4MAAA

The crystal structure of amino acid abc transporter substrate-binding protein from pseudomonas fluorescens pf-5
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
373
structure length
373
Chain Sequence
FAAEPFTFYGLKSMSGAFASYGKFADMGSRLAVEQYPTLLGRPLHYKVIDTEGNAGKAVRRVQEAIAQDGARFFQGCTLSSSALAVAKEVGKVGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETMVPLIKLLPEAKRWYTITPQYVFGEALLEGAKQVCAEHGIEHIGNSYHSLQEQEFSGYLTNAIAARPDVLVLLNFGSQSSNALRQAVNFGIKERMKVLLVWSAGLDQFQELGSDVLEGVYLGAQYWHQVDTPLNRELVKLTQAKYGINPTYPLAADYIGSKIILDTIAATGSFDGATVAKAMQGLTYQGPTGEESIRAGDHQVIKDYYLLVGKAAATMRDKDDLAEVLSAGRSFPDVSATGCAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Amino Acid ABC Transporter Substrate-binding Protein from Pseudomonas fluorescens Pf-5
rcsb
source organism Pseudomonas protegens
molecule tags Transport protein
molecule keywords Putative branched-chain amino acid ABC transporter, periplas
total genus 133
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA01
4PICA 1U8TA 3A0RB 3EQ2A 2ZWMA 3C6QA 4PE5B 1LJLA 2R25B 4G86A 4RY8A 1BAPA 3Q15C 1Z2DA 4LE0A 2F8TA 3BREA 4YRZA 2IPAB 3MA0A 1YS7A 1TMYA 3O74A 4LX8A 1BVHA 4RSMA 3Q41A 3H5OA 5FWYB 5JNWA 2JRLA 3H75A 4W5RA 3NHZA 2PUEA 4Z4GA 1CEYA 1Z17A 5EWMB 2VUIB 2PE5A 4KPYA 2IPLA 4NCAA 2MSLA 2OQRA 2JB9A 1NXXA 1DC7A 4FB4A 1QP0A 2AYZA 4IRXA 4KV7A 1Z25A 1D1QA 4N0QA 4NICA 1DG9A 2QV0A 4G0YA 5EWJA 1YMVA 3TO5A 3LFTA 1A04A 5HQJA 3OLYA 4RZSA 2WRZA 4YWHA 2J48A 2PLNA 2E4YA 2FEKA 3HO1A 1FFGA 5EWMA 5T3YA 4QPJC 3O2SB 1DJMA 2KYRA 2L18A 1USIA 1GCAA 3D02A 1RZRD 1M2FA 1NXTA 3LUDA 4JB0A 3OQNA 4N41A 1E2BA 4N0PA 1BA2A 1Z12A 1JFVA 1ZHHA 4LE1A 3QELB 1EWVA 4FE4A 5IUNC 1DBPA 4KK4A 5TQ0B 3RVSA 4RKRA 7ABPA 4W5OA 4MQEA 5E3JA 1LBIA 1SRRA 1VPWA 3CKMA 1OXBB 2X7XA 1ABFA 2JVJA 2IPNA 3HEBA 5I4CA 9ABPA 4TLMB 4KFCA 3JPYA 2E4ZA 2GBPA 3KLOA 4MYRA 1F51E 4MLCA 3OLVA 5C5CA 3MIZA 5FWYA 3HJFA 2JBAB 2H3HA 3K9CA 3GT7A 3O1JC 4Z4CA 2HPHA 4QYMA 5BR1A 4PZ0A 3SY8A 3M9XA 4EUKA 2W42A 4RK4A 4RWEA 4H3HB 4JB2A 4F8JA 1ZVVA 4ML3A 5JNRA 2NUBA 2E4VA 5BRJA 3KCNA 4EYOA 3C97A 1RNLA 3RVNA 3CU5A 3C3KA 4OTZA 1DC8A 1ZITA 5TPWA 3MYYA 3SQNA 4RK5A 1ZESA 1QNLA 5T7BA 4O5AA 1TVMA 2PUDA 4O1HA 2WJAA 3RVRA 1KMIY 3NBMA 1H9CA 1K66A 5IX8A 1GLGA 4Z4HA 3QLVA 5HKOA 3H1FA 4OBBA 3N0XA 2FQYA 2M98A 3S99A 3BRQA 2A9OA 1CHNA 4RV5A 1JDNA 2PL1A 4RS3A 3CG4A 5C5EA 1Z16A 2GI4A 1JL3A 1TM2A 1CYEA 3I5AA 3EQZA 3QELA 3NNSA 5IEJA 1EAYA 3OM1A 1VRVA 3TMYA 4WT7A 1JF8A 3QLUC 5EWLA 5TPWB 1W25A 4IGAA 3RQIA 2E4UA 1B00A 4RXTA 1FQWA 4LZLA 4WZZA 3HSYA 1ZY2A 1ABEA 2LPMA 4XASA 1C0EA 4OATA 1FFWA 1PNRA 4PEVA 3JPWA 4IF4A 3GA5A 3ROTA 2R4QA 2QSJA 3HDVA 3O2JA 1JH9A 3H5VA 4EYQA 3F7NA 4MS4B 1Z26A 3OQMA 4HYEA 5JNSA 2A9RA 2FVYA 4ETNA 4LE2A 4RKQA 5JNVA 3TD9A 1PNTA 5D2CA 2OENG 2QW1A 3IP6A 2NZUG 2B1JA 3QEMA 2LUOA 2HSGA 2RJOA 3A3KA 1BDJA 3IP5A 2GX6A 4ZMRA 1ISSA 3GWGA 4G0ZA 1JFTA 3RH0A 2LP4Y 4HNRA 2L17A 4EY3A 4G97A 1JX6A 3Q7RA 1C4WA 1VKRA 1JYFA 3O75A 1JHZA 1UDRA 2PL9A 3QLUA 4RDCA 1EHCA 1YK1A 1Z18A 1J56A 1ZH4A 2H0AA 2NT3A 4S04A 3OQOA 4NQRA 3IDOA 4XAQA 3H5WA 2PAFA 2MYNA 3ILHA 4ETMA 6CHYA 2PUFA 3TB6A 3O1IC 4Z4EA 1MVOA 3EGCA 1NXSA 3N0WA 3O21A 5KC9A 2JK1A 4Z99A 1FFSA 3URMA 1F4VA 1LJUA 4RU1A 5KQMA 3MM4A 1SD5A 3N75A 1OXKB 3OMXA 3HXMA 2IKSA 5IUKC 4RK6A 5BQ3A 1KRWA 4L85A 4IILA 3DLHA 4XLTA 1L5YA 1DCMA 3JVDA 1E6MA 2IDMA 3EDCA 3KYJB 1MB3A 3NHMA 4LDZA 4Q6BA 2F8SA 5TQ2B 1JBEA 4RK7A 4OLBA 3HUUA 3UUGA 1SXHA 3OM0A 1BDIA 3JS5A 5IEBA 3HV2A 3KYIB 4MQFA 4P1ZA 1RXEA 4TN5A 5GOTA 3RVJA 4EGSA 3H6HA 3CHYA 3KTOA 5TQ0A 3GV0A 3SAJA 2FN9A 1ZN2A 2HJ9A 2NT4A 3H5IA 3LKBA 4KQ9A 5CNIA 3A10A 5FWXA 1ISRA 5FBKA 2ZAYA 3OMWA 4E7PA 1VLZA 1PEYA 1URPA 4KVFA 5CNKA 2PUGA 1ZDMA 2ID9A 1NATA 3HS3A 1DBQA 1FSPA 2IYNA 4EVRA 3EODA 5TQ2A 1D2AA 3G1WA 4YGXB 4KMRA 2I6FA 2LIVA 2FLKA 2MSWA 1LK0A 3RVQA 1JFSA 5DCLA 3HM9A 2MSKA 2WY2D 1AB5A 4PYRA 1ZH2A 5F64A 2N9UA 3EJWA 3DLBA 1NY5A 2FMHA 4GPAA 1XHFA 2IPMA 4Z4FA 5DGCA 3LUHA 2RGYA 1DZ3A 2M1ZA 3W9SA 2VYCA 3BBLA 1U04A 4ZMSA 1DRJA 3EULA 4KREA 2AYXA 1BDHA 3T8YA 1NXVA 2FEWB 1U0SY 3GL9A 3BRSA 3KHTA 3LKVA 5JNTA 1E6KA 1JWLA 3CNBA 1I3CA 2GWRA 4YO7A 1MAVA 1NXOA 3QEMB 4MS3A 5ED4A 4MLDA 3K4HA 1D5WA 3B2NA 3O1HB 4JAVC 3MQ4A 4Q6WA 4G0PA 4WUTA 1YK0A 3SM9A 5TQJA 4QICA 3H6GA 1YMUA 5CHYA 4Y9TA 3Q7TA 3MF4A 2FXIA 3Q7SA 3P9YA 4MS1A 1QQBA 3QEKA 5JS1A 2JVKA 4P98A 4WXMA 5CNJA 2L19A 2JBAA 1QKKA 1PHRA 2FW0A 2BGGA 4NV3A 1JDPA 3C3MA 4UHJA 3D8UA 3EAFA 3LUAA 2QU7A 4MR7A 4F11A 4YV7A 4KRFA 3DGEC 3HZHA 1P6UA 2QZJA 4D6XA 4MR8A 2VUHB 2P9HA 4YS6A 1ZGGA 3JVIA 4G0XA 2IOYA 3FFWA 3G85A 4KZKA 3OO0A 1S8NA 2TMYA 3UKJA 3N6VA 1MB0A 2E4WA 1R8JA 5B3JC 4N76A 1JYEA 3M6MD 4DADA 3FFTA 5KQPA 3DZDA 3SNKA 3I45A 3OO1A 5DLEA 4RY9A 3Q9SA 1Z13A 3MMNA 3RVPA 5KC8A 4B09A 1XWWA 4NCBA 1Y1LA 3JY6A 3ILYA 4S05A 2V0NA 3OLZA 4LRQA 4M88A 4N03A 2PMCA 1E6LA 4MS3B 8ABPA 2CHEA 3HDGA 3QLTA 4TLLB 5KQGA 4TMYA 1KRXA 3LMKA 5DTEA 1DP4A 3L6UA 2QVGA 4RK0A 5HM6A 4OLAA 4G0QA 3GYBA 3QX9A 4EYGA 1KGSA 4D74A 4Z9BA 3T38A 5TE9A 3RVKA 5KWSA 1M5UA 1HEYA 4W5QA 3CTPA 3N0RA 2YHBA 3R0JA 2FEPA 2FSPA 4GNRA 4MRMA 1MIHA 1PEAA 3QX8A 5FBHA 1A0OA 4H3KB 3A0UA 3HCWA 1Z15A 5TPZD 3L49A 3CLKA 4IMJB 1K68A 2RDMA 4MGEA 4Z9AA 5GQSA 5ABPA 1LBHA 3IPCA 1NXPA 4YR7A 4KQCA 3T6KA 3LTEA 4MQFB 1P8AA 3OLXA 3ROFA 4XFKA 4WXEA 4CBVA 4L4UA 1NXWA 2FMIA 4Z4IA 3RVOA 2Q5CA 3CG0A 1TLFA 4FE7A 3HVRA 2PJUA 2FKAA 3KSMA 4YCSA 2PUAA 2WWVD 4MR8B 2JVIA 1EFAA 4XARA 2PKXA 3E3MA 1QPZA 4W5NA 3OLWA 1L5ZA 2CD7A 1M2EA 3QK7A 3GBPA 2HQOA 2QXYA 4JASB 1RZRA 4MS4A 4MR9B 4RXMA 3H1GA 2QR3A 1YTUA 3H5LA 1RXIA 4JP1A 4H60A 3DGFC 4YP9A 3CZCA 2XDYA 4Z0NA 5KI6A 2DRIA 3FGZA 4XXHA 4F06A 3FFXA 3LUJA 4KNYA 1GUBA 1ZGZA 2E4XA 4ETIA 1PUXA 2WMYA 1D1PA 2P4UA 3H5TA 3CZ5A 4MRMB 1D4ZA 2YHAA 3UK0A 3GBVA 4N47A 2A9PA 4Q7EA 2CHFA 3LUCA 3QLVC 3I09A 2PUBA 4MR9A 5IC5A 4D6YA 2B4AA 3IPAA 3VNBA 1YVUA 3F73A 3TX6A 1YS6A 3FDFA 4ZJPA 1GCGA 3CRNA 4KK3A 5IBQA 4IMIB 1EWTA 3DBIA 4OG2A 1GUDA 4ZYLA 6ABPA 3KJXA 2L2QA 5JS2A 1XHEA 3GRCA 4LDAA 2WB4A 3HK2A 1JLKA 3I42A 4EYKA 1A2OA 3H1EA 4HNQA 2ID7A 4RK1A 1W9HA 5BRAA 4MPTA 2VK2A 1U2QA 3N8IA 5KQLA 4O1IA 1USGA 4F12A 3HUTA 3IP9A 3NNNA 1ZAYA 1NTRA 3LOPA 2MYPA 3SG0A 3LUKA 3O2QB 4HNSA 4MAAA 4MQEB 3LUFA 1SXGA 3CFYA 4UHKA 1QP7A 1U2PA 4F3TA 2FQWA 2O20A 4WWHA 1T34A 2FLWA 3T95A 1EWKA 5JNUA 5B3JA 1IIBA 4RY0A 4G0OA 3M9WA 2MYUA 1AB6A 1M5TA 1DCKA 1SXIA 1DRKA 1USKA 3KLNA 3VNAA 1Z2EA 4G0MA 1DCFA 1RPJA 3C3WA 4JOQA 2LBPA 2FTKE 1QO0A 2QVCA 1QP4A 4RXUA 3RVMA 4EVSA 5HSGA 5EWLB 4JA2A 1QO0D 2FQXA 2NZVG 5PNTA 5FWXB 5IUJC 3LUGA 5DKFA 3F6CA 3CS3A 3KS9A 5EWJB 4DN6A 3NNDA 2A9QA 1DBWA 4MS1B 1P6QA 2R47A 1TJYA 1QMPA 1WETA 2WJWA 3JTEA 3F6PA 5IULC 2PUCA 4E7OA 1YIOA 1APBA 4ZPJA 3KKEA 2FMFA 2FMKA 2MYTA 3BILA 4MR7B 3IP7A 4EVQA 4YLEA 3RVLA 3KG2A 2R48A 4DQDA 2HQBA 3FMVA 1QQAA 5TPZA 2CWDA 4W5TA 4QYWA 3N53A 2HQRA 2FN8A 2RJNA 2GKGA 1P2FA 2JCGA 3E61A 5CNMA
chains in the Genus database with same CATH superfamily
2XVZA 4PICA 3E3OA 4D3FA 1LRLA 1R5NA 3BK2A 4QUKA 4OB8A 1C2YA 4Z2AA 1H93A 3RV3A 4BJ5A 3ZV7A 1XD9A 4YRZA 4DLBA 4N0MA 3R5HA 2IEBA 1RLMA 4HTFB 1JAYA 3EQ6A 5FWYB 4E5NA 1RAGA 2ACVA 1RXCA 1RCFA 4L6IA 4FFWA 1JQAA 1R4AA 5GM1A 4X64B 1SU4A 3K0FB 3NOQA 1PR1A 4IDEA 1O6ZA 2IUEA 5HFAA 4KP7A 4C06A 4B1FA 2WG2A 2GUWA 3OEEA 3IHLA 1IDOA 1Y9JA 4ARSA 2ET6A 3WBFA 2DHEA 1FFCA 2RKOA 3FGPA 2HLHA 3GEGA 1R9JA 4FMCB 3TB4A 4ZDIA 1KDPA 4F4HA 1XWIA 3JAKA 4QTZA 5HS6A 3L79A 1QH8A 1EIZA 4DM7A 1WZEA 1KPGA 1PSWA 2IT1A 1LV7A 1X7DA 4OHPA 4FS8A 3OLYA 3L4BC 1SR8A 4C04A 2WJ4A 1IN4A 1UK7A 2DZDA 4PZEA 3BXXA 1YU6A 4L02A 2IODA 2XR1A 4GKVA 2QZPA 3O2SB 4BX9A 4C78A 1WHSA 1QB8A 1O2DA 5G1OA 1OIWA 2P3QA 2XKAA 3GH3A 4D9FA 2I33A 3WLQA 4TUYB 4DL9A 1KSJA 4LE1A 2XT0A 1RQLA 2DFVA 2NXCA 4RPJA 2RHBA 4WA8A 4HN2A 4HH1A 4CV2A 3D3WA 4MUYA 4DC1A 1ZRNA 2IA5A 2X7XA 3TXYA 1ADYA 3RRYA 2A78A 2QUZA 3MWYW 3R3ZA 3A36A 2YWJA 1X1RA 2QI9C 1MJGM 3D2AA 1EESA 5D3MB 3DCJA 1GPAA 5MDHA 3QXGA 2DTEA 1E2MA 3SX2A 2DHRA 4AS3A 4LNUA 3AW9A 2R6ZA 4KB5A 4B4DA 4EF5A 2IEGA 4F6RA 1H6CA 4IYJA 5L9AA 4EUFA 2W6ID 3WFIA 4FCCA 4POAA 4F0JA 5CLHA 1FYVA 2BZSA 4P7KA 2ZM5A 3B9BA 5KPDA 4TT3D 1JLLB 1IJFA 4MW2A 2O2IA 3HJNA 2JIZD 2DT5A 1UT6A 3GF4A 4XVHA 4IDNA 4EB0A 4RK5A 3PSHA 1F2TA 4MP3A 2QENA 2WJAA 1XF1A 3B3JA 4MIOA 4X1KB 1TXGA 4DCOA 4YT4A 2QKYA 4CCYB 3G9XA 5DOVA 3LL7A 4ZVPA 3DZKA 1TIKA 4BP9A 2UZ4A 2EFCB 3FMGA 4MV9A 2ZK7A 1K7YA 5ICSA 1V16B 4PO8A 4TLEA 1VCHA 1K4KA 3JQAA 3S68A 1JBQA 3UVEA 2XCOA 2AC7A 4L0CA 5EWLA 4NAUA 1P7PA 2ZRHA 3RK1A 2YV3A 3RKSA 1C0EA 2ZU0C 3CH4B 3LQFA 1IM5A 1FFWA 4WL0A 7YASA 1DC5A 4Q66C 1JG3A 5ALWA 4F60A 4DV1B 5A02A 2GS9A 1I7LA 3AR5A 2R4QA 3O2JA 1VJGA 2F6RA 4UW9A 1PNVA 4ZO6A 3HGTA 4BMXA 2IV2X 1JH9A 3Q8XB 3S2IA 3QIVA 4WNAA 1MABA 1EYZA 1UT8A 3AXTA 3DFKA 4RIFA 3ZLJA 2E49A 2REOA 2A5GA 3ES9A 3UFXA 2OENG 1ADCA 5JMTA 1UBKS 1F2UB 1EDEA 1L4GA 2CL6X 3STWA 4K26A 1TEVA 1VGRA 1O89A 3MLAA 4PLWA 2RHCA 1GPMA 1KEWA 4JI4B 5G0SA 2EDCA 4B3TB 2FCRA 3IP5A 1K08A 2GFHA 2R86A 2NP7A 4G0ZA 4S1WA 2PKCA 3BC1A 1MG0A 2O1SA 3F8TA 2ZRDA 3L43A 4V0QA 1DEHA 3Q7RA 4M8SA 2PWPA 3AP1A 3M1LA 2W2LA 2PHZA 3PRJA 4I1RA 5E9JA 2HIHA 4YUXA 4MRVA 1XYYA 2ZJFA 2DJIA 3DO6A 3PEVA 4XX0A 5FKJA 1WD7A 1BXZA 1RLOA 2QMYA 3F5QA 4JL5A 2C5FA 1Z45A 1YF3A 3P2IA 2AGVA 3ET4A 5ADUS 4Y6SA 4ERNA 3N9IA 1V43A 2NTVA 3QBTA 3QTTA 1SXJA 2CNWD 3N2GA 4X6LA 1J1IA 1YONA 3VR2A 4HO1X 1HGXA 3SR0A 3WO1A 4A8TA 4B4KA 3DDHA 5AJWA 5KSYA 1SXJC 3IVGA 5JZMA 1VBKA 1YQEA 2C5EA 1ZRMA 3KKMA 3FDZB 5BV7A 1PZEA 4RU1A 2JFWA 3BOSA 5LMCA 5GINE 1YNSA 4HNUA 1RACA 2IX9A 2PAAA 4HGPA 1J24A 2WAOA 2ZG6A 5IUKC 4GMDA 4NFSA 2I66A 3JQFC 3W4IA 2R8BA 2J08A 3I39X 2UZ1A 4R9RA 1IY0A 2F8SA 2XYVA 1AGRA 3KEQA 1FMTA 3D0OA 1TIPA 4QJ4A 3RO7A 3V4LA 1V7PC 4CMKA 1BRTA 1BDIA 1JEJA 1T5LA 3K6KA 3HV2A 3P19A 4TN5A 1SXJB 2Q99A 4NEGA 1QORA 1IHUA 3ZE1B 4HKTA 5BR8B 4D5GA 3ZKWB 1HDIA 2DE0X 4B9AA 4G5OA 5CB0A 4IICA 3WKDA 1RIIA 4TTIA 2Y2UA 3DFFA 3GJ0A 4KUEA 3P9SA 3H1AA 4EZBA 1ZUHA 3VSCA 2F64A 4L73A 1YH3A 3DE1X 5AI8A 1NBME 3OETA 2C8KA 4Y9SA 5K0SA 2YZ7A 4Q3CA 4BNLA 3LFHA 4B3MB 4YXWD 2Z3VA 1R27A 2WVAA 5KQRA 3B5IA 4ZK2A 1N5IA 3S1SA 3STVA 4FFOA 1R15A 4UDOA 2CXXA 5ED0A 3KFLA 4WXHA 2Y1OA 3PKJA 5JXWA 1P0PA 5DDIP 2YY5A 1WCV1 1KTVA 1EVYA 5LQAA 3HYSA 3EJWA 2ON6A 4AX8A 2AW5A 4QUJA 4GPAA 3CZRA 4HZUA 5AYVA 1XU4A 3KAPA 5JV5A 2WJHA 4OGKA 5EGSA 1CY7A 4H7HA 4RMHA 4ETWA 2GCOA 2XF8A 4INJA 2RGYA 5BWBA 1ZJ5A 3PFNA 1XU7A 4IGEA 3DZJA 3FUTA 4TTRA 2ZUDA 3PGLA 4TV8F 1OLXB 3RIEA 1LS1A 2K2WA 4Y2XA 3I4LA 1B73A 1Y6RA 2E5WA 3D7LA 3WK9A 2GPNA 5JMPA 4P80A 2OB2A 4ZVNA 1ORWA 3L7NA 5IJAA 4EP1A 5BN3A 3IKMB 4BQOA 4EJ2A 2FA9A 1I3CA 2ZIWB 3V2IA 5KWJA 4C20A 5EMKA 4K3UA 2G5CA 3VUFA 4R83A 5AXCA 1W34A 2PRIA 4FJ2A 1DXHA 1CFJA 1KAGA 1HYBA 1A9PA 2GEBA 2GTHA 3ANMA 5CVDA 3MN1A 4BNDA 2XTJA 4JLJA 5DISB 3MTDA 1SELA 2XZTA 3Q5GA 1UJ5A 4DUZB 1U0NA 1VJ0A 4UAGA 3MS4A 3MJCA 4FGJA 1I10A 2TMDA 2V7UA 3D64A 4GEKA 3LBFA 1XX6A 2GM3A 3ZWQA 4KVGA 4KHPB 4F85A 4GVLA 4P82A 3LXXA 3F47A 3AFHA 4WVLA 3ZCPA 1KEZA 4LTMA 1PWZA 2Q9BA 1Y34E 2A0WA 4PRKA 1SVKA 1Z7GA 3ZQ6A 2R7LA 2C8VA 5E6UA 4W8OA 3VSEA 3CKYA 1C30B 2JLSA 1KEPA 1OI7A 4MVWA 3D81A 3EDOA 4PZCA 1PFKA 2SNIE 1V8DA 3CPHA 3RD5A 3AOEC 4ARBA 1H2RS 3Q2KA 2UV8A 4D1YA 2VJYA 4UPDA 3L82B 2G9RA 1RAHA 3I1IA 2VUUA 1COZA 2AFHA 1Z4LA 3BXPA 2G0AA 4ZCPA 4N6OA 1QP8A 4JI6B 2ZS7A 1FPQA 4WH0A 1M1YE 3RFVA 2OSVA 3CUYA 1KSFX 3U4IA 2XWBF 3F5SA 1MGOA 2IHVA 4LK3A 4IX9A 9MHTA 4PCAA 1SK9A 4EEKA 4CM3A 1LEHA 4NMHA 1Z74A 2VS1A 1QHNA 3C1TA 3C8UA 3MMNA 4LKOA 3TX2A 2VF4X 3U3XA 5LUAA 1O3YA 3ILYA 1PWHA 2QNRA 3F5DA 2JFYA 1NVBA 1XZJA 2ZYGA 1HO3A 3QXSA 2PMCA 1MX9A 4RQUA 4LFBB 3BT7A 4EHLA 2EEZA 1V1JA 3LYLA 1PZMA 4XWTA 5JU6A 5KQGA 2O19A 3WZMA 2GDJA 2WYHA 2P3LA 2VRCA 2W43A 2WSLA 4MVJG 4M46A 5DHQA 3AEUA 2M6KA 4O25A 4XZ3A 4FIZA 5JDCC 2ILTA 3I6BA 3HG7A 4HGYA 4IMRA 4KN5A 4WKCA 5IAEA 2KLHA 2RI6A 4H7FA 5FV7A 3ZHVA 3C7CB 3A6ZA 3PE6A 5C80A 2CHGA 3GXOA 3U4HA 4BMVA 2J0VA 4L0QA 4EY6A 3ABIA 1US8A 4GNRA 2BEUB 2PQ0A 3ETJA 1MOPA 2NVOA 3AKDA 3AX6A 4LOHA 5ESDA 1A0OA 2A9VA 1KQGA 4HS4A 1MT0A 2QRVB 2Z08A 4R1NA 1LPBB 4R1UA 4FN4A 4RHTA 1DQRA 3EBOA 4U2KA 2OXCA 1QG0A 4HNGA 4ZGGA 5CX1B 4I1PA 3FE2A 1FFYA 2FWRA 1VRCA 2QROA 4JMPA 1Y8QB 5AHWA 1XZPA 1AUQA 2GK6A 1TM3E 2J6IA 3ZPXA 1YOVB 2RFLA 4MP8A 3WADA 1LQ2A 4BBZA 1GSOA 2Q5CA 2ZTVA 1M2KA 2QLMA 1RWBA 4MDYA 2VKQA 3QG5A 3IELA 2DQ4A 3SQDA 1Y8ZA 3AJAA 1QHEA 3F4KA 1OUMA 3LCJA 3TAHA 1NOJA 4DG5A 4GL2A 4F6LA 2QXYA 2LGJA 3WDSA 2RGXA 4DS3A 3A11A 1WBJB 2XVAA 4B2YA 1B0UA 3GQBB 3ZGNA 4BV9A 4C0BA 4D44A 2JD1A 1UAAA 4IUDS 3RBVA 3CZCA 5JBQA 3EHDA 5BVGB 2ZSKA 4KCGA 5KI6A 2JGMA 1VLHA 2QMQA 2QAIA 2XY4A 3RCBA 2YBEA 5U1PA 1J0XO 2XMRA 3TIXB 2BI4A 3EH2A 3N8KA 1N6RA 2YMMA 2BGRA 2OLKA 3IIKA 3T5TA 2ZQ5A 3WWCA 6NULA 3TTWA 1DDOA 2WSSA 2P78A 5J5AA 2FE4A 4BGIA 4OYYA 2D62A 2NYRA 4I55B 5KNDD 2EVWX 1BJTA 3C74A 3H9UA 1EDZA 4EAAA 2QTMA 4UM5A 7ADHA 4MRPA 1BE6A 3K92A 1KIMA 2B4AA 3R7LA 2D74A 1FF9A 2J32A 3P0FA 3L46A 3O6VA 1Y6FA 4KR2A 3QMMA 3MK31 3CRNA 4XGIA 3A1UA 5DP1A 3WV5A 4A73A 2GLUA 4QYIA 2I5PO 2JRCA 4KITB 2C7PA 4QSMA 2Q5IA 1FMFA 3ICCA 1TKAA 5JJ5A 2O2XA 4RIHA 2EATA 3GEEA 4G0NA 5J5CA 4DB4A 4ALMA 1QMGA 2ZXEA 2IJGX 4CXMA 1UJBA 1WY7A 1X14A 3L8DA 4DRXB 4PZPA 2J3LA 3NYIA 5TMBA 4KH1A 2QTAA 2ZE5A 3IMKA 1E2HA 2OFWA 4XJXA 4NF2A 1L7VC 4Q48A 3RSHA 2ZYSA 4MVJD 3SC2A 1G9SA 1JJBA 2BH9A 1AS2A 2HWXA 2WMOB 4FBGA 4UBMA 4XWYA 1ZAYA 5LZ9A 4EELA 1CHDA 5E6RA 3F3KA 4B71A 3QWBA 3MS2A 2O20A 4JY7A 3ZEAA 1NUHA 3DEJA 1QOPB 1QC5A 1T4MA 3E6AA 2QE7A 4XPIA 4F2GA 5JQGF 3QVLA 3JZIA 3SS7X 1EWYA 4DUPA 1QFXA 2GB4A 3WYCA 4R31A 1LQUA 4B4WA 4EG4A 4E13A 4D4GA 3DAHA 2CNKA 1Y5MA 5HVNA 1CZHA 2QV7A 2O8DB 4FFRA 4TYWA 3F4BA 4MV6A 2Y1LA 1KZ7B 2LBPA 5CXQA 1D2HA 1M34E 4KNWA 1J9ZA 4AY6A 3GD7A 1QDUA 2G36A 3UNXA 2X1MA 3G2JA 4G24A 1DIAA 4OQZA 3WO0A 5CK4A 4EVSA 4XM2A 4NVRA 1MGPA 2F3RA 1QO0D 2CD9A 5ADVA 1ADBA 1TJ3A 3EWSA 2E7ZA 3IS3A 1FNSA 4JUDX 3AK4A 1H6AA 4H1TA 1XEFA 4X1OA 1DFIA 1MA0A 3QVKA 2Z98A 4C87A 4GIBA 1TJYA 3GUVA 4KUGA 2VHQA 2VTEA 4JSTA 4UHCA 4WJZA 4D5EA 2PR7A 3I9MA 1YNOA 2WU0A 1Z36A 1F17A 1VHQA 2ATIA 5COBA 4LHZA 3RG2A 1GSIA 1YIOA 4J4TA 2I3GA 4RFSB 4X60A 5LYJF 5DIZA 3MT0A 3FCUB 3S2UA 3NBXX 4RGVA 5F2KA 4L4ZA 2MYTA 3ASVA 5K0ZA 3UMCA 1K5PA 2LIPA 1CRZA 2DQZA 4XYMA 3ZHBA 3MC1A 4ZAVA 5C53B 4NH0A 5FFFA 3W8NA 1JZTA 1N5OX 4UAVA 2CWDA 3FCEA 4W5TA 2BM1A 2HWYA 3C3XA 2W2OA 1AIPA 3IIIA 3DDNA 3OUUA 2PZMA 3H1TA 2V7VA 3I4FA 3IDFA 2PR2A 3Q7IA 4GT1A 3ID6C 1IWOA 4QOGA 1PT8A 2AXPA 2PO7A 3SJAA 1NIPA 2WWXA 1U2GA 4DR6B 2JGAA 4KQ1A 1BAPA 4F92B 5AOAA 1IHOA 5FADA 2R6R1 1BVHA 4KX3A 3CIFA 5JRDS 1J2EA 1KU0A 5IDWA 3FZGA 3K9HA 1I32A 2ZBGA 3OQ1A 3M2TA 1ESDA 1M34A 2G8LA 3AZOA 1UR5A 3LCCA 4RPIA 2XJ9A 5JQWA 2F4VB 1CEYA 1Z0DA 3RM3A 3SQOA 3JD3A 3AUTA 2WEKA 5CFNA 3F1KA 3PVSA 3CSSA 2QN3A 3LJKA 4KI7A 2PYDA 3KKNA 2AS0A 1I3OA 1V47A 1IBCA 1L6RA 1G8JA 2QI9F 4FC7A 2O0JA 5I45A 4BXOB 2EW8A 1SG0A 2MSLA 2ZYVX 4JHXA 3A1DA 4QASA 1ILEA 2ZW9A 1Y33E 1RWOA 1P7ZA 2AYZA 2N75A 1TZMA 4R9SA 1Y7IA 4GLFA 3VHXA 4AJPA 3LW7A 1XCBA 1HI9A 1ZN7A 2FFJA 2G1KA 4ZCQA 5I9MA 3RK0A 3EEOA 3N2YA 1Z35A 1PGQA 1SHTX 2EARA 3C6YA 2OCAA 2J48A 2PSEA 2IYXA 4UJ3A 2V5UA 1X1TA 1N4AA 4DUGA 3NALA 3EDMA 5K01A 2QPLA 3FDXA 3TR6A 4IW3B 5K45A 4BMDA 2P7IA 2W2KA 3LBHA 3T1VA 1Q6YA 1UPBA 4KAJA 3K9FC 1NVUQ 1R00A 3DQQA 3EGOA 1L8QA 1V5WA 1VDMA 2PRJA 4ZYXA 1Z4OA 1Q6ZA 1GKUB 2OXEA 5MFPA 1GAQA 4ITVA 1EWVA 1K5GA 5IUNC 2Y9MB 2GPJA 5D5PA 5DIFA 1QHXA 1Z6PA 1L7NA 2IIQA 2OHOA 2WV7A 3AUSA 1OFGA 3LDFA 4IIUA 1WP4A 3F2VA 3CR8A 4NYIQ 1YASA 4H7DA 4EITA 1QG4A 3V2GA 2O5RA 4EF4A 2HA4A 3LXRA 5LQJA 3WSTA 1V1RB 1EUDB 3HXTA 1IRIA 2ECPA 3ODGA 4FNGA 4M0UA 3OZIA 1WW2A 3W2IA 2ZBQA 4LJAA 3OCUA 1NU8A 4H08A 3I72A 1BVUA 2WJZB 4EJ6A 1WX1A 2DH5A 4HQ0A 2ID8A 1X8JA 4IH4A 3ON5A 4PZ0A 1O6CA 1RWXA 4R6XA 3O8QA 4XCVA 1WP9A 1CSEE 5IAOA 1HNXB 4A26A 4RFLA 1YZNA 4G1FA 4MEAA 3RBZA 4B3BA 1L8XA 1JR3A 3D6JA 3DFZA 4A16A 1BC5A 1KMMA 2HRQA 3AEUB 3F67A 3O0TA 3Q0IA 1ZITA 3AOGA 4DDKA 2CCJA 3ROGA 3VOAA 3MMZA 4J91A 1V3UA 1QFJA 1T36A 3E18A 2DB3A 1ULBA 2GAFA 4LGYA 4HT3B 4MWOA 5IX8A 3SF8A 2JIMA 2XGJA 3E0QA 3ER8A 1N1MA 2E2WA 3V00A 1B93A 3UMRA 3IKJA 3VH2A 3HJAA 3ZWVA 2A9OA 4L4YA 1PN3A 1GTMA 3H2JA 3IUQA 4RS3A 3LUPA 4CGYA 1T2CA 3HYCA 3MHTA 5GVRA 3MWFA 3C16C 4Q15A 5D85A 5DRYA 1OMOA 1ECBA 3DNPA 1WTAA 2DBQA 1DBIA 5AOBA 5BWCA 3PWKA 2HCBA 1UXJA 1H0KA 5K8JB 4BQPA 2MSCB 1LGYA 2H1HA 1YO6A 2YJTD 3QVJA 4RHXA 5LC1A 4EHDA 1M5RA 5IBCA 3NTVA 3PEEA 2OG1A 4MO2A 1E8NA 1YHZA 1ABEA 4DLUA 5IMSA 3GEPA 2DWQA 3KWFA 3M6AA 3U44B 1C3OA 3MOSA 1KQNA 5BSHA 3NH6A 2H52A 4PIVA 4QTYA 1JA0A 2A9RA 1NI5A 4IWYA 4FR2A 1Q1EA 2WKSA 4NS1A 3KLPX 1EP2B 5LQSA 5CG2A 5FCDA 4BN4A 4MPPA 1L4KA 3KJGA 3MJEA 1E9RA 2E85A 3CVYA 4Y7DA 4EO7A 1GL6A 1OHHA 1CUEA 2YXEA 1EVJA 2AFHB 2C82A 2P6NA 3VPSA 4TYNA 1IB6A 3KIPA 4G97A 2SCUA 4PAQA 2WFZA 1EJ2A 1RRGA 5E4TA 1LVUA 3S8YA 1NKVA 5ARBA 3A9UA 1EVIA 1FFBA 1UBGA 4JP3A 4DEVA 2P2SA 3GPCA 4BE4A 1QV6A 1BS1A 3TQFA 1C9EA 4WZAA 1NF8A 2EWWA 4Y2TA 4Z3DA 1ADFA 2CFOA 2IF2A 4HUTA 3W4JA 4NK4A 2AUNA 1SHZA 1ENOA 2E37A 1YB4A 3BTUA 3OZEA 4OQLA 3BE8A 1G64A 10MHA 4PAWA 2PUFA 3W06A 4YMTA 5ISMA 1ST2A 5ALZA 1IQPA 4RM2A 2GSDA 3FGNA 4KQ6A 3I61A 1KJIA 1QYDA 4KN6A 1Q17A 4GI5A 1NW9B 1RQ2A 2EU8A 2OBMA 4TV8B 3URMA 2ZJ6A 5FA8A 3TGWA 1LJUA 2BFCB 5JH7B 5KQMA 1YBHA 3TOZA 3JASA 2XBUA 2VZ9A 1RLUA 3WIUA 1TQ8A 1G8AA 3HBFA 1WOYA 4HR7A 1WWKA 1KRWA 3GY0A 4IILA 3UB4A 4XYLA 3R7SA 2V54A 1E6MA 3X2FA 4BGUA 4DR7B 3S40A 1LV8A 3ER6A 2R8PA 4GOLD 2I9KA 4JVLA 4D3SA 3TYXA 1RYMA 4OV6B 1PEKE 3CNLA 1JA1A 9GPBA 4AICA 5MGBA 2GBLA 5SY6A 4ZARA 2WKPA 2C5BA 2Q4TA 2EL7A 4RWZA 2Z43A 4WCFB 4PFJA 2JKZA 1ZN2A 2BBWA 2NT4A 3LBNA 3LKBA 3UJBA 3PFCA 1DKQA 4KXUA 4HV4A 4OJTA 2YNMD 5D7BA 5DW0A 3SJBA 2VJQA 2VYQA 2CVZA 4LW8A 5JEDA 3KELA 3AVTA 5JECA 1RJEA 2QTVB 4Y2HA 4DXDA 4MGYR 3EODA 4N4AA 4CNBA 4DVJA 3TRDA 3KV1A 4KMRA 1KYWA 1JH8A 5LOVB 1V11A 3RK4A 2D1RA 3PQFA 3P9XA 2YWHA 3FY4A 3OSUA 4JEMA 2WY2D 4LJ8A 5JFGA 2GNPA 2VP9A 2B3DA 1TZBA 4F2DA 3HZRA 4OVKA 1KK0A 4Q39A 1SUWA 1W93A 3A1WA 3CLTD 1JHMA 2FMHA 2XI4A 4GZ3A 5LB4A 2NU9B 4YJDA 1O94D 3FCYA 5ADWA 1V4BA 1X1SA 2DCMA 4BECA 2W8BA 1QLJA 3IEPA 4WDRA 1BDMA 1GL7A 3ZKWA 4ENSA 4CIDA 3L05A 521PA 5A5VA 3U7FB 2WG1A 4OL9A 1CE8B 1NJ2A 1QO7A 1U3DA 4N5MA 1I1OA 4F3RA 4RTOA 4LXIA 2CVHA 4LNAA 2WWYA 4MI3A 1GDHA 4R1LA 2XMCA 5FX2A 3GL9A 1NNI1 4ZXFA 2W0SA 1HUQA 3EQ8A 3M5PA 5EJ6A 3LHKA 4HAWA 4CF7A 2Q41A 2GWRA 4C6HA 4QOJA 2HV9A 3W0LB 3OZGA 5KX5A 4IHJB 3LVRE 4IJ5A 3RS2A 1BX0A 1M6WA 3LSYA 3WLLA 1ZM3A 2E48A 5JAQA 2QRKA 5FOWA 4CIAA 3IVMA 2D2VA 3GA7A 1N0UA 3K1ZA 1RXWA 3NCTA 2JLWA 2ZYAA 1TT5A 1AZLA 4L8LA 3S1AA 3V8MA 1MJGA 3AL0C 3W5IA 3VOTA 3DXFA 3GK3A 3WI7A 5K03A 2H31A 2WT4A 5I4BA 4Q3NA 4LY6A 4AJJA 4OMUA 1GUFA 4S24A 5TVKA 3GFTA 1KI2A 5BSMA 3F71A 3G1UA 2VDQB 3H1BA 4JDPA 4EUNA 1I33A 1KK3A 3D8UA 1G3RA 1KJQA 4DR2B 1PV2A 2QBYA 1N0IA 3EZ6A 1J06A 1Z8HA 5EJ7A 3WQHA 2O54A 1NN1A 3SOPA 1MUUA 1SA0A 1WRBA 3NJ4A 1UBHS 2EIXA 4J75A 4ZQHA 4TZ6A 4CQJA 3PI6A 4OUKX 3AB7A 1SOVA 5CD1A 1FX1A 3SNHA 4I2VA 4K03A 2QSYA 4G0XA 4ZAYA 3ZG6A 2Z3ZA 1YOVA 5G53C 3GVIA 2JGNA 3KLMX 1Z62A 1MB0A 4Y3UA 4GP9A 1C4XA 3AIOA 3RTEA 4BBJA 1JYEA 5A3JA 2NQTA 2ZVPX 3Q11A 4RY9A 1JEOA 3DM5A 1E5VA 1XV5A 1BEUB 3ET5A 1XWWA 3IPLA 2TECE 5D1HA 5AM4A 3RVPA 1AU9A 1Q95A 4OX9B 3K73O 3EASA 4RJTA 1A7KA 2V0NA 4M88A 3DEKA 2XUGA 4N03A 4W7SA 2GZDA 3C1AA 4CM9A 4DQLA 1E6LA 1WXQA 3TINA 4KYTA 1BH2A 4ZANA 3O47A 3RFTA 5I7RA 4ZO8A 2YJ3A 3IDAA 1WVMA 3GAMA 3ABQB 5JHHB 5BMOA 1B4DA 3H05A 1WVGA 2LCQA 3RUAA 2X8WA 4FMPA 2OAEA 2RJ3A 3IR6A 3PXCX 4EYGA 3KTAA 3RVKA 3KQTA 4D9MA 4RW0A 2I03A 2BMJA 1ZL0A 1YU9A 4G1MB 1L0BA 4FBMA 1MQ8B 5JJLA 2FSVC 4DSOA 4W5HA 1M8FA 2H16A 2ZSIA 5D3QA 4BLSA 4X7PA 1O6GA 3OAAD 1T1IA 5T3UA 2XUOA 3Q3EA 1D2CA 4MYUA 1H8ED 1NMZA 4YRTA 3WWEA 2B69A 2G67A 3KJHA 3R5SA 2XCSB 1E6UA 1LBHA 1YUNA 3PSAA 3IPCA 4QDUA 4QPNA 1NXPA 4YJ3A 1JR2A 5FOVA 4NATA 3S6JA 3VISA 5HMMA 4CG2A 1HSOA 3N5CA 4J1NA 1Z2NX 2CZCA 5F73A 3COJA 4N3GA 3GU3A 4JBGA 5B1EA 5AK6A 1YBFA 4CN9A 4WZ6A 4J4BA 1MJ5A 1CUSA 1OD6A 1V8OA 1XA0A 2FNAA 2FGKA 3E7WA 3TW0A 1Y6ZA 3NM5A 1DELA 1TK2A 2H57A 3E7DA 5K05A 1ZCBA 1SBYA 1FYEA 3GRKA 3AR7A 2HQOA 3HUFA 2DTXA 2Z2ZA 4N5LA 2R1TB 3LY8A 4AYXA 1UFQA 2VJMA 3NB0A 4HK4A 1OT3A 1XXHB 2A88A 2NX2A 3A70A 3EOBI 3ODPA 3O9ZA 4HN4B 3WL5A 3UPTA 4H6VA 3DMNA 1VJ5A 4LDQA 1QGYA 2BEKA 3ILVA 4RTPA 4EGQA 2GYYA 1U6KA 3CLUD 3P9RA 4R01A 3L4BA 5K3SA 4XXHA 2OCIA 1IAVA 3NHFA 3OF5A 3EW7A 5DTIA 4OBXA 1PWYE 4HNTA 1OWMA 2VYND 3EW9A 5BXQC 2ZWIA 1WBBA 4EZIA 1SOMA 2P4UA 4K8OA 4Q9AA 2IHTA 1OZAA 1AQLA 1K8ZB 1R8QA 1IJEA 1I6LA 3SS8A 3AF5A 3KSBC 2OMEA 4PX3A 1JDBC 4IDOA 2QGZA 3FLEA 3H3FA 1PFYA 4Z0TA 1FJXA 3KOOA 4F1KA 1VECA 4X95A 2GCGA 2ZBUA 3F7TA 1YCDA 2ES4A 4KXWA 4L57A 4OPMA 1O03A 1KI6A 1X13A 2FPOA 4PBSA 2ORVA 4QFDA 5LQDA 1GPJA 1MBZA 2XBLA 4TT3A 4XSVA 3RSZA 5FI0B 1E4EB 2E89A 3QXXA 3IQGX 3LU1A 4LV6A 2AI1A 4AS2A 4GOMD 2VF5X 2ZATA 1ADGA 1A2OA 3GQBA 3L1UA 3I01A 1OTXA 2N3ZA 3AP3A 5BRAA 3ZTYA 1RVDA 4PLCA 3WIDA 4GRAA 3UC5A 3SYTA 1Y4SA 2MCFA 1NDHA 1RFGE 3CPSA 2E5LB 4CM4A 4ZRNA 4QO8A 3GHYA 4JMLA 2YWRA 1NHGA 3M5CA 3LUFA 3CFYA 1X9HA 3K1YA 4FZ5A 4GM0A 4LOLA 3FF1A 4RDHA 1KDVA 3KWJA 3RHTA 3S7TA 1XTTA 5CDTA 3MSCA 3T95A 1HTWA 1WBDA 2DBRA 1U8AA 3ENWA 3MPOA 2A0YA 2DU8A 2HJVA 3EGXB 4RY0A 4U6QA 1CERA 4DANA 4OXNA 5AVRA 2H9AA 2EHJA 3FAZA 3VZSA 1LDBA 1X8LA 3J7AC 2ZB8A 2AFHE 2XYHA 3H8VA 4P3YA 4IV0A 4ZVMA 5C8YF 4TS3A 5DM0A 3AVUA 1BO6A 2FF5A 1T2EA 1C50A 3H1PA 3LECA 2XOKA 3PGXA 1XCLA 4QDXA 1PJ3A 4LBYA 1QO0A 4DA8A 5IJ0A 1DJLA 3SYRA 1RBMA 5COQA 4EG3A 3HU5A 3TPZA 5FWXB 4EG0A 1UJ2A 3QY0A 4FE3A 3U81A 2EOAA 5AKXA 3JQ9A 5CVJA 4OX9Y 4I1OA 3A2KA 1P7YA 4FFMA 4K9NA 1VHDA 1GT91 2HEGA 1CUJA 2PSFA 3NP7A 2R47A 1M6HA 2D13A 3ELYA 1G2OA 1MMFB 2HGZA 1IPFA 1YHNA 3N7AA 3NZEA 2G82A 1ZGCA 1F0YA 4XX0B 5CA1F 1AUVA 4Z3OA 1JKJB 4AMZA 4DAOA 4LWOA 1EU1A 1SUAA 2JAUA 1DDGA 3HKCA 5F1YA 3WWDA 4K6HA 1E1LA 5F2EA 3TZKA 5T64A 4G25A 2WUEA 2QTLA 4FJ0A 4EIWA 4QD3A 1JGTA 4EVQA 1E64A 1E7MA 1QK5A 3IE1A 4AIIA 1DKPA 1WXGA 4ZYYA 2Q1TA 4B4UA 1Q20A 1E2PA 3CUEF 3FMVA 1PFGA 4NPAA 5EYPA 3QUSA 1UINA 2WHQA 4JJGA 2VUTA 5IVPA 2HX1A 4C6TB 1FYDA 1T3SA 3O31A 2V9ZA 3ORRA 5CB6A 3KNZA 1KDTA 4X85A 4AJ4A 3NTLA 3AY6A 1SURA 1Z4IA 4TLAA 4I66A 4J0JA 5AOCA 3A25A 1JSCA 1NRJB 1WIWA 3OICA 3EDQA 2R9VA 2HZBA 4DMMA 5A4FS 1T6NA 1DXOA 4Q9IA 2AJDA 4JOSA 3RIGA 2ZP1A 4ALLA 4E33A 4XGRA 4V0OA 3O8OA 3T3MB 2B4RO 3QP9A 3LXMA 4MA5A 5AVOA 5LM3A 2DWOA 3HPRA 4L0MA 2NO9A 2QTNA 3VDRA 5B1DA 1N77A 3UM9A 4IQFA 1RQRA 1UPCA 4RNDB 1HL7A 3WB2A 1TEHA 3AESB 3L8EA 2JNWA 4R81A 1S8FA 3C6MA 2KBFA 4LWZA 4S1OA 1Z7EA 1Z33A 2H06A 5B1HA 3UC9A 2BAGA 4H59A 2QG6A 4ZT3A 1NQOA 1DG9A 2EQAA 3N28A 3QMPA 2UZIR 3LFTA 1GR0A 2IXBA 1ZQ9A 2PLNA 4JIGA 3FETA 3ELWA 4IS2A 4X5OA 1R50A 3QU2A 2B7CA 4ZP1A 2FFQA 5E1BA 5EWMA 4E31A 1AKNA 4M8LA 3IODA 2F48A 5KIAA 1ZWLA 4MWGA 1NXTA 3LUDA 4LYGA 3AHCA 2XUFA 2IDKA 3L7LA 3K8OE 4DMKA 1XELA 4P4GA 3CIOA 1XNQB 4K9MA 3VYRB 1KXZA 2B4YA 1A7UA 3JYNA 3WNDA 5J2TA 3I9OA 4A8JC 2IOFA 4AC9A 1J0CA 1CY6A 4OIFA 5BV2P 4KQHA 5JD6A 1AHPA 1T8PA 4Q16A 1G291 3CW8X 4Q4LA 2VA9A 4TLMB 4ZCTA 3AF6A 3NH9A 5TX7A 3V4PB 4E5PA 3VX4A 4TQAA 2YCBA 4WMLA 1QVRA 4GZMA 1DBSA 1DVRA 4NDZA 3WMRA 2BKUA 2CCGA 3D6UA 4M89A 2O06A 1C9DB 1G7SA 1H5QA 3D4IA 4ID3A 1WKCA 3CNHA 4R84A 3RQSA 4BNKA 1R4MB 1LBEA 1VBFA 4JK3A 2QVXX 4IHKA 1L5WA 4N7JA 4PQFA 5DP2A 4G2TA 4IM7A 4N3NA 4FSHA 1T9GR 2PZBA 1LB1B 1P18A 2O0HA 3FYUB 3ZH2A 3IQHX 3I6MA 1E2GA 3NWJA 3Q3JB 5ALRA 2O1XA 3SMQA 4CMBA 3AF2A 1GZ5A 5B7GA 3DL4A 2O5VA 3A6LA 1XRQA 4WA7A 3ZD9A 2AJTA 3DWIA 4ZREA 3UOWA 4BN5A 3GLHB 4XDYA 2H2IA 2GHIA 3TLAA 3AUJB 5G4LA 5FPQA 4QT4A 2I6QA 5DSTA 2JI9A 6Q21A 3Q8LA 2BF4A 1C4KA 4BPBA 1U0GA 1MIOA 1J8FA 4FHFA 4EZEA 4NBRA 1GRQA 1UXKA 2QQGA 3T0GA 4Z7JA 1VL1A 3OZ7A 1QIMA 4OGGA 1LPOA 1CR1A 2X4IA 3IULA 2HJSA 3COZA 1BHSA 1KH1A 3NP9A 5DT2A 3HVKA 2I6SA 3OFND 1CHNA 4MARA 3O82A 3W8EA 2CHVA 1Y89A 1J0DA 3MXTA 1I1QB 1M73E 1UWCA 1Y4AE 1AQUA 4B3HA 2HTEA 4LJYA 4GPEA 5KWEA 1U31A 1CYEA 3G6WA 3FIUA 2YN0A 4AKEA 4DA0A 4UTPA 4DCVA 3SR3A 1P3JA 4TLBA 4XDZA 3M49A 1WSDA 4OQQA 4ARZA 3HKDA 4YTEA 1OC4A 4XDGA 3KSUA 5REQB 1Y3AA 4OBEA 1FQWA 4CKWA 4WZZA 1DEAA 2HLNA 4D42A 5K6AC 1NOIA 1G41A 2OV8A 4WZBA 2IHUA 4X66B 2H4JA 4GPD1 1Q0TA 2RHJA 1SC6A 3NHKA 3TLGA 4CKEA 2QG4A 3URKA 5B30A 4Y2GA 2FOXA 2Y0EA 4GWLA 1V1MA 3FG9A 1GPNA 4FINA 4U7DA 2QMOA 3N3BC 3TD9A 3NTQA 1J2YA 4GMHA 4H0FA 1C7JA 2FZEA 3QBJA 3GPDG 5AW1A 1F5NA 1A9SA 4WLFA 1N9KA 2VKTA 1P91A 3HJTA 4LQLA 3V80A 2AZ4A 1SKYB 4TTSA 1T2DA 2CXSA 4D9HA 2CNNA 4NOJA 1N3LA 3Q3VA 4U4AA 3KOXA 4GZ6A 2YIDA 4OQ4A 3RJ9A 3VVCA 5IVHA 4WNIA 2VDOB 3S0JA 1KMQA 3MBIA 3QVGB 4DYDA 5HHTA 3R7BA 1F6DA 2REQB 5M04A 2KM1A 1E1YA 3NU1A 3S5UA 2D2IA 3GLFB 1V1MB 5KKCA 1AKMA 2ZR8A 2FSSA 1Z6GA 3IUYA 2MINB 3RC9A 4ZJZA 2VDPB 4JVMA 3JYQA 2YXBA 2VRCD 4OHKA 1AKRA 4OHBA 2D4HA 2ZT5A 3WX0A 4Z54A 3BMOB 2GVZC 1CUFA 3IBCA 3ILHA 3QH4A 4RKWA 2C4VA 5C4MA 3B12A 4X84A 4TN1A 1WEHA 5DE3A 3VHRA 3EGCA 2H1CA 1Y3BE 3HL4A 2GN6A 1I4OA 4EG1A 3REQB 5DEOA 2HF2A 1EFHA 1G42A 1GKKA 1ONNA 3AMVA 1FFSA 1K9SA 3M4NA 1EX1A 2P2YA 1QNFA 3O2NA 2HADA 3UH1A 2EW1A 1YGYA 1ZAKA 4I1UA 1S3IA 3S8EA 4B7AA 4DDUA 1D4OA 4E08A 2FZGA 1E2JA 3DE6X 3RASA 4B74A 3DLHA 1HLDA 4R9NA 1TVKB 3E7FA 1PWXA 2QSZA 3DE3X 3FF4A 4O4LA 3KT0A 3SP1A 1C8BA 1IN8A 1W19A 2HRCA 2YMQA 4HMPA 4DWOA 2VN8A 2XT9A 3TTYA 3IILA 2QR2A 5CLLA 5BP7A 2XB6A 4LZPA 4MVJP 2H7YA 1IULA 2Y0BA 4P1ZA 1FK8A 3H8WA 2XWQA 4QGAA 2D7DA 2BHLA 4RM3A 5CG1A 1UODA 3P26A 4M1ZA 4Z7QB 1J21A 1TJ5A 1LKZA 4HVLA 4N01A 5IZ4A 3CA8A 1OBVA 3R7DA 2XUZA 3PDIA 1NULA 5CB8A 1WMEA 2GZMA 1GLNA 1ZDMA 3LCVB 1M8GA 1FRNA 1NATA 3DCIA 3WRYC 1E2DA 1JIQA 1H4TA 5BV0A 4X65B 2FP3A 2XJ4A 3QF4A 4ON9A 5CT8A 4KBYA 5EKTA 5JALA 1E5QA 2C84A 1L7BA 4FKBA 5A7HA 4DLSA 1GZ7A 3EPJA 3L0BA 1JSXA 3KOWA 4IJQA 1EG2A 2G72A 2V7XA 2XAUA 3G2NA 5THKA 2YWCA 1HYEA 4NFHA 1LK0A 2XZLA 1KYXA 3DC2A 5DCLA 4PG7A 2FW9A 3I9KA 1XTBA 4UHDA 1FS4A 4NCJA 1Z5NA 4HRVA 3KSRA 3IA2A 3JQDA 3OQIA 3JQ9C 4RD1A 1Z6ZA 3EMBA 1P1IA 4MVYA 2ATVA 4JBHA 4ROTA 4KYVA 4INPA 5LKAA 1IWBB 1JU4A 3PTAA 3T52A 2Y1EA 2IPMA 4QJIA 4KTTE 5IT9A 5I7UA 3QF4B 3RTAA 1NBHA 3G13A 5EN4A 2AC2A 3UAXA 1VE3A 4DF3A 3EULA 1V6AA 2LDXA 2ORIA 3CMCO 4UXIA 3TZQA 2VR1A 3MAJA 1JQDA 2P5UA 4CUZA 4IEIA 4RSRA 4A92A 4AAYA 1OLSA 3G8AA 3QE0A 1O1YA 4BNIA 1BW9B 1ILWA 3PGMA 4GQAA 5KOHB 1E8MA 2ZRQA 4UDXX 2FN4A 2Q6IA 1EJ6A 5ESXA 2O8DA 1N92A 3PVZA 4DHEA 1ZK3A 3OE5A 2J4CA 3GNLA 3UWKA 3CH7A 1A4IA 3JWHA 2GF2A 1GA4A 4XA8A 5GONF 4QUHA 4FP9A 3ZQJA 5TQJA 1TUBA 4QICA 1XDBA 3A6PC 4JLKA 1T8RA 1YJBA 2PTHA 3L7DA 3CX7A 1OLXA 1E7QA 4DIBA 5AVKA 3IUPA 2A9FA 3ETLA 3H3XA 5BN1A 3GG9A 1C0PA 5EP3A 3C70A 3QA3E 1EHYA 2E5FA 3FZYA 3T0IA 5D3MA 2BGTA 4L6CA 4TRMA 4PN3A 1UFKA 2C57A 3K9BA 4YRFA 5TJ9A 5CM9C 1LWNA 3L4EA 1W44A 4QM6A 3QOXA 5FDFA 1XJ0A 1XMPA 1Q50A 2IZOA 2NVBA 1WMFA 5ERYA 4M0EA 3VSDA 5BUCA 1CFZA 3T1QA 3NI2A 4YV7A 1HX7A 5K8LA 1CJMA 4QNRA 3ZCRA 4P4UA 2WTAA 1E3WA 5KAMA 3SDBA 3QFRA 4MWSA 3DOOA 2AEEA 4LQCA 2YJNA 1TU3A 2DLNA 2PZEA 3FTQA 4BO7A 3GJ4A 1UDWA 3KLBA 1UT5A 2CF6A 2XMGA 3F5FA 3OOSA 5CIQA 5FF9A 5HTKA 3A32A 3G02A 4EG5A 4RJJA 1L3BA 3K96A 4R3WA 1EDBA 1T0BA 1H8HD 1U8XX 1NI4A 3OPNA 2IBMA 1LZLA 4J7CA 3WYDA 5LQMA 1ZJZA 3HCPA 3A27A 3JY6A 4KV9A 1BJKA 3KOZA 4Q3DA 5FR1A 1JAHA 1JHQA 3ZHXA 1IN7A 1CEQA 3HDGA 3WDMA 4CLXA 1X87A 2JIZA 4RD3A 4RQBA 1DP4A 4UBIA 4X97A 5DTEA 3WJ7A 4DILA 5J2UA 2MU1A 1VZ2A 1X3SA 3AHIA 5K0EA 3KQOA 2JCBA 2YRFA 4FR5A 2RE8A 4CHGA 4FGKA 2YIJA 3ADKA 3I73A 2ZULA 1II9A 3HJBA 5ILGA 1R6VA 3FNIA 4NHEA 3ZZTA 3N0RA 3AFOA 2P0YA 3DHYA 5CLQA 2WC1A 1OSNA 1XEXB 3OY2A 1Z2AA 2BM9A 4GSKA 2IXFA 4EARA 5GADl 1VE6A 4NAVA 4B6QA 4BJ6A 4C6TA 1K68A 2JFZA 2OHXA 2GPBA 2IBSA 1KDRA 1OI3A 3DEHA 5DGHA 1EFKA 1ZG3A 4MQFB 4AJLA 4UDNA 1UMBB 2HHLA 2YMLA 1MORA 4WLUA 3D8RA 3BIOA 1RD4A 5HP4A 1QCCA 4C7JA 1HRDA 3NWBA 1Z37A 3HP1A 5D00A 1SBIA 3GEHA 1LTQA 1GZ4A 5MGNA 4J0FA 5AHRA 3OEHD 4Y8VA 3ZZUA 3AEKA 2XMDA 5CA0A 1D5CA 3TOCA 4YCSA 1PQYA 5HQTA 4QXPA 1CDZA 2PKQP 3EC1A 3H0KA 5EZ5A 5IZCA 1P0MA 3RTCA 4K28A 3TTUA 2ZWAA 1V11B 3GPIA 3HVHA 3NFYA 2G4LA 3ND8A 3H86A 3GB9A 3FWKA 3PKZA 2GARA 2O05A 4PNHA 3O3OB 5GJWC 3PGKA 3SEAA 4RXMA 1NVXQ 1ZGAA 3H1GA 3IEKA 3OT1A 3PC4A 4A5SA 9LDBA 2ZOSA 4C4XA 5L45A 4FW9A 1E60A 4O02B 2DH6A 1P80A 3GP3A 3ZY2A 4OK6A 5IDVA 5KYUA 1G8SA 2VNHA 5EHNA 3INRA 3WMEA 2DRIA 3FGZA 3BJRA 5FAXA 4BB5A 1E3DA 2ATXA 2RI1A 5JE8A 3FFXA 3BCSA 5P21A 5TF0A 2E4XA 3A3OA 3CZPA 3CY6A 2G9VA 2QPOA 2X2OA 3HL0A 1PUXA 3PL5A 2PT9A 4R2MA 2C8JA 5AK5A 1S1MA 2OZLB 3VC7A 3ZWOA 2I3DA 2FOLA 4HDKB 1E1RA 5A5GA 3RREA 3NEPX 3QLVC 3ZGZA 4DIDA 2VJMB 4ZYWA 4D6YA 3MXOA 2Z9CA 3VNBA 1JHXA 1UZMA 3OWOA 1E1QA 1WSBA 4XWWA 1YCHA 3WGUA 5F7OA 2QOEA 3TW6A 2VSXA 5TJHA 2D1FA 4YPVA 5FFMA 5JD4A 4BNVA 1NE2A 1VGVA 4YCDA 1H3FA 1PR4A 1I2ZA 3FRIA 4RV9A 3DW1X 2ZTSA 4DQ0A 2B30A 3QUBA 4OMCA 5T8KC 2XQVA 4FKMA 4DY4A 1Q0ZA 5E3IA 4ZEXA 2ZIXA 2HK8A 2VK2A 1U2QA 2Q29A 3CLUC 1ZJYA 4P3KA 1CDDA 2IUTA 2OWEA 3DXXA 4O1IA 4B44A 3RYCA 5C7IO 1NTRA 3LGAA 1QIDA 3NBZC 3DMFA 4ECAA 4FYPA 4DLWA 1JVNA 3KSAC 2DJ5A 4EHBA 2BBTA 2FFRA 4L4XA 4REQB 1AZTA 3WLEA 3U3JA 4EJFA 4NMXB 5BV1A 3A1CA 4YROA 4FZVA 3Q3GE 4IVNA 4Z0PA 2N46A 5DX0A 4DLTA 1USKA 5C7LO 2BKEA 1AXRA 4Z7NB 3RYTC 1JEDA 2OBBA 2Z09A 3KC2A 5TEVA 2PS3A 4A0SA 5B7PA 1RPJA 3E15A 3E84A 5BVHB 3P2YA 1B6SA 3OKPA 2XUPA 4FGWA 4E2WA 3E58A 4EI2A 4QATA 1HDGO 2DVMA 4AECA 4D9JA 1GQFA 1QP4A 4R0MA 1KZ9A 1GKYA 1JNXX 1T91A 3AU8A 1DFHA 1A9YA 2JGDB 3R77A 5DI3B 5F5NA 5JDIC 4CIVA 4M53A 5A62A 5JVDA 4REQA 5B7QA 4ZI7B 1FB5A 3B8EA 1Y63A 4H7JA 4I19A 4NY1A 3DYVA 4KXQA 4W99A 2FPUA 2VYFA 3G1TA 4QYIB 4V03A 1GG2A 2PU7A 2VAVA 4GBGA 4OJYA 1GD1O 4L1KA 4AX4A 2ZQZA 1WETA 2W6JA 4CMAA 5BYBA 3VU0A 4B40A 4XR9A 1E3EA 1P2UA 3RTGA 1DMRA 4C4OA 2EP7A 4AULA 1S2MA 2EFGA 1YB1A 1A5AB 2W2VA 2FMFA 1UWLA 5EHGA 4YLEA 1JIUA 1T0JB 2I62A 1N6PA 4IJMA 2Q62A 3KTAB 1XGKA 3FOFC 4JITA 4BTVA 4IXMA 3HP7A 5JFTA 4D4HA 5DTQA 1BN6A 1DMSA 1KDOA 2C0PA 5SY4A 1U0BB 4ZTBA 4QLBA 2IHBA 3WJ2A 2ZRJA 1LW6E 1SAYA 1MFPA 1HMPA 1DEXA 3P71T 2QQFA 4KXMA 5F7JA 3UY4A 2IX3A 4UZFA 3C6QA 3EXFA 1CIJA 4ONEA 3ESQA 4QQNA 1QTQA 3E5NA 5LR6A 4RANA 4YAFA 1PS9A 4F9FA 5CFZA 1WABA 3ZYCA 1F9EA 1YI8A 4CW7A 2XE6A 4HLUA 1PK7A 2I2AA 3I9NA 4AWAA 1G8PA 4ABYA 3ND9A 3O8DA 5JISA 4W5RA 1WPRA 3H2IA 5FQNA 3EOAI 5CCDA 1AQNA 2VWGA 4F45A 2GZRA 4KL8S 1H69A 5ICFA 3TRHA 2J87A 1N5DA 3OIYA 2CLEB 1Y7LA 4L3OA 1OZFA 2IPLA 1C81A 1J9GA 4IS3A 2FUEA 3VYWA 5TC4A 3SBOA 4I2NA 5AW9A 3O9MA 4ZALA 4W1RA 4FNOA 4AD8A 4E2XA 4A0QA 5KKAA 4Z4QA 1Z73A 3F4LA 2Z04A 4IXDA 5EWJA 5G2OA 1FTGA 3HP4A 4I1YA 5TDHA 1KP9A 1XRRA 4PZYA 2IV3A 3RNOA 4D3YA 4OH7A 1TF2A 3BVPA 1JFLA 3RUHA 1RJ9A 1K06A 1V1RA 1BDBA 1RTKA 1CF2O 3C87A 2Z6AA 5KDDA 1DJMA 4P4SB 1Z0SA 2CE2X 5EUBA 4BNUA 4ZT6A 5JJCA 1RP1A 3O03A 4L4RA 1GPKA 4OQPA 4X92A 3UGJA 3DULA 1SHKA 2NU9A 1N2SA 4KQEA 4EPWA 2LKDA 4NYMQ 2PH1A 1YRQA 2LCFA 5B1IA 2GVNA 3FCXA 3LZ6A 1UZUA 2WJJA 3QKUA 4NHOA 3ZBUA 1A76A 4HQKA 4K81B 1IRXA 3RROA 2C61A 4X1YA 1PG2A 3W7VA 3WJAA 3FOAA 3DBHB 4C3ZA 1PWEA 2PYZA 4PU0A 4BGVA 1NLYA 4YQEA 2HO5A 4IIXA 3LWBA 3T9CA 4WINA 5C1BA 5DNCA 4MLCA 5LP6F 3N59A 4ND4A 2FH5B 1D6SA 2H3HA 3NT5A 1ZNZA 1YJ8A 5FTLA 1OYOA 3CWQA 2VDVE 1CQJA 4IV8A 4YDHB 4YAWA 5C34B 1TOAA 1X7WA 2ZB3A 1NR7A 3EG5A 3H2KA 3PCTA 1U0OC 5IJWA 1ZR2A 1NBMA 2YVUA 3DL7A 3UQZA 4MVJM 4X8OA 5DTJA 3D31A 4X63A 3RAEC 1G60A 3BMNB 2RH5A 5CBPA 4C2TA 3G0BA 3RBAA 2CLCX 4HDQB 5ALQA 3Q3HA 5BRJA 2R751 3IUEA 4Q34A 2QJWA 2ZIXB 4BCCA 4D8YA 1OF1A 2DOKA 2JGRA 3A4TA 1J70A 1CU1A 2GJSA 3DDUA 4AFNA 1YKFA 2PUDA 3IJPA 3R3VA 4JU8A 1D6JA 1GPYA 3L2OB 1K66A 4JT4A 4RZ2A 1GLGA 1ISJA 3EXEA 3II6X 2FQYA 1NUAA 1RABA 2QD2A 3G2IA 3ZD8A 5CXUA 5I9IA 4IIVA 4A6EA 4CKBB 3OPQA 1RC0A 1BWSA 5GJCA 3F7OA 4CMGA 1KEEA 4YMIA 5F3WB 4WVFA 2CXNA 3AM5A 3DONA 4HDSB 2CCKA 2HCFA 2BDTA 1DEOA 2GXQA 1ZOOA 4XYGA 4YCAA 3ZY3A 1CJSA 1RSZA 3QF7A 4BQIA 3Q8KA 3SXJA 3K09A 4XH9B 4F38A 3ABOB 3SLGA 4Q7LA 1YRYE 2B1RA 1P4SA 1PJ2A 3AJ8A 3E9DA 2B5WA 3ZCXA 1TZKA 1Q0UA 1F8XA 2YMPA 3DT6A 3D4LA 3A1NA 3ZJYA 4HG2A 1EQAA 3ZXSA 2HQSA 3AR3A 1Q0RA 2JFGA 3T5DA 4MYCA 1N7JA 4PYMA 3P32A 2ZXUA 4IO1A 4FHEA 5FWNA 2HIMA 5ITZB 3L3BA 3OFNA 1CZOA 1JT2A 2ZTMA 3A6JA 2MSEB 3VV2A 1D03A 1JR4A 2BJVA 2WG0A 3O4FA 4UBNA 3DEFA 1J25A 2VDLB 1CVLA 4B6EA 3TGLA 4BWGA 4BV3A 1AUOA 3FWNA 1NVDA 4DCGA 1E3MA 1Z0IA 2NPOA 3HU3A 3OEYA 5AJUA 4PF1A 3COSA 4NU8X 4WASA 3RTDA 5AKYA 4Q1FA 1H1DA 4FMDF 4FXOA 2JBWA 3QKIA 1WQ4A 5HK8A 2JCSA 2WQ7A 1O95D 1R8XA 5JVDF 4BNDB 2VT6A 4BLWA 1ZHOA 5MHTA 3I1JA 2BBOA 2C54A 2HA2A 1KJ8A 1ZUNA 2JHAA 2Y99A 2OV1A 3O94A 3QJGA 3ZHYA 1TFRA 1ZH4A 1Z18A 3UEOA 4LOKA 4RS4A 4F46A 2WAXA 4BOYA 3AHEA 2P8SA 4GFDA 4PYNA 1J1UA 2NU6A 4DIKA 3H42B 3TEFA 3WIVA 4RPGA 4INOA 5KOJA 2MYNA 3D6MA 3G2HA 3LHSA 3PHLA 1G2QA 6CHYA 4GR4A 4RF4A 4FD3A 4S1VA 1XZIA 4CL8A 5B64A 1CB0A 1U9IC 4YDQA 4K6CA 2B9VA 1PR9A 1UM9A 3N0WA 4CF6A 5KC9A 3I2YX 1ZU5A 2HC9A 1YR9A 3ENVA 4BLPA 4D79A 5CB4B 2J9YB 2AD1A 4XUEA 3U19A 3GCWA 1XA4A 1J8QA 1IUPA 2NO7A 3DOJA 1PTKA 1SWVA 1UBTS 4YJHB 4EJMA 4CKCA 4QPDA 4BZXA 1L6IA 3U3OA 5LP6C 1E9DA 1DAGA 1I4WA 1NUQA 3G8YA 4B6JA 4AY5A 3ZI0A 4XLTA 2PZAA 2WSIA 1THGA 1DCMA 1GVNB 2PMBA 4LF5B 3RSQA 1W6RA 2GAJA 2XDAA 4IIFA 3BH7A 3QLEA 1S5PA 4J2OA 2GN2A 2YS6A 5TMPA 3U44A 3OM0A 4XIGS 5FR2A 2FRVA 3DEYX 3VDXA 3WWOA 3DHVA 2XCLA 3KYIB 1WHSB 2QLJA 1TTHA 2I65A 4UAUA 1C9NA 1G9XA 3E05A 3QOWA 5DW3A 3UWMA 4CN8A 2H4HA 3LM8A 3M6XA 3SZMA 3UT0A 3THXA 1QZTA 5CXSA 3WGZA 2NSLA 4URYR 5EXSA 3TOVA 2Z4RA 3DAFA 1JIIA 1P17A 3KQPA 1QAOA 3TNLA 2PQ2A 3HS3A 4WOJA 2E18A 2GKSA 4OJKA 2R8XA 3D3KA 4WBXC 5FWDA 1GRCA 2XIQA 4YI5A 3K70D 2FR8C 3HR4A 3H9CA 1KO8A 1H1TA 4X91A 4HH0A 2GA9A 2JW5A 4ZHSA 1QGZA 4MH0R 1NNLA 3RC1A 2X9NA 4ALJA 1DQZA 3CISA 3L7IA 1UP7A 2MSWA 3JWPA 4JL6A 2KMLA 4MZDA 1BEZA 3EXAA 1PHPA 3RC2A 4EGJA 3KQMA 2HLDD 3WYFA 4ACAA 1NX6A 3B70A 2KX7A 4WW0A 5GY7A 4PYRA 3K4QA 4M9RA 2WOJA 5DSXA 4DSZA 3OCVA 4IRMA 4J16C 2XTZA 3LRPA 2QAGB 2VSQA 3Q72A 1XJ5A 4ZVOA 3TQRA 4UPEA 3JWIA 2PN1A 2G1PA 4Z4FA 3CN9A 4KJZA 1GGNA 1TU4A 3GLQA 5BSGA 1XZNA 3OMLA 3OPVA 5AK4A 2N42A 2QGFA 4IIBA 3CEAA 3BBLA 4ZMSA 4Q21A 2QX8A 3RUFA 1XDDA 1OOEA 4R40A 5D87A 3TSZA 1BDHA 2BHTA 2GRUA 4GEGA 5IVIA 1K97A 4HJXA 3ZDFA 5I4KA 4JJFA 4HC4A 3UV7A 4BTLA 4JUBA 1Q1NA 1E6KA 2VK1A 1GQOA 1FFAA 1TUGA 4CEJA 1MVNA 3R7WA 2HJWA 3STUA 1TYCA 1IZ9A 1MAVA 4R2WA 1ATIA 2NU7A 3NANA 1MH9A 1NBEA 4HNHA 4O4JA 1SJ9A 4WBSA 2OHIA 3BSSA 2K87A 1AXEA 2RAPA 2GPSA 1X7HA 4AMGA 3FKSA 3GFVA 2YICA 5EHXA 3U13A 1LUAA 3FMOB 3GRUA 3HB1A 3WGHA 5HJ7A 1FNCA 4X20B 3K70B 3PXAA 4YMSA 3QEJA 1UQRA 2HY7A 5G4KB 4WXMA 1Q84A 3U1BA 1KDZA 1CTQA 4BRZA 4YXFA 3RWBA 1H42A 1YDFA 2JBAA 3A26A 3CNOA 2EERA 3KEMA 5FBZA 1CR6A 1MABB 4H4EA 1TGVA 1QCYA 4ND6A 2Q49A 3E2PA 3N70A 3L1JA 2WWHA 4BCBA 4Q7MB 2NQ8A 3OTGA 4H1UA 4LKRA 3T3GA 4N5IX 5CRIA 2ZT6A 4FU0A 3VR4H 2OB1A 5EZQA 2FG7C 2QZJA 4EUEA 1WUKS 4ZHQA 3ZDAA 3K2IA 4EHJA 4A8PA 1OWNA 3NBAA 3EFEA 4J07A 4L8FA 5C8DA 4Z8YA 4RPCA 5AKHA 5HZMA 3CLVA 4R2XA 4WPGA 4L9SA 3SXUA 1EFVA 3H9EO 4XGNA 1NOKA 2R1VA 4NBSA 3LY7A 1G1MA 1KQ3A 4TL8A 5DYNA 2R7MA 4DADA 4HFJA 3DZDA 5AIBA 1FDVA 2AUTA 3KYCA 4DLKA 4ZZIA 4CZ2A 5HW0A 4Q0MA 1ZU4A 4ZOEA 1OGJA 2SBTA 2FU5C 3IAUA 1V3QE 3KQUA 3VAZA 2IYYA 1KI8A 4YRBA 2SHKA 5C7YA 2C0CA 2AG5A 1PR6A 1EFCA 3ZLVA 4V0SA 4HLUC 4A4DA 4FFDA 1EEXB 4RNCA 5AKGA 1N0VC 3PRKE 1FSGA 2OAGA 1M2GA 4G85A 4IZ6A 3KU1A 1FDWA 2WD8A 2X19A 5I4IA 3G23A 1DIOB 2ID4A 4U7HA 4ZVSA 2QVGA 2F55A 4OLAA 1D2NA 1N2IA 1Z6YA 2NAFA 3ESYA 2W6NA 4GR5A 4JQYA 4M6WB 4KVAA 3VOSA 2XD9A 4Z9BA 3T15A 3HO6A 2WPNA 5TE9A 2COUA 5KWSA 3LOUA 4YUYA 4RMJA 2QT9A 2R1VB 3MINA 3MUNA 2HRRA 2VBGA 3BB3A 3DHNA 4QECA 3CYFA 4KSCA 1I36A 2IITA 3NR2A 5AO9A 2VK8A 1U8UA 3LC7O 5H02A 3CO5A 2W70A 4FWIB 1QQ5A 4PIMA 3DLPX 1FL9A 2VPXA 4ZA2A 5A7GA 4ER6A 2C4NA 3A0UA 2F1JA 2I6TA 4GF5A 3PU6A 3GJ5A 1I4EB 1V7QA 4Y7CA 4XFDA 3C5WP 2D5AA 4P3XA 5HWSA 2C7QA 3WMFA 3D6HA 1YSCA 3UAVA 3NHBA 3VGJA 5K0JA 1XCOA 1PG5A 4N5NA 2Q7XA 2C04A 1JECA 2ZJ2A 2H7XA 3RF6A 2W2TA 4Q1EA 1IEQA 5ALFA 5IXYA 3O4HA 3Q85A 1WCWA 4MR8B 4RZXA 1TEXA 3AZQA 4LC0A 2AR0A 3I83A 4E88A 5JEEA 2H8GA 1HQYE 1QH9A 3DB2A 4FI3C 2YWBA 2CD7A 3M6FA 5LB2A 4D9BA 4F2WA 3THYB 4KGDA 3QUQA 1G3QA 1XEAA 2DR0A 3OOYA 4ZXPA 1RRPA 4RADA 1U1CA 1RWQA 1P0QA 2AYYA 2OXRA 3NHYA 1HDEA 1V5GA 4ISBA 3GUUA 3PX3A 5P8WA 3PV0A 4NJMA 3UYLA 1GTJ1 4IJUA 1S7CA 1Y0BA 4HWOA 2AG0A 4AF7A 2FDRA 4XX1A 3NYQA 2B1IA 4DLLA 1LCIA 3BN3A 4G5QA 1QGOA 4FFSA 4GQBA 1PLKA 3RYIA 4KUHA 2OCBA 5B2ZA 2YXDA 2XZOA 1F8FA 1JTFA 3TOSA 4CQMD 3E7PA 2PO5A 4OHVA 4RDIA 3I09A 1EXDA 3DT9A 4XGKA 4YAKA 5IC5A 2VP6A 4B7ZA 3KE9A 1YAJA 4F4UA 3K72B 1Y82A 2QRGA 3VO8A 7MDHA 4RHCA 1NJ5A 2FZWA 4EI8A 3BAZA 4DCPA 4M0KA 3PEWA 3OC0A 4J6EA 2R6DA 3R5XA 1U7HA 3V46A 1M2OA 3DWFA 1JDSA 4ZZ2A 4C07A 4F3CA 3ISTA 2WI8A 4ZAFA 3MJHA 3PE3A 4JOCA 1ODFA 3RAJA 3WQSB 3ZV3A 5J40A 2P9YA 1Q74A 2WIGA 3H1EA 5AMXA 3SX4A 2Y1CA 1S4QA 1YS1X 2ADMA 3EXHA 1FTYA 2BEVA 2FFHA 5DX1A 1XSEA 5C1IA 1ZYUA 1C14A 3F5MA 4PINA 3T4EA 4BNYA 3FPCA 3G5LA 4R2KA 4C2AA 3TECE 1T34A 3EXIA 1NP7A 3WY9A 3N7UA 3HB0A 5TQVA 1O6BA 1ZI8A 2CJWB 2V96A 3IAS1 4AJOA 4D8VA 1MIOB 4W6QA 2EAUA 3K4PA 5FTNA 4J49A 2X0DA 4HDNB 3C45A 4YT5A 4WDQA 4KQFA 1M34B 3CGGA 3HWSA 1YQDA 1LS6A 3AUFA 2NVUA 2HDNB 4HWKA 1U4SA 2KPOA 1EJBA 2SKCA 1R0WA 2MOKA 1JAZA 3GLGB 1NVMB 2REXB 4L16A 4AG6A 3QYFA 2WHXA 1OJLA 3LGXA 4I3GA 2P5SA 2D5LA 2E1RA 2PL3A 4M22A 1FP1D 3LUGA 3DJFA 5JXJA 3FTDA 4XOUA 2VJLA 3JQAD 1HYHA 1JAIA 4EA6A 2A9QA 1VL5A 4HLCA 3SIWA 3T7JA 4EECA 4X8HA 4JGGA 4OO3A 2C2OA 3HCAA 5EFZA 5F5LA 4CM4B 5CVEA 3HXLA 2JCYA 2XW6A 3T7TA 4ZV4A 1RPNA 1ZIYA 2P77A 4WFQA 5E8RA 2TYSB 3KZKA 2HWKA 2OFXA 1NV8A 1DWOA 1FQOA 3QUCA 4QKQA 3RWOA 1VB5A 2BY4A 3I34X 4P3NA 4XSHA 2IU0A 5EL0A 2COKA 1MP0A 3KKEA 3ASYA 1FZQA 2AOTA 3TBFA 2V3VA 1AM4D 4GE0A 4DV5B 1WV0A 3IVXA 3IOEA 4X00A 4UE3S 1AOXA 1UZAA 2KJQA 2IDZA 3KQSA 2GAAA 4KXVA 1ZRHA 4LHEA 3ZHTA 5LDHA 2YCLA 1JLMA 2F1IA 2C29D 2EBUA 2CJPA 3BWMA 3R3JA 4BFVA 1U8YA 2PKYX 2WA1A 1GRRA 2ZJ5A 2OCXA 4CJXA 4X94A 4NSNA 4YCLA 1LJLA 3UMVA 4EMUA 3WKBA 4BTEA 4JUAA 2ZYDA 4PPGA 3C7TA 3C8MA 3GN1A 4X9XA 1XYVA 2W71A 3OZDA 4AWBA 4B7XA 4BAGA 4DSTA 1C7ZA 5FV4A 1VL2A 2PY6A 2UDPA 4IDAA 2G3YA 3HY4A 3BSWA 1S9DA 1JHAA 1QV9A 2YFQA 1CQJB 4KW7A 3HGMA 3UK7A 4AYTA 3C8ZA 1MQ9A 1R2QA 1Q2XA 3TZLA 1ZCZA 3KT8A 5AQ1A 4TT8A 1K88A 3VR3D 1NQUA 1YDHA 3ZHRA 4XPZA 1M6VA 1WOMA 5CVVA 3U09A 4ZAWA 1M1ZA 3A1VA 5ETJA 1UP4A 2Q5FA 2YZMA 5EQTA 1D1QA 3MWDB 3QEBZ 4FYXA 4N0QA 3DP7A 3HKCB 1P5FA 5KSPA 4YRKA 3A1TA 3TLKA 3X1WA 3QKRB 4YWHA 3DYBA 4XTRA 4YCJA 1NBOA 2O14A 1W30A 2FEKA 1P1JA 4FOTA 2O7QA 3W77A 4P93A 3WZ2A 2UVPB 1XMSA 2WZBA 5KYYA 3IKVA 3NCHA 3OJOA 3S28A 4DSNA 2Y05A 5EJ5A 4IIJA 3OECA 721PA 3WVNA 1NSTA 1W59A 3L7CA 4Z9YA 5EYPB 2P40A 4FFVA 3VVBA 3QE3A 5BQOA 3W5CA 16PKA 1SUBA 3FR8A 3JR3A 2PIAA 3ZV4A 5B5SA 2OBYA 1N9GA 1K3TA 1DRVA 2BW0A 3WJ1A 4KK4A 2CHUA 1T2VA 1W6UA 3HWX1 4J3FA 1SRRA 4O59O 4C14A 4A0HA 4I50A 5C8ZA 4W5OA 5AI4A 2HA3A 1KSGA 1WNFA 1FX0A 5JLAA 2IZ1A 3RAFC 1TMGE 1WU7A 2FQ1A 2WZQA 2W6PA 3FRHA 1FSZA 4QUDA 4M49A 5LD2B 3BIJA 3R7AA 2XGSA 3LT1A 3ZHOA 1MJFA 4J2HA 3GT7A 4RF2A 3LF1A 5JZVA 3CRZA 3PX2A 1SCDA 4RAOA 4LEIA 3O7WA 4H15A 5E4JA 4LJ6A 4FHCA 4IIHA 2QXTA 4HQNA 2Q5QA 1BVRA 3AILA 2ZUUA 3QMWA 1PFWA 4OQFA 3G7SA 1FJHA 2CYCA 2FJPA 4ZT4A 2HRZA 3WBJA 2NUPB 2QYTA 1W4AA 3JZMA 3N2EA 5AKKA 3W90A 1MZPA 1NBWB 4UEOA 2I9PA 2XSZD 4AL4A 1ZESA 1E77A 4Y1EA 5FI5A 5CM2Z 3RU9A 3S8MA 3IO5A 4WGGA 1X94A 2W7TA 3NHLA 4IOMA 2GHQA 3BRWD 3WKCA 4OHXA 3OD1A 1KRHA 1R5JA 3LO5A 3QLVA 2B4QA 1EG7A 3ADBA 2HQ1A 3HMKA 4WOKA 3WLTA 3U17A 4BJ3A 1DOAA 3B1KA 4O2BF 4J0KA 4LS3A 3LAWA 1PNQA 5ELMA 2WAMA 1O9BA 2G7ZA 4D8UA 3QELA 4D43A 1ZD1A 1II0A 1JRLA 1ZCJA 4FOPA 4RPKA 3O8NA 5BSKA 4Q4AB 3HDTA 5JLJA 4WT7A 3ZUPA 2G0TA 2HWUA 4IGAA 3RQIA 3FX2A 4URXR 1QH1B 1T5DX 4MCHA 1BROA 1UQTA 3UG7A 4F9TA 2I6XA 2LPMA 1FS6A 3D1JA 1N5RA 3FW1A 2F00A 4XUDA 1U1IA 3AL2A 1F3OA 3SIXA 2WWWA 2ZVQX 4HQ6A 1T1EA 1Y3IA 3QYAA 1FSFA 2W4QA 2G83A 2XH8A 1C9YA 3AVQA 4TQGA 3VYTB 1AS0A 5A05A 1J2RA 4HDRB 5K09A 3DOFA 1BIFA 2WVGA 1PNTA 5D2CA 4ZZ0A 1GEEA 4A0FA 4YFVA 3PA6A 3JQ6A 2B20A 2OGZA 4ZQIA 5KTYA 5CX1A 1VJCA 4XWKA 4V0NA 3AKZA 3IUNA 4EBFA 3D0QA 1P72A 4AMBA 2AMVA 3PD1A 4LHVA 5B55A 1E7RA 1Z08A 2O3RA 3K9GA 3WNVA 1X9GA 4U7JA 4OLJA 3GMTA 1PP4A 2DQKA 4L27A 4LMBA 5KREA 2QRUA 1E1QD 2YUIA 4M0DA 3G6KA 5CW2A 5DNUA 1BU5A 3V7WA 5AD1A 3WAJA 3JV7A 4AT1A 1GPDG 3KV3O 1Q12A 1QM5A 2XB8A 1JDVA 4C03A 2J9ZB 4G0VA 2CNBA 2ZZMA 1IHPA 4B2LA 121PA 4TRNA 4YJ3F 4Z9FA 2P65A 2IZ0A 4TV9F 4DT1A 3RNLA 3ZVKA 4P32A 1C30A 3BFXA 2Z3WA 3OHPA 2VLBA 1OFIA 2P5YA 3KB6A 4UOZA 4BNTA 1LC3A 3R6DA 3GLIE 2ZRLA 1NYLA 2JK1A 2Q9CA 4JLMA 1A8PA 1G5HA 3W5VA 1J8YF 2XNDA 1TRHA 1IM2A 2IYTA 1EWQA 4JC0A 1RW4A 4PLYA 2HNKA 1GYQA 4RZIA 4CMIB 4MNTA 1WUYA 1PL8A 1ZOLA 1DUIA 2X76A 3QPDA 1GTG1 4D46A 1QKIA 4EW3A 3JVDA 3V1MA 5A4KA 2IDMA 4I5FA 5JAHA 1MB3A 3E70C 2X4DA 1QS0B 4L76A 2WM3A 1JBEA 2OD2A 3UH0A 3U7QB 4AMVA 4RPHA 1GRNA 4Q7JB 4G5SA 1X0VA 2EG9A 2ODPA 5IVDA 2IQ5A 1LZKA 1DPGA 3VYVA 3ZH9B 4EHIA 4ZI2A 3WK6A 4ITUA 3LG2A 3QM1A 3IKLA 2PH3A 4X45A 3TH5A 2QRMA 3KAJA 1KXJA 1NXQA 2PZLA 1P74A 2QYHA 3DDZX 1D0SA 3OMWA 2TRSB 1WUTA 3NT4A 2V6JA 3OESA 4KO3S 3CJTA 2JJ1A 4OHCA 4IIEA 4ZGWA 4NNOA 1N1DA 4MUKA 2YX1A 4MCAA 4Q47A 2WIJA 3A37A 1RKUA 1NZFA 5AK3A 3RAGA 2IWHA 4EMTA 2YIMA 4EUSA 5AVQA 3FKQA 3ZZ1A 5ALKA 4WE3A 1G8HA 2FK8A 2JC3A 4I81A 2P79A 4IDQA 4P5EA 1PW7A 1JHOA 2ZBEA 4WFKA 5EOVA 4UOEA 2VBFA 1YVDA 3V5NA 3ZN2A 1L5LA 4L78A 3E1GA 3HM9A 2PCLA 1AURA 4RD6A 4YYEA 5T4FA 3E22B 4GP6A 4HCJA 3GLIA 4RULA 2CF5A 4OFXA 3V4RA 2NM0A 2CZQA