4MAAA

The crystal structure of amino acid abc transporter substrate-binding protein from pseudomonas fluorescens pf-5
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
373
structure length
373
Chain Sequence
FAAEPFTFYGLKSMSGAFASYGKFADMGSRLAVEQYPTLLGRPLHYKVIDTEGNAGKAVRRVQEAIAQDGARFFQGCTLSSSALAVAKEVGKVGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETMVPLIKLLPEAKRWYTITPQYVFGEALLEGAKQVCAEHGIEHIGNSYHSLQEQEFSGYLTNAIAARPDVLVLLNFGSQSSNALRQAVNFGIKERMKVLLVWSAGLDQFQELGSDVLEGVYLGAQYWHQVDTPLNRELVKLTQAKYGINPTYPLAADYIGSKIILDTIAATGSFDGATVAKAMQGLTYQGPTGEESIRAGDHQVIKDYYLLVGKAAATMRDKDDLAEVLSAGRSFPDVSATGCAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Putative branched-chain amino acid ABC transporter, periplas
publication title The Crystal Structure of Amino Acid ABC Transporter Substrate-binding Protein from Pseudomonas fluorescens Pf-5
rcsb
source organism Pseudomonas protegens
total genus 133
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA01
4XASA 4Q6BA 3OO0A 2R48A 3GYBA 2A9OA 2PUCA 3RH0A 5BQ3A 3CLKA 4OTZA 1I3CA 1SXIA 5CHYA 5TE9A 1Z25A 3IPCA 1Z26A 5DLEA 1SD5A 3KYJB 4RK0A 3JVIA 3O74A 4MRMA 5KC9A 2W42A 2FN8A 3JS5A 2QSJA 4ML3A 1URPA 5EWMB 1RNLA 1MB0A 4F3TA 5IUKC 3C6QA 4RZSA 1XHEA 3O2SB 3ROTA 4ZMSA 1FFSA 3OMXA 4KVFA 4KK4A 1ZY2A 2QVGA 3MF4A 3FMVA 3EAFA 2A9RA 3CG4A 2IPNA 3IPAA 1DC8A 5ED4A 4KFCA 3EQZA 3MA0A 2GKGA 4RK1A 4MS1A 4W5NA 4LE1A 3RVQA 1U8TA 1Z18A 2R25B 4GNRA 9ABPA 5JNVA 1LBIA 1BVHA 3KS9A 5F64A 5FWYB 2L19A 1YS6A 1U2PA 1NTRA 3BBLA 1APBA 2MYNA 3W9SA 1TMYA 2WWVD 4W5RA 1ZITA 4RK6A 5JS2A 1NATA 1DRKA 3H5LA 4N03A 1YS7A 5BR1A 3EGCA 2PUDA 3HS3A 3Q7SA 3CTPA 3P9YA 1EAYA 4FE4A 4MPTA 2NT3A 3TB6A 3HEBA 1SRRA 3OQMA 2DRIA 5ABPA 1DBWA 2RJNA 1J56A 2E4WA 3LOPA 4D6YA 4HNQA 4Z99A 4KPYA 4N47A 3H6GA 1JDNA 4MR7A 3FDFA 2FMKA 1YK0A 4P98A 4YO7A 4KRFA 1JL3A 3H5VA 4H3KB 5TQ0B 2RJOA 5KC8A 1PEAA 4OBBA 3F73A 3CFYA 4RS3A 1QP4A 1GCGA 4OG2A 2FTKE 2WJWA 3K4HA 4MS4B 3KLNA 2NZVG 2GBPA 3H1EA 1MVOA 3HUUA 1M2FA 2A9QA 3KSMA 3C3KA 3TMYA 1NXXA 1PNTA 3JPWA 3LUKA 4Q6WA 1YK1A 1D5WA 2TMYA 3I09A 4KK3A 4KQCA 1VPWA 3T8YA 4XFKA 3IP9A 4DQDA 3LTEA 4IGAA 4UHKA 3LUFA 1NXSA 4LDAA 2M98A 1YMUA 1W25A 4L85A 3CRNA 3GV0A 3LFTA 1DP4A 1P8AA 3T95A 3OMWA 1JHZA 3CZ5A 3TO5A 1QKKA 1A2OA 2QXYA 3E3MA 4HNRA 4Z4EA 2WMYA 2JVIA 2GWRA 3MQ4A 1M5UA 1B00A 2E4ZA 2H0AA 2OQRA 2XDYA 1TM2A 3NNDA 3LUCA 4H60A 4XLTA 5EWLA 3SG0A 2LIVA 5KQMA 1TVMA 2QVCA 5GQSA 4O1HA 1F51E 3QEKA 5T3YA 2HQOA 4M88A 2PMCA 1JH9A 1ABFA 1BDHA 3O2JA 5DCLA 2PUEA 3F7NA 3TX6A 1PNRA 4EVSA 1D2AA 1U2QA 1CYEA 1R8JA 5IBQA 4B09A 1RZRD 5D2CA 3EQ2A 3OO1A 2PUGA 1YVUA 3UKJA 4LE0A 2L18A 5TQ2B 3RVSA 3GBPA 4IRXA 4IILA 4E7OA 1VLZA 2MYPA 3HV2A 3L49A 3URMA 2I6FA 1E6KA 1NXWA 4PZ0A 1C4WA 1QP0A 4RXUA 1K66A 1MAVA 4RY0A 2JBAA 4MYRA 3H5WA 3UK0A 4G0XA 4F11A 3I42A 4WUTA 1KRXA 1L5ZA 1T34A 3CNBA 3GBVA 1JWLA 7ABPA 4PYRA 2ZWMA 4Z9BA 4EGSA 4MS1B 2V0NA 3H1GA 2HPHA 4NQRA 1LJUA 4XXHA 4QPJC 3T6KA 3IP7A 2JVKA 3Q41A 3RVPA 3QX8A 4RKQA 5HM6A 3N0WA 3Q15C 5BRJA 3OLYA 4Z4FA 4G0OA 2VYCA 3EODA 4TMYA 3JPYA 1YMVA 3M6MD 1NXPA 4YCSA 5CNKA 1MB3A 2WY2D 3QK7A 4MR8A 6CHYA 3IP6A 5KQGA 4G97A 2NT4A 2JRLA 4N0PA 4N76A 3HDGA 3KJXA 3NHMA 3ROFA 4UHJA 3KHTA 4MLCA 4YWHA 4EYQA 3RVKA 3D02A 4YRZA 3QLUA 4MR9A 5CNJA 3BILA 2CD7A 5TPWA 4Z4CA 3DLBA 1QO0A 3OLXA 2AYZA 5T7BA 5JS1A 3JY6A 2MYUA 1UDRA 5HSGA 1K68A 1USIA 1KRWA 4KV7A 4KREA 1PEYA 3QEMA 4MQEA 4KNYA 2CWDA 4MQFA 2R4QA 5IC5A 1H9CA 3S99A 3HJFA 1QQBA 4N41A 4RDCA 5EWJB 2MSKA 4EUKA 4LRQA 3C3WA 4FE7A 3A0UA 2RGYA 3QLTA 4WZZA 2PUFA 3JTEA 4ETNA 1DCKA 1Z2DA 2B4AA 4W5OA 1QPZA 1GLGA 5IEJA 4D6XA 2Q5CA 3QLVA 4QYWA 1Z16A 3RQIA 2IPLA 4Z4HA 5BRAA 4E7PA 4N0QA 1FQWA 2HSGA 4RSMA 5DTEA 1BDIA 4MS3A 3FGZA 2JB9A 4G0MA 3RVJA 2PE5A 3H5IA 4JA2A 4MAAA 5HQJA 3I45A 2VUHB 2X7XA 5EWMA 2P9HA 1DCMA 3KKEA 1JX6A 3O1HB 4ZJPA 4P1ZA 3F6CA 1FFGA 1IIBA 1OXKB 3GT7A 1Z17A 2HQRA 4ZYLA 4RV5A 3Q7TA 4G0PA 1EWKA 2YHBA 4KZKA 4WXMA 2O20A 4TLLB 1RPJA 4ZPJA 2PL1A 4QYMA 3OM0A 2IPAB 1JLKA 5JNSA 2GI4A 2LP4Y 4JASB 3T38A 4JB0A 2F8SA 2B1JA 2FMFA 4RK7A 5TPZA 3SY8A 2KYRA 3A0RB 4OLBA 3HZHA 4RK4A 1XHFA 3FFTA 1ZGGA 1PHRA 2JVJA 2ID9A 2JBAB 2A9PA 1DC7A 6ABPA 4MGEA 5B3JC 1E6MA 3A10A 4Z4GA 5JNTA 2AYXA 3FFWA 4ETIA 4YLEA 2CHEA 2PLNA 4H3HB 5E3JA 3Q9SA 3ILYA 1AB6A 3A3KA 1EFAA 2IDMA 3GWGA 3VNBA 1NXVA 1YIOA 4IF4A 1PUXA 1DG9A 3OLWA 2L17A 4RK5A 3HM9A 1VKRA 4YR7A 2J48A 3K9CA 3DGEC 2CHFA 1E6LA 2N9UA 5TQJA 3MYYA 5JNWA 4MRMB 1Z15A 4NCAA 4Q7EA 1D1PA 1XWWA 3CG0A 3H5OA 3I5AA 3OQOA 4RWEA 2VK2A 1C0EA 1U04A 4MR8B 2FKAA 3B2NA 3NBMA 1NXTA 2E4UA 2IPMA 3LUHA 3N75A 2BGGA 3O1IC 1E2BA 3H1FA 1ZH4A 3M9XA 2QZJA 4O5AA 4RKRA 2JCGA 1NY5A 4MS4A 4NCBA 5HKOA 4S05A 3O21A 3JVDA 2FVYA 2QR3A 4RXTA 3HK2A 3RVRA 4MR9B 2FMIA 1QNLA 3LMKA 3EULA 1ABEA 4NV3A 1ISRA 3KCNA 1LK0A 5KI6A 1D4ZA 5TPWB 1ZAYA 4F8JA 3L6UA 5DKFA 2FXIA 1DJMA 4ZMRA 4LE2A 1ZN2A 4WXEA 2IOYA 5CNIA 1HEYA 2PUAA 3N0XA 2QW1A 4JP1A 3KLOA 5FWXA 1JF8A 5IUJC 1W9HA 1AB5A 2E4XA 2LPMA 3QEMB 2MSLA 4Z9AA 4MQFB 1FFWA 3LKBA 1BA2A 1P2FA 3C3MA 3QELA 4Y9TA 3O1JC 4LZLA 3OM1A 3N6VA 1JDPA 3BREA 1ZGZA 4YGXB 1DRJA 1JFSA 3BRQA 4MR7B 1S8NA 3VNAA 4DN6A 2FEPA 3O2QB 3D8UA 3BRSA 2YHAA 3CU5A 4MS3B 4KMRA 3F6PA 1BAPA 3HVRA 2QU7A 3EJWA 3LUDA 1USGA 3IDOA 4RY9A 1LJLA 3RVMA 2OENG 4W5TA 5TQ2A 4DADA 8ABPA 1QP7A 1OXBB 2IKSA 3QLUC 3SM9A 2FSPA 2E4YA 1QQAA 1JYFA 3KYIB 3O75A 1P6QA 3TD9A 1DBPA 2FQYA 4F12A 3NNNA 3MM4A 1BDJA 3Q7RA 4YP9A 1M2EA 1RXIA 1Z13A 4G0ZA 3CS3A 3OLZA 4EVRA 2PL9A 1EWVA 4YS6A 4Z4IA 2FQXA 2NZUG 2R47A 1Z12A 3CKMA 1L5YA 2ID7A 1GUBA 1KGSA 3DBIA 4OLAA 1DZ3A 3FFXA 5EWLB 3QLVC 1LBHA 2PKXA 3OLVA 4GPAA 4XARA 1JFVA 2RDMA 1QO0D 3MIZA 4D74A 4F06A 5C5CA 3LUAA 2FEWB 2FW0A 3CHYA 1KMIY 1VRVA 2VUIB 3MMNA 3N8IA 3NNSA 4W5QA 1GUDA 1Z2EA 3IP5A 1ISSA 2MSWA 4OATA 3KG2A 4CBVA 5PNTA 4EVQA 3HXMA 4PEVA 2WJAA 2HJ9A 3RVLA 2P4UA 4IMIB 1F4VA 3N0RA 4PICA 3SQNA 4RXMA 1YTUA 2LBPA 5FBKA 3DZDA 5JNRA 3RVOA 3GL9A 1USKA 3M9WA 2FQWA 4EYGA 5FWYA 5KQLA 4KQ9A 2NUBA 3C97A 5IULC 2QV0A 1CEYA 4FB4A 2F8TA 4G86A 2L2QA 1NXOA 1ZH2A 1RZRA 2FLWA 4XAQA 3N53A 1Y1LA 2WRZA 1MIHA 1A0OA 5GOTA 5EWJA 1WETA 1FSPA 3RVNA 4O1IA 5B3JA 3SNKA 3QX9A 3G1WA 1A04A 4IMJB 5KWSA 5C5EA 3LUGA 5FWXB 3GA5A 3LKVA 4RU1A 1JBEA 4HYEA 4LX8A 2ZAYA 3NHZA 4EYOA 1QMPA 2LUOA 4JAVC 5TQ0A 3QELB 2E4VA 4EYKA 1TJYA 4L4UA 5TPZD 5IX8A 4ETMA 1JYEA 1P6UA 1TLFA 3LUJA 1ZESA 2PAFA 4NICA 4TLMB 1JFTA 5FBHA 1ZDMA 3UUGA 1SXHA 3H6HA 2JK1A 3CZCA 4RY8A 1EWTA 2FMHA 5I4CA 2PUBA 1CHNA 3EDCA 3DGFC 4LDZA 4MLDA 4WT7A 5IEBA 1M5TA 1ZVVA 3HSYA 4QICA 1EHCA 3SAJA 1RXEA 2PJUA 2WB4A 3H5TA 3HO1A 2GX6A 4EY3A 3DLHA 1DCFA 3E61A 3HCWA 5JNUA 2HQBA 3HUTA 2H3HA 1SXGA 1ZHHA 2FLKA 2IYNA 2M1ZA 3HDVA 3KTOA 2MYTA 4MQEB 3GRCA 4HNSA 4JB2A 4S04A 4YV7A 1U0SY 3ILHA 4Z0NA 3H75A 1GCAA 4PE5B 2FEKA 4G0QA 1D1QA 4G0YA 4JOQA 5IUNC 4TN5A 5DGCA 5CNMA 3OQNA 3R0JA 4WWHA 5KQPA 2FN9A 3G85A 1DBQA
chains in the Genus database with same CATH superfamily
4GWGA 2JAHA 1UPBA 2JZCA 3PC3A 1U3UA 1RDFA 3IHTA 3PD1A 2Q9UA 5AJZA 3VQTA 4BZPA 1P77A 3DSRA 5JD3A 1DAHA 3WYFA 4N5NA 4JL6A 4C6SA 1WMSA 2Z8YM 2MIIA 5TE9A 1KVSA 4F4UA 1EK2A 1UH5A 4K9QA 2NV0A 4IDFA 4QUBA 2H51A 2W42A 4EVRA 1Y8RA 4C5AA 1L4EA 2FPMA 3NIWA 4QPPA 4IWXA 3H5AA 5IUKC 3H4IA 3KPJA 2G07A 5DX1A 1L7QA 1R6AA 3N3BC 5IDWA 3LWDA 4JCCA 4KAJA 3GLFB 4Z51A 4NZZA 1K8ZB 2EFGA 3D7NA 1EXVA 1B6TA 2DTEA 2YXEA 1S8FA 1I6MA 1DAKA 2W00A 3I9JA 2I2AA 2GKGA 3EXAA 4FWIB 4WK0B 3UMBA 421PA 5CVVA 5GZ3A 2HYIC 3N39C 4LF9B 1G5TA 1RWQA 2NXJA 4LI0A 2HRDA 2HLNA 3K7EA 3WKDA 3CCCA 4FS3A 2ZXUA 3O8CA 5HXAA 3W5VA 3GRYA 1RJWA 3DS8A 5KOIA 1NTRA 4JX8A 1Y5RA 4F4FA 3V2GA 4DEYA 2WWVD 3WWYA 3PHBE 1FRQA 4A10A 1HE1C 4PU0A 4DWWA 1WMAA 2KBFA 3HY6A 4U4AA 3MC1A 3GCGA 1A27A 3HS3A 3TEJA 5F5XA 4FE4A 5JBIA 3L7MA 1WPXA 2NT3A 3H04A 1V71A 3MS2A 5EFZA 2AJ8A 1RI5A 2AK2A 2YMLA 4P5DA 3PVZA 1MEJA 1H9CA 1Z34A 2AQKA 3GJZA 2H0QA 2NW6A 4KPGA 3I6BA 3A1WA 2H6EA 3JQGB 1KDRA 1DUVG 1EEHA 2O2SA 2EGUA 2RGDA 2XGGA 3QVGA 3L1KA 2WPDA 3M9LA 3ABZA 4FEGA 4KRYA 4MIKA 2DPHA 3T99A 4G81A 3DFMA 2FMKA 2JBWA 3DMHA 2IZ5A 1NKVA 5CVTA 4HMOA 5IM4F 2LWIA 4TXNA 5IT5A 3VU3A 1V8DA 1AXGA 1WXHA 2AN5A 2JPDA 3K1ZA 3M33A 1Y4UA 4LECA 4O4LF 4WCVA 2J9RA 4IJMA 3EUFA 1EBBA 2A0XA 3TKLA 3CFYA 1QHFA 4BFCA 3K5IA 2AWOA 3IGFA 1F0KA 3LK7A 1Y81A 2PBLA 3GXOA 2CJXA 3DUWA 4V1CI 1ND6A 1XA0A 3U3XA 2HY7A 1QQ7A 3I1IA 1HDIA 1RM4A 2A9QA 2VK1A 2Z1DA 3DWIA 3K2IA 1KF0A 3K2BA 3PLRA 4HNTA 3KZOA 5DNAA 2RIRA 1OC4A 4F4IA 4AWXA 2YVUA 1IZYA 3D4NA 4FT4A 1E9DA 2XNKA 3HYCA 2GARA 4MINA 3GGGA 4AJOA 5AVTA 3ZTYA 3A06A 2Z57A 3ZU6A 5BY2A 4EHDA 3ROEA 2ZVQX 1DFHA 3CPSA 4FSDA 2JGRA 4IMRA 4JI3B 4UHKA 4RIFA 3LUFA 3W1EA 4LYEA 1DX9A 2FR8C 3GK3A 4OEHA 1EDDA 3GLVA 3NHSA 4OAQA 4UXHA 3CRNA 2TMDA 4MVYA 4RPKA 4UVGA 3WOVA 1FMTA 1JHZA 1MX3A 2O8VA 3KAKA 5IAKA 4DSZA 1U94A 3ASYA 1A2OA 2I22A 1NJ1A 1V5GA 1TL7C 3DEAA 3DLCA 2WIAA 3CGWA 3N2NA 4FX2A 1XMQB 3O91A 4Q9AA 1ZM2A 1YRBA 1D09A 1YCHA 2P91A 2QT1A 2VWPA 2OY0A 4RHXA 4X91A 1MABB 5KAMA 3DF9A 5DWDA 3R0VA 1QIFA 5DM1A 3VSCA 4FB5A 2HM7A 3STTA 5J5AA 1JH9A 4BZWA 3F7NA 1PEKE 5CB8A 2C04A 5GVSA 2V9PA 4I5EA 3DHVA 1CYEA 2Y8EA 4PX5A 2GETA 1JEYA 4IAOA 4JROA 1L1FA 4FFVA 4TT8A 4QUEA 3VZQA 3ANYB 2HF9A 2XVZA 3I4LA 2BGMA 4CLRA 2H1VA 3V8VA 5DCUA 4OHXA 1AQNA 5LQKA 2QTTA 3DKPA 1HDRA 3HV2A 4QNNA 4QKQA 2GF9A 1E18A 1XZFA 2F3RA 2OM6A 1LBSA 2GPWA 2Z09A 3DC7A 1NM5C 2VRCA 3OX1A 1UWLA 4PTZA 3ZE7A 3H5WA 1QJCA 4QASA 2FVXA 1LPAB 4CM4B 4H6PA 1UK8A 1U4OA 1J4AA 1Z88A 4PYRA 4PBTA 3BFVA 4G2TA 2OEPA 4LJ4A 1JVNA 4LYYA 1Y9JA 3WXMA 1EK0A 3AVXA 4XX0B 1WF3A 5ICGA 1WZUA 2HIGA 2JANA 4Q1CA 4HVCA 2F3QA 3JQ8A 1I4DD 2DBYA 1HFKA 2Q29A 4GUDA 1T1EA 1VLHA 3I5MA 4RMIA 1KE2A 3BUSA 1H8HD 3DBLB 4ZQBA 1PJ2A 1WHSB 2EP5A 3Q8WA 4R8RA 2GUWA 4C30A 3RAPR 5I01A 3U7FB 2OBYA 2Z5GA 3L0BA 3QK7A 1UZNA 3EDMA 3IP6A 4XH9B 2AKYA 5AI4A 4KR6A 5BQXA 4Y2YA 2GRJA 1DDIA 2XUOA 3WLQA 4N7BA 1XZHA 2QMQA 1BW9A 2XT6A 1HBJA 3P9NA 1HV8A 4GU5A 3T7AA 2C2XA 3QW2A 4EYQA 1DFIA 2OB1A 1WSAA 3D6VA 1ECPA 4ZWNA 4CHGA 4YAKA 3R0IA 2C29D 4ZOEA 5EJ6A 3MCTA 5H1YA 3NHJA 1VZ3A 2BFFA 4HV4A 5C8YF 1KTVA 3E0XA 1EIZA 4UPDA 1JHYA 1HEUA 2FXVA 1Z0FA 1N2ZA 3P0EA 3O38A 3F7TA 3SJ7A 2V7QD 4FKBA 4X6UA 3FH0A 1SKBA 1IAQA 2YOGA 4P0TA 4L0MA 1IVYA 1Q14A 2AE2A 2WT4A 2VAPA 3ND7A 4UBLA 3W3AD 4C6TA 2C99A 5AW1A 3AILA 2EDAA 3U3OA 2Q4TA 3ASUA 3U44A 3HXOA 3R40A 3NMUF 3GARA 1SNYA 4DG9A 1OJLA 5C0OE 3UJBA 3MT0A 4YECA 3IP3A 1OI2A 2RK3A 2DKFA 3C6ZA 3P7MA 4NECA 4B33A 4E2XA 4BAUA 4F97A 1I5RA 4EMTA 5HTKA 5TJHA 3KT0A 1QYIA 3GLIA 4QT4A 4BNHA 1GLGA 3JASB 5DK6A 4YC7A 2HQSA 4Z86A 5JV5A 4A4DA 4CCWA 4XD7D 4MVJH 1B3RA 3PQ3A 5J23A 3PJRA 3IO5A 1A76A 4F3YA 1T8RA 1TOAA 2NOAA 3NOOA 1Y63A 2PR2A 3EISA 1VDZA 1SCIA 3F4BA 1SGWA 3PT9A 4G0MA 5C5DA 3WIDA 2Q8QA 1AVTA 2NM0A 5EWMA 3U0VA 3PXDA 5FUYA 1CR1A 2ZJ7A 5KNDH 3GFQA 1DUSA 5KJCA 4CCYA 2PPLA 2ZR9A 4I4TA 4QHTA 3VAAA 1FK8A 1HE5A 2DCMA 2F67A 1K6JA 1UPFA 5FPTA 1EWKA 3A3PA 4WXMA 2EWVA 3KWMA 1JLMA 3BMXA 3LBIA 2IZOA 4H6XA 1LZKA 1XXHE 3C6BA 1BQEA 3EN0A 1DLJA 2PL3A 5LUAA 4BC1A 1EUYA 3LHIA 1SM4A 4EB6B 1M0TA 4DV3B 1KY4A 2NU9B 1MB2A 1PHRA 1M6NA 4W1QA 1AQJA 5SZHB 3E9YA 2ZAGA 3QKRA 3B3GA 4MW4A 1T0IA 5B3JC 2AX4A 3CMMA 4YUVA 1OH5A 1WXGA 1TVCA 2HFJA 1H0KA 1U7DA 3DZJA 4IINA 3T3IA 4B6RA 1DMRA 1GRNA 2V7GA 3E81A 3A3KA 3DM9B 3RBAA 3Q0TA 2EGHA 2VXOA 4HDSA 3U5TA 2C5SA 3BMOA 2XSZA 2AOUB 3HKEA 1PO7A 3KYBA 2YWGA 2EBWA 3MHTA 2IW1A 3BJZA 1SUFA 1GNSA 4RGQA 2J48A 3IYLW 5LC1A 5AW7A 2GCOA 3HDTA 4FE3A 4V2IA 4WKNA 1YFJA 1HKHA 4GPZA 4I4NA 3ABRB 2RAFA 1HT0A 2VK2A 4H4DA 2H3EA 4JYPA 5DI9A 3C0KA 4TRNA 1X7YA 5CM2Z 5HMLA 3VZDA 1P2TA 4IQ8A 4MVJF 1QYVA 1G3UA 1F5NA 1SU6A 1TADA 1Z5UA 2QX9A 4TL7A 4V24A 2FFQA 5EE5B 3UK7A 4F92B 5CRIA 2VA8A 5KYGA 4KLZA 2G9QA 3IJRA 2YUTA 2QG6A 1W76A 1Y3DE 2EZ8A 1YVEI 4CM5A 4U7PB 3REQB 4HEJA 3K35A 4OJYA 3D6NB 3OTQA 1NC1A 4FIZA 1ODCA 4LK3A 4TV9F 2A5LA 3RODA 1U2DA 1GP2A 4MNTA 2QK4A 2IXGA 1I10A 1PI3A 4KTTE 3TBFA 5CNIA 3N0XA 4QBTA 4EYEA 1KAGA 4ND1A 2EKBA 2WDPA 4DAEA 5AW9A 4KJZA 3O26A 2AW5A 1UPXA 2E2WA 5CIWA 3NTLA 1P2FA 4RPGA 1EX6A 1OYOA 2X8JA 1P29A 1KAOA 1KY5A 1LX7A 3RSOA 4A6XA 2O1EA 5GJBA 3H8JA 2D7JA 3LYUA 4LI3X 5F2KA 3VAYA 2DFNA 2GR9A 4DPMA 4Y9SA 5L3QA 4OGGA 4XSGA 1IXKA 2BM9A 3BRQA 1K2WA 3KJQA 4NBWA 1XD9A 4ZOAA 3SR0A 4CL0A 4D0GA 1SUSA 3B53X 3D8UA 3BRSA 3WC4A 5JLJA 2BGLA 3P2KA 2PV7A 4M9RA 4LS3A 4Y3UA 3PHGA 3HYSA 4JC4A 5AJHA 5JCZA 4C1BA 4K1XA 1WSDA 3B7PA 3CTMA 2YZ2A 1OAAA 2GHQA 4RY9A 4E15A 4F4CA 3TE7A 2Y76A 4N3CA 4AJLA 4X60A 2O5CA 1QP7A 3RTEA 2JLAA 1OXBB 1Z07A 1AQYA 1Z6XA 2R6FA 3UWOA 3WKBA 1T13A 4MQ5A 2XHZA 3RS9A 3IV9A 1NNSA 4NOKA 2N3ZA 1BE1A 3DPSA 3H0EA 3M6LA 5TRTA 3FKJA 2XCIA 1Z8DA 1EUZA 3HA7A 3IAHA 4GBMA 4O08A 3IQEA 4FMDB 2RGBA 2XIQA 5HOEA 4JVSB 3TG8A 1IDOA 1H2AS 3FROA 5AKLA 5M34A 4G0ZA 1UIRA 1HT3A 4URVR 4KKXB 1AE1A 5JTUA 4YJ2B 3W79A 2RB5A 1K0FA 2EKQA 4I3GA 4IZOA 1SELA 1ZHOA 1QZUA 3MLEA 1VMAA 1UXOA 2LDBA 3IQGX 4G5SA 3NWBA 1U0LA 4ZO4A 5JAMA 3LGXA 2OQIA 3BFXA 4V39A 3HCDA 2H08A 3HB9A 2F48A 5FO1A 4AD8A 2W8ZA 4NBRA 4YCAA 4IQ4A 5ADUS 5HILA 5JJLA 4V38A 1CV2A 1RABA 4X93A 3MTQA 1JMVA 2QM3A 3D8NA 3EQ8A 3IH5A 4O3MA 1W75A 2VPTA 3EF0A 2OG2A 1BX0A 4UREA 1AMNA 1Q6YA 2BI7A 2CLEB 4NFSA 4DV7B 1PQ4A 1Z47A 5AW2A 5JJBA 4C0HA 4BKMA 3ADCA 3HL4A 1KYTA 3E84A 3RVLA 3AOEA 3K15A 3U3RA 5COQA 3U49A 2EZ9A 1KDPA 3WJ7A 2QN3A 2ISQA 1D2GA 2H7XA 3K92A 2ZQ5A 3GW8A 2GASA 2RG7A 4MZDA 1M2OB 4UM7A 5CVJA 2DB3A 2BMEA 2XD9A 4A2PA 4RQTA 1M66A 3Q5EA 4CGZA 1IM5A 1Y9AA 4LK2A 1NYRA 4OGKA 1LPOA 9LDTA 1XXHB 4NR0A 2WUGA 4B87A 5A4FS 1WQ3A 1YA6A 1R0CA 1Z2NX 3AW8A 2OFXA 1LI5A 2A33A 3ABSB 2RGRA 3FM9A 3C3YA 1XU9A 2DFPA 4LCJA 1Q0SA 3GZNA 5KSPA 3BB3A 3LHDA 3WBBA 3VJRA 4AS1A 4HNAB 5A3RA 5IVIA 2Z5VA 2P1RA 1UKCA 4MVJI 1Y3FE 3ZWCA 1WDWB 1B8NA 4ZCTA 1UP4A 1I6KA 4BQSA 3BHJA 2IYQA 2QRVA 5CA0A 4G37A 3ZW9A 1NVMB 3WGUA 1ZHFA 2A5YB 1PFVA 2XZLA 3AL2A 4KUGA 3UAVA 1JQBA 4GGMX 3UT0A 5TPZD 5KOYA 3O3NB 5K4HA 1YE3A 1DQSA 4YUZA 1CULC 5CB6A 1ARZA 4H7JA 3LPLA 1GQSA 4G0WA 1AUPA 2Q2QA 3AIOA 2A58A 1SXHA 2JK1A 3LXUX 4RY8A 4QPDA 2OZLB 4JSYA 4MVWA 4NJOA 1UJCA 4GRDA 2W90A 1EFHA 2FZKA 1M8GA 1Q3TA 1YR7A 3CUWA 1RXEA 4Y2GA 5HCUA 1K5PA 2UVQA 5CB0A 1QYRA 2GZHA 4RENA 5C7OO 1S2GA 5CH3A 1YKGA 4FPXA 1LH0A 4EJSC 4DLLA 2IKQA 2YJ6A 5AVKA 2JIBA 3SQXA 3HVKA 2BFEB 3CE6A 3KZXA 4OP3A 4HJXA 4DQ0A 1T5SA 2NMVA 4WN9B 1P5FA 4XGQA 4D9NA 4XASA 1G291 1U8EA 1Q3KA 1SCDA 4ZI7F 3KB2A 2H1FA 4PONA 5LKRA 2PX4A 4I7EA 3QV2A 1JQ3A 1G4AE 3AVOA 1J8YF 3O8QA 3TQTA 3ICCA 2VJOA 3IPCA 4JU9A 1U3FA 4X7PA 3WWCA 1KR5A 1ZW1A 4HSGA 3EXIB 2GTIA 3ADOA 3C8HA 5EMKA 3O74A 3TNDA 4CCSA 2ZWOA 1AV6A 3R0QA 2RBGA 2H4ZA 4IV0A 1NIJA 5DP2A 3OEWA 1E1LA 2HZ7A 4NCXA 2AEMA 4WW0A 3ETLA 3G7NA 6NULA 5L4LA 4F6CA 1P5RA 1Y9DA 2GO7A 1SKQA 2H7VA 1ZY2A 3KWJA 1LBQA 3QG5A 5AJWA 1ODSA 3GVPA 2B1QA 4QQKA 3PL1A 3CG4A 3CWCA 3IPAA 1DC8A 1N2HA 1OAKA 3D5EA 4MPJA 4Q0MA 2J6IA 1SPBS 2ODPA 4EWLA 4W5NA 2ATEA 1SCUB 1YR3A 1R0LA 1QPBA 2AI1A 3C1TA 1O87A 1A4IA 1LTHR 1U8TA 3H5RA 1YB2A 1SAYA 5F1KA 1CVLA 4DREA 1JEDA 4JV5B 1I3NA 3WBKA 4GOJA 3VSEA 4D81A 3LT4A 2OZEA 2MYNA 3IIEA 1ZVKA 2DHCA 4Z9FA 1P2BA 5FWDA 1NATA 2CNOA 2ZSBA 4B8ZA 3AP2A 1B4DA 4IDGA 5BR1A 2JGAA 5KX5A 3N28A 2VNSA 2ONCA 1IJFA 3P9YA 4RJLA 4QL3A 3S2IA 3WGMA 4KUHA 2AG8A 3KPYA 2Q9CA 4O8ZA 3DWFA 3MFYA 4NZMA 4GOXA 5SYNA 4ZV9A 1J56A 3ZJ5A 5H5JA 6REQB 4KI7A 2E89A 5I9SA 4AK9A 2F7SA 4R1TA 1MJHA 1NBMA 2MSNA 1G0NA 1IHYA 1XIVA 4JJGA 4BVAA 5C18A 1E1RD 1F6BA 2ZITA 2OV8A 1O6CA 4XQCA 2YN0A 1KMQA 3TQIA 1LPPA 2EKPA 3KVNA 3TBKA 2F64A 2BPOA 4QAJA 1E2PA 2QTZA 4N0MA 3JQQA 5EIHA 3T06B 1LNZA 4HNHA 2AC4A 3ER6A 2ZYIA 3JAWB 4LZNA 4KVGA 5JZVA 1VE6A 1UAAA 3HVJA 1QUEA 3O9VA 1T0BA 3LKZA 3DDNA 3MGAA 5ETJA 5P21A 4Z0TA 1C0IA 1J8QA 3QZUA 4GI3A 2WJWA 1U1EA 3IMKA 5BSHA 1WV1A 5LWHA 1LLCA 3LE8A 1M8JA 1YFZA 5FTWA 4LHXA 1P7ZA 4CQMD 2C54A 2Y6UA 3I73A 1TECE 2BUAA 3KV1A 4IOJA 1LSSA 2XUFA 4G9GA 4KACA 1C81A 1IFXA 4L15A 4ROTA 1D5WA 5FBWB 1H6CA 3LDAA 5H3CA 2YIDA 3AI2A 4WADA 4XFKA 2JBHA 4AY4A 4F46A 1I4EB 3LTEA 2TMKA 2FJPA 3GGSA 3ABIA 1HWYA 2FCRA 1NDUA 1RI3A 2O3UA 4J3NA 1OASA 2HWKA 2FUG1 2B0JA 1MCZA 3DE2X 2FZWA 2NO9A 2R66A 1AMUA 3UK6A 3WX0A 3EH1A 2E6KA 1EFUA 1Z0AA 3B78A 2BDEA 2C2YA 2Y67A 4K9MA 3RIGA 3V80A 4B6FA 3RG8A 4GX2A 2CCKA 1JE0A 1KOFA 4Y2HA 3ND6A 4D4GA 2AG5A 3A1NA 3AQIA 2OBBA 2VHYA 3PVCA 5E7QA 2P2GA 1U31A 4W63A 1U2QA 3EIUA 3P26A 4MA4A 4PPQA 4DG8A 5I4BA 4AKHA 5ALDA 1RZRD 5EIOA 3HUEA 3PF9A 2P3QA 4M76B 1NVBA 1RHKA 4KDEA 5F77A 1VPLA 4CM3A 4CLXA 3LQ2A 2VJKA 5IJXA 2O3QA 5I9TA 3R7WB 5C4IA 4YACA 1VLZA 4RLHA 3U7EB 3OZRA 4PZ0A 2HBRA 2REQA 4LFCB 3TEFA 5LOVB 4W1SA 4UUAA 2Z3ZA 1TCCA 1EWYA 4FOTA 4P4NA 4S1PA 2YVQA 2W70A 1CQWA 2VH1A 3D4OA 2I66A 1V6SA 4TMXA 3F9IA 1TEXA 3B8EA 5FTKA 4DA6A 2V0NA 4L27A 3GVIA 3H9EO 4KH0A 4U2KA 1UANA 1A2KC 4ZI3A 1GM5A 1CQZA 3GJXC 3F98A 3FPAA 4CKBB 4FZ3A 3HC7A 3GD5A 5D3MB 4FDTA 3IALA 2O2YA 2ZVJA 2WFMA 2MT9A 3DT9A 1ZL0A 2H52A 3TXAA 5AVYA 1H4QA 4MARA 2DFVA 4L5CA 2EL7A 3AUUA 1FBNA 3HJBA 2ZROA 3ZD8A 1G64A 1QVVA 5D51S 3L4KA 3QUQA 4OD0A 4MCIA 5CDGA 4GHWA 1IOLA 1WCIA 5AVXA 1RCTE 3D1JA 1L7XA 1D9ZA 1WXDA 3UFXA 3V2IA 5A0VA 3KSUA 4WVLA 4B3HA 1J70A 5HUJA 5LL6P 2P41A 1JTVA 4N0PA 4N76A 2WSBA 1MG5A 4I5IA 3H2SA 3HGQA 5TR9A 3FCEA 3R41A 5JSZB 6GPBA 2O8BA 1Z6YA 4D5GA 1YR6A 1KMNA 5HNKA 1EEXB 2IYSA 1AC5A 2CYCA 2G06A 1WW8A 3BRWD 3JR3A 1J24A 4FHFA 1FBTA 2HDWA 1JN0A 3UUFA 1NN0A 1Z39A 4M6WB 2AKAB 3PDIA 2ZIUB 4O1MA 7REQB 4KR3A 4HT3B 4XGIA 3AFNA 1JGTA 3PIIA 4DR5B 1FNMA 4ZEXA 2Q6IA 1DHRA 2QJRA 4P3KA 3OLXA 4BLVA 4DJJA 1QFYA 2ZRQA 1D04A 3A9VA 1MRSA 4UNSA 5E9AA 3FE2A 1EIWA 4JWKA 4Q47A 1HO3A 4L73A 4DLRA 4CIBA 2PX0A 1YQ9A 2ZJYA 3HLYA 2ZJ4A 4UNQA 2J4DA 1OFTA 4ARZA 3H84A 5AD1A 2NG1A 4J03A 3CR7A 1BXZA 2P75A 4G01B 3IMFA 4JI0B 2FN4A 4JVOA 1KMMA 5DRTA 4ZT4A 1WG8A 1SVIA 1I3LA 1UKVY 5CYOA 4NDNE 4ARCA 5JH7F 3JQ6A 2Y93A 3ZWXA 1OXXK 3CZ9A 1PNOA 3VKVA 1FL9A 2AMFA 4LSWA 3MMZA 5AVZA 4RZHA 2WUWE 2OGTA 2RBKA 4XA8A 2ZU0C 1RZ3A 2QX7A 2PE5A 4JLOA 4HXEB 1JLHA 1FYFA 2G5GX 3UN1A 4DBZA 3R6TA 2PQMA 1YZUA 3UW1A 4ZJPA 5JS8A 4C6RA 1RHQA 1OXKB 2QMHA 3UH0A 3TLMA 2O14A 5J59A 2UZ0A 1O9HA 2EDCA 1YJAA 4TLLB 5H02A 1MF7A 1UXGA 1PVVA 1A71A 2GTPA 3VYTB 1JLKA 2Y0DA 3ZCTA 1SVLA 3EMDA 1JIKA 4JASB 1N8NA 4FFMA 5L3SA 2EJBA 4OREX 4O2BF 4BCCA 2IT1A 3OWOA 5BN5B 2D0OB 1XHFA 3PNLA 4CI0B 1XTUA 4WZAE 5T4EA 3UMGA 1GPUA 3LY7A 2C7GA 4HG2A 1YR8A 3GG2A 4K5QA 2WPDD 3ROQA 3WK9A 1XKXA 4KR9A 4E14A 3W9BA 1CZKA 1EZ4A 2N47A 3HU3A 1W48A 5ERYA 3VKHA 4J2OA 3CUEF 3QLEA 3GVXA 1Z35A 2Q6TA 2J5KA 3HP4A 4EH1A 4M0FA 4ZT5A 3W7VA 3WV4A 3E4CA 3AUYA 4PO9A 4BX2A 4EUSA 2JLQA 2FAXA 2F3UA 3HM9A 3H4VA 3IR6A 2WTMA 1E69A 2X77A 3IJ5A 4MPDA 4UVEA 5A06A 4GOOD 1RMQA 1QE3A 2ZEJA 3ZK9A 5LQCA 3M3DA 4ACBA 3AOGA 1GPNA 1Z4KA 3HUDA 4L78A 4X9XA 5BN3A 1E3JA 1BXGB 1XF9A 1GGJA 3AJDA 1NR7A 1X7GA 1ZK0A 1KXJA 2P68A 5JWHA 5D6OA 1SBHA 4JDUA 4QDKA 5AVSA 3DM5A 1DAFA 3KUUA 3NRJA 5DYNA 5JCXA 1SVUA 2IC5A 3M9XA 3RSLA 3WNDA 4GDFA 4AQ7A 5EUCA 1E2FA 4BHTA 2BHNA 4RIGA 3JVDA 1ZCBA 3QFFA 4LHEA 3UVEA 4CMIB 2FVYA 5AKZA 3MCZA 1XTIA 1MHPA 2Z9CA 3KKZA 2ETVA 3HPQA 1O96A 4FUQA 3S28A 1Q1BA 3AT1A 3EULA 1RAHA 1JSXA 1IHDA 2F17A 3EA5A 3PXXA 4FFLA 3VC1A 3PXEA 1N2IA 4MUHA 5J5VA 4E13A 4F6RB 4F91B 3ZD7A 5EGNA 3A2KA 5SICE 1D2RA 3RS5A 3TRIA 2FFHA 1OVMA 2VHWA 2I80A 1A5ZA 1N1GA 1BWRA 1U0NA 3KLOA 3O4RA 2HA3A 5TF0A 1JF8A 3SEZA 2JAQA 4FDAA 2XLCA 4JSTA 4M37A 3M4ZA 2LPMA 3K1AB 3V6LA 4LFAB 1G5HA 2FWIA 5IKMA 4FNGA 3TR6A 3THWA 4B6QA 4JL8A 3NM4A 1ZIOA 3RU2A 4CR6A 4LZLA 4FLEA 4NDZA 1QWOA 3UWMA 4WZBE 3FPKA 4Q01A 4A0GA 3A6EA 3FVRA 5K8IA 1EP2B 3TIIA 1CYDA 2C5LA 1H6DA 1HLGA 2VRCD 3VNAA 2X2EA 4AZTA 4D99A 4EY7A 5K0CA 1DAPA 4LVNA 1EK1A 4NOMA 4RZ3A 5A5DA 3SHOA 3LL7A 4RLSA 4EB8A 5KMGA 1Q7GA 4U2DA 4TYYA 1OI3A 5EJIA 6YASA 3VJMA 2GVNA 5ANRB 3VHLB 5LMCA 1Z4IA 3GEEA 2I6SA 2AEEA 1NQAO 4BIIA 4A7PA 5JRJA 8ABPA 3AIKA 1EDOA 1QIJA 4MA5A 2ATIA 4HAZA 4B84A 4EL5A 2CE2X 1QHGA 2EARA 2QT9A 4WBSA 2Q2OA 1JYFA 2EXXA 4PANA 1K6IA 5B3AA 3Q10A 4EB3A 1MBZA 2HBYA 3FPGA 1SKAA 1X9GA 2YIJA 4OFXA 4Y0NA 1NNLA 5FLYA 1W8DA 2OD7A 4CETA 2NNWB 2O0MA 2VS1A 4CM4A 1K8QA 3BPSA 1L1QA 3EQ9A 3ADPA 3IPLA 2M6LA 1P1BA 1QYDA 3IDQA 3N2LA 2BWJA 4L3OA 2EIXA 4L8VA 2WMOB 2P77A 4JXKA 4LRYA 4XIIA 5IC4A 4L6CA 3UANA 4C4XA 3WRWA 3L82B 5FKJA 4YX9A 2GB4A 2OLEA 2YY6A 1KZ6A 2J08A 4GPIB 4GPTA 7ADHA 5AK4A 1DZ3A 1QK3A 1CLUA 1WHSA 2R1TA 3ESDA 5FOWA 2PKXA 4NBSA 2WJYA 4GEGA 2GAOA 4LDPA 2O5RA 4GKAA 3DWGA 5FUVA 3V7WA 3ZHZA 3ZGXA 4XPIB 1S8OA 2UZ1B 3UV6A 4LJRA 3Q8XB 5KOJB 2QTHA 2BJHA 4YQFA 2UUCB 2VDKB 4KR0A 4G5YA 1K6EA 4GYKA 2A9JA 2VHVA 3OKFA 5E4FA 5EP3A 1Z2EA 3QLJA 4RIEA 4PYOA 5E2BA 1JUDA 1QX4A 1JQ5A 3EPPA 3PUWA 1DEHA 1F6WA 1L4HA 1ZJ4A 2V7UA 3AJ8A 4FBGA 1YJBA 4KG7A 1EFLA 4ZHQF 2J67A 1AHIA 2NQ8A 1FJ2A 4GPBA 2QKYA 4JENA 1RJ9B 2ZTVA 5K0BA 3A32A 3NEJA 3CX4A 3LRXA 4S2UA 4EYGA 1M6VB 1FTGA 2WFLB 1X1SA 3GNLA 2OFPA 1SIBE 1NVEA 5AYVA 5KPJA 2QT0A 2XCOA 5EOVA 5JTTA 4GUAA 4QG7A 4TLAA 2UAGA 5IYZA 1CEYA 1RYBA 4U5QA 4JMPA 3HR8A 2B4TO 3UJ3X 4BNFA 3CLTD 3DOUA 1WXQA 4XAQA 3SC6A 3NJRA 4PQYA 1TAHA 4F85A 1NY6A 3PEFA 3QYJA 5MGBA 2XKKA 3VR0A 4KLRA 3TLAA 1PGNA 3WRVA 3FTPA 5H68A 1P1RA 2PBZA 3NR2A 3CUYA 1S9DA 4WZAB 3JASA 1KJZA 2VK4A 4B43A 3MRXA 4EG7A 1NYLA 3OQIA 2AEFA 2D4AA 5FYDA 1YZ3A 1I2ZA 2QROA 5JHHB 2YW2A 3GB9A 4P58A 5TGTA 2YJZA 4YI5A 1DV1A 1L4BA 3N58A 1EMDA 4P3OA 5FBLB 3HCOA 1KL7A 2X2OA 3ESXA 3WLFA 4D9JA 5K8TA 2YHUA 4R8LA 3FYCA 3R6LA 4JI6B 1KP9A 3FOFC 2PEZA 5IT9A 1ZESA 3HQ4O 4RYDA 5TB5A 4JXXA 4Z49A 2M32A 1OWOA 1TFRA 2Q3EA 3DDHA 4E07A 2ISSD 3JAKB 4OXIA 1JG2A 1XLTA 2CL7X 3DBRA 1A9RA 1F7UA 4LDZA 2Z8ZA 4QHYA 5IJ9A 2PA3A 3KXIA 3DE6X 5JVDA 1EHCA 5KSYA 4RULA 3HZRA 1BQ3A 1QHHA 3HO6A 4MI1A 4OBXA 3D6FA 3I6IA 2XSZD 1DX6A 1FW8A 1JDTA 4JC5A 4DQXA 5FNVB 2VHZA 4X3PA 3ZBQA 2E1PA 3N05A 3NAGA 4QLOA 2JFPA 1SMKA 1X7XB 1SXGA 5B2ZA 3KRTA 2FLKA 4PAGA 1NDQA 1F38A 2X2PA 3WISA 2QAGB 3QFHA 2DECA 3RSFA 5EVCA 1U2DC 5HZHA 1U2SA 2XB2A 1QIKA 3N5KA 1TM1E 2BHTA 4TM7A 1HK7A 2RHHA 4PS0A 4D96A 2NVOA 3QE0A 3OOWA 4YMWA 3KU1A 1HDEA 1M74A 1YO6A 2I4OA 3EHDA 4XLLA 5CNMA 2H31A 1ACMA 4EGFA 4DEXA 5HZKA 4FFOA 1FNCA 4Q6BA 4ETMA 2AOUA 1ESDA 1VBFA 2C1ZA 2CLSA 4CTKA 1I94B 2ATVA 2YQ4A 3UJDA 1AMOA 2VHUA 4X3OA 5CHYA 3VHQA 1TPYA 1Z25A 5LA6B 2I3AA 3WGNA 3GCDA 1Z0UA 3AHJA 1IVSA 3IEMA 1XKLA 3KR9A 1MRNA 1OA1A 1I4TD 4JDPA 5EZ5A 2HUPA 1T3SA 1UKAA 3AK4A 2TSYB 2G70A 1V37A 3KQHA 3DE0X 3HCEA 1KOGA 2PKQP 4PNHA 4Q3LA 2QRPA 4WZBB 3O2SB 2A59A 1FQJA 1KK1A 2LKCA 2O07A 3DMYA 4FFPA 4L57A 3TNFA 1PVOA 2PBFA 3TQOA 3OMXA 3NZEA 2ZI9A 4D3XA 4C0AC 4YXFA 3PXBA 4JLWA 2W2OA 5LBUA 1LQUA 2ERYA 1Z7WA 2X0NA 4OM8A 5DU2A 2IBTA 1P17A 3QX7A 2VP5A 3CZRA 1VHTA 1XK6A 2OILA 4NPHA 5AI5A 2ZSKA 2Q21A 3GCWA 4BMNA 5AO9A 3NANA 2C88A 4OHFA 4BX8A 1JXMA 2IF0A 1K27A 3STUA 1MA3A 3LC2O 5FI1B 5F4BA 2VJPA 5CXXA 4RDIA 3T61A 1PX0A 3PPXA 3TW0A 3X1XA 4IJ5A 1GA6A 3Q3VA 3HKDA 2ZYWX 2ZDQA 1MJFA 2P3LA 1YS7A 2R60A 2WSIA 1TU4A 2OBXA 3BHMA 3C4QA 4BAZA 4BFZA 4MEAA 4JJZA 4H0NA 2O8DA 2OGWA 1XRNA 2PG3A 1UBOS 2Y1KA 4MPTA 1SG6A 2GCPA 3VH1A 3D2AA 4ZD6A 5B1DA 4EYSA 2P7HA 3P45A 1E1QA 1KC3A 4MUNA 1CR4A 1U0RA 3L5KA 5CFMA 5CPBA 4E5YA 1DJLA 1PJ4A 2C2MA 3F6RA 1HTBA 3QBJA 2CUZA 1DZIA 4H9GA 4W7SA 2FG6C 4IIGA 1N6OA 3TBHA 5JARA 1NN5A 1WCXA 5E6SA 1E8NA 4JSRA 4HYQA 5CB4F 3X44A 3R1IA 1C7FA 4IIDA 4TSFA 4RL4A 1MO6A 4ENSA 5M2QA 1VG9B 1R3DA 4DLVA 2Z4RA 3CEHA 1J7JA 2RHBA 3D3WB 3H1EA 4JX9A 2JFYA 3KUXA 3NKVA 4QTYA 3AOEC 4D1YA 4HDQB 3MWEB 5J47A 1ZSNA 3PEUA 1Z7GA 3AU9A 4WJZA 4WOPA 3KU4A 3I8OA 2G9RA 4IKPA 1OW3B 2GGSA 3KQMA 5AM1A 2VF4X 4RF2A 4PLGA 5E6UB 1EFPB 1NYTA 1N9KA 4FEYA 1E94E 1UKEA 1Z4NA 5KNBA 1T9ZA 1NF8A 2VF8A 5FBVB 1E8DA 1U1DA 2B69A 4W99A 1F5SA 1QFZA 5IHPA 1QNFA 1BN6A 1AF7A 4YJ2A 1K4KA 1G59A 1CUVA 1GZ4A 1A8QA 1ZXBA 1XRLA 4L8WB 3KOYA 4MHSA 3OECA 4YQZA 3WLSA 1V1MB 1V4NA 2GWRA 4RM2A 5AUNB 1NUPA 3GYGA 4UW9A 1V5EA 3NNDA 1Z4MA 4ZO7A 3BHIA 3K8OE 1T15A 1THTA 2PFGA 2C58A 3CRVA 3GDFA 3LRTA 3KL4A 4O1HA 4QBHA 4ZYYA 4K6OA 4DRYA 2CV2A 4KI0A 3TR0A 1P9RA 4W9MC 5CAEB 1BROA 3NH9A 5DCLA 2XXAB 2VP4A 4LG1A 1YC2A 1LLDA 1AS2A 1P2VA 3NCHA 4P3PA 3UOGA 3CNEA 4D4JA 2XRFA 4XUEA 4GMXA 4H16A 3Q0IA 1CR6A 3OIYA 4HNUA 3S2ZA 4ZVUA 3D8BA 4B2IA 4I4TF 5ER9A 2C3YA 3IBGA 5JXHA 1QR6A 3V8EA 4QD3A 1QYXA 2PR7A 3T3GA 4YUWA 1BHO1 1FJHA 1SHLA 3QIVA 2XI4A 3SE0A 2LZ0A 1QP0A 5ENVA 3DBHB 1Y48E 4TT3A 1ZWLA 4OAOA 3IVMA 1ONNA 2VJNA 3I04M 2DQSA 4WX2B 5LVAA 5L51A 3P4UA 2QUJA 4L8YA 1B16A 2R1UA 3TPZA 4TYNA 5JS6A 1QCCA 2CJYA 2FHSA 3MYRA 4LISA 5EXPA 5MF6A 1M6HA 3CLVA 4WLEA 3D0KA 1GVNB 2O5VA 5C7LO 2WWWA 4C0SA 4QM7A 2WABA 4M0KA 1T9AA 1H3EA 3FCYA 1ZUD1 2VNJA 3CA8A 2XUJA 3WG9A 1IATA 4UM5A 3ZCQA 3PNVA 4G0OA 2HL6A 2ACVA 3R6GA 4BFYA 3UV7A 1N6KA 1REQA 4BGDA 1SUIA 1KDTA 3EMVA 2OKCA 2B4KA 3DXXA 1E61A 2V5VA 3H16A 2QZ9A 2WHRA 1UZAA 1EFDN 4O02B 3K6SA 2FZ4A 2VEOA 3ZGVA 5KWEA 2HOQA 3OEHD 2J45A 2NGRA 1QOPB 2P8SA 2QP4A 3AF3A 3P19A 2JI7A 4J29A 4YRJA 3ZUGA 5A6VA 5BYAA 1I13A 3UKOA 3V5NA 4PLHA 3VR6D 1BMDA 1J23A 5JC8A 3GZ4A 3G2KA 3QLUA 4FHGA 1NF2A 4LJKA 3FW1A 2G80A 1QE0A 3CV3A 3QKWA 4QBGB 3T54A 3AEQA 3F8TA 2PSFA 1I7PA 5E0KB 3EE6A 3NWEA 2XVYA 1R0WA 3QVUA 2G28A 2ZI7A 4OUKX 4UJ5A 3SVTA 1PGQA 4E33A 3LLMA 3QUSA 1JAZA 2FOIA 2R96A 3IDFA 4R69A 1P3DA 1QH8B 3PSAA 2VIIA 1J9ZA 1K68A 2ERXA 2PTHA 2XYRA 4EG0A 4RTMA 3SJUA 2BFEA 3GLKA 1CY8A 221PA 1WDTA 2IE8A 2JCSA 4MX8A 5KNLA 4TV8B 3M3PA 3FCSB 3STVA 5K3OA 1Y5NA 1DC5A 1U6KA 1QIHA 1ZISA 3V8PA 3DV9A 4XYGA 5KYWB 4IKOA 4QYWA 4PLCA 5THQA 4AY2A 4DLBA 3C3DA 4J43A 4Y98A 2JIZD 1VLLA 1SCAA 3T9BA 5BMOA 5DHRA 5H70A 4E12A 5ED0A 4HTFB 3ZXIA 4LWOA 5JSFA 3JRXA 4G4SP 1UFQA 3RVJA 3ZHTA 1ECLA 4CZ2A 4JNCA 5SY9A 2W37A 3DHEA 3FMGA 1BE6A 4RV4A 2I33A 4NWIA 2J46A 1IIBA 2CSUA 3CVOA 2WMDA 3UH1A 3ZDZB 1DOZA 4HH4A 4HUQB 5JDIA 1Y0BA 3W8RA 1U0EA 4AUMA 5CDSA 3TLBA 3SQDA 3VNVA 3OWXA 2FWJA 2FX5A 4KRXA 2GSWA 4EGQA 1SCUA 1YZYA 1WKCA 4ARAA 4AZSA 2B1JA 4Y9RA 1Q77A 1P81A 2A7XA 1H4VB 2QYTA 3K32A 2HA0A 1MQAA 1ORRA 1X70A 1L7NA 1KJ8A 1K4MA 1SUPA 2R6CA 2HDOA 1MA0A 1VJ5A 2VH2A 3FFTA 3LP6A 4CM1A 5J2TA 3Q8LA 4LV6A 1NBMD 4RY2A 2P9EA 2YNMA 3EVGA 1G9TA 3P1JA 5LZ4A 2ZSHA 4X0EA 3OEYA 3GAFA 2AZDA 4AG3A 4QIHA 2XAUA 3NHLA 2GN8A 2IHTA 1FYVA 2PUVA 3G6KA 3PVSA 4G5OA 4LV5B 5EN4A 4UEWA 4X20B 4XEHA 4WBNB 1T2EA 1XCGB 1GKKA 2CJPA 3Q12A 4ZARA 3LUBA 3AIIA 1IWPB 5CVEA 4NYMQ 5C4MA 1MOPA 2FX2A 5AK5A 4M60A 3CPJB 2H29A 4KC0A 3JQ7B 3R24A 6REQA 3OZSA 1YRLA 2B20A 2H17A 1NVDA 3AP3A 2XOEA 1CW2B 4UASA 5TQJA 5JNWA 4AKSA 3I62A 3DDZX 2VTKA 2CGEA 3N70A 3KJGA 1XWWA 2C96A 2OHVA 2PPVA 2QPOA 3GUUA 2FUG6 2PXAA 1BS9A 3NATA 4KN9S 4MR8B 4N8DA 3DD5A 3JAWA 4FTWA 3I05A 3E3OA 4QZVA 1PR2A 1N0IA 2VOEA 3BFPA 4LYGA 3KVVA 1KZ7B 2RH4A 2QN1A 3OZDA 4MULA 2FEAA 5FQOA 1ULUA 3WB2A 1GNTA 3ZUPA 4CKCA 2PD3A 4DR6B 4IWYA 3BGWA 1Q95A 4RIIA 3HJCA 1NTOA 3PEVA 4Z0PA 2WD8A 5ALQA 4L9RA 3SX0A 2VZLA 5FOVA 5I3CA 3G0GA 1GZ3A 5KVAA 1E9SA 4XYMA 3R9WA 1NW7A 2O2ZA 3RWOA 1CUJA 4Q1BA 4CIDA 3K96A 5CDFA 1VJGA 4IQGA 5SYAA 3BTSA 1ZN2A 1DKMA 2OV3A 1PYOA 5DWQA 1GUFA 2P69A 2RGNA 2X8LA 1AS3A 2DU8A 1Q0PA 1YQWA 2VWQA 4ZU1X 3ZZ0A 1COZA 1QIIA 2ASEA 3JQ9C 3PR2B 1M83A 4NZ9A 4KXVA 1DT3A 2J59A 3DNMA 1YVPA 2EYUA 3M6FA 2WIFA 3B82A 5GGYA 1M34B 4U7DA 5EKXA 3L4EA 3CLRC 2NWQA 3X3HA 4BGIA 1AV7A 1SC9A 1XWIA 1KYWA 3EGXB 4WXHA 5L6MB 5CCDA 3PYMA 1V48A 3E9CA 4BJHB 4TXJA 2PLAA 3EGWA 3N7AA 2B8WA 1UMCB 3LP5A 2Z8YA 4G07A 4Y6PA 1N9ZA 4KE8A 1ZCFA 5I7EA 5TS3A 3CU5A 1WZNA 2X5KO 2GA8A 3EVDA 4UXIA 5ADVA 3HVRA 2I3DA 4YDHB 2FU5C 4GXNA 3NYIA 1BNCA 4A6PA 3W78A 3LBHA 3KLMX 3CIOA 3R7WA 3HJHA 3UPDA 5FUQA 3ZHRA 3C48A 1NWHA 3A9RA 4KBGA 3L1VA 2HWUA 3ACCA 4S0XA 2G67A 3D6TB 3KYIB 1N7GA 4ZAGA 3O75A 2Q5OA 4ROSA 5LOVA 3NHFA 1V45E 1LRJA 3H5NA 4D4IA 5HTOA 1VIVA 2D2VA 5KUTA 3ZV7A 1SQ5A 3PWKA 2WP0A 1SVWA 3Q7RA 4JS0A 5EMJA 3OPQA 4YP9A 5BSVA 3ZCPA 5GOZA 4ZYTA 3M7IA 3IVCA 1GU0A 3CQ9A 4FOLA 2DPLA 1CQJA 4I9FA 1JWBB 4EUKA 5AOBA 1KY3A 1GSAA 1Z83A 2GDZA 3ZJYA 3PUJA 1PL6A 1JEEA 1HFJA 4P4GA 3RYFB 2QHXA 3IOEA 2ZCUA 4DARA 1NVAA 2ZBGA 3BF7A 1ZD1A 1IJBA 1YJCA 3NHKA 2XNJA 4GR9A 3DO8A 5LD2C 1M73E 1MLDA 3SFTA 1FVOA 3TLCA 3WWEA 2VBGA 4UPEA 1TC1A 3I2IA 4JI2B 2FEWB 4QXMA 5FORA 1KARA 1A8PA 1U7OA 2BJVA 2VUIB 3O4JA 4INAA 3VTAA 2QG9A 4DNQA 3KOXA 4MVJM 1P39A 3JVEA 4QDZA 3WNZA 1RD4A 1JH8A 2WJAA 2HJ9A 1NUHA 3A4LA 3EA0A 3QNWA 1DQPA 4GI2A 1T43A 4WKGA 4M6WA 4RXMA 5LQSA 4B4DA 2LBPA 2FUCA 3V00A 1GNLA 4JQSA 4WH0A 3KWLA 4P84A 1UBCA 2PS0A 1I1OA 3KSDO 3M9WA 4HQRA 3G8BA 4KQ9A 5AUOB 2NUBA 1A7JA 1H1LA 3SDZA 3R3YA 4ZJZA 2BGJA 2ZRCA 3BL6A 3DEHA 5ALOA 3QFTA 4C5BA 5BSTA 1FX0B 1S8AA 1NI5A 1ECBA 2VHXA 1NOJA 2AV6A 3JZIA 4URXR 3D5QA 4LZWA 1EP9A 4JI1B 1MIHA 3PIDA 4K9DA 4DUGA 2DWOA 4CEJA 4H59A 5JYEA 3THRA 4TVKA 3VVBA 1E99A 4WA7A 5HVNA 3OJ0A 1M2WA 3F3YA 4URUR 4HB3A 2M6RA 2O9JA 2VH5R 5KX5F 3ZI4A 1V9CA 1KAQA 1H85A 3GA5A 4TWRA 5A2QA 4BMSA 1RKXA 4CF6A 3FPBA 5F1PA 5HW0A 5DN9A 1W2WB 1THGA 1ZK4A 1JBEA 1CEXA 1QK5A 3L46A 4H15A 4QDOA 5KTNA 4JAVC 2Q6VA 1DG3A 2X14A 4RBNA 5GJVC 3AINA 1QS0B 3BMNA 3EWIA 5EEHA 4CV0A 2HEIA 1ZINA 1PDVA 1T4BA 2I2CA 3C3EA 4FCCA 3S7TA 4NICA 2XUIA 1E2JA 5PGMA 4IS3A 5SYMA 1VPVA 4F5WA 2DZDA 2ZB4A 5FXMA 1O6FA 1F8YA 1WXEA 3PFCA 1A8SA 3DGFC 1UBRS 2Y6VA 3EXEB 5F3DA 4GYWA 3V7FA 5KTYA 1G8JA 4KXQA 1IN6A 4YAUA 4MUGA 2QY6A 2X40A 4L9SA 3WQBA 2DAPA 4AJEA 4AKIA 4YJ3F 4A92A 4EDFA 2ZULA 1J8DA 1X92A 3JU3A 3FIUA 1CUIA 3QFCA 2PLFA 4IDEA 4GOKA 3NOQA 3OZUA 2JGNA 3QH4A 3ETJA 2IU0A 4EGAA 1BGVA 3NIBA 3RAFC 3AKDA 4M1WA 2CDRA 5CG1A 4Y2VA 3M6UA 2F1OA 2F43B 1Z75A 1RQNA 1ESMA 1FFDA 1L5WA 4P22A 2FDXA 2J3KA 4IDAA 5C8VA 4PNPA 2KMLA 2QPLA 3L0SA 3RS8A 1E62A 2R7NA 4DUZB 2ZI6A 5H16A 1MT0A 2V7BA 1AX9A 2IITA 3OPNA 4ENRA 3AI3A 3C74A 3QBVA 2PT5A 4J9VA 2DULA 4KN8A 4BFSA 4LC1A 3R8XA 2FR1A 5CFOA 1I3CA 4M9SA 2P2LA 2GEKA 2VBCA 1TM3E 4WKBA 1IZ9A 4V0OA 4FQ8A 1SD5A 2JFUA 3EZGA 4V02A 1PZHA 3JZMA 2FN8A 2YS7A 1KJQA 1D8TA 4NULA 2WNSA 5ICFA 4BEBA 5AOAA 1Y6ZA 3KKQA 4DMLA 3R3WA 4Q3KA 4OQYA 1N7JA 2GH1A 1FZQA 2X7HA 4FEAA 5FLKA 4UTOA 4F4HA 3MRVA 4CODB 3FTNA 2WJPA 1K2VN 4A2WA 2BJWA 3R77A 5IT4A 4PQEA 4MRVA 3WLHA 1N5KA 5ED4A 3QHAA 1ETUA 1GDDA 3PGXA 3UGTA 4J6FA 2WWHA 3AERA 5HF8A 4B34A 1W88B 1MO5A 4DT1B 1YZHA 1NRIA 1NHWA 2Q62A 4RJTA 1SVKA 1RXUA 3E7FA 1IXYA 1VDMA 1I6LA 4J0CA 5HBGA 2A92A 4YAFA 4B7UA 1LA2A 1QG0A 4N40A 2F55A 2GYVA 4ENPA 2Q8PA 2A94A 4ZVRA 2C8LA 3F5MA 1X7ZB 1OGJA 2FW9A 4YDSA 3K1AA 4NV1A 1GZUA 2Y2UA 3CUSA 3OF2A 1P4RA 4P53A 3E48A 2WQ7A 5L40A 3QSYA 1HTWA 5BUCA 2YVLA 1Y34E 2ZB3A 4FMPA 2DRIA 4Q9HA 4N82A 4ZVMA 2RJNA 1K08A 3C70A 5C52B 2NYAA 5I48A 4KRGA 4I6GA 1LKZA 1QH1A 4JYCA 4Z99A 4A16A 2EZTA 4KFRA 2VT7A 2H8GA 1EM6A 1HMPA 3EUWA 4GMGA 1RSZA 3PFWO 4LY9A 3UO8B 4ZQCB 3VU1A 4HDAA 4U9UA 3VV2A 2Q50A 4QC2A 3H5VA 3MTIA 1Q2XA 2RJOA 2XMGA 3BMCB 3TIVA 1D2EA 2CLOB 2AZ4A 1PGOA 3QX3A 4V0QA 2WAYA 3B6JA 3R5SA 3WGTA 3PXGA 3D9QX 4E3ZA 3FWNA 3K4HA 3EVAA 2PEYA 3KLNA 3E9QA 2GBPA 3E4DA 3L07A 1MN6A 1XYYA 2JFFA 4MGHA 1IMJA 1EXDA 4ZQIA 3GJSA 2HJSA 1CPYA 1UJ6A 2KI5A 2YZNA 1CJVC 4DAOA 4Y18A 1SHUX 2IP2A 4NBLA 1RP7A 5HS4A 3DXZA 3G7SA 1B76A 3AWDA 2PFKA 5KWVA 4U6SA 4EA6A 3CNQS 3ZWNA 5EIBD 3K9FC 1CNFA 3ZV5A 2GZAA 4KQJA 2UUAB 1YKSA 2HZBA 3N6RA 2JW5A 1RLTA 2PWYA 2OXFA 3GEBA 5FEMA 5KJEA 2YN4A 3S8EA 3K0CA 1CFZA 1WDLA 5E7MA 2EX1A 4MJXA 4EUNA 2O52A 3LFTA 4IIBA 5G0TA 2ZYRA 3G2QA 3M1YA 4G23A 5E1BA 4GMFA 4KFSA 4XW2A 4R2KA 5TC4A 1DOAA 4Q3BA 1M75A 3RB8A 4ZV4A 2LIPA 3SXPA 1TM2A 3SG0A 3CRQA 3T7RA 3FDJA 1GGFA 2XMCA 4M9UA 1JKXA 1EJBA 3L6RA 2I5PO 1W8IA 3OTIA 4ZKEA 1BDHA 5KS2A 2PUEA 3UATA 4QFCA 2YFQA 2VCHA 3EEBA 2N1BA 1TPZA 1GY8A 2J30A 2OHIA 1LU9A 4Y6LA 1GL7A 2AE1A 5WRFA 2P35A 1YS1X 1NGSA 4NBVA 1TJNA 1VLJA 1PJ3A 4NZOA 3MGKA 5FI5A 5DTMA 3QVXA 5D6NA 1RC0A 2JFVA 3GLTA 4YJHB 2WV9A 2IZZA 5FUMA 1RJ9A 2MYPA 2CLKB 4UZFA 3URMA 3UV3A 1DEXA 4JZYA 4RJJA 2Q1UA 1Z2OX 4H7HA 4DXAA 1JDBB 1F2TB 1DBSA 1XPJA 2HHAA 2N75A 2WFLA 2WYOA 4OMDA 5F7JA 5ADHA 1VIAA 3PJFA 2WWGA 3R0ZA 4OHPA 1T34A 3GBVA 4O2AB 4ZVTA 4BLTA 5I9MA 1TQ6A 3ZPXA 4LPSA 3FAZA 1TQ2A 5G0WA 1VJDA 1XEXA 2QRHA 2D74A 1E9EA 2Q2NA 3NUQA 3Q41A 1DNPA 5AW5A 4ZCQA 3C16C 1ZRNA 2BHLA 2F90A 1BIFA 5LLSA 3ELWA 5CEFA 4BP3A 4GMHA 4XZ3A 1G7CA 2F1KA 3QVTA 1J07A 1T5IA 3N8DA 1E5QA 3IVRA 4E3WA 1RWWA 4H31A 4WA8A 5IG2A 1JDZA 2QR5A 2VT6A 4WBXC 3MJHA 1KQFA 3ND9A 4RV9A 3U1TA 5B1EA 1V8OA 4BGUA 1QCYA 4ER5A 3ASZA 3K6RA 5KB3A 2O0KA 2R7AA 2EYQA 4G97A 2JFOA 2PVPA 3T7IA 4MW5A 4DMHA 1W36C 1OROA 3HDGA 1DGQA 1VL6A 3R7SA 4D43A 4DNOA 3ROFA 5CH5A 4Z9YA 1QWSA 5DH9A 1VM6A 2JLCA 3D64A 5F73A 4MUXA 1Z0SA 1JKJA 1FQOA 1GTJ1 2CL0X 2CLCX 3SHFA 3FTFA 1MEOA 5EAIA 1YDEA 2Z1NA 2HC9A 5EE9A 3VH3A 4X1IB 2ZSFA 5A0FA 3ZEAA 1WY7A 2C4WA 1KEEA 4PLYA 1RYFA 2CVFA 4M22A 4FFDA 5BV1A 1F06A 2WD7A 3F71A 1RRKA 4C4TA 2PNJA 4NMHA 4GVXA 3UZUA 4JUAA 1NQUA 5JW6A 3CH6A 5D01A 2XX3A 1J25A 3BSFA 3BA6A 1JQJC 1EK6A 3EG5A 3EZ6A 2XYHA 3SS9X 3IHWA 4EK9A 4AQYB 1RFGE 1LDYA 1CIJA 3MFQA 3N87A 2AXEA 2BRUA 4OXNA 5D85A 4M54A 3G89A 3PQEA 3MCAA 2V65A 2A1UB 1NRWA 2Z9DA 4QUKA 5DT2A 4GF5A 2I29A 3PF8A 4FE7A 4LRQA 1FSSA 5F76A 2EJWA 3WNQA 3DTNA 4NU8X 4NU5A 3WMFA 2P9JA 2XMBA 3EBLA 2NAFA 2KJQA 3FDZB 3FSEA 2H2IA 3HUFA 3QOWA 4P3NA 4TMZA 2JEYA 3ZH2A 5C81A 1Y1TA 3QLVA 4CLOB 4DCTA 1IE3A 1UDBA 4IFEA 4QO7A 1KH2A 1ORTA 1YFKA 2BCGY 3MRSA 2VSQA 1QX3A 4QREA 5EP4A 3SOZA 3THSA 1DOHA 4AY5A 2VK8A 4XIFA 4LBZA 2GN9A 2IDKA 1VE5A 2NNLD 2WJ3A 3I9FA 4KXLA 2YYAA 4DHEA 3PRKE 1HX7A 4NLLA 4BO6A 5BNZA 1KK3A 4TS1A 2MINA 4P2BA 4CIXA 5F9HA 5CURA 1DWOA 4HRVA 1J97A 2HCJB 2HH9A 1M3SA 3L05A 4IIHA 3T4UA 1Y5IA 4WKOA 4E5NA 4RPHA 4UNRA 5IF3A 4M1ZA 2H57A 4MYDA 4H7KA 3L4JA 3UMRA 3W5AA 3LGAA 3O8OB 1FFHA 2L0XA 3I6QA 4ERXA 4F6LA 4RVOA 3K1JA 4IXNA 1JG3A 1IB6A 4PC6A 1LDMA 4QYMA 1QDEA 4CKZA 1W0CA 1YBHA 1RRVA 2DT5A 1W1UA 1T36B 3WYGA 4J9UE 4BWFB 1QBKC 4E32A 1W4LA 1PJAA 1E1QD 1P31A 1KZ4A 3F3MA 4C29A 5DLPA 2DJ5A 2G63A 4HQKA 1S0UA 3V1UA 2A9PA 1NV9A 2D2FA 3AKYA 1G9XA 5IZCA 5A71A 4CKEB 3C5WP 4Z4GA 2AYXA 4GOND 4J7XA 2BISA 3G82C 3GDWA 1PLKA 3V4FA 3C3XA 1XTJA 2X6RA 1L5MA 5AM5A 1OMOA 4KE6A 5IASA 4TSFD 5DHFA 3UWKA 4UE2A 1PUXA 2D59A 4C0JA 4LUCA 3LXMA 5DOZA 1NJGA 1P1KA 1D03A 4FFSA 4FMCF 5F1YA 4CU5A 4YIHA 5ENZA 4L50A 2YY5A 2OGSA 4J0GA 4BL5A 1E6LA 4JLAA 4RTSA 3PPYA 4M46A 2C92A 2C8VA 1UT8A 1DDOA 2AN4A 1U7TA 4OH7A 3G0BA 1CUWA 3KTAA 1UWCA 3DEIA 2XE8A 2VP3A 5ARDA 5B6JA 3ORHA 4RNDB 1GXSB 2PX6A 4UUBA 1KPIA 1OQAA 2HPAA 4KB5A 2IPMA 4BKRA 1FC0A 2GFIA 3IBTA 3OA2A 1CC1S 4BVEA 5KNBD 1ZH4A 2JD1A 1QSGA 4O4LB 5B6IA 8GPBA 4BECA 4BV2A 3V1KA 1ISPA 4OXYA 5BVGA 4MPPA 1LVGA 3T7TA 4W8GA 3HK2A 2QD3A 2ZS8A 4CCYB 1N25A 1QNLA 4B3IA 1SHTX 1H6BA 2LVBA 3A9TA 4KQIA 2FWMX 4FBLA 3A3YA 2VPQA 3ICPA 3IRVA 3ZOZA 2DQYA 3RK0A 3O8BA 3IB6A 4UUPA 1GQRA 4GW3A 5TPWB 4Q48A 5DKFA 2ZRGA 3UT5A 3F90A 1Z63A 2X1HA 1E0DA 3DAHA 2IOYA 3E05A 4KXUA 4MI9A 4W9RA 1T9CA 5IYZF 2ENUA 1HRDA 2QW1A 3AF6A 1XROA 3EPLA 1ZNQO 4A6EA 5IUJC 4L76A 4OFWA 1AB5A 1XAHA 1VGQA 2OXTA 3TRKA 4DIFA 5LXTA 3W7AA 3TZCA 3LKBA 1NW4A 4NNOA 1KP3A 4X7BA 2A3RA 4N8SA 2HMWA 3HL0A 3F0TA 4BRZA 5C1DA 2R8EA 1V1MA 4Y9TA 1AGPA 3DAOA 5ALGA 5I9LA 1EGMB 1KFKB 1ZGZA 3E22B 1J1ZA 3ICWA 4MW7A 2P6RA 4JFRA 2BVNA 3I8XA 2BFDB 2B4YA 2PKRA 4TZTA 2ZBDA 3UG6A 2HIMA 4TT3D 4DWOA 4LJ6A 1TQ4A 2I55A 5DHAA 4GR5A 5HKBA 3IXLA 5K03A 1EJ6A 3SHQA 2QRZA 2YJGA 4DV4B 2QU8A 1VZ2A 2CLIB 1I1QB 3GG9A 4RABA 1QGYA 2HN9A 2HRCA 4BMDA 1Y82A 3KIPA 4D79A 3QLUC 2WSLA 3SM9A 3ZGOA 3B6EA 3G13A 3ZE8A 1ZJWA 1QQAA 5JVDF 1TTQB 4R8MA 4N48A 3QF4B 3T1TA 1U9CA 3DBHA 3U4QA 2W2LD 1HYEA 1SURA 1VKZA 3CF4A 1TM7E 1WEKA 2FFAA 2Q3MA 1JZSA 2XH8A 3J80A 1UJ2A 2RHJA 4WNIA 1GZSA 1R4NA 3DHYA 4EX6A 2CZCA 3H9QA 3SXUA 4OB8A 3DAFA 2ODQA 1MXHA 1Y9ZA 3GMDA 1HKUA 4MUAA 3TW6A 1Z13A 1T3GA 3IOMA 4JT4A 1ZWKA 3DZBA 1J1IA 4KFTA 1EWVA 3BWYA 4MIYA 5SV2A 3VUFA 5IDYA 4WXYB 1JLLB 3RYIB 3GT3A 1Z12A 2PWZA 1HDXA 1OPXA 4B6SA 4LXIA 1PDWA 4G1EB 1KFBB 4R1LA 3L6EA 3MG9A 5DGHA 4PW0A 4DVGA 3S2YA 2HF2A 1LX6A 3NYRA 4N5IX 3HRKA 4NBTA 4NONA 4RVGA 5EWLB 4C89A 1ZOSA 4IHJA 3RARA 2ZZNA 2B2NA 1J2TA 3M34A 4F06A 4JP3A 3Q0EA 3CHYA 2RHOA 1Q1QA 5KREA 1IVNA 4XVUA 3E53A 1N5IA 5B12A 1L2TA 3EFHA 3HSKA 1R0XA 2IHUA 2OD2A 4LTNA 4OATA 3W7BA 1NF3A 3U6BA 4X66B 2R11A 2AOTB 1OD6A 1KH1A 1OLUB 1RQLA 2GM3A 3H2BA 1CUHA 2F9MA 2QMOA 1M54A 2RC6A 3K8YA 3ZBUA 4AXBA 2QRNA 4MZXA 5FQNA 2VQFB 5KNBH 1NNI1 3P2MA 1L5NA 3UB2A 1AT1A 2E3JA 3WZMA 5C8YB 1ODFA 3TTYA 3D2CA 2VNHA 3B3JA 3IHLA 1MGPA 4TYMA 2ECOA 5CVDA 5U9CA 1IBMB 5DNVA 1IPEA 4LDRA 3ODGA 1FY2A 3S68A 3A1EA 3L0OA 4I6JA 5EP2A 2QE7A 1J8VA 1F8FA 1NZDA 5DN6A 3HLKA 3RJMA 1EKXA 1VYTA 3P9XA 4JFAA 1CCWA 1SBYA 3ZQJA 1CZHA 4BRUA 4JK3A 2PJZA 1QBGA 1W4BA 3R20A 3FHOA 4RQUA 1E4EB 4AIRA 1X19A 1EB9A 3JD3A 4AO6A 3LUGA 3LX8A 3MZ0A 4RHUA 3WMEA 3B2QA 2EW8A 4AKGA 1XALA 1YIDA 3IR5A 1Z4LA 2BMJA 4HK4A 5EJMA 3K71B 3NORA 3CH5A 1XDDA 4UEKA 3ORSA 1KQPA 3LFHA 1QB8A 3AUXA 4HTFA 3CX6A 5L9AA 2OXCA 4CLHA 1ZVMA 5TQ0A 1N34B 1W4ZA 1UBTS 2OHGA 1DJQA 3DL4A 4INOA 1CZNA 2GBLA 1SY7A 2R8XA 4DSNA 1BCRB 5K51A 2HTFA 4B2PA 1WTCA 4Y1RA 5BR8B 3QOYA 1P80A 4TLMB 4Z6KA 3JZAA 4JJKA 4O0LA 1WU7A 2YNMD 1X1BA 2PYZA 2DVMA 2NU8B 3WYDA 3EIQA 2O1XA 1A95A 3NTQA 4I55A 3WO1A 2O8NA 1S1MA 1UINA 1CUGA 2OO5A 4QICA 2OCBA 2V96A 4BNJA 3AVTA 1OFHA 1T1JA 2WB4A 1BOOA 1BJRE 3BQ9A 4HDKA 1WEHA 2EJVA 3AUKA 4ZT6A 3U3MA 1EINA 3V6MA 2FY8A 1HFWA 3ROMA 1NSTA 3LQKA 3PL5A 4TL6A 2LCQA 5CD1A 3OZBA 1NN1A 3GXBA 1CDDA 3K9WA 3JWPA 3HB0A 4GXQA 2R97A 4I8DA 4D56A 4DLXA 4S04A 2ZXFA 3A14A 2WDZA 2OL4A 2W4MA 3OF3A 4FYHA 5IUNC 3DO6A 1QYWA 3TLZA 1HE2A 1UBUS 3E7PA 4WBNA 1MQ9A 4X20A 3PQ5A 3OQNA 3ED1A 3ESYA 1TQHA 3SFZA 4E2WA 5KYKA 1OZGA 4ZIRB 4ITRC 2GBIA 1WL8A 4YLYA 3EOBI 3FI0A 1MVNA 1W52X 3ZCUA 4L0QA 1ESCA 1QORA 3A1TA 5CFRA 2V4ZA 3DFKA 1GR0A 2OV1A 3O0TA 4RM3A 4JT9A 4CKWB 1R8XA 1U0FA 3BGIA 4D8WA 1GQQA 2LR0A 1B73A 3H0KA 3F74A 3EDRA 1DIAA 4C2BA 4FSHA 1B6GA 2GS9A 2ODTX 5HFNA 1OB5A 3AVYA 4E51A 3SHVA 4UTNA 2NTEA 5EZ6B 4PR3A 4R1OA 1UT5A 3EAFA 2PRKA 3KZ1E 1A9XB 3OBBA 3OIVA 1QVZA 2IPNA 4YYEA 2ZWAA 5B1SA 4B74A 4YCMA 3VDNB 3PQFA 2PSJA 3CF0A 5F3RA 5H80A 4C3UA 4KIUA 1RJDA 2ICAA 5I47A 5IDXA 2G4CA 4WJLA 1K0UA 1H4TA 3PA8A 2HNBA 3UMJA 5IFLA 1RYNA 4I9HA 1KI1A 4Y2UA 1ZLXA 1BVHA 4PC1A 4TV9B 1BE8A 3I64A 5ICMA 4E2YA 1RW4A 4K6HA 1DQZA 4IIJA 3ST7A 5C4GB 2B25A 4P4TA 1G0OA 3H5LA 2Q7OE 1BDBA 3KVYA 3R7DA 5AOVA 1PW7A 2NUPB 4BQIA 5B5SA 4CEIA 2ZJ6A 2A7QA 1EAYA 2AMVA 2JI9A 5AHRA 1X7DA 2OGZA 2B8JA 3JRWA 3FGPA 2W5UA 3OG9A 4QPNA 4RA9B 2YICA 3T5DA 3OOYA 2COKA 1HDGO 5GPBA 2JA2A 1RTKA 1RHMA 2RHCA 4HOYA 3RCBA 3L8FA 2YWBA 3B36A 4E70A 2CLFB 4XOIA 1L5FA 3WIUA 2XQVA 3K8QA 4HXFB 4BP1A 1EUCA 4HATA 1YWGO 3SQWA 4Q9IA 5AXCA 2H0RA 1KS9A 2HIAA 1CIVA 1TJ3A 2W93A 3FZQA 1F17A 4P6VF 4DQKA 3L8MA 4H3KB 3IAUA 4HDRB 4RCYA 5DW0A 3RTGA 2QRKA 4TQ9A 3RNLA 4E6PA 5ALKA 2GXAA 2FJ0A 1U2GA 1QP4A 1INLA 1NMEA 3LLCA 2FTKE 4QFDA 4OXXA 2AQ8A 1L7AA 2B5WA 4A8JC 3SVLA 3JQFA 1BMQA 3SJBA 3EGDB 2PS9A 4LQCA 1NLFA 1SOWA 2XA9A 2HCFA 3BL8A 2BGNA 2JCBA 4EITA 1XKQA 7YASA 3C7KA 3GLHB 1ONSA 1P18A 3L43A 1OXMA 3M5CA 5KNCH 2QP3A 3U80A 1PT9A 1RACA 5G40A 2JA1A 3C39A 1EBUA 4KFUA 3FMFA 2JDIA 2BFCA 2W7TA 3L1IA 4KL8S 3AF1A 1UR5A 1MPTA 4KPUB 4M49A 3ZDQA 2PZMA 1ENZA 1UMBA 2GK7A 4LRWA 4EUHA 4S1TA 3KXLA 1W25A 2BTQB 1JXOA 4BU0A 4DLAA 1A50B 4UPVA 2L42A 1DP4A 1VPDA 2I6QA 4XCXA 5JDCA 1N36B 1T26A 2F6RA 1QKKA 4JLBA 4HNRA 4F38A 5JASA 2APJA 2J6HA 4N3NA 5L45A 5A4IS 3N07A 1UMDA 2QE6A 4ZJYA 2GKSA 4PVDA 2Q46A 4H08A 1JA9A 1JT9A 5ERGB 4GLFA 3KQYA 1SBZA 1YDWA 1GGEA 1ZU5A 4TXHA 4AZ0A 1PGJA 1F7VA 3C24A 1CU1A 3AI1A 4IDCA 3C85A 4TOIA 1EBFA 3SIRA 2JZOA 3DMNA 2C59A 3NV7A 4X1YA 5C8ZA 1TTTA 1PJ8A 2QSUA 3SIWA 1S2NA 4HPXB 4BX0A 3EEOA 3NYQA 2BEWA 3DLAA 2NLOA 5KSZA 1RZUA 3C15C 3UMVA 1CHDA 4DUGD 1EVQA 3INNA 2EWWA 3FYUC 5KU7A 1PDOA 3K94A 3M1LA 4HAUA 5DNEA 1S9HA 4RTPA 1YQEA 1ENOA 1FMJA 4Q4JA 4ZTBA 4ENUA 2HU7A 4N6NA 1ODIA 3QPUA 2DY0A 4ZOLA 3VDRA 4NZNA 3TAHA 1XTPA 2I7TA 1MC8A 1UC4B 3OJEA 2AF4C 1G5RA 4GE0A 1LW7A 4IDQA 2V5UA 4O25A 4QATA 2OAGA 4WY5A 3U4DA 7ABPA 4D44A 3ZLTA 3DHNA 1FX0A 1FDTA 1BU8A 2VHCA 3SOPA 2QM7A 1OCEA 1Q1NA 5J2TF 2IHZA 5L3RA 3T94A 3ZWBA 3GX1A 1GCOA 4REOA 1R9GA 1JHUA 4X95A 2G6TA 2PX3A 1C41A 4WLNA 3UA4A 4X8HA 4X24A 2CFOA 2OTCA 3DEKA 4WGFA 3A6PC 3Q7IA 1ZYUA 1TRKA 4GWLA 4R1NA 1J0XO 1BEZA 3QI7A 2HPZA 2O3SA 3PNKA 4CJXA 3C41J 4DTIA 2R8ZA 1D6SA 5BOVA 3K0SA 1QS0A 2E18A 2PN1A 2BR3A 4QWWA 4G5FA 4OLFA 2WIGA 4OP2A 4Y1FA 4DCNA 5EHXA 3NHMA 3UPUA 4UHJA 2SKCA 3O8NA 4D9EA 1J42A 4UKDA 2XZPA 4OB6A 4UUQA 3T9DA 3Q98A 4F4JA 1EHIA 1QHNA 1RAEA 4UEQA 3K9NA 1H65A 2QQGA 4R41A 2VLIA 3A9UA 3F4LA 5K0NA 1HNXB 2OHOA 3P9QA 5DM60 2H54A 2WEKA 4B4UA 1B3BA 2Z4TA 3D0OA 4JGIA 2Y1CA 3ZWQA 3S1AB 5JI3E 1LXCA 1OTYA 1HYHA 1BSVA 2O2HA 3PQ7A 1VXOA 1RI4A 1JR3D 1VFPA 3KFVA 3PJDA 1CRPA 1P73A 2W6OA 1P0QA 4D0SA 4UXJA 2MU1A 2F43A 2PCLA 5FOSA 3HGMA 4DMFA 4CGYA 4E22A 2LKDA 1YASA 3LW7A 3E15A 3QLTA 4OMUA 4XJVA 4YP1A 2P40A 1SOVA 3SSMA 2JHAA 4HRYA 3TSCA 1AHPA 2P1ZA 4YWJA 4WBNF 4MP3A 2DSTA 1F12A 1JBQA 3JW8A 3PFGA 1S5PA 3SF8B 4MB2A 2FPUA 1A8IA 4C3VA 2I4RA 5HQ3A 4ZI7B 5GIOE 5DNDA 3AEUA 1E7QA 4HN4B 5DSZA 1HPLA 3AI7A 4JKYA 5JBNA 2WSYB 1HG0A 1LJ8A 2Q1YA 4KO8A 2I2BA 1PG5A 3C7AA 3N3AC 4X8MA 2EHJA 3OJLA 3UMYA 3I45A 4D9MA 3E9ZA 3JQEA 1KERA 5B1HA 2Y1DA 3ERCA 2HT1A 2BZGA 1N6RA 4P1ZA 3II6X 1FU4A 4AUNA 2Q5QA 2W0MA 3B1FA 4NYJR 1EM8A 1POXA 2F3SA 1X8XA 4HUJA 2XR1A 4G0PA 3QE9Y 2I78A 1SBNE 5IBPA 1DSSG 2BP7A 1IY9A 2H5LA 1CVRA 3IV6A 4DMKA 1S3FA 1U6IA 3BERA 4QYSA 3IVXA 3TSZA 1YF3A 3EVBA 4LZZA 4XQ9A 3HB4X 2FA9A 2P8JA 4KDRA 1PX2A 4DT1A 1JXAA 3INRA 3U39A 4RJKA 4WIAA 2GZRA 3B20A 1ZO8A 2JVJA 2EQBA 2IYWA 2RHGB 3N59A 5IWCA 4OQDA 2DPYA 4LIPD 4BOYA 2Q0XA 3QWIA 1Y89A 3L8GA<