4FWBA

Structure of rhodococcus rhodochrous haloalkane dehalogenase mutant dhaa31 in complex with 1, 2, 3 - trichloropropane
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
292
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPFPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGALPKYVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGFIIPPAEAARLAESLPNCKTVDIGPGLHFLQEDNPDLIGSEIARWLPALHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystallographic analysis of 1,2,3-trichloropropane biodegradation by the haloalkane dehalogenase DhaA31.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 104
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fwbA00
4ITVA 1UK7A 2DCMA 2Z3ZA 2VJCA 4UBJA 5DNWA 2ZVDA 3H19A 2WFMA 5DTJA 4OSEA 1BU8A 4BATA 2Y1KA 3WWCA 4Y7DA 1AX9A 2ACEA 4BDSA 3E0XA 2B20A 2QTBA 3VJLA 5LKRA 1FJ2A 2PSEA 5CT6A 3G7NA 3PF8A 3TJMA 5I8PA 3HXKA 2XUQA 4GLBA 1ZI6A 5AM1A 3O9VA 1WOMA 1WPRA 2FJ0A 1ZICA 2WUEA 2EDAA 2XMZA 5LYYA 3OURA 3ANSA 4D9JA 2YYSA 1AZWA 1THGA 3UUFA 4C4YA 5EHXA 2XLCA 3O0DA 1F0PA 4H7HA 3G9ZA 4Z49A 1LPOA 1CUGA 3WKBA 5A7HA 4G9EA 3WMRA 3WK7A 3HABA 3I2JA 4M0MA 4UHDA 1E8NA 1P0PA 3G0CA 1ZD4A 3YASA 5J3JA 3PICA 1EX9A 3D2AA 1ZI9A 3HZOA 2PSFA 5K3AA 3QMMA 3RK4A 2G5TA 3QMVA 3PF9A 5IKXA 3WL5A 5KREA 4DNOA 2B4KA 1QIIA 3S8YA 3BXPA 5AKXA 2HDWA 2E3JA 3V9AA 2XUKA 3F98A 3F67A 4MQLA 5ESRA 2VSQA 5K3CA 5EIEA 1DWOA 2VJAA 1IUOA 4FKBA 1L7AA 3G8YA 1QIJA 4BVKA 4TGLA 4ZI5A 4IH4A 1QO9A 1XZEA 1XROA 2ORYA 1TRHA 1R3DA 1FFDA 4X91A 5AM2A 4WCVA 3H2GA 5A71A 5FRDA 3I1YA 4H35A 3E4DA 1VA4A 2R11A 1XLVA 1A88A 2O2GA 4DSZA 4B0OA 3EF3A 4AXBA 4UHFA 4GECA 3D3NA 5HFNA 4O08A 4H7IA 5AM0A 3AUKA 1E3QA 1H22A 2CUTA 4MJ3A 1U65A 1A8UA 5LIPA 3AZPA 5CH8A 5T4FA 2HU7A 3STTA 3I6YA 2PU7A 3FYUB 4CG1A 3O95A 2HA7A 2JGIA 1T2NA 3NGMA 3AILA 4KACA 1DT5A 3WK9A 1WM1A 3AIOA 2H9YA 1QTIA 2C0QA 2VEOA 5H3HA 3F97A 5ISMA 4DSAA 2QJRA 4AN0A 1XZKA 3PUIA 2WFLA 5I7UA 5HK8A 3WJ2A 4G8DA 1A7UA 4OYLA 5A2GA 4B83A 2IITA 4BAGA 2GBFA 2JGFA 2R8BA 1DINA 5EHQA 4BVLA 3MVEA 4NS4A 3GZJA 4PSCA 2HA4A 5IVHA 4RE5A 1CQWA 4UHHA 3M81A 2HA5A 1QIEA 2H7CA 3WK8A 1A8QA 1UK8A 1XZCA 3VVLA 5ALLA 1TCCA 1Z68A 4FLMA 3C45A 5AJHA 2JF0A 1EA5A 1ACJA 1EXWA 1OILA 4KAJA 5IH7A 2WFZA 3G0IA 1XRMA 1DX4A 2X76A 4PSUA 1X2EA 1XQYA 1QIKA 1BN7A 5HF8A 4DMHA 3H2IA 2HFKA 3ZPXA 4UHEA 3WZLA 4QZVA 2XQJA 3H17A 4JYPA 3FYTA 3EQ7A 3ESAA 4N5IX 1MX1A 1TK3A 4ZRDA 1I6WA 3DDUA 3V1NA 5DJ5A 2DHCA 5HF6A 1P0MA 4HXEB 3U0VA 3STXA 2QMQA 3WWDA 2C4HA 3A6ZA 4HXFB 1WB6A 2XUGA 4G5XA 1YAJA 1LPSA 4GWLA 3BDIA 3BWXA 3IB3A 3FSGD 2XMDA 2WG1A 4DMCA 1XQWA 3QMWA 2XE4A 4HZGA 3OM8A 3BF7A 4QDZA 4X6YA 3A2MA 1NU6A 5FKJA 4L9AA 4X92A 3SWWA 4BTLA 4MYSA 1CUBA 1W52X 5AK4A 5SYNA 2BUBA 4EZIA 2JGLA 2O2HA 4C4XA 2K2QB 5FUMA 2FJPA 5AKIA 2AXEA 4XIIA 1CFJA 2QM0A 3QZUA 1DQZA 1LZLA 3C43A 4Y9SA 5C8ZA 2VJBA 2D5LA 5E4JA 1NX9A 5ALNA 3Q0TA 4Y2QA 3FLEA 1XRNA 1Y37A 1BE0A 5EHNA 4CG3A 4RGYA 4RPCA 5LZ5A 1R9NA 2HADA 5DLPA 3IDAA 2C5GA 4H18A 1VLQA 4OB7A 3MUNA 5T4BA 5BWCA 2GBCA 5C81A 2HIHA 4WFJA 1QIFA 1KU6A 3DKKA 3WWEA 5K5EA 4KEAA 1ZGBA 4X85A 4Y2JA 4DYHA 1CUUA 3FAKA 3AINA 4X90A 4U2EA 4Y2TA 5DWDA 5HQ3A 4TPKA 1UKBA 4YASA 2JGJA 2V96A 1LPBB 4AQDA 5C7YA 1J07A 1YR2A 3NOXA 3WK6A 1CUHA 4KRYA 5JYCA 5JD6A 5FOQA 3G9XA 3IUJA 2OQIA 4LYEA 2CKMA 1ZIYA 5JZBA 2XQFA 3D59A 2JIDA 5AOCA 2W22A 3EIOA 4IO0A 1G5FA 3G0GA 3WKCA 1N5RA 1BCRA 4TVKA 2BCEA 2X5XA 2RGUA 2ZYSA 1AURA 1ZD3A 3FNBA 4BP9A 2RHTA 2JGMA 2AJDA 5JATA 3R41A 3ESDA 1CLEA 1ZD2P 2C0PA 1R88A 2UZ0A 1QE3A 1JJBA 3STYA 1W6RA 4UBKA 1EINA 3I1IA 3WKDA 3AJAA 3I28A 3VJKA 4EB0A 4UHBA 2C7BA 4N8DA 1MT3A 1YASA 2RONA 1U2EA 1R9MA 4KYVA 4FWBA 1UK9A 2Z8ZA 1G4HA 1QIMA 4EUSA 3S2ZA 3TRDA 4J3JA 1C4XA 2ONCA 2WTNA 1UOQA 2B9VA 1ODCA 2YH2A 4JUIA 3BIXA 2XMCA 3H2HA 1QIDA 1FFBA 4P08A 4YX9A 5JADA 2CBGA 1VJ5A 3WL8A 1YB7A 4HTAA 3HC7A 1ODSA 1LNSA 3QBJA 3O4JA 3STVA 3H04A 4I4CA 4I19A 3ICWA 3TEJA 3ILSA 5FPQA 3IA2A 2AJCA 3LIIA 3AZOA 3DOHA 1BCSA 4WFIA 1AC5A 2PKYX 2Y6VA 2OAEA 1JFRA 3WIBA 5AM5A 1EI9A 2QXUA 1CUVA 3K9BA 2G5PA 3BL8A 1UKAA 1IUNA 5HF9A 1AUOA 1KEZA 3DCNA 4UHCA 2RAUA 2HA6A 4BBZA 5LP1A 3VXKA 1UWCA 3QYJA 4DTCA 2WIDA 4P92A 5ALPA 4W9RA 5D6OA 2RI6A 2WHQA 5K3FA 4AX4A 1EDDA 4Q3KA 1H2ZA 3BE8A 4OYYA 2VAVA 4OUKX 4UBOA 1WHTA 1BS9A 1AKNA 3LP5A 4X6XA 1QFSA 3QVMA 4DNQA 1K63A 3R0VA 1UKCA 3ZLTA 1S8OA 1DWQA 2OLEA 5AKKA 3DL7A 5KBYA 4ARAA 2G63A 4J0DA 5AOBA 1R1DA 1EB8A 2VQ6A 4PSDA 4XX1A 4OU4A 4F60A 4RNCA 2I78A 1D07A 1QFMA 3C6XA 1ZIXA 3I2FA 5ALUA 4FTWA 2XUIA 3PFBA 2HA3A 2ZSHA 4FOLA 4FNGA 2QKYA 3A2NA 4QA9A 1BEZA 2Y6UA 5SYMA 4NZZA 4X7BA 4HAIA 1ZJ4A 2JGEA 4DLNA 4BDTA 4QDOA 1LBTA 1LZKA 2OCLA 4MYDA 3R3XA 1X2BA 5A62A 1G66A 2J4FA 4A16A 4B7ZA 1ZGCA 1LLFA 4NVRA 1DX6A 5EFZA 4UFOA 4ZXFA 3HSSA 3FYUC 3WLAA 3QITA 3UMJA 1VA5A 2QT9A 2WU4A 2CJPA 5JAOA 3KDAA 3QM1A 4KAAA 2B61A 4X6UA 3I2IA 3R3VA 1ZOIA 4E14A 3IUNA 3KWJA 1H23A 3O4GA 1YCDA 2H1IA 1M33A 4UFPA 1IZ8A 3JWEA 4LYDA 4DIUA 2NW6A 2BKLA 1TCBA 3G02A 2DR0A 2VF2A 3LIPA 4K6KA 3CCBA 3IULA 4KRXA 1T4MA 4J0IA 5CH5A 4Q82A 5LZ7A 1TCAA 4PW0A 4HVTA 1GKLA 3I2GA 2H7XA 4CG2A 2PX6A 5AKGA 2ACKA 2GBIA 4QDXA 2WJ6A 3VISA 2BUAA 2EEPA 4KAFA 5LZ8A 3GA7A 1XZIA 1HBJA 4OB8A 2GBGA 5JASA 2XT0A 3V1KA 4IHAA 2VT6A 3JYHA 4UPDA 1GPLA 2HFJA 3A70A 5CURA 5AI8A 1N5MA 3R3WA 3DKRA 1XRLA 4C01A 1YA8A 5AI5A 1PJAA 4BCCA 3AIMA 5DYYA 3WA7A 3OG9A 1FSSA 3L1IA 3BJMA 1WB4A 1QIHA 3IVMA 2PL5A 2QJWA 1AQLA 5E2IA 5BOVA 4X00A 2ZJ6A 4OD0A 5ALEA 2DHEA 4WY8A 4OCZA 1CVLA 5AM3A 4BE9A 4AO8A 3CN7A 4CFSA 4ZWNA 3GROA 1B6GA 2PBLA 4H7DA 4HXGA 3C6ZA 1LPPA 1RP1A 5FLKA 3C6BA 3V1LA 1WPXA 3FLAA 5AKJA 2J3QA 1GZ7A 2OCKA 1HPLA 2CZQA 7YASA 4FFVA 5CXXA 3O9MA 3DS8A 3OC0A 4BYMA 2BGNA 5FXMA 2ZSIA 4A5SA 5EIAA 3V48A 5AI6A 4FHZA 2V9ZA 3IUMA 1W1IA 1J06A 3WJ1A 4ETWA 1ACLA 2YXPX 3BIWA 2GYUA 3DEAA 5JAHA 4CIAA 4LHEA 3QPCA 4XVCA 4PF1A 1AGYA 4K2AA 5CT9A 3N2ZB 1U8EA 5ALTA 4JYMA 1VZ2A 4FBLA 4Q34A 4DNFA 1LPNA 5HZGA 1C7IA 2YASA 4H7EA 3DNMA 1MU0A 4QLOA 2WJ3A 5AIBA 1XZFA 4BCDA 2IX9A 1CIJA 1HDEA 3WL7A 2ZJ7A 3G9TA 4BCBA 4BE4A 2XMGA 4J7AA 5ALMA 2BJHA 5CT8A 5T4HA 5DNUA 1QONA 2OGTA 1JU3A 1VKHA 4B9AA 4FNMA 2Z5GA 3JW8A 3DQZA 2CB9A 3L1HA 2XMRA 5ALSA 3CXUA 4E11A 3EBLA 3R40A 3G9UA 3D7RA 3K6KA 4OU5A 4EY8A 1ZD5A 4G4JA 4Q3OA 3FVTA 4UBMA 5D3ZA 5CT4A 2ECFA 4C6HA 2OCGA 3M82A 4U2DA 4AZ0A 1YB6A 4Y2PA 3W2TA 3ZI7A 1MO2A 2HU5A 4EA6A 4UBLA 1XQVA 1E8DA 4MEAA 4WY5A 1XZDA 4MWSA 4WDRA 4QLAA 3K2IA 4Y2VA 4QEKA 4WJLA 2QRUA 1HLGA 2XUDA 1YAHA 3F96A 1VXOA 2WIFA 4LXHA 4K6GA 2DHDA 3ZWQA 1XRRA 2WSLA 2P8SA 3B12A 3DL4A 4V2IA 5DYWA 2XUAA 1NU8A 1Y7IA 3ZLVA 4ROTA 5AKHA 5DYTA 2PSHA 5IVKA 4JEIA 2AJBA 1VOTA 4P9NA 2OGZA 5AI0A 1JT2A 5AM4A 1JMKC 4G1FA 1SCIA 4I3FA 5E4YA 2OGSA 1E89A 3KD2A 4N5HX 1VXRA 3VJMA 2DQZA 4AMYA 3R3ZA 1XZLA 4L72A 4J0KA 1VZ3A 2VJDA 1CUIA 2V98A 1K6EA 2PPLA 1GXSA 2LIPA 5ALDA 1X70A 4QWWA 5AI9A 1XZBA 1DQYA 3MUOA 1XQXA 4G8CA 4DGQA 1GPKA 5BV7A 3STWA 5ALJA 2QR5A 3W06A 1MPXA 1CUEA 1R50A 3HJUA 1MN6A 5HF5A 3QPAA 4GEGA 3O4HA 4FLEA 5ALZA 4AB1A 2QS9A 2WG0A 4QWMA 2V97A 3FVRA 2WIKA 5ALFA 3ESBA 3WKEA 3FYUA 2VA9A 4B81A 4J03A 4Y2YA 3T52A 1SCQA 1AMNA 3IUQA 2QXTA 2W6CX 4UFNA 1ZJ5A 4DMFA 3W05A 5AH0A 2OXEA 5JALA 1L7RA 4L0CA 2RIPA 1XZMA 5YASA 4A23A 3UUEA 1CUWA 5JZSA 1CUAA 1XKTA 5ALVA 3HYSA 3T4UA 2CMFA 1Q0RA 4MEBA 5CMLA 4AO7A 5LLSA 1LPMA 4ZGBA 2OPHA 1CRLA 4JNCA 5CT5A 3DLTA 4PO3X 1ZI8A 2CEKA 2O7VA 3H2JA 1MNQA 1UZAA 4B84A 3DJYA 3R3UA 1WHSA 2XQIA 1VE6A 2WG2A 2XUHA 2QUBA 2XDWA 2C58A 3VVMA 1G42A 1IMJA 4S0XA 4BC1A 1XLUA 5EIHA 3WI7A 1MJ5A 1DTEA 5ALOA 1J2EA 4F0JA 5ALGA 3B3QA 2DSNA 1ISPA 2Z3WA 1JI3A 5AIAA 3FWHA 1CUSA 4Q1VA 5FDFA 5FPPA 4G9GA 2ZYRA 4BAUA 1JU4A 5K3EA 3FCXA 2JEYA 1E5TA 3WQHA 3RM3A 4PNZA 2HHAA 1YSCA 2WM2A 3L1JA 1TQHA 4X95A 3QPDA 5AO9A 3FBWA 5DNVA 3R3YA 4IH1A 3C5VA 4F21A 2QOEA 2AJLI 3WZMA 2GZRA 4UBIA 5JD4A 1H2WA 4H7FA 3HRHA 4U2CA 4UBNA 1PV1A 3ZV7A 3GBSA 2QUAA 4M0EA 3TGLA 4C87A 5KWJA 1TIBA 5ALYA 4B82A 1ORWA 1XZGA 1EH5A 2PUHA 4BAZA 3F9CA 3NWOA 3SC2A 4Y2UA 3AIKA 4WDQA 4W1SA 2ZYIA 4LIPD 3C6YA 2XLBA 3Q8WA 1MAAA 4LXGA 5BWBA 2HA0A 1GQSA 3BJRA 4GXNA 2WILA 1K4YA 2WU3A 3ZLUA 5ALQA 1QZ3A 1LPAB 3WWOA 1O6FA 2JBWA 4J0HA 3LCRA 1UOPA 3LLCA 4FLFA 3HI4A 4YK7A 2D0DA 1HKHA 4CCYB 1UT6A 4MQMA 4QDTA 2I3ZA 1BRTA 4KE6A 4Y2XA 3W04A 2HA2A 4AO6A 3VDXA 4LKOA 4AN1A 5HQ3B 1BROA 2VTVA 2Y2UA 3BDVA 1RWQA 1UXOA 2GYVA 1N1MA 3ED1A 4EY4A 3WYNA 2Y2VA 1SCKA 3CCCA 4H77A 1IUPA 3I2HA 1C7JA 1CQZA 2XB6A 3WK4A 1CUJA 4PV7A 3U1TA 1SFRA 1OCEA 3GELA 4KJXA 3PE6A 4QDUA 4QE3A 2WUFA 1DWPA 3C5WP 4Y2SA 1BEEA 4J0GA 1MAHA 5A7GA 1SC9A 5HKAA 4XJVA 3E3AA 1H2YA 1U4NA 5AKEA 2H7YA 3W9UA 4X97A 5AKLA 1THTA 2Q0XA 1E66A 4HRXA 1CV2A 3MGAA 1GT6A 1LBSA 4BP8A 3ANTA 2O2IA 1YS1X 4IQ4A 2XUJA 2WUDA 5A6VA 5CW2A 1QGED 1CUDA 2ZYHA 3D2BA 3N0TA 3O4IA 5C8XA 1TKRA 3DD5A 4N8SA 5JANA 4CIBA 4ZV7A 3LS2A 1CUCA 4B0PA 2OCIA 5LZ2A 3WWPA 3HLKA 4KE8A 1USWA 5AKYA 3KWFA 4EY7A 2XMBA 4E15A 3H2KA 5IVIA 5A7FA 1QIGA 2J4CA 1DT3A 2DQYA 5LZ9A 1ORVA 3WIOA 3D5EA 4GDMA 4X93A 4GBGA 4W1PA 3H18A 1J1IA 1Q84A 2WUGA 1LGYA 1MX9A 2X8BA 5ALWA 3AFIA 1SOMA 4WFKA 3VKFA 1K8QA 3QH4A 3HEAA 2FUKA 4E46A 1F8UA 3H0CA 3RARA 5JZ9A 1UK6A 4XWGA 4KE9A 4MXDA 1EHYA 1FFCA 3FSGA 4BZZA 4OB6A 4DM7A 1CUFA 1EVEA 5AK5A 4Q05A 2WHPB 4FMPA 1HQDA 4U2FA 1EVQA 4ZV9A 2WQZA 3OPMA 3DYIA 5IVDA 4BC0A 3PDCA 1QLWA 1GPNA 5K3FB 4DMKA 1ODTC 5HKBA 3C8DA 2VT7A 1K5PA 3FLBA 5ALHA 3ICVA 4X71A 5F4ZA 3PI6A 2XUPA 2BGRA 3P2MA 2WIJA 2WTMA 3STUA 4CI9A 1XZJA 1EK1A 2WIGA 1CR6A 3D4LA 5JAPA 1PFQA 2WKWA 2OG1A 3PUHA 3V1MA 3A2LA 1MTZA 2RHWA 3WA6A 4J0CA 2VATA 3W9BA 3FCYA 3IURA 4L3WA 1YS2X 1XLWA 4FBMA 5K3BA 3OOSA 5C8VA 1L7QA 4YPVA 5CXUA 1EDBA 1W4LA 2BAGA 2JGKA 5CRIA 5JIBA 1QJ4A 2DFPA 2XMQA 1WCYA 4W1RA 1CUYA 5ALXA 5LZ4A 1MNAA 1XZAA 4H0CA 5DTIA 1BN6A 1YA4A 2ES4A 4Y2RA 1Q0ZA 1QOZA 4BRZA 4DNPA 4KE7A 4KR0A 2I3DA 4P93A 4PQEA 4QNNA 2Z8XA 1QO7A 1UOOA 1GKKA 5ALIA 5CH3A 2QZPA 3D2CA 4N8EA 3H1AA 3GUUA 5AK3A 3WKAA 2VAXA 4NMWA 5AKZA 4B9EA 3PFCA 4X3CA 4FDMA 4GI1A 6YASA 2IIVA 5AK6A 3C70A 2HRQA 1FFAA 3OTQA 5FP0A 4RE6A 3RLIA 5EI5A 4JH0A 5HK9A 2OAGA 4G8BA 1P0QA 2HRRA 3SK0A 3F8SA 1MX5A 1JKMA 4BZWA 4EHBA 4CCWA 1P0IA 3KOOA 4GHWA 1DU4A 4M0FA 1HL7A 4EY6A 4IH9A 4CCYA 3B5EA 1CEXA 2PUJA 2HU8A 3RKSA 5CBKA 1XZHA 4HRYA 4BTVA 4OPMA 4G4IA 1WB5A 5AI4A 5AICA 3WK5A 3KSRA 1A8SA 3EQ8A 4MWTA 5D3KA 3WYDA 1F0NA 2AJ8A 2FX5A 2QVBA 1XFDA 5FV4A 1EB9A 4LXIA 1JJFA 1OXMA 3ESCA 4FFWA 2XQKA 4U2BA 3EQ9A 1W75A 3X3HA 1W76A 5AOAA 3HACA 4INZA 4ZREA 2ZJFA 4EBBA 2GYWA 2PU5A 5EGNA 4H7JA 2BFNA 2OQVA 3SX4A 2G4LA 1JMYA 4Q3LA 4C89A 1Q83A 5AHXA 2WHRA 3FOBA 4C88A 1H2XA 1QTRA 2HM7A 4AZ3A 2XUOA 2PVSA 5LKAA 1R4ZA 1TAHA 2WJ4A 2GZSA 4W1QA 4U2GA 1Y7HA 1O6GA 4EY5A 4K6HA 3DOIA 3IBTA 1UFOA 1XRQA 3H1BA 3G0BA 3I6MA 1XKLA 4X94A 1XRPA 3G0DA 4GW3A 2WFLB 5AP9A 4ARBA 5CTAA 2ROQA 4BRSA 1CUXA 1CPYA 2BUCA 1VE7A 2C5FA 2XUFA 5HFAA 1F6WA 1RYYA 3C8HA 1E8MA 2EDCA 4B6GA 3NUZA 5E4TA 3BF8A 4BVJA 2PM8A 2J3DA 3CN9A 5ALKA 2WLSA 3WL6A 4J0JA 5K3DA 5JD5A 3KXPA 1GGVA 4HS9A 1CUZA 3DYVA 5T4EA 5ALRA 5KWIA 2XQGA 5I9IA 4UUQA 3M3DA 2PSJA 2WHPA 2XMSA 2I03A 4F5ZA 4AMZA 4G4GA 3I6ZA 3GFFA 5JARA 1IZ7A 4C4ZA 1ETHA 2JEZA 5D7BA 1JJIA 4B80A 4K5QA 4BB0A 3D0KA 5EHZA 2XI4A 3I2KA 1B41A 2O7RA 3E1GA 4B85A 5HCUA 1EDEA 1GQRA 5JAUA 1N8SA 3IIIA 2PSDA 3M83A 4H7KA 1FFEA 1KU0A 2HL6A 1IVYA 3AZQA 4W63A 1EK2A 3C87A
chains in the Genus database with same CATH superfamily
3M0EA 4OP3A 2XVZA 4NG5A 5EKUA 1IRIA 1KQ3A 1E61A 1SVLA 3E9NA 4YJFB 5A5EA 3AIIA 3OQBA 4GZMA 5DNWA 1WZUA 1A8HA 4L8LA 1GSAA 4LNUB 2NPFA 3ZWAA 2O07A 1Q7RA 1NUTA 2QRPA 1XTTA 2JRLA 4YWHA 4CIXA 1XCPA 1GZSA 4OXQA 1BXKA 2X9GA 4OBEA 1LVUA 3T99A 3GA0A 3C3KA 3LY8A 4HG2A 4DMGA 1X7WA 4QRHA 4JZKA 1EUCA 2GXSA 1RAHA 5LKRA 1DC8A 2R7LA 3AP1A 2C0CA 2PSEA 1PHRA 1ZH2A 1Y5LA 1K89A 5SY9A 2YXBA 3GLHA 1CF9A 4QYXA 4DGSA 4O0LA 1N9ZA 2XUQA 4RO0A 3ZE0B 1JDPA 1PJLA 2CXRA 4P36A 3EFEA 1GTVA 1ZI6A 5T8KC 3R9KA 1DKNA 3UQYS 5AM1A 3FR8A 3MJHA 1K3UB 1PVVA 4EELA 2CZCA 2QN1A 1WOMA 1WPRA 3MCWA 4LSMA 1ULHA 1AV7A 1CJTC 1P7CA 2RKOA 4QUAA 5CM2Z 5EOVA 3AW8A 4LF4B 1M6YA 1QVZA 2H0AA 1TZ2A 4OIMA 2EDAA 4OG2A 2LW7A 3LW7A 4TKLA 1JFFB 5LYYA 3NONA 3OURA 4C04A 3RAGA 3ZQ6A 4M4SA 3Q11A 4LQLA 1FYEA 2QM3A 4B2YA 1IN1A 5F3RA 1ZBDA 3CWCA 1P3Y1 2XNJA 3GYBA 4N82A 2BBSA 3GNTA 3L7AA 4U00A 2GBLC 1HNNA 5EZQA 2PKCA 1VSQA 2M32A 4KZPA 3GEIA 4L8YA 2XTAA 3TAXA 1RYDA 1LPOA 3TRJA 4MVCA 4DT1A 3OZTA 3WKBA 1ONPA 2NU6B 2MWMA 4M1YA 3DT9A 4HJXA 4O4JF 3ABQB 2FFQA 3DG9A 1Y4DE 5D87A 4EGQA 4M0MA 3HDTA 1JG7A 5EJMA 2G7MC 4ASUA 2VPTA 1E8NA 4FM9A 1RXUA 3C7TA 3G0CA 2OBMA 1V95A 3IKTA 1J00A 3BFKA 2QVYX 3ZVMA 5KDLA 2CNDA 4WFQA 2JKYA 3TQFA 1YI8A 4XCVA 8ADHA 5JSFA 2IYUA 1AXRA 2JGNA 5EWMB 4PLFA 3USES 1PR1A 1C7FA 2XXAB 5EWLB 4G1EB 5FUQA 2R2AA 2PUTA 2RGNA 3VI4B 4P4TA 1DO0A 4NH0A 4EG6A 1OAOC 1SUFA 2QL7A 3ZU4A 4RKRA 4V0NA 3BJZA 3HZOA 2K87A 2PSFA 2B35A 3QMMA 4C6SA 3RK4A 3CLKA 1OKKA 3PXUA 2W6ZA 3QMVA 2WC1A 1SULA 4C0XA 2B98A 3ZLJA 2WBLC 3LYUA 3NVAA 5KOIA 1N34B 5IKXA 5CYGA 3WL5A 5KREA 1DJQA 2IP2A 3LUAA 3IXQA 3RVJA 4XDYA 4MUFA 3FPFA 1G3IA 1PVDA 2QG4A 2AYXA 1YD7A 2L69A 2JIOA 4HNAA 4TYNA 5AKXA 4MJ7A 4YC7A 1XEWY 2ISCA 4DKJA 4V0ME 2YWHA 4QGFA 4G1CA 4LV5B 4S3MA 4TUYA 5E7IA 5BWLA 2HK9A 3JARB 1U7WA 1SUDA 3GHHA 1WQ4A 1JU9A 3L93A 3KJEA 5J4YA 2COEA 4FW9A 1RD4A 2OZPA 4RA9A 1WEHA 4N6NA 2QI9C 2ZULA 1YONA 3PDUA 2VJAA 1ORTA 2H6EA 2V7EA 3GEPA 1KYIA 1L7AA 2BGMA 3H6HA 3UGJA 3QUSA 2JGAA 5ESDA 1A2BA 3U16A 2H3EA 1WLSA 3E58A 2FFRA 1V5IA 2QTFA 4UU7A 4CMKA 4GOJA 1XRJA 4IH4A 3UNXA 1XZEA 2XAAA 7ADHA 1VKRA 2CBZA 3L0PA 3FDXA 2ANBA 5H70A 1GPUA 3N3AC 1YE5A 7MHTA 3MIZA 4QFBA 1ML4A 3ZKAA 1QDLB 1FFDA 5C1BA 1SBQA 3H2GA 1JDJA 3IAXA 4GGOA 2OVFA 3I1YA 3PQ8A 5FRDA 3ZH2A 1J0CA 2V6IA 2I4NA 3E3MA 3OM0A 2V6GA 3MT7A 1FFSA 2AG6A 4JJFA 3I12A 3QVTA 1KMIY 2PRIA 2X5KO 1N3LA 2ZRDA 1IB6A 3G2QA 4N18A 4CZ2A 1ZXXA 4LBWA 3BWEA 3EF3A 4AXBA 5JMWA 4KIUA 2Z6UA 5A4KA 1GXSB 3D3NA 3EN0A 1JW9B 5DIFA 1R6VA 1A9QA 3QP9A 4NRDA 4UM9D 4P58A 1IFXA 4B2LA 3NJ8A 3P4XA 1S96A 4FYPA 1A4IA 3NHKA 1OJ7A 2DWUA 4OOFA 2FSPA 3H9BA 2AYYA 4US1R 2IGTA 1KMNA 1Q1NA 1E3QA 4OAQA 3U3KA 3H5IA 4FFBA 4MVWA 3ZVLA 1F4PA 4EI9A 1EGMB 3K92A 2WDZA 4AP5A 1A8UA 1PZHA 1LC0A 2A7QA 2EZ4A 3OA0A 3QKRB 1GZVA 1L8LA 2WZQA 2ZQ5A 1AU9A 1TK2A 2HU7A 3FWYA 3G7SA 1AF7A 1MJFA 1ZRMA 3LECA 4LHXA 1BMQA 2WD9A 4ZALA 3KVYA 4YAKA 2OGUA 3KP1A 3Q88A 3ULKA 1JDBC 3KCNA 1RYFA 4QKQA 4DJAA 3I6YA 2NV2B 4C3ZA 2RGXA 2WJVA 3R6DA 1F4LA 4GWKA 5JS6A 3M4XA 4JXXA 3WLNA 2J0QA 4F96A 3FYUB 1EFKA 1E4EA 1IB0A 3IDQA 4C14A 4TQ9A 5LSAA 3VYVA 2R5WA 3T1HB 2LDXA 5E0KB 2FE4A 3L82B 4CG1A 2HA7A 1YT5A 2X2OA 3AR4A 2IZOA 3P2OA 3TW6A 1I80A 2RMKA 4DM3A 2B36A 4NZOA 5AVJA 3QXSA 4ME6A 4B8WA 4I1IA 5JJBA 3V8MA 3ONVA 3WK9A 4EL5A 1OU0A 1S2OA 3OZRA 1U2GC 1M75A 3C4VA 1PR9A 4CLOA 2X8JB 2XHZA 4HGPA 3QEAZ 3BB1A 1CRWG 3NTLA 4MKFA 2C0QA 4N0DA 4Q00A 1FNMA 3A11A 3VC3A 3OHMA 1CJBA 3QHPA 1OFUX 5H3HA 2GPTA 1P17A 3FOWA 3SSNA 2FSHA 1I4WA 1TO2E 3HVKA 2YMLA 1PGPA 2OXCA 4OGWA 1G1AA 4ZGGA 4MPDA 3II6X 1VKOA 4N9WA 4NU8X 5FEUA 4PNEA 1M5UA 4PO9A 1CQIA 3C87A 4RLFA 3ZW7A 1OZHA 5CU7A 3RF7A 1F7VA 3E9MA 3R0QA 2I8CA 1V96A 2BMEA 3NU1A 4BAGA 2XD9A 2EX1A 2GXQA 2R8BA 3X1ZA 1J4AA 3EW9A 3O4VA 3NIDB 4ZVTA 1QK4A 3K0FB 4OBBA 5L40A 5EHQA 2B6NA 1SH7A 3L6UA 2GN6A 1FRVA 3VMMA 2HA4A 2IBMA 5DGIA 1QLHA 1GLGA 4RE5A 3O0TA 3KQVA 5FJJA 4UHHA 4QQNA 2WM3A 4YJKA 2XOKA 3OQOA 1NY5A 1QIEA 2AQHA 3WK8A 4ENWA 2Z8YA 3RU7A 3K2BA 3IR7A 1OX4A 3PEUA 3VVLA 1RWPA 2FPRA 5BR7A 3H8VA 3NDPA 4FYXA 2F7SA 2R6DA 1TCCA 2H1VA 4IZHA 3KKOA 1V3VA 2Q4DA 4NMLA 3EUAA 4L5IA 2GM4A 4FS8A 1E2BA 5DHSA 3VR4A 2B4RO 1PK8A 2YR0A 5DPMA 3ZWCA 1Z38A 4EVQA 3M6IA 1JQDA 3RR2A 3KTAB 5ERGB 3U1VA 4HAYA 1FNDA 2CLFB 1WXHA 2Z1DA 3IV6A 3UWMA 3K32A 4GBED 3A1VA 5LMUB 5K45A 1LRJA 2IF2A 3AR7A 1MQ8B 3CF4A 3EGEA 2CB0A 2HPVA 4B5KA 1YHNA 2KE5A 4L02A 4TROA 3GJ6A 2Y9MB 1SBTA 3JQ8A 3UHOA 3P52A 3OUTA 3VZPA 4LVUA 3NYRA 3QV1A 1BN7A 2ZEJA 5B4TA 4OHFA 1GWNA 1T8TA 1EVYA 3C1OA 2HMWA 2CFRA 1PWZA 2QR3A 3EODA 3JVIA 1GGEA 3OLYA 5HEKA 3OF2A 1VSTA 2IPNA 1P9NA 4UHEA 3WZLA 2RAPA 1YI1A 4DCGA 5C2JB 4YP0A 2CV1A 1PJSA 2Y1WA 1AS0A 4JJ4A 2EFGA 2LRHA 1TCUA 1GAEO 3OBIA 5K0EA 2VXCA 3HB9A 4GWGA 1C1XB 1J9EA 1JHDA 1O6CA 5HMLA 4E5UA 2QEQA 1ZW6A 1PIWA 3JX9A 4HRVA 1I3MA 3HCOA 1NYRA 4OHMA 2ZIVB 4U8GA 4ZRDA 5BSUA 4C21A 4DCVA 1HE2A 5EERA 2OZEA 3OTIA 4OI2A 3KQOA 5DJ5A 3WHIA 1CZNA 1ZD8A 1BOFA 1C1DA 1XNJA 3DMTC 2IUEA 5IJ0B 5L6LB 5JVDB 1N78A 1HFJA 2A86A 3DXZA 4ABYA 3F7OA 3TLMA 3OTHA 3QVVA 4R2HA 5JO9A 4OFBA 1KO1A 1YR9A 2ZYAA 1JPJA 1OBCA 3U0VA 4O4HF 5K51A 2EKBA 4ZCPA 2C4HA 1F3OA 2BFBB 4IIEA 2XUGA 3CZRA 5GZ3A 3BX1A 1GL3A 2O8VA 3EUWA 2WHYA 4I0WB 4TLBA 5B7GA 1BDIA 1SEPA 3JQ7A 1FFXB 5DN6D 2RC5A 1E9DA 4C2TA 4OHYA 3GL9A 9ATCA 2JLCA 3RFXA 3K71B 4B4DA 3IHWA 1BGWA 1P8AA 2Y1GA 2JH3A 5CYPA 4QJ3A 4P3YA 3ZG6A 1D0VA 1L9KA 5DVZA 3RYHA 2CMHA 4J7XA 1EK5A 4Q93A 3RS4A 3DE2X 2BWJA 5HOQA 3JQFA 1UP7A 1T5TA 5C1IA 1C0KA 2FKNA 2GLTA 3KZCA 4DMCA 3FPAA 1XQWA 4S1VA 3P20A 3F3KA 2Q45A 2QYSA 3OM8A 1NKSA 5FUVA 1NG9A 1M2WA 2CL5A 1QYIA 1MOSA 1EBBA 2CSUA 5EJ9A 2FR0A 4WMLA 3Q4GA 4B34A 4O25A 4R41A 5REQA 4L9AA 3E7WA 3MWKA 4OMDA 4H6XA 4X92A 2G8NA 5A5FA 2A88A 5HDBB 2OYSA 1W52X 4V3BA 1B0ZA 3GEMA 2Y1DA 2F00A 3C14C 3LPDA 3TZKA 2BUBA 1COZA 3FN4A 3KSMA 4OQ4A 4QICA 5J2UB 4C20A 3O82A 2O2HA 2SHKA 4RVUA 4EM6A 1C3VA 4Q1EA 4W5QA 1Y48E 2GJSA 3LBNA 4MUGA 4HNGA 1ESDA 2O2JA 4CW7A 5FUMA 1V41E 2FJPA 1M0TA 3N8GA 1W4ZA 3V42A 4TVOA 1CFJA 1DQZA 1LZLA 3KOZA 3ZY2A 2DH5A 3C43A 4LHSA 1ZG3A 2B7LA 2VJBA 5LBIA 2XXJA 5JCJA 3L7CA 1EUDB 5E4JA 4DV0B 2E49A 4Y2QA 4OBWA 1Y37A 3B1WA 2Q2QA 4F4JA 2PRZA 4RVNA 3GLSA 1QGDA 2IEGA 1RHQA 1XMIA 4RTOA 1EZ4A 3ECSA 3IDAA 5DLPA 4TWZA 3D4NA 1L7MA 4H18A 4Z0HO 4IXTA 3R9WA 2XEDA 2KX7A 2NSJA 1KI6B 3LX8A 1OAKA 2W4QA 3TWOA 5JBIA 1Z5PA 3WLPA 4WFJA 5DBIA 1LKZA 4MHOA 1UBEA 2YWXA 2A1UB 4Q24A 2EWVA 3HL0A 3H4VA 1F3LA 1C9YA 1L7XA 3AHGA 1MB2A 3DKKA 1CD5A 2VF8A 4AULA 2YHUA 4PR3A 5LWHA 3HB1A 2OSVA 3JS5A 2MOKA 3IDSA 4HSGA 3COSA 4U7DA 1SWVA 1NDUA 3M1YA 3WLHA 5FI0B 5ICEA 1VB3A 2FN3A 3EPHA 3WLSA 5IBRA 2JLQA 3ZU3A 3S1AA 4CQJA 3WYEA 3FFAA 4WNAA 3BMNA 2GPWA 2LNDA 4YJDA 4U63A 2CLCX 1ZIPA 4KN5A 1UF9A 3EGIA 2IY8A 2Z6VA 5HNKA 1TYAE 3E22B 5B2EA 1JVBA 1I4DD 1ZDMA 2UVPA 3K0BA 4G0XA 1B1AA 5IDYA 3RWBA 1U5AA 3CF0A 1IJBA 1A77A 5EEGA 2CDRA 2I9PA 4PLWA 2V96A 5TS2A 2X8LA 2L18A 3MLEA 5DSZA 3H13A 4XWAA 2WJJA 1NQTA 2YNMD 1JJ7A 3I3OA 4QU5A 4TRRA 5KYYB 4H3HB 1YR2A 5KDDA 1JTVA 3M4NA 1G41A 4LYYA 5BV0A 4J49A 4AROA 3MINB 1NXWA 2YQ4A 2A4MA 4G56A 4UD2A 5A4AA 2UXBB 3KPWA 4I1UA 1W1WA 2EARA 3BSSA 4H27A 1N2JA 3NYIA 4PC7A 4OATA 3T5DA 2D1RA 2CLMB 2ZW9A 3ON5A 2D5AA 1M8GA 3G9XA 4URZR 3ZGXA 2B37A 4B33A 4R54A 2TMDA 2JS7A 2BM9A 1FS5A 1N0HA 2TMYA 3EEIA 5FNZA 1X1QA 2NZYA 1RI3A 2XQFA 4Y1EA 5HVNA 1MIOA 2D5BA 3EGOA 4MS3A 3A10A 5J9FA 5LA6A 1DX9A 4Z53A 4ZO9A 3O92A 3RC7A 3G0GA 3KXDA 3BFPA 1BCRA 2J3JA 1RMTA 2FHSA 5BN3B 3PUWA 3U6BA 1LY1A 2OCXA 1KSJA 4NULA 2VNSA 1J22A 1HMPA 2RGUA 3LFUA 3L49A 4O5AA 1ZD3A 4MLZA 3SQXA 2O59A 1P9LA 3EVGA 4WN9B 1L5GB 4D4KA 3A0RB 3IEPA 2LD4A 1FQWA 3GFBA 4DC9A 4KPUA 1R8SA 2GKSA 3REFA 1ZQ1A 3QJ5A 1HE3A 4D8WA 5F12A 2MTBA 1ZD2P 4GGPA 4CKEB 2RJNA 1OZAA 1JHUA 1G7TA 4QVGA 4GX0A 4TMXA 1LQTA 2I55A 1W6RA 3BZWA 4HMPA 4Z0NA 4B7XA 4NCHA 2ZIXA 2JLUA 4QQFA 5FL7A 1OIXA 2VUHB 4MLDA 1XF1A 3E53A 3WKDA 4EB0A 3VJKA 4M49A 4PIPA 1KL7A 4IGIA 1TU3A 4DL9A 3UMSA 4JLJA 2AFVA 3A1SA 2BT4A 2EBHX 1FBNA 2JH9A 1R9MA 2XSZA 3O8OA 4KYVA 4Y7CA 4O1IA 5KS2A 4P0PB 1X0VA 1OI7A 4D9GA 2Q21A 3PD7A 4MA0A 4DKXA 3MOGA 1W85B 2EGHA 2G71A 4NZYA 1ISGA 1TNDA 3CLUC 4KQCA 4QUDA 1PW7A 4IFTA 1TJ5A 3MTIA 3UYLA 4E2FA 4E09A 4RA6B 3BD7A 3P9PA 4JT4A 3F46A 1SCNE 1X7XA 1QR2A 4PLYA 3WG9A 5IXSA 2B9VA 4RV4A 4TLAA 1ODCA 1OLOA 2R5NA 4JJ6A 3P26A 4H1VA 1K86A 4JUIA 1O89A 4HLUC 1J39A 1W59A 1IZZA 2R8XA 3OY2A 1QRTA 1Q14A 1QIDA 3WGQA 4P08A 5I51A 1RABA 4R2LA 4Q01A 4HQOA 3PFFA 3IAEA 4HGOA 1YQDA 3MTJA 4BMSA 4TV9F 1LNSA 1FU7A 3GP5A 3OX4A 3U5ZB 1OBFO 5A4JA 2ZSDA 3OIWA 4K26A 3FOZA 3QRWA 4D9MA 1L5RA 2PWZA 4JXJA 1Z3CA 6CHYA 3HCAA 3IV9A 3TLYA 4KHPB 2XDAA 3CQ9A 1DIHA 4I4CA 5GINE 4I19A 5EIOA 4NESA 3ICWA 4BBAA 1F60A 4DLUA 4TYYA 5FPQA 3IA2A 5BWNA 2DQKA 2W8BB 4TKZA 2W6OA 2YC2C 2HNKA 3L0OA 2WIBA 3G6KA 3PHBE 3AZOA 1LJUA 1BCSA 4WFIA 1YOBA 4UUBA 2ZBFA 1YA6A 5K2MA 2P3LA 1YIDA 3PXAA 1H0SA 4EYKA 2Y1OA 1EWTA 4JWTA 4Z6KA 3AHJA 3VGPA 4ZN6A 1FJGB 2LPMA 3UK2A 4DFDA 3A6DA 3AVOA 3A6PC 2G5PA 1PBTA 3BL8A 4M46A 1BKSB 1BJKA 1UKAA 2JBHA 3ORFA 1UUFA 4U6QA 4ZHQF 1IUNA 1PEDA 2GEJA 2GOYA 3CYFA 3DCNA 2PUAA 1UT5A 4ISBA 1O57A 1WR8A 2HNAA 3IO5A 3KSBC 2HA6A 1BFUA 4UNQA 1L5QA 4RGVA 5BUCA 1ZXLA 1U8FO 2P5TB 1CP3A 2C2GA 1H5QA 3CB2A 3KQPA 3SE7A 3VR3D 1YBAA 2QUKA 1G5PA 2WLTA 1RI5A 1ZZGA 4UXJA 1RQ2A 1VL5A 2WIDA 4RFSB 4ZVVA 3T5BA 5IAGA 1W36C 1KAQA 2Q6TA 4YRJA 2W4IA 3N2KA 4EG0A 4U3JB 4WL0A 4IDBA 1L6IA 1ZUIA 4KH0A 4KNVA 4ZKEA 3U4DA 2VFAA 1WXXA 1UC4B 4Z2YA 3OCJA 3Q7RA 4D3FA 3BE8A 1OU4A 1GG8A 1Y4UA 2IK8A 1EVIA 2X41A 1UKVY 4G1MB 4G0VA 1XDUA 3D31A 2ZJBA 3JCZA 4OYYA 2Z57A 4KUEA 2VAVA 4KO2S 4OUKX 5CD9A 5D1HA 1FYVA 2CXTA 2OBLA 1K4KA 3WRVA 1SUBA 2GARA 5BMVA 3WP1B 2X9VA 3IKLA 4IJVA 3RUIA 2CK3A 1W46A 1MOQA 3KAKA 4GP7A 4YXFA 4PSVA 1MENA 3U4QA 3LZCA 4C4OA 1SAYA 5A3VA 3Q8KA 1C50A 4X6XA 2UUBB 1Z2AA 2OMKA 2F1KA 2PL9A 2FMIA 3QVMA 3AWDA 2QZ4A 3FZYA 3R0VA 4JITA 4OQPA 1IQUA 1UKCA 5IJXA 3W1EA 3KVRA 2OLEA 2WJZB 3H8JA 1RRKA 1V5EA 1W9HA 4N7MA 5LQAA 3DL7A 1YFZA 3LK7A 4M6WB 3CISA 3RRNA 4ND5A 5BN5A 2VP4A 1GD1O 1TEXA 1HL3A 5IMBA 1MC1A 2Y27A 2E87A 4X8OA 4G5SA 1LI4A 2M6LA 1E58A 1E5LA 1PT5A 2VQ3A 2YWCA 3L8DA 4QJBA 5F21A 1E2LA 4R8LA 3B2EA 1FFHA 4CEHB 4BFTA 3AG5A 2F9FA 3GVXA 4NONA 4J7CA 4N5HX 3UHPA 4JROA 2O14A 2ZCUA 5CA0B 4G0ZA 3VVBA 5C5EA 5LQUA 3ZU5A 4AICA 1YFKA 3BEDA 3UMGA 1E7RA 5WRFA 3P8ZA 1CEYA 4A8HA 4DXHA 3F3SA 1D7AA 4PGHA 1Z2CA 2VBCA 2Z30A 1C8KA 1ZVMA 1QFMA 3C6XA 4IQ0A 4JGIA 2WZBA 4DG8A 1XMSA 3WYCA 2HIGA 2PH3A 5H5JA 2OO5A 2NO4A 4OK5A 4G37A 5DWVA 4MDFA 4C7XA 3F90A 1RAFA 4DUGD 2JKZA 3HBFA 1P8JA 1ECPA 4ZYZA 1IN8A 1II9A 3MERA 3I4CA 3JD3A 5SYMA 2QROA 5CVVA 4CF3A 8AT1A 1C9MA 5DBGA 2PH5A 2Q3FA 4I6GA 1O7JA 1Y3CE 2G17A 5AUNB 5IKMA 1GAXA 5LFAA 2H57A 3SYRA 4FMDF 4WUTA 1T35A 4BO7A 4HZIA 1NLYA 2WNHA 1OW3B 4KLRA 1AM4D 2VJYA 4PICA 4ZI7A 4OHRA 3JR7A 3DVAB 4KN6A 1FTWA 4Y8VA 1NI5A 4XIJA 1I5RA 4BDTA 4QDOA 4Q9IA 3HJAA 1MH1A 4NU6A 1IJEA 3L8CA 3ZHBA 2ZI5A 3I5MA 3CHYA 1WKCA 5I5GA 1W8IA 2IA5A 2IIQA 3R3XA 3JVEA 3TDKA 5A62A 2OKGA 4A16A 2WF7A 4IIDA 3ZR4B 3SG0A 3ZUPA 5I7FA 4BO3A 4JU8A 2JLXA 4FFPA 1LLFA 1KKUA 4E07A 4C7MA 5JPDA 1YRLA 4YHBA 1TF5A 1FRNA 2HWWA 5EFZA 4WGFA 1M66A 1VRWA 1URPA 3HSSA 2OCDA 1GCOA 3ANNA 1ZGJA 4OEHA 4XE5A 4JYAB 3CONA 4DR5B 3L41A 4IG9A 3SQWA 3DEYX 2C99A 4JOCA 1G291 2XVAA 1XCBA 2NO1A 1P2TA 4S04A 5CCDA 4DSOA 1HG1A 3A6GA 5EQDA 2A78A 5G1OA 5H9VA 5CDFA 5AYVA 3TTYA 2WVAA 2XRMA 3WLMA 1US8B 2CJPA 3E81A 4V0SA 2VJLA 5FPTA 1B6RA 3ZCRA 1O95A 5JAOA 4QJ5A 1V0JA 4UPVA 3KDAA 1Q57A 1W44A 3WRWA 5CVDA 4MIYA 3B7PA 5FV7A 5B7QA 5GJVC 1QHYA 1VE5A 3PSAA 4RY9A 4MUYA 4X6UA 3VKHA 3BICA 4E14A 3MUFA 1M1UA 1K7CA 1QF7A 1LS6A 3D7MA 4P4GA 4V0KA 2CHGA 4WXPA 3RVMA 5IJWA 1F5SA 1H23A 1T8YA 3K96A 4QU8A 1DLIA 2Q3DA 3JYQA 1M33A 5DISB 2MSCB 5ILGA 1RFLA 1I33A 3FCCA 3P2KA 2GCOB 1QP8A 3H3JA 4IL5A 1NXTA 4G0MA 4RC9A 4YDHB 1NVFA 2W42A 1B2LA 4JI0B 4TZ0A 1GL6A 4I50B 4ZCLA 3ZGLA 1JHVA 3ITKA 1ZAYA 2X0KA 3VO8A 1JBEA 2A0FA 4IICA 1WRBA 3F6CA 3EPRA 3GGCA 1LLDA 2HSWA 2ZFUA 1YMQA 1RBYA 2C57A 2BKLA 3LKBA 4JELA 4NBVA 1X7ZA 4NDNE 1YQWA 1VHWA 1VE9A 2C9YA 1CY4A 1FP6A 1DFGA 2BBOA 2PSSA 1MCZA 2QLMA 3EXG2 4GOMD 4KR9A 4AWXA 5KYWA 1IHYA 1MVLA 5KKAA 4EYEA 1YFJA 1T4MA 1TAQA 3RVDA 1ZLXA 5A3JA 2I67A 3A4TA 1C7EA 1T1GA 2JLRA 3GLRA 5CH5A 1M2FA 1XF9A 2I1VB 3K0AB 1Z9BA 3ESYA 3BWMA 1UBNA 821PA 1GKLA 3RV3A 5K6TA 4KQMA 4MUHA 4PY2A 5KTNA 3SJBA 4Y6RA 4I9UA 4OGKA 3UK6A 4F4HA 2ACKA 3QKSB 5EA2A 5BSRA 9LDBA 2QNBA 3IQXA 3OU7A 2OMEA 1G9TA 2PGOA 2QUIA 4GX1A 1NWHA 5FO0A 1KEEB 4OA8A 4UEWA 4FJ0A 1AQNA 4BQIA 2MINA 3IJRA 1K5HA 4UQPA 3TOVA 4DXDA 4DUPA 5TRTA 2BUAA 2H0RA 2EEPA 3FVQA 1NM5C 3CW9A 3UJDA 1P5JA 1M54A 3D6HA 4QPJC 2BGKA 3V80A 2VDOB 1ZOSA 2DPYA 2KW5A 4CKYA 5FB3A 5KYUB 3LY9A 3UJHA 5C7IO 1H2FA 4OXXA 1A9OA 1QH1B 2J3MA 2QZSA 4QBFA 5BSGA 4DLYA 2D1FA 3JQCA 4P4SA 3T9AA 5A1JA 4K9LA 1PSZA 4DLRA 2HRBA 1QGYA 2OQRA 2FEKA 2VT6A 1K7YA 2VTDA 5H3CA 1YOVA 5JLJA 2YHIB 4ANFA 1IVSA 2FSFA 3AV3A 1GPLA 2GVNA 1Q15A 3LOQA 1YR3A 5CURA 3PC8A 1MA3A 5DBOA 5IT5A 3GZNB 3L8YA 2ZS7A 3P27A 1BDMA 1LBEA 4X8MA 5KSYA 5C5DA 2LV8A 3LT5A 4RWZA 3FOFC 4MI9A 2ZI4A 2YWJA 2JFYA 5GJWC 4L4XA 1TYBE 5TQVA 1YDFA 5HE8A 5AI5A 1Z0ZA 4BZXA 3RRZA 1BH6A 1JAZA 2FZVA 5DU2A 3PWKA 3AIMA 2CL6X 3PFHA 5IASA 3I9NA 1N2HA 1XQ1A 4MW4A 5EHIA 3RSHA 5KIAA 4D96A 4ECAA 2QYTA 4CTNA 3TD2A 1QIHA 2R86A 3FWNA 3L05A 2GA8A 2JDIA 2Q6IA 2YL2A 3CUWA 1TMKA 1U2TA 2IY7A 3HKBB 4RQBA 4WZ6A 4L8VA 2PL5A 1JDVA 4NBUA 2GZAA 4LOJA 1H2AS 1TW2A 1DEKA 3AJDA 2O3QA 2WTXA 4DYDA 1DGQA 3S2EA 3PNQA 4IR7A 1MOZA 4A0SA 2XZOA 1AQLA 5JXHA 5E2IA 1LDBA 3VA7A 1UDRA 1UZUA 3AYZB 2VYVD 3UOAB 2HRDA 2ZJ6A 4X00A 3UWKA 1KHHA 3SIRA 3TQTA 2O9JA 2D1SA 3D4OA 4X64B 4UNRA 2AQIA 3MWDA 1X7DA 2DHEA 4UDYX 1T9HA 1S02A 5TF0A 1IOVA 5AVQA 5CLLA 1FRZA 3EXFA 4OCZA 1N6NA 2CW5A 1XTBA 4HWSA 3M34A 4JEMA 3TN7A 1G5HA 4OVKA 3TW8A 3CN7A 4LVNA 1IK6A 3PRYA 2DFKB 1HF3A 4GSKA 3KT0A 2AT1A 3E84A 1DG1G 4OH1A 3LQ2A 1VB5A 1VDMA 1M7BA 2VUTA 4BJ1A 7GPBA 4KKVA 5JNWA 3OLCX 3EFOB 4EA7A 1SU6A 3CR7A 4BB9A 2GAJA 3L5OA 4HEHA 4QXPA 3EWNA 4TKUA 1FB5A 4C4SA 5DI9A 2E85A 2YTZA 3DVLA 2QRVA 5A6SB 1WHSB 2BSAA 2Q46A 9MHTA 3VRHA 3V6MA 1T9KA 2E2WA 3L79A 5FLKA 5B30A 3S44A 1HLFA 4QDJA 1J09A 4FINA 1MKYA 4FYIA 3P45A 2AF4C 1ONOA 1G18A 4CU5A 2V45A 3CIFA 3NC4A 1NFFA 2J3QA 2EBFX 2FSUA 4M37A 3DUFA 4W7SA 2OCKA 2BOVA 1Y9EA 2GO1A 1HPLA 1Y34E 2WHEA 2ZSEA 3AHEA 4BO8A 4EWLA 3MQ2A 3RYFA 3ZE1B 7YASA 3H2ZA 1KGSA 2RJ3A 1E1RD 3ADKA 4LOAA 3O9MA 3DS8A 5CXXA 4O4LA 4BYMA 1KSGA 2BGNA 4HFRA 2WIAA 1U0SY 4D43A 5B37A 4KVFA 2J33A 3AUAA 3MWYW 1WSAA 4FSHA 1KZGB 4K9PA 4YCBA 1M7HA 2I3BA 1NVUQ 4UM7A 4JSTA 4DDTA 1KIAA 1RRMA 1RWWA 4FK8A 3LOPA 4EQZA 3K70D 1MJNA 1MDFA 1Y3HA 3EXEB 3OQNA 3IEVA 4TYQA 1BC5A 3B36A 1RC1A 1CY0A 2BMJA 2CWDA 1DMSA 4DIBA 3W2GA 4HMOA 2CD7A 2OZKA 1RKBA 4C1NA 1IXKA 2JLYA 4YONB 1R5JA 3IUMA 2VZ9A 4EHDA 3W5BA 4AQYB 1IJFA 2XZDA 4NAUA 3P32A 4ETWA 1P1CA 2EKPA 2HQOA 3OKAA 4IKPA 3ZX4A 2VHUA 1HLPA 3L0IB 4DPLA 2QJTA 3HP7A 4DWVA 3NVMB 1V6CA 4P1ZA 1C3OB 1PBNA 2B5OA 2ZRHA 1ZVQA 1QMPA 1KO8A 1T4CB 2Z1MA 3AI7A 4GRAA 4DW8A 5IMSA 3M6AA 1GARA 4JOQA 4JQZA 4RPHA 4TQAA 2H3HA 1G3RA 4OJNA 5H0IA 1M5RA 3KT3A 4PHFA 1KJQA 1E4OA 2AN5A 2W2NA 1HE4A 1XVUA 4YAOA 4C2AA 1RYHA 3IC5A 2WWXA 3ICCA 4XZ3A 5B1SA 1ZUNB 2VWHA 5JSHA 5LYJF 1U8EA 1D1PA 3DTYA 3L0BA 1P45A 4H1TA 4PO8A 2NO9A 4RCYA 4RGBA 1ZU5A 4S12A 3TCNA 3LFHA 3WYGA 1B8NA 1OFGA 4YJFA 4MEJA 3QE4A 1HFWA 2DX7A 2QD1A 5CXSA 2DUJA 4CYMA 3NXSA 1ZWLA 4LNUA 2CUKA 1LPNA 3RSLA 1E9AA 4PN7A 4AP6A 5EJ8A 3LDFA 2PKQP 4DMRA 2OZVA 3IKMB 1E94E 5LMNB 4OI0A 4MYHA 5AJTA 5KSWB 3ADDA 2J6HA 3M5CA 1A5BB 4HTFB 4N03A 1ORIA 1U1DA 1WBJB 3ABOB 4PAOA 4QXAA 2G40A 1RM3A 3VYWA 5K9ZA 2PKQO 1YBHA 3ASYA 2DTEA 4QLOA 3Q1KA 2WJ3A 4Q21A 5FAKA 4WOPA 4WPGA 4F3CA 1BQ4A 1ZOOA 1V3QE 2IYLD 4MVJE 1L4LA 3R6WA 1U3DA 3KWLA 4QHYA 3SVZA 5F9FA 5DYNA 4BLRA 3U0BA 1Y9DA 4C5CA 3IOEA 4MUBA 3CRRA 4U6NA 3FF1A 4E2YA 1O0SA 2ATVA 3EDYA 4R69A 2D0OB 3F3YA 3OPXA 5ARBA 2O52A 3JD1A 3M1IA 2O57A 4RLQA 1D4ZA 2DGDA 4BX9A 3T7AA 1OHHA 2NTNA 1FXSA 4NCXA 1SQFA 5FFFA 3KAPA 4S1PA 1NFQA 1W5FA 1OIWA 5DNEA 4ZZ3A 2IRWA 2V59A 1AKTA 1JU3A 3AUYA 3D0QA 2OB2A 1DO2A 3S6JA 4FNMA 3Q2OA 1RFGE 2Z5GA 4MKXA 3SQLA 3EE6A 5B5SA 3AP2A 4H1HA 4BECA 2CB9A 1GA4A 3EH2A 2NUPB 1ZU4A 3DSRA 3JASA 1ZWKA 3AGPA 3L1HA 3NHZA 5ALSA 2PRKA 2O3SA 3A1DA 4E11A 2FQ1A 4FPXA 4IZ6A 1XDDA 3C48A 3IAFA 4HAVA 5GOTA 4MZXA 1CVRA 5I9MA 3DC7A 5TMDA 1Q50A 3G9UA 3KUKA 2NU6A 5FOWA 3FCOA 3IBYA 2Z2ZA 1RCUA 3CLSC 3Q5DA 4IQGA 1Z4OA 3ZBPA 3D3WB 1H8HD 5JZMA 2AUMA 5ADVA 2YWRA 4GQIA 4IFIA 4NF2A 2P2SA 2WEKA 1ZNXA 2P62A 3LKDA 4JJAA 4KN8A 4Q3EA 4UE6A 3X43A 1E3SA 2E9SA 3D64A 5E8JA 3KZKA 5M2QA 5IARA 1GFZA 1TA9A 2JI4A 1GU0A 2OCGA 3ZDAA 1UJNA 2L42A 4CNQA 2JB9A 3HPQA 5B1EA 1CDDA 3NUGA 1VQ1A 4G25A 4KFRA 3RWOA 3WE7A 4EB6B 3EVNA 3UPUA 3PQ5A 4IJ6A 3KJXA 4L4ZA 5EWMA 4E30A 2EC5A 4ZAYA 4Z5XA 1KKLA 4DUZB 5EWLA 2XXAA 3MGGA 2D7DA 2JGDB 2IEDA 3K72B 4UBLA 4FX5A 1XQVA 1YC2A 3QKIA 3M5WA 5EIWA 1E8DA 4L4RA 4B09A 1C1HA 3JYPA 4NYJR 2C8KA 2LVBA 4I8DA 4L1KA 4ETNA 3JWPA 4QLAA 3QNWA 3QE9Y 3COJA 4REMA 5I5EA 2G83A 2P9TA 3GFGA 3GRVA 3KOMA 3DKIA 1AKQA 2ETXA 2LP4Y 3HCPA 4BVGA 2Q1YA 3T94A 2VYQA 1K0UA 1N3YA 1XCGB 1NMSA 2BTQB 4CMJA 4K9OA 3U61B 3O84A 1VL8A 2WIFA 2FFAA 4MDEA 5E6SA 1RS0A 5FOXA 1BO6A 5F9HA 5GZ6A 4LECA 3AYXB 4HRAA 2PZKA 5BNTA 5IUNC 2LE0A 3WY9A 4PRZA 1XRRA 3GVHA 3LP6A 1ZONA 3BM5A 4HN9A 2CFSA 2I6QA 3R1IA 2D74A 4K2HA 1QGUB 1D2EA 1T10A 2XCOA 3ODGA 3B12A 4BFXA 2FFBA 3SEFA 4GLOA 4YR9A 4JP5A 3FYDA 4ZT4A 1HNZB 3H8SA 1P7ZA 2VSNA 2ZRCA 4TSKA 2JHAA 1JS1X 2ATXA 3O2JA 4ROTA 4W99A 1ZH6A 5DYTA 3VR0A 4AZVA 3CKKA 3Q7SA 1VYHA 3O38A 1G6Q1 2PSHA 2W5UA 1JG3A 3HS3A 4EMBA 4JEIA 4YRGA 4TLCA 1VOTA 5AVVA 3TG8A 5HKKD 1ZVJA 1IUKA 4F3KA 1JMKC 2QY9A 2P0YA 3BHIA 3C3MA 4G1FA 1SCIA 4H60A 3QVKA 4KK3A 2IEBA 5G0TA 1CZLA 5TR9A 1KQNA 3PIIA 3EJ6A 4IXNA 4JL8A 2A0UA 4RELA 3UJ3X 1KF0A 1U11A 4R2XA 1VG0B 1E89A 1RLTA 2BMVA 3C5HA 1DQNA 1E3EA 2DQZA 1TUBB 3IBFA 3KD2A 3PVZA 4JLBA 1G19A 2CE2X 4WERA 3GN1A 3ZDFA 4Y1FA 1V1JA 3R3ZA 3U6KA 3O1JC 3W9SA 1UAYA 4J0KA 1JH8A 1WXWA 4G26A 1M6HA 4XVHA 4MULA 1HUQA 4CHGA 4E88A 5KYTA 1ZKMA 1K08A 2D7CA 3W5CA 5HQTA 3NAQA 4PFKA 4UAGA 2WAMA 2XPCA 621PA 4CCSA 1VPTA 1GXSA 2VRWA 2ZJYA 2PQMA 3VSEA 3DM5A 1PV2A 5AUQA 1X70A 2CXHA 5IDQA 3FTQA 3HHEA 3N58A 1JEQB 1XU9A 2P9BA 2GBLA 1XZBA 3NHAA 1BU5A 1YV9A 4JYZA 2WJHA 1ZO8A 2X77A 5BORA 2Y0DA 4IMRA 1T34A 2P7HA 4GOLD 1GPKA 3WIEA 4FUQA 3DAOA 3HV0A 2QR5A 3S2ZA 2DPGA 3FKSA 3QKRA 3ZWYA 5BR8B 3DTVB 1PI3A 3ZJTA 3NBUA 4YTEA 4KO1S 3WRXA 3CC8A 4MS1B 1NRXA 4PYRA 3M33A 4AB1A 4XARA 5I01A 3RSSA 2O5EA 1NJ8A 2QS9A 4U5QA 2WG0A 3E03A 5G4KB 4DIDA 1JEEA 2YFYA 1Q7EA 3DVQX 2HHLA 1GSOA 5M7EA 1ZKDA 5ALFA 1AQIA 5TXGA 1NULA 3WKEA 3FYUA 3EPKA 2BVNA 1L1FA 3KEFA 2GAFA 2ZOSA 2WW8A 4BB5A 3H8WA 1GUDA 2KBFA 4FMBB 2Y68A 2B2CA 4QTYA 3ANXA 1NI4B 1KK1A 1DFIA 2CJWB 3I1FA 2EJUA 4A6PA 1U0GA 5I3ZA 5MHTA 5BT9A 2POCA 2O1XA 2X8JA 1SCQA 4KQFA 4ZOCA 2Z6QA 2ZAGA 1TTHA 3CSSA 3F2IA 1CSEE 1NMEA 4KQIA 2COUA 4LCEA 3TTWA 3QQ5A 1O87A 2ATCA 2EF0A 1GY8A 1TO1E 2FUG6 1HM5A 1VJGA 2OM2A 2V6BA 3AHIA 1L7RA 2XE8A 1Y9JA 3CV3A 4S24A 2AEMA 1R8QA 1XZMA 2PA0A 2ZIFA 4XVUA 3HK2A 3UAWA 2E21A 4CPDA 4FIZA 1I6LA 4BQNA 1TD9A 1JDTA 2FLWA 3FFBA 1PV4A 1ABEA 1C9DB 4F91B 1CUAA 1F14A 5ALVA 3HYSA 4GPTA 4YS6A 4YMUA 3B52X 3K0FA 4DPMA 1N75A 3BD9A 4MGZR 4DCMA 4NJEB 3E3NA 4LJ6A 1T25A 4MV4A 3QSGA 1P7VA 5CB4F 1A1SA 2GS9A 2OPHA 4CDMA 1E6EA 4GMXA 4FFMA 4D92A 5F7XA 3HR7A 3FGPA 3SS9X 5K01A 3WGIA 4RTQA 1SR8A 1YUNA 3GDWA 3DLTA 1F8XA 1PJZA 4AG3A 1Y98A 1CR1A 1GRNA 1ZC3A 2D0IA 2PAFA 2WPDD 1NLZA 1BJTA 1V6SA 2EL9A 1FQKA 4OJMX 4PWZA 1ARZA 3LPMA 3TLGB 4B3TB 2C20A 4Z1MA 2CXXA 3LRTA 4I55F 5E1BA 2HYDA 3QNUA 3TEMA 2VDRB 1WIWA 1ZOLA 4J0QA 4WCFC 3DJYA 3GLFE 4QARA 1Q1GA 4ZQIA 4R3NA 3HU5A 4MIOA 3C3EA 4B45A 1X86B 3OFSA 2O3TA 2YQ5A 2BCGY 3PXEA 3QIVA 2EJBA 1VIMA 4JB0A 4JJZA 4FFOA 4J4BA 4PCAA 3RAPR 1VE6A 2WG2A 4XLTA 4XYLA 4O1MA 2C54A 5ICFA 3W8DA 2AKAB 3Q15C 4QVIA 1QANA 2PMFA 3EC7A 1ADJA 1S2GA 2XDWA 2JVKA 1J0EA 1NFRA 3G2OA 3O3MB 3N6XA 5PNTA 3TCKA 2E5WA 2DECA 4ZHQA 1KYVA 4R1NA 1PWXA 1W6UA 2NVUB 1IY0A 2GN1A 4FMCB 5ALGA 3TRKA 4JSYA 5KX5F 3PNPA 3VNUA 3LDHA 2AC7A 1HZJA 3DBOB 3HPRA 3PB3A 3FWHA 1GOTA 1E62A 3BGOS 5DM60 1M6NA 3UAOA 3AL2A 3CEPB 4Q1VA 1C1XA 2FAXA 3B6ZA 4LJRA 4DM4A 5FPPA 3QG5A 2ZYRA 1NYTA 3EBOA 3ENNA 1A95A 4JVMA 1U9IC 1RZVA 2JEYA 1E5TA 3O2NA 3QJYA 2TECE 3OVMA 4PM4A 3RUDA 2FV8A 4CT0A 4EARA 1A7AA 5IFLA 4NMHA 4GPBA 5IJ0A 5ITZA 5JVDA 2QGFA 4UE3S 1STOA 3A6EA 4CQLB 1OB5A 2GPBA 4WVLA 4CM9D 4ER0A 2WM2A 1COWD 1TQHA 3X1JA 3ITDA 4YT8A 1Y1RA 2BFBA 4RJIA 4DBVO 3U19A 3CZ9A 2XV1A 2P6MA 1OXTA 2FU5C 2K5UA 3VU9B 2ZDQA 2CFOA 1DXQA 1FFXA 4GKAA 3ZY6A 3B1VA 2QOEA 2ZRJA 5CJJA 2GZRA 1BX3A 3HKEB 4KX5A 4MYTA 4B35A 5CCXA 3CUKA 4UNIA 3CEMA 4KVZA 4CLHA 4DA8A 3V4PB 4KO3S 5BQOA 4U2CA 1UAAA 1U2GA 1PV1A 3ZV7A 4YH1A 5B7NA 3REQB 2EZ9A 3T5GA 2VL7A 3JTEA 4BLUA 3DEHA 1JA0A 4C87A 4PIVA 4UHJA 3VR5D 4CR6A 1ZUHA 4XVQA 2YMMA 4ALNA 4I6EA 4BWGA 3DLBA 4R9VA 1JYSA 4UAUA 2FQQA 4WADA 2QL5A 3M6VA 4AYTA 1ZX1A 3NWOA 4AY6A 4EATA 1U6IA 5IK2A 3H05A 3GJTA 2XRYA 2SCUB 5EJIA 1ZN2A 3RFFA 5C1OA 3IEMA 4WDQA 1DUIA 2VQFB 3RJ9A 4NH4A 4D9EA 6LDHA 3TLEA 1T0IA 3AOEC 2FK7A 4P7GA 1KFKB 4E5YA 3Q8WA 2VQSA 5HRUA 4HDMA 1MAAA 2ZJ5A 1I2CA 3ACCA 4MKRA 1B76A 1DC6A 1O97C 1QV6A 1UBRS 1UC8A 5J2UA 4UZEA 2CVQA 4OXNA 4RIFA 5CLIA 1GQSA 2WWRA 1BYIA 2OEPA 2WILA 5DW0A 1XEAA 1W19A 1FXWF 3LD9A 3E3LA 2D54A 3CWQA 5EMNA 4YFVA 3ROQA 1ZEJA 2QTLA 3WWOA 1IN7A 1N2GA 3SYNA 5T6MA 3SSOA 3ZGYA 1BW9B 5JISA 3F6PA 1JPUA 2DT8A 3K6JA 4NMMA 5JI2E 1ZMXA 4WW0A 1FS4A 1PWHA 4WCFB 3ZCTA 4X1IA 3I04A 1UOPA 1VYTA 3LYLA 4UNNA 2KI5A 1YJCA 4DR4B 1Z39A 2NO6A 2CY0A 2D0DA 1II8B 4HAZA 1HKHA 2OZLA 2H1WA 1G9XA 1TTQB 4B4KA 4CCYB 3HXQA 1KDVA 4LMRA 3CG4A 3UGKA 3V2IA 1U63A 4BV8A 4AJ4A 1XRSB 2CNKA 3ILXA 4L27A 4PANA 4QNMA 4AIIA 1BRTA 1X13A 1KI6A 4QIHA 2GZDA 1PR0A 1XP5A 4MPPA 3K30A 4AO6A 2BEUB 2NNWB 4LKOA 3LHSA 4LXTA 4ZZ2A 4BUZA 2A1UA 3UJ7A 5BUQA 2Q1TA 2FXIA 4WSOA 3GEEA 1A9SA 2R85A 2O20A 2ZWOA 3PYLA 3TNLA 2OA0A 5EE5B 1RWQA 1CR0A 1PQUA 3H87A 3I9V6 4ODIA 1NP7A 3QU7A 1V4NA 3SEQA 1F7UA 4AYWA 2ZQYA 2GZHA 4JDPA 3I34X 1GUAA 3ED1A 3F7NA 2E4YA 4JLSA 5T3YA 1XD9A 4EY4A 2O8NA 4QJ4A 1NQOA 1WDWB 2XVYA 1SCKA 1QV7A 4KMOA 1RQRA 2VOEA 1QKIA 2B3DA 3LRXA 3D7NA 4LX0A 4HWPA 2DPHA 3UBMA 2QAJA 3E22A 2AOVA 5AVKA 2FNAA 4D4HA 2HGSA 4IX1A 4GX2A 3OX2A 3GCDA 3U1TA 5FNVB 3GELA 2WICA 1U8ZA 4KJXA 1CETA 2ADFA 3DDNA 4LZNA 4MARA 4PC2A 4QDUA 2DC1A 5G0WA 3UT0A 3VBEA 3IAUA 4QE3A 4MP8A 4QBKA 3TBKA 5KYYA 2R7MA 1T3LA 4OLHA 3TB6A 5DP2A 2C2OA 3ABIA 1Y9ZA 4IWYA 4RULA 2COKA 1D2CA 3EAQA 2IJGX 3C5WP 2CXSA 3KVNA 3PGLA 4JA2A 4J0GA 4LRWA 1V4BA 3WL4A 5A3QA 5KSZA 5JYBA 2P90A 3MBOA 2A5FA 4DLLA 3TNJA 2CFCA 5EJGA 3NOOA 1FEZA 1PO7A 2VZEA 4N4AA 1WZIA 2AEFA 1F51E 3HO1A 4GI3A 2H7YA 4BNXA 2VCHA 1D5WA 1TF7A 5AKLA 1THTA 2AFHE 1R15A 2FMUA 2Q0XA 1E66A 2ZJZA 1LDGA 4HRXA 2REOA 1ZP6A 3MGAA 2OM6A 3Q3VA 4DILA 1M7GA 3GNLA 3QF4B 1LBSA 2AN4A 2HV9A 3K4PA 2O2YA 3DP7A 3SXPA 4FOTA 2ETVA 5MGNA 1AH2A 3UV6A 2ENWA 3V3TA 1E3DA 2XUJA 2O5CA 2V5VA 5CW2A 2BHTA 3QX7A 1JB1A 3BS4A 2KS6A 1CUDA 4V0MA 4WBNF 1WZEA 4R51A 5CFOA 5L3QA 3IAS6 1D9ZA 2PAAA 3TINA 2M9MA 2PUBA 1NNEA 3CLVA 4WN9A 3VQTA 2NYVA 4EI2A 1SZDA 2X19A 5CB8A 3DD5A 1H94A 2ASVA 3CLRD 4GM4A 5EP2A 5IWCA 3NPAA 5B1YA 2NMVA 1RIFA 4Z99A 1GDTA 1ID8A 3X1XA 4CKEA 1YGPA 4CIBA 4ZV7A 1OKKD 2I3AA 3E82A 3MB8A 2A57A 4OF4A 3D43A 4OH7A 4R3WA 4TN5A 5F3DA 2NG1A 2Q5JA 1XALA 1QLJA 1AUPA 3IYLW 4FFNA 4G0PA 2YWBA 4KE8A 4DUYB 3SHFA 2G4VA 2XMBA 1NONA 4ZODA 4ZVKA 5EESA 3FH0A 5EKTA 3H2KA 4E15A 4CKZA 4RTMA 4FGLA 1IEQA 3ASUA 1PR2A 2VZLA 2XGSA 1RMQA 4JVOA 2YXNA 1ORVA 1YBFA 1IHUA 1O94A 2JFGA 3D5EA 1GLVA 3SEZA 3V2UA 1EFVB 1H0KA 2AFIE 1W85A 4NOKA 1MC8A 2XNSA 2C3YA 4BO6A 2H2WA 2QRLA 3DO8A 3MTQA 1DEHA 4UARA 1C0LA 5BSMA 5EZYF 4RA6A 2JAOA 3T0GA 3WMXA 1YCGA 3HG7A 1XEFA 1SD2A 1M9NA 3DT6A 1XSEA 2V74B 2XA2A 4YRAA 1HRDA 3PUYA 1LGYA 3ZGVA 1E5XA 3OF5A 4UJ3A 4BVHA 4CDRA 1BDJA 1L8OA 2A9JA 4EFKA 1THMA 5KZMB 3V4VB 4FR5A 4M8KA 1RXSA 4ZFNA 2ID9A 2FUKA 5IFKA 2OCBA 4ZK2A 1E3IA 3DE5X 4K9SA 2OHIA 5C9ZA 5JD3A 2OD9A 4JD5A 3SVTA 1EPUA 4PPGA 5F77A 3EIHA 4ITUA 3RARA 3UB3A 2PJRA 1PDVA 2X5NA 1TXGA 4QULA 4XGKA 4DLXA 1EZ1A 1UK6A 2R87A 2ZI3A 3KG2A 2XYRA 4I4TF 3GIDA 2QR2A 4LBYA 1A9YA 2VSFA 4XWGA 5E3JA 3ZDRA 3ZTYA 1ECFA 1U7PA 1X7YB 4LQCA 5B3KA 2XT6A 3PGVA 1Z16A 3B6MA 3GT0A 3H2YA 4LZAA 3WSWA 1E6LA 4JXZA 1DRJA 1IG0A 4AUEA 2GHTA 2WU0A 5DN9A 3S2FA 3E6AA 3VKGA 3TGWA 4K05A 2WHPB 4FMPA 2I34A 3EXIB 3SZ3A 3EDQA 1U28C 5U4XA 4PVCA 3A58B 4CDGA 4D74A 1HR0B 1PN3A 3N8HA 2CKDA 1EP2B 3LP8A 5IVDA 4MYCA 5BV1A 1W8DA 4JX9A 1QLWA 3D4IA 2D62A 4EENA 3I6QA 2C5HA 5K3FB 4NFSA 4D97A 4QUJA 4DMKA 3G5MA 1H1TA 4K81B 3VC2A 1YRQA 4MMZB 4I5EA 2PGAA 3L7KA 3DM9B 3NM6B 1JMVA 3C15C 1KEUA 1K5PA 3B9BA 3LG2A 1DARA 1WHTB 4DJJA 2CYAA 5LLDA 3FLBA 3I32A 5CVCA 1YU6A 3RADC 5G0UA 3O2QB 4IQ8A 1FUIA 4RFSA 4R5HA 2XUPA 1AZTA 3RYIA 1XFAA 5I9LA 1VYUA 4A92A 2WIJA 2WTMA 4G0YA 4CU2A 1Y3FE 3BWDD 3N6RA 4U3JA 1SN7A 3Q9UA 4WNIA 4YMIA 2XW6A 2C4NA 2WVJA 3HBMA 2Y0PA 3LDAA 1GNVA 2P6UA 3RVPA 3E5MA 1XTJA 3JU3A 4R8VA 4EB3A 3LVRE 4J4TA 3TZCA 4HVAA 2GEFA 1OXSC 2F90A 3LC7O 3PQEA 3OMWA 4BNIA 4P7KA 2D2VA 3HBJA 3OJLA 1ISMA 3EB9A 4G0UA 3WA6A 4KSCA 1OX5A 4UNSA 1EHIA 2PZBA 1Z34A 2WV9A 2ZWAA 3E9YA 4F3NA 3QF7A 3SMVA 3WRYC 1RKXA 1YIOA 3QQPA 3I0MA 2XB4A 4B4WA 3IURA 4N54A 2OUIA 1GTZA 1OI3A 2P41A 4RPGA 3HO6A 4LY9A 2Y77A 3PIDA 4LY0A 3WWZA 3WQQA 2DUMA 4KR3A 1H2EA 1AGRA 3AKDA 1QVRA 3GLFB 3I92A 1L7QA 2IZ5A 1Z82A 3DMHA 1U3CA 2NUTB 2WU8A 2I6SA 3B1YA 2NZVG 4LXUA 3S27A 1YDHA 5CRIA 5I7WA 3PNYA 2REBA 3Q9NA 4XB6B 1NIJA 2QGNA 4B71A 2OG2A 1CCWA 3WQRA 2HBZA 1NRJB 4WA8A 3RV4A 2VWGA 1HG0A 3CUEF 4R1SA 4RK1A 3T1QA 3R3JA 4DN6A 3V4LA 5ALXA 2GFIA 3OU2A 2XOKD 5F64A 2ALJA 2YIDA 3MTGA 5CA0A 3VR6A 3P71T 4I4NA 3CJTA 2ZBVA 3M6FA 4RVSA 1M0SA 1ZISA 3JALA 2BGJA 2IHBA 4OSPA 1TZMA 2I6FA 4GYYA 1DBSA 2H2IA 2IUFA 1LBHA 3PL5A 3WSVA 3AR8A 1ISRA 5DTQA 4AZSA 4Y2RA 1AKUA 1QOZA 3DE0X 3VR4D 3IHKA 3N2NA 2HZ7A 3P4UA 1L5KA 3TJRA 2VH5R 2KLHA 3HSYA 3PUZA 1TIKA 2FPXA 3V7YA 1YQQA 4RZIA 4D1YA 1RYBA 3K5HA 3QHAA 4FC7A 3W8RA 4DNPA 5KJCA 4KE7A 4BMPB 1YVPA 3KCQA 2WR8A 4JT2A 2GVZC 1JHQA 1IWBB 3JSXA 4PX2A 4JHXA 2ZI6A 4KRFA 4ENQA 1IBKB 3ZNPA 4KWEA 3GRFA 3V7FA 3S55A 1MMFB 3HDQA 3JQRA 1KY3A 2H2HA 4Q6WA 1S3FA 1C9EA 1GKKA 1R8JA 1QAQA 2QENA 3A9SA 2A1TS 1QQ5A 3DTNA 1ZBQA 3N2IA 1VKNA 3PGKA 4DR2B 1D1QA 1FBTA 3AHHA 3RW9A 3AF6A 3GUUA 1VMIA 3ADPA 1FNNA 2Y0EA 4J6FA 4PBRA 3WKAA 1QX4A 2VAXA 4URWR 3R76A 1Y4SA 4CTOA 1TZKA 3ILVA 2BFWA 5AESA 1SBYA 3PFCA 3HA3A 1T8PA 1ZIDA 3WGYA 4X3CA 4FDMA 2OB1A 5KAMA 3FCSB 2QE7A 5JNRA 2WSBA 1JAIA 3D0OA 2MYTA 2P40A 4BMNA 3SSAA 6YASA 1VPVA 3QEKA 3NHYA 3TBHA 2BFCA 4FGWA 5CFZA 3OAAD 2HRQA 1EFRA 3UTDA 5JC1A 3O1IC 1ZJWA 2IDZA 1GZ4A 4DLVA 3MS7A 3PTZA 3RLIA 3NANA 4N5DA 1NT4A 5C8YF 2HSJA 3OO1A 1JLRA 4YWJA 1VRCA 1U5BA 4XIGS 5CA1B 1LBIA 2OWDA 4PXAA 5I47A 1Y7LA 4YIHA 2Q3MA 3DD1A 3HWX1 2FXVA 2QU7A 4MUJA 2XCLA 5BXQC 1QHEA 4K87A 3UW1A 3MQFA 4KU4A 3KUXA 3MF4A 4F12A 3TNDA 4Q7QA 1A97A 2JFOA 4GHWA 1US8A 3LRPA 4AF7A 1DU4A 1SOWA 1P9WA 1C0EA 4EY6A 3B5EA 2R60A 1FTSA 4M99A 5L4NA 1I2AA 4U2KA 4RZSA 2VSXA 1J8YF 2VDKB 4HRYA 4CJXA 4BTVA 1WXQA 2LGJA 1TYEB 3KOXA 3KSAC 2UZ3A 1FMCA 1ZXBA 1WB5A 3NHMA 1FP7A 2IUTA 2ODNA 3KSRA 4POAA 1KY2A 2DFTA 4B6FA 4R2KA 2OFFA 5TJ9A 1USUA 4AG5A 2H48A 2GCOA 3CUTA 2AJ8A 2IYNA 3FWPA 3ZDYB 3ZDZB 4Z4CA 1HOXA 1PG5A 3OUUA 4I50A 2BGUA 2IH2A 2GM5A 3PEYA 3L6BA 2W71A 1M2GA 1VP3A 5JROA 2ZAMA 4J1QA 3G2IA 3E7PA 1GITA 2WWWA 3H3XA 3VMFA 1G17A 5FBWB 2XB9A 1Z4KA 1B2RA 4J1TA 2DJIA 3WGTA 1FA9A 2O05A 4J2HA 4O6VA 4U2BA 5DFAA 3EQ9A 3NJ4A 4LJ7A 1K3TA 4MV3A 3MSXA 4W6QA 5K0SA 2DRIA 4MR7B 4NQRA 3ILYA 3O3CA 1W35A 4GBMA 2C4KA 2XZPA 1Q0HA 4UUOA 2ZLBA 4RHTA 4E7PA 3HACA 2D2FA 1RM5A 1P31A 4LZPA 1N0IA 1OT5A 4DMMA 1JXAA 1H65A 3Q12A 1J33A 2J0VA 2PU5A 1Y5MA 4B31A 1KS2A 4KIFA 4GR5A 5EGNA 4URUR 4KUGA 4KPFC 4H7JA 1PQYA 2X5OA 1ZK1A 5G41A 2HQSA 3BMOB 5JNUA 1EKXA 3FB1A 5K0ZA 2R7AA 1K6XA 1Z8DA 1RHKA 3DLCA 2XTJA 3DZHA 2J48A 3CF6R 3QTBA 2HSDA 2VUUA 4XIYA 1Q83A 1KEEA 1QO0D 4RJTA 3PA6A 2W2PA 2F6RA 3LU1A 5C7LO 4C6TB 4C88A 5AVWA 3KSUA 4OLAA 2UYOA 3AY6A 4FUTA 4UTNA 1F48A 5BV2P 1WOYA 3BE5A 4AZ3A 1NY6A 1Z4NA 1VSUA 3RS0A 1IQPA 2RHHA 4UTXA 3V7WA 1TAHA 1WAMA 5KYUA 1QWSA 1AHIA 3EW7A 3F9IA 3LBIA 5J5VA 3U37A 3OWHA 5CDHA 5AHKA 1QH1A 2OFPA 4MDHA 3Q3CA 4ON9A 1BRMA 1KFJB 4YAEA 1XXHE 2QG9A 1PS0A 4HN2A 4B3FX 5IYZB 2O54A 2OENG 2AFHB 3GPIA 4K0RA 3SIWA 5J4VA 1SOUA 3E3OA 3WMGA 1Y7HA 1O6GA 1O0BA 2W2LA 2F8SA 2N1MA 3D8RA 4TKVB 3T41A 4H6VA 1JWBB 3LLSA 4M9QA 2YHIA 4K6HA 4XSGA 4XWTA 4W5RA 3GT7A 3IBTA 1HT1E 2G9ZA 1XRQA 2HSZA 2XWQA 5J4HA 3E70C 1PZMA 3GZNA 1KI3A 3Q40A 4BFSA 2GAOA 2E37A 1F2TB 3I6MA 1EDZA 3C3WA 3BRWA 4YAUA 3WNBA 3HYNA 3KOUA 1Y3AA 2ID8A 3CZ5A 1XPOA 3G0DA 4GW3A 3ABZA 3CBGA 1NR7A 2JL1A 3Q3EA 4L5YA 5AMXA 5E1MA 3T9DA 3CNOA 3I5UA 3JSAA 4BNUA 1XTVA 2IBSA 4BRSA 1UPAA 1CUXA 2BUCA 3U62A 3A9RA 1VE7A 2XYHA 3E9CA 3ID6C 4LSWA 2IXAA 1X1AA 2QIPA 1M74A 4HQLA 2SKEA 2PL3A 3V4SA 4JQYA 3HKBA 1XIVA 1A5AB 3E1SA 2Z83A 3HGTA 3BJIC 3I53A 2G1JA 1U8TA 4LQDA 1A5SB 3DKVA 2X0RA 1M6VA 5E4TA 4A0QA 3M6WA 4EA6A 5TIIA 3EDRA 4ZCQA 4OHXA 5HOEA 4E32A 4KQKA 3RIXA 1DLJA 3VR4H 1D03A 1EJ0A 3EQ2A 1T2CA 2FY8A 1IWOA 1MZVA 2H85A 4M1TA 1FJHA 5P21A 1T1IA 1RXVA 4HXYA 2PD4A 4F45A 5M29A 1YS9A 5IEBA 5K3DA 4K9KA 1OXBB 2BC9A 3A3NA 3NBYC 2PIDA 4MW9A 4Q02A 5IDWA 2AFIB 3KXPA 1ZN9A 3MS2A 1YZLA 3WGUA 2AX4A 1CUZA 2QUZA 5EAIA 3VH2A 4ZZ0A 3PHLA 2W6QA 2C95A 2YYZA 2WSYB 3HZRA 5MN4A 3NIFB 1WF3A 3NB0A 2UAGA 2J0SA 5DHRA 3ELBA 1JLLA 4YCDA 2JLAA 2QX9A 4LY6A 2XQGA 3LT1A 3QA9A 5LM3A 5E1OA 5IJAA 1E6MA 3NBFA 1K9SA 4OQMA 3TM4A 3CR3C 1DJPA 1K8ZB 2EKDA 1DDGA 2I33A 2VDWB 1RPAA 1DKPA 1E7QA 4HQ6A 2XIJA