA 2QZZA 4TKUB 5EINA 5J59A 3NOOA 2F8MA 3GXBA 1CE8B 2FPMA 2WF6A 4GO1A 4RQAA 4B85A 1JDTA 2I5PO 4EFNA 4QG3A 3EA4A 3M6UA 3UFXA 2FUG1 2ZRJA 4ZEMA 3HBMA 2GEJA 3LLSA 1U3VA 3T4EA 1I6KA 2QAGB 3GPIA 1ZK1A 1Y37A 4F5DA 3HS3A 2WM8A 2C7BA 4YRGA 1KZHA 3DOIA 4LXTA 4NFYA 3L4EA 2J9ZB 5NLLA 4DLBA 1IXYA 1WY7A 4OP1A 3LNCA 4ARCA 2YS6A 3PGLA 2EYUA 3BH7A 3OJXA 2NX2A 3EPRA 3IAS6 5C5EA 1OXTA 2OCLA 3CKYA 1A5TA 5JNRA 4AQDA 1XTQA 4MEBA 4V39A 5ERGB 2D5LA 2H7YA 1YC2A 5EWLA 2C5EA 4B3BA 4OQEA 1GPH1 4F84A 1K97A 3GZJA 1SUSA 1T36B 2VDVE 2VPQA 1S96A 2Q6LA 3NDPA 4L4YA 3X1KA 3ER8A 1X1SA 3B3FA 4JQCA 3AP3A 4OXRA 1DHTA 5EJ9A 5LQAA 4DLUA 4BNIA 4LFAB 1H0HA 4II7A 5DLDA 4NBUA 1OLSA 1NVVR 2NAPA 2R6R1 3M6LA 3VC3A 2R1VA 5CFQA 3CLVA 3UN1A 2NUTA 4JJZA 3T5GA 2WZQA 3C1TA 1G9TA 2WKSA 3IP6A 5AQEA 2Z2KA 3G1UA 4RHYA 4HAZA 5JO9A 4A0GA 4CEJB 1EDBA 4NWIA 5BMOA 2JG3A 4UTOA 2J59A 4UJ3A 5T7BA 5D01A 3NKFA 1S8AA 1X13A 2BZ0A 2JAWA 2Y76A 1WXDA 5SZKB 2JJ8A 1QLHA 1ZH4A 3AZQA 3M1LA 3O94A 4I5DA 1DIOB 3JALB 1JZTA 4RK0A 1I6MA 4DFDA 1E2NA 1N5OX 1RSZA 3H9CA 4YJFB 5C1PA 5EA2A 1UKYA 1GZDA 3L9WA 3F67A 1XBTA 3ZVMA 1KXZA 4NCBA 4YRBA 5FJJA 2FP3A 3DCYA 2MTBA 2WMDA 5CCEA 3ER6A 4J0IA 5COAA 3GPBA 3LQQA 5ALEA 1RCTE 1UKEA 2WHEA 2I34A 3BIOA 3IQIX 2ZPAA 1IN6A 4JGGA 4MMXB 3GROA 3QGMA 1W73A 4AJOA 1DKMA 3COPA 4M1MA 2J0VA 4AY2A 4K3UA 3KOXA 3GGSA 2Q5QA 2J33A 2EGHA 2C4WA 2LP4Y 3DTVD 4YLEA 1FTYA 2GYWA 3VSBA 4BNXA 4LOKA 3YASA 3WHKA 4YJFA 2YMPA 3Q8LA 1UK9A 3U80A 1C14A 1LPOA 2IGTA 1NQVA 3C41J 3CEJA 1A50B 5FHQA 1LCIA 2JHPA 4YRRA 1QVZA 2H9IA 3F9CA 2ZUFA 3HY3A 3K9FC 1I7DA 4KRFA 2GH1A 2BBSA 5FOWA 5EOVA 3L2OB 1QFXA 2W2OA 4FHFA 4LF7B 1JHQA 2O6HA 4U3JB 2OO3A 2V6BA 3EH2A 4P3XA 3KJZA 5F4BA 3C3WA 3GCDA 3ZXSA 4Q7KA 1NX6A 3OIUA 2YV1A 2GXSA 1CDEA 2FQXA 3U3MA 2BHLA 2A9KA 3QY9A 4TTRA 2HO5A 2PD3A 1TTHA 3GBPA 3I0NA 4PHTA 3ROQA 1E3TA 1QHXA 4BP8A 1BD4A 1BEUB 4Y2QA 1EI9A 3U13A 2NP6A 1UQUA 3DD5A 1KI9A 3UVEA 1BHQ1 4D8XA 1XCJA 1DJPA 1U0NA 4NH4A 1GT6A 1EJBA 1XLVA 1DTEA 3BMXA 3IVRA 4Q03A 5HE8A 2VNAA 4JI6B 1VC2A 4OHBA 3LL4A 2VJMA 1KAHA 3KU4A 4INZA 4URFA 4W9NA 4C76A 1JMVA 4ZDIA 4INOA 2AF4C 2M6LA 4Y67A 4C4PA 1QFJA 1JQAA 2FDXA 2H92A 1PZXA 4ND6A 3F47A 4ZJPA 3TKLA 1J8YF 2B4QA 5B12A 3H9UA 1WB9A 4HQLA 4LC0A 4HPXB 1XKTA 4R83A 5JOQA 3IE2A 3SXJA 2QF7A 2H18A 1P7YA 3AJ9A 3TLGA 3V00A 5B58T 2NXJA 2AWOA 2VNHA 3H9JA 2ROQA 3D2CA 4N3CA 2C98A 5CITA 3NBYC 4DW8A 2QXUA 2W2PA 3OMLA 5FA6A 4AZ3A 2IJGX 2ZBFA 4EW1A 2D8AA 1U2QA 2ORYA 3ZDYB 4JI7B 1ISPA 1QIMA 3I9OA 2CL5A 4YMWA 2GR9A 4MJ7A 1XQXA 4RHTA 3RS5A 4CPDA 1RP1A 1W49A 1C3VA 1TXGA 4ASUA 4AWBA 4DWVA 4DDUA 4JKIA 3HJHA 2XUOA 3FRIA 4Q6BA 2R3SA 4MVCA 4UVIA 1K7EB 5E9AA 4H9GA 2VOJA 5DOZA 4DA0A 1XMXA 3ASYA 1XK6A 4LMRA 1B8OA 2FPUA 5JWRA 5EGSA 3HB4X 2GN4A 5CPBA 2UXCB 2VTEA 3VR2D 1D6JA 1SKYB 4DG5A 2F1RA 4RVHA 1Z0SA 3T7IA 1SOVA 4FCWA 1XSEA 3BILA 3RKRA 2PSHA 4B45A 1SBCA 4U1RA 5BUZA 1RQLA 3KJXA 1JQJC 4BIIA 5A0TA 4G5HA 4B73A 1J56A 4C03A 5JS8A 5FOTA 3IDZA 3DNMA 1Q7EA 1C9EA 2O1SA 3DMYA 3KQOA 3KOMA 3MGGA 3SQLA 2OK7A 3PYMA 4QL3A 3H9GA 3ZGLA 2BFEB 2OMEA 3S0JA 3SQMA 1ADJA 1RCUA 3HLYA 1TOAA 4JEHA 1LKZA 1LNZA 2PVPA 3RUEA 2H5JA 3GEGA 1Q1NA 3L7OA 5EXEA 2O05A 4IV0A 4CU2A 1MQSA 4YXFA 1POWA 4JWTA 4KODA 3PBKA 4II2A 2J07A 1W52X 3HV2A 4OK5A 1G21E 2X77A 4RD2A 5JTUA 1E1KA 3IQZA 4DMUB 1E5VA 1F06A 3H42B 5C7LO 3PFFA 4ADSG 3TAHA 2EP7A 1GTZA 1R9GA 4KGVA 1FK8A 4RULA 4IIUA 4PHHA 4JYPA 5TGZA 4C7XA 3EGVA 1GVHA 3DMGA 3DVQX 1DCKA 3PCXA 3PKZA 1EUQA 2GI4A 4LG1A 4I7EA 5BSWA 2ZCVA 4KP7A 2JL1A 5FOUA 1ZBQA 4NV0A 3N0TA 1ZSVA 2ZROA 3L8FA 4OXQA 4RY9A 2B1IA 5GZ3A 4HAYA 2CXOA 2LW7A 1PJTA 5GM1A 4F2GA 2FW1A 4HP8A 2Y0CA 2ENWA 2XYGA 5ALQA 3RSCA 3MHPA 4KQXA 4CM4B 1RADA 3O3OB 2I4IA 2JHAA 2V65A 2IIPA 3OKAA 4EUNA 4IIFA 4TS4A 5K01A 4YVFA 4AT1A 4IGKA 1KKMA 1SGWA 2ASVA 4XARA 5FBLB 1E69A 1WVMA 2D4AA 3ZY3A 3DFMA 1LDBA 4OIFA 4KR9A 3MCZA 4P84A 2GTIA 2J9XB 4Q01A 3PIIA 4EG4A 5BR4A 5DZSA 2BSQA 1XKQA 3IQGX 1BFKA 4RXTA 1YFZA 2Z04A 1VSTA 3EC1A 4NU8X 4JX9A 5ABPA 4JBWA 4UNQA 1UAYA 4KXWA 4MRNA 3IEIA 3MG9A 2FQWA 3ABOB 1RRPA 2ZEJA 3KYBA 4EF4A 4PR3A 1F5SA 5BOSB 4QPCA 4CIAA 6ABPA 1WF3A 3FAZA 3M3HA 1FUEA 3MT9A 3QPAA 1YIAA 2J41A 1T1IA 4L8FA 5EKDA 4JC5A 7MHTA 1C7RA 4RDCA 5C2JB 3IVXA 1RRKA 2H48A 5FTWA 5LR6A 3TFQA 5BRJA 3VMMA 3IC5A 1AUVA 1GCAA 2PWYA 3ICCA 3QLVA 3OHPA 5DK4A 3TNLA 4ALMA 5B55A 5B64A 5AW7A 3FF4A 3HRIA 3LX5A 3U7FB 1VB5A 1NI4B 4GPEA 3RAPR 2AFVA 3NWOA 2Q5HA 1C2TA 2TECE 4Q1CA 1Q11A 1SVKA 1XYGA 4I55A 1D7AA 1UM9B 1FLVA 1GADO 2IPAB 3NTXA 3P2MA 1NJ1A 3W8NA 1W36C 3K9NA 3W1EA 5IJ0A 5EIWA 2CHEA 3RHTA 2QMHA 4CLRB 4LTNA 5J4HA 1JIUA 4M53A 5CP8A 1YRBA 1UQRA 1W5AA 3FGPA 4ZYZA 5GADl 3HUUA 5ARBA 2Z4TA 4X1IB 3RARA 1ZGJA 1VGQA 3DGFC 2CDRA 4PICA 5C4MA 2PZMA 2VJPA 5C4IA 5ITZB 3RK0A 2QVBA 5JSHA 1CQJA 3ISTA 3WYCA 4XVUA 4TOIA 3MFYA 3AR2A 4CDMA 3DCNA 5JYBA 2ZR0A 1Z6AA 3MB5A 1IY2A 3SM3A 3WGKA 4BKUA 5CFPA 2EWWA 3KJQA 4GLFA 1XZHA 2CZCA 1HQKA 2FWMX 2HSDA 3MUEA 1YBHA 4E0BA 1XZCA 3ADPA 4TRMA 1WS6A 2I6GA 5DBIA 1DG9A 3L0DA 3MJTA 3GD7A 2VRBA 4Q1EA 4YP6A 1XRMA 4GKKB 4AKHA 3DO5A 2ZDGA 3CEAA 3HU2A 1A96A 3HNRA 3K6RA 1UXJA 1K68A 3KXPA 1A5BB 2ZJZA 1DOZA 5IEBA 4DEXA 1Z5WA 2QRMA 4PPQA 1F6DA 4PM4A 3NVMB 2IBSA 5E1MA 2B36A 3C4QA 1LX6A 4MS1A 3RU7A 4F06A 1QUEA 1BXKA 4A2QA 4WZAB 2XYVA 1LTHR 5JS6A 1ZXBA 4G1MB 1R27A 5F1KA 5JSYA 5IU6A 1PR1A 2GD2A 1V5WA 2QP4A 4J7CA 3BWMA 5HZKA 1HLGA 2N1BA 1NVKA 3EHDA 2Q6KA 3PFCA 2FETA 2ZP1A 1XLUA 3EXG1 2LCQA 4MDFA 3OQBA 1OLOA 1MO6A 4OAOA 2QPLA 2I67A 4EB3A 3TIVA 4J43A 3QOWA 4LTDA 1BQEA 3TQTA 1ZU4A 1D8AA 2X6TA 4UC0A 1KZGB 1SBQA 2GN8A 5AW2A 5C7YA 4U6SA 5BSTA 1I1OA 3D5QA 3ZZNA 1RYDA 3X0DA 3LVFO 1L4BA 4LRYA 1L1RA 1UAGA 4KWHA 4MJXA 4XWWA 3G5AA 4HVAA 4NDZA 5GJVC 1PSWA 2YY5A 3ODPA 3ZK8A 4H0FA 2E4VA 2Z9DA 1FP4B 2ZETA 5B53A 3JQ7A 3A1CA 3CLTD 3PQ5A 4G85A 4HFJA 3F7MA 3IT0A 4JQSA 4X94A 2YR0A 4YP9A 6REQA 3UMMA 2A5FA 2C7RA 2NN3C 4YUZA 3C48A 5LD2B 4TV8B 2QD2A 1NL3A 3IVAA 4FR0A 1AKYA 3SBEA 4FGSA 2PO7A 4H0NA 3BX1A 4IHJF 1PT9A 2VI5A 4FUTA 3CGWA 3GGCA 1AQJA 4LGVA 1JIIA 2ZJFA 1BU5A 2K4MA 5E3JA 4LJSA 5LA6A 4XGKA 3NDIA 1AURA 3URMA 2P9QA 1NM5C 1IUNA 3PHGA 3A0UA 1LGYA 3SEFA 4YX9A 1B0UA 2Z6UA 4QLBA 1RABA 1OLXB 3KYDA 4EI7A 2MSKA 2XUZA 4LBVA 3N39C 2CNLA 4PNZA 2ZAGA 2O07A 2R7NA 3KEQA 3W9BA 3M9WA 2EXXA 4G26A 1JDBB 3GIWA 3C6XA 4FXPA 2ZJ1A 4G81A 1R4AA 5E38A 3KJHA 2B1QA 3SE0A 1QX4A 4MW1A 4MB0A 5JT1A 4AN1A 1E6CA 1ZJZA 1LF5A 1WSBA 5EQFA 2JEZA 5AM5A 3UYLA 5JCOC 1MZPA 4H1WA 3T9DA 2HWYA 3PNYA 1E98A 4RQUA 4HLCA 3ILHA 5CRIA 2BMDA 1I01A 2H57A 5C4GB 5LZ5A 2P11A 4HAWA 1CY1A 3ILVA 2QI9C 1ITZA 2DPYA 4FDLA 2QD5A 4CM8A 4EGSA 1VRWA 2QSYA 4O02B 1DPFA 4CLRA 2R751 3ZU6A 3PJDA 1EG2A 3MM4A 5AVZA 3L1JA 4D81A 3N6RA 3MAAC 1CVLA 4BMZA 4FYHA 5FQOA 2PTHA 1HQCA 3D3WA 4CF5A 1NVDA 3ST7A 3TDMA 1RYBA 2V96A 2IUTA 3MPUA 1E20A 4H4DA 4AMBA 4PV7A 5JFGA 3L7LA 2VJKA 3CX8A 3WB9A 4AZSA 5ITSA 2W2MA 1LSSA 1DO8A 2OUKA 4QJIA 2ODPA 1PFQA 1UDCA 3HBLA 1GTL1 1PEYA 4CM9A 4EGJA 3L5OA 3U49A 3LRTA 3WSVA 4DGSA 2HPAA 3COSA 3NYIA 5A3QA 2MSLA 2R47A 3QWFA 3B7WA 1T91A 2DCMA 3GAZA 3KUKA 3LWNA 3CH4B 3IFSA 1I5RA 1QVWA 1WY5A 3IUJA 3U3XA 2XQGA 1RXUA 4B6OA 3ZE8A 4GZ5A 3CZAA 5LJIA 1R2QA 4IUCS 4H3SA 1H6AA 3E58A 2I3BA 4EYEA 3GUZA 1V1RB 1UP6A 1VGRA 4KQKA 3UAXA 4K2AA 4HDRA 3DHEA 1F60A 1IXZA 4TWBA 5LZ8A 1X7ZA 3K32A 2Q4DA 2CZQA 3GRUA 1G8FA 4AY4A 4EW6A 2C20A 5JV5A 2REXB 4HAXA 2AQKA 4IGAA 1M1UA 2B4TO 4PG5A 2LD4A 4R6XA 5IASA 2VSFA 3WGZA 4HWGA 3C3JA 2BJWA 2W00A 3DDWA 2BUAA 2DKFA 2IUSA 3H16A 3QWIA 1V8PA 4BLRA 3CVUA 4LECA 3LJKA 3N8IA 4EPWA 3E6AA 1H5UA 1OLSB 4CKZA 3N2EA 4R0MA 2HV8A 4RHXA 1OZHA 2FMFA 4IIYA 3LLMA 3HCWA 1RDFA 4EW3A 1P1CA 1FRVA 4URHA 3QUBA 1DZ3A 4RTMA 1EXWA 1P0QA 1NHWA 5COBA 3TLXA 4B47A 1KQNA 4CV0A 1GUZA 1GPYA 3SJCA 3LZ6A 1J0BA 4KG7A 4WGGA 2BMWA 1BDIA 1NUHA 2R4TA 4EPYA 2FWNA 3QKSA 4NE7A 4CLOA 2CDCA 4BNDB 3M82A 4PXSA 4CKYA 1ZQ9A 1DLIA 1QFZA 3GVIA 4FGWA 4N40A 1IN5A 3ROZA 2J9YB 3SXUB 3KR9A 4FYKA 1R3DA 1H2HA 4ZT4A 3FWZA 5KOHA 1Z4OA 2YJ4A 4W7HA 3RS0A 2VZEA 5B1SA 3AW9A 2OM6A 1OBCA 3AERB 5NULA 4BFCA 5MF6A 1C2YA 5B2ZA 3QPVA 3JQAA 2QTBA 3MAJA 5DW3A 3ZBPA 1UINA 1MHPA 1UJMA 3KQQA 4MDYA 2IV3A 1A8QA 1EYZA 1FYWA 4TKUA 4JJFA 1U9IA 5FPSA 1V95A 3U4CA 1EP1B 3SKVA 3TJRA 1FE8A 4DA6A 3R6WA 2WWWA 4J1QA 2OAP1 3PPVA 5JS1A 1B00A 4R2WA 2B94A 3UANA 3WA6A 4H6WA 4W1RA 4NVRA 4RABA 3QM1A 4CMIA 1M54A 2ZYGA 3BWEA 3L7IA 5ER9A 3AP2A 3BDAA 4BZZA 4RK7A 4EG6A 4RTOA 3MW8A 1I30A 2FDCA 5CT4A 4G0VA 1T13A 4N65A 4YCJA 4Z7JA 3HG7A 2IF2A 3T06B 1VTKA 1A97A 4UJ5A 3RW9A 1T4CA 1TMGE 4X9XA 4YEDA 1TE2A 2QXTA 1P4GA 2XE7A 1U6IA 1CPYA 1SCUA 1CFJA 4RKQA 5SICE 3TZQA 4Z1OA 3U44B 1D0VA 3IIJA 4IF6A 1X1BA 3F78A 5A04A 4Z4HA 2OSVA 4UHKA 2EP5A 4CMIB 4HK4A 5K6AC 3SEAA 2VJDA 4RH0A 2FMHA 1B42A 3IAUA 4F71A 4WI1A 5LM3A 2YMQA 4J2HA 4PVCA 4I4TA 1WSDA 5IK2D 3IAEA 1PZEA 1UBSB 1UWVA 3T38A 1JTFA 3LG2A 4HNSA 1R12A 3LY5A 1T6YA 3B3QA 5A6SB 2XSZD 3RG8A 4WY5A 1ZGAA 1ZK4A 1YBFA 4MSUA 5LQRA 4BFXA 1K4YA 3P94A 4GMFA 4MRMB 4U7PB 1LFDB 2G72A 1DMSA 1MH1A 3AF3A 3EVTA 4GMGA 5EWJA 3WJ2A 4CE6A 3H05A 5JU6A 4TZTA 4O8ZA 2NZUG 1R8YA 2ZYVX 3QJGA 4GUDA 4PQFA 4P4SB 2Y6VA 3WG9A 1PL7A 3INNA 1KJJA 2OE2A 2VSYA 5CVUA 3U17A 2RGYA 1QV7A 3FFTA 3JAKB 4MWZA 4M88A 4B71A 4XIFA 3MOSA 4BUJA 4B76A 3H18A 1QQ6A 2HL6A 3HXLA 3QKRB 3JVDA 2PRIA 3LYAA 4IFEA 4YRIA 5EHXA 4QBGB 1DCMA 3H9BA 4IG9A 2G71A 3AIIA 3W5BA 1G98A 2KM1A 3MHTA 2YWGA 4K9OA 4UOQA 5KYWA 2P3SA 2Y0EA 1NUPA 2GM5A 4CCAA 3TIXB 1CQWA 2VTKA 2HK7A 2P5SA 3FBWA 2ACVA 3UFBA 3DVAA 4KREA 4QUJA 5I9SA 4EG7A 2VJLA 2H9AA 5LP6A 3AHIA 5THKA 2W70A 1F12A 2QT9A 1XHEA 1E9RA 4OAQA 3WWCA 5DNUA 1E2DA 1ORDA 2NTJA 5CTAA 4DQ0A 5A5DA 2ZIVB 3WY9A 1DU4A 1JU4A 3NEAA 1XXHA 2VUIB 4HNHA 3V8MA 3EEOA 4P0QB 1CNEA 3JATB 1MH9A 2VYVD 4R7ZA 3H87A 3I2GA 3X3HA 3ML1A 2WSIA 3IQHX 3WGJA 1RR6A 2OV8A 3MB8A 4PR0A 1GZ4A 1KAEA 1RJEA 1L2TA 1YR1A 2H1HA 3KSDO 2WT9A 5JADA 3GLIB 5CD1A 2ZIGA 1VCOA 4J3NA 4BWVA 4D9IA 2REBA 3D8TA 4BKQA 2R9VA 1NONA 1YQUA 1SCKA 2PUHA 1C30B 1OB5A 1J21A 2ZSDA 3H5WA 1D4AA 3TJZA 3HXTA 4HDCA 2B4YA 4FOSA 3UYKA 5LFAA 2H65A 3ELYA 3QPBA 4JU9A 2IXBA 4LDQA 3CCCA 4HQRA 2XUJA 2LBPA 4QYWA 3UHFA 1QE5A 1Q3TA 2O5CA 1X3SA 3TZKA 4FZJA 1J70A 3WBKA 4FUQA 3LYUA 4O4HA 1U8XX 5IJ9B 4KR7A 4OQQA 1EWYA 3N28A 2PNJA 2I3AA 2RHJA 1KQGA 5JZBA 1AQUA 3CUKA 3T7RA 4AY5A 2HNKA 1GPLA 1KC1A 1PSZA 1E59A 1DEAA 3EH1A 4F97A 4LI3X 5KJCA 1AXEA 3SQDA 3DHNA 1V39A 4B48A 1P2TA 1BW9B 1IK6A 5FUYA 1HSZA 1WNTA 1LNSA 1T3SA 5AJHA 5ESDA 5AUQA 4MLZA 3RLIA 5C32A 2F1IA 1QHYA 1RWMA 1PQWA 1NE2A 1Z28A 2BFMA 2WPDA 2WNSA 1IE3A 2RI0A 3F49S 3I9JA 4BNDA 2UYCA 1ZI8A 1K8RA 2GXQA 4P7GA 2R68A 5FOVA 4JLSA 5BUQA 4FYWA 1JG4A 3K0SA 1FNMA 2DHRA 4TTPA 1NF9A 4N8SA 2IY8A 5IM5A 4ZVQA 4ZGBA 1NI3A 3OT5A 1C9YA 4XD7D 1LLQA 5BN5B 2F17A 3IEPA 3MWEB 4HNAB 5EJMA 4CTJA 5I7VA 2IS4A 3THRA 2P9CA 3F73A 3FNFA 5M04A 2ABWA 2CFTA 4GM1A 1QRAA 1T5OA 4WKGA 1Q0ZA 1HO3A 2OGZA 4G0PA 3ZXYA 5L4SA 2PUGA 1WMEA 2IYAA 2WHRA 1HE1C 2JI8A 3A06A 5AUPB 3ABZA 4W8OA 3TL3A 3QPCA 4O08A 1V7ZA 1OBHA 5HEKA 3SYTA 2XNDD 4R5HA 4UMDA 3HXOA 1EWTA 3TSAA 4BV8A 1HNNA 3DL4A 3DP7A 3SX0A 5T6BA 3RJ5A 4S0XA 3SN6A 4DXDA 1I4LD 5LNK1 1SJ9A 4NEGA 4RWEA 2JEYA 3OTHA 5AW4A 4GOND 1GITA 4AN4A 3K9GA 1Q7RA 1DAIA 3JYHA 5LA6B 2BGWA 3E4CA 1G6Q1 1UBCA 1HFJA 1QG6A 1P81A 1VKNA 2FI1A 3D0KA 3KBOA 1GG2A 2GYUA 2P8JA 1QIKA 3JYQA 4C7BA 2RONA 4R1OA 1JKIA 3WLKX 3RYCA 1SXJB 1JQLB 4NIMA 2G82A 4YJDA 5I8WA 4XQCA 1KOJA 3CLHA 2RB4A 3L6OO 3PK0A 4WLUA 3TW4A 5HJ5A 4OQPA 3B1VA 5FV7A 2BN4A 2F7SA 4OV6B 4QATA 4X64B 1Z07A 4EMUA 5LOVF 3P0JA 4H7HA 4PPFA 3ZQJA 3DT9A 5LBUA 5KHLB 3U0VA 4NBNA 1Z4JA 1OAOC 2IYSA 2L42A 4HWKA 3OH8A 4PBTA 4YRMA 3UXMA 4K9DA 2B0JA 1NC3A 2INGX 1G7CA 3ZDEA 2Q6IA 10MHA 2R1TB 1NG9A 1NRJB 1TU0A 3PC4A 1QFMA 4ER0A 2W9XA 2VBIA 1P31A 2ZBQA 3A11A 4OLFA 4MWEA 4R3UC 3PGKA 4DSUA 2H5IA 3L8HA 1AGNA 3SC2B 1I3NA 3GNLA 3GGPA 4EUHA 3UKOA 3PNLA 1AMOA 1LBTA 1GCGA 3ANTA 2QUZA 2J3LA 3D0QA 4LK2A 3X2EA 4R1LA 2RJNA 4YO7A 4C0KA 2XUKA 4ZU6X 1CS0B 4ENVA 2DETA 2LZ0A 4J1NA 4G0XA 4GYJA 1P2BA 4BQSA 2IYUA 4ZVSA 3II6X 1MGPA 3QV1A 2QTVA 5EIAA 3TXYA 1QDEA 4WKNA 1ZG3A 5ALOA 1KPGA 2OQVA 4CMKA 4LJ6A 3CY6A 3BE8A 3CIFA 3JRNA 1B0PA 1ZCAA 5FD8A 1KY3A 2Z2XA 3DFIA 3AVOA 4UD6A 3R9XB 2HHLA 1J23A 4YJ3F 1QDUA 4BQEA 5BVGA 5HXAA 4UDNA 4EUSA 2BSAA 3OFJA 1Z63A 1UC9A 1CNFA 2B34A 3FLBA 4CV2A 1GL9B 4N6GA 3R7WB 2O2CA 3OETA 1PZNA 1R0XA 3BHJA 3EGEA 4UHDA 5CT6A 4Q37A 4FFBB 3QVMA 1U4OA 4QODA 4URZR 3WX0A 2LCIA 3MWKA 4JVLA 3UATA 4KL8S 3GLVA 1SC4A 4PG8A 3FMVA 2BMVA 4RPHA 1NQXA 1F6WA 1TM4E 1W88B 3V9AA 5C52B 2FYTA 4MV4A 5F2KA 3S8MA 5GMOA 1SUPA 3SYLA 4BYGA 2CFCA 2JLCA 1KOLA 1VFNA 2NYUA 2EFGA 4B8ZA 5JCZA 4C89A 1RZRA 2XTMA 2AHOA 2BCJQ 3LBFA 1VSUA 2FOXA 4U7FA 4ZPJA 2IFTA 3RC3A 3VKHA 3BVPA 1OY1A 3R8FA 1H3EA 4CLXA 2QVLA 3GDHA 1GU1A 3BH6A 5MFPA 4IRXA 2WIAA 4C06A 4JJGA 1RKBA 1UDBA 3AR8A 4G1VA 2RK3A 1C4WA 2R6FA 5BNIA 3UH1A 1NVMB 1MABA 2D3WA 2OKCA 2GEUA 3MBIA 4JXJA 1Y7IA 4FDTA 4BDSA 5IX8A 2YJ3A 2CXNA 4XFJA 3DAOA 4ZOLA 2VPIA 3SJZA 1M2OA 3EIWA 1ZD5A 2OC9A 4Y2VA 4WXPA 3BN3A 1OXUA 4QUHA 5DWVA 4LDNA 5JHHB 3IO3A 3O4RA 3FTPA 3SKYA 3V48A 2EOAA 1DT5A 3GFRA 4X7MA 2H2AA 5ALFA 4HI0E 4F5YA 3F6EX 3QLUA 3M6WA 1TIPA 3DZCA 3DHVA 5EERA 4DSAA 1SU4A 5F5LA 4ZYLA 1D9XA 2D3TA 1A8UA 4ZO9A 1L5NA 4ZJZA 4FU0A 5B36A 5BSEA 1SCIA 5KTOA 1Y3DE 1V43A 3F7TA 5DBGA 4BB0A 4BO3A 1GRRA 3T61A 1XCBA 4FFBA 1Y8CA 1W1IA 1OX6A 2AMVA 2FUCA 2JJMA 1I3CA 2RBEA 5K8CA 1QQBA 4MS1B 4ZJUA 3MA0A 4KIJA 4E1BA 4Q7QA 5JNSA 2V4MA 2HEIA 1E0DA 3QIAA 1TW3A 1RHMA 1QKKA 3MT0A 5BR1A 2PS1A 1JQ3A 1QCCA 2YC2C 4FEYA 3FA2A 1TJ4A 3MCUA 4LOHA 3FGOA 3I45A 3GJYA 4KI0A 4AL4A 4QTTB 1T2EA 4N3BA 3NORA 3U3DA 4C3ZA 5HK9A 1O96B 4LXUA 1XOIA 3A6GA 3STUA 5FPYA 4TUYB 1JBQA 4LVOA 4GZ3A 4XE5A 2ZRNA 1DKQA 1K6IA 3UBMA 4QGBA 2N3ZA 3CZCA 1JEDA 1Y3CE 4M8LA 1CEYA 1FIUA 3H3XA 1XZIA 3B9BA 1N2BA 3ICOA 4G4SP 3KD3A 1VYVA 2H0QA 3VSAA 1X7WA 5FOXA 4YQZA 3JWPA 4FLMA 1B8UA 4PNHA 3SICE 1AX9A 1GAEO 4FYJA 1WZCA 3JRWA 4WLEA 1KS9A 3NBZC 3GQBB 1NQUA 3A70A 4LYYA 7ABPA 3AK4A 5FIUA 4BJ1A 5EJ5A 5JVDF 3ICEA 2R7LA 2HSGA 2P4SA 3O4GA 1Q1EA 3E9RA 1I2CA 1COWD 1EPUA 3O8LA 2LDXA 1IDOA 4AD8A 3NIGB 1E2KA 4AZVA 4EO7A 1YB6A 2ONYA 1ODLA 3QJYA 1HOTA 3KZCA 2DWUA 4HFNA 3WSTA 5I7WA 3UG7A 2OGTA 1E66A 1Q83A 2AQ8A 3DFFA 1PW5A 1PWEA 4RLFA 1WIWA 4E5SA 1SIOA 3P27A 3F6SA 3AEQB 3KEGA 1DC7A 4XEUA 1BC5A 1WEKA 4P33A 3ZHZA 3IAM6 4B0PA 5C7OO 4LC1A 2JGDA 2RC5A 1W4RA 2TMDA 2ZSEA 3UWDA 4AX8A 1ZA1A 1Z5VA 3HRKA 1MIHA 1Y1TA 3R9KA 2AW5A 1DXOA 1MXFA 1Y1KE 5GIOE 4X1OA 1QTIA 2DPXA 3DM5A 1T5TA 1KH2A 1U0TA 2OLJA 5EMMA 2FFBA 2V5VA 4DR2B 3OMWA 4UDXX 1LNQA 2JK0A 2IIBA 3UJ7A 1Q19A 2QRZA 3EGDA 4FCTA 1I36A 5AK4A 4ECAA 3W79A 1KETA 3SYNA 1T2CA 1EQAA 1R18A 3HMQA 3DZFA 4V3CA 4GVXA 4I3HA 4RVUA 3D7RA 3OPYI 2JA2A 3DV9A 3W9SA 2BBTA 4D9GA 2XVZA 1E7YA 4ZQCB 4HT3B 3PS9A 2QIOA 1GUDA 4OJMX 3SU8A 5D85A 2IBTA 4ZP1A 1UBMS 2H7VA 1BE6A 3CBGA 3R23A 2CXRA 2V9ZA 5FF9A 3AIOA 3MGBA 2QUJA 1RKVA 1X15A 2R5FA 5AKYA 1YU6A 4DR4B 3H7IA 3HO8A 4ZC8A 2IYXA 3KB2A 5HKKD 2RB5A 3PV0A 1JFTA 2XYHA 3USCS 4CLDA 3ETLA 3WRXC 4CUKA 5DTJA 4NCKA 2WUWE 3C5CA 4TUYA 1T4DA 2ETXA 4PGHA 2GAJA 3A1DA 3QPWA 4NBRA 2PQ2A 3RVLA 2QRVA 5DYIA 1K7YA 1XWWA 5JCXA 4B3RB 3GN1A 1D0IA 2QJOA 1EFPA 2JFNA 1LSOA 1JLLA 4W9NC 4K6KA 2W2VA 2Z0MA 2QTAA 3DWFA 5IUNC 3GVPA 4IX9A 3UXYA 3AF6A 1BQ3A 1MC4A 2QN9A 2EDCA 2A30A 3HACA 1H2BA 1PN3A 2CHUA 4WV3A 4QTYA 1H1LB 3HU1A 3ZDRA 1YR3A 5F12A 4XUGB 1DC6A 1M2VA 2YFHA 5FI0B 3RRFA 4HYTA 1HGXA 1ORWA 3OJFA 2IZOA 2G07A 1HDXA 1DOHA 3N2LA 5PNTA 4COOA 1UBRS 3FNGA 2ZUBA 2ZYIA 4EJ0A 1BA2A 1RZRD 3A6LA 1E5TA 4TVBA 1T9AA 4DM7A 1PD1A 2NQ8A 4HGYA 3KSMA 4DMCA 1V9CA 2PD4A 5KYKA 3I1FA 5CTJA 3TGPA 1G8PA 2X76A 4I08A 3TB4A 1N9ZA 2RHHA 1UMKA 4W82A 5HQJA 3IP7A 2J0UA 1E3EA 2YOHA 4U6QA 2KPOA 4RCYA 1ZESA 2PUBA 4G0WA 1MPXA 1RCFA 1W48A 4JA2A 1QRRA 4J0GA 1FF9A 2W2KA 4GL4A 3AUTA 2NPFA 1H2WA 3PSHA 2DBRA 3BSWA 4UZEA 5EJFA 5KVVA 1R50A 3RASA 1M5RA 3E22B 3CNEA 1PGOA 1XMPA 2NO5A 1NY6A 4ZCRA 3TAXA 4AJJA 3I62A 3OQNA 2MINA 5CJ2A 3BSFA 2JCYA 1MKYA 3C85A 4EEKA 4LRTB 4QNNA 4ZTBA 2FSPA 2QRGA 5CB4B 1XVVA 4X92A 2BH2A 1T5IA 3R24A 4QOGA 1T34A 3EMDA 4YS6A 1AF7A 1Z0ZA 2FTKE 3BQNB 4FEAA 4E03A 2WUFA 3ZH2A 2N9UA 1MIOB 2C2YA 1CUYA 4QVKA 1INLA 2VTDA 2JFWA 3BGVA 3P2JA 1RPAA 5AOAA 1I4WA 1B1AA 1NKSA 2OXFA 2YTZA 4KDFA 2GNAA 2G9ZA 3DEKA 3GELA 4HGPA 4TV9A 4AZ0A 3OZFA 4KN9S 4BVBA 2NZXA 4YYZA 5HW0A 1LW6E 3WB0A 4LJLA 4B4OA 2ZI5A 5A05A 5JCOA 3DF9A 5AJYA 5E4JA 1KFJB 1ZWKA 2F4NA 2AOUA 4IOJA 2X8LA 4REQA 5EJ7A 3U6BA 1OW3B 2XB9A 3IDSA 4B3CA 3AKCA 3CT4A 4RGYA 1ZD8A 2GJ4A 4ZT7A 3UAZA 3V2HA 4MQFB 2B99A 1EUDB 3AGQA 3GQVA 2CJPA 2GBLA 3QBEA 1BHO1 4UQPA 4R01A 4XRGA 2A9FA 1T15A 2ODNA 4IHJB 4R69A 2QTVB 3EDQA 5DSZA 1KJIA 4KXNA 1C3XA 4KR0A 5JD5A 2D1RA 4PZPA 1JFRA 1RAIA 2Q3EA 2QQEA 3GMTA 3O93A 2OCPA 2B92A 5T4EA 4JNKA 5JMOA 1KVRA 3PDCA 1J2TA 4EG0A 3P1JA 4KX3A 4WEOA 1UQTA 3CRQA 3QVKA 4DYDA 3B6JA 4LWQA 1ZKDA 4DIOA 1TDJA 3H6KA 2BE9A 2DLNA 2JI9A 3FM9A 4RZUA 1U9ZA 2X5KO 2F8SA 1A9SA 4MW4A 5H8WA 4RACA 4GXTA 1NUTA 3QVGB 1X3LA 4MOWA 1RXIA 2I71A 3IIKA 3I0ZA 4MDEA 4NJEB 2P5YA 2RGWA 1XP8A 4C05A 4UCFA 3RNOA 5THQA 3SE7A 1JFVA 1YQXA 3PDWA 5KNLA 4DHEA 3AKEA 4ALJA 3BMOB 1KI1A 1PD0A 4Y1EA 3ECCA 3GY0A 4F7WA 1FW8A 1KS2A 2DP4E 3B9RA 3ZEAA 3UT6A 4TVSA 3FNIA 2DFDA 3SEZA 3LHKA 4ZALA 1WXEA 3OU7A 3A04A 4DXHA 4D80A 4PG4A 4F3NA 1CP3A 1NIPA 2E4XA 4K03A 3BK2A 2X0JA 2RGEA 1XZPA 1JDSA 1FCJA 1PK7A 3BQMB 1TRKA 1PJ2A 1NV9A 2XUDA 4ERNA 4X0EA 4BX2A 1YMQA 1N92A 4AY3A 3BF8A 4L74A 4MDHA 4N5NA 5AO9A 5KJ6A 4DV7B 3OIYA 4M1WA 1JAZA 3DE7X 3RVSA 1G20B 1IVYA 4QDXA 1KEZA 2OESA 1ECGA 1CV2A 1MU0A 1BH6A 3LUFA 5AM3A 1GGEA 4QXPA 3DEFA 1SA0B 3ES9A 1RXSA 1SXJE 2REQA 4GR5A 4W8HA 4CF7A 4EDFA 2O52A 2RHRA 3P2IA 4PO9A 4RVCA 1TTTA 3WNCA 3TLGB 3L82B 2F4VB 2PLWA 3SIRA 1YIOA 3VU9B 1EEXB 1RWQA 1KK1A 3ZDFA 3KUUA 1GG9A 3FTEA 4R8VA 3QFRA 1JIKA 3KLMX 9LDBA 1VKZA 2XWJI 2QD4A 2SICE 1R6AA 2NUPA 2YMMA 3ZDQA 3JR3A 1E2JA 4M0LA 3TUJC 3LT4A 3WOHA 4F4CA 1V16A 2I65A 4FWTA 3DDCA 2AFIE 1ZIOA 4BKOA 1J0DA 4K8RB 4ISBA 4JUFA 2G1PA 2A0UA 4LQLA 1KMNA 1VMKA 3SC2A 2C78A 5BW6B 2HREA 2OQIA 3E7DA 3ONWA 3PTZA 1DWUA 4JT8A 5DHQA 4CETA 4NY1A 4K7JA 4BTLA