4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
1XQXA 3DYIA 4BC1A 1GQRA 5IVHA 2V98A 3C5WP 3EQ9A 5IVKA 3HABA 3JWEA 2PX6A 4MEAA 4UFNA 1SFRA 3TJMA 3QMMA 1J1IA 2J4CA 4P92A 5LYYA 2XQGA 4Q1VA 3FLEA 2BUCA 2GBGA 5LZ9A 3PF8A 3JYHA 1ZD5A 1UKBA 3D2CA 3VISA 3PE6A 4DNPA 3V9AA 4O08A 2WHPB 3F9CA 2VJCA 2XMRA 4PO3X 2QXTA 1CUIA 1ZI9A 2O7RA 3BF8A 4RNCA 4HXEB 4DIUA 2WG1A 3DNMA 1FJ2A 1W76A 4X7BA 3R3WA 5DTIA 5JATA 1XZAA 1ZICA 4KRYA 2DHEA 1H2WA 1K8QA 4I3FA 5BWCA 2QJRA 3AIKA 1CUVA 4OB8A 3FOBA 2OPHA 1YSCA 1LPBB 5HCUA 1M33A 2XMDA 2ZSHA 3SK0A 2PU5A 4U2FA 3DQZA 1TQHA 1CVLA 4BB0A 4BVJA 1UOQA 4J3JA 1R88A 4QWMA 3I1IA 4H7KA 2D0DA 3M82A 3BXPA 1CUFA 3N2ZB 4XIIA 3WYDA 1JFRA 3H2HA 1KU6A 1E8MA 5EFZA 5ALQA 3C6XA 3DL7A 1JU4A 3W2TA 5AM3A 3AJAA 3A2NA 1QIJA 2CUTA 4AO7A 1NU8A 1CRLA 1UK9A 1A8QA 2BFNA 4S0XA 2BGNA 1JI3A 1E66A 3G8YA 1CUEA 4IH4A 3RLIA 1VLQA 3VVMA 4Y2XA 4KE7A 3WMRA 2VTVA 2WIKA 1CQZA 4UUQA 1FSSA 5FXMA 2FJ0A 3C8DA 2Y6UA 3ESDA 2JBWA 1CIJA 5CMLA 3KXPA 4LXGA 4PSCA 1UK8A 5HFNA 1DX4A 2H7YA 2HADA 4F0JA 5AKHA 3H19A 3KOOA 1LZKA 3H18A 5LKAA 4BTLA 1XZDA 1DWPA 4Y2TA 3C6BA 1AX9A 5DWDA 2CKMA 4KR0A 2UZ0A 3KDAA 4GEGA 1CFJA 2JGLA 3LIIA 5ALUA 4OU4A 3EQ7A 3WIOA 4A23A 4BCDA 3HLKA 3WL8A 3I2JA 3STVA 3LP5A 1B41A 2G63A 2VJAA 2QT9A 5CH5A 3PICA 3H2GA 1ZIXA 1YAHA 1XRLA 4B0OA 1EVEA 5K3AA 2C7BA 2PSEA 5HKBA 2OGSA 5LZ2A 2HA7A 5CH3A 4OYLA 3I1YA 2PPLA 3OTQA 4QLOA 5AIAA 5K3DA 3H17A 4E14A 4KE8A 4KRXA 4Y2VA 5AI4A 2WG2A 3G0BA 1XZCA 5A7FA 2WHPA 5DLPA 5IKXA 4D9JA 4N5IX 5AOCA 4X6UA 4AX4A 3L1HA 5HF9A 4Q05A 4MXDA 1GT6A 2OCGA 3G9TA 1HL7A 1AQLA 1MX9A 2GYUA 4DM7A 3ESCA 4G1FA 2C0QA 2YYSA 3I2FA 1S8OA 1VZ3A 1E5TA 2FX5A 1D07A 4LIPD 4L9AA 3K9BA 2HDWA 2AXEA 3H1AA 2QMQA 3LIPA 4AN0A 3RKSA 3VJLA 5I8PA 1BCRA 1UKCA 1XRRA 1UK7A 2VAVA 1ZOIA 1VXRA 5KWIA 1T2NA 2O2HA 1T4MA 1UOOA 2QXUA 1GPNA 3YASA 3EQ8A 3Q0TA 1CUHA 1E8DA 3NUZA 1JJBA 1AURA 3QVMA 3F67A 2ZYSA 3NOXA 1WB4A 3I2IA 5AO9A 3IUNA 2X5XA 3HYSA 1H22A 2ZVDA 5DYWA 1IVYA 3B3QA 2IIVA 3OC0A 1ZI6A 1F0NA 1CLEA 1YAJA 4J0GA 5AICA 1VKHA 2GYWA 4DMHA 2XUOA 1Y7HA 2XUAA 1SCKA 1XRPA 3GZJA 4L72A 3FCXA 5CH8A 2JGFA 2GBCA 3FYUC 4DSAA 3HJUA 1BS9A 3DOHA 1ZI8A 5IVIA 5EHNA 1UKAA 1MAHA 1U2EA 1LPPA 1EDBA 4NZZA 4AO6A 4BE9A 1BRTA 5FRDA 2VJDA 4P93A 1PV1A 4BP9A 1XKTA 1TAHA 4QDTA 4QA9A 3WL7A 4C89A 1EINA 1IUNA 6YASA 1XQVA 4TVKA 3DCNA 3QYJA 2JGKA 4Y2PA 3A70A 4TGLA 1I6WA 5A6VA 3QITA 1YASA 4KEAA 5CXXA 5EIEA 5T4HA 4DMFA 2RAUA 2ES4A 5KREA 3WI7A 3F97A 3I2HA 2VSQA 2Y1KA 1XZGA 4CG3A 4BDSA 1XLVA 3HC7A 4J03A 2XLCA 2PUHA 5AH0A 3ANSA 3AUKA 3O9VA 2IITA 4ZV7A 1JJIA 3STTA 1Q83A 2JGMA 5CURA 1GQSA 3G0DA 1ETHA 3IUMA 1F8UA 1Y37A 3R3VA 4Q3LA 2GBIA 3DLTA 5F4ZA 3IURA 1XQWA 5D3ZA 4GECA 5AI6A 4PW0A 3G7NA 1HKHA 3WA7A 3A2LA 3WWPA 1Z68A 3VXKA 1QOZA 2BCEA 4WFJA 1WHTA 2HU7A 3DD5A 5FP0A 1QIFA 2HM7A 4ZWNA 4H35A 3TRDA 4G4GA 1A8UA 5E4TA 2OG1A 5CRIA 4B85A 2G5TA 4FBMA 5AKIA 5KBYA 3BWXA 5AK6A 5A7GA 1BEEA 5LLSA 2VA9A 4A16A 4QZVA 4U2DA 1QIHA 5AM2A 4H0CA 2K2QB 3H04A 3DOIA 1UXOA 1MJ5A 5AM5A 1ORWA 1IZ7A 5JAOA 5T4EA 4OU5A 5AKJA 5A71A 3GBSA 5D6OA 1JKMA 1MN6A 3VJKA 1QONA 1XKLA 1TRHA 4X3CA 4BYMA 1SCIA 4E46A 3PDCA 4WY8A 2DFPA 2OQIA 5AOAA 3WIBA 3O0DA 4QE3A 3D0KA 4KE6A 1J06A 1MO2A 3ANTA 3QPCA 4BVLA 4DMKA 2ZSIA 1XZBA 4OCZA 3WWDA 3QBJA 4AXBA 3OURA 4EY6A 4BAUA 1DWOA 1L7AA 2X8BA 4IH9A 4XX1A 2O2IA 4IH1A 3QPAA 1LZLA 1Y7IA 5HK8A 3AIMA 2XQIA 2WU3A 3WK9A 1P0IA 3DEAA 4YX9A 2DQYA 3IIIA 3UMJA 1CUCA 2QR5A 2VF2A 3WWOA 2XMCA 1QTRA 3U1TA 1ZD3A 3WL6A 1G66A 3IUQA 3GELA 3WJ1A 2AJLI 1N8SA 2G5PA 4UHEA 2Y2UA 3FSGD 4F21A 1X70A 2VATA 4HAIA 4DSZA 5HQ3A 4CCYA 4LHEA 4GLBA 4AZ0A 3WWCA 1G4HA 4JNCA 1EVQA 1MAAA 3IDAA 1GZ7A 3R40A 4K6GA 3M3DA 2XMQA 1DQZA 4OYYA 1O6GA 2NW6A 1MX5A 1CUXA 3C6ZA 1WCYA 3ESAA 4P08A 4UBNA 2HA0A 3WLAA 1YA4A 5JADA 1LPOA 1MU0A 2VQ6A 2Z8XA 3FYUB 2ROQA 1LPMA 3V1LA 2CJPA 3R3UA 3AIOA 4GI1A 2JEYA 3F98A 4Y2UA 4ZXFA 4EB0A 4DGQA 2OCIA 5AM0A 1QIKA 3FVTA 1U4NA 2B4KA 4GBGA 5DTJA 2J3DA 1THGA 1XZEA 2JGJA 1LGYA 3AILA 1P0QA 5IVDA 2RHWA 4H18A 2XI4A 3GFFA 4Q3KA 4DNOA 3WZLA 1O6FA 4J0DA 3C8HA 1VE7A 1R3DA 1CUDA 4YASA 5EIHA 2R8BA 3IUJA 3VKFA 3DYVA 2GBFA 1JMKC 4C4YA 5ALFA 4AB1A 1R9MA 3OG9A 1W4LA 1BN6A 3C87A 4QDUA 4AO8A 4V2IA 5JASA 3W9BA 3WKBA 4W1QA 5ALDA 4DNFA 4X94A 2PUJA 1QFSA 3W05A 3ZLTA 1UWCA 5A7HA 5E2IA 4X90A 1LPSA 1R9NA 2OQVA 2AJBA 3OPMA 2IX9A 4Q3OA 4QLAA 1RYYA 3S2ZA 2ACEA 1DX6A 1SC9A 4BDTA 3R3ZA 2C5GA 2OAGA 5JZBA 3STYA 3R3XA 1MT3A 2OGTA 5ALIA 3O4JA 5AK4A 5ALOA 1RWQA 1LLFA 1J07A 3WQHA 3B5EA 5LIPA 3CXUA 3VDXA 2PVSA 4QDZA 3O4GA 3AFIA 1GKLA 4J0JA 4DMCA 2P8SA 4CCYB 5HQ3B 1ISPA 4M0MA 4H7HA 1DT5A 5ALMA 3WKAA 1VZ2A 1SOMA 2H1IA 2AJCA 4IQ4A 2ZYRA 5K5EA 1ODSA 1BCSA 4N5HX 1HPLA 1FFCA 4FTWA 4Y2SA 5HKAA 5JIBA 1EI9A 5ALTA 5E4YA 1EHYA 1CUJA 4P9NA 3ED1A 4BATA 2Z8ZA 4CCWA 2PSFA 4B83A 3O95A 3AZQA 3R3YA 2WIJA 1IMJA 1USWA 4FOLA 4WDQA 3BE8A 4J7AA 3D2AA 4FWBA 5JZ9A 3FNBA 2XMBA 2ZJ7A 5K3CA 5AKZA 1UK6A 2BUAA 1JU3A 1K4YA 2PSJA 2ZJFA 4XVCA 2XQKA 2BKLA 4EBBA 4MEBA 3I2GA 4Q34A 3DJYA 4EA6A 4KAFA 1NU6A 5CT4A 1UFOA 3G0CA 3ZI7A 1AKNA 1PFQA 5ALEA 2BGRA 3IULA 3CCCA 1AZWA 3PFCA 3C43A 5FUMA 3RARA 4FBLA 4KYVA 1BN7A 5JYCA 5LZ4A 1FFEA 1H2ZA 4WFKA 4CFSA 2ECFA 5AOBA 3WK6A 5EHZA 1E3QA 4IO0A 2XUHA 3ICVA 1JT2A 5EHXA 4UPDA 2BJHA 4C87A 3Q8WA 4HXGA 3BIWA 2WFZA 5ALGA 1RP1A 1ACLA 1XFDA 2WILA 2HA4A 5CT5A 4DTCA 1X2BA 5CT9A 3D2BA 2XLBA 3G9ZA 4AZ3A 3O4IA 1EDDA 2J4FA 4UHDA 4AN1A 1QZ3A 2XMSA 4X71A 1UOPA 3LCRA 2VT7A 4HXFB 1LNSA 5LP1A 2HIHA 4JYPA 4ARAA 3D5EA 2QVBA 3CN9A 2O7VA 4U2CA 4Y2RA 5CXUA 3ESBA 3FCYA 1OXMA 1W75A 1THTA 4EZIA 3B12A 5A62A 5C81A 1OCEA 4XJVA 2HL6A 2WFLA 3ZLVA 1AMNA 3W06A 1XRMA 2FUKA 3V1KA 3WK4A 4UHHA 5C8XA 5J3JA 4FLMA 2XQJA 3GROA 5AHXA 4RPCA 1R1DA 4H7DA 5K3FA 3QH4A 3FLAA 1N1MA 1H2YA 2DSNA 2DR0A 4U2GA 1WHSA 2DHCA 2XMGA 5JD5A 1TK3A 5DYYA 4U2BA 4EUSA 4CIAA 3H2KA 1AUOA 2V9ZA 3WK5A 3IVMA 4HRYA 1GPLA 2YXPX 5BOVA 1G5FA 2EDCA 4BAZA 3EIOA 3W9UA 3WK8A 5H3HA 3KD2A 4LKOA 4H7JA 4UHBA 4G4IA 1FFDA 4EHBA 4MJ3A 1PJAA 1ODTC 2HA6A 3JW8A 3RK4A 4F60A 4ZI5A 4BRZA 4UFPA 3D4LA 3FBWA 5C8ZA 4G4JA 1XRNA 4NVRA 4RE5A 1E89A 2I03A 3I2KA 4RGYA 5ALPA 4C4ZA 3TEJA 3MUNA 3G9UA 1U8EA 3HZOA 1DT3A 1R4ZA 4RE6A 4X6YA 3STXA 5FPPA 5SYNA 4B6GA 3MUOA 1HQDA 2WKWA 4C88A 4FFVA 2GZRA 1VOTA 2V97A 4GW3A 1XZLA 1YS2X 2QZPA 1FFBA 4X92A 2XE4A 1AC5A 4H7EA 3KSRA 4LYDA 1H2XA 3FSGA 2QS9A 2WM2A 4OPMA 4XWGA 4K2AA 4GHWA 4MQMA 4C01A 1QE3A 3ZWQA 2LIPA 1MNAA 2W22A 4X97A 4BTVA 3I6MA 3G9XA 2AJDA 1BU8A 3BDVA 5CW2A 3F96A 4JYMA 1VA5A 3UUFA 4EY4A 1QTIA 2G4LA 3I28A 3V48A 1MPXA 2E3JA 5JZSA 4TPKA 1EX9A 2XMZA 4W1PA 2RONA 2XUFA 1A8SA 2WTMA 1WB5A 2VEOA 3AINA 5ALKA 1XLUA 2VJBA 1EH5A 2WTNA 2XUJA 5ALWA 1YCDA 4H7FA 1WM1A 4BRSA 3BIXA 1XRQA 4A5SA 5DYTA 3FVRA 1EB8A 3BF7A 3ICWA 4BP8A 4B7ZA 3KWFA 4ARBA 4MYSA 4G8CA 1WB6A 5K3FB 2JIDA 3HEAA 3HRHA 1A7UA 3S8YA 3L1JA 4MQLA 2PSHA 4B82A 4G9GA 7YASA 2PSDA 2VAXA 4G9EA 5T4BA 2W6CX 3WYNA 3U0VA 3V1MA 1CV2A 1DWQA 4ITVA 4N8EA 3C45A 4PF1A 5AJHA 4X85A 3DKRA 4KJXA 4QDOA 1XZHA 4WJLA 5C7YA 2C5FA 4UBIA 3T52A 5HZGA 5AI5A 4HVTA 2B61A 2HA3A 2XDWA 2H9YA 4B9EA 4HRXA 1X2EA 3ZV7A 2GZSA 1YS1X 1XLWA 3W04A 5JAHA 4AQDA 1H23A 1IUOA 5CT6A 2WUFA 4WY5A 1EB9A 2GYVA 5LKRA 1KU0A 4H7IA 2CEKA 3I6ZA 3WKCA 3H0CA 2HU5A 1ZJ4A 2WU4A 2WIGA 2C4HA 2XUKA 1LBSA 2B9VA 1VXOA 3FYUA 2XT0A 1XZMA 5AKGA 1FFAA 1WPRA 4PNZA 1Q84A 1ZJ5A 4CG2A 2WHQA 4BCBA 1Q0ZA 4CIBA 2HHAA 5C8VA 1TIBA 1UT6A 1VA4A 4YK7A 1N5MA 4L3WA 2DCMA 5SYMA 2RGUA 5FV4A 2WJ3A 1QGED 1MX1A 3QMVA 4C4XA 4N8SA 4JH0A 3D3NA 2PBLA 4BBZA 3I6YA 5ESRA 1IZ8A 4W1RA 3G02A 2WQZA 1CUAA 2ORYA 5AIBA 5FPQA 4Y2YA 1GPKA 4OSEA 3CN7A 3FYTA 3A6ZA 1XZKA 5ALLA 3N0TA 4DYHA 2O2GA 2Z3ZA 1MTZA 2Y2VA 4MWSA 2DHDA 2CZQA 2WLSA 4QEKA 4OB6A 4UBJA 1YB6A 3LS2A 1K63A 5DNWA 1XZIA 5FKJA 2CMFA 4OD0A 3QPDA 4G5XA 5FLKA 5CBKA 4N8DA 3DDUA 5FDFA 2HA5A 1G42A 3STUA 3DKKA 3ILSA 4UBOA 4DLNA 3K2IA 3V1NA 1ZD4A 5ALXA 2RI6A 2XUDA 1CUGA 5JAUA 1DINA 3NWOA 4K6HA 2DQZA 3DL4A 3D7RA 1QLWA 3HI4A 4C6HA 2XUIA 2BUBA 4IHAA 3E1GA 2HFKA 2JGEA 5DNVA 2CB9A 1ACJA 1WOMA 1HDEA 2HRQA 4DNQA 1CUWA 5LZ8A 2EEPA 1L7RA 2D5LA 2ACKA 2WUGA 4BE4A 4B81A 4J0IA 4LXHA 1QIMA 4X93A 2JF0A 4ZRDA 4F5ZA 5I7UA 1TCAA 3GA7A 5ISMA 3IB3A 5DNUA 2QOEA 2BAGA 1LPAB 3E3AA 3PF9A 4UBMA 2YASA 3H2IA 1ZD2P 4WCVA 5IH7A 4QDXA 4G8DA 5K3BA 3TGLA 3WK7A 1W52X 1NX9A 3A2MA 2H7CA 5A2GA 1K5PA 2X76A 3D59A 3HXKA 1W1IA 3IA2A 3UUEA 1VE6A 5AI0A 4WFIA 4AMYA 5AK3A 1N5RA 4Y2JA 5AM4A 4UBKA 2WFMA 3K6KA 5JARA 4H77A 1JJFA 2PM8A 2OLEA 2WJ6A 1WPXA 4FNGA 5I9IA 3GUUA 4FLFA 4K5QA 4Q82A 3QZUA 1CUZA 2I3DA 4ZV9A 3WZMA 4B80A 5ALVA 3PFBA 5HFAA 2JGIA 4X6XA 1BROA 3HACA 3EF3A 2JEZA 1P0PA 3AZPA 3STWA 5HF6A 3R41A 4NMWA 5HF5A 3BL8A 3WJ2A 5ALYA 4Z49A 3SX4A 1Q0RA 2OGZA 4ROTA 4FKBA 1UZAA 1QIGA 3KWJA 3OOSA 2V96A 5AKXA 4Y7DA 5T4FA 3RM3A 4PQEA 4FFWA 5ALJA 1CUUA 2ZYIA 2WHRA 1EA5A 4FHZA 4UBLA 2QUAA 4JUIA 3X3HA 4J0CA 5HK9A 1IUPA 2QJWA 1BE0A 4KE9A 3H1BA 4AMZA 4E11A 5LZ7A 2WUEA 4W9RA 2QTBA 4FLEA 4BVKA 4W1SA 2FJPA 1CUYA 3NGMA 4QNNA 4PV7A 1LPNA 4JEIA 1B6GA 5AM1A 3BJMA 2OCLA 2AJ8A 1QJ4A 4UHFA 5AI8A 3MGAA 4B0PA 1OILA 2PU7A 2XB6A 3VJMA 2C0PA 3WKDA 4WDRA 3WKEA 4X91A 2OAEA 4HS9A 3WWEA 2RHTA 5AP9A 1QIEA 3AZOA 3P2MA 3E0XA 4BZZA 2VT6A 1C7JA 5CT8A 1MNQA 3HSSA 2WFLB 1DQYA 3PI6A 4FDMA 4GDMA 4HTAA 1QIIA 2I78A 5CTAA 3MVEA 4YPVA 3IBTA 1TCCA 2H7XA 5AKEA 3ZLUA 3WA6A 1AGYA 1U65A 5YASA 5AI9A 1GXSA 4KAJA 1CR6A 1F0PA 2PL5A 5BV7A 5AKKA 1EXWA 5D3KA 1DTEA 3FAKA 3PUHA 1YA8A 4UFOA 2R11A 5ALHA 5ALNA 2WIDA 4LYEA 5EGNA 1CPYA 4B9AA 4ZREA 4I19A 2ZJ6A 1TCBA 4BC0A 5AKYA 1CUSA 1BEZA 1KEZA 2XUGA 1TKRA 4OB7A 2OXEA 5KWJA 5JALA 4U2EA 2XUPA 1C7IA 5EIAA 4GWLA 4Y9SA 4KACA 2Z5GA 2XUQA 1K6EA 1XZFA 4KAAA 2Y6VA 4CI9A 1CEXA 3C6YA 2QRUA 5HF8A 2CBGA 1GGVA 4K6KA 1ODCA 1HLGA 2WJ4A 3OM8A 4UHCA 5AK5A 3CCBA 1W6RA 1P0MA 2J3QA 5K3EA 3BDIA 4M0EA 4EY8A 3BJRA 4EY5A 5ALZA 4W63A 1C4XA 5DJ5A 5EHQA 1ZGCA 1CUBA 2HA2A 1VJ5A 3M83A 4OUKX 1A88A 4L0CA 3O4HA 4J0KA 3EBLA 2WSLA 3LLCA 1J2EA 5LZ5A 3SC2A 4EY7A 2Q0XA 3M81A 3L1IA 5JD6A 3H2JA 2QKYA 2HU8A 1GKKA 4X95A 5ALRA 5EI5A 2XQFA 3O9MA 3QM1A 4HZGA 4BCCA 1CQWA 2I3ZA 5BWBA 3E4DA 2Z3WA 1EK1A 3G0IA 4M0FA 1SCQA 2WIFA 5JAPA 3QMWA 1ZGBA 1LBTA 4BAGA 1JMYA 2PKYX 1XROA 1QO7A 5AKLA 3T4UA 3G0GA 4J0HA 1ORVA 2HFJA 2B20A 5JANA 3ZPXA 2QUBA 4ETWA 1EK2A 2ONCA 3C5VA 5FOQA 2ZYHA 3VVLA 2OCKA 3PUIA 4GXNA 4FMPA 4CG1A 3R0VA 4LXIA 1HBJA 2RIPA 4INZA 1R50A 1E8NA 4QWWA 5E4JA 1YR2A 3DS8A 1DU4A 4PSUA 1EDEA 4PSDA 4ZGBA 3WL5A 1QO9A 1XQYA 3SWWA 2QM0A 2C58A 2WG0A 4B84A 1F6WA 3C70A 2WUDA 2EDAA 2YH2A 4MYDA 4MWTA 4E15A 4NS4A 3F8SA 4BZWA 5JD4A 1YB7A 4X00A 4FNMA 5ALSA 3FWHA 1XZJA 5D7BA 1L7QA 1ZIYA 4I4CA 4Y2QA 3FLBA 4G8BA 1QIDA 2HRRA 1QFMA
chains in the Genus database with same CATH superfamily
1RRGA 2VDLB 1GQRA 3KB2A 1MXHA 1T3LA 2V98A 4K9DA 3TSWA 1D2EA 4CM4A 3S2YA 1SXQA 3QOFA 3QVJA 4RX1A 1KVUA 3ZZTA 3KT3A 2O19A 4XR4A 2HK6A 5B1DA 2HJSA 2JFVA 3LYUA 3BXOA 3FETA 4PZZA 4WEQA 1YRWA 1ECFA 3JWEA 3O93A 5FOXA 4WLUA 4NBTA 2W70A 1ZD8A 4RD4A 3TJMA 1J1IA 4OHRA 4G24A 5GONF 3X2FA 4CM8A 4HJXA 3HN2A 4P98A 5JE8A 1YFJA 1MP0A 1XB2A 5LYYA 1H2EA 2KBEA 3QUBA 4IRMA 4F12A 1JXMA 1BH6A 2CXXA 1Y1LA 2Q28A 2YX1A 2BUCA 5AUPB 5LZ9A 3JU3A 4N65A 3TRKA 3ZY6A 4HV4A 2QTGA 3JPYA 5C80A 4DAEA 1WZEA 3VISA 4NOJA 2A14A 5TJHA 2GDJA 4DA8A 2W2KA 4GXTA 1GSHA 3W7AA 4S12A 3CX8A 4I9UA 3V4VB 3ZOKA 4A0SA 1CR4A 3FUWA 1KZHA 1RD4A 4ZAGA 2A0XA 1RAHA 1OZFA 2DBZA 3LOPA 4JJEA 1SPXA 2ZRBA 2IZ6A 3WDLA 4P86A 2F1OA 3KJGA 1VPTA 5WRFA 1X3LA 1OFGA 2O7RA 4B8YA 2E5WA 3BF8A 3HYNA 4HXEB 1U2QA 1TU4A 3IIMA 4AKTA 3PPIA 6GPBA 4LF7B 2IA5A 3QU2A 1W76A 2P6RA 1UDCA 4N5MA 1TLFA 1R4NA 4B5KA 4EKIA 4KRYA 3GVXA 3KQQA 3VKWA 1JB9A 1DQNA 1VKNA 1YKSA 2JIBA 3AHCA 4I3FA 1UAAA 5HOQA 4FM9A 4V0NA 1T2DA 1XWWA 3DB1A 5J58A 3PR1A 2VRBA 3TAHA 1RJGA 1KKLA 4P32A 3ZHYA 2C57A 4DSOA 1ZRMA 3BIFA 2EHDA 3OOHA 4EW3A 2OPHA 2J85A 5JYEA 2GXUA 5HM8A 3S81A 3O8NA 3BMCA 2G8NA 3ZU2A 4L07A 2MYNA 1NVUQ 2XMDA 2Y0BA 4FXOA 1KY2A 1B6TA 1B7GO 1WSBA 1SVWA 3H0EA 2Z8YM 1TFRA 2D8AA 3K1YA 4L4ZA 2BSAA 4TV9B 4JJZA 3IP6A 3RFTA 4NC9A 4XJXA 1SK9A 3EAQA 3QKUA 1GZSA 5EZYF 3BICA 3U4IA 3DOEA 5E9AA 3ZWOA 3GEGA 1TUBB 1V6AA 4Q7JB 1F14A 1B42A 2J41A 3OSUA 4QBTA 3ZCQA 5F64A 1VHQA 1G8PA 4QEDA 3EGEA 5A9TA 3EOAI 4GI7A 3C6XA 4WOPA 2FPGA 1XCBA 3RSOA 1DC7A 4QPZA 1WO8A 1ZDMA 1OIXA 3LP8A 5CVCA 1NU8A 2BFFA 5D3QA 1CRLA 4EFMA 3D0QA 3H75A 2BFNA 5EIBD 3K2EA 2JVKA 5FFMA 2BGNA 5TPZA 3T7JA 3A3KA 2POQX 3CJQA 1YI0A 2W2PA 3TQFA 2JGDB 2NOAA 4C3VA 3DM5A 1NNLA 3DOUA 4GP9A 3RAJA 3G8YA 1VHDA 4ZGWA 4GOOD 2P5UA 5IN5A 1WZNA 4B76A 5BUQA 2A9FA 3DLBA 1E2IA 1KNXA 4LCEA 2F6RA 4R2XA 3CZAA 5LA6F 4QQ8A 2VOJA 5FA6A 3WIVA 2F4NA 2V4MA 2X0JA 3FZEA 2MR6A 3P4XA 2P9ZA 1I6KA 1XWIA 4BLSA 5TARA 5FT9A 1CQZA 1Y6RA 2FSSA 4UUQA 5IKMA 5TMBA 2PTGA 4RV9A 3OCXA 1KTIA 4CLOB 1FSSA 3MTIA 1K3TA 4PRZA 4CKBA 1QOPB 4KWEA 3C8DA 2AMFA 3ESDA 1YJAA 3BD6A 1L5SA 4FR0A 1WOYA 3TGPA 3H5VA 4FEYA 3K8QA 3QWAA 1ZZGA 2BFWA 4FNOA 4ZAYA 3A6GA 1E5XA 1SGWA 3PPYA 2G09A 4K6FA 5K7SA 1KI6B 1JJ7A 1QGZA 4KZPA 3UWDA 5HFNA 3EBOA 2K7FA 1GQFA 4F3TA 1P29A 2AG8A 2XD9A 1A9RA 3FNHA 4ZOCA 1K6XA 4UC0A 3RO7A 4YJFB 5EOVA 1O94C 2YRXA 3E48A 3RS3A 2GEKA 2R8RA 2HREA 3Q2IA 4KI7A 1PVVA 4IX9A 3LK7A 2XADA 2BFDA 2QB5A 2HW8A 4NE2A 5A9SA 4IDEA 3PNVA 1Q5PA 4QYIB 3SR3A 5TQ2A 5IWCA 2OBMA 4BTLA 1C2TA 4MGZR 4TLMB 3QWBA 3VZSA 3S1LA 1TAQA 1NF3A 2Z08A 5EJFA 1JPNA 4Y2TA 3WGIA 2YQ5A 3A6HA 1OA1A 5DWDA 2CKMA 2VAWA 1KKUA 3ABRB 4KR0A 1NSYA 1PQUA 2X0FA 3KDAA 4P4UA 4Y7CA 4O4IA 4MQ4A 1OLXA 4NZPA 3WAKA 4GEGA 4RHUA 3RYFB 1OPRA 1F8GA 4BGUA 1AQYA 4UUPA 3HLTA 2R8ZA 5IT0A 5K6AC 1B6RA 4IUDS 4LG1A 4X20A 3MBKA 1SC4A 5CEEA 4M1EA 4BCDA 2WJIA 3OQIA 4J8PA 1HI9A 2O3SA 4FS3A 5EPOA 3K70B 1KAHA 3TNJA 1VYHA 2PYIA 4JLKA 2QTZA 4P3OA 1QHGA 1XDWA 2H1CA 3LC2O 4FZRA 3RK0A 2NYRA 3WB2A 1NUPA 1P2VA 4C4OA 5I7AA 4J29A 2IWRA 1FFYA 2PHZA 5E38A 3M4YA 1D1PA 4KN6A 1DFHA 1MQAA 3B48A 4AY5A 4EG1A 3THXA 4B44A 1KMQA 2CJXA 2IQ5A 4HLUC 4NWIA 1NJ8A 5HVNA 4PNPA 1SUIA 1T5HX 1EVEA 3H4TA 3ZHSA 3UK0A 2XTJA 2QV7A 3WY9A 4Z9XA 2PSEA 5DNYB 1IYZA 4NICA 3AG5A 4GGMX 3RUEA 4Z6KA 3VO8A 5LZ2A 2AKEA 1JGTA 1G2PA 2H16A 3IMFA 4OYLA 3I1YA 4CN8A 2ZBUA 2ZZKA 5SZIA 4YCSA 4E4RA 4YO7A 3D9QX 2ZIZA 3X1YA 3LVRE 3H17A 4YMUA 3H1FA 4OM8A 4E14A 2CUZA 2X2EA 1R0CA 2VDMB 4ADSG 2ZIFA 1Z2EA 4ZZ1A 4MTLA 1LKZA 4IHQA 1N9KA 1R0BA 2RGAA 3SXPA 3WLLA 1S8FA 4BO6A 3LUFA 1HMPA 3FVQA 5JAMA 5A7FA 4IM7A 3K2BA 2TMYA 2G7MC 3BJZA 3L41A 2IV7A 2QR2A 4Y1FA 1FDTA 2B2XA 2Z56A 3L1KA 2IUTA 2O50A 1X38A 3ZXIA 2C1ZA 2YNMD 4URXR 4KXYA 1YZGA 1Y1QA 1Z35A 1I80A 2VYNA 3L1HA 5HF9A 2Z1DA 1QH1B 1DNPA 3D3WB 4R7TA 4D3ZA 2DYKA 1H4SA 1K2VN 3JQ7B 4TKMA 1QU2A 4TYYA 1GT6A 1GPUA 2CLFB 1E62A 1H5UA 3G9TA 1HL7A 1IL0A 3KQPA 5HUQA 1DCTA 1L5ZA 3EWAA 1XQ6A 3C24A 2PZKA 4W6QA 1E2UA 2GYUA 2JIMA 1YDEA 3U81A 2B4TO 2H59A 2FA9A 2XWJI 2UYGA 3HWX1 2YYSA 3OUUA 4GEKA 1BMFA 2G1JA 5B2EA 1Y9AA 4Y3UA 2FGJA 3FCAA 3FGPA 1MO3A 1S8OA 3GZTB 3T7DA 1JIXA 1QH0A 4KSYA 4PU0A 5IC4A 5FH9A 2JJQA 1E3SA 4RKYA 4LRUA 3RFCA 4O6VA 3WX0A 4MLZA 2EIHA 1D0IA 4M6WA 3EEFA 4WLOA 4M1ZA 1A95A 1X80A 4XUEA 4G89A 2AXEA 4ZGGA 1U0NA 1I32A 5BNFA 2V5VA 1FTNA 1OI2A 3UAWA 2ZYAA 5KVQA 1HO3A 3M5DA 3RVNA 1Q1NA 2TMKA 3ID6C 4FGLA 2F1JA 2Q4TA 4JDUA 2OKGA 3IS3A 1P9LA 4WIAA 3VJLA 4AVYA 1RCUA 2EBHX 4IDOA 1WMAA 4IS2A 4AC9A 3PHIA 4Y6RA 4R31A 4DT1A 3SXUA 2F1IA 1M8JA 3DT9A 1LI4A 4GPIB 4R1MA 4FHGA 1XNQB 1B43A 4NI5A 5HE8A 2VAVA 1ZOIA 1VXRA 1VYUA 2PD6A 2QMHA 4IV5A 3HVUA 4WK2B 5KWIA 3BBPA 3OZTA 1Q77A 3HJHA 4D9KA 2J0UA 4N01A 1FRNA 1SKQA 1DQRA 4B3MB 1KEEB 1P6XA 3T0GA 1JPUA 4URHA 3WFIA 4KOEC 3WMFA 1KP9A 1DC4A 3D4OA 3VNUA 1JH8A 3F4KA 5C46F 2GCEA 2NXNA 1L9KA 1Q7EA 2CHGA 5LR6A 4EKNB 1JR2A 3DW1X 2I6TA 1C9MA 4D8UA 4QBFA 4BQQA 3FZNA 3I6QA 4GRIA 1NAHA 1X1TA 2GDZA 1E8DA 2ZW9A 4IV0A 5FHRA 1O97C 1IQUA 2M6KA 2AOWA 2UKDA 4YMTA 5EAIA 1YC2A 1TI7A 1KI8A 2OKCA 3AVTA 4RTSA 2ZTVA 2B7LA 3F67A 4CKBB 1GSIA 4IWYA 4V1CI 4W9NA 3FCEA 1KO4A 1ELOA 2H2AA 4HB3A 5BN4B 1VGRA 3F3KA 3CUSA 3I2IA 1OFUA 2WD9A 2L2QA 1Z4OA 4MARA 3UICA 3W5JA 3FRIA 2MSNA 4TMWA 1ODKA 2CJWB 2Y1GA 5JNTA 4AQYB 3ENNA 3WGKA 1VMEA 1SXGA 2X5XA 1OV4A 3IQGX 5KU7A 1G291 4EG3A 1IPFA 5ERGB 3B3QA 2Z0MA 1FSZA 3U37A 4BRUA 1F0NA 1YAJA 5ESDA 5REQB 3AKYA 1NBMA 3R0JA 4P4LA 3AI2A 3OLVA 5LYJB 3OHPA 5G4LA 4OQPA 1RABA 1N2CE 1DIHA 4LF8B 2RARA 4CTKA 5A9SB 1B0ZA 1E2KA 1S3SA 3CLUD 4QYIA 2DM6A 3BG5A 3JWPA 3VO1A 2JAQA 2P90A 2XUAA 4EJ2A 5AVUA 1UDAA 2C84A 4B3IA 1JKJA 1UMKA 2JD2A 2OAQ1 2ZRHA 1E0KA 4OL9A 2VHUA 2Q0HA 3G6WA 3OH8A 3NT5A 1EWTA 4L72A 1HETA 2HMUA 3ECSA 1H94A 2BEKA 3BXXA 2JGFA 4TZTA 3JAKA 3RU2A 1TX4B 4XCVA 4DXDA 1XA3A 4CFYA 3AKDA 3B5IA 1OH5A 3ZJVA 1BS9A 3R5XA 4BNDB 3LU1A 4MS3A 3UGKA 1BRMA 4YCMA 1L4EA 1M7BA 1W19A 2OC4A 1GIAA 5GOZA 4P7FA 4MWCA 1ZI8A 4QJ4A 2IXBA 3QUTA 5K8LA 1UKAA 1R8YA 1DEKA 1U2EA 2HTEA 4BLWA 1LPPA 2RGCA 3IPRA 3OZCA 3C3WA 3LDUA 5K8UA 2P4SA 3PHJA 1CE8A 2I33A 4KXUA 2AI2A 1GEEA 1QM5A 1XFAA 2C2WA 3PEYA 1IY8A 4IIJF 3DZJA 4O4LA 1ZCZA 4HMQA 3FE2A 3MGCA 4BP9A 1K1EA 3T5CA 1N2GA 1E9FA 2ZJOA 4S1PA 2VDRB 3AF2A 4YDHB 4EPRA 3P2KA 4OJKA 1TAHA 4IVQA 3DD1A 3HR4A 3TR5A 3NM5A 4DVGA 5JXWA 5CGQB 3LX6A 3MWEA 3CH7A 5DULA 1J8YF 2N0SA 1FBNA 1HURA 1REQA 5IAJA 3DCNA 1XQ1A 4DR3B 3BZUA 3ZZNA 1JSXA 1BAPA 1RYBA 3EXHC 2FR1A 4ZTBA 1KDYA 2PMCA 4EEZA 2OZEA 1MA3A 2VNIA 3HUDA 3SYMA 3X1JA 1DDGA 4U7JA 4V3BA 1H65A 1KR5A 4XYBA 1N2CA 2HCFA 2JAWA 4ZDWA 2BD0A 4U7PB 4MVJF 4XB1A 1T5BA 5CXXA 1ID1A 4HDKB 1K2WA 1XHFA 2HQ1A 4LDZA 4Z9BA 2I62A 5EIEA 2ES4A 3BE6A 4D8XA 4NBUA 3B1VA 4X1KA 4ZJYA 3PLAE 3F97A 1PLKA 3I2HA 2BF4A 4HZUB 2CYCA 1FPMA 1II8B 1VJ0A 2Y1KA 3CJRA 3PD1A 5FPHA 4K1LA 4ZMSA 5KNDH 2VZEA 4HNAB 1WZIA 4IVRA 2RFLA 4BEJA 1Q22A 1GDTA 1QH1A 3D3WA 5DIFA 2IOYA 3W34A 3R75A 3K6RA 2C7GA 1U3WA 1UODA 5GONB 4MP3A 3QSYA 2HRZA 1DJNA 1OJLA 2BE9A 2HOQA 1RXCA 1MEOA 2WV9A 4J6FA 1Z37A 3N7AA 2XZLA 4EATA 3K9FC 3AUKA 3JQFA 3PJFA 4QUEA 1MFPA 2X2FA 4YCBA 2KSQA 3PNQA 3PX7A 2AZXA 3VA7A 2AF3C 3IKLA 1WSDA 4K26A 4ZV7A 3WLEA 3VZRA 4BO9A 3L40A 3STTA 3QV2A 4FYWA 5EUCA 1V16B 4KU4A 3A3PA 3AEZA 3TW8B 4BNKA 3SOZA 3BJIC 1HT2E 1M6YA 3CEMA 3DZ8A 2YWXA 2Q1WA 3B6ZA 1S4MA 2XGSA 4OJYA 3IUMA 3QNMA 2GQ0A 2AE2A 1PZXA 3BMOA 4YRCA 4ZAFA 4F2PA 3E8MA 1P5RA 5K51A 5T41A 5GTDA 4J1TA 4ZALA 2PKWA 4DLUA 4Q3LA 2GBIA 1KR2A 3N0RA 2PX3A 5H68A 3HKEA 2FG6C 4CT5A 5AI6A 5JJLA 1Y6QA 2ETXA 2OT3B 3H8JA 4PHGA 5CGZA 2ZUFA 1E1YA 3BFJA 3ZHZA 2JAPA 3WWPA 1IHDA 2OYCA 2DBRA 3ZGOA 1QOZA 1NUSA 2Q4RA 3ZY4A 2FWNA 4FHEA 4WFJA 2V3CC 3H2BA 4EHDA 2EFGA 5A4MS 1PYGA 1GAEO 2UZIR 4CNBA 1KFJB 2V74B 1NUHA 2BBSA 4LBWA 4ZWNA 3SC2B 4C6SA 2AQKA 2YN4A 3KYCA 5E95A 3AHGA 1VG1A 1B26A 3TRDA 2PWBA 4UUBA 4UNRA 3TNDA 3MWLA 3W7BA 2QJOA 4G4GA 3UMSA 1M6HA 5CDUA 2QV0A 1J8VA 4A2PA 2OG1A 4INAA 4EPTA 3LJKA 1KPGA 1ZVJA 2FW9A 1X9IA 2G5TA 4ZVLA 1PK9A 4MV0A 4QYWA 5FL7D 3UMGA 1IWOA 4CMEA 2I7VA 2V65A 1L8OA 3WO1A 2JZNA 3SM3A 4G26A 5H59A 1CVIA 1JHZA 1QHSA 3BWXA 3ZHOA 5KIAA 4XIYA 4ZICA 5G3ZA 1L4NA 2VA9A 2AR9A 4BMVA 4FFLA 4QZVA 2EP8A 3QHQA 3BRWA 3NNNA 2QTVB 4X41A 1X1QA 4XSVA 4HH4A 3UAXA 4B6PA 1AIPA 4H0CA 4LJKA 2R6HA 5JS2A 1CERA 4L5YA 1ZC4A 1RM4A 4Y1GA 4D5EA 1EEXB 5EN4A 4BO5A 4KYUA 3VHQA 5C8YF 1XNJA 2K2QB 4TL8A 2A30A 3DOIA 3H04A 2FHSA 2A84A 3CNHA 4M76B 1MJ5A 3SZRA 4X9XA 4IP0A 4P7KA 3K1TA 3HJBA 3H3JA 4OXNA 2F1KA 2PMWB 4RK6A 5E9QA 1ORWA 4MSUA 2HWYA 3EZXA 4YWHA 5T4EA 5DCWA 1PUJA 5FYQA 3TUZC 2RAPA 1XXHB 1XTBA 3GBSA 1VSUA 1PX2A 1XP5A 4FFNA 5I4IA 4DABA 3N07A 3ZD9A 2JHGA 3AESB 1W7AA 4CKWB 2W2OA 1JG1A 1P4GA 2WRZA 4DG8A 5L8VA 4GD3Q 1M6EX 2H4XA 2YWHA 1TJ4A 2IXTA 4Z0TA 5HOEA 3A1EA 4V0ME 1B8NA 3L0SA 4P5DA 5EEHA 1ULSA 1W49A 1U2SA 3CXRA 2DFPA 4IDGA 5AOAA 2CNDA 3H86A 3JQGA 4BNDA 3UHAA 2LKCA 3WIBA 1KYWA 2QRZA 3V4SA 3AT1A 2QTHA 4PGAA 2GGSA 5CFPA 4FOPA 1XZNA 5KNDA 3QPCA 1MO2A 3EZLA 3P0IA 1KH3A 2AMLA 3PXUA 4YPFA 3QE3A 4B7XA 2IEAA 3U56A 4ZCMA 1A9TA 3RSHA 1AZLA 5EKSA 4OCZA 1U0SY 4F8JA 1VG0B 4M0KA 3AUAA 1Z6AA 2REQA 2I3BA 1JHMA 4WJZA 4MLCA 4ZC8A 3VNQA 3WWDA 4A0FA 4H1WA 1P33A 4GVPA 4JT8A 4K9LA 4DLKA 2F3QA 1HEYA 2CUNA 3L6RA 4J0EA 1YJCA 4MI9A 2FMKA 3RFUA 1ZCBA 3JQRA 4GO1A 1L7AA 1C3EA 1UC4B 1L5GB 4UULA 1NLMA 3UV3A 4C0XA 1ZVKA 4J7UA 3CE6A 3CWQA 4XX1A 2CLLB 1RVV1 1SUWA 4Y9DA 4X64B 3AR4A 1PK8A 3OLYA 3PVCA 2PL9A 4AMVA 2X9LA 3UXMA 3ZQUA 2A5JA 4MI3A 4Y0VA 1A50B 4ZI7B 3VPDA 2X6RA 1EBUA 4OQDA 4E6EA 3WK9A 2GCOB 1N2CB 4HNGA 4I36A 4FDTA 2Y27A 3CYFA 5K3OA 1RWVA 2Q45A 2NUTB 4ALIA 1I0IA 2Q9UA 3RUIA 2OZKA 4PZDA 1EZ4A 3BGOS 4HDKA 2VF2A 3RRFA 1EGQA 3W5BA 1YONA 2QUIA 1PHRA 5K9ZA 1RAEA 1EWQA 2E4YA 3L0BA 1IY2A 3T9DA 3U1TA 4S35A 1HA3A 4GPBA 4BHTA 1Z4KA 3S5JA 5J63A 1U1FA 2QZJA 3WL6A 3ZWMA 2JJ1A 3AY6A 1RLIA 3QLVC 4PX3A 3D6AA 3VR5H 4FSXA 3VM6A 3PHGA 4NEGA 2A0YA 1YBHA 2ZIAA 4U0KA 5IG2A 2IF0A 1VRCA 2GAIA 2VTDA 2ZRNA 4E5DA 3LFHA 2GF2A 3CTMA 3KJFA 4L6IA 2OCYC 5I9TA 3UJBA 1P19A 2Y2UA 3C7TA 4F21A 3U3DA 1PN3A 4MWGA 5LDDC 1MJFA 1U3TA 1X70A 3K94A 4HAIA 5HQ3A 3HB5X 3L2OB 1B16A 1R6XA 2ZDQA 5E7IA 5ELMA 1JE0A 2IYRA 3OQVA 4JOBA 1G4HA 2CL0X 1OHHD 4NYMQ 5JZVA 1EVQA 2JKZA 5TIIA 1TLTA 3VHRA 5P8WA 1TW3A 1GZ7A 2QUJA 3R40A 2CF5A 3R6DA 2WTEA 4K6GA 2EERA 2HH9A 1H93A 2XMQA 5CLHA 1F48A 1O6GA 5F78A 5FUWA 4GMKA 4XIJA 3T3DA 1M3SA 1YDGA 5AW1A 1CR2A 3DEZA 4E88A 4IINA 1WCYA 3QUQA 4P08A 4QXQA 4L02A 1IDOA 2ERCA 3EDOA 1VIDA 3ORYA 1LPOA 3HQ4O 3E03A 4DILA 4DWVA 1PGNA 3Q3JB 5CNIA 1ZM4A 2J6BA 2Z8XA 1JA9A 3MWDA 3NO4A 1G3UA 4HVCA 2ROQA 4WZAE 5EFOA 3CH5A 3D8NA 3K5PA 1BWSA 4YJGA 1RC0A 3KD3A 2RG1A 4R3UC 1Y82A 4P81A 4ER7A 3QI7A 3EIWA 4CF6A 5I7EA 4FE4A 1KI9A 3P8ZA 3GD7A 2VEDA 3N28A 1Z5ZA 3F98A 4ZXFA 2IUEA 4Q1BA 1W73A 4OLHA 1Y34E 1M34B 1TK9A 3BSFA 2OCIA 1W85A 5AM0A 3FVTA 2DZDA 2AK2A 2XRFA 2XVZA 2EKPA 3FF1A 1Z5VA 1JHAA 1NQWA 1QHIA 1ZSVA 1K8RA 2WJAA 4QXRA 3MEQA 3FOEC 5COQA 4HBGA 4IICA 2DCUA 1YL7A 2Z4RA 4RPKA 4XJTA 3V97A 5E6RB 5K45A 1NFQA 1T8WA 1D9ZA 3DL2A 1ZRNA 2HXGA 3GHYA 4I1SA 1G3MA 1UC5B 5CAEA 1UXIA 1U2ZA 3RWMB 3PQ7A 3LA8A 2FE1A 4H18A 1DELA 3L0ZA 1SB9A 2ZRIA 3AEUB 1F8YA 3GFFA 3FDXA 3U44B 1TJNA 3K73O 5BURA 5E8RA 2ESRA 3DBLA 1CQIA 3WZLA 2G8LA 3GGCA 3GLSA 4DMUB 2WP0A 5D87A 3P9NA 2E87A 2QD1A 3IP8A 4P3NA 2BKXA 2VQSA 1YB1A 3DHWC 3MQ2A 4DLAA 1WBDA 1W8DA 3C5HA 4KL8S 3AWIA 3ONFA 3PPWA 1S3GA 2BVNA 4Y9RA 2LDXA 5GZ3A 2P2DA 1W30A 4Y67A 4ABYA 4IZOA 2H5LA 5ELLA 2QTAA 1UANA 3VDNB 2ZVPX 3REGA 1NXTA 2XW6A 2W6ID 1Z0UA 3FW1A 1DX9A 5HIMA 4B6JA 1N3YA 1USVA 3DYVA 3K96A 5FAKA 1G9TA 3PXCX 1JMKC 4C4YA 1BVHA 3ZK9A 1Y3AA 3EDRA 2YOFA 4Y8VA 1SUBA 3I01A 4GOXA 3SBDA 2JLWA 2G1AA 5CK5A 3J7TA 4DLXA 2WHEA 5JQGA 4HLNA 4QU9A 3CHYA 5DZSA 2PVCA 1Z74A 3L7YA 4QDUA 3KXDA 4KK3A 4GR4A 4V2IA 4ZEWA 5KSWB 4BNTA 3W9BA 1N75A 3TPCA 2QG6A 4DEXA 2HCRA 4P2BA 3I42A 4BO1A 1MC8A 4DNFA 2IHBA 1RWXA 4ZAWA 3TLJA 4AKIA 1C9JA 4C7KA 4C7OA 1QFSA 4GRAA 1DHTA 2FPMA 3HCOA 3W05A 3ZLTA 4CQLA 2R6AA 2WPDA 5A7HA 4BB5A 4LJ7A 1E5QA 5E2IA 2G67A 1NOKA 1HT0A 4UM5A 5JNVA 4E94A 2W00A 4RETA 1EBBA 1KI4A 2XBUA 4LJAA 3AF5A 2OQVA 1KKMA 2PUGA 1ORDA 4NDZA 1FUUA 5KJ6A 2L18A 2YFHA 5IPFA 1E2PA 1NVXQ 1H1DA 2EVWX 2WF9A 4Q3OA 2QSJA 2RGWA 3PQ6A 1KEPA 4JMLA 3CY6A 4L95C 1DX6A 1WD7A 2VHYA 4M8LA 1NNUA 1T9AA 1LSSA 1SC9A 4QVKA 4Z54A 3FOZA 1DOZA 3KSDO 4IOMA 1RMQA 1A9YA 3LUPA 3OJOA 1D1QA 3MNFA 1R16A 3OPVA 3O4FA 3OF3A 4AJLA 3PLNA 4TYMA 3STYA 4OXIA 10MHA 1MT3A 1QCCA 1VPEA 3JR7A 3AIIA 1J49A 3PT9A 4TLDA 5ALIA 3KYBA 3LBNA 3N9IA 3O4JA 3M9LA 1NLZA 4KMRA 1UPBA 3HYRA 2GBLA 1EFKA 5ALOA 2G5CA 4LJLA 3NEYA 2H31A 3KEFA 3PD0A 4HLCA 4LX8A 4PRLA 2X19A 4HNVA 3BD8A 4BO4A 1ZIOA 1LLFA 1ZISA 1XL0A 3K09C 3PXXA 1A9OA 5IFLA 1J07A 1UMDB 4GXQA 4P83A 1Q0UA 1H3FA 2GJ9A 3C4JA 3ETEA 3HVJA 4I0WB 1MC5A 4B46A 4GC5A 3H84A 3UNXA 4M0PA 3F46A 2H2IA 3KELA 3CXUA 1U3CA 3WDKA 2E85A 4DG9A 3A9WA 3OWXA 4LE2A 1G7CA 1U0OC 4QDZA 4O2BB 3JZDA 2BKUA 4QFDA 1RM5A 4IWXA 3FWYA 1EFRD 3U7QB 3KS9A 2ONYA 3M70A 1GKLA 3BQNB 1KYXA 2WJYA 3NEAA 4J0JA 5HQ3B 4NCNA 2W48A 1BX3A 2FYTA 1KQPA 1MIOB 4ILEA 4Y2GA 2JK1A 4H7HA 1DT5A 4Q9LA 5ALMA 1EM6A 2V3VA 3X44A 3WKAA 4NYJR 3WSWA 4TKVA 2KW5A 2CCJA 3R9WA 1NAIA 4HWKA 2VRNA 4MQ6A 3SQXA 1JF8A 4DV3B 3SKYA 4FZVA 4MS1A 4UAJA 5BW8A 2D13A 3T5BA 2KWIA 2BEJA 2LGJA 3K9HA 5H0IA 2O2YA 5F21A 3RSGA 2QRKA 3FN4A 3SDSA 5DTRA 3IO3A 3FR7A 4LDRA 3MWDB 4LMAA 2YOHA 4RH0A 1CY0A 2I87A 2IIBA 3COPA 4XAQA 4QTTB 4CKEA 2PO5A 1HPLA 1P6UA 4Y1RB 4BMOB 5HKAA 4TM7A 3RU3A 4ITUA 4DIMA 5JIBA 3LUDA 1V6SA 3PEEA 1OXUA 3MAJA 4O4JF 1IOVA 1H8HD 3HJAA 1X7ZB 4LOJA 1CT9A 2YV4A 3EPPA 1G9SA 1V8OA 4F9EA 1PI3A 2C7VA 2BI4A 3TQHA 2QX7A 3R6LA 4H16A 2UU9B 5NULA 3CZQA 4KJZA 5IULC 4IIEA 1QB7A 3ZWCA 1GOTA 3CC8A 4F86A 3JQAD 4BATA 1BZYA 4E5NA 4KBFA 1AA9A 2I91A 5AW9A 2QN6A 3CLTC 3QOXA 2J46A 4FOLA 1GG8A 4MJXA 1LFDB 4WDQA 5SICE 2INGX 3PGXA 4YGXB 1C80A 4YP6A 4BV9A 1DIGA 3GEHA 1I4TD 4HKTA 4CU2A 1KWKA 1OB5A 1E99A 1N1DA 3SMVA 2AMYA 2ZJ7A 4NJOA 4XVRA 1VSVA 4UW9A 2GILA 4KQGA 1XJ0A 4PQFA 2J5BA 4CT0A 4LZOA 1JU3A 4INPA 3UYKA 2ID7A 2PSJA 3TSAA 2H1VA 4G5HA 1MRNA 3DBOB 3ZDEA 2YINC 5DB4A 5H80A 2CY0A 2AI1A 4C0WA 3I2GA 4Q34A 1XMXA 1GPAA 3B60A 1NU6A 2GZ3A 5G0VA 2VPIA 4C3UA 2GD2A 5CT4A 3CEAA 3HI6A 3G0CA 1B8OA 1BCRB 5KQSA 1I14A 2ZULA 5L7TA 1X7DA 4O59O 4E5UA 2ZBRA 2IE0A 4YT2A 2I5PO 3I4CA 3CCCA 1PR6A 3VU8A 1G8YA 2HLDA 4AWBA 1YNSA 2BL4A 4K9KA 3W1WA 1RMYA 3IX7A 1JNXX 3UT5A 5HTOA 4IDCA 3B51X 4WNCA 3RARA 5CB0A 2AQ8A 3WB1A 3RTBA 3OQOA 1R3UA 1TAGA 5JYCA 1E6EA 3RQIA 1J21A 2OHOA 4YCCA 2IHTA 3NDPA 3WGNA 2WUVA 5AW3A 1Q17A 1IG3A 1KI3A 3JWIA 1R2QA 1H2ZA 3P9SA 3S1AA 4WFKA 3LUCA 4AIIA 2FW6A 3SYRA 1C3OA 4Q66C 4L5AA 4K1XA 4CFSA 2QE7D 1CDOA 2HF2A 3JASA 3OPXA 4TLCA 2IYSA 4NL4H 5DBGA 4D57A 5KNCD 1ULTA 1CJKC 4F6RB 3GMDA 2QPOA 4AZWA 5EHZA 1E3QA 3SQNA 4D26A 1OT3A 2ZUEA 3VJRA 3AF6A 5L3RA 4P4SA 5FWAA 3TTVA 4ZOAA 1RXYA 3ITNA 4Z4EA 2CDRA 4E3WA 4MW1A 2PXXA 3LPLA 4XQ9A 1HRKA 3ICVA 4LJ6A 4ESHA 1XU4A 2CJYA 4FMDB 1G5TA 1CW2B 4YAFA 3ORRA 4WNIA 3AC0A 2C7QA 2F8MA 3IRVA 2B4YA 1TYEB 3WBKA 3Q8WA 1JAXA 2J9FA 1PR9A 2A9VA 3HFRA 4LOKA 3MXOA 4N6GA 4E5PA 1NKVA 3N7TA 1B3BA 3EXFA 3OWHA 2D8MA 3OLXA 3QBEA 1DV1A 2CVFA 4KYTA 1K7CA 4WZBB 4IIGA 1NJ1A 2QIPA 1HDOA 4XASA 2FCRA 2UZ3A 1DG3A 5EC8A 2F1HA 3TOZA 2YDYA 3L84A 4N7MA 5IJXA 4F6CA 2XA9A 3E5RA 5CT9A 1G8KA 1NSFA 3NXSA 1YULA 2W11A 1ZA2A 4LDQA 4XX0B 3VAZA 4LZLA 3MJRA 1BHO1 2J4FA 5HP4A 4MULA 4YJHB 4LWZA 4N3NA 5ITWA 4GBED 4AN1A 1ZH6A 2JIZD 2NPIA 4JBWA 1XE3A 5IKEA 3D5TA 4GUAA 4IJWA 2UYHA 1XTPA 3QVWA 2MU1A 4UMEA 4YIKA 5LP1A 3KT0A 1WPGA 3KQTA 1QNLA 4PO9A 4M53A 3ZGNA 1X1BA 1HQYE 3KQYA 2AKYA 5EE9A 4JYPA 1OC2A 1R5OA 4MVYA 1YCHA 2CLIB 1X39A 3D5EA 3K9CA 2PBRA 3CN9A 2AG6A 4FMCB 1AKYA 5CXUA 2D59A 2PMKA 3DKPA 3OLWA 3OSZA 4EJMA 3L9WA 1QHNA 2PKEA 3EIQA 4YDSA 3U3MA 4D45A 2IEDA 1YACA 4DXHA 3LFTA 1H8HA 1ZHHA 4XB6B 3QHAA 3BVPA 4I4NA 2DLCX 2VHTA 1DBWA 1U81A 2OFWA 3F4LA 4ZI2A 1BNCA 4WN9A 1TKAA 1JHXA 4UEKA 5FUYA 5HEKA 1JR3E 4FYVA 4A03A 2BH2A 3EULA 5FOTA 1B1CA 2WAAA 2O8CA 2PV7A 5CNJA 1W36B 3CRW1 1T8TA 2XPCA 3W06A 1MIOA 1FS6A 1BG6A 2ET6A 2FETA 2JHFA 1QYIA 3A58B 3ORHA 4NDNE 3TXYA 5K20A 2IJGX 3C3YA 3JYNA 3PC6A 2HMWA 5J3JA 3EIHA 3L7BA 3PXBA 2XQJA 3GROA 2F43B 3OEEA 4FLMA 4PRYA 4H7DA 4M37A 4RMHA 2NZVG 2ZUWA 3JQ9C 5IYZB 2FMHA 1T6ZA 1P77A 1T0UA 2IHKA 2XZPA 1DEXA 1UPFA 3D7KA 2BMDA 1P61B 3FLAA 1J1UA 5A5GA 1EP1B 5T7BA 2DSNA 1X8KA 1C9DB 3CZ4A 3T4XA 1MABA 1FP7A 4DIDA 1TK3A 3TW0A 4P0TA 3BMNB 2OXCA 5M7EA 1NW9B 4EH1A 4BKPA 2WYOA 3ND8A 3KZVA 3S2IA 1VLJA 2D1FA 4H6VA 5FF9A 4DV6B 4RBNA 3BQMB 5I7VA 1CWUA 2VRWA 4L4XA 4TMXA 3L8CA 1SAYA 3WTBA 1RZRA 4DR1B 2VFAA 1QV7A 1WCIA 4Q7QA 2O3JA 4YAUA 3MRTA 5FYDA 1YD7A 2YXPX 1G5FA 4BAZA 3EIOA 2FWJA 4QASA 3W9UA 4DWWA 2PT7A 4L5CA 3EZ7A 4CIXA 2ZCVA 2PG3A 4ZN6A 4U0JA 4H7JA 1JHPA 1W0JD 5EJ7A 4CTNA 3BD7A 4UHBA 3DBRA 3NQ41 1SVUA 4G4IA 1EYZA 1BX1A 4M99A 5DTEA 3PWKA 4WVFA 2QLNA 3O3MB 1PT5A 3JW8A 4MVJD 1INLA 1Y7LA 3AUUA 3HCEA 4P2GA 4NBKA 2Q1YA 3IXQA 4P7GA 3S29A 5JDCA 2WI8A 1N2IA 4BRZA 2B94A 3RIEA 2YWEA 2D7CA 5EJ9A 4HB2A 4UFPA 3D4LA 1FNSA 3FBWA 3FWKA 1XMPA 3T1TA 4G4JA 1RYEA 2RBKA 1E89A 2WSMA 1C9EA 3W90A 3CJTA 4L9WA 2VAPA 3C15C 4MW2A 4ZQGA 2VP6A 3VAAA 1VKRA 1W5FA 2XSZA 3NJ8A 3HY4A 5IARA 3GNQA 4HDRA 2J9RA 1W4BA 1KZGB 1XF9A 3ROXA 3SYTA 1Z18A 3NDIA 2JB9A 2JH8A 3S7ZA 2BGMA 1E69A 1ZNWA 5HWSA 5JMTA 4RLHA 5LU8A 1GZ3A 3E61A 2VTBB 1OH8A 5KYGA 1T0HB 4NNJA 3I23A 3OF2A 5BUCA 4X45A 2E2WA 4CLEA 5FPPA 4Z1MA 3EVGA 1PNRA 2BLLA 3FKJA 3UQYS 5LXTA 4JSYA 1P2TA 2FJUA 4RIEA 4UEWA 4XPIB 2YWRA 2G5GX 1M74A 3UT5B 2WKWA 4DR6B 3DHEA 3W2HA 5EWJB 1VLVA 3V5NA 3C4QA 1NJSA 4NCHA 2O9JA 2O5RA 2VQDA 3ZWBA 4KXLA 2BZ1A 1E9DA 3E8XA 1VOTA 5D7NA 4YI3A 1PD0A 2VLIA 3O1LA 4YA6A 3U7HB 1G1MA 5K8TA 1E64A 2TMGA 4BFLA 2A5FA 1HDGO 4J76A 4U6QA 4UATA 5J4YA 5LD2C 2QU7A 3DE5X 4HCJA 4HYEA 3SQWA 2IYXA 1G6OA 1RSZA 1O54A 1O97D 2C2XA 4B33A 1TTPB 3GFTA 5E7JA 1APBA 1FFBA 1G5PA 1P7VA 1TFUA 4X92A 2HT1A 1FZTA 2XE4A 1ECPA 3BMXA 3JASB 3R7SA 4ER3A 4RTLA 4IQFA 2IP1A 2OUIA 1XCOA 3HB0A 3FSGA 2A4MA 2QS9A 3I52A 1WD5A 1YE5A 3LVBA 1G8SA 3N5KA 4Q4JB 4XWGA 1L4MA 1T36A 4C01A 3KL4A 5B1EA 2VK1A 1C0IA 1QE3A 2RH8A 4MIEA 3ZWQA 2PD4A 1I3KA 3U09A 1MNAA 2W22A 4X97A 2WA2A 5IHPA 3OTWA 4R54A 4L16A 1QKIA 1J6UA 2HLPA 1ND5A 1BHJA 1UKEA 2HGZA 2ZIGA 1CY2A 3A9RA 3MBOA 3Q7TA 4M1KA 2HNBA 3SM9A 3ZNQA 1LRJA 2OFOA 4YRSA 1QP7A 1BU8A 2JASA 3IUPA 3V2HA 3ZQJA 4EVRA 5F7XA 3OAAA 2IC5A 3BDVA 1XD2A 4HXYA 4KR6A 4GF5A 4JYMA 1USUA 2QJTA 4OO3A 3D7SA 1P9RA 5I4KA 3K2QA 5IH3A 5AT1A 4FC6A 2JGAA 2EBFX 4KVGA 1QGUA 2IEBA 3V48A 2RJNA 3HHPA 4K9OA 1MPXA 2E3JA 4RV4A 5U4QA 1F2DA 4AZ3B 4XX0A 5BNTA 4JNKA 4TPKA 2CV1A 1EX9A 3Q0IA 1Q21A 4YJHA 3OCUA 1U7PA 3E7XA 3N0WA 4GX2A 1SUFA 3C1TA 3GLHB 4K28A 4B48A 3T5MA 3SOPA 1ZL0A 4GE0A 4PXAA 5CP8A 1UDWA 3LFUA 4EABA 2VEOA 1RJWA 4W5WA 2VDWA 3B7WA 1VE1A 1W94A 4NZ9A 5BWMA 2P2CA 3EGVA 3KKKA 3OQ6A 1EH5A 1W0KD 4MUXA 2WSSA 3HUFA 3PC7A 1QE5A 3UYLA 2Q4DA 4ND4A 5F5LA 3WL4A 2CNWD 4Q12A 3FNEA 4N39A 5ALWA 4H7FA 2YICA 1ZEMA 3EUEA 5EP4A 1WBBA 2VYVA 1NVAA 4K9PA 4F4HA 2QYHA 2QI9C 3E9DA 4LTDA 3MBIA 5BWOA 3THWA 1BW9A 3V4FA 4I55B 4WKPA 1G5RA 5AXDA 5DYTA 4DLLA 4RFVA 3NHRA 2D2EA 3LXRA 1P0FA 3DZIA 5G40A 4KQWA 4LTNA 3EE6A 4PIVA 4MYSA 4ARBA 5IUNC 1XF1A 5IANA 1PR1A 2J5KA 4MKIA 5A4IS 1ONSA 1OWMA 3IKMB 2JIDA 3UCFA 3L8YA 4HLQB 2G9RA 3WMXA 4C7VA 2AEFA 4DIOA 4GM0A 4C76A 3NTXA 4II7A 1A7UA 4TRMA 5KAPA 2NYUA 1SWWA 4JX8A 4XGKA 3ROGA 3U0BA 5B3JC 1E20A 2PGXA 3JCZA 3OPQA 5B7PA 3BPSA 1NRWA 2ZIXA 1JYFA 3GB9A 4KQEA 1ZQ1A 4HDNA 2VAXA 5HA5A 2XIJA 1ABEA 1UC9A 2R97A 4KLRA 1N6RA 1HE4A 3SSOA 3BMNA 3VO9A 4BNHA 1I0ZA 1ODFA 4RKQA 3VSBA 1YR7A 3WRVA 5LMUB 1D2HA 2OY0A 4R0VA 5AJYA 1TU0A 5IWAB 1NG1A 3O8DA 3IE2A 1WF3A 1E2MA 3T3GA 4MHTA 3AJ8A 1NVDA 4ITVA 2H08A 3C45A 5CLJA 3CISA 3RTAA 2J9GA 4XD7D 1QF6A 2G83A 4LRXA 1CZRA 4X85A 5FOVA 1HNXB 3ECAA 2C5FA 2YDXA 5DIZA 3T52A 4R8KA 1MKYA 2CCKA 3OJFA 5AI5A 2B61A 2VNKA 2OE2A 3B7GA 1WXIA 2VSYA 3CEJA 4MK4A 1Q3TA 3QU5A 1L7NA 2GZSA 3OY7A 3HU5A 4U7HA 4BQSA 2IQIA 2CDAA 3KKPA 1ZXLA 4ENWA 5JJ5A 1PBTA 4HGYA 4J9VA 4R1NA 5ENZA 1Y98A 2FSPA 1TL7C 4Q1FA 1E7WA 1CP2A 1FQKA 1IUOA 1L7OA 3UFBA 5CT6A 5JTUA 2WUFA 3ETGA 1EM8A 5CHEA 3KX2A 4HQ6A 2PAAA 3GGSA 5FAXA 3W2GA 2HZ7A 2WVAA 4O29A 3L4EA 1KOLA 3UV7A 2IXAA 1V0JA 3PTLA 5DXJA 5LKRA 4ZYLA 4QKQA 1W1WA 2ZWPA 2CEKA 5HGXA 1J2UA 1PHPA 3ZHBA 1JIQA 1JEQA 1QVRA 2W2QA 2YFKA 2HU5A 3H0CA 4KWIA 5CLGA 4X54A 4IMPA 4O4JB 5E3HA 1AT1A 2P79A 1W9MA 3V8QA 3DAGA 3VC1A 1F9EA 3AY0A 3GCDA 4BNWA 4MUBA 3NBXX 2PS3A 3H99A 4XWWA 2XT0A 1R74A 4KCGA 1P4JA 2JLUA 2G80A 2VJQA 4HMPA 4JYZA 3EAGA 4BX9A 5K4GA 2BBWA 4XD7A 1ENPA 2C5BA 3RGWS 2VOEA 3DZDA 4PYRA 4TQGA 1AJEA 5CIQA 1ZJ5A 2D5AA 9ATCA 1WETA 1WXWA 4RVUA 4QHYA 4CL3A 4JELA 5GWXA 4ZOEA 3I09A 1FDRA 3EOBI 4NE7A 5GQSA 4D9EA 3CIFA 4BBPA 3OM0A 1JQJC 2MHCA 2PQMA 1O08A 3CX4A 2HHAA 3BAFA 4JLJA 1SUPA 4MV7A 1TIBA 4EGAA 1OD6A 5DYNA 1ZD9A 1IIBA 4G0OA 3DP7A 4X1OA 3H4IA 4OHUA 1TO1E 1U02A 3F74A 1AXRA 3C8UA 3EGXA 2DKOA 2DQ4A 1GU1A 2CLEB 2W4MA 4ZKDA 5AQ1A 1MX1A 7GPBA 5KYWB 2FSUA 4OQNA 5CXQA 1R5NA 3NWEA 4JH0A 2PGLA 4DANA 2GEFA 1XA0A 3ESRA 3FPHA 2BGIA 2COUA 4ZT6A 3TOVA 1KMHA 8AT1A 3I6YA 2W2KB 2G17A 5TNXA 4W1RA 4IDQA 3G02A 1PS9A 2WQZA 3MJSA 1EE9A 4NDAA 4TMKA 5KTYA 1IDN1 2APJA 2ORYA 4NQZA 3HCNA 2IYUA 3ILHA 1GPKA 1KNQA 1P80A 3GJQA 3FMGA 3PIIA 3L6BA 1O77A 2FPIA 3DEIA 1PIWA 4DARA 4A82A 3HY6A 1EESA 1SHKA 1X3SA 2HD4A 2O1EA 1SCUB 1XZKA 3A6ZA 4UVDA 4EJSA 4EVSA 4BMCA 1KQ3A 3K0AB 3N0TA 2O2GA 5LC1A 1E6KA 2Z3ZA 3Q3VA 2QJFA 4D6PA 1J4AA 3G2NA 3K1ZA 1BJKA 1SBTA 2A0FA 3W5CA 1TVKA 3FGNA 4LYFA 1MTZA 2WEKA 2Y2VA 1JKXA 4O2AB 2H1SA 1AO3A 3K35A 4TSKA 4WINA 1V1MB 2CZQA 4K6OA 4WK6A 4QDJA 4QEKA 4HSEA 4UBJA 2QP9X 4HT3B 4HEA1 1YZKA 4QIHA 3DMRA 2BKVA 1K63A 4JAVC 3IXLA 5F12A 1XZIA 5KOHB 4Z3OA 4BO7A 1XMOB 4RXMA 3AUXA 2J5XA 3M4NA 5DT9A 1LC0A 2SNIE 1F2UB 1TNDA 3I0ZA 4OD0A 5BXYA 1TGVA 5CVDA 4TKUA 1PSZA 1UFVA 5IDYA 3WQSB 1DCKA 1RJEA 4RDCA 3WISA 4UE3S 4OX9B 2O3QA 4GMDA 4NCXA 3FTNA 1FDOA 2PGIA 4H3SA 3GP8A 5DK6A 5EP2A 1E0SA 1K27A 2BF7A 1SHZA 3GJ8A 2P77A 3ROKA 2NO7A 3STUA 3PE3A 1KSHA 2X86A 1DQPA 3ILSA 1EFDN 4UBOA 2IUUA 4ARSA 1DWUA 2AI3A 3GGJA 3FFWA 4OQMA 2O7QA 2ZBDA 1ZVVA 3SBEA 3ESXA 2R47A 3WB0A 5ALXA 2PWZA 3NGLA 5GP1A 2UVDA 4XJSA 4YREA 1L8LA 5K0GA 3IKJA 3BM5A 3NALA 1A9PA 3SLKA 3IP7A 5JAUA 2AMVA 2C54A 1U3VA 2GXQA 4L0DA 1TZ2A 3G85A 3DL4A 2BFFB 1FX1A 2QF7A 3FKSD 4JVOA 4G41A 1QLWA 5GY7A 3VX4A 1F0KA 1YJXA 2ETVA 4KPYA 1ADBA 2VTKA 4EJFA 3DZHA 2G6BA 4M46A 2VCHA 2FWAA 1RQPA 2Y0CA 3JX9A 1SHUX 3KPWA 1T9ZA 1WY5A 4FHDA 2R5FA 3HP7A 4IHAA 4M0CA 4YMGA 1KPHA 2Q3DA 1C8BA 4FGJA 3EG9A 1PR4A 2R7NA 2N3ZA 3C4VA 1OLOA 1I0LA 3OFSA 1V1JA 2CB9A 1LX7A 1V9SA 3GGGA 2KQUA 3FI0A 4QC2A 4GPAA 1FS5A 5LD2B 2GR9A 3RC3A 2UAGA 5LCXA 3I1FA 4HWRA 4WT7A 5LQRA 4UOZA 4U8HA 3KQNA 3HJFA 2EEPA 1L7RA 4LPKA 3WLNA 2P9YA 2QNIA 2ZKLA 4WOJA 1RRFA 2J08A 1F20A 3IP5A 3R5FA 2ACKA 2XT9A 4CWAA 1M1ZA 1NC1A 4J0IA 3QFRA 4ALLA 3BXEA 4X93A 5E6SB 2NADA 3LWDA 2IYZA 3JQBC 2Y92A 3OJLA 3PGKA 2UZ4A 1GPBA 2ZB8A 4PC6A 4BLTA 2YJ3A 2BPOA 1I4EB 4IIUA 3TR6A 4F8YA 1O95A 1RQ2A 4MV4A 4PTYA 2R7AA 4GI2A 3IB3A 4WGFA 1UKYA 1QP8A 1YQDA 1LPAB 1TJ3A 2CVHA 3K70C 3LWNA 4IJ6A 4XWTA 4R3NA 4UBMA 4HPXB 1UM8A 2XVAA 4RQUA 4GMFA 3WLQA 2E5FA 4L8LA 4R8SA 2CV0A 1ZD2P 1T2VA 2EWVA 3LF2A 4JLNA 2JCXA 2GVZC 4G8DA 4P4TA 3RH0A 2PRIA 3ICEA 1NVTA 4AUKA 1NUAA 2ZOSA 3MUEA 4MYRA 3QOYA 5EZYB 4AJEA 3AR6A 4D3XA 2DF8A 1G60A 5A2GA 3D6UA 1DO8A 4O4JA 1HTTA 4HH1A 3B6MA 3HXKA 4TLBA 3TIIA 3Q8LA 1EHIA 4K0KB 3IA2A 4L9SA 1JLRA 2CNKA 2IYPA 2AUTA 4WFIA 5HDBB 5CPBA 3DULA 1LTHR 2HF9A 1VIAA 2P27A 3FNFA 4F96A 1TPYA 3A8TA 4X20B 5DWVA 2CMHA 3VUEA 3WGOA 1A77A 1GTG1 2FN9A 2GN6A 2Q5JA 3O21A 2AEEA 1WEHA 4WSOA 3ZDQA 4ME6A 5BSHA 2WFMA 3K6KA 1USGA 3QQ5A 4RH1A 4W5TA 2YUTA 1L5VA 3WGZA 2Q6IA 1JILA 1FDWA 5D2CA 1I1NA 3ZW8A 4N4AA 1DAGA 2X9GA 1CNFA 3BE4A 3TOCA 5I4BA 1QDEA 4H77A 1JDPA 3HJNA 4ZYYA 1T8UA 821PA 1JLKA 2R6DA 2GEDA 1XTQA 3LECA 3NIFB 1SCJA 4F9TA 3K16A 1R6BX 5DT2A 3JATB 1SBIA 5DMHA 5JSKA 5I9IA 1GPH1 2FMIA 1SCAA 2ZS8A 3GUUA 4GH5A 2IEIA 4IOKA 2X0EA 4FLFA 1M83A 4BE7B 3EPJA 3TPFA 3NBYC 5AWFC 5J5VA 1BGXT 2WZCA 4KLNA 3WQBA 2QDXA 4ZV9A 4QVIA 2H1HA 1SXJD 1P17A 2Y93A 4RPIA 3UIEA 2UYQA 1G8AA 2P69A 3GLKA 1XMJA 3CUUA 4NBNA 5FCDA 4ATNA 4AJHA 3IAEA 1Z82A 2EW1A 3J7AC 2CL7X 1NVEA 1QH9A 3PFBA 3ASZA 3KB8A 3MOGA 1S01A 4NPAA 1J2TA 4U7TB 5T3UA 3PBKA 5DM4A 4DLVA 1BROA 3MJEA 4BP1A 2A88A 1KJZA 1L5RA 1YQXA 1EE1A 1T0BA 1VFNA 3HACA 3OEED 3WGYA 1P0PA 5TX7A 1NBAA 2G0NA 4AYXA 3RAEC 2GSWA 1HC7A 1BTOA 2POCA 3V8EA 2QMUA 2GESA 4U63A 1E2JA 1Z73A 1DQSA 2J07A 3LYHA 4DCOA 4F6LA 1G19A 4WZAB 3VZCA 4OLAA 2EQ5A 1Q0RA 2EFCB 2R6R1 3SS9X 3SX4A 1YCGA 5IF3A 5K6AA 1POXA 2G9VA 4ND7A 4FKBA 4XCXA 1MHTA 4BFTA 3TX2A 3TTXA 2Z04A 3GDOA 3CX3A 1U3FA 4Y7DA 4WOCA 5T4FA 2VDJA 2PRYA 3S0JA 2R3SA 3VAYA 1FU8A 1JR3A 1RKQA 4DN6A 4FFWA 1Q7TA 4Q4HA 5ALJA 1MV8A 4KX3A 1BS1A 1V35A 1CUUA 2R25B 1DEOA 3D4BA 3TEMA 3A14A 5FTNA 5E1MA 4ENSA 3HZZA 3KT6A 3G5UA 1A2BA 1CRWG 1J0BA 4LK3A 1YHZA 1KDRA 2OFPA 3OX2A 1H05A 3R4CA 3CFYA 3BERA 1RLTA 5EWLB 4AWXA 3KBBA 1WXHA 3JRWA 3LYLA 2BR5A 1XALA 4OF4A 1QPZA 4EL0A 2D06A 2JLCA 3AU8A 4JQZA 2D1SA 3I0NA 4MW6A 1LWOA 1X80B 2XHZA 2XNDA 3KQMA 1T9DA 3T7CA 1NBEA 4M60A 3EVEA 5J59A 2COEA 4XVQA 1EWYA 2VUUA 2O0KA 4HUTA 3H1GA 4KQ9A 1ZPDA 1BWPA 3TJRA 3F8TA 4UXJA 4DSTA 1D8AA 2BRUA 1YBVA 2QP4A 3UJ7A 121PA 5IJ0A 5HIAA 1SZPA 3HGTA 1O2DA 4CKCB 4YCLA 1KEVA 3T0FA 3RG8A 1OA0A 2QTBA 3CNBA 4QUHA 2WVJA 2OBLA 1Z7BA 1UT8A 2CLOB 2I1LA 3ANXA 1ZGAA 3JSXA 2IW3A 3ELBA 4MCIA 5FLYA 3G82C 4V3CA 3VZQA 4EJSC 4CF3A 2GLUA 1SIWA 1S2DA 3F6PA 2XNKA 1NFRA 3IJ5A 5EXDA 3RUHA 5JISA 1KEEA 3ZXSA 4H59A 1XL1A 4AICA 5E3JA 2UXDB 2I4RA 1M7HA 1EUDB 4JEIA 5DV9A 1B6GA 2GVDC 2R7MA 1K08A 1NR1A 4MO2A 1TVEA 4BV3A 1L5FA 1J99A 5DW0A 2AJ8A 5AI8A 4UHFA 4PWYA 2YHSA 4HX2A 3GLQA 3RRBA 1A71A 2X8JB 4XKJA 3GG2A 1DRJA 1C50A 4EF5A 1L7MA 5GZ1A 2XB6A 2C0PA 4YI5A 2L69A 3DMFA 1SKBA 2JAOA 2W4QA 5CVJA 2B6NA 4X91A 3SYLA 5ER9A 3VC2A 3WKEA 3A9SA 3PGLA 1Y6FA 2FW1A 4X44A 3BXFA 1GA6A 4IRUB 2PRZA 2YTZA 3BHMA 1IIRA 2WOJA 1P2SA 5AVQA 1QIEA 3AZOA 5ABPA 4NYIQ 4DB2A 3MINB 2I29A 1YQGA 3VPBA 3DLHA 2EP5A 2CFRA 2X5JO 3MD0A 3MJDA 3VNVA 3PJDA 2QLMA 4BFXA 4ML3A 2B78A 4DC0A 2EQAA 4ZCTA 2CK3A 4FDVA 3HK2A 1XVTA 4RHYA 4M98A 1LWNA 4OHBA 1UH5A 1G55A 3B6IA 5BWNA 4PPNA 1R4MB 3TL2A 3LHDA 4CTMA 1R8JA 4OAOA 3L7AA 1JDNA 3FUVA 4FDMA 4GDMA 4NMXB 5DOZA 2VHJA 4HTAA 1F1JA 1MQ8B 4RTPA 3KHKA 1QIIA 1AN9A 1I1QB 1SA0A 1YR8A 1JKJB 1JW9B 1K86A 3LNCA 4R81A 4C0BA 4E70A 2R8EA 2Q2OA 4G0WA 5EZYA 1K06A 4P4NA 3RV4A 1NQAO 4EHKA 4H0FA 3ASVA 2NZ8A 4M1MA 2B1GA 2NT4A 4F2WA 4JP8A 1A9XB 3V33A 3ESQA 3W6PA 1JQBA 1ODJA 2FLVA 1ZCJA 1X94A 2VBFA 3R7WA 3ZJYA 5ICCA 3O94A 1JWBB 1YT5A 1L6RA 2H7XA 1Z15A 3ER8A 4WZZA 1IATA 4NX2A 1HH4A 4UCQA 2B8TA 2JKYA 2ZYTX 1NMYA 5GV7A 3RYHB 4C03A 2YKGA 2VKTA 3WA6A 4DYVA 1BE1A 4XCQA 4UNNA 2J3JA 4N47A 3RC2A 2GZ2A 4WKBA 1OQAA 1QCYA 1D0SA 3TF5A 3F5MA 1PGPA 4WY2A 3UGJA 1MB3A 5C1OA 1XPRA 5J2UA 5AKKA 2Q6TA 2A7QA 3Q9SA 2GKGA 5DW3A 1IZ9A 3N0XA 4XW2A 1GGKA 1CYEA 4FGKA 2AYZA 3GDHA 4NQRA 3VR6D 2R11A 3I61A 4FILA 5ALNA 3ZGZA 2AS0A 4LBYA 2XZTA 3DW3X 4MKGA 2FWRA 4HUQA 2A58A 1NP3A 2DH5A 1TQ6A 3MJFA 1SIUA 3DVQX 4JFRA 3UT0A 5BR4A 5AW7A 5EIXA 4N54A 2M32A 4RJLA 5IU6A 1EJ2A 4RK1A 1YS7A 3GG9A 3TLXA 4I19A 3QGMA 3KQKA 5JCXA 2ZJ6A 3AFGA 1J7KA 4B6RA 4BC0A 5JDIC 1BEZA 2PT9A 2XUGA 3ZWAA 4BB9A 1MENA 4P3PA 2GX6A 5CX1B 5KWJA 3MT7A 1Z2CA 2Q7DA 5BSGA 5AJUA 5JALA 1PEAA 4FKZA 1II8A 5CDSA 2C9BA 3DNPA 1NUUA 2PIDA 3KZXA 2Y99A 4HNAA 2ZYVX 1K6JA 2W83A 1VM6A 3JVDA 3JYLA 4KQ1A 4PZLA 5EIAA 1YNOA 2NUAB 1CYDA 4BZPA 2GS9A 4Y9SA 4KACA 4WX2B 1CSEE 3VR6H 4W99A 3AP3A 1XZFA 2OP1A 3NDRA 2O8NA 3DC7A 2Y6VA 3L7DA 2PFSA 1PVOA 1NYRA 3KSUA 3MLBA 3GEIA 4LBZA 4P1ZA 2FDCA 3RVRA 1RYFA 1CEXA 2WWRA 2WUWE 2ZIUB 2ODWA 2F00A 3DOCA 1WDWB 1OFUX 3M6VA 3N3BC 5A0TA 4US1R 4B87A 1TMOA 2X15A 3GCZA 3UANA 1GEGA 2BGGA 1X42A 3A1DA 4E3ZA 1DAFA 1X7XB 3TZLA 1HT1E 1ADYA 2M1ZA 4MUHA 1Z7EA 3PWSA 1Y80A 1N6IA 2QN9A 2E4AA 2YNMA 2P7HA 2FFBA 4KO8A 4HFNA 4TWIA 4UHCA 5CFQA 1K66A 1L4HA 4NFLA 2MMGA 1P8JA 2J3QA 1GN8A 4DBZA 1NQUA 5A3JA 4EP1A 3BMOB 2G04A 2I54A 3D8HA 2WJJA 2IT1A 1JA0A 2IXFA 3TRFA 2DT8A 3CLRD 5JSUA 1OBVA 2D0IA 4KQ2A 3FTCA 4M9XA 5ALZA 4YXFA 4AJPA 1A5SB 1AOXA 3H1PA 2XJ4A 4IPTA 3U40A 1IHPA 5JJCA 2PRJA 1C4XA 3VU0A 5FNVB 2H8GA 4KQCA 1GL9B 3OECA 4ACBA 3GW8A 1C4OA 3HBNA 4BYGA 4EVQA 1FVOA 3AVUA 4PC1A 5TSDA 1PJTA 4MP6A 4M88A 4LRSB 4O4HA 1CUBA 2HA2A 4D43A 1II0A 1VJ5A 2AN3A 1QBKC 4YS6A 4EUKA 4YUAA 1Y7PA 1KAMA 5BPFA 2V8BA 1A88A 2PLAA 3GDGA 2WWYA 3O74A 5BWLA 1T0PA 4DQLA 4J0KA 1LRLA 2IPOA 3EBLA 2P7IA 4OHZA 4ZRMA 3LLCA 2QEQA 5LFAA 4MGIR 1YRQA 2ZIWB 4IQGA 4YJ3F 5LZ5A 4EHIA 1EE2A 2TYSB 4FC7A 4I3GA 1PL7A 5B12A 5L3ZA 5JMOA 3I58A 1U0BB 3G23A 5CJPA 1P75A 2F59A 3KHTA 1K5DA 4WBXC 1JPJA 2OEPA 3O3OB 4EO4A 3B82A 1E0AA 3L1IA 1UFRA 3IDQA 3A6FA 3CT4A 5G1PA 2XR1A 3O0TA 5JD6A 4RWEA 3FPLA 1H6AA 1K98A 2XOKA 5K3SA 3ZU4A 4XYEA 5LBIA 1AMOA 3NVKI 4XGIA 2W2NA 3NCTA 2QM8A 3I73A 3QLUC 4L2IB 2HU8A 2DE0X 2OCDA 2X0DA 3QLVA 4HLDA 3VDMA 4YRNA 1VE3A 3LAWA 1GKKA 1A4IA 5CNKA 4C1NA 4HOYA 3L0CA 5ALRA 1KETA 1PWEA 2WICA 3AB3A 2VAMA 4HX9A 3MLEA 4H3HB 4QNMA 3UMBA 3QM1A 5JEEA 2J67A 3BTUA 4QJ5A 3WLHA 1SUDA 4HZGA 1CQWA 4KGDA 3WBBA 4XVUA 4QYXA 5LOVB 1WW3A 3K30A 4L28A 4B47A 3E4DA 3IELA 5HW0A 2AWOA 2QUHA 1GLNA 1KI1A 5J1SB 3ZWVA 4WA8A 3I83A 1NMQA 2NVWA 4M0FA 4AQ7A 3ETLA 3W4KA 4BFCA 3NTOA 2E4WA 3H9GA 5CDYA 5JAPA 3PWZA 1L7VC 1E2FA 1TJYA 4MWBA 1OZ0A 3NBAA 1FJHA 3BIOA 1V3VA 2HEIA 4D4IA 4EELA 3FPSA 1UXHA 2C4MA 3C7KA 3B1KA 3GLRA 2GN9A 3KPJA 3VR2A 5KOJB 5AKLA 3ZV6A 5K8CA 4BQIA 3DEKA 2ZITA 3DH0A 3G0GA 1G63A 3AESA 4L5IA 4JP3A 3TCKA 2C03A 3EVCA 4NV1A 3ZYZA 3I9FA 3G8AA 2CW5A 1EK2A 1OX5A 2X0NA 1ZNQO