4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
4E46A 1UFOA 2WU4A 3FCYA 2ZYSA 2Y6VA 1GXSA 1MX1A 2H7CA 3KSRA 1GQSA 3PE6A 1HBJA 3H0CA 2PKYX 2G5TA 3BXPA 1D07A 1YAJA 3EIOA 4X6XA 1PV1A 1U4NA 3UMJA 3ZLTA 4Q3KA 1CPYA 4RE5A 5CH8A 1Y37A 4EY8A 4WCVA 5CXXA 4E11A 4M0EA 1EK1A 3D4LA 1YR2A 5HKBA 1QLWA 5ALDA 4C4YA 4RE6A 4PNZA 1EXWA 5YASA 2WUGA 2XMQA 3W04A 1GPKA 1LPBB 4Y2JA 2VATA 4IH4A 5C8ZA 1CUSA 5JAHA 2GZRA 1QTRA 1H2ZA 5ESRA 1B6GA 1UKBA 4H7EA 1YSCA 3NWOA 3WIBA 4J0IA 5I9IA 4FKBA 1MTZA 1RP1A 4BRSA 4K2AA 5LZ4A 4F60A 4C4XA 4YK7A 1IMJA 5AI9A 5AM1A 5K3DA 1U2EA 1DINA 2ORYA 2XUOA 4PW0A 2HFKA 3MGAA 3KXPA 4QLOA 3C5WP 2O2GA 3F9CA 4AB1A 4FLMA 1UK7A 3MVEA 1CUXA 2O7VA 4CG1A 5ALVA 2WG2A 2WUDA 2OGSA 4OB7A 1IUPA 1CUFA 4J0GA 4J03A 3LP5A 4NS4A 4FNMA 2V96A 4LYEA 4B82A 5KWJA 1I6WA 4N5HX 2EEPA 4H0CA 4W1QA 2VT7A 3FLBA 1ZI6A 4QLAA 2WM2A 2ZYHA 3OM8A 2NW6A 4YPVA 1Q0ZA 4X6UA 3KD2A 3O95A 2QUAA 4UFPA 2O7RA 5DYYA 4G8CA 5LZ2A 5CT9A 2CZQA 4JYPA 5HQ3A 1LPNA 3B12A 2XUJA 4DNOA 1LBSA 3C6XA 3D7RA 3AIOA 3NUZA 3PDCA 4CFSA 1IUNA 5A62A 2XB6A 3HLKA 4G9EA 2WIGA 2HA3A 3BDIA 2OCLA 2XUFA 3WK6A 1G5FA 1EVEA 4W63A 4AXBA 1ORWA 5ALJA 2C5FA 2PUHA 3RM3A 1VA4A 2WTNA 1WCYA 2C0QA 3ZLUA 2Z8XA 1A8QA 5ALTA 1F8UA 5HQ3B 5EHZA 5ALNA 2FJ0A 1EX9A 3ZPXA 3G9XA 5IVHA 1UK8A 4TPKA 3DQZA 1J1IA 3WK5A 2Z3WA 5ALMA 1BN6A 5AKLA 2ACEA 3OPMA 3H2KA 4AZ0A 4H7JA 1CFJA 2VQ6A 1F6WA 1J07A 5K3FB 5HF9A 1ZICA 1AZWA 2Q0XA 2ES4A 2I3ZA 5HF6A 3I28A 1E3QA 5DNWA 2AJLI 2AJBA 3LLCA 4G4IA 4H7IA 1VOTA 4UBLA 4B9AA 3EBLA 5AHXA 5FOQA 4FNGA 1MNAA 1DWQA 2DR0A 4FOLA 2QJRA 4HZGA 3DJYA 3FLAA 1LPMA 2QMQA 1LLFA 2WG0A 3O4GA 1IVYA 3F67A 5CW2A 1CUEA 1LPAB 2I78A 5AK6A 2J4CA 3E1GA 1UWCA 3I2JA 4BVJA 5E4YA 1Q83A 2WHRA 1ODCA 1R9MA 1VE7A 4QDTA 3A2LA 4XX1A 1K4YA 5ALHA 4MWTA 1Q84A 3AZQA 5AKYA 2W6CX 5BOVA 4UBKA 5CT8A 5ISMA 3DOIA 1XLVA 2V9ZA 4P08A 5JATA 3EF3A 4W1PA 4QDUA 3C45A 3K6KA 4L3WA 4P92A 1TKRA 4KACA 4HRXA 2AJ8A 5ALXA 3CN9A 5LP1A 1XZGA 4LXIA 3GELA 4PSDA 5CH5A 2QKYA 3C8HA 4G4GA 4B80A 3FBWA 1R1DA 1XZKA 2JIDA 4B84A 4B7ZA 1GKLA 3V9AA 4EB0A 4ZXFA 4N5IX 5H3HA 5JAPA 1ZD5A 3R3XA 1A88A 3AINA 4JH0A 1JJIA 5HZGA 3AJAA 3G02A 1CUYA 4DMFA 4ARBA 5BWBA 1BE0A 1JU3A 1MX5A 1OILA 2OQVA 2PPLA 1GT6A 4MQMA 1ZGBA 5LLSA 3Q0TA 2ZJ6A 2VEOA 2HA0A 4C6HA 3WZMA 1QIKA 4X92A 1DTEA 3HI4A 3FLEA 5AKXA 1ZI9A 3FYTA 3HSSA 1BRTA 3O9MA 4JYMA 2PM8A 1FFDA 4F0JA 4FMPA 3DL7A 3ICWA 3WK8A 1TIBA 2VJDA 3T4UA 4LXGA 5FPPA 2WFLA 1E66A 1K63A 2C4HA 5ALLA 1JU4A 2GZSA 3M82A 2WILA 4JNCA 4RNCA 3O4HA 4F5ZA 2BGRA 5E2IA 4K6GA 2XUKA 1EDEA 1XQVA 1C7IA 2ZSIA 2DSNA 1OXMA 1UOOA 3MUNA 3WL8A 4X85A 4Y2TA 4PSUA 4X93A 2JGEA 4NMWA 1QIIA 3HJUA 1VKHA 4ARAA 3P2MA 5CMLA 3K9BA 4BDTA 1W1IA 3LIIA 2XUPA 4U2FA 3DD5A 5AOCA 4BCCA 4GLBA 2WFLB 4UHBA 1ZOIA 1LPPA 1XZDA 3QM1A 4DMCA 3HABA 4Y2XA 4F21A 2ZJFA 3WYNA 1PFQA 3IUNA 1TRHA 4C4ZA 4BBZA 1FSSA 5IVDA 5AI5A 3NGMA 3G0GA 2FUKA 1LNSA 5ALUA 5BV7A 2XLCA 3DYIA 4D9JA 4Q05A 3D2CA 3FSGD 3D2BA 1W6RA 2XMDA 5JAUA 3D5EA 2V98A 5ALPA 5AKGA 1XFDA 1YB6A 3RLIA 4J3JA 2ZYIA 1QJ4A 4QWMA 3G9UA 3PFBA 1CVLA 4M0FA 4NVRA 5KREA 5ALIA 5E4JA 3BWXA 2I03A 4X7BA 1XRPA 2XMZA 4J0HA 1CEXA 3STYA 3I2HA 5JIBA 2PSHA 3PFCA 2PBLA 2BJHA 4ZRDA 3DNMA 1P0IA 3BL8A 1FFEA 4XJVA 2VTVA 2PSFA 5K3CA 1ZIXA 3JW8A 2OCKA 1WB5A 4MEBA 4GECA 1EVQA 2AXEA 3PUIA 4B85A 3H2HA 2HA7A 3WK7A 1FFAA 1HPLA 3CCBA 4UHCA 3SC2A 5JALA 1XKTA 2BFNA 3WLAA 1CIJA 1QFMA 1EDBA 3AZPA 4EY4A 5CRIA 3F97A 3E3AA 2XUAA 5A6VA 1XRLA 1SOMA 5FKJA 4YX9A 4BRZA 2WTMA 4OU5A 3IUJA 3IULA 3ESAA 5DTIA 1CUCA 2CEKA 5T4BA 5JANA 4Y2YA 1FFCA 2GYVA 1GPNA 3ESBA 3WI7A 4WDRA 3UUFA 3QZUA 3ESCA 1WOMA 3S2ZA 4FLEA 4I4CA 2WSLA 4X94A 2OG1A 1AKNA 2XQGA 4C01A 1XQWA 2C7BA 1R50A 1JI3A 1WB4A 2WIFA 2WG1A 1ODSA 2VJAA 4QDXA 4OCZA 3LS2A 3FYUB 2I3DA 2YH2A 1JMKC 2Z8ZA 1VZ2A 4B6GA 3STUA 2WU3A 3WKCA 1USWA 1N5MA 1THTA 4DNFA 4NZZA 3G7NA 3I1IA 3DKRA 3DS8A 2VA9A 4AO7A 5JZBA 4CG2A 1KEZA 4BATA 2BCEA 2HA4A 5AKKA 4QDZA 5HK8A 5F4ZA 3H2IA 1VJ5A 4GBGA 2J4FA 5CT6A 4B83A 4PSCA 2JEYA 4BP9A 4X6YA 1W76A 1G42A 2HM7A 2RIPA 2O2IA 5SYNA 1JT2A 1LPOA 5ALGA 1L7RA 5AIAA 2WHPA 2AJCA 4CI9A 4PO3X 3WKDA 1ODTC 5HCUA 3WL5A 2ECFA 3RK4A 3V1KA 3LIPA 1QIJA 1K8QA 3G8YA 4ROTA 1MAAA 2WIKA 2HA2A 3IA2A 3QMWA 2EDAA 4QDOA 1GGVA 5C8XA 1G66A 4BP8A 4BAZA 3IDAA 1EINA 1VA5A 4B9EA 1YASA 1GQRA 2WHQA 5CT5A 4EBBA 1Y7IA 1GPLA 2XMBA 1K6EA 3WWOA 3A70A 3FYUC 4TGLA 1CQZA 2OGTA 3PICA 5HFNA 3WIOA 4DGQA 1YA4A 3V1NA 3WKAA 5IVIA 4KRYA 2RONA 5LYYA 2RHWA 5ALZA 4XVCA 4M0MA 2YASA 4DNQA 1CUIA 1XQYA 4I19A 1LZLA 4UBJA 4Q3OA 1QTIA 5AP9A 3PF8A 3D2AA 1DQZA 4J0CA 3GBSA 2C58A 5DNVA 1UZAA 1SCIA 3WWEA 2WUEA 5AM3A 1AURA 1DT5A 4BC0A 4MJ3A 2XQJA 4XWGA 4BB0A 1XLUA 4HVTA 3FNBA 5JD4A 5IH7A 4OB8A 1HL7A 3DL4A 4KE9A 4Y2UA 3O9VA 4HTAA 1EDDA 5LIPA 1CUUA 1EI9A 3FYUA 4QE3A 2HFJA 5DTJA 1QIMA 3VJKA 3QITA 3W9UA 5ALWA 1HLGA 5IKXA 3F96A 5D7BA 1CLEA 4L72A 3FVTA 3BIXA 4FHZA 3M83A 1XZJA 3ANTA 1JKMA 5EFZA 3WA6A 3WMRA 1EK2A 1BROA 4WFIA 1XRRA 2E3JA 4Q3LA 1FJ2A 2J3DA 2X8BA 4DYHA 5ALFA 1WHTA 1ACLA 2PUJA 4DNPA 1K5PA 4HXFB 5AKEA 3C87A 2EDCA 5AOBA 4Y2PA 3S8YA 2Y2UA 3L1JA 5AICA 2HIHA 1JFRA 3WWDA 1O6GA 4W1RA 5JD5A 2QOEA 5DWDA 4J7AA 4L9AA 1QIEA 3G9TA 2H9YA 1TK3A 4DLNA 3OOSA 4S0XA 4G9GA 1MNQA 1E8MA 4E15A 5JASA 1ZI8A 1QE3A 3R40A 5I7UA 3B5EA 1M33A 4WY8A 5AO9A 3STVA 5T4EA 4U2DA 2IITA 1AMNA 1DU4A 1BCRA 4MYSA 4Y2SA 1CUAA 3CN7A 3FOBA 1A7UA 2GBCA 3N0TA 4AQDA 3I6MA 4J0DA 3O4IA 2HDWA 4FFWA 3D3NA 2XLBA 4EY7A 2Z3ZA 4KR0A 3STTA 5JARA 2K2QB 5K3AA 3AFIA 4DMHA 3EQ7A 5DJ5A 3ED1A 1HKHA 2C5GA 3MUOA 4FWBA 1U8EA 2HL6A 4WDQA 2D0DA 2PL5A 1HDEA 4HS9A 2B9VA 1TCBA 1EHYA 3OURA 3PUHA 1ACJA 2WJ3A 5AM5A 1JJBA 2VAXA 2IIVA 3A2MA 5FP0A 1BEZA 5EHQA 4Q34A 1DT3A 2J3QA 2PX6A 2G5PA 5CXUA 2QJWA 4KE8A 1WPRA 4BYMA 3WZLA 4QWWA 2HU5A 2ROQA 1CUJA 4BC1A 4ZGBA 3KWJA 5CURA 5EIHA 2DCMA 2O2HA 1A8SA 2BUCA 4IO0A 7YASA 1N1MA 3IUMA 3H18A 3UUEA 4U2EA 5K3FA 3DDUA 2XUQA 4H77A 1C7JA 2H1IA 1QGED 2BAGA 1MU0A 2Y6UA 3U1TA 5DLPA 2XMSA 3DOHA 3OC0A 5D3ZA 1BS9A 1WB6A 4IH1A 3HXKA 5AI8A 1GZ7A 2PU7A 4WFKA 3BIWA 2VT6A 4BTLA 1YS2X 5D3KA 1XZCA 5FPQA 5CBKA 4UHHA 4EY6A 4Y2QA 4J0KA 4CCYB 5LKAA 1JJFA 4I3FA 2XE4A 1R9NA 5JYCA 1XRNA 2XUDA 5AK4A 5A2GA 5FLKA 5EI5A 4H7FA 4QZVA 1AX9A 2B61A 5C81A 2XQFA 5FV4A 5AKJA 2WLSA 2JEZA 1CUBA 2OPHA 3H19A 1R88A 4X3CA 5A71A 3PF9A 2H7XA 3VISA 3AUKA 2CUTA 2XI4A 3DKKA 2XMGA 3IIIA 4ETWA 1T4MA 3CXUA 4MQLA 4INZA 5ALSA 3C6BA 4GXNA 1BEEA 3F98A 4KAAA 1RYYA 5AH0A 2B4KA 1YB7A 4X71A 5A7FA 2XUGA 2WIJA 4G5XA 3KOOA 5HFAA 2GYUA 5AK5A 1Q0RA 3RKSA 2OXEA 4H35A 5JAOA 1ZGCA 1MO2A 4WFJA 2DHEA 2GBFA 4L0CA 4RPCA 1NX9A 3I2FA 3FVRA 1XZAA 3IBTA 4ZI5A 1E8NA 1J2EA 2CJPA 4LXHA 3HC7A 4ZV7A 3TEJA 2PSDA 1ZD3A 3AIKA 1XROA 3C6YA 5JZSA 2QT9A 4XIIA 2X76A 4K5QA 3WWCA 3OG9A 3JYHA 3VVLA 4X91A 5DYWA 5E4TA 1SCQA 3A6ZA 2LIPA 2X5XA 4B0OA 2QXTA 1AQLA 4UBIA 3G0DA 4B81A 4FBLA 3O4JA 1SFRA 3KWFA 4EY5A 2XQIA 3E4DA 3BF8A 1CUVA 2QZPA 2CB9A 3WL7A 3FWHA 1S8OA 1XZBA 2D5LA 4U2GA 1CUDA 3V48A 4OSEA 5BWCA 1ZJ4A 3U0VA 1YS1X 4BZWA 3BF7A 2XUHA 4GHWA 4MYDA 1UK9A 2VJCA 2QR5A 1P0PA 1IZ8A 1EB8A 1EH5A 5J3JA 4QNNA 2WUFA 2JGMA 1XQXA 4HXGA 4H18A 2QTBA 1VXRA 1LZKA 1XRQA 2WIDA 1YCDA 2G63A 4UHDA 5C7YA 3I2KA 1X70A 4PF1A 5AOAA 2BUBA 4UHEA 2HU8A 3VJLA 4HRYA 1PJAA 4Y2VA 3BJRA 3VKFA 5ALRA 5D6OA 3R3VA 2GBIA 1WM1A 3BDVA 4DSZA 2DFPA 4UBMA 4EZIA 4UBNA 4BE9A 2BKLA 3TJMA 2ZYRA 3D59A 1TAHA 3R41A 3C70A 3G9ZA 4OUKX 5ALEA 2ACKA 1CQWA 4B0PA 4Q1VA 1O6FA 1ISPA 3HACA 5EIEA 3DYVA 3M3DA 1H23A 3Q8WA 1WPXA 1Z68A 3VDXA 5AI4A 4U2CA 1E8DA 1KU0A 3G0CA 1XKLA 3W9BA 3HYSA 4UHFA 4IHAA 1XZLA 1DX6A 3WQHA 1X2EA 4OB6A 4DSAA 3TRDA 1W4LA 4UBOA 3A2NA 3ANSA 4BCDA 3TGLA 2XMRA 3AIMA 1UKAA 4G1FA 1WHSA 5AM4A 4OYLA 1DWOA 3N2ZB 4BAGA 2JGFA 4N8DA 2ZVDA 4RGYA 1L7AA 2Y2VA 4V2IA 5IVKA 1EB9A 5EHXA 4U2BA 2BUAA 1FFBA 3GA7A 3R3YA 3VVMA 3EQ8A 4N8SA 4A23A 1IZ7A 3IUQA 1AC5A 4MWSA 4DIUA 2H7YA 4OYYA 3SK0A 2HA6A 5AM0A 1QO7A 1LPSA 3GZJA 4PV7A 2GYWA 3PI6A 5FDFA 4KE7A 3QH4A 1MPXA 2QUBA 3GUUA 1ZD4A 1R4ZA 1QOZA 5LZ5A 1VZ3A 4X00A 5ALOA 3WA7A 3DLTA 2HU7A 2HADA 3VJMA 4AMZA 5EGNA 2CMFA 4UUQA 4K6KA 2RGUA 3LCRA 3FCXA 3QYJA 4FFVA 3T52A 2DHCA 3HEAA 4MEAA 1XZHA 2WQZA 3QPCA 4YASA 3W2TA 3SWWA 1XZFA 1ZJ5A 4LHEA 5JADA 4K6HA 3V1MA 6YASA 4CG3A 3WL6A 4KAJA 4KJXA 4IQ4A 2DQZA 4BDSA 4FLFA 3ZLVA 2WFZA 2YXPX 4GEGA 4G8BA 1UXOA 1MX9A 4BAUA 3VXKA 3L1IA 2PSJA 4W1SA 2ONCA 4ZV9A 1F0PA 1KU6A 3I2GA 4KE6A 5A7GA 3STWA 2XMCA 3ESDA 1F0NA 4FDMA 2BGNA 3L1HA 1NU6A 3WYDA 2R11A 5HF8A 3ZWQA 3GFFA 2PVSA 4C89A 4E14A 1UT6A 3RARA 2YYSA 1YA8A 2C0PA 1MT3A 1EA5A 1CV2A 3WK4A 4C87A 1VE6A 5A7HA 4DTCA 1TQHA 5AIBA 2WFMA 2HA5A 1XZIA 3K2IA 4AO6A 4W9RA 2QS9A 4GDMA 2WJ4A 1CUZA 2WHPB 4LKOA 3IB3A 4HXEB 3ICVA 3KDAA 5AK3A 1XRMA 2HRQA 2OGZA 5DYTA 1C4XA 1B41A 2OCGA 4A5SA 2R8BA 3C8DA 4Y7DA 3X3HA 3SX4A 2P8SA 5AKIA 1HQDA 3B3QA 1ZIYA 2W22A 4X90A 4GI1A 3WJ2A 2Z5GA 2JBWA 1XLWA 5K5EA 1BU8A 5ALQA 3WWPA 3DCNA 1QO9A 3IVMA 4A16A 1UKCA 1SCKA 4X97A 3EQ9A 4QEKA 3V1LA 2PU5A 1A8UA 4KRXA 4DM7A 1E5TA 1MAHA 4BCBA 1YAHA 3H04A 5KWIA 4GWLA 4AX4A 3WJ1A 1CR6A 4G8DA 1G4HA 5K3EA 3R3ZA 4Z49A 3ZV7A 3QMMA 4FTWA 5ALKA 5T4HA 5FXMA 2VSQA 2IX9A 1LBTA 1DX4A 4BVLA 3WKBA 3QPAA 3H2JA 1N5RA 5HK9A 5LZ8A 1AGYA 1BN7A 3STXA 5CH3A 2OCIA 1QONA 4ITVA 1U65A 4FBMA 1NU8A 5KBYA 3H1AA 5HKAA 2JF0A 2VAVA 2DHDA 2RAUA 3YASA 1L7QA 4Q82A 3HRHA 4AMYA 4G4JA 2UZ0A 4H7DA 4P9NA 3OTQA 1QIDA 4GW3A 1P0MA 1DWPA 5FRDA 3BJMA 5AKZA 4BTVA 2DQYA 3FSGA 2JGLA 2CBGA 4OD0A 1JMYA 2HHAA 4H7HA 4DMKA 4EA6A 4EHBA 3I6ZA 2GBGA 3W05A 5LKRA 1CUWA 2QVBA 2VF2A 5I8PA 3G0IA 3C43A 4JEIA 4ZREA 3D0KA 5AKHA 4CCWA 1P0QA 4OPMA 3C6ZA 3ZI7A 1H2XA 2HRRA 1N8SA 3HZOA 2XQKA 2FX5A 1UK6A 4BVKA 4JUIA 2WJ6A 4UPDA 4X95A 2CKMA 1CRLA 5CTAA 1QIGA 1W75A 4CIAA 5SYMA 4N8EA 4IH9A 4UFNA 3C5VA 2JGJA 1TCCA 3H2GA 3R0VA 1W52X 5ALYA 5AM2A 2JGKA 2G4LA 4BE4A 4WJLA 1UOQA 4CIBA 4UFOA 1H2WA 2Y1KA 3F8SA 4AO8A 4KAFA 5AJHA 3GROA 1ORVA 1QFSA 3FAKA 3AILA 3JWEA 5T4FA 1QIHA 4EUSA 5LZ9A 4CCYA 2OLEA 4AZ3A 2RHTA 2QM0A 4ZWNA 1BCSA 5HF5A 2VJBA 4J0JA 2XUIA 1UOPA 4LIPD 2B20A 1R3DA 5AI0A 5EIAA 2RI6A 2OAEA 1T2NA 4O08A 4KEAA 4P93A 4KYVA 1QZ3A 2AJDA 2QRUA 3I2IA 1DQYA 5LZ7A 1CUGA 5DNUA 3BE8A 4H7KA 4MXDA 3QMVA 4Y2RA 1XZMA 3IURA 5K3BA 1VLQA 1RWQA 5CT4A 5EHNA 4BZZA 4Y9SA 1CUHA 3WK9A 2OAGA 2PSEA 1SC9A 3I6YA 4LYDA 1ETHA 1H22A 3DEAA 1Y7HA 3NOXA 3QBJA 4OU4A 5FUMA 1LGYA 4QA9A 4C88A 3W06A 3E0XA 3ILSA 1AUOA 3G0BA 1IUOA 3QVMA 3QPDA 2JGIA 4AN1A 5JZ9A 4HAIA 2ZJ7A 4TVKA 3WKEA 2OQIA 3CCCA 3AZOA 2ZSHA 5C8VA 4PQEA 2WKWA 3R3WA 1QIFA 1XZEA 2XDWA 5AI6A 3R3UA 1H2YA 1MJ5A 4AN0A 3H1BA 2V97A 5JD6A 1E89A 4WY5A 1TCAA 1J06A 3I1YA 2FJPA 1THGA 3M81A 2QXUA 1VXOA 1OCEA 1GKKA 1MN6A 3H17A 3O0DA 1X2BA 1ZD2P 2XT0A
chains in the Genus database with same CATH superfamily
3BX1A 3TM5A 3CR7A 1UWVA 2ANBA 2VCEA 3QENA 1OIWA 1RRFA 4Q7LA 1ATZA 4G65A 2B78A 5GONF 4AT1A 2ZYSA 5CNJA 1G6OA 4EQ6B 4EZEA 1NVTA 2Y6VA 2JHPA 1ZJWA 1I7QB 1RABA 3B6EA 1GXSA 3KEOA 2RJ3A 2ZB7A 2QG9A 3IELA 4M76B 1N2BA 2PA3A 3CKLA 3WBFA 1MX1A 2H7CA 5HOQA 5IJZA 2PWPA 2Q3CA 3LAWA 5KNDA 2OM6A 2X1HA 2XWQA 4O1IA 4OGKA 1MA0A 2A14A 4I7EA 5AUOB 2ZS7A 2HCBA 2J7PA 3GJ3A 1Z4JA 2VKQA 2Q4EA 4WKOA 5LUAA 4ER6A 1G60A 3BERA 3KKQA 2G5TA 1G3UA 5CIWA 2X9VA 5FL7A 4J76A 2GM3A 1ZX1A 3K92A 2B5VA 3GVCA 4LHWA 5CHEA 1ZN7A 2FPWA 1KI6B 1KMHA 1WU7A 1D07A 3I9V1 3B7PA 3C3AA 3IJPA 2CLDX 1PV1A 1FOEB 2PS1A 1R0KA 3UMJA 5DBGA 5CK5A 4FCTA 2A33A 1P7WA 1Q57A 1S7GA 1Y37A 2IGBA 3WGJA 5BNZA 3HVKA 1KRHA 5IT4A 2FF7A 2W6MA 4J1NA 4MGKR 1TAGA 3CUSA 4E11A 3KPVA 4U5QA 5BSTA 3IOBA 3D4LA 1F2UA 5FQNA 1ST3A 2CLKB 5GM2A 1ZSNA 3KCNA 4G67A 3CV3A 5ALDA 1CY4A 1DOHA 2AFVA 2EGHA 2FEXA 1R0RE 4HP8A 1OGYA 2HRZA 1MH1A 2O3TA 3EBOA 1YR9A 4C4YA 3N76A 3O2QB 4RDCA 1SKQA 4YWJA 4C2BA 3KQLA 3DMTC 3R44A 5JSYA 3RC7A 2BTEA 1OBOA 4C0AC 3DMNA 1N5OX 3DKPA 1M66A 2HBQA 3T3DA 4YQFA 1GKYA 1OIVA 1O9HA 4Y2JA 3MBOA 1OXKB 3RRBA 5F7OA 2E5LB 1ZONA 2VATA 2ZIAA 1C1HA 2NU7A 4JBXA 4NLLA 4BV9A 4YT8A 1WW2A 1L1FA 1CUSA 1ZK3A 4S1VA 5CB6A 1MAUA 3DP9A 3KDPA 5ESRA 2A7XA 4UM5A 3SIRA 4ZKEA 4DYVA 2IOQA 4H7EA 1E1CA 4FONA 2QJOA 4FIZA 4ACBA 3P2IA 4RDIA 3VTKA 5ADUS 2HYDA 4FKBA 1MTZA 1OVGA 1CYEA 2WVAA 1ZL2A 3S29A 4K2AA 5KYKA 1BCSB 4B7CA 1FSPA 2H5JA 2FB9A 4EAAA 4C4XA 2CKDA 2P2YA 3QYPA 5TQ0B 5B7QA 2B7LA 4Q3DA 1P2VA 2I6XA 3DLAA 2QMYA 1N2JA 4OLHA 4QSHA 1NVBA 1U2EA 3CNOA 1DINA 1C1DA 2ORYA 1R10A 1WWKA 1KE1A 4QLOA 2X40A 2ZITA 4K1XA 4HPXB 4Q00A 5DO9A 1PL6A 3LXMA 4IOLA 2O8DB 2Q6OA 4GZ6A 3TCXB 4BWFB 4CIXA 4Q4JB 4C04A 5BRAA 2I6FA 2QL5A 3F9CA 4AB1A 3EMBA 1EDOA 4HNSA 3MS4A 2A58A 4N65A 5EJAA 2V55B 3T7SA 2WUWE 2PQMA 4HVLA 1GGNA 1Y63A 2Z1MA 4JCOA 2XEXA 2PLWA 4CU2A 2EERA 5B6PA 4JI0B 2J9XB 3LTEA 1WHSB 1S7CA 4RJ2A 4DV2B 2H00A 4S3MA 4F5DA 2HWYA 4JBGA 2DJ5A 4MVJE 3W3ZB 4HEJA 4A82A 2Q1SA 1TM2A 1KERA 1E1CB 2AI3A 1E0JA 3QVSA 3VNSA 1KAHA 2GBLC 4CODB 1WW8A 2MYPA 1NQTA 2C31A 3ZWOA 3IUSA 4W8HA 1PJZA 2YJGA 3R9KA 1YE5A 3D3JA 1XC7A 4EG4A 4QYMA 2Q1UA 4WCFB 1M0TA 1Z7WA 3LP5A 4NFHA 2JVIA 3V9PA 3U4CA 4AKSA 1KYVA 1P39A 2V96A 3HBAA 3IXLA 3SLGA 3T4EA 4V1CA 5FWYA 1R6UA 4XPZA 3R5FA 5AVTA 3FBTA 1A7AA 1RBMA 5I8ZA 1V7ZA 2FYTA 5GGYA 1KEWA 3OZ7A 4LX0A 4N5HX 4KP7A 3HP4A 2BRUA 2IYRA 5L3RA 4OHXA 4W1QA 1RVDA 2FE1A 1N6NA 1QHHB 2G0NA 3ILYA 1LI4A 2VT7A 3B6JA 4ZT3A 5CFPA 2GEVA 5BSRA 1Q92A 1Q7RA 1SBIA 4BL5A 2ZYUX 4MW9A 4NWIA 1L5OA 4P4NA 1EGVB 3IYLW 1S1CA 5J40A 1KAOA 2VSFA 1QP4A 3WMEA 3L0PA 5DIFA 2ZI5A 2BMAA 1OYOA 2ECPA 3T5DA 3VPBA 5D00A 4HV4A 2C84A 1NYQA 2EQ5A 2WM2A 4JP5A 2ZYHA 2NW6A 2QXYA 4P3XA 4QFDA 1QPGA 1SG9A 1XEAA 2FSIA 4RS4A 4OM8A 4W4TA 3VPCA 5BOSA 3E53A 3LDFA 4DJJA 2B0JA 1SZDA 3GRPA 3O95A 3OIFA 3I0ZA 3VR5D 4WA7A 2XKKA 3QSGA 1H5UA 2O7RA 2QEQA 3JAKB 1O94C 1PLJA 2NZYA 3DSRA 1WCWA 3PFHA 2IVZA 1YVDA 3I42A 3T1NA 4LE0A 3TUJC 3KQUA 4MR9A 5E7IA 4NZMA 4Y67A 2WZDA 1NUPA 2GFQA 5KSZA 1BE1A 2NTJA 2Q3BA 5L7YA 2OD2A 4YRZA 1NE2A 4YFVA 4DNOA 1FMCA 3RWBA 1FCJA 2Z98A 1N7IA 2V7BA 1LDGA 1F4PA 1RRMA 3SXPA 2V59A 4ID9A 1Z6QA 4ZHSA 1OB2A 3ANLA 2ZOSA 3K0KA 3NUZA 3HWSA 4UNPA 1BDJA 3EBPA 3PDCA 4HS4A 4WAUA 2AW5A 2ZRFA 4OF4A 4YLYA 2EOAA 3QKUA 2OYRA 4WNYA 3W1VA 5KSYA 6CHYA 2NSYA 2V6BA 3G0OA 1U8XX 5H70A 4PWYA 3DDSA 5H80A 1N77A 4GOKA 1JDZA 2A5DA 1ZMXA 3BDIA 2OCLA 2XUFA 3WLOA 2JBAB 1CJCA 4OJQA 2C5BA 2WSSD 4NU0A 2W9XA 3W5DA 2PT6A 1NRXA 2G08A 3KR2A 3OZFA 2QW0X 1II9A 4MLPA 4UDNA 4UEWA 2C5FA 5IABA 2YIMA 2VEDA 1SKAA 4CKBB 2Z43A 5IS2A 1BS1A 2C4VA 2PXXA 3RI3A 1VL1A 1PBTA 1PLKA 2GNAA 1WCYA 4HSEA 4EFDA 5EMLA 3OEHA 1WBJB 2V5VA 2AC2A 5J9FA 3EVBA 2Z8XA 3KSDO 1D3AA 2PYZA 3M6XA 2HCFA 3MGBA 1EQUA 1E2LA 3SNHA 3NWBA 5ALTA 4C0KA 4EAQA 2CWWA 4MR9B 1NJFA 2QTTA 1S89A 2AX3A 5E9JA 3EVNA 5AVXA 4F6RA 4UU0A 2W2KB 2BP7A 5GIOE 4C06A 1PCXA 3SSNA 1XO1A 4XDHA 3L7KA 1YMVA 3D02A 3LGXA 3RO7A 4E1VA 4YACA 5KMGB 2RAVA 1CZNA 3CW2A 5LBUA 3JVUA 2Q8PA 4NJOA 1NE7A 1NTOA 2Y93A 5H4HA 4XZ3A 4Z99A 3ZI4A 1BN6A 2HTFA 4PYJA 2QA5A 4FFBA 2H5IA 5TS2A 4EKDA 2ZRGA 3AFHA 3L4SO 4XI9A 3NG1A 3UG6A 3ZX4A 1XU9A 4AIRA 3RVKA 3ADDA 4AZ0A 3CLSC 3I39X 2REOA 3ZQJA 4KREA 1OTYA 3DXFA 2VQ6A 1RPZA 1RLMA 2BCJQ 1F6WA 2X13A 1J07A 5IJ9A 5K3FB 4P0QB 5C53B 1PGJA 4CKCA 4DDHA 1UINA 2FR8C 3FNHA 2VYVD 1B2LA 2JFZA 4AJLA 5KTNA 5BWMA 2NUPB 2JFFA 5G0WA 2W6NA 1B3RA 1LFAA 2FX3A 2Q0XA 1T5TA 1ODJA 2ES4A 2IPAB 3DWGA 2YHIB 4WWHA 2AE1A 1P8JA 3LSYA 4Q16A 3N8HA 5DNWA 2AJBA 3ITDA 1ZGJA 1D2HA 4N7BA 3KAKA 2VTEA 4G4IA 4MAFA 5E0KB 3FB4A 5DNYB 4CGYA 4B9AA 3EBLA 3OFSA 5KQGA 5AHXA 3ZWWA 8GPBA 5FOQA 4IL5A 1MMFB 1MNAA 1Z18A 2CJYA 1M2GA 1E0AA 2XYPA 2ZS8A 4CKWA 1I2CA 3PRHA 4R16A 3HWRA 2AQ8A 3E7XA 4JVNA 4ZZ1A 4LYYA 2C7GA 5EY5B 3UICA 2E1RA 2QYHA 2FQYA 2GOYA 2DWQA 3HP7A 4AJ4A 4HUTA 3N74A 3CRW1 5F21A 1G5HA 1UBRS 2R44A 3O4GA 4NCXA 5DHUA 1ECLA 2I76A 3F67A 2CHVA 2X0EA 3UKJA 3ZNOA 1EGQA 1CUEA 3AOEA 2ANCA 4LGMA 3JQDA 4RETA 3RWMB 1ZW1A 2HMVA 3ET4A 3NALA 4V02A 5BSGA 1NQVA 3DPIA 3I2JA 4EF6A 1YIOA 4W5JA 2ODPA 3JATA 4FR2A 2NACA 5E4YA 1W36D 3DV9A 1XU7A 2WHRA 4IKPA 3F49S 1FNDA 2Y76A 2V54A 3ASUA 3CTPA 3W34A 4LGYA 4Y0NA 4QDTA 3GA5A 3QKSB 4ALJA 1K4YA 1SHUX 4TZ6A 4RLFA 4HKTA 3LYLA 2N9UA 3LNCA 4RLSA 5JMOA 1P4RA 2E5FA 4EPRA 5HIIA 3AZQA 4RCZA 1EUCB 5F76A 1J8DA 2GZMA 5AKYA 2VDMB 2OB1A 3KFLA 5JWRA 2VJOA 3JD1A 4TQUS 3O4VA 3HKCB 4NPHA 2XDAA 4OJYA 5BNWA 3OY7A 3KQKA 2Z6AA 1ONBA 1V48A 1C5KA 4CMGA 3H5RA 2OK7A 3I04M 1LQTA 1A5AB 4RJIA 3NJ8A 4R3UC 1SPBS 2RBKA 3SIWA 3H7IA 4BQIA 5DN6A 3QXJA 4PLZA 1Y5MA 2JFVA 3ENVA 3PQCA 9LDTA 3ZQUA 4P92A 1XTUA 2AXQA 4MUNA 1NF2A 2IU6A 1BVRA 1A9RA 3IVRA 2OBFA 4FYYA 2YXLA 5ALXA 2GAOA 4WGGA 1BHO1 1ISSA 1M75A 1RQ7A 1M6NA 3E9DA 3NBKA 4ZT4A 4ZYVA 5EHIA 3RUFA 1WO8A 3L4EA 1SOUA 1J0XO 2OMEA 1VIAA 1B74A 2JDIA 4ZRNA 4U0KA 4YXFA 2IH4A 3GF4A 4IM7A 3IXQA 1TQ2A 3GLVA 4NEHB 4CKZA 1YO6A 4WBNA 4JGBA 2I9KA 1MOSA 5CVTA 3AG6A 4KH0A 3WTBA 4XGRA 3ZD9A 3D4IA 1EESA 1GPWB 3HUFA 2VPQA 3PU6A 1XZKA 1G0NA 4F91B 5HGXA 2JIDA 4LXQA 1GTSA 1ZEJA 1UANA 1QCDA 3DLIA 5CD9A 1SA0B 1L4FA 4B7ZA 4JYBA 5J2TA 3GAFA 4FT4A 3ZOKA 2YJTD 3A05A 2HLDA 3GDFA 2SNIE 4AC9A 4E0BA 4EB0A 5B55A 5I7OA 1NV8A 4KOAA 4X8OA 4F92B 3PYMA 1WSWA 4F93B 4B3IA 1AQIA 2EFCB 3K31A 4QOGA 5AXBA 5FTLA 5WRFA 4HX5A 1JN0A 3TJZA 3IEPA 5HZGA 3V8QA 5TT0A 2G80A 2LDBA 2G88A 3G02A 4Z9XA 4AKIA 3F9RA 4ARBA 1BE0A 1JU3A 2ZSAA 3FSRA 3HA2A 3HLTA 3U4HA 4R6XA 1K97A 4QPZA 3UUWA 5BMOA 3H1GA 3JZFA 3MIZA 2VDNB 2OQVA 2PPLA 4MQMA 4YRJA 1ZGBA 2FQXA 3RVBA 1D2AA 2B6NA 1RD4A 1Y3AA 4MUMA 1N34B 1PTJC 1D6NA 3KPWA 1F9AA 2ZJ6A 3FR7A 5B58C 1JB9A 1IG0A 5DK6A 5E3JA 1H3EA 1VC2A 4C6HA 2ZBRA 1V1MB 1B14A 3L4BA 2GUWA 4X92A 5EKXA 4IJKA 4CFZA 5J4YA 5HS6A 3JQ8A 3FLEA 4PLYA 1PFWA 3U61B 2V0GA 4JBIA 5AKXA 1PGNA 3OJEA 3ADKA 2Y0DA 2IXFA 1A95A 1DQRA 3FYTA 1BW9A 3NKLA 4K1LA 4K3VA 4NJEB 4U8GA 2FPSA 2GM9A 4RIHA 3UAGA 1NJ8A 3HSSA 1FFXB 1UIRA 1GSAA 4L8VA 4BOYA 1BRTA 3QX8A 3DVSX 1ZQ1A 2J6HA 4ZQBA 2VSNA 2QMUA 4GPIB 1FP4B 2C83A 4F0JA 4HB0A 3HJBA 3FI9A 4QPJC 5C7OO 4EYSA 3ZWNA 4P4TA 3ZS8A 1VKNA 4C7MA 1I94B 1CEEA 3EH1A 4EHNA 3WK8A 2J6CA 5B36A 5D01A 4UQLA 1QE0A 1S3SA 1TDJA 1K63A 1J2YA 2CDNA 4HUQB 3NORA 1CULC 2C4HA 2NPIA 7REQA 1JU4A 5J2UA 1R00A 1HKUA 5AUPB 1ZN2A 1SVNA 2VDUE 2YZ2A 3HHPA 221PA 2GCPA 4XYEA 5JNLA 3B1KA 2B69A 3JPWA 2VP6A 3O4HA 3SC2B 4F5ZA 1TJNA 5JJCA 2BGRA 5GZ6A 1UR5A 1PQWA 2NU6A 3OKAA 3V97A 2CXUA 4D56A 1I3MA 3UFXB 2R5NA 3IAM1 2QTRA 3L5OA 4AJ9A 1P75A 4EHJA 4BFUA 1U3VA 5JH7A 5K0GA 1C7IA 1H2AS 3FTCA 1V1MA 2AEMA 2J33A 3GGPA 3TBFA 3PC4A 3WNDA 1OXMA 5A6SA 1DJNA 1NW3A 3EG5A 3MUNA 3ZZ1A 3SXUB 4Y2TA 3PCRB 4M2LA 3BD7A 3CLKA 1GCOA 3QY0A 2QRPA 1O96A 1VKHA 3MCUA 3FNIA 5CYOA 4BIIA 4LJ8A 4ARAA 2GCOB 4XUCA 3A1UA 1W1IA 3H1FA 1DC5A 4BDTA 5L51A 4AAYA 2Q2VA 3PNMA 1UDWA 1RC0A 1IQUA 4KV9A 4TTRA 3TSWA 4LSMA 2XCIA 2XUPA 1BXZA 3F3SA 3NFYA 5AOCA 1G3IA 4H2DA 2NXCA 4POOA 1Z6PA 4KXQA 3ZJVA 2Q3FA 3NHAA 1EFHA 3OLZA 4L5IA 2ZAOA 1I4LD 4XFDA 4XLTA 4ID3A 3TMAA 4ES6A 4XVUA 3QUAA 1PYOA 5TQJA 1LPPA 1T35A 2XYRA 5C1OA 3HABA 2OHXA 4AKGA 2IV2X 3L07A 3ZCPA 4Y2XA 5GVRA 4F21A 3BJIC 3QGMA 5C32A 1EIWA 4KQMA 3WYNA 1AF7A 1EJBA 3UJ9A 4C4ZA 1TYDE 1KYXA 3GT4A 4RL4A 5IVDA 3T95A 3NGMA 4IUBS 1LNSA 3A6EA 3HN6A 4G5GA 3Q9UA 2XLCA 5EXSA 1E6MA 1EYZA 1RAHA 1SEVA 1M76A 2WWXA 2I80A 3AHGA 4RMHA 4UNIA 4D9JA 2C04A 3K6JA 1ECFA 2X19A 1MAWA 4GQBA 1ESDA 3D2CA 3A28A 2XAUA 2Q3DA 3BEOA 1QZTA 3SZGA 1UP4A 3GOQA 3K0EA 1D9ZA 2QPAA 3EIWA 4C0WA 4MHTA 1O5OA 1E2GA 4LDAA 3RFFA 3P8ZA 3FFWA 5JAUA 1IJFA 2O20A 2PZBA 1OAOA 1XZ8A 2PCJA 1SBHA 4NATA 4B87A 5JCJA 4ETMA 2MDTA 3PLNA 4XRGA 2PRSA 4BX9A 1RQXA 5LU8A 5MN5A 2EQAA 2QE7A 4C3OB 1Q0QA 3KHTA 5IVKA 4KPYA 3CXRA 4L5JA 3K9GA 3R7DA 3ZCTA 4DUGD 4WXRA 2W58A 4OXRA 1NWHA 1H2HA 2RHGB 3DBLB 1DL5A 4FI3F 2AV6A 1QH1A 1X8JA 2ZW9A 4Q03A 3GEPA 4BPRA 1DEOA 2PNFA 2ZYIA 4QWMA 4OHVA 2QJTA 1SR8A 2CBXA 4QELA 2NG1A 3OJLA 1Z47A 3KFVA 3IR5A 1CDDA 4NVRA 4NV1A 1HE3A 1Q6ZA 2AK2A 1L7PA 4URFA 3BWXA 3RRZA 5I45A 1V16A 3L18A 4HL6A 4X7BA 1RXSA 3M33A 3S2GA 2OFPA 5BN5A 4HDKB 3KB2A 3CNQS 1EFKA 3TNYA 4PYLA 3U4GA 2IXBA 2J0SA 2ZJOA 1KGSA 1ZPDA 4ZC1A 2H2WA 2P0EA 2PSHA 2WE8A 1AKMA 2X2EA 1KI4A 3CHYA 3D6UA 4IX1A 1Y8AA 3U7JA 3QKWA 3BL8A 1FFEA 3G5TA 4L2IB 3VH3A 3E7PA 1OBFO 2J0UB 1U3CA 2HC9A 3K94A 5JG7A 3E6AA 5EXTA 3IERA 3D5QA 3OFND 1L5FA 3UFBA 1FTYA 2CF6A 1BAPA 1E5DA 1NMEA 3V2HA 4KLCA 3JW8A 3IMFA 5DT9A 5TF4A 4NFLA 1SUSA 3EZNA 3X1KA 1QYRA 3NUGA 2A88A 1X7XA 4D3ZA 2B30A 2PWZA 1QOQB 2QSZA 1X7YB 3WGYA 4FINA 2B1QA 3ZWXA 2FLVA 2WVHA 4KNVA 3ZJYA 3P19A 4EHKA 1JWAB 2OHHA 3P0FA 4CN9A 1M7GA 2HU2A 3EIHA 1NRWA 4GF5A 5DHQA 4LXTA 1HPLA 3GJ0A 3ODPA 3SC2A 1EFUA 4LWQA 3WSVA 4ONEA 5HRCA 3WLAA 4TTPA 5EL0A 1QFMA 1FFWA 3H86A 4KTTE 2HPHA 3QU5A 3TRFA 2R84A 1VJ1A 4M60A 2BFEB 3AZPA 5COQA 4I55F 4G63A 4FYIA 4G2NA 5BRNA 4EHDA 4FIDA 4ZTZB 1E2KA 4L5BA 2JVJA 4B7UA 1IBRA 1S02A 3GJQA 2DFKB 4HDKA 4YC7A 1FS5A 1FJHA 4REMA 3RK0A 3D7MA 2XUAA 3KE8A 3LYUA 3VU3A 1A5BB 1PWEA 1SOMA 3QXCA 4RSHA 2QGNA 3CIOA 4YX9A 2WTMA 4YRQA 4XOUA 1IVSA 1X80B 3Q2OA 1U3TA 3DNFA 4NBTA 1YC5A 2FSVC 1FSGA 2WVGA 3ESAA 4YMVA 1O95D 1ORRA 3BAFA 1KRWA 5LQJA 4DCUA 3MWEA 2O0KA 5T3YA 3UT0A 1QV9A 4PHCA 3QU4A 3C1OA 1C7FA 2GYVA 5AQ1A 1GPNA 3GCGA 3SE0A 3PPYA 3H4TA 3UUFA 5KQPA 5JYBA 3OO1A 4CLXA 1NNUA 1NC3A 1N1DA 2IU4A 1U5AA 2G83A 1W5EA 1N33B 1GQYA 2CUKA 4FHGA 5EWLB 4X94A 5C3MA 2VQDA 4A8TA 4EGAA 2XQGA 4C01A 4AMUA 1FVOA 2O8FA 1XQWA 1H3NA 4R2KA 1R4NA 2D74A 2ZR7A 4J1SA 2IS2A 2OV6A 4DLNA 4Q6WA 3A3KA 2BFCB 4OQFA 5F5LA 1JDSA 2UYOA 1JAYA 3FHOA 5KYYB 5MHTA 3OI7A 1U3WA 2WG1A 3DMPA 2VJAA 4HDSA 2OESA 1U99A 4J49A 3SYTA 3X1DA 4EGJA 3THYB 1OVMA 2M6RA 3HDYA 4QDXA 4OCZA 3CX6A 3I12A 1ADGA 4XWTA 4A7PA 4B3RB 1JBEA 2I3DA 3A10A 1JLLB 5JUWA 4CQMD 4AJEA 4OKNA 4F2DA 1JMKC 3M6MD 2WKQA 4CEHB 2XAAA 4IQ8A 2QW1A 3V4RA 4YAWA 2V3CC 2DC1A 1OXVA 1VZ2A 1BX0A 5IWCA 1TT7A 3CR8A 1P19A 4TLCA 2WU3A 1MQ8B 4NCBA 1YA6A 2FP4B 3BE5A 4MS1B 3OX1A 4A6XA 4OFBA 3D6JA 4KQEA 1OT5A 3Q8XB 4KKXB 5JJKA 3IR7A 3B52X 2BEVA 2CHUA 1G64A 2JI6A 2YC4C 1K86A 2D2XA 4AW9A 1BVYF 1WQ1R 1Z16A 1I1QB 3DZDA 4ZO7A 5FWXA 1LW6E 1E1RA 2AF3C 2OC9A 2I4IA 2WE7A 2C54A 3E27A 2IXDA 4JSYA 4O5OA 3NATA 3DS8A 3ZCUA 5G4LA 1VLMA 3I3SR 5DNDA 4DRXB 3AP2A 1ZUNB 1LRKA 2VA9A 3OLQA 4KV7A 1TUBB 4CG2A 1ULAA 4EDFA 2F7SA 3BYZA 2P35A 5CW1A 3OWXA 5KNCH 1DWUA 2DKNA 3L6RA 1N6PA 2IH5A 1K6JA 4JMPA 4RLHA 1HDXA 2XXAB 3E15A 2HA4A 2PRIA 3OIUA 4HWKA 4JODA 2YJ5A 5CB0A 3JQCA 2FMFA 2GSWA 1KK1A 4Z3DA 2ZVQX 5F4ZA 3LY5A 5KTMA 3SM9A 3H2IA 2AS0A 1QTNA 2BGUA 3RAJA 2V1UA 4I8DA 4AIIA 2ZZMA 4EG8A 3KZ1E 2P6OA 3DE6X 3H8JA 4GLOA 5I51A 2FUG1 1KJNA 1S3GA 4BNFA 5I9SA 2OCYC 3VR4A 1P5JA 1EM6A 1T13A 3OUUA 3NDPA 1J97A 4G36A 3N7UA 3QYFA 4QX6A 3FOFC 1XF9A 4PSCA 2X8LA 4UNQA 3AM5A 3LHKA 4OIFA 3UTDA 4TLEA 1DKLA 1VMDA 3NZEA 3PKZA 1SGWA 4DLWA 1MGPA 4ADSG 3ZU2A 1GN9A 3JARA 3B1YA 4YRRA 1Q20A 2WRZA 2ZP1A 4REQB 2IXEA 2RIPA 1YVEI 1QWSA 2O2IA 3EXHC 4G85A 3EUAA 3ISVA 4TRMA 3GJXC 2X86A 4B76A 5CPBA 5J2UF 3URKA 2NXNA 3HCEA 1KDYA 4Q66C 1XCGB 2PT5A 3G2IA 2EYUA 1T36B 3W5UA 1ZIPA 5AIAA 3GW8A 3AHIA 4D97A 2AJCA 3DAHA 1TM3E 2CNNA 4PO3X 3GOHA 4GUDA 3WKDA 5CA1F 1ODTC 3AWDA 5SZKB 2ODBA 2WYIA 3UMBA 3RT9A 1G2PA 2Y1DA 1NN1A 3F3KA 4O4IB 4OQPA 4EKNB 4RJTA 2XMPA 5K4HA 4HHEA 1AXRA 3BZWA 2ZI6A 2NSHA 1QRSA 2DFNA 4OHPA 1V6AA 3WL5A 3MGCA 4DIKA 3HB5X 1NVVQ 2G7ZA 3W79A 3FWPA 4QT4A 5KU1A 1QG0A 2ABWA 2M6SA 2N3ZA 1Q1NA 2XVAA 5B3AA 2Q6IA 2VO1A 5LL6P 3IT1A 2AVDA 1ECCA 1E92A 2GEUA 3QKIA 1RLIA 1Z34A 3LT0A 1RTTA 5J5AA 4DSTA 2JI4A 3FJOA 5FAXA 3ROQA 1IXYA 4ABTA 4RSGA 3QMWA 5ITVA 1F5SA 1RS0A 1L7XA 3DOJA 3LOPA 4I5EA 3WHIA 2GAJA 2ZWMA 1HTWA 4OH1A 1UFRA 1Z5WA 1ZKMA 1G66A 3CLUD 2RKOA 3TL6A 3PJRA 4MV4A 2BFPA 4J4HA 1Y9ZA 3MJCA 4NBLA 4DLTA 4ZVLA 5IT0A 1EINA 4DLLA 5HKOA 2XYQA 1GQRA 2WHQA 1UJ5A 5CT5A 2EKZA 4O4JB 4EBBA 1Y7IA 2PZAA 4KQGA 5TE9A 1X8XA 1GPLA 1CR1A 4JCCA 4CEIB 3PLAE 2QW8A 1M2HA 4M7RA 4CM8B 1G59A 2QHXA 3A70A 1Y8QB 4KGZA 2YWDA 2DFVA 4N7RA 4NFSA 3AKCA 4R1LA 4X60A 5CUQA 4P6VF 2QX8A 3LOQA 3ZC3A 1KY2A 4YCJA 3ZE7A 5IXSA 3GLIE 1J2RA 2F3UA 3DEFA 1T3TA 2G8NA 1CQZA 1JJ7A 3CZPA 4RO0A 2RHDA 1G41A 1OZGA 2OD7A 3GGCA 1XI2A 1KJ8A 2BRUC 3CLRC 1QB8A 5JCZA 4XXHA 3ZHCA 3BMOA 5FFFA 2VWHA 3WKAA 3N0XA 5IVIA 4KRYA 4YRDA 1W0JA 1X8LA 1P7ZA 3WHPA 4M0DA 5ALZA 2OT3B 4XCXA 1TVKB 1VLZA 2NTNA 2ODNA 3FRHA 5F1OA 1MTOA 3O3MB 1YUMA 2BY4A 4GQIA 4KFSA 4EG0A 2VH1A 1DZ3A 3DEZA 3OEYA 4P4UA 2X6QA 4F38A 1YDMA 3R4CA 4MICA 1A76A 5L7WA 2E21A 1ID1A 4ZVUA 3FUCA 2VNJA 1N2GA 2BKAA 3A8TA 1EX6A 4I19A 1LBQA 1LZLA 1G9XA 4NYJR 4WBXC 4F3TA 3DZKA 2GVNA 4HEA1 4UBJA 1FDSA 4LDZA 5AP9A 1GM5A 2FKNA 4Q3AA 1Q7CA 1GUYA 2NO6A 3D2AA 1K8XB 1DQZA 4GPZA 3KL2A 4MA0A 1UEIA 3A32A 5A5GA 5GOTA 2E6UX 2C58A 2POCA 3KSMA 4IUDS 2YTZA 3L04A 1GPUA 4KQJA 1HRDA 2O8NA 4JI8B 1F7VA 2R65A 1SCIA 4D4JA 3FMFA 5LSAA 5GAJA 3RS7A 2BEKA 1UMBA 3H6HA 3UH1A 3ZD8A 5A4MS 3UQZA 5T57A 1DT5A 4GPAA 3EFEA 4BC0A 2BHTA 2PKQP 2RH8A 1JLMA 1K7YA 3LF1A 1E7QA 1MD9A 2ZI9A 3MTDA 4LPSA 4TTJA 3W5IA 4CKBA 4JB8A 3M6LA 3ZZUA 3LPNA 3ND5A 3BGIA 2BBWA 5CYGA 3TIGA 4HB2A 2QMHA 1UZLA 2HDOA 2VJYA 3HUUA 5TPZD 4HVTA 4OAPA 4UCWA 4QBHA 3EXG1 4YHBA 5JD4A 2XCTB 1GITA 3GFRA 1ADCA 3UWOA 4B6JA 1J22A 2AR0A 5IH7A 1N5LA 3T1HB 1ABFA 1E6KA 2PV0A 5AW5A 1X1TA 3LA8A 3QVUA 1FYEA 4ENTA 4RM3A 1SUFA 1T9CA 3G13A 4AXBA 1OAKA 4B4VA 2IYOA 4H1HA 1GQQA 3OF5A 5LIPA 4GE0A 5ENDA 1XCPA 3CKYA 4EVQA 5IFLA 1BS2A 3UH0A 2HFJA 3MJEA 5TXGA 5A5EA 2IRWA 1M34A 1OLSA 5EVCA 4R7ZA 5JS8A 2OFFA 1N78A 3ZDAA 2CL7X 1Y9DA 2ILTA 3W9UA 3CUEF 1KK3A 2PR2A 3LVQE 1HLGA 3F96A 2AOTB 1GZHB 3EC1A 3CW8X 4G0PA 1NX6A 1V6SA 1HQKA 2R96A 4BNLA 1PDWA 4O2BF 5JY1A 2NYUA 1AKYA 4FHZA 3T6KA 3M83A 4H59A 5K2MA 4ZOAA 3CF0A 1XZJA 3B1FA 3P71T 1EIZA 1EUQA 5BUCA 4ENPA 5FX2A 2XYHA 4FXOA 1EQAA 1M8PA 3U81A 3ECAA 1JKMA 4IIBA 4KJZA 4QYWA 5DXAA 4J9UE 4Y6PA 5J59A 2IW1A 2XJ4A 2X7XA 1FB5A 3WMRA 2VC2B 4QBGB 3WLRA 4X20B 3EWSA 5LXTB 3GRUA 4IDNA 4M21A 3TW4A 4W82A 4XR9A 4YP5A 5ENVA 5C1IA 3NH6A 1ZHOA 2PH5A 2MMCA 4HR7A 3RC9A 2OK8A 2ZKLA 3L6EA 5G02A 1SCJA 1Z8HA 2FSFA 4O4IF 4WUVA 5TPWB 3TG2A 3T99A 3BXXA 1G8HA 3CB2A 2VF7A 1OLOA 4DYHA 1EFPA 3M9LA 1T1EA 2A4MA 4BV3A 1P72A 1YBVA 1DARA 1FDOA 1R27A 2X3FA 1ACLA 2HJSA 4F06A 5EXEA 5C1PA 3AT1A 4MI9A 2VXBA 4OQXA 4HXFB 5HP4A 5E6SA 2FWPA 1JPNA 2R2GA 2EZTA 2J5KA 1PVVA 4X63A 5I8WA 3IP3A 2CXHA 5KVCA 1USIA 1ZK2A 3S8YA 1NBWB 2XJ9A 4HEQA 4KN6A 2PG3A 2XWPA 3FDFA 3OPXA 5EWJA 2X4LA 3EDYA 5KVAA 3OQNA 1E2NA 3FWKA 1DAIA 1MENA 1RBYA 1DQSA 2OGWA 3RR2A 1PDOA 1O6GA 3BWCA 3M5PA 3I52A 4YVFA 4F7WA 3KEMA 1J2JA 4AKHA 2OILA 4DLVA 2D4HA 1JIKA 2ZB8A 4WESB 4J7AA 2VLBA 2VK4A 1G5QA 1NI4A 3DR5A 4I1OA 4IGKA 4L9AA 4OK5A 1QO0A 3U7FB 3I04A 4MIEA 4Q7MB 5KJEA 3G9TA 3R09A 3T3PB 4NQZA 4P83A 1I2MA 3LFTA 1INLA 2H9YA 2REQA 3VPAA 5BRJA 3H83A 3VBCA 3PUXA 4MW2A 5AYVA 4B8WA 4G9GA 3UOAB 4BP3A 4ARCA 3VUEA 1MNQA 4DOMA 5ED4A 4JHXA 4E15A 1RRPA 2RHRA 4YUAA 2YMLA 4QHYA 8OHMA 5HPYB 3K8OE 5ER6A 5D8DA 2IYUA 3K9NA 1ZI8A 4WE3A 4X24A 3DMDA 1T2VA 1QK3A 3K0HA 3OQIA 5IK2A 4O4JF 3B5EA 2VYVA 3TR5A 1SU7A 4GP7A 3V5NA 4UATA 3STVA 2HHHB 3T5AA 3C6MA 1YKGA 3SMVA 3HJTA 4RKWA 4L4SA 1KZGB 3MNFA 1SURA 2W2LA 1Z39A 1DU4A 1U0SY 1UXJA 3DEHA 4IJ6A 4ND5A 4EYGA 1BNCA 3I09A 5EJ8A 5KQRA 2NT3A 3OU2A 3OY2A 3ZZ0A 4RENA 3CN7A 3ESZA 1NBMA 4MS4B 4LHSA 1U8YA 1T5IA 2GBCA 1HA3A 3JTEA 3A6LA 1T5LA 4AQDA 1U1GA 5FBRB 1I3LA 1W8DA 1AUXA 4EG6A 2HDWA 2JK0A 4DMGA 3D3NA 2BISA 1QPBA 3MRSA 2V58A 4EUNA 3GLHB 2JIRA 2YRXA 2Z3ZA 3K72B 4KR0A 3GJ5A 1Q3HA 2JGDA 3JYPA 1XZQA 4IFIA 5CK4A 3VVCA 3QVVA 2PA0A 1MO4A 1YD7A 4ND3A 1K7XB 2LKCA 3JRXA 1LKZA 1T8TA 3E22B 4Z53A 1V8PA 3GFVA 2VWQA 4EMSA 5CBPB 3ZZMA 2REBA 2XB2A 2VR1A 1FSZA 4C0JA 2ZS9A 1HKHA 2A5GA 4QG3A 4B8YA 1VI2A 3OZEA 1TADA 3NKVA 1NVDA 2YFYA 2H59A 1MDBA 2FOIA 3BMXA 1U8EA 2WSYB 3FCSB 4WDQA 4ZK2A 5CCEA 4GMGA 1H5QA 2PL5A 4D0RA 3IFSA 1D7AA 5J4VA 2FU5C 3HR7A 1TI7A 2FFRA 1E3TA 2W37A 3A9UA 3OURA 4IYJA 1JFSA 4WY2A 2DX7A 1O7JA 2KLBA 2W2TA 1SUDA 1ACJA 4JI1B 4EHAA 1ISMA 1BMQA 1P1CA 3EXFA 5AM5A 4FK8A 2HJWA 2HHCA 2VAXA 4YJ2A 3HXQA 3NHWA 2QD1A 1Z3CA 3KWMA 1VI6A 1KYQA 3OJXA 3MGGA 4NBWA 3VTAA 5FP0A 1BEZA 1OBCA 4RKQA 1SWVA 1DT3A 1MV5A 2PLAA 1NWCA 2CNOA 4J0EA 1NMZA 4ND2A 1VLHA 4L78A 1OTXA 4ZI7F 1HV8A 3HFGA 4KB5A 1VJDA 1KZ1A 1PDVA 3P2JA 3V4SA 4YLGA 4BYMA 4WOJA 1U4SA 1IJBA 1QNFA 2O0HA 5C4GB 4IDCA 1RRCA 1Z7EA 4ZXPA 3EXEB 3I6BA 4TTIA 1T4CA 4GSYA 4BC1A 4ME6A 3W3AH 2HF7A 1E99A 1A96A 3T41A 1XRJA 4DIDA 4DKXA 3B89A 2EARA 3Q40A 4G81A 1VL8A 1TO1E 4ER0A 4KGDA 1A8SA 3PYLA 4PC6A 1Q0TA 4HUQA 4QQKA 3SD7A 3OPYB 4PTYA 4B71A 4UE6A 3TQOA 1EJ0A 7YASA 1QQAA 1WSBA 1EHIA 3Q9NA 1PL7A 3FOEC 2DERA 3H18A 3UUEA 1DXHA 3D81A 4LQLA 2ZCJA 4BX8A 2P5SA 3DDUA 3FUWA 5B30A 1CY1A 3I1FA 4H77A 2ZEJA 1V5FA 2PUFA 1QU2A 2BEWB 2ZRQA 3C48A 4RQAA 3LBHA 1QGED 4OIMA 2BAGA 5CM9C 5D6NA 3E9NA 3MHTA 1E9CA 4NONA 2L0XA 4TYQA 2BM9A 2CC2A 3N2GB 1UZNA 2H4WA 3EXIB 2GPAA 5HXAA 1DCTA 1B1AA 2R1TB 5DLPA 3U7HB 2TRSB 3UCFA 3KSAC 5K8LA 1UBHS 2PH1A 2FRDC 3F7NA 3VC2A 3T3NA 3DOHA 3OC0A 3HK2A 1DJQA 1Z6ZA 4TMYA 1BS9A 1CSEE 2WTUA 4BNNA 4KBGA 4X1YB 3WQBA 3VH4A 1ZNXA 3LQFA 1X9IA 3IHKA 5AI8A 3T9BA 2VCYA 2BZSA 2INGX 3DVRX 4FCWA 1EFVA 1EWKA 1QZUA 1JQ3A 5REQA 2ZZKA 1QP7A 2XVXA 3AERB 3ME5A 4NSNA 2Q5EA 1X1BA 1UT8A 1NMSA 5BSVA 4E3ZA 1WXDA 1ARZA 1QQ7A 5F3DA 2B0CA 4KIUA 1IN5A 2GWHA 4ND7A 5DULA 2J5RA 3A6FA 3BWEA 2IWHA 1IK6A 4RA9A 5FPQA 2P9QA 5CBKA 1RM3A 2H4YA 4O59O 4ND6A 2QWXA 3P9ZA 4EY6A 3ZU6A 4MS3B 3P9RA 1W9MA 3NNNA 4CCYB 1HNXB 4BBPA 3THSA 1O94D 1JJFA 3L1UA 1OR8A 4ZQGA 2YY5A 4LW8A 1R9NA 4NMMA 4OLJA 2RI0A 4X3OA 1XRNA 3FKSD 4J6FA 3MYYA 3WGGA 4DBZA 4ALMA 4BN5A 4ZJPA 3LUAA 4XDGA 4YB8A 1C3OB 2H4FA 3HB7A 4ZVMA 5BP7A 1OF1A 2Q6KA 1YFKA 3S1AB 3PDWA 4BVAA 4YRGA 5A06A 1NMQA 1PJQA 1D2NA 5KJFA 1SM4A 2ZYAA 4LBVA 5EIWA 1I1HA 1WLYA 2G76A 3DTNA 5B7PA 5C81A 1UFKA 3THXA 2RGGA 4WVLA 5B6JA 4UEKA 1WV1A 2FRDA 1M67A 3BQNB 1K7CA 2PD3A 4FFNA 1JFLA 1W85B 1A27A 1Q0SA 3I1JA 2JDID 2HZBA 1KI3A 4ARUA 4F1JA 4INPA 2JZOA 4TXNA 3HDJA 1J0DA 1CG6A 2GBLA 5H82A 2YIDA 2IEGA 3IP8A 2ZSBA 3L0SA 1MW8X 1V7CA 2B1RA 4HVAA 3U4AA 2NP7A 3GDHA 1TU3A 2AFHE 4MQLA 4PGFA 2OR3A 1GNPA 3EJ6A 3GO4A 2X8WA 1NLYA 2PE5A 1WZCA 4LGCA 4XLZA 3LFHA 1H2FA 2W90A 3IBSA 3MAJA 4PCAA 3PQ4A 3HXOA 4BVEA 1L5RA 3IPCA 3ADBA 1MLDA 1J0BA 4DCGA 2QTVA 5TQ0A 5K0LA 2EG9A 4O3FA 5DLYA 5TRTA 2WIJA 3KKMA 2GYUA 4R9UC 5JNSA 3LLMA 1LC0A 4CT5A 2BFOA 4H35A 3LI2A 2DPHA 2FVYA 2OHIA 4B74A 1L3IA 1ODLA 3DBHB 4YPFA 2F64A 2Q3MA 3W4IA 2DBYA 1FPQA 2X0KA 3HN2A 3VZPA 4DV7B 2P9GA 5CA0F 2DHEA 4RF4A 3AF5A 2BHSA 1TA4A 3QFTA 5P21A 5BVHA 5JCPA 2ONZA 1OYYA 1E1KA 4FJ0A 4L6CA 4HLUA 3GLIB 3FVRA 2PXCA 4RPJA 5CXSA 10MHA 3ZDQA 2IYSA 2GA9A 2DF8A 2XT6A 2AUNA 4NBRA 3DDHA 2D0IA 1J2EA 4ZO9A 1VPDA 4NHEA 1GEEA 1X1AA 5G4KB 3PXEA 1D09A 1FIUA 1N2CE 7ADHA 3I34X 1VSUA 4QFCA 3RRMA 2Y92A 4J2HA 4BUJA 1XROA 3C6YA 3M6WA 3ZGOA 3L6BA 2EP7A 4LJ6A 4CEJB 2P2CA 4BZXA 1NPYA 2ORWA 1HOXA 3F7OA 1YOVA 3HXPA 2JCVA 3MXTA 4M9QA 2FEAA 1ZVJA 3ND9A 1SBTA 4HLDA 4X91A 5E4TA 2YN0A 1SCQA 4TSFD 2PIDA 2LIPA 4BNIA 2C5LA 3AKEA 5J4KA 2GVDC 3ZUPA 1PL0A 1JNXX 1AE1A 1ZEMA 2NUAA 3COPA 3WWZA 2O6HA 4BEJA 3I9V6 3MSCA 4LZPA 3W6ZA 5CIYA 1II0A 4IDOA 2HJRA 5HCIA 2LCIA 4EY5A 2XQIA 3E4DA 3QWIA 5JE8A 4LWOA 1YZKA 1M1YE 2QZPA 4RGVA 3EDCA 3ORSA 3WL7A 1Z9BA 2BT4A 4OHZA 4YRCA 4ZYYA 3ITKA 3FHTA 2OSVA 1PNTA 1X9GA 1YONA 2QGFA 2D5LA 1YQ9A 5D2CA 2WB2A 2Q4OA 4J1TC 3WLPA 3T0FA 3L7DA 4U2GA 2OXCA 1CUDA 1XCOA 2X7HA 2DETA 1DXYA 3JY6A 4S0ZA 1NSTA 1F3LA 4DG5A 2HQ1A 4JXXA 2ODEA 1UWKA 4LYJA 5E95A 1YS1X 2P7HA 2GN0A 5AJWA 2I1LA 5CAEB 2I0FA 3ZW9A 4EATA 1SU4A 3BF7A 2GZHA 2Q7XA 1JQKA 3CF4G 1GAEO 4G5OA 4EQ6A 1SZCA 4GHWA 2VXCA 3L7JA 4L5AA 2HJVA 2Z1DA 1OWPA 3HPQA 1GL9B 2C42A 4YUZA 4MYCA 1JJVA 2OBMA 3N6RA 4HDMA 2J85A 4JLDA 1IZ8A 4O33A 3T5TA 5IASA 2GF9A 1YVRA 1DADA 1E2PA 1UMCA 4LF7B 4PZDA 1ML3A 1EH5A 1IDN1 2CF5A 2Z4SA 5BVGA 4U9UA 4UM8B 2NZ8A 1SMKA 1RHKA 1ZCAA 2G17A 4GVLA 1QX3A 1XJCA 1XQXA 3KT3A 1JTFA 1KVSA 1LSJA 2PUVA 1Q95A 2VYFA 1J99A 2VDPB 4F45A 2ZPUA 1OWMA 1XRQA 1KJZA 1Y9JA 2WIDA 3CIFA 1GU7A 1NZDA 2XD9A 3AFGA 1AA6A 1P1BA 1YRYE 1YB2A 2QI9F 3OMWA 1IHXA 3NOQA 1X70A 3NMUF 4RH3A 1J23A 3KRTA 4LC1A 1BQ4A 2PD4A 3MCTA 4RHFA 4ZU3A 5HDBB 4DMMA 1FJGB 5AOAA 1POXA 4PSVA 1Z4KA 2BUBA 2IY8A 2Y1CA 3C4JA 4QOHA 1CR0A 1OKKA 4R2LA 4R69A 4UHEA 4QVIA 5FT9A 2OD9A 5BV8A 4UJ3A 4UVHA 2D1QA 2FI1A 2VPTA 1IIBA 3VJLA 4DVGA 1TYBE 1Z75A 3RSGA 3VPFA 4PE5B 1A9YA 1Y6JA 2C8JA 2C88A 3R2JA 1PJRA 4LF9B 3AHDA 3K5WA 3ZQ6A 1IQRA 1HYHA 2GBIA 3A3NA 1DUSA 2IY7A 3K1AB 1KH3A 4J1TA 1D0SA 5CEEA 4UBNA 2PIAA 3GPCA 4N9QA 4Q1CA 4MVJH 3EA5A 3H1PA 1MJGM 1CJUC 3M1IA 3MK31 5K8IA 2PUTA 1EUDB 4FSHA 4C0SA 2R1VB 3TN7A 3ES9A 1HE1C 1A04A 3QUQA 3GD5A 1EFVB 2IP2A 5G1NA 3ROKA 5CITA 3LHIA 5FBQB 1VJRA 1UDXA 4FKZA 1ZK4A 3DEJA 3G9ZA 5SZHB 1ZZGA 2ZBGA 2ACKA 4B17A 4E70A 1IEVA 2UVPB 3P27A 2DYKA 5BW8A 3HBLA 1GLGA 1WCIB 1PO7A 1UT5A 2COKA 4FGLA 4TZKA 2C9MA 1E9EA 1T3LA 4DQ0A 1NPTO 4KLNA 3IEKA 4DZRA 5KJ6A 1O6FA 4PXSA 3EVGA 1SQGA 3PC2A 4UHJA 1ADFA 1OFHA 2QZZA 4PICA 4IMJB 4N4AA 5CLQA 1R0XA 1H2BA 2PJUA 3LUDA 2WAOA 1Z68A 5I4KA 3LDUA 2JARA 3AVOA 4G0XA 3VDXA 3LZCA 2DT5A 1ZGGA 4D9KA 4DQLA 2XVZA 1HSOA 3NHKA 4UAVA 3WGHA 1V16B 1R64A 2HXYA 1RADA 1TF5A 3G0CA 5CX1B 4BO3A 3KR0A 5E6RA 5JSZB 4CYMA 3RT7A 4JR0A 4GOXA 2WWIA 4L7QA 1II8B 3WQHA 5B6IA 4ERXA 3GPBA 1HH4A 1T2UA 1GTJ1 1E1QA 1CDEA 1YMUA 3NW9A 3IH5A 3QX7A 5KB3A 3CW9A 4YJ2F 5E4FA 1RCFA 2B37A 3TRDA 3JSXA 1RZUA 3ITEA 4MCJA 4TMVA 2H1CA 4FOSA 4NAVA 1IWBB 1QFXA 3KQTA 4DA6A 3T7DA 3INRA 4ZOLA 1U90A 3CX7A 1YQEA 2PZ8A 3AOGA 3TD9A 4NV3A 4ND8A 3LC1O 3UMCA 4A2CA 3AIMA 1Z4QA 4V39A 5I7EA 1WHSA 3AEQB 4KYIB 3TOCA 1P6UA 1X7YA 4HWTA 4N01A 4OYLA 1KZ9A 2ZTMA 3ZE8A 4J1QA 4RPKA 1DWOA 3LTNC 1ODKA 2AQKA 2GH1A 1NFRA 2C2WA 3GDOA 3E84A 3HZHA 3O3NB 3ZHBA 5ELXA 1QG6A 1QHIA 2D0PB 2OV2A 4BAGA 2LD4A 1YB5A 2V5UA 4N8DA 1IFXA 3ZY4A 4Z0PA 3W9YA 3ZIAA 2B4TO 3CPEA 3USES 5BNFA 1NNEA 4FILA 2GB4A 3GRCA 1QHYA 4H7PA 2NO4A 3HUEA 4U2BA 2BZ0A 5KJCA 3GJ7A 1IY9A 3GJZA 2FSSA 2IPNA 5JYDA 1SHLA 4GI7A 2GJ9A 2ZR8A 1W59A 1PR1A 1VYVA 2JFWA 3IT2A 5EYPB 3SBEA 2TMDA 2R25B 2IOHA 1CQJB 3IUQA 3TCNA 4S05A 1QYIA 1GYQA 2F17A 4ZVPA 1WS6A 1L6IA 3EGCA 3TQTA 4DIUA 1JKIA 3LNTA 3RD5A 4A9AA 5LD2B 2I66A 4OYYA 2PBRA 3SK0A 4ETIA 1QO7A 4PS0A 3NEAA 1EBUA 3EUWA 3ZJ5A 2IEAA 4TKUB 4HQOA 5FDFA 2XCSB 2Q5HA 1P44A 3NHRA 4J3NA 5IFKA 5KYWB 1MPXA 1R0LA 1Z88A 4OY3A 4TS4A 2JI9A 5DNAA 2Y0PA 3HL4A 5EN4A 9LDBA 2VPZA 3NC0C 1Y6QA 4BRUA 3DAGA 5DYGA 2WJYA 2C82A 2OGUA 4IXMA 3AONB 4TKLA 4C7JA 5IZCC 3H3FA 4H60A 3P32A 5ALOA 2O1WA 3MTQA 4D02A 2HADA 3S2EA 1KIFA 1U4OA 1LWNA 1XVTA 3OTOB 2B9EA 5JNUA 1NJSA 4UUQA 3CH7A 5BO5A 3A6HA 3SU8A 3ZWMA 4XIFA 1O0BA 3KQMA 1RWOA 5TX7A 2HIGA 5LDGA 1IQ0A 3QYJA 4QJBA 4WOBA 3L8FA 4OP3A 4WBNB 5FPKA 1Z5UA 1DHTA 2XSZA 1DIRA 1H0SA 2YWGA 5FWNA 1XVLA 1B8PA 4DARA 1EZ1A 4Z9BA 2FOXA 2JHCA 2HPAA 3AUFA 3W2TA 3SWWA 3UMMA 4XE5A 2XTAA 2VYND 2EYQA 1AK1A 3AW8A 1BMFD 1JLLA 1ZJ5A 4UEJA 2C2OA 4Q9DA 4LHEA 2HOQA 4DXHA 3DZFA 2AN4A 4EJSB 4GX2A 3V1MA 4J7XA 3ZWBA 5FR2A 4LCJA 2WF6A 5DX1A 5EE0A 3WLEA 2BMJA 1L4YA 1R4MB 1SRRA 2BMVA 2DQZA 3L7BA 5LQMA 3U31A 1X3SA 3DHYA 1CT9A 1ENOA 1TKAA 3JWHA 3M2PA 3X1WA 3PUJA 2Q6LA 3V3TA 4HWPA 4JI3B 3VOBA 2EHDA 2QUKA 3BQMB 3IT0A 1BC5A 3OZGA 2WFZA 2YXPX 4KN9S 1G8GA 3UC9A 1NW5A 2W0MA 4KQCA 1XLTC 2GEBA 4G8BA 4HATA 4LOAA 2ZTVA 3I9MA 4QODA 4QVGA 4R81A 3ZJ4A 1V8FA 2DE0X 4HH0A 2ZLBA 4MVJG 2P5YA 1O6CA 2IWRA 3L1IA 2PSJA 4GKJB 3TPFA 1KETA 1E6LA 5EUQB 4L4ZA 1WRBA 2F3QA 2G07A 2IF0A 1QFJA 4BB6A 1L5YA 2JL1A 4NRDA 4PU0A 4MUKA 4U7HA 2V9PA 1ULUA 4RK6A 4NCIA 1F0NA 2R68A 4BJ1A 1KTIA 3L1HA 5IZCA 4IXNA 4HVCA 2QYOA 4F2HA 1RAAA 1YZFA 4XYGA 4O4HA 1SIOA 2VHCA 2ZRIA 3LUGA 4HOYA 2FPLA 2JASA 1C9NA 3EUFA 1P1HA 3NQ41 4Q1EA 1X7ZB 3JD3A 5FEMA 1UMCB 2ZJ0A 2CE7A 5M3BA 3RARA 4C07A 3COWA 5T5QA 4C4RA 4FW8A 4OX9B 2NM0A 4GFDA 5GPBA 5B1YA 1K08A 4KDEA 2WWHA 4BO4A 1U02A 1K27A 1OUMA 2ZAIA 3L7LA 4Q7QA 3FIJA 2CNDA 2C0PA 4GBMA 1AB6A 2C1ZA 4JXKA 1CV2A 1AA9A 3MM4A 3LBNA 2Q46A 4AMVA 3TVTA 3P9KA 4MWDA 4D80A 3RYCA 3KTOA 1N2CB 1BDMA 3OZDA 1Z74A 4JUFA 4PFKA 4HDRB 4DV0B 1GAJA 4CKCB 2IBSA 4K9RA 5FNVA 3WLLA 4PZLA 1H94A 1ZUHA 3AXTA 1TQHA 2ZSJA 3F5MA 4DLUA 5H0IA 5SV2A 3UVEA 4BGIA 4ZDKA 2NU6B 3T1QA 2W7TA 4X1OA 2B8NA 3W90A 5KNCD 2WPNA 2YHIA 1NC1A 1E98A 5EHGA 2VK8A 2WF7A 2Z09A 1CY8A 4X20A 3EWNA 5LJLA 1JR3E 4HO1X 1A2BA 3AEKA 3OZIA 1KZ6A 4WLEA 4NBVA 3K15A 5AVQA 4HXEB 2CCJA 2DFLA 2RFLA 3HR8A 4K9QA 4PO9A 1ULZA 3LUHA 5HZKA 3AI1A 3L4KA 1X77A 2RB4A 1P1KA 1TVCA 1ZA2A 2CLMB 1C4XA 1I4OA 4JASB 3ZE0B 3BCHA 3BL5A 1O4WA 5EMKA 2OCGA 4F71A 3KJXA 2IPOA 3B36A 2GCOA 3AM3A 5B7NA 3DXXA 4D43A 5JS7A 1ORIA 2JKYA 3L6UA 1GRRA 2JLWA 3SX4A 3EOAI 2P8SA 3UMYA 4Z0NA 3IE0A 1Y4ZA 3H5LA 1PR6A 4DC9A 5HM8A 1KWGA 4OYHA 1IU9A 1T3HA 2C98A 4HAWA 1JHOA 3T9FA 1E4OA 3QFHA 1OAAA 4X90A 1IXKA 4BJHB 2XA9A 2ZXUA 4MIKA 3UWSA 4U00A 4UD2A 1OW3B 2AMJA 5HBGA 3F6YA 1N3IA 4DMUB 3VPSA 3L77A 5JNWA 3QTLA 2ONYA 3IMEA 1CS0A 2QX9A 4FHCA 2QLBA 4M8LA 3Q6MA 3T7RA 4C0HA 3WWPA 4AY2A 2OCAA 1MB9A 1Y3DE 5DCLA 2I6GA 2DLCX 3ZD7A 3IVMA 1T0BA 3NONA 1TXGA 2OVBA 1PD1A 4Q3EA 1VG1A 3JQ7A 5CG1A 4AYXA 2IUEA 1II8A 1Q1AA 4FFRA 4IIEA 5C5EA 3EQ9A 3AJRA 4QEKA 3L79A 1Y42X 1A8UA 5I47A 1IHUA 1LSUA 5EXDA 1N9GB 3KUKA 4HB4A 4D82A 1MB4A 3I5MA 1BXRA 4BCBA 3Q4GA 3IT3A 2YC2C 1JDNA 2EFGA 4IMIB 4OSPA 1CC1S 3L6CA 3RDPA 5KWIA 3VR6H 1IBKB 4GWLA 2J3IA 4R2MA 4UDOA 4L28A 1LTQA 4DZZA 4HD8A 2RSLA 3BSWA 4J0QA 1AGNA 3NLLA 1KEEB 2IHTA 3EGEA 1F8GA 3R5SA 4MI1A 2JIZD 5KQMA 1YQQA 3DB1A 4JU8A 4W8OA 4UCXA 1WNFA 3U9LA 1MO5A 3R3ZA 4Z49A 1A4RA 2G36A 2HUNA 3B8EA 3IBCA 1H1LA 2CK3A 4F8JA 3WAKA 1C1XA 1V6CA 4IDHA 1MXFA 4FTWA 4I81A 3K73O 3MWGA 1Q2UA 2IX9A 4TL9A 3NM6B 2DUMA 1FF9A 1YGPA 3CLSD 3N8KA 4WERA 1W6UA 3RADC 2JFPA 4R9RA 3SYLA 121PA 1JDUA 1DX4A 3B53X 4G86A 3U7GA 1D4FA 2IEYA 3WKBA 2YWEA 1E62A 3T1YB 1XR3A 4HNVA 1EHCA 2I65A 3LUJA 1Z0IA 2GLTA 1VHTA 1AGYA 3Q3CA 4O2AF 4QUKA 2PL1A 4XQGA 2B6HA 1RI1A 2RGNA 3AKDA 5TMBA 4AICA 4ITVA 1EP3B 4FBMA 5B4VA 5CHYA 4CIWA 1NU8A 1NW9B 4ZYXA 1K5GA 4GMKA 1SCUB 1OFUX 4PG7A 1NR1A 5CYPA 3TL2A 2AG0A 1CIPA 1B4DA 1XG5A 4RH0A 1M5UA 3WG9A 2I6UA 3YASA 1SVSA 3D64A 3RW9A 1EXDA 1NURA 2D54A 4WT7A 2IELA 1ZC3A 1H6AA 4HNTA 2WI8A 4FUQA 2RGDA 3OTQA 4H7DA 5CJPA 2AFRA 1W9HA 4HG2A 2O2CA 2YICA 4R1SA 1QIDA 1RZVA 3E48A 2GXQA 4MV6A 3W5HA 1AXGA 2CJXA 3CLRD 4ED9A 1L8XA 1DWPA 3IB6A 2MSLA 3OOWA 5DM1A 4DXDA 5EIXA 5AKZA 3A3OA 8MHTA 5JFOA 2F1OA 1NXWA 2JAWA 4OD0A 3EOZA 1H1LB 4WEQA 4KXFB 4BKQA 5LXTF 5JMWA 1NV9A 3BXOA 2WT9A 3RS4A 1GKUB 3V8MA 3IAM6 2Q8QA 4R8RA 3KVYA 4EA6A 1YZQA 4EHBA 1YRQA 2VPXA 3DD1A 3I6ZA 3A9TA 5EP4A 3EDMA 3W05A 5LKRA 4K6OA 1CUWA 2Y9MB 3EVFA 4ZCIA 4C7KA 3HCWA 2DULA 4FDUA 4HFJA 3G0IA 1NLMA 2NPOA 1CVIA 2XB4A 3AMVA 3CE6A 3EXEA 4FFMA 5J5CA 1FPMA 1G8PA 4FZ3A 5AKHA 4DCVA 5TIIA 5LMZA 3DA8A 4RQUA 5CTJA 2FK7A 2QG6A 4OQ4A 2B35A 1TNDA 4UTZA 4ZCQA 4UOEA 4L22A 4MJXA 5JJIA 2HY7A 2YNMA 3E5NA 5ADHA 2XIJA 3CRNA 2XQKA 4LAFA 1JKFA 3QHQA 4DLRA 2YS7A 2ZAMA 3ZE1B 3DT8A 3DV0B 3OTHA 1XDDA 5AJUA 2G4CA 2ICAA 3MEQA 5P8WA 2CKMA 4YNBA 4A1OA 4N03A 1QANA 5J1TB 1JPJA 1Y3BE 2JNWA 2OXRA 4ZYWA 4TS3A 3VRHA 4D9FA 2BKEA 3FM9A 2X4DA 3DFMA 3L8MA 3LO5A 4QATA 4RXUA 5DN9A 2OUKA 3TGPA 5AVJA 5FL3A 4OMUA 3P0RA 1ECGA 1F2UB 2EX4A 3ZK9A 5EFOA 3R0VA 1BD4A 4LVCA 5TS3A 2QUIA 1P3DA 2OB2A 3QIVA 1UJ4A 2JCBA 5JS1A 1LXCA 2KI5A 2G4LA 1N9ZA 2AOXA 2XWSA 3F7TA 4UARA 3OCXA 1K5DA 4C6TB 3MJTA 5FR1A 5BMVF 3NP7A 5HJEA 3VZRA 3SSMA 3UK0A 2PWYA 5KYNA 3UGQA 2CLCX 5CDSA 2D2FA 4HNAA 1AM4D 5KUTA 4F72A 1GTL1 1KJJA 3UJ7A 4M1YA 3DGEC 3MS2A 1UM8A 2R7MA 2MINB 4PFJA 1J5XA 3ETDA 4N5MA 5ES3A 4B3BA 1ORVA 3SZOA 3EZGA 1RTKA 1VG0B 1Z0KA 1B6SA 2VA8A 4JYCA 2PLFA 3RIMA 3JWEA 1Z83A 1FX1A 5L95A 4PINA 2VJPA 3HL0A 4DADA 1USVA 2LE0A 5DZSA 4HH4A 1BRMA 5AW2A 3TVYA 4S04A 4IG9A 2AYXA 3CLUC 3OE7D 4RZHA 2G1AA 2QM0A 3CUVA 3AHJA 3KQSA 1A9SA 4PG8A 3LKZA 3R3SA 4HDRA 2H29A 2XUIA 3WYGA 5HE8A 1NA5A 4ZVQA 3R74A 4F4IA 3GU3A 4AYWA 1S2OA 1YZLA 2VF5X 1L4HA 1R3DA 1XJWA 3BFJA 2PJDA 1QHXA 3EISA 1HDYA 1LQUA 5EINA 5BYBA 4G5RA 4Q24A 4DCOA 821PA 4LF6B 1DGQA 1OA1A 1UQRA 1TJ5A 2RI6A 2OAEA 1T2NA 3H9QA 3O90A 4O08A 3UMSA 1C30A 4CXMA 5EQDA 4BKMA 1PEKE 1Z37A 3Q3VA 1YDEA 3X1JA 1GFSA 1JLKA 1XWFA 4KEAA 3ICOA 3M1YA 5E2BA 2OFWA 3ZCXA 1ABBA 5IANA 3FE2A 5CVCA 4EVIA 3I2IA 1Z62A 3KE9A 1JDPA 1DQYA 2B25A 2AD1A 2R4UA 1E2IA 4OOFA 3FVQA 4Q7EA 4DY6A 4GRIA 1CUGA 3BXHA 3W1WA 4MXDA 2BKUA 3M5DA 1Y9EA 4Y6OA 3LH5A 3MWDB 1IDOA 3IURA 4IINA 5EUCA 4RKYA 3V1UA 2CUZA 4GKKB 4GX1A 1ZHHA 2Q0QA 1ORHA 3UKOA 4KWEA 1IN6A 2R9VA 2B4AA 4Q48A 5EHNA 1GDHA 3OFJA 2Q7OE 4F46A 5I4BA 4L51A 2QR3A 4ZVNA 4PAMA 3U4IA 1N5JA 1P4HA 1KXJA 2QPOA 2YBEA 3HCDA 4NG5A 4UTXA 5K0NA 2GM5A 2GM4A 2UUOA 4R8LA 1CUHA 2JFYA 2O5CA 3LWBA 1YZNA 5F7JA 2IGTA 1KTVA 3OTIA 2VNKA 3R6GA 1UPBA 4UCFA 3FMGA 4AZWA 5JAMA 2YJNA