4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Rhodococcus rhodochrous
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
1TKRA 1H2ZA 2HFJA 2G5PA 4B80A 4AO6A 1G5FA 5LZ7A 4K5QA 2QM0A 1BCRA 2HFKA 5EIAA 3FVRA 3ESAA 1CUSA 1ETHA 4WJLA 4J0KA 5EIEA 1FFAA 5DTIA 5LZ5A 4KE8A 3UUFA 4NVRA 5ALQA 4DMCA 2OXEA 1QIGA 2XMZA 2ZSHA 4IHAA 1CUCA 5AM5A 2GBCA 3WK4A 5EI5A 5DYTA 4JEIA 3G0DA 2XUJA 4D9JA 2VAVA 2IX9A 3FOBA 4LYEA 1QIHA 4MYDA 1MX9A 1ZI6A 4J0DA 5EHZA 1LBTA 2FJ0A 3DOHA 1SOMA 3KOOA 3OG9A 4DGQA 1SCIA 5EIHA 1MT3A 5C81A 3VXKA 1XZHA 2V97A 4GI1A 1RYYA 3FBWA 2BKLA 4B82A 2JEZA 4X95A 1GPNA 3I2GA 4F60A 2WU3A 2HA5A 1E66A 2QVBA 1H23A 1XQYA 4H7HA 1CR6A 2O2HA 5EFZA 4M0MA 4JYPA 3A2MA 3HC7A 2Z3ZA 2AJDA 3GBSA 4AN1A 4K6GA 2HU7A 3A70A 2PSHA 1CLEA 2OQIA 1E5TA 4U2CA 5CT9A 1R88A 5ALKA 2O2GA 3DQZA 2WUGA 2XT0A 5SYNA 3IDAA 1ZGBA 4M0FA 2HDWA 3VJLA 1YS1X 2HA7A 3D3NA 1F6WA 5AKJA 2WG1A 4YX9A 4RPCA 5HZGA 4MWSA 2JIDA 2RHTA 1UXOA 4KACA 4B6GA 1BU8A 3WLAA 4BDTA 4UBMA 4HTAA 1MNAA 3PICA 3NWOA 5AI9A 1MN6A 2OAGA 4PSDA 3GA7A 3D59A 1XKTA 3T4UA 1B41A 1TIBA 1DX4A 1RWQA 5F4ZA 4AXBA 4FBLA 3MUNA 4GXNA 4UHHA 2RONA 3O9MA 4BTLA 1CUBA 1XZJA 2E3JA 2H7XA 4CG1A 2LIPA 4EUSA 3HI4A 3AILA 4AZ3A 5LP1A 5YASA 3G0CA 2ZYSA 1XRPA 3CN9A 3BJMA 3RK4A 4HZGA 2CJPA 5AKIA 2Z3WA 1CUWA 2GYWA 4B84A 4I3FA 3FYTA 5CXXA 1ACJA 4IH4A 2I78A 3AIKA 2XMQA 5FPQA 3KDAA 1ZI8A 4J0HA 4J0JA 2XI4A 1QE3A 4EB0A 4UUQA 5AI8A 4MWTA 1YR2A 1ORVA 2C5GA 2BUAA 3O4GA 5CURA 5IVDA 3G9ZA 2QJWA 4UBJA 5ALWA 3STTA 4DNQA 3FNBA 3ICVA 1ZD3A 3B3QA 2QUBA 2PSJA 4JUIA 1T4MA 2HM7A 2RGUA 4Y2QA 3G9TA 4OB7A 4G9GA 1N8SA 2HU8A 1EVQA 4A16A 3EQ9A 2AJLI 2IITA 1FFEA 5A6VA 2XE4A 4KAFA 2QR5A 4MEAA 1N5MA 5A62A 5ALOA 2OG1A 3ESCA 5CBKA 2HA4A 4HS9A 1J1IA 3WA7A 3WA6A 1R3DA 1WB5A 1IVYA 2PX6A 1HLGA 1L7AA 2VT7A 3TJMA 4INZA 4BDSA 2I3ZA 2WJ6A 1MU0A 4ZWNA 2WSLA 1LZKA 4B7ZA 1MJ5A 7YASA 4ZI5A 4X93A 3WL8A 4AX4A 3F98A 3E0XA 1EB8A 5A71A 4DSAA 4G8DA 5HQ3B 4WFIA 4OCZA 3V1KA 3AZOA 5DNUA 3WL7A 3WK6A 3V1NA 5JZ9A 2RI6A 4BAZA 1F0NA 5IVKA 1YB6A 3ZWQA 1W4LA 3TEJA 4ZV7A 2JGKA 2XMSA 2QT9A 4OB8A 5JATA 3WL5A 5HF9A 3RM3A 3CN7A 1FFBA 1LNSA 1QIFA 3H17A 4MXDA 3DL7A 3WWPA 3QM1A 5JALA 1LPBB 2Z5GA 2XUAA 3BDVA 2VT6A 3R3UA 1C7JA 2OCGA 1GQRA 1OXMA 4H35A 1UT6A 1HL7A 1LPPA 1VZ2A 4HVTA 2PKYX 2WJ4A 4ETWA 2C7BA 2AJBA 2HHAA 1JI3A 4FFWA 3WYDA 4B0OA 1ZOIA 1LPAB 4WDQA 1FJ2A 3ZLUA 3O95A 4CCYA 4E11A 4AMYA 3NUZA 3WWOA 5FPPA 1CPYA 1BN6A 2BAGA 2OQVA 2X5XA 1L7RA 4TVKA 3QBJA 4JNCA 2XMGA 2ZJ6A 5EHNA 1W1IA 2JGMA 1PJAA 3M3DA 1AMNA 4G4IA 3BE8A 5K3EA 3C87A 3O9VA 5AK5A 1EDBA 5EHQA 2JGFA 2EDCA 1B6GA 3WKBA 4X00A 3DKRA 2XUPA 1PV1A 1UK8A 3GELA 5K3CA 4H7FA 4DTCA 2GYVA 2WQZA 4Q3LA 1CQZA 4DMHA 2HRQA 2QXTA 1YA4A 1QTIA 4Y2TA 2XMBA 3O4JA 1JMKC 2D5LA 1HPLA 4NMWA 5JD6A 3R41A 4KE6A 1XZMA 3CCBA 3V48A 4Y2XA 1DT5A 1XZGA 4X6YA 1QIIA 1ORWA 3EIOA 4Y2JA 3IULA 2PM8A 4UBKA 2DHCA 3W05A 4K2AA 3V9AA 3VJMA 2XMCA 1QO7A 5LZ9A 1MTZA 2PSDA 3R3WA 3PDCA 5IKXA 2V9ZA 3G9UA 5JZSA 1OILA 2VTVA 2R8BA 5AK3A 1G66A 3C70A 4BBZA 2PPLA 2QJRA 5KREA 5AIBA 2XQGA 2OGTA 5T4EA 3H18A 5ALSA 1CUVA 4OUKX 3HABA 5LZ4A 4WCVA 2XLBA 4P92A 1U4NA 2ZYIA 4CI9A 4P93A 5HK8A 1SC9A 2HRRA 3IBTA 2H7YA 4ZREA 3WKCA 3R3XA 3G9XA 5IH7A 5CXUA 2EDAA 4FLFA 4BC1A 4X91A 4IO0A 2OLEA 4H18A 3ICWA 4EA6A 3E4DA 2I3DA 3I1IA 1VE6A 2OAEA 2XUOA 5ISMA 3WWCA 3EF3A 2B9VA 1ZD4A 5H3HA 2C0PA 3O0DA 1AKNA 4GHWA 2HU5A 2VQ6A 5ALIA 1QJ4A 2HADA 1CQWA 1J2EA 2Y2VA 4HXFB 2DQYA 5E4JA 4BTVA 2C58A 5DWDA 1UOPA 5IVHA 4N8DA 1N5RA 2DHDA 1WPRA 1UK6A 1DX6A 3BXPA 1WHSA 1H2YA 5E4TA 1XZCA 1BCSA 5ALPA 1WOMA 5FP0A 5FOQA 1MX5A 4J0CA 1EK2A 1U65A 2XQFA 4LYDA 4LXGA 4BZZA 1MAHA 1C4XA 4FDMA 4CFSA 3W06A 1H22A 2XUFA 4G4GA 2PL5A 3G8YA 5DNWA 1UOOA 2OCIA 3S2ZA 3BF7A 1R50A 2BUBA 5AKZA 2D0DA 2GBGA 2CB9A 1AX9A 3FSGA 3B5EA 5BWCA 4OU4A 5CMLA 5ALTA 4FFVA 1WB6A 5AOAA 5DYYA 2FUKA 3KWJA 1A88A 4H0CA 4C01A 1BE0A 3HZOA 2WJ3A 2WFLB 4H7JA 2WHPA 3IA2A 4GDMA 1LPMA 2FX5A 5K3FA 3CCCA 1WPXA 3FVTA 2JEYA 1XKLA 2XUQA 5HKBA 3C43A 5ALVA 1XRMA 2Y1KA 2B4KA 1SFRA 4AB1A 4TPKA 4RGYA 1CUAA 1JU3A 3C8HA 4MJ3A 2VATA 1L7QA 1YA8A 5CT5A 4XJVA 4W63A 1QIDA 1JFRA 3PFBA 4QDTA 1UZAA 3VDXA 4GLBA 1AC5A 1UKCA 3ZLTA 4Y7DA 4QLOA 1YAHA 2AJCA 1BEEA 4DLNA 3ED1A 3G7NA 4KYVA 2PU7A 3DYVA 2G4LA 1CUDA 5FUMA 5HK9A 2YH2A 4W1PA 4GWLA 1G42A 3RKSA 4DM7A 4CCWA 5EHXA 3WL6A 2JGIA 1P0PA 3HACA 3LIIA 4BVJA 1GKLA 1K8QA 3STUA 2WUEA 2CZQA 4UHCA 1HKHA 3HSSA 3U0VA 3P2MA 3G0IA 4H7KA 4RNCA 5D3ZA 1KEZA 5A2GA 2NW6A 3D2CA 2R11A 4P08A 1ZJ4A 1EDEA 4HXEB 4X92A 4PNZA 4UHBA 5AKGA 3JYHA 1ZICA 4GBGA 1QGED 5AHXA 2XMDA 4N8EA 1GXSA 1W6RA 4A5SA 1VLQA 5HFNA 1CUGA 4Y9SA 1GZ7A 1A8UA 3GFFA 2Y6UA 1CEXA 3UMJA 4BAUA 2G5TA 4YK7A 3F97A 1VA4A 1TRHA 1CUEA 1CUHA 3PF9A 4UBIA 4KRYA 3WKDA 3DDUA 1CRLA 3AIMA 2WHPB 1RP1A 2YXPX 3EBLA 1VJ5A 1LGYA 3L1HA 4J3JA 3STXA 3FWHA 4HXGA 1CUXA 1DWOA 1SCKA 4PQEA 1XROA 1YB7A 1S8OA 1R9MA 3ANSA 3IUQA 2JGJA 1EH5A 3M81A 4UFNA 2WKWA 4WDRA 2WIDA 3V1MA 2HIHA 3OM8A 1XLVA 5DYWA 2ORYA 1CV2A 4WFJA 5AP9A 5FXMA 3AZQA 3BL8A 1P0MA 3DNMA 2ZSIA 2EEPA 1XFDA 1DWPA 3RLIA 2VJCA 5ALDA 3ESDA 5CRIA 1DQYA 1CUZA 3DCNA 3LIPA 5C8XA 3L1JA 1XZLA 3C8DA 1JJFA 3ZI7A 2CBGA 2CMFA 4F0JA 2BFNA 3ESBA 3ZLVA 3I6YA 2AJ8A 4DSZA 3OPMA 1R1DA 5C8VA 4OU5A 1NU6A 3F9CA 5LIPA 4ITVA 4PV7A 1IUPA 4QWWA 2H1IA 2VEOA 3A2NA 3C5WP 3D7RA 3QPCA 5AKKA 1CUIA 4QDZA 3RARA 2HA6A 4E14A 5LYYA 1IUOA 5KWJA 3AIOA 5T4HA 1ODSA 4K6KA 3JWEA 5AOCA 4PO3X 3E1GA 3N2ZB 4QA9A 2OGZA 2VA9A 2WTNA 4H7EA 3UUEA 3WKAA 3FYUB 3MUOA 4G1FA 2PVSA 5AOBA 5A7GA 1LLFA 3DJYA 3AINA 1GQSA 5C8ZA 5AKHA 4N5HX 5I7UA 1W75A 5AM0A 1W52X 1EINA 1QTRA 1VXOA 2O2IA 4QEKA 4W1SA 1I6WA 1P0QA 2ACEA 1CUFA 1ZI9A 4X94A 4ZRDA 3S8YA 3H2JA 5A7HA 4H77A 4MEBA 3F96A 3BDIA 3KWFA 1A7UA 5ALNA 4ARBA 1K63A 1JJBA 1ZGCA 5K3DA 6YASA 3D2AA 1UOQA 3BIXA 4CIBA 1ZJ5A 5CT4A 4KRXA 3WWEA 2ROQA 2HA0A 2XB6A 4I4CA 4Q34A 4NS4A 2OCLA 5JZBA 1MPXA 1ZD5A 4BVKA 3WK8A 1O6GA 5FRDA 1XLUA 2VJDA 4GW3A 5AO9A 4Q1VA 3STWA 1VA5A 1M33A 3KXPA 4OD0A 5JAPA 1NX9A 3R3ZA 1Q84A 1IUNA 2W22A 2XUIA 2GZSA 3BIWA 5BV7A 2AXEA 2GBIA 5EGNA 1Y7HA 3FSGD 1TAHA 3DOIA 5BWBA 4Y2SA 3EQ8A 1TCAA 3H1AA 3AUKA 1QFMA 2O7VA 3QMWA 3VJKA 4C4XA 5AI4A 1JKMA 1XZAA 1E3QA 3H19A 3DEAA 4FNGA 4X85A 5JANA 1C7IA 3QMVA 2WIJA 3DYIA 5AICA 1EB9A 3IUJA 2QKYA 3SWWA 3QVMA 1G4HA 1YS2X 1ACLA 3ANTA 4C4ZA 4AZ0A 4E15A 1H2XA 4H7IA 2XUKA 4Y2PA 4Y2UA 2WM2A 1XQWA 1EXWA 4B0PA 5ALRA 3FLBA 5D3KA 1U2EA 4EY4A 2WILA 2GBFA 4Y2YA 4YASA 4N8SA 4HAIA 4CG2A 3W9UA 4PSCA 2CUTA 1XZEA 2VSQA 1LBSA 4EY5A 3H2GA 4AMZA 2QUAA 1FSSA 5AM2A 1ODTC 1TQHA 4U2FA 1IMJA 3WWDA 3H2IA 5AJHA 2J4FA 2JGEA 4OYYA 1IZ8A 3WZLA 5ALZA 2C5FA 1YAJA 3GZJA 4AO7A 2ECFA 5IVIA 4QZVA 3IUNA 4OYLA 4EY6A 1HBJA 3W2TA 5KWIA 1AGYA 2I03A 1YASA 4J03A 4DMFA 4F5ZA 2J3QA 3WKEA 4WFKA 3NOXA 4ARAA 3WZMA 3VVMA 3WIBA 5ALHA 2ZJFA 5HFAA 2VAXA 1XZFA 1QIJA 2WFZA 4ROTA 4XWGA 3K6KA 4G8CA 1QONA 1AURA 2HA3A 2DCMA 5LZ2A 3IUMA 4U2BA 1UK9A 2QTBA 4IH1A 4GEGA 4Q82A 1Q0ZA 3SK0A 5ALGA 3K9BA 2W6CX 4B81A 4KAAA 3CXUA 1USWA 2VJBA 4OSEA 2WG0A 3D4LA 4AN0A 4W1RA 4FOLA 1GPKA 3QZUA 2ZVDA 3WK9A 1ZD2P 4FHZA 2JGLA 1DWQA 1Y7IA 2WU4A 4X6XA 2ES4A 1XQXA 1TCBA 4DMKA 5CH3A 1QO9A 4BC0A 4FBMA 3OC0A 3BWXA 3FCXA 1WB4A 5ALJA 1MO2A 3GUUA 5LLSA 2WIFA 5JAOA 2JF0A 1WHTA 1BEZA 2GYUA 5JD5A 1E8DA 4KR0A 2WFLA 3O4IA 4DNPA 4ZXFA 3KD2A 3R3YA 5ALLA 4EY7A 5FKJA 3N0TA 3BJRA 4WY5A 3FAKA 3VISA 1XZDA 5AI6A 5JIBA 1NU8A 3DD5A 3WJ1A 2WLSA 2DSNA 1T2NA 2YYSA 4L9AA 1EA5A 2ACKA 1XRNA 1LPOA 4UBLA 5HQ3A 4FLEA 4X97A 3VKFA 4B9AA 3KSRA 5JAUA 2Y2UA 4Q3KA 5ALFA 4G5XA 2OGSA 3FLEA 5HF8A 2WUDA 5BOVA 4U2GA 5JARA 2X76A 3M83A 3QH4A 4DYHA 1FFCA 3H1BA 4PF1A 4Y2RA 3TGLA 5AKYA 1VE7A 1EX9A 1EI9A 5D6OA 5JAHA 1KU0A 4UBOA 3LS2A 3O4HA 1EHYA 1CFJA 4BAGA 3HJUA 3IIIA 4AQDA 2CEKA 3FYUC 1HQDA 2PBLA 2ZYHA 5HF6A 4X7BA 4BCBA 5DJ5A 2JBWA 3I2HA 1Q0RA 3B12A 2C4HA 4BZWA 1R4ZA 5D7BA 1DTEA 1QFSA 1W76A 2QXUA 1YSCA 2WTMA 4G9EA 4YPVA 3F8SA 4G4JA 4QLAA 2XLCA 3I28A 4V2IA 1K4YA 5LKAA 5CW2A 1AUOA 2WFMA 5T4FA 2BCEA 3LLCA 1KU6A 5AK6A 1VKHA 4BYMA 5DLPA 4C87A 3WI7A 3C5VA 3R40A 3I2JA 5AK4A 5CT8A 2H9YA 4N5IX 4BP8A 4UHEA 3H0CA 1WCYA 5HF5A 1LPNA 1ISPA 4EY8A 4QE3A 2QS9A 2RIPA 4W9RA 4CCYB 4LIPD 1Z68A 3T52A 4Z49A 4E46A 2O7RA 3LP5A 2WIGA 1ZIXA 2QOEA 1UKAA 4J0IA 3I2KA 4KAJA 3C6YA 1D07A 5ALYA 4BE9A 3HXKA 5CTAA 3AZPA 5E2IA 4MQMA 3F67A 5AI5A 5ALMA 5ALEA 2HL6A 3SX4A 1Q83A 4UHFA 4CIAA 1TCCA 2J3DA 4LXHA 1DINA 3PFCA 1J07A 2BUCA 2WHQA 3FYUA 5HKAA 3BF8A 3QPAA 4JH0A 1F0PA 3WJ2A 1EVEA 1JT2A 3A6ZA 5AI0A 3IB3A 1EK1A 1UK7A 2WIKA 2WUFA 3C45A 1VXRA 5FV4A 3JW8A 4H7DA 3V1LA 4LHEA 4X3CA 1EDDA 1N1MA 3HEAA 1XRQA 1LPSA 1TK3A 3NGMA 1DU4A 5A7FA 2B20A 5LKRA 4XX1A 2XQIA 3GROA 3STYA 1QIEA 3FCYA 2XQKA 3R3VA 3H04A 4HRYA 2V98A 1GPLA 2PSFA 2WG2A 4MYSA 1OCEA 4G8BA 4EZIA 2BJHA 3PF8A 3PUIA 1MX1A 1H2WA 5K5EA 4IQ4A 4QDOA 3D2BA 3OOSA 1QZ3A 1XRLA 1XQVA 4L3WA 1HDEA 1P0IA 2K2QB 1DT3A 4OPMA 5HCUA 1CIJA 4HRXA 3H2HA 4O08A 3IURA 4BRZA 1BN7A 1AZWA 3X3HA 2Z8XA 4Y2VA 5AH0A 5FLKA 1VOTA 3I1YA 2HA2A 3D0KA 4QDUA 4UFPA 2XUGA 1E8NA 5ALUA 4BRSA 2B61A 1U8EA 4M0EA 1CVLA 4B83A 3EQ7A 1ODCA 3WK7A 2X8BA 1E8MA 4S0XA 3W9BA 5AKXA 4I19A 4FNMA 1Y37A 1IZ7A 3DS8A 2QZPA 4X6UA 4FMPA 4DNOA 1A8SA 4FTWA 4X90A 3Q0TA 2XUDA 3VVLA 2GZRA 5K3FB 1A8QA 1R9NA 3K2IA 1AQLA 1K6EA 4K6HA 2DFPA 4UBNA 3AJAA 1QLWA 1LZLA 3IVMA 2XUHA 3HLKA 1GT6A 2DQZA 5AKLA 3R0VA 4J7AA 5E4YA 2ZYRA 3WIOA 4QDXA 4BE4A 3TRDA 3H2KA 3HYSA 2Z8ZA 3WYNA 4AO8A 1XLWA 1PFQA 4A23A 4C6HA 2UZ0A 1WM1A 2P8SA 1BROA 5T4BA 1QIKA 4Q3OA 3DLTA 4UFOA 5J3JA 3M82A 2G63A 4C88A 3E3AA 3PI6A 2RHWA 3G0BA 3L1IA 4ZGBA 3YASA 4KE9A 4BP9A 3FLAA 3I6ZA 4GECA 2BGRA 1JU4A 4LKOA 2QMQA 5AM3A 4CG3A 5CH5A 4PW0A 3QPDA 4F21A 1THGA 2FJPA 4KEAA 2OCKA 4Q05A 1XRRA 3QMMA 1GGVA 1VZ3A 4ZV9A 4UHDA 1SCQA 5FDFA 1YCDA 3MVEA 3DL4A 4B9EA 5DTJA 3ZPXA 5KBYA 3I2FA 4P9NA 3SC2A 4MQLA 5AKEA 3PUHA 3G02A 4C89A 3STVA 5JD4A 3QITA 1QIMA 5ESRA 2V96A 4XIIA 4PSUA 4IH9A 1BS9A 2J4CA 2PSEA 1QOZA 5C7YA 4EBBA 2PUJA 3U1TA 5JADA 1X70A 4EHBA 1JJIA 3WQHA 2CKMA 4KJXA 1E89A 4RE5A 2VF2A 5AM4A 1BRTA 4WY8A 2IIVA 4U2EA 3ILSA 4U2DA 4W1QA 3LCRA 3PE6A 3I6MA 2Y6VA 5K3BA 1K5PA 5ALXA 4BVLA 2PU5A 5SYMA 4TGLA 3QYJA 2Q0XA 3ZV7A 1F8UA 2QRUA 4DNFA 4RE6A 1MAAA 3Q8WA 1X2BA 3C6XA 3A2LA 1CUYA 4KE7A 4BATA 1MNQA 4XVCA 1GKKA 3W04A 5DNVA 4DIUA 4L0CA 1DQZA 1FFDA 5JASA 3AFIA 4FLMA 3OURA 5AM1A 3DKKA 1XZIA 4QWMA 2PUHA 2WHRA 2XMRA 4BB0A 3MGAA 4NZZA 4L72A 4C4YA 1UKBA 4LXIA 5AIAA 1THTA 3C6ZA 3I2IA 1XZKA 4FKBA 2RAUA 3OTQA 5JYCA 2DR0A 3WMRA 2OPHA 2VJAA 4QNNA 4J0GA 5LZ8A 1X2EA 4FWBA 2C0QA 1CUJA 1UWCA 4UPDA 2XQJA 5CT6A 5I8PA 2BGNA 1JMYA 4BCCA 5CH8A 2ZJ7A 2DHEA 2H7CA 3WK5A 4X71A 1O6FA 1XZBA 1J06A 2YASA 4BCDA 4OB6A 1ZIYA 4B85A 4JYMA 5K3AA 3C6BA 1UFOA 5I9IA 3G0GA 3D5EA 1CUUA 2XDWA 3HRHA 2ONCA
chains in the Genus database with same CATH superfamily
4X1IB 2V8OA 3JQBC 2QD4A 5TC4A 1TA0A 1X15A 4G1BA 1IXKA 4MO9A 2HFJA 13PKA 1T0JB 1T9GR 1C2YA 2G5PA 2JFOA 3GO4A 4XGNA 1IBRA 5CEFA 1E0AA 5DX8A 3RODA 1KJ9A 3LAWA 1QVAA 4AO6A 1D0VA 1CQIB 1G5FA 4M46A 4PC7A 1Y4UA 3EG5A 5AHRA 3LFUA 4LMRA 3FNEA 2EHDA 3JQGB 2QM0A 5D5PA 2PEYA 2Q6IA 2HFKA 1ORIA 2R6JA 4RAOA 3ESAA 3DPUA 3HU1A 5B3LA 2BFCB 3VO9A 2JI7A 1HETA 3HDVA 1CUSA 4GGPA 2AOUA 2KX7A 3AGPA 1YBVA 5L45A 2R68A 1EIWA 1P2VA 3UJ9A 4O4IB 5DT2A 3ZGLA 2GQ0A 1HNWB 1DKQA 1DTSA 1U0BB 2HQBA 4PC1A 5LZ5A 2ZTLA 3AV3A 3O8BA 2NQ2C 4KE8A 4KMSA 2CVFA 4CNBA 1U0LA 3Q6NA 3OSUA 4EA7A 5J2UA 4TYQA 1GZ6A 2BGGA 2B4QA 1RXWA 2F1KA 4W5WA 1XVLA 4NCNA 2IHJA 3RJ9A 2WTUA 2J0QA 3WHLA 3RVNA 4IMJB 5ADWA 1TD9A 4YMVA 4UQOA 1SJ9A 4F2GA 4EPWA 1ZGJA 3LY9A 5AM5A 1AN0A 2RJ3A 2VDWB 3WMFA 4AKSA 4D8WA 1DRWA 3WK4A 4ZIRA 5EI5A 1X8JA 1Q0HA 5DYTA 5E7MA 3MFYA 1REQA 2XUJA 1I7PA 3JD3A 3NXKA 3MN1A 1AUVA 4QQRA 3PC3A 4LXQA 5IMBA 1T5BA 5HIAA 1L3IA 2P90A 3PIRA 4MOWA 5HGJA 1Z0UA 3AUAA 3BG5A 4D9JA 2VAVA 1THMA 5E0KB 2QIOA 2NUPA 3NOVA 4ZU1X 3VV2A 2GN6A 3ZCVA 4F91B 1QIHA 3OE1A 2PYDA 2ZUDA 3LCJA 4KO8A 4C4TA 2HJRA 4CYMA 5EEHA 4WFQA 4GLFA 2CVZA 1L5WA 4NCIA 5EXPA 2VPZA 1YXMA 2Q1WA 5HBGA 1D5CA 3OF3A 1GV1A 3ZZTA 3KOOA 3OG9A 4BLTA 4C0HA 4U3JB 4A2WA 4L50A 2QN2A 1I4EB 1JYSA 1MA3A 4CIYA 1SCIA 2GHIA 5EIHA 1MT3A 2QQEA 1NUAA 3ZZNA 1H6AA 3TIXB 2WBLC 3ZWAA 1OYOA 3CX6A 3CZAA 3G5AA 5C81A 1EXNA 5D51S 4YCBA 4KGZA 3PDIB 1XZHA 2W2OA 4O4LF 4OBEA 4B3CA 2VF8A 4I46A 3RVSA 4HNQA 5AT1A 2PKCA 1RYYA 1V16A 2DUMA 3FBWA 4HEQA 2WYUA 3WRYC 4YO8A 5E9QA 5CYFA 2DULA 3LBFA 4B82A 1PVVA 4ZQGA 3HA3A 1I51A 5G1PA 4DV6B 1PDVA 4B43A 1GPNA 4F60A 1GAWA 1UBFA 3GL9A 1CJVC 2BL4A 2WU3A 2HA5A 3DZCA 3GJ4A 1XKXA 1E66A 2C9BA 2HWUA 1T9BA 3G6WA 2CXSA 3W4IA 2QVBA 4WZAB 3TLEA 3W5SA 1G5TA 3WIEA 5HWSA 2AN1A 3OA2A 4GR4A 4N4AA 4C20A 1Y6FA 2O2HA 4LRWA 2YNMA 5KOHA 1B8OA 1WBJB 7ADHA 1KK2A 3WB1A 2A3NA 2Z3ZA 4TZ0A 3ZWBA 2QT0A 3PC8A 4CQMD 4AQYB 1Y81A 2JD2A 3I0NA 4NMLA 2JH8A 2QYTA 2W43A 5D6NA 4F3YA 1UQUA 3RRFA 1DPGA 1NP3A 3BFPA 1U2RA 3JASA 1O4VA 3EZFA 4CMBA 3OJEA 5JJIA 2I4TA 1E5TA 3M6FA 1MOQA 2OCBA 5CGZA 4PG5A 3FLMA 3ECSA 1PWXA 1R88A 3LF1A 1FNNA 3AETB 5CX4A 1DJMA 3H3XA 5TJHA 5G0UA 4OLBA 4E1AA 2D54A 2ST1A 3IP3A 2WUGA 5L95A 1SOUA 2NXEA 3ONVA 1SD5A 3GRYA 2C2OA 1QQ7A 3HSKA 4AWBA 2CZCA 5LM3A 3DTTA 1OAAA 1SM4A 3KYIB 5G3ZA 2QSJA 4YGYA 2O2ZA 1ZGBA 4OKNA 5DBOA 3O3OB 1HXHA 2DUJA 2QZZA 1GWNA 1Q1NA 5E8JA 3D3NA 4Q18A 1F6WA 3DEFA 4WK6A 3MOIA 4P4SA 1EWYA 4MV3A 4YX9A 4WRRA 4JNKA 5FNVA 4Z8YA 2TS1A 4RPCA 1UT8A 4IJVA 2IV2X 4UPEA 4EG1A 1J42A 4MWSA 3USZA 1Z15A 1QH1B 3PUVA 1UXOA 5ETJA 4PC2A 2G7MC 2NM0A 1BU8A 2FDRA 3UMBA 3K9HA 1D2RA 2ZR7A 3AVUA 3P4YA 2FLKA 4UNIA 4ZYTA 3GGCA 1H94A 2UUPA 3E7XA 3WWYA 2LWIA 1SIWA 2XZPA 4W8HA 3ZU3A 5AVWA 4RZHA 3NWOA 3E7WA 1Z47A 2OAGA 4QYIA 4AS3A 4E07A 5KX5F 1IL0A 1YZVA 2QTTA 4FHEA 4G5OA 4PSDA 4RKWA 4F2WA 1SMKA 1Q7GA 1AS0A 3RYIB 3TSCA 2VCHA 3IQWA 3T0IA 1WCV1 4YNBA 4PR0A 4IIFA 1H9CA 1DX4A 1K0UA 4NLLA 1H8HD 1MTOA 1SBNE 3NG1A 3FOCA 2WWGA 3OPYI 4WZAA 4AXBA 4HH1A 4FDLA 2PBRA 1IN8A 4FBLA 1QSGA 1RQLA 2VVTA 4GM1A 4JLSA 3K6SB 5EJ5A 3FMOB 1C7QA 3MCZA 4DMGA 1KZ6A 3ZHYA 2X3UA 2HI0A 5EKTA 1XZJA 3GRFA 5CVJA 4LQCA 1BKYA 3PQ4A 4YGXB 1V1MA 1NUHA 3KVYA 4CG1A 5K8CA 2CDRA 1GFSA 4DWWA 3P5BA 2R00A 1YT5A 3U7HB 4AZ3A 3TMKA 4N82A 3PQ8A 3P9SA 4ENSA 4D5EA 4BUJA 2JLVA 3GRAA 2X3FA 3IAS1 2H3EA 3Q0IA 4HQNA 5HSGA 2NSLA 2QJFA 2R8XA 1J2UA 3TYXA 5KTSA 2FCRA 1G8HA 1N6KA 1XRPA 3ZNOA 2OLKA 2JJ1D 4D02A 1QX4A 4G0OA 4DLLA 5KYKA 4ERNA 2O23A 1XMSA 1MOSA 2NX2A 3RK4A 1WABA 2Q4TA 3QPBA 4HFNA 4MW2A 4PG7A 1SHTX 4LBWA 3ZQ4A 5JHHB 4ARIA 1A4IA 3VH4A 3ZZUA 2ERYA 1U7HA 1Q1AA 3KWMA 4R0MA 1O5TA 4I3FA 1XVUA 1QTNA 4LJ6A 1MB9A 3IT0A 1R4MB 4W7HA 5HJ2A 3QLJA 4CCSA 2FPIA 3CVUA 4KYTA 2Q9AA 4ZYLA 2O8VA 1CT9A 3WMWA 4A8HA 3WLJA 3CKKA 4LYYA 2V0GA 1R5JA 1NP6A 1KZYC 1U99A 3BHNA 3QHQA 4QOJA 1EAYA 2ZUUA 3F8TA 3JZFA 1FYDA 1TLTA 4K81B 1G5RA 4BN4A 4XE5A 2W37A 1QPBA 1SKYB 3KJHA 2A33A 3JWPA 1US8A 3N76A 5FBZA 5LBIA 1ZI8A 2AUTA 1TVKB 1D4OA 3TTXA 2I9PA 3CUYA 4NTZA 4BPBA 1T2EA 3NDRA 3VO2A 5DHSA 2X13A 3CUEF 3IVXA 5AHKA 4TOIA 4F8JA 2IDMA 3NHKA 1RRGA 3O4GA 1XA4A 3HUUA 3KB2A 3Q9LA 4HFJA 1VCHA 3TZBA 1Y1LA 4BIMA 2GN1A 2QAGB 4R9SA 4Q21A 2OO7A 1V35A 3ZJTA 2QJWA 1JHDA 2KI5A 5ALWA 3VFDA 4DNQA 5EZYF 2C2HA 1GZDA 2GEKA 2R6CA 2QUBA 3B3QA 3FOZA 2PSJA 8OHMA 4O2AF 1JTVA 2GESA 1Z4OA 2A0KA 3NALA 3IE2A 1W46A 4H3VA 1MJGM 3H0EA 1S4QA 2EQAA 4H4DA 3C8MA 4HAWA 2YJGA 4G9GA 3AR8A 3RVPA 4B6QA 2HU8A 2RGXA 3FPJA 4WJKB 5EUBA 3RAFC 3C3DA 3VAAA 1OYYA 4YI3A 5HEKA 3V8EA 3UATA 4OX9Y 2V6MA 1SPBS 4XWOA 4CT5A 4US0R 4JLWA 1UXJA 1P1RA 1L5ZA 2GJ4A 3F5FA 1FFEA 3L0DA 5DDIP 3M9XA 621PA 1I4WA 1R15A 2AXNA 1JSXA 1SIOA 2H59A 4X8OA 3ROZA 1P7YA 1T2UA 3B1ZA 2RB5A 1HL3A 3D2LA 3Q85A 3RS5A 1PJZA 1IXYA 1HRDA 5ALOA 4U4AA 5EJIA 4Q6BA 2YV1A 3PGMA 3A4LA 4HS9A 1J1IA 4D0RA 2Q49A 2ZSAA 1XCPA 4IJ5A 4D4MA 1EZ4A 1SB9A 4Z0TA 1R3DA 2H5JA 1AIPA 1NKSA 2YC2C 4E5VA 2CV0A 1V39A 1JYFA 3I30X 4P33A 1VKZA 2E87A 4UXHA 1COWA 3QLUC 1IHYA 2D8MA 2I3ZA 4INZA 3TJMA 4YCAA 4BEJA 4FKMA 5U1PA 4B7AA 4ZWNA 3UWMA 2XZOA 2DWUA 2G9QA 1C9KA 1V6CA 3AJ9A 3DC7A 3GFPA 5FFFA 3RU9A 5CFMA 2IEAA 7YASA 3QU7A 4ZI5A 4TYYA 3MWKA 3R7WB 4K1LA 4QUJA 1FDTA 4JP5A 3WL8A 4RIHA 4KQXA 1O94A 3FMPB 4F7DA 2ADFA 2C2GA 3F98A 3E0XA 3QY0A 4RDCA 1ECGA 1TAQA 1TXGA 2NT3A 3E3MA 4UUBA 4BZXA 4LY0A 5E1MA 2Q2WA 3GD7A 1ULTA 4C7VA 1P7PA 3VR6D 1YDMA 3IUEA 3IVGA 2AZ4A 4RA6A 5H4GA 3K35A 4OCZA 5ECWA 5IBQA 1WXIA 1E2NA 1NASA 4AW9A 1O5IA 3MLBA 1UBHS 1SG9A 5H82A 1YR3A 4D9IA 2JI8A 3ZHCA 1JPVA 4QJ3A 3WK6A 4MGEA 3SX2A 3N2GA 4D4IA 2RI6A 4RWZA 5I7HA 1ZJWA 3KSMA 4YHBA 2P69A 3KVOA 1FP1D 3H8WA 4GQBA 2AI3A 1CZNA 1NI5A 1XVTA 5IVKA 5H3LA 1ECFA 3P0JA 2F2TA 2WQ7A 3H11B 4TMVA 3ZK9A 3ZWQA 4CQMA 2BFEB 2WYIA 1NOIA 1DV1A 1FFSA 2XMSA 3K9CA 1U3UA 4HTFB 2QT9A 2QG6A 5EUMA 1X7WA 2XITA 4OB8A 1WP9A 2FTKE 4OLJA 1X39A 2FW7A 1DC3A 1PF7E 1EFTA 1OI2A 2UZ3A 1K6IA 1H1TA 1U9ZA 3AH8A 1VL2A 4TWIA 3RM3A 2C7OA 3NC0C 4QXPA 3VMFA 2WWWA 2PWBA 3CMCO 3AU9A 1ELOA 1XMXA 2EFHB 4ML3A 4FQ5A 3AEKA 5F98A 5IABA 4GR5A 2VNJA 3H17A 2UZ4A 1JLMA 4MA5A 3ZCSA 1IN7A 1TO6A 2R84A 1TZ2A 5JEEA 1PFGA 5GJWC 2H8GA 3IILA 2W6ID 4RMNA 5DM4A 2Q7OE 3TDKA 2CF6A 2A4MA 1WSWA 1UAGA 2FXIA 4JJ8A 4X41A 4XUEA 4DMUB 1TU4A 1LX6A 1X9HA 4FR5A 4K9PA 5CDFE 3HGMA 3U6BA 1Q95A 3UW1A 2HMUA 2AN3A 1QGZA 1R6BX 2VT6A 1U7OA 1ZIDA 2DWPA 3ROMA 4QOIA 1Z7YA 2JKYA 5JNUA 1OXMA 2IPMA 3HGQA 3HBFA 3VR6A 1T6NA 1A5AB 2H06A 1M2JA 2YHIB 4K40A 2R4TA 2OXTA 3NHYA 1OGIA 2WVAA 3I9V1 1Q3KA 2NTYC 3IHWA 5C32A 3IDOA 2P4SA 2IFTA 3SQWA 2X1LA 4OLAA 3N0RA 2HLDA 1FW6A 1F2TA 1RWMA 2AJBA 1SCUA 3IH5A 1ZCFA 3S1LA 4O2BF 1P5ZB 3RRMA 5FF9A 4QTYA 4ZYVA 1X3LA 2BFFB 4NCJA 2IV3A 3HCWA 3ZGOA 5BNZA 1M73E 3S28A 4ZCSA 2BEUB 1IQUA 2FOIA 2OY0A 3UCXA 2JAWA 4WACA 4E5YA 3MJHA 1LQUA 3KOWA 2RGWA 3FJ1A 2JW5A 3NWJA 4I55B 3HJNA 3BX1A 2C7QA 5BUQA 4XWYA 2RHLA 2FMFA 1NYTA 2XTZA 2VWGA 3OCWA 4D0SA 4XJSA 3N1UA 1GCUA 1Z12A 2F43B 2NVBA 3QLTA 2F1JA 1AKYA 3LO8A 1H0HA 3CVVA 2QRLA 4IX9A 4XTRA 4GOND 4YDSA 5BSVA 4BASA 3LL4A 4Q3DA 2GXUA 3T5BA 1P0FA 1IEQA 1L5HB 3O8DA 4S1WA 2XPCA 1G6OA 1JZTA 2QTVB 2M1XA 4P80A 3LRTA 1W1IA 3FHCB 5CBPA 3JV7A 4MQBA 4G4IA 3BE8A 4F4FA 2H4ZA 2IZ5A 4MQEB 5FCDA 4RPKA 4L9SA 3AXSA 3C87A 2C9ZA 4OY3A 5MDHA 4MUKA 2HDHA 2HUPA 2WPDD 5CJPA 5AK5A 1A9OA 4KR6A 2QTWB 1A5TA 1EDBA 1U04A 4L0MA 3CR8A 2JGFA 2EDCA 5DRYA 5GIOE 3B1WA 1RPJA 4QU5A 3TLGA 2WICA 4X00A 1T10A 4DCGA 3AF0A 3AJ8A 4OFWA 4CLRA 1JKXA 3K32A 2DRIA 2VDJA 1AV7A 3D1JA 1PV1A 2PX2A 3TINA 1QP4A 3LVRE 3IAS6 5E3JA 4LF9B 1CD5A 1NLMA 3U3DA 3CONA 4CHTA 4KQ6A 2WQZA 1XO1A 3T9AA 2Y92A 4Y6OA 4IKEA 1M8KA 1R3UA 3QUAA 4EPTA 4FEAA 1LI5A 1I3LA 3IXMA 1LF0A 1JA0A 1B73A 1I4LD 4CBVA 4EGCB 2JFQA 1SU6A 2RHBA 2JFXA 3PVCA 1NDHA 3WRVA 1YA4A 3AONB 2VWQA 3TZQA 3EA0A 3INTA 4Y2TA 2VHVA 5J1TB 2EJTA 1G18A 2XMBA 3EGWA 2ZOSA 1JMKC 3OQ6A 2AZTA 5KU1A 1LX7A 1Y42X 2IOHA 3V8RA 1MOZA 1YHYA 1ADGA 4YY3B 1IPHA 4KE6A 4ZMBA 1ANKA 1YOVA 4JI8B 3PX7A 1K3TA 2Q3DA 1N0HA 1QYRA 1DT5A 3J81k 2DR3A 1OLUA 3BZWA 3MGKA 4UNNA 4DA7A 1YRAA 4NH4A 4XPIA 5FO0A 5TS2A 1GSAA 3LA8A 3MTGA 1T5SA 3W7AA 1CEYA 2UVPB 4B6OA 2A5YB 4I1UA 2Z9CA 3FDZB 4JVLA 3Q8MA 1A7KA 3LQQA 3DDCA 1KFCB 1G21B 3SZUA 2SCUB 4MGHA 3RJZA 1YL6A 2Q8NA 1SUSA 3V9AA 1WR8A 2GPYA 2E6KA 2IUYA 4RUKA 4TLMB 2X9NA 1U11A 1LBIA 2HZBA 3RT7A 1M34E 3ETNA 3V4VB 1VJCA 5FA6A 2CDNA 5LZ9A 1LD3A 4U1RA 4UE3S 1HNXB 3KL2A 1HZZA 2MHCA 2CL0X 3GFVA 4GM0A 4J6EA 1N2SA 3SC6A 4ARVA 1NUTA 3ENQA 3O8QB 5AK3A 3G8AA 4FOPA 5KQSA 1G66A 4KTTE 4O1HA 1PSWA 1R6XA 4HYEA 5KTTA 1FFHA 4TKVB 1NRJB 5IKMA 2HHLA 1YFKA 2XQGA 4JBXA 2P4UA 1UJNA 2OGTA 3ORQA 3PKZA 5JH7A 3WLHA 4H4CA 1ADCA 4CKYA 2CLFB 4HAOA 1YC2A 3ADBA 4CEJB 3LT4A 4R3UC 4IVNA 2NYVA 3I32A 1IUKA 6LDHA 1Z13A 3QNMA 3B7PA 3W6OA 4WCVA 2G1UA 4JLJA 2XLBA 1V4NA 5IF3A 4YCJA 4CI9A 2NGRA 4JJ7A 4I1VA 4OQNA 2ZREA 4M87A 1TJPB 2QN7A 3IBTA 3DCJA 5FIUA 4NZNA 4PGAA 5EERA 2Q29A 3R3SA 1U0GA 1E3IA 1UL1X 2PEZA 1NATA 1EJ0A 1H2RS 1P7VA 1Q17A 2VDWA 3Q3VA 4LDAA 3C7TA 4R6WA 4ZIRB 5HUJA 5KYTA 3DOOA 3IT1A 5GONA 2QL6A 4EUHA 2O1XA 3SJUA 4R1OA 4X91A 2DJ5A 3UJ8A 3VNAA 2O8BA 2I66A 4G5GA 5CP8A 1MRNA 2H2GA 3MWLA 4ZAGA 4EA6A 2R8ZA 3T0GA 4YPFA 2B8JA 3ROFA 1Z33A 4TQGA 3V8BA 2L0XA 4LCBA 1ITZA 2IP4A 2VWHA 3PQEA 2VBIA 5ISMA 2A8YA 1RWOA 5FLYA 1E3DA 1PZXA 4X8LA 2R8PA 1GCIA 5C7LO 1XTJA 4B6EA 2PMEA 1ZD4A 2WZQA 1REQB 2WYOA 3L1KA 4WK4B 3O0DA 3IOBA 1ADFA 1AKNA 3AV0B 1T3ZA 5FWDA 4J94A 3EA4A 4MVJG 2IZ7A 3O03A 4DLXA 2VQ3A 2N46A 5B64A 5CFZA 5PGMA 1XPOA 1NW6A 1QZXA 3L9WA 4FD2A 3KJQA 1ISGA 5ALIA 4YRSA 2NNLD 3OLWA 6CHYA 2HADA 2Y1DA 1J2EA 2Y2VA 5E4JA 4EO9A 1I32A 4PHTA 2ZJ0A 3LXMA 3PUKA 5DWDA 5CDYA 2VZ0A 3H7AA 3KVNA 2FXVA 1Z6YA 2J59A 3JQEA 3E2MA 4KITB 3PDWA 3K5HA 4WHMA 4YFYA 4L4YA 4WECA 2EWVA 5BRNA 1J1ZA 1K7YA 2IU6A 2ZPTX 3ACCA 4FWIB 1EG7A 1FQOA 1HH4A 1WHSA 3DMTA 4PC3A 3VKWA 2X7JA 2WSSA 1BX1A 2I7VA 2QRQA 1FB5A 1BCSA 1LKZA 1RWWA 2BEJA 3LZ6A 4OKIA 5TRTA 2PH7A 3TXYA 4NXNB 3N70A 5E1OA 1WOMA 3IL2A 2CD7A 5FP0A 1UMBB 3MB8A 2Q3FA 5E1DA 3M4ZA 5A5GA 5K20A 1GCAA 3WBJA 3VZCA 3A7EA 2X41A 3K5IA 1XD9A 1YJBA 4PHCA 4LXGA 5CLLA 5EE5B 3L4EA 3WQRA 5FOTA 3VUFA 6NULA 4B6JA 1OXSC 5LNK1 2ZE7A 1C4XA 2MU1A 4OQQA 3CUTA 3H5LA 1QAOA 1T2AA 3EYWA 2YICA 3I5AA 4JR2A 3KWLA 4JT4A 4L57A 3VA7A 4U0JA 1KJWA 3LKZA 3T7KA 1WY5A 1G19A 1NA5A 2JVJA 1HUQA 3OC6A 5JMTA 5DNWA 2LNDA 3R2JA 1HDRA 1TYZA 4JKIA 1TECE 3QBDA 3WFJA 2R8YA 2OD2A 3IJ5A 3A4TA 3OOWA 3TDMA 3UTDA 4GSLA 1VMIA 3BMOA 1ID1A 1O8CA 3DBLA 2V7BA 3BSFA 3G5LA 4HX2A 1FNMA 5JTTA 4RD4A 2XT6A 1EGQA 1EU1A 1FSZA 1PK9A 4B46A 3VR2A 4DTIA 4QIHA 3E7FA 4XUCA 4MHOA 3I23A 3KQOA 1I2ZA 5MN4A 2YS7A 1QBKC 2GBGA 3L79A 4V0NA 3U37A 4Z4QA 3DZIA 4ZVNA 1OY1A 3TPFA 3ZHSA 2YWEA 1VTKA 5JYDA 1E3WA 3RS4A 3VSDA 4TQUS 2BBWA 3QVKA 3BCHA 2CLLB 1HYBA 1WB6A 1QH8B 2GPWA 3BWCA 3RBAA 2HXGA 3EGEA 3IJRA 1A88A 3FY4A 1U3CA 5KUTA 3W8EA 5C5IA 1PBNA 3A1DA 3ILHA 4H7JA 4LK3A 3H9EO 5HKOA 3K0HA 3IA2A 3PUJA 4G1MB 3WDSA 4C3OB 5HFJA 2FX5A 2ZJAA 3LDAA 5JMPA 3C3XA 2YJTD 4QBFA 4F4DA 3E82A 1K06A 1Z8HA 4GQIA 4EQ6A 4NYIQ 1U5BB 3U4CA 3ZY4A 1BMFD 1QDUA 5AW4A 2W93A 5IN4A 1MO6A 4Y6SA 3MTBA 2PX5A 1CB7A 2XF2A 5HKBA 3C43A 1KC3A 1RHKA 5KQGA 4QYWA 2Z08A 3B1JA 3H4IA 4AB1A 3U7IA 3LOUA 4RHCA 4YRRA 3AQIA 3HWX1 1SHKA 4RGYA 4AI6A 4NV0A 7GPBA 2F48A 1ZIPA 3ED5A 2AV6A 2FEOA 4RKRA 2VBCA 4OM7A 4AG3A 3IEUA 2QNIA 1YONA 4V24A 2W9XA 1C3XA 3F6PA 3M2TA 3KB6A 1IZ9A 2A78A 2PT7A 2VATA 2ZS9A 4JENA 4KU4A 4HLQB 1WDLA 2FWAA 2WJGA 5CT5A 1TMGE 1M74A 4W63A 2IPAB 3PJRA 4HLUA 1ZLYA 3LQ2A 2JHFA 3A14A 1ZUD1 2B5VA 2PS1A 3BMCA 4OYRA 4OHMA 4K3VA 4AF6A 3TR5A 4ER7A 2DHRA 4LW8A 4GLBA 2IK8A 4PLVA 1USVA 3KTDA 4CNQA 2CF5A 2OHHA 4YHHB 3DLBA 3D4IA 3MBOA 5EPUA 1EBUA 1DAPA 5DGTA 3OMWA 3M89A 3Q12A 3NM6B 5DI3B 3SYKA 1Y6JA 1TM1E 2MSNA 4M53A 4EHLA 1TZMA 1R0SA 2FN3A 2IU4A 5E2BA 5AXBA 1U0SY 1E9BA 5LJIA 4TXJA 1UBMS 3ED1A 1EFVB 1H6DA 2ZSUA 3PNVA 5DBHX 2PU7A 1TK9A 4IVRA 2BOVA 3PUYA 1XCBA 5TDHA 5IYZA 4KXUA 1W581 2XTJA 2YH2A 5G53C 4TXLA 3Q98A 4G0YA 1QV6A 4W1PA 5BOSB 5LP6C 4HD8A 1MO3A 1TL7C 1VIVA 2VJQA 1LDMA 3I9NA 4M37A 4UEKA 2X1HA 1MC1A 3B6JA 3B5JA 3TB6A 4AX8A 1FDVA 1UWLA 4L5JA 4D7AA 2BT4A 1G42A 4TT3D 2HHJA 1MLDA 2BEVA 3D7LA 5K0CA 2ZM5A 5D00A 2ZTSA 1QQ5A 2RFLA 3JQDA 3T3GA 5KINB 2Q9BA 2HJWA 3EMDA 2JGIA 4GF5A 2WD7A 1P0PA 1LF5A 2H31A 2O5VA 5L6LB 3CLRD 2PMDA 1FS4A 2Q2OA 1NMQA 2VNIA 3D7KA 1EBFA 3JD0A 3NAGA 3E0QA 1V1RB 4OHPA 4R98A 5DISB 1PTKA 1K8QA 4D92A 1F6DA 1SULA 2Q1YA 2WUEA 1RRPA 3DKIA 3GQVA 3H6KA 3SQLA 5BRAA 5IARA 1HT0A 2DFKB 4GC9A 4NAVA 1S5PA 4PRKA 4KQEA 1KEZA 3AKEA 1AH2A 1JILA 4YJ3B 3CB4A 4QU0A 4BB6A 3EPRA 2VS1A 4URYR 3V4SA 5JZMA 3NC1C 2QT1A 1RQRA 7REQA 4PHGA 4EFMA 4RESA 1CY0A 1JFLA 1P6QA 4FGUA 4X92A 2A5FA 4YONB 3H5TA 4GOJA 3OA0A 5AKGA 5F52A 3GVXA 4TL7A 2PWPA 4K05A 1QGED 2FK8A 2PZLA 3H1TA 1IB6A 1KSFX 1YJXA 2X40A 2ZQYA 4U9IS 1GXSA 2GXSA 2B82A 1YDGA 1GVHA 3ZKAA 4PVCA 4HQOA 2ID9A 1VLQA 2VAWA 3O8QA 3U3XA 1ECBA 5HFNA 1GNSA 1DBRA 2IHZA 3K73O 1WW3A 4OGKA 4FEYA 3B60A 5FORA 1U28C 2Y6UA 3FZEA 1O97C 2WP8J 2EZTA 1ZJJA 3NKFA 3OFNA 4XD7D 4FYYA 3WLIA 2E4XA 4BAUA 4MWZA 3LV8A 2R7KA 3U19A 4L0QA 1EEHA 2VHJA 2OWDA 3DFKA 2Z6AA 3IAAA 1TRHA 5F1YA 4KODA 1J0EA 2RAFA 3D0RA 3PD0A 4PX9A 5HRCA 4X1KA 3F9IA 4RH0A 1G0NA 1FYVA 4LRQA 3WKDA 1CRLA 4GMDA 1QORA 2BHNA 5BOSA 4DUZB 2QLNA 1U3DA 3C3JA 3LBAA 1J99A 3EBLA 3Q7TA 2EBWA 4NMXB 5JSZB 4JT2A 3SJAA 1UUFA 1VJ5A 3FNIA 1LGYA 5K0GA 2IYYA 4RXUA 4WKOA 2I1QA 4ZEOA 4OQMA 5GY7A 3T35A 1KBQA 5IZCC 3STXA 3FWHA 3OCZA 1QR6A 3DMTC 4HXGA 4MARA 3NM4A 4WUVA 1DWOA 2PO7A 2DPGA 4QJ4A 5LA6A 2RK6A 2E7ZA 1U7ZA 4G0WA 4U5XA 2RGYA 2C57A 1XROA 4OXIA 1YB7A 4YLGA 2ACWA 3I58A 4MI9A 3T7AA 3W5DA 2W4IA 5ELLA 2J5QA 3UANA 2X0NA 3IUQA 2KLHA 2ODEA 1HDOA 4IMPA 5FBWB 4X66B 5JAMA 3AOEA 4OTZA 1MVLA 1T0PA 2WKWA 3V1MA 5K8VA 2B8EA 1KYQA 1GPMA 3IBSA 1XPJA 1E79A 2HMAA 1CV2A 4LDZA 2OCYC 4L75A 1DBSA 2X7XA 1C3LA 1SAYA 5FXMA 2OCAA 3G2QA 1PJ2A 1PQUA 2FG5A 5BP7A 4RBNA 3IDZA 2Y68A 3H9BA 4BX8A 3WRYA 4Y6GB 2NZ2A 3KTAA 5DN9A 2B78A 3PHIA 1WMFA 3NIFB 3HSYA 2TECE 3WAGA 2RC5A 5A4IS 2YQZA 3I3OA 1KYYA 1RLJA 3SXPA 4BS9A 3LIPA 1Y7LA 1A2QA 3SS7X 3SKXA 4CF3A 4GS5A 1YRYE 2MYNA 5C8XA 1MUUA 1VG1A 2J9ZB 3A6LA 3KHKA 1IY1A 4QQFA 1XP5A 3WSTA 3UGTA 4DC0A 4KAXA 4D4JA 1Z26A 4E21A 2CVHA 1JJFA 4OVKA 2VXYA 4U7JA 2D3WA 2G67A 5EWMA 4U8GA 1DDGA 3CNEA 4BKOA 2CBGA 3HEMA 2DKOA 1IVSA 1UXGA 4QFDA 1OC2A 3L7LA 2X4GA 4F0JA 5EP4A 5AUNB 1U63A 1N8TA 3ESBA 3FAZA 3QXXA 4ZODA 4Q1DA 5MFZA 2JLWA 1XUOA 4Y9UA 2AJ8A 2IJGX 3OX1A 4KX3A 4DUGD 1VE5A 4EYQA 1K92A 1GL9B 1R1DA 2EKDA 2VNKA 2P1ZA 5TIIA 4TLBA 4IWXA 1YFLA 1L5RA 3DNPA 1XQ9A 4TRMA 3K1YA 4YUZA 1K1EA 3NTXA 5AW8A 1WNTA 4V39A 5EIBD 3G23A 3WGKA 1RQ2A 2PUWA 4GYYA 1RAFA 4PV7A 4JLDA 3SG0A 3NS7A 5JS2A 3IE0A 5AVXA 3KE9A 4QWWA 1MW8X 3MQFA 4XH9B 1KP2A 2BGUA 2IZZA 1YRLA 3C5WP 3D7RA 3IOCA 3Q6IA 1VP3A 3OKPA 3QPCA 2FW1A 3OCUA 2DQ4A 3NOQA 1AGXA 2XRYA 1KDTA 5LYYA 2ZRPA 3AYZB 1SN7A 4S1OA 1SO8A 1FMLA 2HNBA 3D3WA 1ODIA 4X62B 1SA0B 3GAMA 5JI3E 2J48A 2QTMA 4PO3X 1ABFA 2JDIA 3HDHA 2P2CA 3H6GA 4UATA 2I4LA 4JJAA 3WKAA 3FYUB 3OTGA 3ZS9A 2Q27A 2GPJA 5KNDA 3A1CA 2JZCA 5AOBA 1ZH8A 1TAGA 4DY4A 3DT8A 4Z7QB 5G0TA 5LA6F 2R6HA 2XY4A 3W4JA 5KO2A 4UU1A 1Q14A 3UMMA 4GVXA 1MKYA 4XUGB 2O59A 4D79A 4N5HX 5I7UA 1DUSA 4R2IA 4F2HA 3JQQA 5ANRB 3BK2A 1MO5A 2E4WA 4TTQA 1Z0AA 2QM3A 4EG8A 1SUIA 1I6WA 1V45E 1XTRA 2WAMA 3OTHA 2PMFA 1T2DA 3WNZA 4UE6A 3H8SA 2REQA 3U17A 2PS0A 3MTJA 1KYIA 5IHXA 4F9FA 4FJ0A 3UJBA 4OL0A 3MWEB 1E6WA 1JR3D 3TL2A 3ZV4A 4LRYA 3MXOA 1ZU4A 3KR2A 4YV0A 3S29A 2ZSDA 2H0RA 2JD1A 4DMRA 1NUUA 3RQSA 3JASB 4MR9A 5C4IA 5KWEA 3CNQS 4J7UA 2M6LA 2X22A 4LYHA 3DOUA 2IPOA 1A7UA 1J8QA 3KU1A 3ZI0A 4ARBA 1WV1A 3N3BC 5B58T 2NOAA 5C1IA 1XKQA 3QA3E 4JBWA 4B40A 2AR7A 1UMCB 3C3MA 1RWKA 3D2AA 3BIXA 4RMGA 3VHLB 3HPRA 3T7CA 1PEAA 1ZJ5A 2N1BA 3WWEA 5JS8A 2PJUA 1WX1A 3QW4B 2JRLA 1PNOA 4OMFG 1NW9B 5DMHA 2ATVA 1DCTA 4I4CA 4KI0A 4RPGA 2OCLA 1CZKA 1UMDA 4ILKA 1K8RA 2IVZA 3IAM6 4WCFC 3KEOA 4CV1A 4E6PA 1MPXA 1ZD5A 4RYDA 4BVKA 1Y8CA 5FRDA 3WK8A 6REQB 4E5PA 1FA9A 1IAQA 1UPCA 4GW3A 4Y0VA 5C8YA 5AO9A 3ROXA 2HK7A 2COEA 2X58A 2IYXA 1MFZA 1DKRA 3FDZA 3FYCA 3GUYA 3K92A 1R8XA 1IBMB 2NO9A 1BE1A 3KXPA 4GZMA 4YALA 2IUFA 4NZMA 4MI6A 4PINA 1CETA 1MC8A 4LK2A 4RHUA 2M6SA 5EXTA 2NAFA 4ASUD 2WIBA 1NX9A 3C1AA 2VPPA 3IEKA 2D1YA 2WPNA 4ACAA 1GRCA 4EB8A 3G9QA 2M98A 3CEHA 3EULA 5A06A 1KI4A 2XUIA 1PR9A 3EMVA 4K26A 3SLRA 4DIMA 5BV7A 5BSWA 4BY9E 2BFCA 1FUEA 1D8AA 4P4SB 1X7YA 2PFKA 2DPXA 4G5RA 1LBQA 2XGOA 3IMGA 4E4RA 4JOSA 3DOIA 5IM4F 2HGSA 3SS9X 1ODKA 2C4TA 5ENVA 3AUKA 3GJ0A 4DG9A 1K0FA 1AM4D 2KW5A 3QMWA 2P1RA 1E3MA 3ICEA 3P97A 4CE6A 2QI9C 3KJZA 4OBWA 1JKMA 1XZAA 4X45A 5EMMA 1JHAA 5IEJA 2PZAA 3DEAA 4Q4AA 2OV8A 4FONA 1N57A 5FTMA 5JS1A 2PH1A 1Z38A 2PVPA 4JR1A 4D99A 2ZRJA 2B4AA 5CJ2A 4U02A 1AQNA 4YREA 4ED9A 3DYIA 1OV4A 4XQ0A 2Q99A 1DG9A 2BFWA 5JNLA 3Q3GE 2BI8A 3IUJA 4TKMA 4S2EA 2FZWA 3WNCA 2E9SA 2X2OA 1P8JA 2EP5A 5ED4A 2COUA 1D2GA 3HJFA 1L6RA 4X0EA 3K0AB 4UULA 1EM8A 4PX3A 3CUUA 4AZ0A 3WHIA 1H2XA 2LCQA 2QYOA 5FWYA 2P2NA 1W29A 4IJ6A 1RYBA 4BLPA 2VPWA 4R7TA 2ASVA 3W8DA 1WCIB 1RQNA 3HCNA 3IPXA 3TUJC 1UC4B 1E18A 2YWGA 3INYA 1HEYA 1JQ3A 4OXYA 5I4CA 3AR5A 1YKGA 4F1JA 1KOGA 4BLQA 2DTEA 4QQ8A 1IATA 1L5FA 4KWCA 2H2DA 1GGFA 2ZBDA 2AQKA 3RSFA 1ZM2A 3JQCA 4K87A 3THSA 1KI6A 2WILA 4ENQA 4OHUA 3ZTTA 2HWYA 2VF5X 4FP9A 1NR1A 4RM2A 3L7KA 4OHZA 3BFXA 2ZSKA 2JFVA 4X61A 4RKFA 2Q7DA 1CY6A 1ORTA 4CG2A 2EKPA 4Y1GA 1G0OA 4GX1A 2AG1A 4H6VA 2GCOA 1U0HC 2WF6A 3OHSX 4HATA 3PGKA 4DY6A 4H1WA 3JYOA 2ZCVA 4YRZA 1LBSA 3JVDA 3R6LA 4BEBA 1NXXA 2MYPA 2ANCA 2ZB7A 5T8KA 5E7QA 1ONOA 1UZNA 3H2GA 3PDUA 1KIFA 5K6AC 3ORFA 2BSXA 1ULSA 1MO4A 5LQCA 1M8GA 4G65A 1TYBE 1LWOA 3B1XA 3LKBA 1JEJA 2UZ1A 3HUEA 3PGVA 4P4TA 3TLMA 3RSQA 4DPLA 3BH0A 2NSHA 1SURA 3EOAI 2GAOA 4TKZA 2P9EA 1SRQA 2XA1A 1N0WA 1CF2O 5JSHA 3BJIC 5ALZA 3GLTA 4AO7A 1XAJA 3HJBA 3EZ9A 3K8QA 3UAYA 1YIDA 2VJYA 1V96A 1SPXA 4RJLA 4BP1A 1ZM3A 1YR1A 2KS6A 1O96A 2W2TA 2C1XA 1P73A 3ZW7A 4OYLA 3FGPA 1CJSA 3TNFA 3MTIA 2F8TA 2AOTB 1GT91 2QU8A 1HBJA 3K0FB 2ZRDA 2EKZA 4EOGA 5MN6A 3V8PA 2ABWA 1WF6A 2H3HA 4L76A 2P27A 1T9KA 3FHJA 3GA0A 4O0MA 3ZE0B 1H3EA 2LV8A 1SC3A 2NU9A 2O3RA 4OQPA 1MDFA 4M89A 1DJLA 2BTQB 2PAFA 2VQSA 3FUVA 3P4UA 3QVGB 3HBMA 3KDSE 3ZIAD 4NCXA 3FPEA 4DE5A 1QNFA 2GKGA 3DMNA 3FKSA 1IIRA 1X0VA 3WADA 1NHGA 4L5CA 2AXPA 3L6CA 4CF7A 5ALHA 2ZJFA 4CKWB 5TMEA 2BI7A 1MXHA 5HFAA 2XZDA 4KHPB 2VAXA 4ROTA 4HLNA 2YWRA 1VPWA 3TZLA 1U2DA 5LU9A 1P44A 2G0TA 1Q15A 4AXXA 1E7RA 2VBGA 4BUCA 2D7JA 3IUMA 2NMVA 1OH6A 3T1TA 1J09A 3FFAA 4P0TA 1GZ4A 2F1HA 4M7PA 3LXUX 4XASA 1ILWA 1Q0ZA 1ST2A 2PMKA 4KL8S 3SK0A 2CXOA 3KJXA 3MS2A 4UNPA 4HEJA 4KFTA 4WKBA 3WGIA 3V80A 3AHJA 3QKTA 4DDHA 3C24A 3E2PA 1IXZA 2WC1A 1M6HA 1AMUA 4RTJA 2O0KA 4E7OA 5L53A 3ECCA 2J0SA 2UXCB 5K8JB 5TF0A 2ZR9A 3A6KA 2ATXA 4BN0A 2HK8A 2X0KA 4QVIA 2O8DB 3QVWA 3DAGA 3TIFA 3ZNNA 1FQWA 1OI3A 2BSAA 3UGKA 3ZW8A 5AUOB 1CYEA 4MV4A 2WG0A 4IIXA 3HA5A 1H2FA 1P2SA 5HJEA 1X9IA 1NJFA 4AN0A 2C7VA 3WDLA 3WGYA 4YR7A 1VSUA 1WULS 1YTLA 2MR5A 3S40A 4EJSA 2IOFA 4GYKA 3QZUA 4LVCA 4AY5A 1NG1A 1JKJB 4M7OA 4XUDA 1DUIA 2R48A 3DHWC 3WK9A 1T13A 3BEOA 1YZKA 5CA0A 3N7AA 1NF8A 1ZUWA 2VC2B 1L5OA 4L27A 5JVDB 1OPRA 3SIPA 3OTOB 1LXCA 1F20A 3EXHA 1KPHA 1O96B 1I9GA 3F5MA 4FHZA 1O9GA 4PFQA 4YAJA 1QK4A 3E6AA 2V7QD 4KN8A 1DWQA 4NU6A 4QXOA 1O8BA 5F21A 1ENOA 3EISA 5A6SA 4AJEA 4NL4H 3A25A 3T3NA 1WDKA 4LHZA 1R5OA 2RG1A 1D0SA 1XQXA 3VBEA 4DMKA 1QO9A 3SR0A 4Y6RA 5IEBA 2WU8A 4BC0A 4TWBA 3OC0A 5L7YA 3BWXA 4KQ1A 2DVMA 4YYEA 3E9DA 4F5DA 3VC2A 2NQ8A 3K9FC 3QQPA 5DM60 3WMGA 4KXFB 4E5KA 3OF5A 1SBZA 5ALJA 1UIMA 4ZO7A 2QZSA 3DE2X 1VHDA 4RK1A 4L08A 1L7XA 1U8FO 1E1RD 1VPLA 4KMOA 3U4HA 3WB2A 4EGFA 5JBQA 1C3JA 2GYUA 3EARA 2ZK7A 1DOAA 5DYNA 1K89A 1ZC3A 2FUG6 3QKWA 1K5DA 2R79A 1ONSA 3UXEA 2NU8B 2C4KA 3CX4A 4DLPA 2DOKA 3NHRA 5HDBB 3KKEA 1P3DA 3ORHA 1NKVA 5FKJA 4JI5B 3BJRA 3SHTA 3VISA 1PEDA 5EG5A 3E9RA 1N33B 3C3WA 1XP8A 1XZDA 1QJCA 3PEUA 4NICA 1M6VA 4BQRA 1NU8A 1SVOA 1SY7A 1GPDG 3BBPA 5JIBA 1KEKA 1E6LA 4P1ZA 5DXFA 1ZK1A 1OPXA 2QI9F 1WP4A 2DSNA 3IRVA 4PO8A 4JDUA 2O07A 5J43A 1CJBA 2G9RA 1XRNA 2CCJA 1HFEL 1WCWA 1XALA 2PD4A 4JJGA 4G23A 1GQQA 3UQYS 4F71A 5IDYA 5ECDA 4X97A 3M3HA 2I7DA 1NFRA 3TQOA 3NT5A 3JAKB 3KSRA 4K8OA 5GVRA 5FJJA 1TTTA 4HWGA 4P81A 1A9SA 5GPBA 5U4QA 5CX1B 4A3SA 4BNWA 1E7YA 3P0FA 4GOLD 2IHUA 2V4ZA 3FLEA 5CIYA 3I62A 1IJKA 2JL1A 4XX0B 3TM4A 3C3KA 3VGJA 1NMYA 4N47A 4JU9A 2QORA 1RIIA 3ZBUA 4J2OA 1OTYA 1UBTS 1YBHA 1FIUA 4U2GA 2JLAA 1W8DA 4P6VF 3H97A 3P7MA 5HW0A 2DP4E 3JWHA 3L43A 4G5FA 4IDPA 1KYZA 4EVIA 2EX0A 1R6DA 3F8WA 4I99A 5HKKD 2F3UA 1PJ4A 2CHUA 5EN4A 3WZ2A 1DSSG 3H8JA 5JMWA 3N8NA 1HOTA 1X6VA 4Z4EA 1ZEMA 3ZK7A 4NAUA 4D4GA 4DABA 4JI1B 3UAXA 2FPWA 3QH4A 1KVQA 4LWOA 5T3YA 3U5TA 4WBSA 4TQ9A 1F2VA 2O2YA 3TGLA 4TMWA 5AKYA 3WLOA 3NASA 3TF5A 3ADKA 2PK3A 2ZUEA 2X8JA 3LQ1A 4FN5A 5D6OA 5KHLB 3TI7A 1QYIA 2FSSA 3A6FA 3LS2A 1EUDA 2QMHA 3KQWA 2IS6A 4MUFA 3A10A 4F3TA 1CDEA 1U4SA 3HP4A 4FFLA 1DO2A 4QEZA 3UHAA 5IHPA 1W36C 1ZNQO 4NENA 2PCJA 3G0OA 4BAGA 1G63A 3OFSA 4M9ZA 1Z4MA 1CDDA 1R0RE 2R0QC 1ESDA 3I9OA 1SU4A 2OCDA 1T8WA 5DYGA 3EEIA 4QJBA 4RU1A 2XH8A 4E22A 1FX1A 2HUNA 5AQ1A 3AOGA 1N5LA 3KHUA 4OMUA 4R84A 4IX1A 5JJKA 4X7BA 5CNIA 4O4HF 5BNFA 2ZZMA 1W94A 2JBWA 4MV9A 1R4NA 3B12A 2EYUA 1JHYA 3GGJA 4CKXA 5KYGA 5FI1B 3VOBA 3F73A 1IPEA 1T5IA 4BZWA 1IAVA 5CHEA 3BCRA 2AN9A 3MMXA 3OY2A 5D7BA 2W83A 4RSHA 4KFUA 1ZSYA 4B3IA 3REQA 1O9BA 5H1YA 2QXUA 2R87A 1GTG1 1YSCA 3GDWA 2WTMA 3GZTB 4TYMA 3VR1A 1ZAKA 4ZK2A 4G9EA 5B4VA 3GLIE 2C1EA 3X43A 1HTWA 3ZY2A 4EK9A 5BNTA 3CX8A 5F2EA 3E81A 3TGPA 4EGSA 1KYWA 4LJ4A 4EJSC 1Y3CE 2XVZA 3DZBA 3GT7A 5DULA 4LRUA 3LK6A 3OCYA 3VU1A 3HVKA 5KSPA 5KQMA 4Q15A 1B76A 2D1RA 2YWHA 1JFFB 3DHNA 3QV1A 4Q3EA 4FFBB 4HWOA 4ES6A 1O89A 1JKIA 4QGSA 3GLFB 1TF7A 1ZCAA 2W2KA 2WSSD 4ZQCB 2J9XB 2ZT6A 4I5FA 1RLOA 3W1WA 4AJKA 1KQGA 3LH5A 2V1XA 3KT6A 3NHJA 1RYEA 4FWTA 1EYZA 2KHZA 4IV0A 1G2PA 3GMDA 4NBKA 3LECA 4BQPA 3P9PA 2B92A 1UANA 2PX3A 3A4IA 3JQAD 1G5IA 3VR3D 4J9UE 1Z25A 2VDLB 1U3TA 2GCGA 3ODGA 3L4JA 2OO3A 3MRTA 1U4OA 1H5UA 5DW0A 4FNAA 3L7YA 1VLLA 2KE5A 4LISA 4AN4A 1XMJA 2R66A 4M9RA 1JEYB 1WXQA 1RAEA 3JD1A 1NC1A 3OEHA 4ER0A 2M6RA 4N5IX 1F7VA 1AKMA 1PW7A 3AVTA 3CJRA 4FDUA 4ZT4A 4NULA 2PWAA 4O4IA 1N77A 4I81A 4IIBA 5HF5A 2JB9A 3TLGB 3WHKA 1AKQA 5FWXA 3ROTA 1ISPA 3JPWA 3FIJA 1F1BA 2NSYA 4D56A 4NV1A 1NW8A 3R8FA 3NYRA 2L82A 1C3EA 2JARA 2YXDA 3LC7O 3VH1A 4CCYB 4K9QA 3A0UA 2E82A 1DELA 3SZLA 1L4FA 3OEHD 4E46A 1R0WA 3P0RA 5D2CA 4IFIA 1OHHA 1Q74A 4Z2AA 3TJRA 4JYZA 2HWXA 4PICA 1DDOA 1XJ0A 4DV5B 1KE2A 2IHVA 1IY0A 1MB2A 2GMWA 1ULBA 4GKJB 1OAKA 4Z53A 1XNGA 5I4BA 3PX2A 1HR0B 1ZIXA 2EU8A 2XODA 4HH0A 3WO1A 1WTCA 2CGEA 3DWIA 4J76A 3KJFA 1NQWA 2CLDX 2Z58A 3OJLA 5ALYA 5KEIA 2LP4Y 4DBZA 3OPXA 1YBAA 5I7AA 3T1YB 4E31A 5SZHB 1SKBA 1AXRA 4YJGA 3R5SA 2EF0A 3N8GA 3F67A 4JQSA 1EQUA 1NWCA 4MQMA 4LSGA 4BBAA 4JEHA 1ZS9A 1K2VN 4M38A 2HL6A 3AKCA 1T3HA 1PL0A 1L9KA 2H4WA 2XYHA 1HWYA 2ZYGA 4I9FA 5ICCA 2DT5A 1W47A 4RV9A 3B2QA 4DLZA 3QBEA 4DSOA 1XMIA 4LXHA 1DINA 1JB1A 3HDQA 3U7QA 3WR5A 3PFCA 1ICEA 5HKAA 2WHQA 2GJKA 3P9QA 1Z5NA 5KYUA 5HRAA 3PQ2A 1GNTA 4P86A 1M6YA 1ND6A 5ENZA 4G4SO 4IG9A 1F0YA 3MSCA 3WGGA 3BF8A 1S1MA 1OOEA 1RLMA 3HHEA 4JWKA 4JH0A 1Y3AA 2P6PA 2J32A 1F0PA 2I2DA 3FI9A 2QY6A 4I9HA 4PLWA 1ZA1A 3TLYA 1CE8B 1YU6A 3AJRA 2WDZA 2AWNA 4YUWA 5F3WB 4E14A 4L3VA 1JT2A 1OF1A 2VLBA 3ZUPA 3A6ZA 3F78A 3LUKA 2CWWA 4ZU6X 4Y6QA 5LJLA 1EK1A 1E61A 2OGUA 1CR1A 1USGA 2WIKA 2WUFA 3C45A 3EIEA 4UUPA 5E6UA 2NO5A 2Y1OA 1P2BA 3JW8A 3QEOA 3TIVA 3MA0A 5AXCA 4LHEA 2O8FA 5CM9C 5TE9A 3IB6A 2GAIA 3R9WA 4DIDA 4TS4A 2UYYA 2E4AA 3D4BA 1MABA 1V6SA 4KN5A 2X3YA 3K6JA 3OY7A 1MIHA 3MGGA 2Q28A 3AYXB 4EX6A 4Y0NA 4C78A 3NGMA 4CLHA 4OV6B 2AR0A 3ZWKA 1JF8A 1YQTA 2O8BB 4IZOA 4MNTA 4LF7B 4GBJA 4B3MB 5A5DA 5A7FA 1O03A 2XQIA 4HSEA 1JLHA 2BHSA 3USES 3RC7A 3EOBI 1U7PA 4Q47A 3OOYA 3SP1A 1G3QA 2GTHA 3SLGA 3HVRA 1CFZA 3H04A 3JZIA 1K88A 3RUEA 3D5QA 1YJQA 2WT4A 3BCSA 3U62A 2DUUA 1D04A 4PXYA 1UPBA 3PWSA 3DM9B 3H1EA 4HQ0A 1MVOA 2BJHA 3CCFA 3PF8A 2OESA 3UCFA 2F9MA 1ILEA 1MX1A 4NEHB 3HI6A 5KYXB 1U1GA 1T5TA 4BU1A 1E0DA 4E70A 4DS3A 4F96A 2YYYA 3NANA 4MKIA 3THYB 2W6JA 4Z1OA 1XI2A 2ECKA 4L4UA 4QDOA 4A0GA 3EZGA 1W0CA 1Y33E 1DC6A 3DJFA 3FYHA 5PNTA 3MT8A 3G79A 3LBYA 2FUEA 1QZ3A 4Y1EA 2AUMA 4KUHA 3VPDA 3MWFA 4ZI7A 2GARA 2CNBA 1XYYA 4QODA 4UD6A 3IUSA 2HU2A 4II7A 3BTVA 3JR3A 3TDNA 3R9IA 2P79A 3SIRA 3C2QA 1TMKA 5J63A 4D43A 1V1MB 1N6LA 2GEVA 2NVUA 3IURA 4P58A 2O8EA 3RYHA 1IONA 2ONYA 4ND3A 3GMTA 3X3HA 3ZE6A 4Q16A 5GONB 3UMGA 5FNVF 4RS4A 2HA2A 3HN2A 3D0KA 4RSMA 1SU7A 2BFOA 5HX7A 2EQ5A 4UFPA 4NDAA 1XA0A 2PZ8A 4L9RA 2Q3MA 3LQRA 5LQRA 1MT0A 3IXLA 4DWJA 3JU3A 1HG0A 2Z5FA 1JTFA 3GLQA 4UUNA 3DLCA 2FMUA 1KZ7B 2PS9A 3TW8A 2Z5LA 5DSZA 4GZLA 1MHPA 1DCMA 2B61A 4ND7A 1U8EA 4LY6A 1CVLA 5A3VA 1EWTA 3DT9A 5FUWA 2VP6A 3EQ7A 1JAIA 3P45A 1LK0A 4XGIA 4KP7A 3TZKA 1BXKA 4KGVA 2D1TA 3WK7A 3OJCA 5GZ1A 3FN4A 4NK5A 4S0XA 4JVNA 4O8CA 1F3OA 5C4GB 2XNKA 5DTQA 1B3BA 1WZNA 2RBKA 1K7XB 5JRZA 3OBIA 5ESWA 4BEVA 3CEPB 1Y37A 2WFAA 3OE7D 1XWIA 1IZ7A 2QZPA 3KFVA 4MZDA 4FMPA 4DNOA 2X5JO 3L41A 2ZRCA 2VHTA 3MLEA 3PPVA 2XUDA 4FTWA 1P19A 2G40A 4NENB 4TS3A 5FUQA 3AL0C 1L7PA 5C31A 5C53B 3WGUA 4ENUA 1YB4A 2A94A 4M83A 4HAYA 2IX3A 3A7DA 5DOZA 1Z8FA 2OQRA 4XQCA 3W2IA 5M04A 2YZGA 1E32A 3WQSB 1K4KA 3MMSA 1HI9A 1TRKA 1DBIA 1QH8A 1VSQA 2HQRA 2R8RA 3CO5A 3IUBA 3K2IA 1GRVA 3FGZA 2B8TA 4TLEA 3K05A 4B3FX 3QXJA 1KNXA 4K6HA 3W1EA 1EUYA 4RVDA 2DFPA 4KDCA 4UBNA 1H5NA 3AJAA 3C98A 2ICAA 1DMSA 3PXUA 4UJ5A 2GEJA 4P5PA 3LOPA 5CYPA 3DNFA 3HLKA 3EHDA 1NPYA 5CGQB 3WDKA 3MGCA 1SHJA 3EEBA 1CZRA 4LPSA 2WI8A 1ZMBA 2BIFA 4N0MA 3PJDA 4WOKA 1VI6A 2P9JA 2AQ8A 1JXMA 2VK1A 1U0EA 1Y7TA 2P2LA 1P4HA 3DXYA 1BIFA 3FPSA 3RTBA 1V5FA 3UCEA 1T4GA 4B5LA 4MPJA 2FU5C 1VG9B 5DCYA 4DSNA 4UOZA 2OHGA 2CNWA 3SGLA 5FA8A 3N7UA 1Q0SA 1BWQA 2OV4A 1GCGA 4I50B 1S9HA 4XGRA 5DBGA 1BXGB 3TL6A 2PLRA 4UUMA 1E62A 1KO4A 2CXUA 3P9RA 1CERA 4AO8A 2RIRA 1C30B 3E05A 4FYKA 3FTNA 3SJBA 3AERB 3O8NA 2O3TA 1RJ9A 1RU3A 5B2FA 2P8SA 4ZVPA 5T4BA 3D64A 3Q3IA 1P9RA 1Q2UA 2Y1XA 4EUFA 1S6YA 1QIKA 1YQGA 4H2DA 1Q12A 1RNLA 4P7FA 4RKYA 2JFZA 2WRZA 2F3SA 2CVQA 4QC2A 1G6Q1 4OQYA 4BVAA 5KC8A 3LPMA 2X1MA 3E3AA 2AKYA 2XGMA 3E1SA 4NYJQ 4U0KA 3EY9A 1SK9A 1GPH1 3RC8A 3BRWA 4NJEA 2AMYA 4BP9A 4A4DA 4TKUB 5BWLA 1NX6A 2FA9A 1AGRA 2V5UA 3ZD9A 3EVAA 2RARA 4K2HA 4W7IA 1VJGA 3CGGA 1JU4A 4ITRC 1R8QA 4UMVA 4KYIB 3EVDA 4N0PA 1LS6A 2TYSB 2GDZA 4H31A 3LPAA 2QYHA 4QGFA 2OZLB 2ET6A 4ZCQA 4C2AA 3D6TB 4NH0A 1BMDA 1VECA 2NVWA 4KEAA 3AP2A 4DT1B 2OCKA 2Z04A 1ZMRA 3JQRA 2JVKA 1H6BA 1XRRA 2RH9B 3LCUA 2H52A 2J3JA 3AF4A 4G1EB 1K68A 3VKHA 3QHAA 1EBBA 1PT8A 3PNLA 2FPPA 2EBFX 2JATA 1VBMA 2OENG 4R5HA 2DFDA 3U3MA 3F4KA 1J97A 3CHYA 4OAPA 1Z29A 4Q5IA 4EB6A 2D59A 2NPOA 3MVEA 1ATZA 4HNTA 2YRFA 5DTJA 5KBYA 2LGJA 1YZYA 2WKQA 3UXHA 4IJMA 4RADA 1P2UA 3TX6A 3SC2A 2YYZA 1J4AA 1OTHA 2X7HA 5AKEA 1Y4SA 1BE6A 2PKWA 2AEFA 4AJHA 5JD4A 2C5BA 4LOIA 2R44A 1N36B 1M2VB 2GEUA 4BNDB 5JSUA 3ICPA 1G8FA 4YRBA 1SXJD 3EGVA 4URHA 1KAEA 4FNOA 3H11A 1I7SB 2JGRA 2I0FA 1GXSB 4NBWA 1VKJA 1IZ0A 2I4RA 3GDGA 3CRRA 1ZQ9A 1QOPB 3TSWA 1XDDA 3M7IA 5BT8A 4BX9A 1CXZA 3T99A 1ECJA 1U9IC 2C3MA 3AT1A 3GCDA 4X1IA 3U31A 1YNSA 3BTUA 2R2GA 5DI3A 2WWRA 3TQCA 2C4WA 4A91A 1J6UA 1JJIA 3MNFA 3WQHA 2RH8A 3W90A 3CVWA 3D02A 1Q44A 5HZMA 4R2HA 2XE8A 3C48A 3I1FA 2OE2A 4Y30A 4A8JC 2G9VA 3DR3A 4MQEA 1E2PA 4AROA 2G06A 1V11A 1RIFA 4X1KB 2I2WA 2VF2A 3D3JA 3RTEA 2IPLA 2DHQA 3IKJA 3IJEB 1E64A 3QELB 5AM4A 5BXQC 5IU6A 4KRFA 4RF4A 4U2DA 4W1QA 2OA0A 1IM8A 3VSAA 1Y0BA 4F8YA 5CB4F 2CLEB 3PE6A 1G2OA 2K6GA 1ZK0A 2W5UA 3C16C 3NATA 2F59A 4Q7QA 3NI2A 5K3BA 4QKQA 1W85B 5ALXA 3ABQB 5KVVA 5DSTA 2ZUWA 3H3FA 3IQGX 4HF7A 5SYMA 3SU8A 4TGLA 3TCKA 1GUDA 1KGSA 3V32A 1L4KA 1RQGA 4BZQA 1I24A 4X7PA 1DZIA 3MXTA 3TTVA 1QOQB 1I2AA 5F7OA 2Q0XA 3KM0A 1PV4A 4XEUA 3IEMA 4K9NA 3ZDEA 1QE5A 2ZI7A 4KVGA 3LO5A 4RTRA 1EWVA 3NRCA 2FFQA 4GU5A 3QE2A 5ECGC 2XECA 4E2YA 5DIFA 1HFWA 3PPXA 4ID9A 1P3JA 3OLZA 3QTTA 1PFVA 1KSGA 3RCBA 1I4TD 3IOMA 1K9VF 2GPSA 3TR0A 1HDGO 1JG7A 1NXWA 1CHDA 1O4WA 2LDBA 3G2KA 4FFSA 4LG1A 3S55A 4A2PA 1XLTA 3JATA 5BW5A 1CU1A 2HAEA 4ASUA 5B1IA 1FP4A 1J20A 1MNQA 1WUHS 1M2VA 1YOVB 3NTVA 4S35A 4BNDA 4XVCA 3G13A 2B4RO 5ARCA 2P30A 1GITA 4XWTA 3T3DA 1ENYA 1I0LA 3JS5A 4GYJA 1F4VA 2IY9A 1BW9A 3BGWA 1W1UA 4GL4A 1KEWA 2JGDA 4BMXA 4A0RA 2H9AA 4E09A 2C04A 2ZTUA 2VTBB 4L0CA 1GIAA 1YUMA 2A5LA 5LXTA 1VL0A 2KLBA 2OC4A 5IDVA 4B3SB 3AFIA 3H5WA 4FLMA 4US1R 5AM1A 1AG9A 1G4AE 4Y8VA 5EXSA 4NCBA 2NO7A 1B14A 3OQOA 2VDKB 2RSLA 3G2IA 2G8NA 4HB4A 4MRRA 1A97A 1DO8A 1S2IA 4HDQB 4EKEA 1NSFA 2O57A 3ILYA 5A3SA 3D8SA 5DLEA 2HIAA 2PUHA 1T8UA 3V97A 1DGQA 3IFSA 4BB0A 1DBWA 1EP9A 4HEA1 3QU5A 3TSZA 5BMVA 3MGAA 4ICIA 3SZGA 1XN1A 3KOUA 4J6FA 1KJQA 2FGKA 2FP3A 4GUDA 3KOYA 4O59O 3A1SA 4O2BB 5J40A 4BTEA 3VC3A 1PR2A 3MRXA 4NONA 5AIAA 3TH5A 1U9CA 1Y1PA 3HA7A 3O8CA 1UFVA 3I2IA 2H00A 4I4TF 1TLLA 1Z75A 5J2UF 1M6NA 3UXYA 1LVUA 2YRWA 3AP1A 2BZSA 4RY0A 3U4GA 3VTFA 4ZEMA 4ZRNA 4QOHA 2W4QA 3BSSA 5KNCH 1WUKS 1E3SA 3ES9A 2O54A 2J07A 2C3YA 3O8OA 1VDMA 4GEKA 5E95A 1EP1B 3K09C 2OPHA 3D6AA 4UW9A 2I99A 1GNQA 1E2GA 4RPLA 5EZYB 3VHXB 2GBPA 1UWCA 2CLIB 3NW9A 4KSCA 1NVBA 3MW8A 4LRXA 5CT6A 3DE4X 2YY5A 2H1SA 4KXXA 2RB4A 1GFIA 5A05A 5KX5A 4MHTA 4DLSA 1JP7A 4HYYA 1JMYA 4BCCA 1C9DB 4W9MC 2J0UA 2Q21A 3WLQA 1RM0A 3ZXUB 3HYLA 4YP7A 1VE1A 5ES3A 3CU5A 1M2FA 1DCFA 1DL5A 1LSUA 4DIFA 3PXXA 1T5OA 2YXEA 1VLMA 5KYWB 1AS3A 4L73A 2F6RA 2JANA 2YASA 4YT8A 5M7EA 3ZCUA 3TLJA 5FTLA 1E2DA 1XIVA 1I8TA 3AVQA 2EZ4A 2BCJQ 2UYCA 2QAGC 1A9RA 2VA8A 1EE2A 2ZBGA 1Q7BA 4JI0B 2CNWD 1MPTA 5IFKA 1BWSA 3ASYA 3WGQA 3ZBQA 3VR5A 2H2IA 2WNSA 3PNBA 4KWEA 5T5QA 4QTXA