4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
4OB6A 2OCGA 2FUKA 5ALRA 5C8XA 2O2IA 1L7AA 3WYDA 4BE9A 1EHYA 3AUKA 2BAGA 4ZGBA 3D2BA 4TGLA 2DHCA 3G8YA 1CUEA 5C8ZA 4QEKA 1LPMA 3EIOA 3V1KA 4XVCA 2V97A 4Y2VA 5YASA 5JATA 3OG9A 5AKZA 4JH0A 2YASA 4BP9A 1YB7A 3SC2A 4QDOA 2QOEA 3BWXA 2DSNA 3F96A 2PSFA 3VISA 4FBLA 2WQZA 1RYYA 1A8SA 2DHDA 1N8SA 1UZAA 2XMQA 4LYEA 4OB7A 3WL8A 4INZA 3IB3A 1AMNA 4H7DA 4B0OA 3VDXA 2BFNA 3AIKA 1LPPA 4BZZA 1W76A 1TQHA 1XKTA 1H22A 5LIPA 5DNVA 1E66A 4G4IA 3QPCA 3AZQA 2B61A 3CXUA 1GKKA 1WPXA 2HA0A 1CUVA 2XUAA 1F6WA 2WLSA 3BJRA 1CUYA 4OCZA 4YK7A 1GQSA 4FFWA 3WK9A 4QZVA 3C87A 3LLCA 1U2EA 4A5SA 5AP9A 4LXHA 5JZ9A 3PI6A 2HL6A 5K3CA 3PF8A 3B5EA 3VKFA 1W4LA 3AZPA 4DMFA 5HKAA 3WK6A 1DWQA 5AI9A 4BATA 3V48A 2YH2A 1U4NA 2QVBA 3H2KA 4QLAA 1CUFA 2XMCA 4DGQA 4BCBA 4QE3A 2WTMA 2O2HA 4OYYA 3BL8A 3D2CA 3A2NA 1DQZA 4BCDA 3OOSA 2ZYSA 1MTZA 4UBOA 2BCEA 4YX9A 1U65A 3F98A 3R0VA 4GLBA 2Y2VA 5JALA 1E89A 4DMHA 5HK9A 4X3CA 4L3WA 3WKDA 1J07A 1WB4A 2Z5GA 5AKEA 2B20A 5EHXA 3PE6A 5AM1A 3W05A 1BRTA 1OCEA 4HRXA 5JADA 2IIVA 2ECFA 1P0MA 3GA7A 3C6BA 4C01A 2XUGA 3JYHA 1QIMA 2AJLI 1KU0A 3VJMA 5E4TA 4W1SA 4UHDA 1QOZA 4X00A 3DOIA 1ORWA 5AIBA 4G8DA 1UOOA 1LNSA 3H2GA 4DNFA 3WKEA 4C4YA 3EBLA 1JJIA 2IX9A 1X2EA 3PUIA 4J3JA 3QVMA 2ZJFA 5K3FA 1ZI6A 1BE0A 2CMFA 2OLEA 3L1IA 2WG1A 4W63A 3D0KA 2VATA 1GGVA 6YASA 4Y2TA 5DWDA 2ACEA 2QRUA 2HU5A 4AQDA 2BGRA 5AO9A 4HRYA 4B7ZA 3JW8A 2WIGA 4Q3OA 1RWQA 1K4YA 5BOVA 1AQLA 5CT9A 4ARAA 2WM2A 1OXMA 1MX9A 3V1LA 2PSDA 3FCXA 1E5TA 5LZ2A 4KE7A 4QA9A 1UFOA 2CJPA 5CT4A 3VJLA 1MNAA 3UUEA 5HKBA 3LIPA 3HZOA 3OPMA 5HZGA 3W06A 1WCYA 5LZ9A 2BJHA 5FPQA 1C7JA 4M0EA 4ZRDA 3AINA 5LYYA 5K3AA 4WJLA 2OGZA 4N8EA 2VT6A 3FOBA 3FYUB 3LS2A 1LBSA 4X97A 1C4XA 3FYTA 3WWPA 3OTQA 5EIAA 3ESAA 1DU4A 1DWOA 4CIAA 2VAVA 3WA7A 2V98A 4N8SA 1XZBA 5IVDA 2B9VA 1WOMA 2VTVA 2GZRA 4GI1A 3GFFA 5AHXA 4UHBA 1EINA 4LXIA 4B81A 4S0XA 1IMJA 1FFDA 3G0BA 1BEEA 2QS9A 1GZ7A 2ZSHA 1IUPA 3IA2A 4LXGA 2H9YA 4EY7A 4MWTA 2JEZA 4DM7A 1N5RA 2OGTA 3ZPXA 1CUHA 5CT8A 4Y2PA 1QONA 2WFLB 3HJUA 4QLOA 1YAHA 2WHQA 1BCRA 3V1MA 1G5FA 5KREA 1ORVA 2X76A 1ZICA 3DEAA 5I7UA 3ESDA 1LPOA 3R3YA 4LIPD 2HDWA 5EFZA 4RGYA 5FP0A 4HAIA 3H19A 1HBJA 1BCSA 4UBLA 1A8QA 3O4GA 1UK6A 4FMPA 1Z68A 5AKGA 1JKMA 1SCIA 1T4MA 4C4ZA 2EDAA 1TCAA 5C8VA 3W9UA 5A7GA 4Q05A 4X92A 3O9MA 4J03A 3E0XA 4EZIA 1J06A 1B6GA 4PSUA 1XZCA 4QDTA 4BTVA 3M83A 2Y6UA 1J2EA 2FX5A 2RIPA 2DQYA 2RGUA 4EB0A 2Y1KA 2WFMA 4QDZA 4C6HA 1F0NA 4Y2SA 5DYYA 3IULA 5CXXA 4UFPA 5LZ4A 4XJVA 4DTCA 1MPXA 2WILA 4A23A 1F8UA 3G02A 1XZJA 2Y2UA 3HLKA 3RM3A 4FDMA 4WFJA 5CT5A 2K2QB 4B85A 5KWJA 2XMGA 2ZSIA 4K6GA 5AK6A 2JF0A 5HFAA 4GEGA 4MQLA 3KWJA 4HS9A 1EDEA 1L7QA 5SYMA 1A88A 5LLSA 1XRPA 3W04A 4X71A 5EHQA 1QZ3A 1FFEA 4KE6A 3HABA 5BWCA 1OILA 3YASA 1ZOIA 4J0IA 4UHHA 3F97A 4BRZA 4DSAA 2I3DA 4LKOA 1PJAA 3Q0TA 2VA9A 5JZBA 4GXNA 2WU4A 4P93A 3DKKA 4K2AA 5J3JA 3X3HA 3SK0A 4CCWA 2WUGA 3ED1A 3R3ZA 2XE4A 5I9IA 1MN6A 4IO0A 4UUQA 3ILSA 4JNCA 5HF8A 2PM8A 4UFOA 4TPKA 4AO6A 3OC0A 5A62A 1LPNA 1G4HA 5LZ5A 5EHNA 3WK8A 1VZ2A 2XUJA 4AB1A 1CUUA 5ALQA 2XB6A 4DIUA 1YS2X 3C5WP 3QPAA 1QGED 3GROA 5A7HA 1O6GA 1BN6A 3IUQA 5JANA 3RKSA 1ZD3A 1DT3A 3O4JA 3WYNA 5FUMA 1R3DA 3HSSA 5EHZA 2XDWA 2W22A 5T4FA 3QH4A 2NW6A 4FNGA 1EI9A 2C0PA 3BIWA 1DX6A 2AJCA 4AZ3A 1GXSA 2Z8ZA 1CUXA 1VE7A 1XZAA 1W75A 4NMWA 1AZWA 3H04A 5AKIA 3WLAA 1EXWA 4BTLA 3QMVA 2UZ0A 5JASA 4KEAA 1TCCA 3RK4A 1B41A 4F21A 1SFRA 2DR0A 2WIDA 3WK4A 3GELA 3K2IA 1YA8A 2WFLA 3DKRA 4ETWA 3ANSA 3SX4A 2VQ6A 2XUOA 5K3FB 5T4HA 2Z3ZA 1F0PA 5FRDA 4EBBA 4X85A 4KE8A 4PV7A 2GYUA 2WKWA 2O7VA 4OU5A 1AGYA 3HXKA 3DL4A 2PKYX 2VJAA 2AJ8A 3I2KA 1UKBA 5AOAA 1TRHA 2PSJA 4DMCA 3K9BA 1QIKA 1DX4A 3HACA 4WY8A 4NS4A 1L7RA 2PUHA 4N5IX 2XQJA 3I2IA 5H3HA 2PU7A 5JAOA 5JD4A 3IUNA 1ZD5A 3H2IA 2QR5A 1D07A 1VJ5A 2JIDA 1UK7A 1JT2A 3C6YA 5EGNA 2VJBA 4G4GA 5AI6A 2J3QA 4ZWNA 5CURA 4F0JA 4KAJA 4OPMA 2VJCA 1EVEA 5DYWA 4N5HX 3WWCA 4QDUA 1DWPA 1EK2A 1CIJA 4X94A 1MAAA 2PPLA 1THGA 3BF8A 5JAUA 1ETHA 4P92A 5CRIA 2PBLA 2OPHA 1ZIYA 4BDSA 5LZ7A 3C70A 4HTAA 4I3FA 1H23A 2OAEA 2QXTA 1QTRA 1XZIA 2C0QA 4QWMA 4GW3A 1CV2A 1VKHA 2VF2A 2C7BA 3A2LA 4C87A 5ALGA 3DLTA 5ALOA 4ZI5A 3FLAA 4C89A 1QIDA 1CRLA 2XUFA 1CUJA 4P9NA 1MT3A 2HA3A 3A70A 3CCBA 4KACA 1JJBA 3H17A 1JFRA 4CI9A 3PUHA 5AH0A 3WWDA 4Y7DA 2D0DA 4J0HA 2XUQA 4AN1A 3WKCA 5LZ8A 3I28A 3STYA 4M0MA 1A8UA 5CBKA 2AJDA 4U2DA 3E4DA 3STTA 2HRRA 1TIBA 1H2YA 3NWOA 4J0CA 1CUGA 5HK8A 1MX1A 5AKHA 3EQ9A 3HC7A 3WIOA 2HA7A 1UK8A 3MUNA 4PSCA 4Y2JA 2GZSA 1UOPA 3NUZA 1VLQA 4Q82A 1K63A 4B9EA 4U2CA 4DNOA 3ZI7A 2G5PA 4QNNA 1R50A 1QIFA 3I6YA 1WB5A 4BVLA 5ALKA 1X70A 1P0QA 4FOLA 4PSDA 1QE3A 5ALZA 1UXOA 4MYSA 1SCQA 2EDCA 1ODCA 1T2NA 3L1HA 2XMZA 4MYDA 2X8BA 1ZJ5A 5AI5A 3I6MA 4OB8A 4PNZA 2XLCA 3UMJA 4WFKA 4AMZA 3FYUC 4U2EA 1HQDA 4X7BA 5EIHA 1GPNA 4LYDA 1H2ZA 3U0VA 2RHWA 7YASA 3F9CA 4OYLA 1P0IA 5HF5A 4AMYA 1YS1X 3DD5A 1BEZA 4Q1VA 3E3AA 3HI4A 3N2ZB 4GWLA 4OD0A 4BBZA 2JGFA 5JZSA 2VT7A 2GBIA 4H7IA 1E8MA 1VE6A 3O9VA 4WCVA 1LZLA 2ROQA 2QUAA 1X2BA 2QMQA 1Q0ZA 1RP1A 4G1FA 2XMBA 2DFPA 3PF9A 5JARA 3R3UA 5D7BA 4XIIA 5AKXA 3O0DA 3I2HA 3WL5A 4E11A 1QIEA 3NGMA 2WTNA 5K3EA 4RE5A 1LPAB 3FNBA 4H7FA 2PSHA 2C5FA 4I4CA 1AUOA 2WHRA 1ZJ4A 2I03A 1VXOA 5A71A 1XFDA 3M81A 2DHEA 3IUJA 1K6EA 1H2WA 1XROA 5FOQA 1UK9A 3O4HA 1CUAA 1K5PA 1S8OA 4J0JA 4HXFB 5AK5A 5DTJA 2Q0XA 1THTA 2WJ4A 2GYVA 4QDXA 3HYSA 4CCYB 1MX5A 1PV1A 3G0IA 4OUKX 1ZD4A 3VVLA 3IDAA 2PL5A 1Q0RA 4BAUA 2OG1A 1G42A 5CT6A 4B0PA 1K8QA 2FJ0A 4UBMA 4Y2QA 4QWWA 4H0CA 1E8DA 5ALDA 1QJ4A 1EH5A 3FVTA 5ALEA 2H7XA 1JI3A 3ICWA 4BP8A 3EQ7A 3WWEA 5ALXA 5ALHA 3BJMA 1UKAA 1CUBA 3B3QA 1XZDA 4ZV7A 3WI7A 3FCYA 1SCKA 3WA6A 1ODSA 3DS8A 5KBYA 1WB6A 2X5XA 4J0KA 4EY8A 2JEYA 1VOTA 1NU8A 4U2GA 5CTAA 2IITA 2C4HA 3Q8WA 1DINA 1QO7A 4FLMA 4L72A 5SYNA 1JMYA 4AO7A 1E3QA 4BDTA 2E3JA 2QXUA 3I2GA 1YAJA 3TRDA 5LP1A 1CQWA 4DMKA 2ONCA 3E1GA 2ZVDA 1TK3A 1XZEA 3RLIA 2QM0A 1EB8A 2GBCA 4IH9A 2J4FA 3V1NA 5DJ5A 3U1TA 3C6XA 3KDAA 5AOCA 1CQZA 5T4BA 1XZKA 1Y7HA 1LLFA 5K5EA 3H1BA 1DT5A 1MJ5A 2QJRA 3EQ8A 1VXRA 1IZ7A 5AKLA 1TKRA 4UFNA 3I1IA 5DTIA 2YXPX 2QKYA 1QIJA 2QTBA 5IKXA 4WDRA 3R3WA 2WHPA 3R41A 3BXPA 1XZGA 3C8HA 3BE8A 3I2JA 3WQHA 1YA4A 5AICA 3F8SA 1IZ8A 1YR2A 1N1MA 2G5TA 4KAAA 4CIBA 4J0DA 3G9ZA 2XT0A 3WKAA 3STVA 1YB6A 3H2JA 5JYCA 4N8DA 5HQ3B 3L1JA 2J4CA 1EDBA 3M3DA 2ZYHA 2ZJ7A 4PF1A 1ZD2P 1Q84A 3GZJA 4W1RA 1XLVA 5AKJA 3IIIA 4WY5A 5AIAA 4F5ZA 4BAGA 1XQVA 3ESBA 3WMRA 4MWSA 3H0CA 3WL7A 1CVLA 1GPLA 3AJAA 1MNQA 2Z3WA 5AK3A 2WUDA 2XLBA 3ESCA 3WKBA 1N5MA 1WM1A 2G4LA 2C58A 5K3DA 4E15A 5JD5A 1NU6A 4RNCA 1LZKA 3M82A 5AM5A 1AKNA 5LKAA 4ITVA 5ALWA 1AC5A 3G9UA 3FVRA 1QIHA 4CCYA 1HLGA 1BN7A 5I8PA 3TJMA 5FKJA 3BDIA 4H7HA 4L0CA 3C8DA 4H77A 3WZMA 3DDUA 4KRYA 3PICA 4C4XA 1XZMA 2FJPA 4ARBA 2XMDA 4FTWA 3G7NA 5LKRA 3C43A 4Z49A 2R11A 3P2MA 4X6UA 1CLEA 2ZJ6A 1ODTC 3KWFA 4ZXFA 4BZWA 1KU6A 3O4IA 4CG1A 4GDMA 4A16A 4U2FA 2BUCA 3A6ZA 3QPDA 1VA4A 2VJDA 4BB0A 5EI5A 4UHEA 2OGSA 4UBNA 5ALIA 4B6GA 3F67A 4Q3KA 3PFBA 4EHBA 3KOOA 5ISMA 4X95A 4Y2RA 3QMWA 5D3KA 1HKHA 3D4LA 4FKBA 4X90A 4W9RA 5A6VA 1XQWA 3QITA 3LIIA 2XQFA 2I78A 3MUOA 1EDDA 4H18A 1W52X 1FSSA 4ZV9A 5K3BA 3DQZA 2OCIA 3NOXA 4JUIA 4BYMA 2H7CA 4Y9SA 5DNWA 1ZGBA 2WSLA 2WJ6A 1EK1A 1CUDA 1VA5A 1YASA 2XUPA 4NZZA 2VSQA 5D6OA 4KE9A 3WJ1A 2BUBA 2XI4A 1BROA 3HRHA 1MO2A 4Q34A 1BS9A 2WG0A 4E14A 5FDFA 4KJXA 5BWBA 1XRRA 4CG3A 2HU8A 1ZIXA 1USWA 1P0PA 5HFNA 2HHAA 4AX4A 4L9AA 2QJWA 4U2BA 3WWOA 4K5QA 2I3ZA 3WK7A 1AX9A 3H1AA 2WU3A 5ALPA 2WUFA 1CUCA 3AFIA 5A2GA 5EIEA 3DJYA 1J1IA 3ZLTA 4DNPA 2B4KA 1W1IA 2XUDA 4JYPA 4FLFA 5JIBA 4PQEA 3DL7A 1DTEA 1XQYA 5ALYA 4Y2UA 3G0GA 2PVSA 3H2HA 2XMRA 1AURA 2ZYRA 5FPPA 3A2MA 4B80A 1XQXA 5HQ3A 1XLWA 1H2XA 5ALVA 2XUIA 5ALFA 1O6FA 1XRNA 5IVHA 3V9AA 3VXKA 4FNMA 2OCKA 3AIMA 5CH5A 5AM4A 4BRSA 1LBTA 5C7YA 1NX9A 4K6KA 1ZI8A 1UOQA 4MJ3A 4BC0A 1MAHA 3IURA 4HZGA 2WIJA 4CG2A 4JEIA 1ISPA 2HU7A 3H18A 1TAHA 3C6ZA 1M33A 2XQKA 3PFCA 2WG2A 4D9JA 2CUTA 4MEAA 4X93A 1ACLA 3D7RA 1Y7IA 1QTIA 3FBWA 5AI8A 3C5VA 1TCBA 2ZYIA 3FLBA 5ALLA 4FLEA 5ALUA 4BC1A 4UHFA 5C81A 4G8BA 3B12A 3S2ZA 4YASA 5ALSA 5E4JA 4XX1A 2WJ3A 3WL6A 3ICVA 1XZFA 3DNMA 3BIXA 1YCDA 4X6XA 5T4EA 5IVIA 4PO3X 4GBGA 1FFBA 5ALNA 3SWWA 3FSGA 2WIFA 4DSZA 4AXBA 1CUWA 4ZREA 4TVKA 4DNQA 3R40A 2CB9A 2HA6A 4O08A 1EA5A 2DCMA 1ACJA 4UPDA 1R88A 2JGLA 2YYSA 4WFIA 5D3ZA 3DOHA 4X6YA 3CCCA 3ZWQA 3OM8A 1XRLA 2BKLA 1CUZA 4AO8A 1WPRA 2Z8XA 2VEOA 2WHPB 1QLWA 1LPBB 5DYTA 3S8YA 4B84A 2XQIA 1R4ZA 4MEBA 1I6WA 2WIKA 3G9XA 2P8SA 3ZV7A 1UKCA 1Q83A 4G4JA 5A7FA 3AIOA 4J7AA 3WK5A 5CW2A 2CKMA 4C88A 4DYHA 4FHZA 4BVJA 2ES4A 4G5XA 5AI0A 1QFMA 3QYJA 3I2FA 3N0TA 5AI4A 5AK4A 2O7RA 4KAFA 1A7UA 1R9MA 1QIIA 3QMMA 4UBJA 3STXA 1W6RA 1U8EA 3DYVA 3K6KA 1IVYA 1CR6A 3IBTA 4FBMA 2WFZA 3HEAA 1GKLA 3QZUA 4IHAA 3QBJA 3VJKA 2HIHA 5IH7A 5CXUA 5JAHA 3FLEA 5DLPA 1ZI9A 4V2IA 2CZQA 2QT9A 2HRQA 3AILA 5ALTA 5CH8A 3KD2A 3ZLUA 4BAZA 4HVTA 2AXEA 4IH1A 5AKKA 4BCCA 4MXDA 2GBFA 4GECA 3TEJA 2EEPA 4HXGA 2XMSA 1JU3A 3IUMA 3O95A 3G0CA 5AM3A 5CH3A 2HA5A 3OURA 1JU4A 2RHTA 5E4YA 4EY6A 4XWGA 2BUAA 1WHSA 3EF3A 2RI6A 2J3DA 2OQVA 3STUA 1EB9A 2HADA 2C5GA 4J0GA 1PFQA 1JMKC 3FSGD 2OAGA 4UHCA 4UBKA 1MU0A 1CUIA 4ROTA 3TGLA 2DQZA 5IVKA 2QUBA 3I6ZA 2GYWA 2XUKA 3MGAA 4KRXA 4EY4A 4IH4A 3BF7A 2VAXA 1E8NA 1KEZA 2W6CX 3G0DA 5FXMA 3IVMA 5BV7A 2ACKA 2HA2A 2OXEA 1IUOA 1SOMA 4JYMA 3JWEA 1FFCA 3GBSA 4AN0A 3BDVA 2RAUA 1CEXA 3FWHA 4PW0A 4B9AA 3ZLVA 3RARA 4BVKA 4IQ4A 1CUSA 4I19A 3LP5A 3D2AA 2XUHA 3I1YA 1XZLA 3VVMA 2PU5A 5HF6A 2XQGA 1SC9A 2CEKA 1QIGA 5HCUA 5AOBA 2BGNA 3DCNA 3FAKA 4KR0A 3GUUA 1HL7A 3R3XA 3D5EA 1CPYA 2CBGA 4UBIA 2GBGA 1QO9A 5F4ZA 4EA6A 1XKLA 3WZLA 3WIBA 1R9NA 3R3VA 4Q3LA 3ANTA 4K6HA 2AJBA 2Y6VA 4RPCA 2D5LA 2PX6A 3MVEA 4H7KA 1CFJA 4EUSA 4Y2YA 5AM0A 4W1PA 5AJHA 4BE4A 2HFKA 3STWA 4DLNA 4Y2XA 4B83A 5CMLA 1HPLA 5HF9A 2WUEA 5FV4A 3D3NA 3W9BA 4LHEA 4G9EA 1FJ2A 1JJFA 1UT6A 1GQRA 2JGJA 4FFVA 4YPVA 1G66A 2V9ZA 5E2IA 2QZPA 4OU4A 5FLKA 3T52A 2JBWA 4E46A 1EX9A 1C7IA 2H1IA 2H7YA 5ALJA 4CFSA 2LIPA 2JGIA 3CN7A 5JAPA 1HDEA 2HM7A 4G8CA 1UWCA 3LCRA 4G9GA 4M0FA 3FYUA 5AM2A 4GHWA 4AZ0A 4P08A 1R1DA 4OSEA 2PSEA 1BU8A 1FFAA 4FWBA 5ESRA 2PUJA 3UUFA 3CN9A 2JGMA 5AKYA 1DQYA 1GT6A 2ORYA 1GPKA 1EVQA 3W2TA 4H7EA 1LPSA 3AZOA 2JGKA 4H7JA 2HA4A 1ZGCA 1WHTA 2JGEA 3PDCA 1Y37A 4KYVA 1VZ3A 1XRMA 5DNUA 4WDQA 1XRQA 2OQIA 4X91A 5KWIA 4HXEB 5JD6A 3WJ2A 1YSCA 3DYIA 4F60A 2R8BA 3C45A 1XLUA 2HFJA 3KXPA 1QFSA 2OCLA 2O2GA 1XZHA 4NVRA 5ALMA 1IUNA 4H35A 2RONA 2V96A 3G9TA 4EY5A 3QM1A 4RE6A 3KSRA 3D59A 1LGYA 3T4UA 2G63A 4W1QA 4B82A 4MQMA
chains in the Genus database with same CATH superfamily
2AR7A 2X19A 2GXQA 4OB6A 1ZWLA 2P6RA 3GP8A 3L07A 3QQ5A 1NRIA 3HJAA 1HYQA 1VMAA 4QXOA 1F2UB 3ML1A 5LQSA 1YTLA 4DG8A 5EEHA 3QFRA 1XAHA 3T5MA 3WP0A 4BE9A 1E4YA 2IZOA 1H05A 1KJYA 3E18A 4CTJA 5BR7A 3OFKA 2X4DA 5DLEA 4PYKA 2HD4A 2SCUB 2M1XA 2XGOA 1Q0PA 1NBOA 1USUA 1LI7A 3F0TA 3TMKA 4PHGA 4AZTA 3S29A 2N1MA 2AFHB 3TE6A 1YJCA 3LOPA 5C8ZA 3U4QB 4ETNA 1GYPA 2RGBA 2AB0A 2CK3D 3FWPA 3MWEB 1LPMA 4JODA 1FVOA 3QELA 4MV9A 2ZTLA 3HI6A 2Q3CA 4KBFA 5FWXB 2QLBA 2RC6A 2AR0A 5TDHA 2AMVA 4HNGA 3Q3EA 5L4SA 3WLQA 4O1MA 5C8YA 3LBAA 9GPBA 4NNPA 4I50A 4Y2VA 5FUXA 3ZE0B 4UEOA 1N6OA 1CJCA 3OX2A 5JV5A 4CMEA 1WMSA 2V8OA 1G9SA 1ZMBA 2YASA 2VAPA 1RMTA 3BMCA 3OZWA 4B3IA 5LMNB 1THZA 4UUMA 4RJKA 2IUEA 3DPUA 4G85A 5IYZA 2BHNA 2V9PA 4FPXA 4RH3A 4LW8A 4TKZA 5JW6A 3CZ5A 1XQ6A 1DVRA 2X86A 4QDOA 3QTTA 2IY9A 4E5PA 3K09A 4MIKA 3BWXA 3OTWA 1F60A 4DXAA 2DSNA 3WLPA 2PSFA 2PTGA 1ZRNA 3MHPA 4IZ6A 2H7VA 1UC4B 2WQZA 2QEQA 3BMOA 1Q14A 4ZFNA 3U62A 5H4HA 4LYEA 4EABA 1P73A 4YDRA 4NE9A 1AKYA 3DLAA 1YQUA 2VQDA 1CY2A 3AF3A 4LHZA 2Q9BA 2YW9A 1KZ9A 4TUYA 4INZA 2BE9A 5LQMA 5J4HA 1P7YA 3H0EA 3PVCA 1K5HA 4ZCIA 1KI7A 2P2DA 3GLQA 3PUZA 5DNEA 4IR7A 5BNZA 3GUCA 4Q02A 2RMKA 4XSGA 4COKA 2BGWA 4MRNA 2F00A 4JU8A 4RD1A 3WLJA 5I8WA 4BKUA 1LPPA 4BZZA 1MJGA 2FI1A 5JD3A 1VI5A 1TQHA 4Q48A 1ZCAA 4JUFA 1HM5A 4M9ZA 4X5OA 4ZYYA 5JNUA 3TN7A 3OZBA 2I22A 4ZOLA 2P6NA 4EGFA 1KPIA 1WLYA 4KTVE 2WWHA 2VUIB 1C14A 1SELA 3VNVA 1E6CA 1SK9A 3CXUA 4PHHA 4IDEA 1MQ8B 1XJCA 3V4PB 3EEFA 4C4OA 1OWPA 2CDNA 1OXBB 4C5AA 2ZBEA 2HQBA 2C5SA 3C2QA 3KK0A 3COWA 2WLSA 5CAEA 5IVPA 3BJRA 1JILA 4ZYZA 4Y0AA 3PK0A 3ZHOA 1C3OA 3DAFA 1TAGA 2ZZKA 1YCFA 3DT6A 2FPPA 3LZ6A 3RU3A 3WK9A 2VJLA 1R0YA 3JWPA 4EGCB 1NMYA 4ND1A 1W73A 3AEYA 1C3LA 1EGVB 3EFHA 4KWIA 2G6TA 1G9TA 3UMGA 3RT9A 3AFNA 3ESYA 3QX7A 2BGJA 4WECA 2PK3A 1H5QA 2WWTA 3E2PA 1P5HA 5HM8A 3AFOA 3B9PA 4CM6A 5DTEA 1U2EA 3N8NA 1Z16A 3K9NA 5AP9A 2GR9A 4IMPA 2HHJA 2JZCA 1N78A 3TXAA 4GPIB 1T9BA 3NP9A 2O2XA 3KPJA 3FBTA 3OMLA 3T5PA 4Q9LA 1XYYA 4ZDJA 1FQJA 3GLTA 4DJTA 4NE2A 1WW3A 1CYDA 1K6XA 4C2UA 1O3YA 3BHNA 1W4LA 5G4KB 5JVDB 3AZPA 4FN5A 1DWQA 4FIZA 2JLVA 1DG1G 4D79A 3E9ZA 3UKOA 1J97A 4R8KA 1IJFA 2EFJA 3AUUA 4R41A 3OQNA 1FJGB 1YR3A 1T1RA 1YDWA 4QODA 4Y1FA 2C4MA 2CHQA 2HMYB 2HLHA 3PU6A 3VUFA 2PXCA 1KI2A 1P9RA 1H4SA 4GX1A 5LP6F 2N42A 2UYCA 2Q99A 2REBA 4O4HB 1SG0A 3BWDD 4KLAA 5B57C 4DGQA 2A0XA 5C32A 3L6DA 3I01A 4RENA 4MUAA 1L4UA 1XTPA 2G36A 5HEKA 2RBKA 3DXYA 1NA5A 2GYYA 3L0IB 4HN2A 2BTQA 4JJEA 5T67A 3CLHA 2O2HA 4BCBA 5B3KA 1C0KA 3KKOA 821PA 5CA0B 1SXHA 4PS0A 3V8PA 3LX5A 1CDOA 1DQZA 5D01A 3TAUA 1XPJA 3MTBA 4F38A 3EAQA 1CF2O 4BCDA 4YMVA 3PXUA 1V3TA 4M87A 1F48A 4Q7KA 5FTLA 2BCEA 1DJPA 4YX9A 2Q5EA 3DEHA 1T6YA 5HS4A 1SHTX 2JFOA 4YRSA 1TLFA 5CHYA 1UM9B 3IT2A 1V8OA 3S2YA 3WAJA 4PG4A 3B89A 3OQOA 1ZN2A 5FWDA 3DM9B 1BVHA 1E89A 4DMHA 1DQNA 1YA6A 1E3TA 3SMVA 3F7TA 3EB9A 4K9DA 3GFSA 4WNAA 4AF8A 1M54A 3CNBA 3AEXA 2CLOB 4WXEA 3KD3A 4ZHSA 1NKVA 5HK9A 2SICE 4L3WA 3RK0A 2I2BA 4ND7A 3WKDA 3MNFA 1IB0A 1RXCA 2HK8A 1H2EA 3H1PA 4UD6A 2A30A 1KYTA 3QE0A 5DXFA 3QENA 4D9EA 5EHXA 5AM1A 4I1PA 1Y7LA 1BRTA 1SC6A 4YRGA 4N9QA 5LWQA 2BGMA 3RQSA 6ABPA 4GPTA 4BNFA 4BQFA 2IIVA 2XGJA 1U2TA 1RAAA 2HPAA 2CDCA 5F1PA 3GA7A 1JEYA 2WE8A 5HKKD 2XUGA 1VIDA 1OD6A 1PEKE 2PH1A 1KIFA 3BTOA 3KQYA 2POCA 1ZR2A 3DQPA 1S2LA 4GT1A 3SM9A 5E4TA 1DXYA 3LUHA 3A1TA 1QOZA 3AVUA 1YVUA 4LJ4A 3NEAA 1P18A 2EL7A 4NU8X 3RGGA 1U0EA 3IKTA 3AM5A 2PA3A 4G5SA 3WGOA 3OMWA 4XH9B 4CMCA 1EFLA 1EWVA 1DBWA 5AIBA 4KIJA 5KYWA 2HF7A 2YCLA 3COSA 3H2GA 1DLJA 4QDJA 2EG5A 5DSTA 2QENA 3HA2A 4GC5A 4Z9XA 4S0ZA 4DUGD 1J0XO 4W5JA 4C4YA 3LFHA 1D09A 1C9EA 1HTBA 5EESA 5K6AC 3VAAA 3FRHA 4IIJA 5L3SA 5IF3A 1KJQA 4UATA 3H9UA 4AFNA 4FUQA 3OHPA 1JHPA 2A92A 2ZJFA 4J29A 1G3UA 4PYLA 1OFUA 1YMVA 4MWGA 4F93B 2FK7A 3QJGA 3A4VA 5B53A 3SIPA 4R2HA 4DJ5X 4DWOA 1NNLA 3ADDA 1Q6YA 1ZJYA 1NR7A 3CNLA 3D0KA 2FZVA 1GGVA 2UZ4A 5C1BA 4Q9HA 3DHEA 4RABA 4F4DA 4HY3A 1N92A 1T5TA 3UGJA 3Q1LA 1PHPA 3IEPA 2VPQA 1E2NA 3FZEA 5HQJA 3PNMA 4KFCA 2QP4A 1ZVJA 2C07A 1XN4A 4L5YA 4PSAA 4HDSA 2YR0A 1NQVA 2WI8A 3AEKB 4BFCA 5DM4A 3VR3A 5IJ0B 3GGGA 3KUUA 2O6HA 4HBGA 3UAZA 4CKCB 2HU5A 1EFVA 1WSBA 1CT9A 2BGRA 3V9PA 1RM3A 1SAYA 5J58A 5B1DA 1L5WA 1QDUA 2AXPA 1SXJD 2GZDA 3A3NA 1NFRA 3IEUA 3JW8A 4HRYA 4OX9B 2WIGA 4NZOA 4NEGA 4Q3OA 3W1WA 4J3FA 1ZSVA 4MGZR 2EBHX 2XQVA 3GJRA 2YHIB 3KEMA 1PT5A 3LUCA 1CZHA 3IOEA 3PNSA 5CT9A 2W2NA 5GOTA 1BYUA 5DM2A 3SJCA 1M6HA 2PUBA 2HMUA 3F7MA 1SBIA 2I33A 3DKIA 3KQPA 1TM7E 3G1UA 3L84A 2PO5A 5EIFA 4PINA 4QA9A 3ZHTA 4Z51A 1UFOA 3K9GA 2ANBA 4OA8A 1GG9A 1IWPB 2HPZA 2FR8A 4M37A 5KWEA 3G8CA 3EASA 3JARA 2AC2A 1QAOA 3UUEA 3ZK7A 4C4SA 4CETA 2QW8A 3LIPA 3OPMA 2B4AA 3AOEA 1RI2A 1PT9A 5HZGA 4BFYA 4DBLE 3A1EA 2YV1A 3W06A 3ZU2A 4DMUB 5IHXA 2BJHA 3CB4A 4BE7B 4D8VA 1C7JA 4FT4A 5KVSA 1BXZA 3HXQA 4JLVA 2PMCA 2BOVA 1FVXA 5LYYA 4K6CA 4WGFA 4JI1B 3RAGA 1TTTA 4Y1GA 4Q03A 5HVNA 3O94A 4MB0A 4F72A 3QVGB 1HFWA 1N2SA 1BGVA 4WK2B 4D56A 3FYUB 4YCBA 3WMEA 1OGYA 2XITA 2J0EA 2NG1A 4POOA 3RADC 3H0KA 4ZOEA 4TL7A 3BERA 3TR5A 3UV3A 2BP7B 2GTPA 5EFOA 3SXJA 1X7WB 3WMWA 2XXAB 4N3CA 5AJUA 2HJRA 4YWJA 5CVTA 2QT1A 1Y4DE 3RWOA 4RCYA 3TAXA 2HGZA 3KE9A 3F1LA 4YQFA 3FNRA 5CVDA 1DWOA 4CIAA 2IGBA 2FGKA 2Z2XA 4URYR 3WA7A 4WOJA 3LOUA 2A9RA 2AEJA 4IFEA 4N8SA 5ENZA 4C4RA 1M1UA 1T2DA 4YV0A 5D85A 5KDOA 5LNK6 1JLSA 4LQDA 1PG5A 3IHWA 1A27A 1OIWA 5CVVA 1YBAA 3E4CA 2EHJA 2VTVA 3WVNA 1H0SA 2WC1A 4YP5A 3UJPA 5EAIA 3DTVA 1RCTE 4UUBA 4HFJA 3VNAA 1KO5A 2OL4A 4IHJB 5H83A 3G49A 2PKRA 5E6SA 3QU4A 4P4SB 4D41A 1EINA 3HKCA 4BO6A 3C6MA 1GNVA 3V2GA 3ET5A 5K0JA 4GMGA 4LXIA 1JVBA 5KHLB 4HWRA 4QL3A 2GF9A 3GJTA 4AMBA 4B09A 1L4NA 4LBZA 1E2UA 1RPNA 2ILTA 2KPOA 3EVDA 1OF1A 2CW5A 5I7OA 4CQMA 3K1AA 1NUPA 1E69A 3OEYA 2WV7A 3UZUA 3IYLW 3KKPA 1Q7BA 3OX4A 1KO7A 1F0YA 2JAPA 3EVZA 3KKKA 4HDAA 5U4XA 3TIIA 2W48A 4ECAA 1GRCA 3BK7A 1EXMA 2B98A 4HB4A 2XXJA 1T34A 1N5RA 1SHKA 2LIVA 3TCKA 3TR0A 1CUHA 1OBVA 1M2KA 1QHNA 1JTEA 2I7VA 3TLZA 3B8EA 4YRZA 1VCIA 3RG8A 1XDZA 3ESZA 4GMKA 1FF9A 2MYNA 2V7GA 3QXSA 4ND8A 4XTRA 4D7AA 3NONA 3IEVA 1ZEMA 1QONA 3HJUA 2FPKA 2ZYTX 3FCOA 2WHQA 4TXMA 1N36B 3GLKA 3V1MA 4G0MA 4QYTA 4MLDA 3SYLA 2ZEJA 4GM0A 4J07A 2B83A 1PE0A 3H8JA 1ML4A 4HUJA 2IU3A 5EE9A 5KMGA 3MS4A 4PRLA 1ORVA 3EA4A 1JFTA 1ZY2A 1T4DA 2X76A 3BK2A 4YT4A 3QOWA 4EKIA 3SZGA 4MTCA 4B87A 2O3UA 2ZE8A 4YJGA 3OZCA 5BSMA 3CWQA 1C7RA 1ZICA 1F2TB 2PFSA 3E27A 4XM0A 1P17A 1K3FA 3C3BA 4IL5A 3QU2A 4LRXA 4MI3A 3MTDA 4AIIA 2ADMA 5JS6A 4ZAGA 3UBTA 3ESDA 3JAKA 4GVLA 3Q9LA 1T15A 3QELB 5CU7A 3JQAA 1AO3A 4TYPA 4RKRA 3T7JA 1L5FA 3N8HA 3U2QA 4DRYA 2BSQA 4PAMA 3NP7A 4CKZA 2VDKB 4L57A 5KI6A 1T8UA 5EP2A 4BMNA 5C8YB 3IO5A 5CK4A 1KVUA 3IE2A 1BCSA 4E7OA 4PYIA 3EF1A 3GVHA 4HDRB 2P3SA 4LYHA 3R7DA 1VRWA 4BO7A 3CFYA 3PP8A 1Z68A 3KXLA 1JEJA 1JKMA 1S1MA 3MF4A 4TM7A 5AKGA 4C4ZA 1KVTA 3ZCXA 5IYZB 1FXSA 5C8VA 3W9UA 4G23A 2X3UA 3CIOA 2A1UA 4Q05A 1QAMA 3O9MA 1Q1AA 1Y33E 3H87A 4GKBA 5EKUA 4J03A 3LGXA 3OPYI 5LOVB 2RHOA 1NNEA 1WCXA 4P4GA 2H4FA 3BXEA 4B33A 2PUTA 1O03A 2GJ4A 4MPRA 5DSXA 5IJ9B 1B6GA 3ZJUA 3IBCA 3TVDA 1QX3A 4I6JA 3PLNA 3HCDA 4RF4A 1M2EA 1ZC4A 2GBPA 3BMOB 4TSKA 3TZBA 2CV1A 5GPBA 1FS5A 3TOVA 4RZXA 3H2SA 4KXLA 1J2EA 3U3OA 2V8BA 4D97A 4TUYB 1F5NA 2RIPA 3HXOA 1E1MA 2G1UA 1SG6A 1Z0SA 1Z8DA 2PQ6A 2DQYA 3A1FA 3O2QB 2RGUA 4OQNA 4UTZA 3QHPA 1S0UA 4EFLA 2G28A 1UJ4A 3Q9NA 2YMLA 4F91B 3CSSA 4PE5B 1M8GA 4C30A 2B1IA 2IU6A 3D4BA 4P3NA 3H5RA 3I23A 3RAJA 5HZKA 1F0NA 1P7CA 1ZN7A 2DHQA 2QD2A 3QYAA 5KEIA 1HK7A 5ESDA 3TPZA 4U6NA 3L9WA 4XWYA 1I13A 4ZOLB 1HQCA 2VK4A 4NXNB 3NHKA 1UWLA 2B92A 1PNVA 1BTOA 4UXIA 4NHEA 3UJ3X 1SEPA 1NVBA 3IULA 5CXXA 3M3HA 4Z4HA 3K2EA 4LEIA 1MPXA 4A23A 3G02A 2LWIA 3A7EA 4JXJA 1XZJA 4GRDA 3BMQA 1A9PA 5AHWA 2CF6A 5CAEB 4JOSA 3VPXA 3ETLA 5HS6A 1YOBA 2K2QB 3HVHA 1XE3A 3OZTA 2QL7A 5A9TA 2XADA 5FI1B 3WX0A 1H5UA 3F2VA 5GJVC 3PQ6A 5DX8A 5HFAA 2FPPB 4MQLA 1U7PA 4QBHA 2BC9A 1EDEA 2I3GA 1L7QA 1JQJC 1UQTA 2XODA 3HR7A 4AUKA 3FPHA 4D9CA 1I4LD 3QEMA 4HNRA 1XRPA 3QVLA 4O2AF 1WY5A 4P34A 3PNPA 4YDSA 5DBGA 4IDOA 4YA6A 2YY5A 3MERA 4KI7A 4PG7A 4KU4A 1FIUA 5AT1A 1SB8A 4D3YA 1XD2A 2B94A 4LV5B 1FFEA 4GWGA 1XCLA 4QDKA 4IHKA 2ZBFA 4O2BA 2O3SA 3LUGA 5BPHA 1PR9A 5THKA 1ZOIA 4J0IA 4UHHA 3UHOA 3F97A 2C29D 5J5CA 2OPBA 5KU7A 2YJ6A 4MULA 1X9HA 1P31A 5FHRA 1UF9A 4HNTA 2IYWA 3R6WA 4YREA 4DV7B 2VNIA 3L0DA 3SN6A 2FZ5A 4DCNA 2H16A 3O03A 4D9KA 3Q0TA 3ZH9B 4W9NA 3UENA 1YI1A 3JQBC 1HO3A 2HRDA 3K7EA 4MUXA 5B5SA 5FI3A 4ZHQA 1GEGA 4FI3C 3ZCTA 3ETGA 4A0GA 5IK2A 4JB0A 4A4DA 2Q07A 1RFLA 1L8OA 3A4MA 3MEQA 2J9YB 2C78A 2P2GA 3R0XA 4PTZA 2CLIB 3NB0A 3T1TA 3TGPA 1E1RD 1KI1A 3O4VA 3PKIA 1BFDA 1HRKA 3R3ZA 2BW0A 3QJYA 2CY0A 2XAAA 4BZPA 1C5KA 1MGOA 1Z6ZA 2NWQA 3K4HA 1VHLA 5H5JA 4L4UA 5I9IA 4IIXA 4YUXA 4NJEA 3I5AA 4UUQA 1QHHB 2VHJA 4YYZA 3UAXA 4K9NA 4EO7A 4ZI7F 1EFKA 4HRAA 5TB5A 4YAIA 1ES9A 1UBLS 4IBOA 2WTXA 4BTEA 3MM4A 4R2JA 2CLCX 1Y5LA 1MVLA 3WZ2A 2PM8A 2O8FA 5DIFA 4AO6A 3W77A 5CD1A 3BD7A 2LV8A 5A62A 4B71A 1LPNA 1X92A 3L6UA 3VPAA 4YUYA 1TL7C 4OQZA 5EHNA 3CPHA 3IKJA 4XR9A 2I7CA 4GE3A 4ZQCB 3NCHA 2XUJA 2YWRA 1CUUA 3B38A 5ALQA 4YT2A 1CC1S 2XB6A 1C0LA 2NX2A 4DR3B 3GGSA 4PPGA 4Q4HA 3FTNA 2BSAA 4QEKA 1V95A 3Q8XB 4OXNA 3FUCA 4DLBA 2Z83A 1A9TA 1JDJA 5IEBA 2EQAA 1BN6A 2XVZA 5A5FA 4LRQA 3NG1A 3TXXA 5CYFA 1Z4JA 3VC2A 1ORDA 4MGEA 3IUQA 3RJTA 1EBFA 3EUWA 4GYYA 4GSYA 4N5DA 5CXQA 5JDCC 3O4JA 5C1DA 1FMLA 1GP2A 1R3DA 1W5FA 3PJDA 4B6QA 3LDFA 2WJVA 3QH4A 2YFHA 1EI9A 1XEXA 2JKZA 2QU8A 2ZR0A 1E9AA 3DE5X 3ECCA 3HL0A 3UK0A 3VGJA 5JNWA 4AKHA 1DX6A 2VUUA 1O9GA 1RVV1 4KX5A 2Q46A 4ZQEA 1CUXA 3NXSA 1H4VB 3MJTA 1JEYB 1VE7A 2VBGA 3QEAZ 1HT2E 1L7VC 2JBHA 2QRVB 1UXKA 5C5EA 1GN9A 1W75A 5AKIA 1OUMA 4TZTA 4MW9A 1IQPA 1J24A 5K0SA 2XCQA 4WESA 4RY0A 4WZ6A 5K03A 4LOLA 1EXWA 4N7RA 1WEHA 3L6EA 4CGYA 1DX9A 1DTWA 3ND9A 1BYIA 3S2IA 4DPKA 5C7IO 3KUKA 5CGZA 1XEWY 1U02A 3LSYA 1TCCA 4B44A 1EFRD 5KYWB 2FYTA 1DPGA 4DYDA 1JG2A 1BH6A 5EERA 1X80B 2PH5A 1VGVA 4QGGA 4BWYA 4V0SA 5HKOA 3IP6A 2RDMA 3K2IA 4CLHA 1IEQA 3EZFA 2ZWOA 3F6YA 3KZCA 1EESA 1ESDA 1OBOA 1RRFA 4IIJB 5KNBD 5L3SB 2FR1A 3ZGLA 4ETWA 1OI7A 2XT6A 2VQ6A 2VTEA 3LRPA 4TZ0A 2CMKA 3OU7A 5MFZA 2J3JA 1JDNA 2E6KA 3ACDA 1CIPA 3MELA 1P75A 3U3ZA 5T4HA 2YXDA 1MW8X 1Y81A 2QN3A 1F0PA 5BWOA 3ZXSA 5CFRA 1ENOA 1BMDA 2IDKA 5DBIA 2RBEA 1KXZA 2X8AA 4GX2A 1IPEA 3WS7A 2VOEA 3WO1A 4MKHA 5I7SA 1ONNA 4KDEA 4YJ3A 5AXBA 2OCDA 4MVJH 5LDGA 5KOIA 2BGUA 4M8IA 3KE8A 5B3LA 2RHRA 1LTKA 1OJLA 3L5OA 3ZCUA 4RJJA 5IAEA 2UV8A 2CB0A 4DLTA 3A6DA 1Z15A 1YCGA 2PKYX 4HDSB 3CZCA 1RHJA 4OJKA 3KAQA 2AJ8A 3ZHBA 2EJTA 2R4QA 1UKBA 1PV4A 2PGDA 3P27A 1VFPA 4DIBA 4OJYA 5CEEA 4NP6A 4ZP1A 2ZYDA 1TRHA 3A9TA 2ZS7A 1R7RA 1EFVB 1Q0UA 2OLJA 4TT3D 1A4UA 3FJOA 3K9BA 1TYCA 3GAMA 4MARA 4DLAA 3BREA 3VJRA 3N70A 4PN7A 5DBEX 5AVYA 1KZHA 2YXBA 1FXUA 1EVZA 1R64A 4NLLA 1GCAA 4XJXA 3SS7X 4CTKA 1DL5A 2YIJA 4UM5A 5JSKA 3CUUA 4XUCA 3WISA 4X61A 1XRJA 4L28A 1IRXA 2ZVJA 3RLFA 4D8XA 5FNVA 4UOEA 2VP9A 5CFNA 2WEKA 1QORA 1RQ7A 4JQOA 5LMUB 1RM4A 5ITWA 4G0VA 2XEDA 1DO8A 4P5PA 5JD4A 3N0VA 4G67A 1ZD5A 2O07A 2ASVA 2VSFA 4XVRA 5A4FS 3D0OA 4R7ZA 2NPOA 1X0VA 3G5TA 3ZVNA 2EX4A 2FLKA 3VR6D 4HH0A 2PZFA 3UAGA 4F3KA 1IBLB 1RABA 1R0RE 5ED4A 1PK7A 2J3HA 3N75A 2CFTA 4L50A 2ZT8A 2JIDA 5I7VA 4LVUA 4G37A 1DIHA 4EGSA 4E88A 4LWPA 2YWBA 3AI7A 5EGNA 2ZP1A 4YRKA 4DR7B 1LBEA 5COBA 4MV4A 5T6MA 4I50F 4RVOA 4OYRA 1U0GA 4MKGA 5AI6A 3ZS9A 4MSUA 4KC0A 4WOCA 1JTVA 3NETA 5JCZA 1YFJA 4OFBA 1IZ0A 3RS2A 1U9YA 2FP4A 3UIEA 2E18A 2XT9A 3R9IA 4NOJA 4RF2A 2RHDA 4B74A 1CZNA 1SCBA 1G8PA 4X84A 1LCIA 2R66A 1CDEA 4FMCB 4P4TA 4PYMA 4QRHA 5KAPA 4TS4A 2VYVA 4FHDA 2DBYA 4N5HX 1FTGA 2M2IA 5DEOA 3MMXA 1JKXA 1GN8A 2ZR7A 3JD0A 1D1PA 1F7UA 3KFLA 4OBBA 4CIVA 4S35A 2IWHA 5JJKA 1JZQA 2GVZC 4Y98A 2BFMA 3BKXA 1W96A 2PPLA 5JXWA 4NG4A 3WIEA 3ZWNA 4XCXA 2PH7A 3M6IA 5E6SB 1PJQA 5U1PA 3TGWA 5JAUA 4IGEA 2OORC 3PA6A 4FZ3A 4IKOA 4P92A 4Q7JB 3BQ9A 5CRIA 4CUKA 1O5IA 5JU6A 1D2EA 4YP9A 4RDIA 2H3EA 4EHAA 2A0FA 1ZIYA 1U2RA 4H2DA 1IC6A 4ITRC 3O21A 4O6VA 2ETVA 2VK1A 3ITNA 1YRBA 5B36A 4CQMB 1NIPA 3ONFA 1N0WA 3OO1A 2XWPA 2IHTA 1D4OA 1D2RA 1KEPA 2C0QA 4HEA6 4QWMA 1T1SA 5IJWA 5CFLA 1GPH1 3G6WA 2DFNA 4HR7A 1DIRA 4I3HA 3K0SA 2IIBA 4A0RA 2VXOA 3ZJYA 3A1DA 3ZDZB 1QCCA 4CV3A 2J59A 4QKQA 4JSYA 1SBYA 5FOXA 1DFHA 1C1DB 1XT6A 3N05A 4RA9B 4CL2A 1NVAA 1VL5A 1IHUA 4TV8F 5J2TF 5T3UA 4MW4A 4X8OA 1S2OA 5T57A 2I7TA 4ND8B 3U3RA 3ZW9A 5D3MA 3PIDA 2FW7A 3NKFA 3EY4A 3TRFA 2AFVA 1NFFA 4F7DA 1M67A 1SUBA 2X0IA 3VR4A 2D1FA 2C3UA 3B7PA 2Z2YA 2POQX 4IJQA 1QIDA 1KK3A 4ZO9A 2JH3A 1HUQA 1T1GA 1BX1A 3M5DA 2IXAA 3CZAA 3FF1A 2XUFA 4FYJA 3K70D 2GUWA 5KMGB 1WCV1 4R2XA 1EUDA 4MR9B 4O59O 4P7JA 4AC9A 1FNDA 1MT3A 1O1YA 1PX2A 1XTKA 3KELA 4KYIB 5EMKA 1NBIA 1S6YA 3MWJA 1FVHA 5TIIA 4YJGB 1PG2A 3IP9A 1JBKA 3ZS8A 3TBHA 1P1HA 3ZHRA 2JI7A 5B2EA 2CNLA 4L3VA 2DWUA 4Y8VA 4R8SA 4HAVA 1VJCA 3RAPR 4MW7A 3L6CA 3SQXA 3JAKB 2EZ9A 2NZ8A 4AJNA 3JQAB 3GGJA 4ACAA 4QHYA 3V97A 5AXDA 3VR2A 1W9HA 5ED0A 3CPSA 3AVVA 3OH8A 4F1KA 1YJAA 3OQJA 3BD6A 4ZVRA 3BTUA 3PC3A 4G86A 4J0HA 4NJMA 4U6QA 2ORWA 4MWZA 3HH8A 2PRKA 3UWSA 4IPTA 1OBHA 2VTBB 4G5FA 4K26A 1X38A 2JLYA 3F5DA 1CF4A 1RS0A 5LZ8A 5BVGA 3G2PA 4HVAA 2ODEA 5J23A 1U6KA 1R16A 4I9HA 2A1UB 2AX4A 2FVYA 2Q8QA 2OLKA 3ADOA 5EQFA 5KYKA 1RACA 5JWRA 1V7PC 4AYXA 1TK2A 3EVGA 2AJDA 1KMMA 4WAUA 2JAUA 4EJ6A 1ZISA 2HRRA 4GPEA 4H1TA 1J5EB 3ZGZA 1H2YA 2XNJA 3NKVA 1NMXA 3OJFA 4ATNA 1Q3KA 16PKA 1NX6A 3PYLA 3U5TA 3SYNA 4DLLA 3SQWA 1YIAA 3ZWVA 1L5ZA 4IIVA 1Q15A 3EQ9A 4KODA 1C3EA 3B51X 4Q9IA 4X3OA 3EZNA 3WIOA 1UK8A 3I61A 2CD7A 2V74B 4G2TA 3UYLA 3LW8A 4RYLA 1QHIA 5CM2Z 2COUA 1J42A 1SOWA 1K63A 4IGFA 2KI5A 4B9EA 2AZXA 1NKTA 4GNKA 2WV9A 4ZAYA 5BN3B 2FOXA 4QNNA 4EUHA 4JL6A 2VBCA 3QVSA 1FXWA 4FGUA 4FOPA 2IPXA 4R8MA 2QP3A 4CQJA 3I6YA 4FE4A 5TMDA 1D6NA 1WB5A 2GLUA 3W8RA 4KPEC 3NI2A 4GKVA 6REQA 3LVFO 4LHYA 2J46A 3BMQB 4UTNA 2FQQA 2P2ZA 1QE3A 2QAJA 2AFRA 3O2SB 3EW9A 1S96A 5F5LA 2KYRA 3ZBUA 3ZKWA 2ZSDA 3ORQA 1SCQA 2D59A 1E2FA 1NW8A 2BGTA 3GNTA 3PQFA 5KNCA 1M73E 1I6MA 1NUTA 3O1LA 4JT9A 4WJZA 2AKEA 2O8DA 4RTMA 1GDTA 1FNCA 2XMZA 2J41A 4TV9F 1NMEA 3OCUA 3TOZA 4E13A 3HDYA 3CEMA 2Q5CA 5H7XA 3CQ9A 1IXKA 3N2GA 2P1RA 3P9RA 4UAVA 1KI6A 3UMJA 3WGTA 2K87A 1XD2B 3FYUC 4EG7A 1FLDA 3RC8A 4U2EA 2A58A 2PS0A 4LI3X 4O2BB 4IDNA 3S28A 3T7TA 1DG9A 1MIHA 4DR5B 1J2JA 2Z3VA 3IQIX 4HJXA 3QWIA 4PZ0A 3U39A 3LHKA 1H2ZA 2V0GA 2H85A 4K9OA 3F9CA 1P4GA 2C4TA 3KU4A 3IUEA 4JJGA 4C7BA 2UZAA 3BRWD 4OYLA 2IBTA 5HF5A 2FPGB 3FMFA 2D8AA 4L75A 4F46A 1VE3A 1ZH8A 3FGPA 1B73A 5F1KA 2PKCA 2V7VA 4ZHQB 1WRBA 2G9ZA 4FGJA 3R6GA 3O4RA 4C0AC 1X42A 2X58A 1BKDR 4N6OA 3KS9A 4P4NA 1TD9A 4EY3A 2RGRA 1YMQA 2I4MA 4X45A 4DDVA 3T9AA 2VT7A 3NLLA 4DANA 3JQGB 2GBIA 3CISA 1SVLA 2FETA 3UAWA 3VR4H 4O8CA 2XDYA 3R3HA 2H0QA 3KCNA 3IT0A 2FFHA 4IS2A 4E09A 3IUPA 1LZLA 4NJEB 4ZAVA 1OQAA 1RYFA 4OHOA 4U7TB 3W9SA 1A95A 1ZH0A 3T4XA 4RA6A 2HSWA 4LJYA 3TFQA 3OQ1A 5E7IA 4YI3A 4G09A 3COJA 2G5GX 2V6FA 2IUUA 3DMGA 1CY8A 3PFGA 4JWKA 4C3OB 4EJ0A 2TMYA 1UJ5A 1ZGHA 1KQOA 3GT7A 1N3LA 3NWBA 1OGIA 4OSPA 3EYAA 1J8VA 3E9MA 5J4VA 1MV8A 1XDWA 3GVPA 3HY4A 1ZMRA 5K99A 2DX7A 3U5ZB 4Q4HB 4B79A 2JHGA 4OQXA 4A92A 5L40A 2BBSA 3IJ5A 5M34A 3W5CA 2H1CA 1KDTA 4XIIA 3GA0A 5AKXA 1WUHS 2O52A 1STOA 3HZZA 2FEXA 2QMYA 4TLEA 4ZVLA 2O4UX 4MRSA 4TTQA 2H2AA 4Q4JB 1U2DA 3MMSA 3SYTA 2FRVA 1DAOA 3IAAA 2OZLA 3V3KA 4J2HA 2IYUA 2BMJA 2I62A 4PBRA 2QRLA 3X2FA 1OASA 4AMUA 3TM5A 4C6TB 4GOMD 4AU1A 3USCS 3H4TA 4Y6QA 4Q7MB 3ZNOA 1KWGA 1XEXB 1GZSA 3FNBA 3CX7A 1JHAA 2C5FA 1AGRA 1IN6A 1AUOA 1ZJ4A 1PFUA 2X6QA 1CXZA 1B43A 1T4GA 3ABIA 3OT5A 5EP1A 1I4EB 4B4WA 1AU9A 1SZPA 3SZMA 1A77A 4ER7A 4A3SA 3U7FB 4Q9JA 3GJSA 1HG0A 3QUCA 2IHZA 4QGFA 3UG6A 1E98A 1MORA 4G1MB 3QFTA 5A9RA 4R3UC 1QP8A 2DPLA 2ZSKA 4P83A 3ZY5A 2Y71A 2NUPA 2O7QA 7GPBA 5EIBC 2JHAA 1M1XB 4Y6PA 1DTWB 4XEUA 2I91A 2HF9A 2WM8A 1E79A 5G0VA 3S1LA 1D7AA 5IW8A 2CVFA 1EFAA 3K1YA 3PNQA 3ICOA 3TFOA 5T3YA 2ACVA 3IAHA 1FS6A 4L3OA 3C1OA 3KQLA 2V0NA 1AS3A 3F8TA 3VPHA 1AKQA 4TLCA 4CMEC 4BV8A 1XL0A 4JYCA 5DTJA 2X7XA 5BQ3A 2Q0XA 4GL4A 3TBFA 3IOCA 2QG6A 3AMVA 1EPUA 3DVQX 1YZ3A 2XNDA 3JD3A 4BP1A 5KOHA 2FNAA 4Z4EA 4GI7A 5CLLA 2OB1A 1DBPA 1N2ZA 5TEWA 5IDYA 2ERYA 3VV3A 1MAUA 3R5JA 4C1NA 3K09C 3R7WB 3HYSA 4XJSA 2OTCA 3G0IA 3DMRA 4IOMA 4QGHA 4AJIA 1WZEA 4QD3A 3QNMA 3EG9A 4S1NA 5G0WA 5IDVA 3M5CA 4WOPA 3DXXA 3DV0A 2WA2A 3COZA 2F8SA 3EXIA 2WYOA 3QPUA 4HQLA 1Q0RA 2HDHA 4DARA 2AYYA 4TKVA 4CIBA 5IC5A 4B8ZA 1TF7A 2QBYA 3S8MA 4HG2A 4YFYA 4C7OA 3FHJA 5BORA 1JJVA 9ATCA 1UJBA 5TPWA 4PQRA 4UBMA 1EWKA 3B6JA 5AESA 3EX7C 2IFTA 1WXFA 3QKSA 4BVEA 3AM4A 3EARA 2G7MC 2VP6A 3OY7A 3K31A 1EXNA 2JIZD 2V54A 4JLNA 4FD2A 1E8DA 3CEAA 1R0XA 1NXSA 4EAAA 5JYBA 1LLCA 2B4QA 3NV7A 1WF6A 1XBTA 4TLAA 4KPYA 1B8OA 1K8RA 3FVWA 4XD7A 1FRVA 1JI3A 2RGAA 1V37A 1I3KA 3CNEA 3K35A 4K28A 5A0FA 4A73A 2MSKA 5F7XA 4F97A 1G1MA 1GG5A 3CH6A 3WAGA 1DG3A 3TEFA 3PFWO 1D4AA 3ENWA 121PA 2GX6A 1PKXA 1D2CA 4BZXA 1PUJA 1LTQA 5I9LA 5TS3A 2GF0A 3HYLA 4F9TA 2O5EA 4RCVA 3GCGA 3HEBA 2VA8A 3KIPA 4ZV7A 5AVWA 5GINE 1UKZA 3P97A 3NVDA 1ODSA 3M4ZA 2OHVA 3DE3X 2FWRA 5FUBA 1TM2A 2X5XA 1C8VB 2MYPA 3OF3A 2IY7A 4F6LA 1DIBA 3U16A 4NK5A 5CPBA 5FLEX 4U0JA 4ESHA 2ZRKA 4OQQA 2FEAA 2W4MA 4Z86A 1B6RA 3DAYA 1CCWA 1TEVA 2A5FA 4R9UC 3ELDA 3RFXA 3BCUA 3UYKA 3D3JA 4MDEA 1NU8A 1XJ5A 4LQ4A 5AQEA 3WLKX 1MJGM 2PLAA 4WMLA 4O63O 1CS4C 2C77A 3PGVA 4Q9NA 1NC3A 4Q4LA 5E3IA 3EZ9A 3V4ZA 3B13B 4KW7A 2R87A 4CG0A 3KPYA 3RH0A 5DOVA 3N0WA 3GQBA 1B93A 3OFSA 3HUFA 2FP4B 3GFBA 4WLNA 1F14A 2XOKD 2AHRA 3OOWA 1ZJZA 2ZATA 4RVDA 4BDTA 1EE1A 4OAQA 1K86A 3ZIDA 3WYFA 2G04A 1Z88A 1WXIA 2G4VA 1OFVA 4ENWA 1RWOA 4UHJA 5DO9A 5IXYA 5FAXA 3FTPA 2W6PA 4OG2A 3ZXUB 3NTVA 2J8ZA 1W36D 2NQ8A 3AJRA 3UHFA 3DZHA 1AVTA 1Z3IX 2FKNA 2PVPA 4P5DA 4R51A 4HPWA 5KSOA 3C6KA 1E32A 4MCIA 1BNCA 1A96A 2VWQA 2XHEA 5AVKA 4Z1MD 1XDUA 1J2RA 3E1GA 4LWOA 4MAMA 1TK3A 1USIA 2ZTVA 1OB5A 2V45A 4RVNA 4ALMA 4D9HA 1J8MF 5ERGB 2YJGA 1SC4A 1I6LA 2HCJB 2XF2A 1U98A 1TAQA 2FSFA 4LOKA 4OJNA 2ZBDA 3ZUPA 3C6XA 4JJIA 4O0LA 3NT2A 2EF0A 5BN5A 2O2YA 3KDAA 3N1UA 3D6NB 2PXXA 5EHGA 3DBHA 3TDKA 1MB0A 2PLNA 5K5EA 3GX1A 1BXRA 3OF2A 3A6LA 3PSAA 2VP0A 1Z0ZA 4N5MA 5K20A 5HGXA 2BE7A 1CEQA 3BFVA 2PDAA 1BIFA 1GGNA 3A9SA 3DOFA 3IT1A 3EOAI 2CL6X 3O7MA 4IP0A 2R00A 4BO8A 3I73A 2F48A 3GH3A 4Y1EA 5BR4A 1DRJA 3GJXC 3IQDB 3DLBA 3NM5A 2Q9CA 2I2FA 1QIJA 3IALA 2O5RA 2P9HA 2YNMD 4MLPA 4WDRA 1AZLA 5IUNC 5IKXA 4UEJA 4J16A 5D3MB 1EU1A 4CE6A 1EJ6A 3C3XA 3CRZA 4UD2A 3P19A 1QGDA 3BXPA 1XZGA 4QYXA 2BM1A 4EH1A 1Y6GA 1VL2A 3BE8A 1VIMA 4MVJF 5B1SA 1V6AA 3KKNA 3H5IA 1U6IA 3I01M 3QU5A 3SNKA 4C2BA 4PQYA 1V3VA 5EQTA 1KBOA 1YR2A 1XNRB 1JDZA 1E0JA 2PYZA 3ZGNA 5BP7A 3O84A 3D6UA 1YHNA 3G9ZA 2XT0A 4OUDA 4TZKA 1YB6A 4M8NE 1KH3A 4PFKA 1BDBA 1Z6GA 3T9FA 1EFTA 2LDXA 1ODLA 5HQ3B 2ZE7A 4NU0A 4ZVUA 3WYGA 2GWRA 1ADJA 1Y5NA 3DBVO 4NK4A 4PX3A 3B6KA 1WW8A 2J4CA 3RNLA 3P9NA 3H2ZA 4B2YA 1KAGA 1EGHA 4PPQA 4RD0A 3O26A 3GCZA 4JFRA 2ZJ7A 3HGQA 1XHLA 3LT4A 4B17A 1HMYA 3H05A 4DA0A 3FM9A 4GBJA 1GUBA 2AHOA 1TA4A 3E5RA 3IB6A 1KAMA 1T0PA 4TQGA 3U4CA 3GRPA 4FUTA 1Q84A 5KYNA 2GCGA 4B73A 4NJMB 1BGXT 3K9QO 4X65B 1Y9AA 3KVOA 4BFTA 5KWSA 2FWMX 3NHPA 4N49A 3OQPA 1W88B 5LMZA 3SDBA 2KW5A 4FT2A 3EVEA 4C7KA 1V2HE 1M7BA 2NZJA 2RAPA 1KTVA 2ATEA 1S3FA 1UQUA 1NUHA 2PWPA 2QF7A 4HSGA 3MFQA 2OVFA 5I8ZA 3ZDFA 2ST1A 3RPEA 3WQQA 1B2LA 4II2A 2ZK7A 3GJZA 5JEDA 3RYHB 3G59A 2DERA 4LWQA 4MCJA 4LJ8A 3SXPA 3EXG2 1MNQA 1F8GA 2O0MA 2RARA 3PITA 4E03A 1KTIA 1AD2A 2NXCA 2WVHA 1E9BA 1B1CA 1TUIA 1Z25A 3NBAA 2HT6A 4L07A 5BW8A 4PLHA 1KOFA 4FFRA 1MRSA 2WF5A 3E23A 4L0DA 1FW6A 1A50B 3M3PA 3P9QA 3JZFA 1WM1A 2G4LA 5FPTA 1BKYA 2C58A 4YTEA 5K3DA 4E15A 2IYRA 3FDFA 3L4BA 2HK6A 5I7AA 1P61B 1WDMA 4CHTA 4QG3A 2VP5A 1DJMA 4Q1FA 1XUOA 3HJNA 3M82A 3NIBA 1TLLA 4MRMA 5H8WA 2L19A 1N6RA 1Q12A 3AQ4A 1AKNA 2RI0A 3K0CA 3QVWA 4HL6A 3DWGA 4PQFA 1Q0TA 2P4HX 3NYIA 1JS1X 2ZBQA 1YO6A 4NOKA 5CPFA 3T5AA 1IG0A 2M1ZA 3DJFA 2Q7DA 1CZOA 4ALLA 3IQGX 3U49A 2FR8C 3VR5A 1HLGA 1TAUA 1BMTA 3RVOA 1MRZA 3OECA 2OCXA 3ZKWB 2QB5A 1GPUA 1AHHA 3AOEC 3TJMA 4F4UA 4I4IA 4H7HA 3GFOA 3E2MA 2GGSA 5B7QA 1XL1A 3ETCA 3L1UA 1T2UA 4F9FA 1GZDA 4QTXA 4BKQA 1T5BA 3X44A 2NMVA 5EE1A 4C4XA 2FJPA 2IXFA 1D8TA 1HE2A 3OZSA 1GSHA 3N2GB 2C5EA 1KI6B 4IV0A 4Z49A 4TMZA 3D1VA 3P2MA 4R81A 4F4JA 4F1WA 4QU8A 1DEOA 5F2KA 3I30X 5FOTA 1CLEA 1KJNA 2JANA 4UUAA 5K8VA 4US0R 1IEXA 1KI3A 3QSGA 3CUSA 5JC8A 2D06A 4PC6A 5CR9A 3WLOA 3TAHA 1YRLA 4FIDA 4WXPA 3FMOB 4NYMQ 3DDSA 3T0FA 5ADUS 3PNOA 1PQPA 3GN1A 2F4NA 4WADA 2VDWB 1LBQA 3ZC3A 4OGKA 3WSVA 4KB5A 3H13A 4CG1A 1UPBA 4BP3A 4RTKA 2YXLA 5AVRA 4LJKA 3DOOA 2Z4SA 4DQKA 2RGGA 3EEBA 1FU4A 1WNFA 3C7DB 2XUZA 1GTSA 2BUCA 3QNWA 4HBZA 1QG6A 2HEIA 2OCPA 4ZEMA 4BO1A 2A7QA 1GITA 3S7TA 3IAFA 2R5WA 1R18A 3PQ4A 5EXXA 2OHFA 4XFKA 4BB0A 2EBUA 2W43A 4YJ3F 4KR0A 3E05A 3OTHA 4J7XA 3PUVA 3V6LA 3S40A 4YVFA 1E6KA 2O1WA 3VPGA 1O95A 1SVIA 2IDJA 3EEQA 4S2EA 4DILA 1B14A 4W5WA 1GTVA 5BQFA 2D7CA 3NNDA 2YXNA 3QMWA 4RA6B 3BX1A 4WNIA 5D3KA 5D3QA 4KPFC 4O1HA 3H3FA 4ZKEA 2V7QD 1XQWA 4IGIA 1UAYA 2C5AA 5I4BA 2AW5A 3FOCA 3CURA 4IDQA 3EPJA 4H18A 2IHBA 3TRHA 3DZIA 2C9CA 3QUQA 4JUBA 1OAKA 3PJEA 3RS5A 4MYRA 4BUZA 1Z2AA 5A0TA 3BQMB 3FDZA 1KS9A 3KFVA 2ZS9A 2G80A 2WJ6A 5HUQA 2WWXA 1CD5A 1CUDA 2XH8A 1JYEA 3EVAA 4E51A 3B5IA 3JD2A 3B36A 3DE2X 5FNVF 3N28A 1I0LA 2GPYA 4WL0A 2JK1A 1T29A 1ZESA 2OZPA 2VSQA 4W8OA 5CNJA 1KO1A 1LSJA 5ECWA 1EIWA 1EEXB 2OQ2A 1QGZA 3IP5A 4KE9A 1J7JA 3HBAA 1IIRA 1YHYA 2IZ6A 1QR2A 3C98A 3Q98A 1KZYC 5ICSA 2I76A 2XI4A 1DCTA 2OZLB 4D1YA 1YFLA 3PJFA 3PWSA 3TOXA 2WIAA 1H66A 2VH5R 1MO2A 3OM0A 4KQ9A 4J1SA 4JLDA 4TYQA 1OX6A 4Q34A 1BS9A 2O06A 2GM3A 5DNDA 2IU4A 2WG0A 3DZCA 2ZROA 4E14A 2G8LA 3KVNA 4OBWA 5FDFA 3S44A 1FFHA 3HY6A 2VHUA 3I52A 4XI9A 1W4CA 2HU8A 3LPLA 4UZFA 3W8FA 2XYPA 3TLYA 1UH5A 4W5TA 3M6UA 5HFNA 1PYOA 2ZJBA 3EH1A 4YPFA 3DL0A 4D74A 4ISCA 4L9AA 4Q01A 1QV7A 3AEUB 1I4TD 2RJNA 4XRRA 1Q1GA 2OYRA 1JG3A 2WZDA 4DCTA 1PSZA 3I12A 1ISSA 2ENWA 2HK9A 3IHKA 1QQ5A 5EJGA 2IXEA 4F2WA 4BEVA 2I3ZA 1QDEA 3WK7A 1RHRA 3JQFA 4HWGA 2WE7A 1KFBB 1ZH2A 2L2QA 1H94A 2WUFA 3PG5A 3AFIA 1QGYA 4ETMA 5L7TA 5A2GA 1YJXA 2CMGA 1KDYA 4BX2A 1QV6A 2X3YA 4GX0A 4LDNA 4C03A 2I2DA 3EISA 4KUGA 1E20A 1O9HA 3D6FA 2FRXA 4IF4A 3MUFA 3RVBA 4BU1A 4DNPA 1W87A 2AI2A 4LVCA 3OZRA 2H3HA 4DF3A 4JYPA 4FLFA 1MH1A 1VIYA 4JMPA 3TQIA 5EWMB 5JIBA 5KNDH 2XMPA 3LH5A 1XQYA 5BV0A 4ODIA 2P90A 2QN2A 3ZHVA 2AQKA 3CYFA 1TC2A 1GG2A 3EG9B 4HDKA 3P9CA 4WKNA 1YKGA 2PRIA 4JR2A 2AKAB 2QIOA 4B80A 1MHTA 3DV0B 3R5FA 5GIOE 2A4KA 1L1FA 3EXIB 1H2XA 2W2OA 2DPYA 2VNKA 3U3XA 5ALVA 5B4UA 1ZRHA 4LSMA 2QBYB 1E3EA 1R8JA 1H2RS 1F3LA 1WJGA 3HKDA 4BHTA 5JPDA 3ZW8A 1UDAA 1N6IA 1UOEA 2GAAA 2PTHA 3G9QA 3OIDA 4LHVA 5TPWB 4C0WA 3QKSB 5C51B 3GFGA 2IP1A 3PT9A 4UAJA 1Y6FA 1T6NA 3BXOA 1LQ2A 2E5WA 3LZDA 2YVLA 3EMDA 4KR9A 1Y1KE 2OCKA 4UMFA 1MRNA 3VI4B 4QFMA 5B3JA 521PA 3SHTA 5JRZA 4DCJA 3R7NA 1IQRA 1FP1D 4E4RA 1T1IA 1MT0A 2QL5A 3CSUA 1NX9A 4YXWA 4TYYA 5C18A 2CCJA 1AUVA 1JAYA 1RXSA 1JSCA 1PJRA 2J07A 4RD2A 8ABPA 2N9UA 5EPEA 1LS1A 1H1DA 1KYWA 1X94A 2NTYC 2DM6A 3L77A 1FX0B 3ASZA 3NFYA 4TLBA 3C6QA 3VU0A 4BNIA 2ODAA 4CG2A 2QL6A 1ISPA 5DWVA 4RBNA 4LSGA 2JH9A 3M1YA 3VDRA 1LV8A 4DBLC 1ZONA 2XSZD 5EN4A 3NTXA 2VUHB 4FB5A 3VQTA 5HSGA 5JHHB 1T0JB 4I55B 4LRTB 5IT4A 1IJEA 4E1AA 3ETHA 4AYTA 2I6XA 1M33A 3C4VA 1MP0A 2QD1A 5EJIA 1VL8A 2Z5FA 2QZJA 2BFBB 4C4AA 1QE0A 1L5RA 5I7EA 4S04A 4JP5A 4KDRA 4CMBA 3MLEA 3KJEA 1F2VA 3KZKA 1VP3A 2QSUA 3FYCA 4OFXA 1N2XA 3B70A 5EJMA 3PCTA 4LJLA 4TTSA 3D6JA 3T35A 4AS3A 1ARZA 1ECFA 2H11A 4R1MA 4RQUA 1XGKA 3AWDA 2W2MA 1TCBA 2HMTA 2ZYIA 1LWOA 1Z4MA 2X4GA 1XZNA 3GQBB 5DU2A 3BWYA 4L5JA 5ALLA 5IKEA 2ZIGA 4FLEA 4RS3A 4YR7A 5KTMA 1KBQA 2OM2A 1MAVA 3D6TB 3KQMA 4W9NC 5EE5B 4YASA 4Q5IA 5J59A 4J4HA 4R6WA 1UJNA 2HQSA 1VYTA 1XZFA 1QVAA 1K2VN 1YC2A 3L02A 4GXTA 5KUTA 1YCDA 5LQKA 1D0IA 4X6XA 3M9XA 4BX9A 4O3MA 2YIMA 2CNDA 4UKDA 2G4CA 3H7AA 5ALNA 4FYKA 1QCYA 4PFQA 3K16A 4YFVA 2IZ7A 2A5YB 2LBPA 1ZKDA 4QTYA 4B75A 5B2FA 5JS1A 4A0FA 4CQNA 4DE5A 2HZ7A 4DSZA 2X13A 4ER3A 4NZYA 4TRNA 3UJAA 3UB2A 2HXSA 2C7PA 1QWOA 4ZJUA 1MA3A 3D5TA 3CUTA 2AC4A 3TPCA 3WAKA 2WQ7A 2GB4A 3BDAA 4DNQA 3R40A 5H70A 1YJ5A 3A14A 2P6UA 2ZAYA 3T7KA 3TI7A 1EA5A 3I1JA 5BN5B 2KMLA 3DWIA 5JQWA 1JA9A 3MMNA 3NNSA 4YCLA 1ACJA 4BLSA 4NDZA 4B3SB 1MOQA 2Q3HA 1R88A 1EE2A 3CA8A 8OHMA 2ODBA 5K9ZA 4RD4A 1BXRB 2V7PA 4UM7A 1VKRA 1FXWF 4HFMA 4W7SA 2W0SA 4P2BA 5HDBB 3FPGA 3VKWA 2XA2A 1VSBA 3SOPA 4LCBA 1F1BA 2EFGA 3CCCA 5P8WA 4KZKA 1XP8A 3ZWQA 3GLGA 1XRLA 4IS3A 4ND2A 1RBZA 4CHGA 3IR6A 5EVJA 2CWDA 3FFWA 4YAJA 1YZTA 1KEEA 4GYJA 3U44A 1CUZA 4H15A 2BEJA 2CSUA 1XZ8A 2HCBA 3OKAA 2JFGA 2X0KA 1S3IA 5ICCA 4B4DA 1LRJA 3E3NA 3FHCB 3VSDA 1JALA 1M2FA 4X1KA 4BZQA 2R7LA 3JWGA 1L1EA 1UWVA 3R8XA 1L4FA 3TB4A 1JH9A 3W5AA 2FX2A 2Z30A 2Q1YA 3HZRA 1PL8A 4BGUA 4YV1A 1A8PA 3W6NA 1DDIA 2QGFA 3KHUA 3G9XA 3KB8A 2ADFA 2J9RA 4GAEA 2VP3A 1A71A 4OUDB 1AS2A 4MUBA 2FTKE 3N8GA 3JVVA 4PZCA 3HUTA 4UW9A 1B0PA 1U2ZA 2DG2A 3NJRA 3SNHA 4CF3A 5GP1A 2LE0A 2B21A 4ITUA 4WBNA 1Y3FE 1JA1A 2YN4A 3IPYA 2H1RA 2VH1A 2EJVA 3LBFA 2CLHB 3WHIA 1VHTA 1I2ZA 4F86A 5EMMA 1E9VA 3T1OA 4D6XA 4LTNA 3QF7A 5BVHB 3RT7A 5KJ6A 2FWNA 4FBGA 2P9CA 1GFWA 1N6HA 2FFBA 2PMBA 3QLEA 4G1UC 4FHZA 4R2IA 3I62A 4RV4A 3UMMA 1W44A 2PLFA 4OMFG 5JAIA 3WGIA 3I9FA 1UMKA 3UWKA 1N1DA 1X7YA 2I4LA 4I8DA 3TSYA 3LV8A 4QQKA 3WLTA 3IP8A 4RADA 5AI4A 1OA0A 1RQ2A 4LFAB 3LLMA 2C54A 4NBWA 1WXXA 1X8XA 4RIEA 3WHPA 1HYGA 3LCMA 4D0GA 5GZ3A 1FSFA 3AEQA 3KZXA 1A7UA 1MABB 3MA0A 3R3SA 4LMPA 4XQ0A 1GAQA 1R9MA 2Q2NA 3UKDA 1H8EA 2FRDA 3MLBA 3FIUA 4K0KB 1FA9A 3DG9A 4U7DA 4ZZ1A 4ZYLA 2NADA 2OM6A 5IN5A 1B2RA 2IVZA 4D6YA 1ONBA 1Z7GA 3T61A 3UATA 3LNTA 1JVSA 2GJSA 3C41J 1DUSA 5G3ZA 3K30A 4BNLA 3ZJTA 3QZUA 4IHAA 3DMTA 3RVLA 1D6MA 2IBSA 2AUMA 3JWHA 4ISBA 2OHJA 4B8WA 2NXWA 3D4PA 3UMCA 4MRMB 4PR3A 5KB3A 2ISCA 1ZI9A 2CNBA 2Q5JA 4GP6A 4N6NA 2ECPA 3FROA 4OMDA 5H80A 3ZWOA 3HYNA 1DAFA 4HNVA 2CZQA 3ERCA 2A86A 2BI4A 1GHTA 1P91A 3AILA 5BSWA 1Z35A 1Z39A 1E2EA 3PRHA 1L4KA 4PY2A 3EFBA 3KD2A 4J75A 4M1WA 4HVTA 1WUTA 1SRRA 2XOXA 1QYIA 4MA5A 1R6TA 4P36A 5B58T 2QRQA 4D98A 1RXVA 4MXDA 3C7TA 3MRVA 5GONA 1V5WA 5I9NA 1B4DA 4RFVA 5L53A 1D2HA 1S2NA 1YVRA 2WB4A 2XMSA 3G0CA 2HAEA 1JPJA 1U99A 2H1LA 3A4LA 3MS7A 2PMKA 3DKPA 5AM3A 1HNZB 1OXVA 1P3Y1 3L7LA 4PU0A 4AICA 3C74A 3MBKA 3ZD8A 3RO7A 1LKZA 1ZVQA 4IDDA 1PGPA 3VH2A 2FEMA 2DFDA 3QBEA 4R98A 2BUAA 1L5HA 5MGNA 4KQCA 1NC1A 2RI6A 1OZGA 2C20A 4G0ZA 4J4TA 5T5QA 3UO8B 3G17A 1U8TA 5J43A 2GTIA 3UWPA 5IT9A 2FPXA 3TLEA 1T1EA 3FSGD 4RVSA 2OAGA 3O8QA 4UHCA 1QMGA 4OMUA 3V7UA 4Z2YA 1D2GA 1TUBA 2J0UB 4DFDA 5IFLA 1E2PA 1QHGA 4QYWA 3C48A 3HG7A 3K8OE 4AQYB 3A32A 2PWZA 1E2MA 4X66B 4D82A 4YRPA 2YN0A 5JNRA 4XUEA 3HCPA 3UMBA 1YRAA 1Q1BA 4BMDA 1SHZA 4M38A 1TZBA 1U0FA 4YJ2A 3G1WA 4FCCA 3FTQA 3DF7A 1Q95A 1QK4A 4XPIA 2BHTA 5E1MA 2IOFA 1MG5A 3EQ2A 4FEGA 4M98A 4NCKA 1NYQA 3T15A 4D46A 5F33A 1E8NA 3N53A 4TL8A 5HJ2A 3SHWA 3TFWA 1Z7EA 4ZZ3A 1S4QA 1YR6A 2A2ZA 4FHEA 5TF0A 1I5OA 3EJWA 3GD5A 4Q9DA 1I7NA 1NBAA 1SUEA 3EZXA 5EUMA 4UHKA 1NVTA 2AX3A 3FAZA 3FKQA 2ACKA 2PMFA 4NRDA 1YE8A 1ESEA 2OYCA 3MJSA 3K6SA 4JI4B 2D6FA 3SLRA 2AN1A 3JTMA 2G9RA 1EZ4A 4JNKA 1F06A 1QFXA 2VRCD 3K1TA 2OZEA 2R1TB 2ZI3A 3SM3A 2AQHA 2VDPB 1PL7A 4PXAA 4ARZA 2AVDA 2JCXA 2ZTSA 3GBSA 4BKPA 2W6JA 1SR8A 2IEBA 1J2UA 4U5QA 3ZNQA 3FPAA 4TTPA 2MR6A 3MQFA 1AXGA 1LDGA 2WICA 5JMTA 3AVWA 4D0SA 1M0TA 2Y0BA 2E82A 3QTLA 2XRYA 4YLEA 5JRJA 2ZRNA 1IY2A 3E1SA 3TG8A 3DBIA 4ZO7A 4L22A 4DT1A 4IY1A 2ZWIA 2X6RA 4TMYA 1KSGA 2AXNA 3GRUA 1R0LA 2QQ0A 3I1YA 4Y9UA 1JNXX 4KKXB 2PQ2A 1Z7YA 1YZYA 4I5GA 1ZXLA 1NNI1 1NW4A 1DEHA 1RMYA 2FSUA 3RJMA 2V6GA 2GZ3A 3DAHA 3ISTA 5HF6A 4JX9A 1SN7A 2XQGA 1T2AA 5F7JA 4CJXA 2CEKA 3FUVA 1NLUA 3K8ZA 2CK3A 1QIGA 2OUKA 3PV0A 2NXEA 1J70A 4DDWA 3F5FA 2VDLB 5CVCA 1OREA 5HCUA 4FDVA 1JSRA 1EHIA 4S1TA 4EPYA 1U6JA 3AR7A 1CJTC 2PWAA 4IJKA 3DCNA 4JJKA 3WFIA 5JCPA 1QH8B 3JS5A 1TT7A 3D5EA 4HF7A 3NBZC 1KVQA 4UBIA 3SLGA 1BFKA 1I32A 1UPTA 5F4ZA 3ZBPA 2HJGA 3Q40A 2Q7XA 3A27A 3PLAE 1P4RA 5DGTA 1Q2XA 3KNZA 4MWBA 2PZ8A 4CKCA 1VPEA 1SUDA 2JFQA 2NZWA 4MH0R 3DFIA 1R4NA 1DUVG 1G6HA 2O3TA 4LYFA 1MCZA 3R3VA 4KXNA 3M4YA 2CN1A 4FW9A 3P0FA 4K6HA 3U7QA 3OU6A 5TVKA 3G68A 3KQNA 2J7PD 5AXCA 4WA7A 2V59A 4P80A 2BKXA 1SJ9A 1DMRA 1G63A 4ID9A 4JT8A 4MW1A 4RLQA 3ASUA 4EJSA 4W1PA 4CNQA 1SXGA 1YQEA 3B6EA 5I9TA 4DEYA 1SQ5A 2QLTA 4YB8A 4X7MA 3UJ7A 5J40A 1WL8A 2YVAA 3LGAA 4K05A 1U8FO 1LLDA 3SEAA 1ONPA 4KMOA 4GL2A 1WAMA 3L7NA 3E48A 3VSAA 1XZQA 3D3NA 4R8VA 3W9BA 4HDKB 3RFTA 4G9EA 2P6OA 3R6DA 1JJFA 4RV9A 2OT3B 2BDTA 5LCXA 3U17A 3BMXA 1UT6A 4PBTA 3ISJA 1YZNA 4IVRA 4OAPA 3TYXA 1Q7CA 4TVSA 4YPVA 4NBKA 3PDUA 3JPWA 4JQSA 1SMKA 1NYTA 2VJQA 4D9MA 3T9BA 3GRCA 3UMYA 4NI5A 2F67A 3II6X 4QLBA 4X20A 2H31A 4IHQA 1K7YA 1EX9A 1YVEI 2NOAA 3ND5A 2B8WA 5EKTA 1UDRA 3AB3A 3SCZA 5CDUA 1J25A 4J76A 2C88A 4L02A 1CS0A 3MAAC 3R5XA 4C0XA 1IPFA 1SUPA 1EK0A 3NOVA 1HDEA 3VMFA 3RYIA 3W2GA 3RSFA 1V11A 1QUFA 2GPNA 3LCRA 4G9GA 1L7MA 4J2TA 1JR4A 2GHTA 4CXMA 4RWEA 4P3KA 3TCXB 1MB9A 4GM4A 2UUBB 4GHWA 2QYOA 4AZ0A 5CCXA 1OWLA 1XAJA 1ODFA 1G17A 2C31A 3TI9A 1M8JA 2HCFA 1BU8A 2APJA 2D4HA 3NPAA 2GN8A 1Y8QB 1IM8A 1VE9A 2R1UA 5ESRA 2QZ4A 3PGJA 2CFCA 3VU9A 2P1DA 1O7JA 3AHIA 1YNOA 4C0QC 2PJRA 4NZPA 1VI6A 5DHRA 1DQYA 1NY6A 1IFXA 4MV8A 4DRZA 1GPKA 4HLCA 4G1VA 1ISRA 1WSAA 5IUJC 3HXTA 1NF3A 4U63A 3ZDAA 2JGKA 3N7UA 1ZGCA 1OOEA 2VDJA 3PC7A 4ZRNA 2MDTA 4Q7EA 4CM4A 1YFZA 1YKFA 2A94A 2IXTA 3OEED 2GXUA 3ULKA 5JISA 2J85A 4KYVA 1VZ3A 4D26A 1QF6A 1U1IA 5FBZA 2XYVA 3RKRA 3AJ9A 1VLJA 1NG9A 1N2JA 3INYA 1JH8A 5FT9A 4WDQA 1XRQA 1FU7A 1GCGA 2OQIA 1XDBA 2FMIA 2TRSB 1FZTA 4KNWA 1KXJA 3AUJB 5EIOA