4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
4CG3A 3R3UA 5AKEA 5DNVA 5CMLA 5YASA 2HU5A 4BAUA 3LCRA 5ESRA 2CEKA 3BWXA 4LIPD 2Y2UA 2OCGA 3OOSA 4G8CA 3WK5A 1JJFA 2WIDA 1XROA 2HRRA 4ZXFA 4Y2JA 3WWCA 4FBLA 5AKJA 1QFMA 3AILA 4ZREA 3T52A 4UBNA 3FYUC 3D2AA 3C5WP 4YPVA 5HKAA 1ORWA 5BOVA 3C6XA 3HEAA 1XZGA 5JATA 4G5XA 5HCUA 2O2HA 1XZBA 2CJPA 4B0OA 1K6EA 4X71A 3KWFA 4QDTA 3L1JA 1WB6A 5DYWA 4H7HA 4UHEA 2XDWA 3VJLA 1LPBB 1MU0A 3FYTA 2WLSA 3QM1A 2DHCA 3WL7A 3VKFA 3ESDA 2XI4A 2JBWA 2J4CA 4GBGA 4X3CA 4PO3X 3ANTA 2XMDA 1EH5A 3ZLUA 5LLSA 4DGQA 2BUCA 4FKBA 1LPAB 1LZLA 1H2WA 1MAAA 5DWDA 2XUHA 4PSDA 3HLKA 4OU4A 1E5TA 4UBMA 4CFSA 2RONA 3WA7A 1CUGA 1Y7IA 1QIJA 1LPMA 5E2IA 1D07A 2DHDA 4I3FA 5J3JA 1H2YA 1K4YA 4BCBA 4TVKA 4X7BA 2DHEA 3DJYA 5FPPA 1YS2X 2YH2A 3DYVA 1XZFA 3OC0A 3O9MA 1CUIA 4MQLA 3G0GA 4BDSA 3R0VA 2WIGA 2BAGA 1H22A 3K9BA 3HABA 4JYPA 1ZD4A 4Y2RA 1CRLA 1T4MA 4HS9A 5C8XA 3JWEA 4BTVA 1KEZA 1MT3A 1LPPA 1YASA 4BB0A 4W1QA 4X93A 2OGZA 2YASA 4M0MA 4TGLA 1YSCA 4WDRA 4DSZA 2DFPA 1FFEA 2H9YA 2D5LA 2Z8ZA 1TCCA 3H0CA 2HHAA 3WWPA 5A71A 4AQDA 2B61A 3A70A 1CVLA 5CURA 3RARA 2OCLA 4E14A 1XZAA 2O7RA 1RYYA 2BJHA 1KU0A 4DLNA 5AI8A 4UHHA 1ETHA 4N8EA 5CT6A 5C81A 2XE4A 4BVJA 4BP8A 5AHXA 1GGVA 3L1IA 5HKBA 4N5HX 4G4JA 5AM4A 2EEPA 4W1PA 5LZ7A 4W1RA 4ROTA 2C5GA 1XRNA 3SC2A 5BWCA 3D59A 5CH3A 3O4JA 5A62A 2VSQA 2C4HA 1SFRA 1VE6A 2C5FA 2XMSA 4OB6A 4KR0A 1QGED 1XRLA 3PFCA 4BBZA 2VT7A 3E0XA 5JAUA 2H1IA 3DD5A 3C43A 1Q84A 5AKYA 5FXMA 4C6HA 1MX1A 1TQHA 1X2EA 4OD0A 3GROA 2RHWA 4E15A 5JYCA 4N5IX 2HA6A 1YAJA 3Q0TA 4UFNA 1B6GA 1LPSA 5ALQA 4YK7A 1LPNA 1XKTA 1ZIYA 2HA0A 1NU8A 1EDEA 1XLUA 1YAHA 2ZSHA 2HDWA 3OTQA 1CUZA 1CUCA 2QKYA 2O2GA 5IH7A 5ALVA 4AXBA 3FNBA 2C0QA 4J0HA 1N5RA 3WJ1A 3M83A 3MVEA 4Y2SA 1K63A 1LNSA 3IDAA 4Y2VA 5C8VA 2JEYA 4NZZA 5LYYA 2QJRA 1IMJA 3FLAA 5AKHA 2DSNA 4KE6A 2EDCA 3M3DA 1NU6A 1AUOA 4BC1A 5FUMA 2GYVA 1MO2A 2WTMA 3DKRA 4KAJA 1CUAA 4BZZA 2V9ZA 4BRZA 5DNUA 2YXPX 2ACEA 2XMQA 4AO6A 4FNGA 1HBJA 2JGIA 3PI6A 4AX4A 1CPYA 5EHZA 4QWWA 3FBWA 4G8DA 5CTAA 2QS9A 2WHQA 1QIEA 2BFNA 3TEJA 4Q05A 2AXEA 1E8DA 2ROQA 4CI9A 5ALRA 4U2DA 3I2IA 4J0JA 4B6GA 3W05A 4QE3A 2V96A 2OAEA 1XLWA 3G0DA 2BKLA 2QRUA 3VXKA 4EA6A 2R11A 3GA7A 5ALNA 5AKZA 5AK6A 4NS4A 1CUXA 2XUJA 1GQRA 1S8OA 5DYTA 1CQWA 4NVRA 5LIPA 4WY5A 5A7GA 1XRMA 4DM7A 5IKXA 4AMZA 4KYVA 4QDOA 4H18A 2PSJA 1THTA 4EUSA 4QDXA 1AGYA 1P0IA 4IHAA 4QA9A 1DQYA 2RHTA 1USWA 3BDVA 4OSEA 4MXDA 3UMJA 5AP9A 3SX4A 2IITA 4H7FA 2JGMA 5AKKA 4KRXA 5D3ZA 1WPXA 4MYSA 1GPLA 5A6VA 3RM3A 4H7KA 3PDCA 4CCYB 1W52X 3B5EA 4DMCA 3K6KA 5AI4A 1CUFA 1XLVA 5T4FA 1PJAA 1XQWA 1EVEA 2XLCA 4UBKA 1FFCA 1QE3A 1XQVA 1LGYA 4M0FA 3G9XA 4WFJA 1QJ4A 2ECFA 4J0GA 1GT6A 4W1SA 2C58A 2CZQA 4H7EA 2QVBA 3F96A 1O6FA 5AKXA 1J06A 1ORVA 1MNAA 1UWCA 4OB8A 4UHBA 5ALHA 2DR0A 2Y2VA 4G9GA 4B9EA 1E89A 5K5EA 1DINA 3STWA 1NX9A 3LIIA 3CXUA 3D4LA 1CLEA 4UHFA 1F8UA 2ONCA 2WFZA 1AMNA 1C7IA 1JI3A 4PSUA 2CBGA 5ALOA 1A88A 1XZCA 3DS8A 4XIIA 1N8SA 5JARA 1N1MA 2K2QB 3H2HA 1CUDA 3OM8A 1DWOA 2WU3A 2QTBA 2PBLA 3WL5A 5LZ4A 2XMBA 3JW8A 4WY8A 5FRDA 1ZGBA 4C88A 3GELA 4FWBA 2XMCA 1Q0ZA 1JFRA 2WG1A 3NGMA 5CT4A 3V9AA 5FP0A 1BRTA 3QMWA 4KE7A 3BIWA 3R3ZA 2RIPA 2QOEA 3E1GA 4QNNA 5D6OA 3ZWQA 3AFIA 5CXUA 1IUOA 1UOQA 4F60A 2I78A 3R3VA 5HF9A 2JGEA 3OURA 3HYSA 3IA2A 1TK3A 2ZYIA 5KREA 2X8BA 4JEIA 3I6MA 3V48A 5LZ2A 4Y2QA 5K3BA 2PSEA 4YX9A 2CUTA 5I9IA 3IUQA 2WTNA 4L3WA 3HRHA 3QPAA 4BAZA 3STXA 3BE8A 1ODTC 1ZI9A 1A8QA 5SYNA 4HXFB 4UBLA 2Z5GA 3CCBA 2WIFA 2NW6A 3FAKA 2ZJ7A 1JKMA 4G9EA 3ZLVA 1BN7A 1ZD2P 1HPLA 2BUBA 1EK1A 2WU4A 1JJIA 1JMKC 5ALXA 4ZV7A 3ANSA 3VDXA 2JEZA 4KE9A 5JD6A 2J3DA 3IIIA 3WA6A 2HFJA 5EHXA 2Q0XA 1CEXA 4JYMA 3FCXA 2QM0A 4DNFA 1SC9A 1G5FA 4I19A 5JAHA 2OQVA 2PX6A 3R3WA 1G4HA 3BF7A 3H1AA 1AZWA 3WLAA 3WK7A 3O9VA 4L9AA 5ALTA 3AIOA 5HF5A 2XQJA 4CG1A 1HDEA 3WMRA 2GYUA 4B84A 2OAGA 2OXEA 2HA7A 1IZ8A 1QIGA 4LXGA 3R41A 3L1HA 3AIMA 4FHZA 5JZ9A 1F6WA 4QEKA 2XUQA 1MNQA 2OLEA 3DEAA 5K3FA 5JD5A 2I3ZA 1ZICA 3NWOA 3QMMA 4RNCA 2I3DA 3VVLA 1X2BA 2GBGA 1ZD3A 4X6XA 2XUGA 3O4IA 3V1MA 2HADA 4X6YA 1BCSA 5JASA 2PU7A 1W75A 3QH4A 1VLQA 3EQ7A 3I28A 4ZRDA 4C01A 2WFMA 5IVHA 2IIVA 5ALSA 3KD2A 1CUYA 4PW0A 2OGTA 2PU5A 3STVA 1U4NA 1MX9A 1ODCA 3WKEA 2ACKA 1RP1A 3DNMA 3E4DA 4MYDA 2ZJ6A 4CCWA 1Q0RA 3BL8A 4Q3KA 4RE5A 4QDUA 4HZGA 4H0CA 3I6YA 1ZIXA 1O6GA 5AJHA 5JZSA 1BS9A 2ZYHA 1TIBA 6YASA 1SCIA 3WYNA 1QTIA 4RGYA 2XUKA 4C4YA 3IUMA 4OCZA 1DT3A 4UBOA 2P8SA 1CUBA 1G42A 4AZ3A 1BU8A 2WUGA 3TJMA 1E66A 4Y2XA 5K3CA 4XWGA 5CH8A 4BVLA 5A7HA 1UXOA 1W76A 4W9RA 3D2BA 4ETWA 1LBSA 4WFIA 3G9TA 1LPOA 3D3NA 2WIJA 1KU6A 3F9CA 1CV2A 4LYDA 1WHTA 1TRHA 5T4HA 5EIAA 4X85A 2GBFA 5AK5A 1F0NA 1QTRA 4OYYA 1R9NA 2AJ8A 4CCYA 2GZSA 5JALA 4XX1A 1R1DA 1W4LA 4GHWA 2PSHA 3KXPA 1UFOA 4JUIA 4J0IA 5AI6A 5LZ9A 4FBMA 4A16A 3DL7A 3UUFA 1J1IA 3WKAA 5AM2A 3H17A 4Y2UA 1H2XA 2G4LA 3FYUB 5EFZA 1AKNA 3VJKA 1MTZA 1MN6A 4QWMA 4AO7A 4ZI5A 2OCKA 3JYHA 2C0PA 1P0MA 2HL6A 1FFAA 2PSDA 3M81A 2Y6UA 2DQZA 4P93A 3WK9A 1IVYA 4BP9A 2WQZA 4KAAA 3A2NA 4UFOA 3WZMA 3BIXA 5ALPA 4DNOA 2RAUA 3A2LA 5HFAA 5A7FA 3PICA 2ZYRA 4OU5A 1EDDA 3G9ZA 1HLGA 1XRQA 2BGRA 3GZJA 1UK8A 4X00A 2HA3A 4Q1VA 1VJ5A 2WUEA 5EHQA 4EHBA 4Q3LA 3RK4A 1UKBA 5DTIA 3EIOA 3T4UA 3IB3A 4X90A 3S2ZA 3C5VA 4N8SA 5K3FB 3AJAA 3D5EA 4EZIA 4LXIA 7YASA 5ALFA 1CIJA 3QYJA 1EHYA 3LLCA 5ALMA 3LP5A 3CCCA 4LYEA 3IURA 3ESCA 1P0PA 3QVMA 4AN1A 3C8HA 3R3XA 1CUVA 3F98A 3DOIA 4MEAA 5ALLA 5BWBA 1DWQA 3H18A 4P92A 5H3HA 2XUFA 4BZWA 1CUUA 3FVTA 2XLBA 5AO9A 3AZQA 4Q3OA 4LHEA 4N8DA 1VA5A 2HA4A 1YCDA 2XMGA 2AJBA 4MJ3A 5ALKA 4AMYA 1R4ZA 5JD4A 4HVTA 5AKLA 4G4IA 2HIHA 2H7XA 3N2ZB 3KWJA 5DTJA 1TAHA 2QZPA 2XUOA 1UOOA 2W22A 4CIBA 4BRSA 4DNPA 4OB7A 3ZPXA 4HTAA 1Y37A 4PSCA 1BEZA 4UHCA 3D2CA 1WPRA 3HXKA 5T4EA 3WL8A 1U8EA 3GBSA 2ZSIA 1W6RA 4H7JA 5KWIA 1EINA 5BV7A 4J7AA 3W06A 3X3HA 4KE8A 2Z8XA 5C8ZA 3PF8A 1UK7A 1QIDA 4K6GA 4B7ZA 2PL5A 5E4YA 3WJ2A 2WSLA 2UZ0A 4EY7A 2OG1A 1JMYA 3R3YA 3PUHA 1DTEA 4O08A 2V98A 3W9UA 5HF8A 4UHDA 5AH0A 1XZEA 4DMHA 5T4BA 2XQIA 1IUNA 2OQIA 1GKLA 4HXEB 4ZGBA 5DNWA 4GI1A 3WIOA 1OILA 4INZA 1A8UA 2H7YA 3F97A 3I2KA 2WJ3A 4CG2A 1XKLA 4G4GA 2WJ6A 4JNCA 2XQKA 3RKSA 1U2EA 2J4FA 3W2TA 3G0IA 1BROA 1R9MA 2AJLI 2X76A 4KACA 1JU4A 1VZ3A 1CUHA 4PQEA 2HFKA 4UFPA 3AIKA 1XZHA 1F0PA 1OXMA 3QPCA 4U2EA 4FDMA 3H1BA 1FSSA 3STYA 3PF9A 2WUFA 2XB6A 3DDUA 4B0PA 2C7BA 2DCMA 4H7DA 3TRDA 4Y7DA 5K3DA 2VAXA 2Z3ZA 2PUJA 4UUQA 3WKCA 1CFJA 4J03A 4QDZA 1XRPA 1YA8A 4RPCA 4AB1A 3C70A 2LIPA 4BDTA 4JH0A 2WJ4A 5EGNA 1L7QA 3QBJA 4DYHA 4KEAA 1THGA 5AI9A 4F21A 1A7UA 1BN6A 3OPMA 1UK9A 1WOMA 1JT2A 1Q83A 1WHSA 3AINA 5AKGA 4LKOA 3BJRA 2J3QA 5JANA 3Q8WA 4U2CA 5ALYA 1EI9A 3B3QA 3M82A 3FWHA 3FCYA 4QZVA 3WIBA 4EY6A 1UT6A 1QFSA 5LZ8A 4A5SA 3W9BA 1CUJA 2Y6VA 1SCQA 2RI6A 3U1TA 2XUAA 1XZDA 5CBKA 1DX6A 3DYIA 4B9AA 3R40A 5CRIA 2VATA 4B81A 3B12A 5DYYA 5D3KA 1VOTA 3E3AA 3UUEA 5AI0A 3QMVA 4DMKA 4C89A 1CQZA 3K2IA 1VE7A 3FSGD 4ITVA 4X91A 4KRYA 4L0CA 3FYUA 3I1IA 4CIAA 4EB0A 3HC7A 5E4JA 3G02A 3G7NA 1ODSA 1E8MA 4BAGA 5AK4A 3WWEA 3ZLTA 5ALGA 2JF0A 2CMFA 3WWDA 2X5XA 1AX9A 2CKMA 5AICA 3ED1A 3H2GA 2QXTA 1GKKA 4E46A 3O4HA 4H35A 3V1LA 1AQLA 1QO9A 1YB7A 1YS1X 1VKHA 1ZJ5A 1K8QA 4H77A 4WCVA 4MWSA 4YASA 1MX5A 3ICVA 4MQMA 4UBIA 4AO8A 1L7AA 2QR5A 3AUKA 1OCEA 1EA5A 2QT9A 3CN7A 1C4XA 2WUDA 2PUHA 4IO0A 1JJBA 2E3JA 2OCIA 4HRYA 4L72A 4X6UA 3ILSA 2OGSA 4EY8A 2XMRA 3G0BA 3F67A 1QOZA 4GW3A 1HL7A 3G0CA 2Y1KA 1X70A 2FX5A 1VXOA 5HQ3B 4ARAA 2FUKA 2HA2A 5I8PA 3MUNA 1R50A 1DX4A 1HKHA 2EDAA 4BVKA 4EY4A 2GZRA 5AOAA 4Q82A 1XQYA 3STUA 1WCYA 1ZD5A 3O95A 4DTCA 3ZI7A 4K5QA 3KDAA 2B20A 3N0TA 3SK0A 3I2GA 2O2IA 3C8DA 1DT5A 4C87A 3FSGA 3RLIA 1H23A 3S8YA 4E11A 3AZPA 4W63A 3WK6A 3MUOA 5CXXA 1XRRA 2IX9A 3AZOA 1GXSA 5AIAA 4HXGA 1AC5A 4XJVA 1EK2A 3I1YA 3VJMA 4GECA 2B4KA 3FOBA 3QITA 4EY5A 5JADA 3EF3A 4Y2PA 5FPQA 1A8SA 1ZI8A 4V2IA 2WFLB 3H2JA 5CT9A 1SCKA 1EVQA 2DQYA 4EBBA 1YR2A 2XT0A 2HA5A 4WJLA 2WHPB 3BXPA 5AOCA 4FFWA 1XQXA 3D7RA 4FLMA 4FMPA 4HAIA 2ES4A 4Q34A 1WM1A 4K2AA 3VISA 2WILA 3H04A 3O4GA 4DMFA 1HQDA 3DLTA 2V97A 5CH5A 3QZUA 1BE0A 4GDMA 1IZ7A 1N5MA 4KJXA 3LIPA 3TGLA 3V1KA 5HZGA 1FJ2A 4U2GA 3PFBA 3FLEA 1I6WA 5EIHA 3WL6A 4TPKA 3WWOA 1LLFA 2PM8A 4PV7A 1GQSA 2PVSA 5D7BA 2HM7A 5EHNA 3IULA 3G8YA 5JAPA 4FLEA 3I2FA 5FV4A 5FOQA 4WDQA 2XQGA 5AK3A 5IVIA 4GWLA 3FLBA 1R3DA 5AM1A 1MAHA 2JGJA 5I7UA 3H2KA 1MJ5A 1GPKA 3C45A 2XUIA 4GLBA 2XUDA 4C4XA 2WG0A 2WHRA 1TCBA 4QLAA 2H7CA 4AZ0A 4H7IA 2AJDA 4IQ4A 2VAVA 1H2ZA 5K3AA 2HU8A 2D0DA 1QONA 4B83A 2QJWA 1UOPA 2PKYX 3IUNA 5LZ5A 1EX9A 1QIKA 3WI7A 4P08A 4FFVA 5ALJA 1L7RA 5CW2A 3VVMA 3C6BA 4J0DA 2ZVDA 5JIBA 4D9JA 5LKRA 1CUEA 3EQ8A 4ARBA 3DL4A 3U0VA 1XZIA 4BE9A 5JZBA 1BEEA 5FLKA 1FFDA 3PE6A 5K3EA 5HK8A 2BUAA 3C87A 3CN9A 5AM3A 4MEBA 3IVMA 1SOMA 2Z3WA 5AOBA 1VZ2A 2HU7A 5HK9A 1ZJ4A 5IVKA 4MWTA 1ISPA 2FJ0A 1TCAA 5ALUA 2FJPA 1P0QA 3H2IA 3NOXA 1VA4A 1U65A 1DQZA 5CT8A 4ZWNA 2VJAA 1VXRA 4UBJA 2WM2A 3BF8A 5JAOA 1LBTA 1UKCA 2W6CX 5ALDA 1GPNA 2QUBA 1MPXA 4BCDA 3DQZA 4X94A 1QIHA 4HRXA 4LXHA 2WG2A 2VTVA 1PV1A 3HSSA 4PF1A 4U2FA 4DSAA 4IH4A 4Y9SA 1B41A 4XVCA 4BYMA 2GBIA 4J0KA 5LKAA 4ZV9A 3MGAA 4K6KA 4BATA 1EXWA 1UZAA 2VJBA 1UK6A 3BJMA 1QO7A 2XQFA 4X95A 1DU4A 3HI4A 4DIUA 3OG9A 2JGFA 1QIFA 4M0EA 2QUAA 1GZ7A 5AIBA 1UKAA 1E3QA 1ZGCA 3HJUA 4Y2TA 5AKIA 4AN0A 5FDFA 3FVRA 5AI5A 1XZJA 3EQ9A 1TKRA 5EI5A 2BGNA 2VEOA 5CT5A 4C4ZA 2JGLA 3DKKA 3C6ZA 3I2JA 2ZYSA 3DCNA 4GEGA 4GXNA 1DWPA 3WKDA 2JGKA 3LS2A 3GUUA 4UPDA 5IVDA 4F0JA 2VA9A 1K5PA 4OYLA 5SYMA 1CUWA 2XUPA 5HQ3A 3H19A 4IH1A 3WZLA 1YA4A 4A23A 2ORYA 3D0KA 1IUPA 1G66A 2YYSA 3ZV7A 3O0DA 3WYDA 4WFKA 3F8SA 1C7JA 1ZOIA 5DJ5A 3I2HA 4P9NA 4G1FA 4U2BA 4QLOA 2GBCA 2B9VA 4NMWA 2VT6A 2HRQA 1XFDA 4I4CA 2RGUA 1R88A 4X92A 1QZ3A 4DNQA 1LZKA 3ESAA 2CB9A 3W04A 4FLFA 3I6ZA 4BCCA 2ZJFA 2OPHA 4F5ZA 3HZOA 3C6YA 5HFNA 1WB5A 1YB6A 3KOOA 3QPDA 1CR6A 2AJCA 5C7YA 5KBYA 4J3JA 3NUZA 3EBLA 3WK4A 4B82A 5ALWA 2WFLA 4B85A 1ZI6A 3WK8A 3WQHA 1RWQA 4IH9A 4OPMA 2JIDA 2WHPA 3STTA 4BTLA 2PPLA 4G8BA 2VF2A 2VJDA 2I03A 4X97A 2XMZA 5DLPA 1XZKA 3A2MA 1ACJA 3KSRA 1T2NA 1Z68A 3GFFA 1ACLA 5E4TA 4BE4A 4J0CA 2QXUA 3ICWA 1J2EA 2O7VA 1BCRA 4FNMA 1W1IA 1XZLA 3P2MA 5EIEA 3DOHA 2VQ6A 4B80A 2G63A 2VJCA 3SWWA 1EB9A 3BDIA 1J07A 3V1NA 5AM0A 3IUJA 1FFBA 4Y2YA 5ALZA 5LP1A 4BC0A 1QIIA 1AURA 5AM5A 1EB8A 1PFQA 1Y7HA 4Z49A 2R8BA 4FTWA 5ALIA 3A6ZA 2WKWA 3WKBA 5HF6A 3YASA 2GYWA 4PNZA 1M33A 1QLWA 4RE6A 1EDBA 4KAFA 5ALEA 1WB4A 1CUSA 2WIKA 5A2GA 2PSFA 2QMQA 3PUIA 4S0XA 5ISMA 1E8NA 1QIMA 1JU3A 2G5PA 5F4ZA 3HACA 1XZMA 4FOLA 4K6HA 5KWJA 4OUKX 3IBTA 2G5TA 3G9UA 2BCEA 5FKJA 3ESBA
chains in the Genus database with same CATH superfamily
3ND6A 2ZWVA 2DMRA 4GUAA 1F48A 5EYPB 3A7DA 3R3UA 3RTGA 1GFIA 4IX9A 5YASA 5FBHA 1PGJA 1SKAA 4JCCA 3SBDA 3WJ7A 1MJFA 4JKIA 4R1SA 4BNVA 4GEKA 1TC2A 2XQVA 1GPAA 3GDWA 4XIJA 3B51X 5DRYA 3L18A 3LCRA 3NATA 2EZUA 2FQ1A 3V2HA 3EMBA 4R2XA 1ML3A 3AHIA 4FHDA 3DE1X 1D2MA 1B8OA 1YB4A 2P8JA 1POWA 4UZFA 4LIPD 2FKAA 3U9SA 3OOJA 1YQGA 3PQDA 2OCGA 2NU8B 4ZVQA 2UUCB 1DOZA 3BFXA 4TZKA 3WK5A 2WIDA 3MT8A 3OPXA 4M8LA 1I4EB 3MGGA 4ACAA 3IERA 3G3EA 5JTTA 3D54D 4FKMA 4CG0A 3GZ4A 1DFHA 3KELA 3GPCA 1NVAA 4FBGA 4CN9A 1H4SA 1IEQA 3H4TA 4XYBA 4IF6A 1U0BB 2X2PA 2CMHA 2OFPA 4LA4A 4C22A 2IW3A 2VC2B 1YWGO 2MMCA 3ZY6A 3DAPA 1FSGA 2MINA 3T52A 4E5UA 1Z56C 3QEBZ 1FFWA 1OZFA 1JQEA 5JBQA 2VTEA 3D2AA 3K0CA 1VLHA 1Y1LA 3C5WP 1YS9A 2H65A 1TYBE 1ORWA 3NT4A 1A5ZA 4KO3S 3PPVA 5AHOA 3WNZA 4LJSA 4L78A 2BI4A 4OJYA 1L4YA 2RH5A 3GRAA 2VUUA 2WKPA 4RJJA 2O2HA 1V48A 5D6NA 4F2HA 3H9QA 5GONA 3EHEA 4KU4A 4EFMA 4L7VA 3NHSA 2I80A 5JXIA 1ABFA 4X71A 5J58A 3QX3A 2Q7OE 2JFWA 2RGYA 3KWFA 1M2WA 2BR3A 3RTBA 2HQBA 4D8UA 4GH5A 1MABA 1PL6A 4DCGA 1ID8A 3U62A 4RXTA 4UMVA 5DYWA 1W0JD 3DMFA 4GM4A 3UJNA 3K92A 4XX0A 1FLVA 3VPBA 1ZQ9A 3MSXA 3UT5B 1QFJA 3EY9A 3JASB 3QMPA 1LPBB 5FTJA 4B3BA 4C7MA 4DLZA 4ZKDA 5IJZA 3U49A 1RM4A 4D41A 3RUPA 5F33A 2QVGA 4MJXA 4D0SA 3VKFA 1B1CA 1SUWA 3X0DA 3E1KA 2J4CA 4DQ0A 1U8FO 3TI7A 2RSLA 5CD9A 5BN5A 2BZGA 3ETEA 4PO3X 3OUTA 1LWOA 1K8RA 2QWXA 4M1QA 1EH5A 1NLUA 2C3UA 5JV5A 1UDAA 1Z4JA 3BWMA 2AHRA 5LLSA 3LLMA 4X64B 3KLMX 2UYQA 1ULBA 3GG2A 1T9GS 5DPMA 3OE7D 4EUFA 1IBMB 4M36A 1KYYA 5GIOE 1YK0A 1N1EA 2EP7A 4Z2YA 4EW3A 4YRBA 2Y0BA 4KQJA 3Q3IA 2HO5A 4NH4A 3RODA 3VSAA 2OM6A 3OEHA 1O54A 2CGEA 1B14A 2VJNA 2WR8A 2XB4A 3O83A 3BFVA 4MVCA 4BNTA 1JAYA 1G6KA 1VLVA 2XUHA 4MJLA 1E5TA 4UOZA 2GSWA 3AX6A 1PJLA 2F3TA 3E9ZA 4RMJA 2Q45A 3RV3A 3O94A 1XOIA 5KC8A 3RBVA 4HDAA 2ZE8A 4BO5A 2Z08A 4D6PA 2ZE6A 1AUPA 2BCGY 1Y7IA 1YB1A 1QBKC 2O2EA 1LPMA 1IOLA 1WZCA 3NGXA 1NI4B 1D4OA 1C7ZA 4ZAGA 4DARA 3ACCA 1GTVA 4P84A 4MZDA 3AHEA 1L4GA 1WSAA 4WUVA 5IKMA 2R8ZA 1ZNXA 2V0CA 4MWDA 2RGEA 4RH0A 4TQAA 2IYTA 4JJGA 4BCBA 4X7BA 4GI2A 4X7RA 3S1LA 4BP3A 1SXJC 1TK2A 1TO2E 2C2OA 2GSDA 3L5KA 4E08A 3CVWA 4RF2A 2OB2A 3ND7A 3QG1A 1YS2X 1KDZA 2ZIGA 3CH4B 3IODA 4WY2A 1MV8A 4WA7A 3OC0A 4Y0VA 4EB3A 4TQUS 2NUTA 4PR0A 4BLOA 4DJ5X 1NY5A 4MQLA 1SHUX 4HGRA 4NOMA 4FEGA 2H2DA 3QXCA 1E5DA 2FHPA 4IQ0A 4RQBA 1BJKA 2VJMA 4MAAA 3HABA 4JYPA 2FF5A 4CMGA 4D9GA 1N0WA 1Q3TA 4GO1A 4K8RB 3JQ8A 1VL0A 4QDKA 5AT1A 3R8FA 2QJFA 4PC6A 5E38A 4BTVA 1Y3AA 3IT2A 1LPPA 2WM9B 1EFKA 4DPLA 2ZSJA 1KI1A 3V7UA 3KETA 1F17A 1T2VA 2ZRPA 4UXIA 2ZUSA 1NVBA 4PSVA 1W4BA 2ZPUA 2VH1A 3NKVA 3I3SR 1LX7A 3BAFA 4TGLA 4M0MA 4WD3A 4DSZA 1JQ5A 1UJ6A 2J7PD 3L4BA 3ABQB 1FTYA 5HRUA 1T3LA 1RBQA 1KMIY 3C3PA 1RPJA 4CTMA 1XU4A 1O9BA 1TJNA 1XYGA 1E3TA 1ZH6A 4BNNA 2D06A 3KZVA 1DIAA 3IHLA 3ESZA 1GKUB 3KVYA 1TCCA 1PNTA 2JZNA 3H0CA 4RGQA 3SYRA 4ZN6A 5FWXA 2IHYA 1WBBA 2B61A 1P7ZA 2FPGB 3A70A 3VR5H 1XHLA 1CVLA 1M34E 4IRXA 3WB9A 2P3QA 2ZIFA 5CURA 1QVAA 1K92A 5LLDA 3EEYA 1OXXK 1XQ9A 2VL7A 3LP6A 3G17A 2R00A 2FWJA 5B55A 3SF8B 1P77A 4J75A 5ITSA 2EZ4A 4ROSA 3TKAA 3LVFO 1GPMA 1G3RA 4KDRA 3JATB 3PXUA 1KU0A 3UJDA 2MSEB 2PWAA 5SZJA 4K26A 4LMPA 4QQFA 2JFGA 4P36A 1LX6A 4TTSA 5AI8A 3B38A 1W85A 4JVMA 1H5QA 4UHHA 3KQPA 5CT6A 4YS6A 1GPUA 1BAPA 2GN8A 2P2CA 2C4TA 3K1YA 4MP8A 1TA0A 3AIIA 3T1TA 1OAOA 2AOXA 4TZTA 5AHXA 1UWVA 2PZAA 1V6AA 5I47A 3S5JA 3HB0A 3KC2A 3QIVA 1TIPA 4MGZR 4XLLA 2D6FA 1TM7E 2ZJ1A 5J4YA 2HMSA 4MRRA 4ROTA 2RGAA 3DE6X 3QI7A 3H99A 1J7KA 1DIOB 4RA9A 1A5BB 2VPZA 3EWSA 1UEJA 2HT6A 4BO6A 3SC2A 1LCIA 3VTFA 3OPVA 4C05A 4MR8B 1B3RA 2JCBA 4PX2A 1CNFA 4FDTA 4P38A 3TTYA 1NQAO 3NPAA 3RQIA 4HDSA 2OC9A 3O4JA 4M1WA 2XCLA 2BFEA 4BWGA 1O6CA 1NSTA 2FH5B 4XCXA 1R9GA 5A62A 1F6BA 1GNRA 1I1NA 5LQMA 1V3VA 2VSQA 2R6HA 4BMSA 5AQEA 3VYWA 3SR3A 2WYOA 1LXCA 4KO8A 1YMQA 3FRIA 4FFOA 3G82C 4QM7A 1ATIA 2Y9MB 1L5YA 2CLOB 4X9XA 3HXTA 3NIWA 1A9PA 1AGNA 1V3UA 4G5RA 5ARDA 4Y1RA 5IXJA 1KQFA 2ZLBA 1AF4A 1EU1A 3MBKA 4I9GA 3TIGA 5C31A 3F71A 3KOYA 1V7QA 3O1LA 1ZO8A 1L3CA 4YQEA 3BHJA 3MLAA 1J2JA 1XRLA 3PFCA 3ZDYB 4A8PA 3C3BA 3V2UA 2J5RA 1BEUB 4UU0A 4D6YA 3CPEA 2VXBA 4KLRA 4O1IA 4R7TA 4WZAA 2CE7A 4LN1A 4WAUA 3SOPA 4AQ7A 1OBFO 2WMYA 3DD5A 1B6SA 1W581 4LXTA 4MKIA 4OO3A 3C43A 4QJIA 4YJ2F 1A95A 5AKYA 1EVYA 1TQHA 3OD1A 2PR7A 2YV2A 3GROA 2RHWA 4QL3A 5G3YA 4KH0A 1FF9A 3D6TB 3LXXA 4D44A 5JYCA 1HX7A 1NULA 4BLSA 1JAHA 2H1CA 3PLAE 2Q3LA 2HA6A 2DP4E 3BFKA 2FP3A 1NWHA 3KPYA 4GX5A 4JA2A 2FX2A 3W2GA 5ICFA 4UFNA 5LDDC 5ALQA 1L4HA 2X3YA 4Y6PA 1S6YA 2HA0A 2P9FA 1EDEA 1N1GA 4HDMB 3TEFA 2E37A 1I7NA 1O0SA 1CFZA 1LFAA 3RW9A 1VPDA 4Q5IA 4H4EA 2FRDC 3JQDA 1I13A 4Q1FA 3KYCA 3AVXA 1O4VA 2OXTA 4AF8A 2NZ8A 2IYVA 2GPJA 1K75A 1QAQA 3DOEA 1PGPA 3G79A 4JYBA 1F8FA 4ZZ1A 3FNBA 1EFLA 2Y93A 2VH5R 1N5RA 3QBDA 3L4EA 4RA6B 4ZICA 2EFCB 3M83A 2FWMX 4PS1A 3UQYS 3VR2A 1XWIA 1FJHA 3H5AA 5B36A 5K6TA 1E1MA 1E9CA 4JAVC 3KQLA 1F5NA 4ZYUA 5LYYA 4ZV4A 2ZWMA 2DETA 2RGGA 5AKHA 2AMJA 3OP1A 3KVOA 2XRZA 4G81A 4LE1A 3LXUX 4BC1A 3TTXA 1CJKC 1VKOA 1M6HA 4LXXA 1C5KA 3GH1A 4MLPA 5AUOB 4KITB 2Q3HA 2NO7A 3EZ9A 4ZQFA 3ZV3A 1ZNWA 2CNLA 1MO2A 2QN9A 4P5DA 3DKRA 4AULA 2F2TA 2GO7A 2OCBA 1E3EA 3FFWA 4KAJA 4UM7A 1CY1A 3NZEA 1QF9A 3FZYA 3WV5A 4OHXA 4WXMA 3I2YX 3DA8A 2OHOA 2F4VB 1SHKA 3MTBA 1K5HA 3DE7X 3TRFA 2ACEA 4JOSA 3T95A 4XGNA 4TQ9A 2SNIE 4D4KA 5KTNA 3KJNA 2J09A 3E3LA 1Z2OX 2REBA 2ZROA 3OFND 4Y1FA 3DZIA 2ID8A 4RCVA 1CPYA 3EG5A 1WUIS 3WHLA 2B1IA 5K01A 3QV1A 2JIRA 2YICA 4IOJA 4YUWA 1L8AA 4UTXA 5LMUB 1FDOA 1EBUA 3C8ZA 4FFMA 3SQNA 3VC1A 3OLQA 3NANA 1GHTA 3AY7A 1NNI1 3DO8A 4LHXA 2FPOA 2IZ0A 1H2BA 4BKQA 3A3KA 5EJAA 3BX1A 4F96A 3CNBA 4EELA 1NPYA 1QIEA 4IZ6A 2VTBA 3TI9A 3ONNA 3ZE6A 2V54A 5TX7A 4YP7A 5JCXA 3L82B 1JJVA 4ZZ0A 3TEJA 3EE6A 4LHSA 2XUZA 5D2CA 2WFAA 2QB5A 1U1FA 5A4IS 5BSRA 3H3FA 3ME5A 1JU9A 1GIAA 2MSNA 1QM5A 3DVSX 1VMIA 2A5FA 3UPDA 4JWKA 4EJFA 3FNHA 4BU0A 1UPBA 3E9RA 5J4VA 3TDMA 4R54A 1E8DA 2P5SA 2ROQA 2ZJ8A 1B0UA 1KK0A 5AW8A 2NTVA 3FM9A 4CI9A 4D3FA 4PINA 1CS0B 3MCUA 3E27A 1A7KA 3OQOA 3RD5A 3OJEA 3F8WA 1KEPA 1VG8A 1XTZA 2AOUA 2ZYDA 3HDYA 1CJCA 1NVFA 2R8OA 1PUIA 2QF7A 3JX9A 3RHTA 4DLPA 3F9IA 4DT1B 4HAUA 3I42A 5TPWB 2ZK7A 3C6KA 4ZHSA 1M8PA 4MI9A 3A7EA 3GX1A 3PXXA 5C1PA 1R4AA 4F3YA 4MW5A 2QRUA 3DE2X 5IAOA 4EYEA 1NNSA 1XL0A 1DBSA 2R11A 1ACMA 2HBRA 3GA7A 5LMNB 3QUBA 4UVGA 3VNQA 3ZE0B 1I14A 4CLHA 1E2MA 4RTQA 1UZNA 4EGCB 3WSVA 4US0R 2FZLA 1QZTA 4IJMA 4JIGA 3GT3A 5M29A 4NS4A 1KZGB 2XUJA 1GQRA 1MIOA 1RI2A 1WXIA 1X1AA 4UEWA 4N54A 4CR6A 2H85A 4NVRA 2NSJA 1NYQA 4FE4A 3ENVA 1AOXA 1RJ9B 3CRNA 1UOEA 4IVQA 3RYHB 3FZGA 2AN5A 2WPNA 3KSZO 3ASUA 4N01A 2QYHA 1XRMA 4NESA 4MR9A 4WY5A 4DM7A 4EL0A 3DTYA 4CL2A 2C97A 4KYVA 1LD3A 3K8OE 4QDOA 5TC4A 5A02A 4CETA 4TXMA 1Y3IA 4YAKA 1I3NA 1MOSA 4J1QA 4ER7A 2ODBA 3HEMA 1HLPA 1V9SA 2FLKA 3IEPA 3HS3A 4V0QA 5AW3A 4ENRA 2RHRA 1HM5A 1XCPA 5DHPA 4E31A 2TECE 1G38A 2EJUA 4NLLA 1DQYA 2RHTA 2XA2A 3I39X 3KM0A 1FTGA 2J41A 1AN0A 1USWA 3HUUA 4R2MA 1QYDA 2FP4B 3K6JA 3BDVA 1SOUA 2ZYWX 4UDNA 2NQ2C 3O31A 4KVGA 4MXDA 1SGWA 2E4WA 1OFTA 2HLDD 3SX4A 5BSGA 1UINA 1MC5A 3I76A 3ULKA 2ILTA 2W6NA 2PX4A 3B13B 4H7FA 4BZPA 4C4SA 2RC5A 1Q57A 4DUYB 3L0DA 2JAOA 1JTEA 3C5HA 3FVVA 1WPXA 4MYSA 3NIBA 2B2CA 5D3ZA 5CFRA 1ZH0A 2GCIA 1YL6A 3EVCA 1ENZA 1PG0A 3ENZA 3K3PA 4FB4A 1UEXC 4R8VA 3VTAA 4CCYB 2WAXA 5BUZA 4FGUA 3G7UA 2JLAA 4B3MB 3B5EA 5DW3A 1LNZA 1A8PA 2EJTA 3H9UA 3NV7A 3QW4B 2I29A 5TF4A 3E58A 3NDIA 2QAIA 1YBAA 5T4FA 2PKQP 3QYFA 4R69A 3D3WA 5EC8A 4P98A 4JLUA 4MS1A 1R4NB 1W36D 4DPKA 2D00A 3SJCA 2J08A 2FMIA 1HE1C 1FFCA 1HE3A 3E9DA 3N0WA 4RVNA 3B6EA 1EFPA 1MBZA 3IDQA 4IX1A 5FUBA 1KOGA 3VSCA 1TUGA 2V6FA 2CXSA 1ZU5A 3G9XA 4JJ4A 4GNRA 3HFRA 3NXKA 3H1FA 4A4DA 1WCWA 4UNPA 5D51S 4PSAA 4NR0A 5ERXA 3WISA 3KOZA 2HO4A 4HL6A 3DL0A 4J0GA 5IBPA 2Y1LA 2VUHB 3GVIA 5HR5A 1Y5RA 1KAMA 1FBTA 1FB5A 3V8VA 3PGXA 4H7EA 3OEYA 5C8DA 2R62A 3F96A 2PX3A 2YDYA 4MI3A 3EMKA 4I5DA 3TGWA 7ADHA 4EFDA 1U9JA 2G07A 4M9RA 4OFWA 4R5HA 1FYVA 1ZNQO 4LGVA 2IP4A 2CHFA 5IHXA 4HK4A 1IQPA 4QQ8A 4OB8A 1KAHA 2PYIA 2I8AA 3IQXA 4KVZA 4PM4A 2HMUA 4DMLA 3ES9A 2DR0A 4G9GA 4KHZA 2OZLB 1O3YA 3ETGA 4OGKA 4Q7QA 1NRWA 1DINA 2OV6A 2VHCA 3LSTA 5ETJA 5CA0A 2DQSA 1GRRA 1CLEA 3JYPA 1JSZA 4P7FA 3LRXA 2ONCA 1OX4B 3ZWCA 4AM8A 1P7WA 3AMVA 2WFZA 4J6EA 2OECA 3CJRA 3B2NA 4EZEA 3LY9A 5KKNB 4ZYVA 1RPNA 1JEYA 3QPWA 2CBGA 4PSUA 1OMOA 1G4UR 4OJMX 1YQWA 3SYKA 4H6VA 3WLTA 5CDTA 1RMYA 4MI6A 2H4FA 1CZKA 4HMPA 1PTKA 4QOSA 2G67A 3H2HA 4IDCA 1CUDA 4QAQA 1P6XA 3CUVA 1VP3A 3NP9A 3ZWWA 4JYAB 3OM8A 3D0RA 1MR3F 2CNOA 2QTBA 2WU3A 2Y92A 1AHIA 3INTA 3WL5A 2O2CA 3GVPA 2I8LA 5CDGA 1OGIA 4ZCIA 2GZ2A 2JKZA 3OQIB 2ZKIA 2X40A 4KQXA 4XYLA 4QVIA 3NTXA 1EUDA 5FRDA 1G3MA 4CMJA 3B60A 1HFWA 1PJCA 2CNWA 3KQHA 1ZGBA 3ZY5A 1L7OA 4NE2A 3KE8A 4BNDB 1C0EA 3T41A 3T7RA 4DG8A 3OAAD 4YCMA 5EE5B 2IX3A 3ZZTA 4PN7A 1Q0ZA 3NGMA 2BEJA 2YBDA 2H63A 1SEPA 4YJ2B 1PKEA 5I9LA 4W5NA 1E2QA 3G2KA 2W2NA 3K6SA 1G16A 3QMWA 4KE7A 1H2HA 4ZEVA 1QH9A 1I6KA 1FNBA 1IHDA 2LBPA 4KW7A 1QE5A 4DKJA 1C1YA 4JENA 4QSMA 2G5CA 3CH6A 3BS4A 3CUUA 4E2XA 1T2UA 2AK3A 3TDNA 2PY6A 2H8KA 4QNNA 3SCZA 3ZWQA 5CXUA 3W6NA 1UOQA 1EGQA 4HX2A 1BNCA 3NHYA 2AD1A 1V39A 1YUNA 2R47A 2OAQ1 5HF9A 1RZRA 4MW0A 2I22A 3CF0A 3HBMA 3TW6A 1IXZA 3S81A 1P7VA 4WA8A 3JPWA 2OA0A 3UAWA 2FW6A 2PKQO 2QXYA 3JRNA 1TK3A 3K9QO 4IGFA 3WIUA 3G2OA 4EEZA 1CY2A 2EBWA 3AP1A 5ENDA 3EXHB 2X8BA 5CYOA 2IFTA 4Q9LA 1KVSA 4KLZA 3V48A 3G1TA 1UZLA 3T7JA 2YW2A 1GPWB 2CNBA 1GCGA 1DBPA 2QZZA 3QJGA 2XOEA 2B1QA 3HKBA 3OF3A 4K3VA 5K3BA 4NCAA 3EPKA 3DONA 2CV2A 2W00A 4JLMA 4A91A 4U02A 3ESQA 2Z9CA 3IUQA 3RREA 3PGMA 2H5JA 2WTNA 2V6MA 4L3WA 3Q9NA 1L2TA 1FRQA 3B9BA 3LWZA 3O9ZA 4PICA 1CY0A 5IARA 2VRWA 3FSJX 3F3KA 1DQSA 3D8HA 3SZOA 2JHGA 3C74A 4XWTA 1GYPA 4TKUB 5CM8B 4GYJA 5KAMA 2DUNA 2XAUA 2O7SA 3L0CA 3CNOA 1ZI9A 1A8QA 1JJ7A 5SYAA 5SYNA 1PZGA 3RJ5A 2YC4C 4J0EA 1WMSA 2FG7C 4BNFA 2Z5GA 4EYOA 1E3MA 1O4WA 1GGJA 3P20A 2ZPAA 4OHWA 4WN3A 1X74A 4TYYA 3FAKA 2BGJA 1L7NA 1OKKD 3UANA 1IBSA 3ZLVA 3DV0A 3UJ6A 1I94B 5C52B 2DECA 2BUBA 4INOA 4QUKA 3ISJA 3RQSA 1JMKC 1H9AA 1PAUA 1JNXX 2H3EA 1WLYA 3ANSA 1YZFA 4ZPJA 1DAFA 2P9EA 3SXPA 4RJLA 2JAUA 2JIPA 1N7IA 4LDPA 2VR1A 1PKXA 1KK3A 2IHJA 3N7AA 2J3JA 4TM7A 2FN4A 3BJIC 2KWIA 4IY1A 2J3DA 1LBIA 2HFJA 2OMKA 3NV9A 4QYTA 4WPGA 2HPVA 2ACVA 2PZ8A 3A1WA 2Q0XA 4RKFA 1U3TA 3KLPX 3FPSA 2HB6A 3DVAB 3LNTA 3AETA 1GVHA 2VDVE 1DRJA 1NVXQ 2BLNA 3JZAA 3RU2A 1JTVA 3THSA 4UEQA 3FTPA 4QFBA 3V4FA 4ZOLA 4IQGA 4WNCA 3TFWA 3VZRA 1KSJA 1AZWA 3UB2A 3LT2A 3WGHA 4L9AA 1Y7TA 3AIOA 2BY4A 3A1EA 1LDNA 5A9TA 4I66A 1HDEA 4OXRA 3WMRA 3ZV5A 4QUHA 4CG1A 4G89A 4RO0A 3B9QA 3ETLA 4B84A 2PUFA 5K51A 2OAGA 4FGZA 5G0VA 3SR4A 2OXEA 2HA7A 3DKIA 1C8LA 4WI1A 1BYUA 1UPTA 3R41A 1OWPA 5REQA 1N2BA 4FHZA 4B8WA 4MCHA 3TECE 4TN1A 1MNQA 2OLEA 3IKVA 1WX1A 3CLRD 4YV0A 3Q8MA 3CNLA 3U7EB 4ASUD 1FBNA 5GGYA 2IBTA 3RVQA 3EXIB 4WK2B 2QX4A 2A14A 1NR5A 1NN1A 2PFKA 1DEKA 1QNFA 4D57A 4N9WA 4TTIA 3EOZA 5KYGA 1BFDA 3VVLA 2IZOA 4JU9A 2G0TA 2E1PA 2F1HA 4KQFA 5THXA 5IF9A 3JQPA 3LCCA 2C4VA 4PZPA 4DBVO 1QPGA 3HUEA 2EBUA 4HGZA 3T8YA 3RU9A 4AKEA 3FTFA 5H7XA 1PCXA 2J0EA 2UAGA 3IIMA 5FPHA 4EVRA 3OEWA 4WK0B 5I7FA 5MN4A 2R8PA 3KXLA 4C1NA 3HL4A 1B93A 3C6MA 4ZRMA 2IUSA 3JVVA 1ESZA 1T6YA 2HADA 2QLFA 5EUQB 2QQFA 3H1GA 3UAVA 2GM9A 4ZEXA 4ZCRA 1Y6FA 2QNBA 5LOVA 2IP1A 5KDOA 5KI6A 1MA0A 1W75A 1EQAA 2ZJ2A 2ZSUA 3EQ7A 3I28A 4ZRDA 1H1LB 4IIHA 4R6WA 2PHZA 2PZLA 3KHSA 4YP0A 1H4TA 1TQ4A 3M6VA 4HH1A 1NOJA 5IDWA 2X0JA 5FIUA 2R44A 2FPWA 3G2IA 4GFDA 3K70D 3KD2A 5HXAA 4M37A 1CUYA 4Q7KA 4A2CA 2GN2A 2OGTA 4H16A 3SDZA 3RG2A 3AONB 3B3AA 1CP2A 4GBMA 4LMBA 1YULA 1YV9A 5EXEA 4NBUA 4BE7B 2UU9B 2QTRA 1ODCA 1LSOA 1E3JA 2FETA 2XNSA 3EASA 1YR3A 3NASA 4X8LA 3ZYCA 4L76A 2PS0A 4PYLA 1KEWA 1NASA 4M1YA 5AVOA 4D6XA 1PQ4A 2ACKA 1T8WA 1T10A 3QXJA 3UQZA 4EHLA 1QRTA 2QDKA 1ILWA 3D9QX 1N5JA 2AOWA 2J9FA 1JB1A 2F1JA 1TJ5A 3SC6A 2PEYA 2IELA 2ZJ6A 4DIKA 2I67A 1JS1X 5LA6F 3WLOA 4NONA 3LYAA 4R2HA 2P0YA 2Y76A 3B70A 2VQFB 1KWKA 1N5DA 4WRRA 4CM7A 4Q3KA 1JVNA 5HBGA 3IR6A 4P4LA 1H85A 1JR3E 4EI2A 3WGNA 1BMTA 5I4KA 1QZXA 1TW2A 2PBFA 5DSZA 5IC6A 2I7CA 1IZ9A 5L3QA 4C0QC 3B6MA 2H07A 4XOIA 4KYTA 5BQ5A 5FPKA 5JZSA 2WWGA 4DPMA 5J4HA 1RRCA 1SQFA 4F3CA 2G80A 1H69A 1E1QD 1ZCZA 1QTIA 1VJDA 2WMDA 3EXEA 5LWHA 5EE3A 2QL7A 1S02A 2CFIA 4WOPA 1AS0A 3W7AA 1IY2A 2C2ZA 3BB3A 2P0AA 4K9DA 4PO9A 2J5KA 2FU5C 4KIUA 4LPSA 3HU1A 4OF4A 4UBOA 4MMXB 5FA6A 4HDKB 4ZJPA 1DO2A 1XD2B 3IPAA 1FFSA 5JJLA 3PIRA 1N0IA 4FUTA 5C51B 1GWNA 1G42A 1WHSB 4AZ3A 4KR6A 1PVOA 5JI2E 2EYUA 4A3SA 2WUGA 4DCTA 2NO9A 3CGGA 3VX4A 4MA4A 1W0KD 2HXGA 1KNQA 3IPXA 3F47A 3D7KA 1RU3A 4JVOA 4ZQIA 4DBZA 2WDZA 4MUGA 4XWGA 2JCVA 5LQJA 1NYLA 4F8YA 2Q1XA 1L5GB 1OF1A 1TMOA 3KDPA 2J5BA 2C57A 3SHTA 1J5PA 1T4CA 3SSNA 1JLSA 5DX1A 4RVOA 3VPFA 4GOMD 2RB5A 1JILA 1LPOA 2CJWB 4PNEA 2ZITA 3VKWA 1RD4A 1QYXA 2WIJA 2IL1A 4G1EB 3C3EA 5JPDA 3DTNA 3IMGA 4ESEA 2CBZA 4K05A 3ET4A 1A7JA 3V5NA 3ELUA 1QRUA 1A2OA 1QCDA 1X86B 2ADMA 2R6ZA 1UJ2A 3CZPA 3ZQKA 5AK5A 2HGZA 4HNRA 4OYYA 2B21A 1GTMA 1LFDB 4IIEA 1G5RA 1P2DA 1OPRA 3BIJA 2IDZA 3KR2A 4Q93A 1SZDA 1ST2A 2GZSA 1Y4AE 3PUKA 1E1CB 1ZM9A 1SK9A 4U63A 4XX1A 5LP6A 1O1YA 1ODJA 4DNXA 3U09A 3TCXB 3UHPA 3DR3A 4MHTA 4GHWA 2PSHA 4FS3A 4FT2A 1ML4A 1RHRA 4XI9A 3KXPA 1UFOA 1SOAA 3PNLA 1JHXA 4J3NA 4RVGA 1GN9A 1U2TA 1RYZA 3JQGA 5T6BA 3KWMA 1J1IA 2DPMA 2F59A 2ZIAA 5CIWA 4GR9A 4RQUA 1TCVA 2J7KA 2PRJA 2A33A 3FB1A 3PWZA 2IEIA 1Z75A 3UUGA 1H2XA 3CLSD 3JQFC 2CZGA 2G4LA 5LB4A 4QPNA 2VNSA 5D5QA 4ALNA 4B3JA 2MSLA 3KEQA 1Q7CA 1MTZA 2EU8A 3DO5A 1U2GA 1M75A 5LCXA 1C1XB 2QORA 2OFOA 3ZY4A 1E3WB 1F2TB 1MN6A 1Y8RB 5U4QA 1E3IA 1D5WA 3IPYA 4O4HF 3L7CA 4WLUA 1V41E 3KLBA 1XMPA 3EA5A 2ZGVA 5JH7A 3FPLA 1JHOA 2B3DA 3LRTA 3VM6A 3RWOA 5AW4A 1ZJ6A 2D74A 3ORYA 2ZRLA 2VHJA 4BNXA 3E7XA 1J0DA 2C0PA 3RVBA 1XAJA 1P0MA 3KT0A 3Q0IA 4U7JA 3RWMB 5KNCD 3D8NA 1FFAA 2HK9A 2DQZA 1AKWA 3JVDA 1WXWA 1R2QA 1AHHA 1RLJA 5FR2A 1Q7GA 1CR1A 2WQZA 2EP8A 2V7QA 4II3A 4RFSB 3HKDA 2X5NA 1D4ZA 1UBEA 3LD9A 4YRDA 3NORA 1GTSA 4HTFA 4FSXA 3HBJA 2BGKA 4UFOA 1FIUA 3QPVA 1Z3IX 3ZKAA 4FKZA 3F6SA 3LV8A 1R8YA 1HE2A 2WYHA 1H8HA 2J30A 4IHJA 5ED0A 3GP8A 2O8CB 1U0HC 3UCEA 1ITZA 1KR5A 4JS0A 5A7FA 3PICA 1EK5A 5D5PA 3GLIB 5IK2D 1MG5A 1GOTA 3C7KA 2R84A 3GD5A 1CVRA 3OLYA 5TJ9A 4RTMA 4YNBA 1HLGA 1XRQA 3DE4X 2VZEA 3M5DA 2BGRA 1JFFA 4FM9A 1VCNA 1YDMA 3I6BA 2IU0A 3I45A 4RMGA 5EQJB 2G1KA 2RG7A 5FNVF 3IP3A 1DO0A 2R1TB 3ZJYA 3NT2A 2HA3A 3LQRA 1X7XA 4J94A 4Q1VA 5CDUA 2WUEA 5EHQA 4MQ4A 2IEGA 4EHBA 1XJCA 4Q3LA 1HORA 1YOVA 2GD1O 3ID6C 2IK8A 5C37A 1NUPA 2A59A 4MAFA 13PKA 3EIOA 1P9WA 5IM5A 1PV4A 4AROA 1DG9A 3T4UA 1II9A 1KMNA 3H8JA 3IB3A 4X90A 1FW6A 4B5KA 1NW7A 1WSWA 4Z4QA 1UAAA 3H6KA 4D3YA 5J2UA 4GPD1 2JLSA 4N9QA 4ZO7A 4H6WA 2YVLA 3AXTA 4YJKA 1QYIA 1YJ5A 1CE8A 4QOGA 3FR8A 1CIJA 3TVYA 3B1KA 4L6AA 1OVGA 1Q15A 1FUYB 4FD3A 2C5SA 3NMUF 3LP5A 5FPYA 1NBME 1WEHA 3ESCA 1S1MA 5IULC 4TMYA 1QRSA 1KEUA 1BQ3A 1P0PA 1U90A 1NMQA 1JHZA 1TI7A 2IOYA 2IZ6A 3DFUA 4PG6A 1XEFA 4WNAA 4AN1A 3DM9B 2Q50A 3F98A 5DI9A 1CQJB 3GFRA 4G25A 1CJTC 2DCUA 2V03A 3K0FA 3KJGA 4PGAA 5ALLA 4V1CB 4CL8A 3IV9A 1DWQA 3VSEA 2SKDA 5EIXA 1X7YB 3D8RA 4ZYYA 3VAAA 4D4GA 3SMVA 2G9NA 2OE2A 5J63A 4BZWA 4IFTA 1OXKB 1AO3A 1TD9A 2GJ8A 2WMNB 5CLQA 1CUUA 4N48A 4TLLB 2NTNA 2H1HA 4L3VA 1Z06A 5ULLA 5AO9A 4B87A 3CR7A 3T1HB 3OECA 3O3MB 1YDGA 2Q07A 4N8DA 5DK6A 3OIVA 1V5IA 4MJ3A 1H6CA 5FFMA 2GK4A 1ZNZA 2QSYA 2WIAA 3ZDFA 1LBHA 2WAOA 2PBZA 2OL4A 3IAXA 4FX5A 3BTOA 4R2LA 2G9UA 4PG4A 3WRWA 3DQPA 5B64A 2LIVA 3P0EA 4LUCA 5BUSA 3UCXA 4TRJA 2CW5A 3P0FA 3W6ZA 5TQVA 4M7RA 2RKBA 1LS6A 4UD2A 3WRXC 7REQA 4KQMA 4D9MA 2AKYA 4IIYA 1JXAA 4R8KA 4F3NA 5JXJA 1NI5A 2O0MA 2WYIA 4LJAA 3B1FA 2LKCA 3KWJA 3U4HA 3F2IA 2IIPA 3HG7A 2CCGA 4E88A 4WXPA 1M0WA 1K3TA 3MJCA 4JJFA 4IM7A 2XUOA 4RS3A 4GS5A 3UK2A 1W8IA 2GILA 2D1RA 1PP4A 4KXUA 1RPZA 3REQB 1ZOSA 3I58A 2SCUB 3AEKA 1QV9A 1XAIA 2IYAA 1Z6AA 4JJEA 4X41A 4CLEA 5K0FA 1G1AA 4KSBA 2CHGA 2YJ5A 2ZB3A 3T99A 4HTAA 4EI8A 1EFHA 1ZL0A 3AR3A 2W6OA 1QS0B 4K6FA 1YR6A 3CW2A 2FK7A 3RTAA 3SSOA 5ICCA 1BEZA 3VR6H 1JBQA 2IKSA 2VTKA 3A9WA 3CW8X 4Q7MB 5KQGA 4FGJA 3G89A 4KGXA 3CIOA 3T1VA 2VHTA 4IL5A 3HJFA 3ZXXA 1L4BA 3HXKA 4NZPA 3W34A 3HXLA 3KKQA 3U44B 2B4QA 2ZULA 1MJHA 5T4EA 2H00A 1O0BA 5ELMA 3S55A 2H0AA 3PL1A 1BTOA 4L0MA 3NEAA 5CLHA 1RQXA 3L4SO 3W3AD 3NJ4A 2EAUA 1SQ5A 3LA8A 3U3ZA 2O07A 1Q3HA 2FE4A 1EVKA 5JWHA 5LA6B 2W2LD 1XXHB 4PC2A 3INGA 1Y6RA 1U28C 4IW3B 2H0RA 5DP2A 1JH8A 2LE0A 2RGBA 2YRXA 3QRWA 1UWLA 4O8CA 4ZC1A 2GPWA 1JAZA 3E0QA 3FYCA 1UK7A 1JXMA 3PF8A 4PWZA 5EIBC 3THOA 1WBDA 2H2IA 2PGNA 2VA8A 2FZEA 5E0OA 3IMCA 3U4MA 5DBEX 5F7XA 1C7RA 5K3OA 3WVNA 5CXQA 1TU3A 1EFRA 2H1LA 2LW7A 3C16C 1DJQA 3OZIA 4ZA2A 4O2BF 2UZ0A 3UOGA 1RRVA 3ABSB 3CXRA 4B3FX 4HATA 5ES3A 2O8BB 1KKLA 4TKZA 5K8UA 4PX9A 1X7WA 4HNQA 4AS1A 2QHXA 5FL3A 4ZDJA 2JLVA 5IBRA 1Y8QB 5HYVA 2PZGA 3W9UA 3OA0A 3W90A 3EYAA 4GKKB 2B99A 4A92A 4M83A 4B3IA 3VHLB 1D09A 1RI1A 1ORIA 4DE5A 4DMHA 4KMSA 2DBVO 1LQUA 3HJTA 3O8QA 1IUNA 5LQDA 1TPZA 3QX9A 1GKLA 1C4WA 2ZYGA 1MQ9A 4INZA 4CDGA 2FOIA 3N2GA 2I3GA 1HDOA 2ONKA 1QYWA 4JSTA 1SXHA 3I2KA 1XVTA 2BM0A 4MGYR 3PXGA 1Y6ZA 1SU7A 2Y1OA 4CG2A 1KBZA 1HDZA 1KY2A 1XKLA 3L84A 1NQ5A 4G4GA 5TPZD 2WJ6A 2CXPA 3FMIA 4QUJA 4NTZA 3ZXYA 3G0IA 1VL8A 2GD2A 2K5UA 3G7SA 4YLYA 2XDYA 1BROA 1D04A 3QVWA 4Z8XA 4IUBS 1ZR4A 3NBAA 1G20B 1E9RA 5BSEA 3AM1A 1P1HA 3GEGA 3B1VA 4CMKA 1JU4A 1VZ3A 3EYWA 2B98A 5C80A 3ZVMA 1CUHA 4M60A 4EMSA 3QUSA 4WADA 5DWVA 2QBYB 5KOHB 1T13A 3BMXA 1R0RE 4IKPA 5HGJA 1A1VA 1OXMA 1W8DA 4P83A 4UCQA 1ZSVA 1HFEL 2BMEA 1J70A 3GEHA 2XNKA 4U2EA 2C5AA 3GLUA 3AR2A 4FNOA 4LSZA 2P67A 1Q11A 1VHJA 2QTAA 3H1BA 1YU6A 5KQSA 1EE2A 2FN9A 5JY1A 4F85A 4BBPA 3OESA 1FSSA 3STYA 5LU9A 4A2QA 2RGNC 3MCZA 4F9FA 1HDCA 3PK0A 2OAP1 4B0PA 1PJTA 3NRCA 1QHFA 1V37A 4KWIA 4H7DA 2AMLA 4ZANA 4YJFA 3TXXA 4NJMB 5I45A 5IYZA 1FDWA 3TD6A 3V4VB 4BJ5A 3FYSA 1HNWB 3Q8KA 1ZUHA 2BKAA 1ND6A 2IH2A 1NP3A 1JEQB 3GCDA 3WKCA 4RMHA 5DF1A 5FBWB 4DHEA 1T8UA 2J48A 1E1KA 1YA8A 2PFGA 3GQBA 1DHTA 5I3ZA 4HGYA 2YZKA 1MLDA 2F8MA 4RZXA 4V0LA 1S2GA 2GESA 1L4FA 2LIPA 1KY4A 5SV2A 1W19A 1L7QA 4K9OA 5BV2P 5K0SA 1EFDN 1MJGM 2CVZA 1UBNA 2JFHA 3O6VA 4UJ5A 4KEAA 4Z53A 1THGA 4IG9A 1GGNA 2G5GX 4P3YA 4G0PA 4U9UA 1S3IA 1MORA 3OFKA 4LSMA 1UXJA 3A2KA 3RYCB 4JT2A 1NBHA 3IEUA 4L85A 5DV9A 3FUUA 1A7UA 1U98A 3A3NA 4FZJA 5DYNA 2Q4RA 1VRCA 2AG1A 3V2IA 2V6JA 2GKOA 1JT2A 1P75A 4GOOD 4B3DA 4B6SA 3Q85A 3SF0A 1CW2B 3SMQA 2VPPA 1OJLA 4BX9A 3WAKA 3AINA 1RQLA 3RT1A 5DX8A 4NE9A 3J80A 1IN1A 2WJGA 2C83A 1SRRA 2J3QA 4NFLA 3ZHZA 2AEEA 3Q8WA 3V33A 4TKVA 3ZDAA 4U2CA 1NXVA 1J39A 3LPMA 4L8LA 5ALYA 3GZNB 1ZFNA 3ZZUA 1R0YA 3CEJA 5MFZA 3O1HB 3UMCA 1O96B 5AK0A 3UPTA 3K30A 4UOEA 1ZDMA 4LF4B 4GPEA 2C1ZA 3CW9A 4QEZA 4Y9UA 2EFEB 1JG4A 1SXJD 2W11A 1SCQA 3BFPA 1ZU4A 4OXYA 4UD6A 4ZI7A 1RCUA 3GLHB 1JDJA 4PZ0A 4IOLA 1AQJA 1C29B 2VRCD 2XVZA 3HJGA 2P2SA 3W7BA 5FNVB 4F84A 1ZM4A 2HXYA 4RD1A 1JQAA 4BO3A 3I92A 3LGSA 1RXEA 2FPPB 2CLEB 2O1SA 5JQGA 1O95C 1TKBA 4E70A 4ZVNA 1SUSA 5HA5A 1EM6A 4QQKA 2P2ZA 2V7TA 1NF9A 1UC4B 5EE9A 5J5VA 2X1HA 4JUCA 1MO3A 1ISHA 1L8QA 2C59A 3DPIA 2G9VA 4P4GA 3MTIA 2AK2A 3R40A 4RX1A 4TLMB 5C8YA 3B2QA 4YXWA 4O4LF 5CBKA 1KPHA 3B12A 4OVKA 3ANLA 3FN4A 1A2BA 2QUJA 4IDQA 1L5NA 4N76A 3EF0A 4IINA 4BU1A 2HQRA 1N6OA 2VYFA 3TNJA 4Z4CA 4C89A 2OBFA 4EJ0A 4AC9A 1E0KA 5JSHA 3K2IA 2FY8A 4QXPA 3HB9A 4R01A 4YUXA 3TYXA 4S35A 2PTHA 4DRXA 5JDCA 1IM8A 5GTDA 4L0CA 4JDPA 3S29A 1M2VB 3KXDA 1LBQA 1ADFA 4L08A 3B1JA 4AY5A 4Q7LA 1DPGA 3K5PA 4WXEA 4F4UA 3GLIE 1Y3DE 2R3SA 3NPMA 3VO8A 4DV7B 1TX4B 3F1KA 2C99A 4OSOA 1KYTA 4OIFA 1E8MA 4IDBA 1W59A 2PBRA 1CY6A 1RWVA 4RV4A 2G1JA 4DWWA 3ZE1B 1K5GA 3L07A 5B58C 3OCJA 5KVVA 2DBZA 2ODEA 3LL7A 5FD8A 1J8MF 4TKLA 3R9WA 3LFTA 1QGDA 2IA5A 4J6FA 1XVUA 1VRWA 4M87A 5DVZA 1AX9A 2H57A 2PMDA 2V58A 4WBNF 3DDOA 1WZEA 3SIXA 4E30A 5JI3E 1OB2A 1KI9A 2IGBA 1XKXA 2WK1A 2XNCA 1FS5A 1I36A 5F1OA 2FG6C 4D9KA 1TFUA 4MQ5A 4G0VA 3TW8A 2W2KB 3O4HA 1TADA 1GSAA 1U3DA 2OHHA 4PQYA 3V1LA 3DLPX 1K3FA 1EJ2A 1U1EA 1YI8A 2FYTA 1RVDA 5HZMA 4TT3A 1V1MA 2Y1XA 1U5AA 1KO1A 3W5VA 5I8ZA 1ISRA 3B7GA 3CHYA 4MQMA 4UBIA 4M8IA 3RABA 1BG6A 1ZM3A 1DV2A 3QBEA 4AO8A 3MJRA 4RW0A 2QR5A 3H1TA 3WLHA 1Z26A 1RI5A 5A4KA 3U3RA 3H8WA 4RZ3A 4ABTA 1BWPA 2WQ7A 3B9RA 1E2DA 1OCEA 1Z12A 1GNLA 4LGYA 3RJMA 3B3GA 3HVIA 3SHVA 1JQJC 4A6DA 1FNCA 1Q2XA 5FAKA 5K8TA 4WGFA 1JHUA 2NYUA 2WUDA 3IUPA 3M5CA 1WZUA 2PUHA 3KYDA 4U5QA 4IO0A 4NMMA 3KKPA 5GM1A 2ATEA 4BASA 1YJCA 1M67A 3FJOA 4MULA 3VC7A 4C9BA 1BXKA 1RJDA 4CL0A 4DDKA 3ZD7A 2CLCX 2VP6A 3HO6A 5KB3A 2IYQA 3MTQA 1JIIA 5DXFA 1WBJB 4L72A 3PVCA 3QELB 5H9WA 1KYXA 3SHWA 1OYYA 5H68A 3HYTA 3OAAA 3GU3A 3ILSA 2C3OA 5FH9A 5E6RA 1V8DA 4MTLA 3ZGYA 2YW9A 1OYVA 1TQ6A 3PNKA 4LRWA 6CHYA 5DTRA 3G0BA 1ZCFA 4BO0A 3L1VA 2BHTA 3M6IA 3K4QA 4H4CA 3WGOA 3R7SA 3NHPA 3U16A 3FXAA 1PIWA 2PZJA 4BS9A 3MBOA 2FX5A 5HQ3B 3FMOB 1FNSA 1NNLA 3OMXA 1GITA 3E7DA 3NVDA 4ARAA 3O26A 1G7CA 1WMBA 3FH0A 4N4AA 4JLWA 1HUQA 4NH0A 4QPJC 5CK4A 3V6MA 4OAQA 2NV2B 1WULS 2YVQA 5FWNA 4MB2A 2ZWIA 4XGQA 3A10A 1JZSA 2YFQA 1R50A 1IPFA 4R0NA 3TLGA 4K40A 3TKLA 3JZIA 2EDAA 1P81A 2D62A 3EZXA 2GVZC 3HKEB 5BN4B 4DA4A 1GLGA 2IYFA 3PFKA 4Q82A 1RI4A 5KCMA 1FDSA 1DZIA 4Q16A 1KBQA 3IP7A 3ZU4A 1ZZEA 1SC4A 1GR1A 1XNJA 4DC0A 3QFFA 3K6RA 3KDAA 2C5HA 2PWPA 3E22A 1TEHA 3WMGA 3IBYA 4N5DA 3WQSB 4AKTA 2C84A 3SK0A 3EGDB 3TTSA 5TQ2A 4YUYA 2CF5A 4MWOA 5AHKA 5CCDA 2AXNA 4PS0A 4XWWA 4QRDA 2XCOA 4PBTA 2NV6A 1DLIA 1PG5A 1C9MA 2IHBA 2J3MA 2QD1A 3O90A 4G09A 5CM2Z 3UAYA 3VAZA 3EC7A 2GNPA 2OT3B 3AZPA 2EFGA 1SBIA 5CXXA 1G2QA 1XRRA 3AY3A 3U4AA 4D9EA 2XGJA 4YQYA 1YZQA 1C3OA 2PJZA 1XXHE 1MOZA 2Z9BA 3NOVA 4GWGA 4JP5A 4L16A 4X5OA 3TR6A 4ATNA 8AT1A 1VI5A 4B4OA 2BR4A 3TRJA 3DCIA 1F8XA 1P44A 5TV2A 3KG2A 4BFUA 3Q98A 4QREA 1U1DA 4XD7A 5HE9A 1FQOA 1TO1E 2CHEA 2PLFA 3ILVA 2HSGA 4PHHA 2Q5HA 4UM8B 4WWHA 4C5CA 1X8XA 3KQKA 1G1MA 1ISSA 3C8UA 3NAGA 4GECA 4R51A 1V16B 3LX8A 1YKGA 3K2QA 2G6TA 3RFVA 3CTMA 3QITA 1E18A 1KK1A 1QV7A 2YZGA 3CZ4A 4H6XA 5K3SA 5M7EA 2BJVA 2HIMA 3HZZA 2MSWA 1Z2NX 4A1FA 1Q20A 1IYZA 3QKUA 1QHHA 3NW9A 1FXWF 2Y4OA 1QH8B 3EF3A 3MA0A 4XQ9A 1TM2A 4UTNA 3IVRA 3HXOA 3HNRA 3H2JA 5CT9A 1SCKA 3VI4B 1W1WA 2G6BA 3LE8A 2OFWA 1MC8A 3QWFA 5HIMA 1KK2A 3DD1A 3C4VA 3DVQX 3QTLA 4G5YA 4C0HA 2HF8A 3VMMA 3EZGA 2GYYA 3BXPA 4LY9A 4NYMQ 3U7GA 1Z2PX 2AEJA 2IHKA 1WNTA 2GBPA 2V45A 3LBAA 4V3BA 3RSQA 1OU0A 4PNHA 3DZBA 2QRJA 5AM5A 3TRHA 3T6KA 3JQFA 2QD4A 2I2FA 4JSYA 1DEOA 1QWSA 3CKYA 3FHLA 3IBFA 2F9MA 3E35A 1IEWA 1H1DA 3PGJA 4FDVA 4K2AA 1XPOA 2BMJA 2CLHB 1WCV1 2WILA 4M9SA 1GZ5A 5J5CA 4ARSA 5BNFA 3GFQA 2MWMA 2FEPA 2G9QA 3R74A 1B6RA 3X1XA 5AJVB 1G20E 2A9JA 2PDAA 2HQOA 1BVHA 3EMVA 3HJNA 1ECLA 2UXBB 4C7VA 5JC8A 2YR0A 1BE0A 1GCIA 1B42A 3IC5A 5AVKA 5IF3A 3H9BA 2H4HA 2JFBA 4L6CA 2FN7A 1E59A 2NYRA 3GJXC 5G0WA 2HTFA 4XB2A 1PFGA 5GM2A 1N5MA 1U6IA 1E6EA 1BCRB 1CU1A 1DBWA 3K5WA 3V1KA 1IPHA 4B4KA 1Z2AA 1GTL1 6NULA 1P1BA 5C5DA 3I6QA 3I83A 3A27A 3DMGA 3SZLA 3RIXA 5BXQC 1LNQA 2CZCA 1PR2A 1WR8A 2VZLA 4WVLA 4CNQA 2IDMA 1YI1A 1CSEE 1I6WA 2RJOA 4G2TA 2NGRA 1TD1A 2ZSEA 4II2A 4LTDA 5EIHA 3ZIAD 4CKWA 1ZA2A 2P9ZA 4Y7CA 1KJIA 2HEGA 3C3MA 1K7CA 5F2EA 4YB8A 2NUBA 4NENA 4JUDX 2HJRA 3DCJA 4IDEA 4ZODA 4BJ6A 1RXSA 1O9HA 4MVJP 10MHA 1RM5A 5K2MA 1JLHA 4JDUA 5D7BA 3OIFA 1CYEA 3Q3VA 4ZO8A 1F60A 2BM8A 3OQBA 3ILHA 3IVCA 2FPIB 2J0UA 3ZCSA 4J2OA 1LI4A 2I1LA 2ZTVA 3EAGA 4KDCA 1XF1A 5EHNA 1AV6A 5JPCA 3E3OA 4ANFA 1BX0A 3IULA 2IYXA 5JAPA 1KO7A 1PEAA 3OC6A 1RLMA 1WDMA 2Q0QA 5TS3A 4WCFC 3TE7A 2UVPB 4LF9B 2V9PA 1REQB 4UCXA 4DM4A 1X92A 1NW6A 4BNKA 3K0EA 4UUPA 5IP5A 5AK3A 1EGMB 1IFXA 4Q00A 4RACA 5DHUA 2XB9A 3FLBA 3LBFA 2NSDA 3NAMA 1Z0JA 2ZUBA 1NZJA 3KPWA 1RKBA 1U0LA 3A1FA 4HZUA 4Q4HA 5DEOA 4B8YA 1U02A 4KXQA 2WTAA 4PLTA 5IWCA 4P86A 1XTSA 1M1YB 2KX7A 4JC0A 2IOFA 1KC3A 1SG9A 3EDYA 3KEFA 4O4LB 3HUDA 3L6CA 4PNPA 5B58T 2V5VA 1N2SA 1W9HA 3FHOA 3IPCA 3S8MA 4BVBA 3GPLA 3I04A 3CX8A 5DTMA 2WG0A 4DLRA 4E6PA 2GCOB 5ADVA 2IYNA 3I09A 4Z0NA 2O1XA 1L7VC 2H7CA 3WLIA 1KQ3A 3ZTYA 1V5EA 3ZWXA 4D42A 4H7IA 4E0BA 3TZHA 3L0BA 3RYTC 2XYVA 4M6WA 3UH0A 4AURA 4Z7QB 1R9JA 4YCDA 1H2ZA 2Q2WA 2HU8A 5K3AA 3HPQA 4C2TA 2P11A 1UPUA 5GV8A 1U3WA 4GYWA 1PI3A 3D3EA 1L6RA 1JEDA 2NPOA 5EE1A 3EGWA 1FNNA 3AR9A 3CEAA 3R20A 3SX2A 4BQQA 2CJFA 4IXWA 2QJWA 5CAEB 5BYKA 4ZIRA 1YRLA 3L46A 2Q7DA 4ECAA 4WZBB 1UOPA 2GT1A 2PKYX 3MCVA 4CIYA 1BKYA 3JQAB 4IEIA 3GLHE 1IY1A 3P26A 4YRTA 5AW5A 3QXHA 1VP9A 3TINA 1Y6QA 3E15A 3U39A 2IZZA 1SKBA 2N75A 3OCZA 1EX9A 3KU1A 4XYGA 4HRVA 2R86A 4R68A 1X9IA 4XEHA 5TMEA 1PJ8A 3SZ3A 2I1VB 3DT9A 4DY6A 3RJZA 4RVSA 4Z54A 1IATA 4QU9A 4CKEA 1NOIA 1UMBA 2WHXA 1AA6A 1BC5A 2VN8A 1B8VA 1M72A 3KPUA 4O4JA 4C7JA 4WBNB 3J81A 3W5SA 5F35A 3A3YA 3MMZA 4EUNA 2FOXA 5K8JB 4KIFA 4TOIA 2JJ2D 3TX2A 3F5DA 3OZBA 4QXQA 5ALJA 2JH3A 1GKYA 4GE3A 1NTRA 1G2IA 1OHHD 1DIRA 1E2BA 2GF0A 5TR9A 3C6BA 1QFYA 4RK4A 4TYMA 2RBGA 4HLQB 4LJYA 2AWOA 3R0IA 4YHBA 2ZVDA 4YRAA 5JIBA 1XU7A 1Y63A 1GZHB 3OWOA 1NXPA 2VQSA 4PGFA 4RKWA 1CUEA 1TYZA 4CF5A 2BKUA 1W96A 1I0IA 1XXLA 2O3QA 4DZZA 4OA8A 2NYAA 2ZUUA 4LYHA 4EW6A 5J4LA 1QGAA 4TXLA 3N07A 5BMVF 4X45A 3GUYA 4BRWA 5EAIA 1FVHA 3TMYA 1RRMA 1VSTA 1NLFA 2QMZA 3LT0A 3B48A 5KVCA 2Y3IA 1AMOA 3THXA 2IEBA 2PE5A 1FFYA 4CLOA 1QYVA 3N1UA 4NZYA 4RS4A 5AW2A 2UDPA 2VP2A 4HFRA 3SE7A 3RTDA 1M83A 1CR4A 3CVXA 1OASA 2W6ID 5AOBA 4TT8A 3A6EA 4ZMSA 2A0WA 1TVKB 3ASYA 3R5KA 4C0SA 5M5BA 3BMCA 4LRTB 1PNQA 5HK9A 5K0GA 4E5SA 1VSVA 1G291 1N77A 1JDVA 2I2WA 5H8WA 1NY6A 2WA2A 1XVLA 3MWFA 4J4HA 4EG7A 1SQGA 1NSFA 2FJPA 3AUUA 1P0QA 1SD1A 4UNNA 3EPJA 5IASA 2VK8A 2MDTA 2BONA 2H17A 4OG2A 3JR7A 3Q3HA 1VJTA 1M7GA 1BQEA 5FBRB 3H9EO 2ADOA 5JBNA 3EXFB 1MB9A 1VGQA 2OOSA 2QIPA 5FBVB 3UAOA 1AKMA 2X9NA 6PFKA 1ZSNA 5M34A 1CCWA 5DXJA 4UBJA 4W9NC 4MK4A 1D03A 2GF2A 2YWRA 4DV5B 4TTAA 4K9RA 3BF8A 3TO5A 5JAOA 4ZDKA 1MX3A 4MUXA 2Y4NA 721PA 2QUBA 2Z8YA 4BCDA 4E5KA 2UZAA 4HPWA 3N8KA 2WQ6A 1OLXB 2YTZA 3X1DA 3HXMA 1YZHA 2ZQZA 4GP9A 4XJXA 2ZCVA 1GUFA 1H8EA 3WP0A 4EJSC 2X8JB 3HSSA 3NALA 4YLEA 1KEEB 4EEKA 4Q03A 3GFVA 1UR5A 3QU9A 3BXEA 3EOAI 5JT1A 1CBUA 1VDZA 3OLWA 5EJ2A 2R4TA 2ZB7A 3WIVA 1F2UA 2XE6A 3BMNB 3H87A 3OZXA 3P9RA 4J0KA 1C2YA 4N49A 3ELWA 1L7XA 4G5HA 3USES 2V8BA 4LC9A 3VYRB 3X2SA 4YCNA 2E5WA 1QDEA 2W8BA 1Z7YA 4UQPA 4S0ZA 3O8BA 2BELA 3QLTA 1X9GA 5KNCA 4B3TB 4YI3A 3F7TA 2ZSDA 4U4AA 1Y34E 3IKJA 3BJMA 3GFPA 1KSGA 4X95A 3JPYA 3E53A 3HI4A 1Q0TA 3VR0A 3VYTB 3NQ41 1WZNA 3C15C 1NBWB 5A6SA 2QUAA 2QRVB 5CUQA 5PGMA 3RIHA 1DC3A 2F9LA 2WJJA 3OZRA 1T3GA 2AEFA 1L9KA 1DAOA 2C9BA 2PS9A 3E70C 2JK0A 2FSSA 3L04A 4O2AA 4OFBA 1QHYA 4YAOA 4ZC8A 4AZWA 1K7EB 3PSAA 4QYWA 3FFTA 9ABPA 4YRFA 4PQFA 5AKIA 2UYOA 3FDZB 2Z2JA 2ASVA 4QUEA 4ND3A 1GSHA 2II6A 3FVRA 1SCAA 4YJ3F 4AN0A 3TLJA 5BORA 1G0NA 4RTKA 1JVSA 4LJ9A 1NL3A 3BIOA 1TKRA 3EQ9A 1FLAA 4QOJA 4X54A 5IK2A 1UBHS 1BZYA 2AN3A 2JGLA 1HZZC 2WT8A 2XKJE 2FWNA 2YX1A 1X87A 5CNIA 4EKDA 2P5UA 3HZHA 3LCVB 2XWPA 2QVCA 1SK8A 3LX5A 4WZ6A 5IU6A 2WD9A 2ECOA 3I2JA 4Q24A 4XIGS 1UP6A 2FKNA 3WKDA 2Q1YA 4QPPA 5HVNA 5K0JA 4LDQA 3RI3A 1NI3A 5TMBA 4EJMA 3KZMA 4UPDA 1VE9A 3RC7A 4F0JA 2FZGA 2AXPA 1N2GA 4BOYA 2VA9A 1CT9A 2CFCA 4UM9D 2DVMA 4QBIA 4R40A 5EMNA 5EKXA 3NOQA 4R1TA 4NMLA 1DV1A 4OYLA 4GVXA 1URPA 1T5SA 3KVRA 4QU5A 5EQFA 3VQTA 5HOQA 1XN1A 2XUPA 3DFMA 3C7CB 3Q3CA 3FX2A 5DFAA 2WKRA 3I9NA 4WOJA 2IPXA 3H19A 1IHPA 3QE4A 4IH1A 4PVCA 5ADWA 2X22A 3PNMA 2GAJA 3NOOA 3W6PA 4DCMA 2ORYA 4BECA 4TSFD 1FP4A 1IUPA 3KRTA 3H3JA 1YQDA 4G36A 1QDUA 2W6JA 1WIWA 4IKEA 5C3UA 1KRHA 3WL4A 1WXXA 3KQQA 2G1PA 3RSLA 2UZ3A 1PZEA 4B4VA 4BLTA 4LNHA 3OZAA 1R64A 1JPJA 2QW8A 1WE2A 1WQ3A 1ZOIA 4JXKA 4RSHA 4P9NA 3Q5EA 4U2BA 2M6KA 3GHYA 1IMOA 2A0YA 1E58A 2ZUTA 3ENKA 2DFLA 1EXNA 3MQFA 4MKGA 4D0NA 4F06A 5KOJB 3N2KB 1PR5A 2C4WA 2LKDA 3B9PA 3Q2KA 3RVSA 1Z37A 5EJ4A 4PIMA 1AZLA 1I2DA 2VT6A 3GAZA 4KWHA 4Q4LA 3U40A 4BZXA 1FCJA 1L7PA 1U2DA 1R6BX 5LQSA 3C97A 3QEKA 4KKXB 1JALA 3GDHA 4I55F 2JRCA 1AD2A 1LK7A 2ZS7A 4FMDB 1M0TA 2OK8A 4I4CA 1IAQA 4WEQA 3SSAA 1AVTA 2RGUA 2VXYA 3OX1A 4EG0A 4DV3B 3THWB 3CO5A 4Q4JB 3KB8A 3LLVA 4DNQA 5KNDH 3PC8C 1VSUA 4CWAA 3W04A 2ARKA 2NAPA 2Q6IA 4RHFA 3IQWA 2XE7A 4RXUA 2CK3A 4QOIA 4CU5A 5J1SB 1TEVA 3KKLA 5COQA 2QNIA 3RVOA 3GJ0A 1BW9B 2VDWB 3MRVA 5FWYA 1R6TA 3ZK9A 2ZOSA 3SGLA 1X94A 1M8JA 2NAFA 4QTXA 3UH1A 2DBRA 2NZXA 2Z83A 3CYFA 3QLUC 1R66A 1ZCJA 3ZY3A 2GXQA 4UULA 4C7BA 1Z28A 3W05A 3X1KA 4V02A 5HJ7A 1YJAA 4IVNA 4C4PA 2Z2XA 3EFBA 2KJQA 4BQFA 4I1VA 1A0OA 1OXSC 1KSHA 1WW2A 1JHRA 1Q22A 5LJLA 4DIBA 3KUDA 1ADBA 4X61A 3F49S 3SS9X 1GNQA 3NUZA 2J0VA 4JN6B 3CLVA 3V8NA 1I33A 1FQKA 1DOAA 3AERB 4UMDA 4KQ6A 4D3DA 4I5IA 5CDSA 2PQ0A 1HDYA 1OLSB 3T1NA 1CDOA 2B0JA 3QU5A 5BVGA 5BNWA 3B7PA 4CMBA 3K0BA 1I3LA 1DOHA 1KS9A 1P4SA 3H2ZA 1AE1A 2JGAA 4IH9A 1BWRA 4TS9A 1NUUA 1BIFA 5DULA 1CX9B 5C3MA 3L4JA 1G6Q1 4AQYB 4WGGA 2H5LA 2LCIA 1P17A 3C3KA 4BWYA 4G8BA 3LQKA 4NABA 1SIUA 2VF2A 5B2ZA 4BLVA 4JBXA 1O8CA 4U6SA 4BXOB 3DCYA 1NUAA 1FS4A 4PC3A 5F5NA 1KKUA 3NHFA 4CGYA 2YIJA 3GDOA 3E6AA 1NT2A 1D2GA 1TQ8A 4LSWA 2Z5VA 2AN4A 3DMYA 3N3BC 1XZKA 4G8JA 5DLPA 3COJA 3A2MA 1SEVA 2NZJA 1PS8A 2NVBA 3KZOA 3VR4A 3AVPA 3U1BA 2VT3A 2XSZD 3GFTA 3GFFA 1J1UA 2WA1A 4R2JA 3RRJA 4J9VA 4UEOA 5E4TA 4BE4A 2Q3EA 3TSCA 2O8EA 3DV9A 4R1MA 4DSTA 4XCQA 3TQQA 2OBMA 3MN1A 2QXUA 3TLAA 4DQVA 5EJ9A 1GDTA 4I1YA 4Y9TA 4IV8A 4MQFA 5JSKA 2WWWA 2CCKA 2V7WA 4E2FA 5KMGA 1QQ6A 2WMOB 1TNDA 4FNMA 1W1IA 2JJMA 1XZLA 3ADKA 5CU7A 3DOHA 2VQ6A 2WNIA 3EVNA 4I50A 1LDGA 4LF7B 1G98A 5EZSA 2D2EA 4LTNA 4P3XA 1M1YE 3GJTA 1T8SA 1CF2O 1EUZA 1Q16A 5C46F 3SWWA 1LI7A 2QVLA 3DL2A 4RULA 3VFDA 1DXHA 1J07A 1QB7A 3DHNA 5DBOA 5HQTA 3UMYA 2QTMA 2WU1A 3IUJA 4B6FA 3UCFA 5E9AA 2OXCA 4Y2YA 3FNFA