4MAAA

The crystal structure of amino acid abc transporter substrate-binding protein from pseudomonas fluorescens pf-5
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
373
structure length
373
Chain Sequence
FAAEPFTFYGLKSMSGAFASYGKFADMGSRLAVEQYPTLLGRPLHYKVIDTEGNAGKAVRRVQEAIAQDGARFFQGCTLSSSALAVAKEVGKVGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETMVPLIKLLPEAKRWYTITPQYVFGEALLEGAKQVCAEHGIEHIGNSYHSLQEQEFSGYLTNAIAARPDVLVLLNFGSQSSNALRQAVNFGIKERMKVLLVWSAGLDQFQELGSDVLEGVYLGAQYWHQVDTPLNRELVKLTQAKYGINPTYPLAADYIGSKIILDTIAATGSFDGATVAKAMQGLTYQGPTGEESIRAGDHQVIKDYYLLVGKAAATMRDKDDLAEVLSAGRSFPDVSATGCAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative branched-chain amino acid ABC transporter, periplas
publication title The Crystal Structure of Amino Acid ABC Transporter Substrate-binding Protein from Pseudomonas fluorescens Pf-5
rcsb
source organism Pseudomonas protegens
molecule tags Transport protein
total genus 133
structure length 373
sequence length 373
ec nomenclature
pdb deposition date 2013-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4maaA01
1TMYA 1L5ZA 4FE4A 3HUTA 4Z99A 3Q7RA 2Q5CA 3OM1A 4JAVC 1JX6A 2FN8A 4RY9A 4KFCA 4RK5A 4MR8A 1DC8A 3IP5A 4OLBA 1AB6A 2HSGA 2YHAA 3A0UA 3DGFC 1E6MA 2CD7A 2LBPA 5FWXA 1QP0A 3L49A 3JPYA 2QXYA 4KK4A 4N41A 1F4VA 5KC8A 1L5YA 3T8YA 2E4XA 5EWJA 2GX6A 3KS9A 4O5AA 3HM9A 4IMIB 4RK4A 1DBPA 4EGSA 1YK1A 2FLKA 2L17A 3FDFA 3O1JC 5IC5A 2JVKA 3QLVA 2FMFA 3EQZA 4MS3B 5DKFA 2FQWA 1JLKA 3O2QB 3SY8A 2GBPA 2E4YA 4CBVA 3QLUC 5KC9A 4MPTA 5FBHA 2FMKA 1EFAA 3M9XA 3RVRA 2WB4A 3N8IA 4KK3A 1SRRA 2VUIB 4HNRA 5JNRA 1DJMA 1ZGZA 4MS4B 3LUDA 3Q7TA 2QU7A 1QMPA 4MQFA 2QV0A 4RK1A 1ZH2A 3DLBA 1QO0D 3BILA 1AB5A 4RK0A 2GI4A 5TQ0B 3URMA 4XXHA 3EAFA 1FSPA 1UDRA 3UUGA 3H1FA 4N76A 1KGSA 3QX8A 1VLZA 3C3MA 1QNLA 4W5NA 2RDMA 9ABPA 4G0OA 1M2FA 1T34A 5ABPA 1SXHA 3HK2A 1KMIY 1PUXA 5C5EA 3F6CA 4EYQA 4LE2A 3C3KA 3N0WA 1FFSA 2PLNA 2FQXA 2JVIA 2M1ZA 3FFXA 1MAVA 2R47A 4N0QA 4OLAA 2WMYA 5EWLB 4QPJC 1BDHA 5CNKA 5FWYB 3LUGA 5JNUA 5CNJA 4RY8A 3F7NA 3VNAA 2RJOA 1NXPA 2B4AA 1ZESA 4IGAA 1FQWA 1JH9A 2FQYA 3JTEA 3HUUA 5KQMA 4JOQA 3RVPA 3Q15C 4MRMB 4P1ZA 4OTZA 1BA2A 3ILYA 4MS3A 4KV7A 3T38A 1TJYA 4Q6BA 2NT4A 3CG4A 1QP7A 4JASB 2PUBA 2JBAA 1JDPA 1Z26A 2JB9A 2R4QA 4RY0A 4MR9B 3JVDA 4KREA 3I09A 1QKKA 3GL9A 2N9UA 3RVSA 4MS4A 1SD5A 2IPNA 2QVGA 1YIOA 4P98A 4XAQA 4QICA 1DCFA 2LP4Y 3OLXA 1U04A 4MLDA 5TQJA 5TQ0A 3KYIB 3LOPA 4EYGA 1APBA 4ML3A 2E4ZA 3CFYA 1NY5A 4DADA 3KCNA 2MYUA 2XDYA 4G0QA 3HSYA 2WWVD 3M6MD 3QK7A 1RXEA 1YS7A 3LUCA 3H5IA 3K9CA 4NICA 5TPZD 3RVJA 1RXIA 3JY6A 4G0PA 1USKA 3OMXA 5BR1A 4Z4GA 5EWLA 3UKJA 4RZSA 2FMIA 5FWYA 4TLMB 4KNYA 3TMYA 4QYMA 2JCGA 3DBIA 3FGZA 1P2FA 3KG2A 3NHMA 4H3HB 2PUCA 3RQIA 2JRLA 3N0RA 4FB4A 2WJWA 1PHRA 1YTUA 3BRSA 3IP9A 5TQ2B 1URPA 5KWSA 3RVLA 4PICA 1LJUA 1JFSA 3KLOA 4OATA 5D2CA 1JHZA 3MYYA 5KQLA 4O1IA 4EY3A 4MR9A 3OM0A 3LKBA 2FSPA 4NCBA 4DQDA 2MYPA 3E61A 1OXBB 1Y1LA 1Z2DA 4RDCA 4MLCA 1DRJA 4L85A 3JVIA 4XLTA 2WJAA 2NZVG 3HV2A 3HVRA 1NXSA 2PMCA 3GBPA 1LBHA 1RPJA 2IPMA 3TD9A 1KRXA 4EUKA 1JL3A 2H0AA 3CG0A 3O75A 4LRQA 1P8AA 2QR3A 3H1EA 1D4ZA 4RSMA 2PUDA 2FTKE 1NTRA 2PE5A 1ZAYA 2MSKA 4G0ZA 3OQOA 1QQBA 3T95A 2MYTA 1LK0A 3NHZA 4Z4FA 2HQBA 3I45A 1I3CA 3JS5A 3O2SB 5IUJC 3G85A 4RS3A 4ETMA 1YMVA 4YLEA 6ABPA 5C5CA 2JBAB 4IF4A 1LJLA 3LMKA 3TX6A 3HDVA 5TQ2A 4G86A 1ABFA 1JBEA 4RK7A 2HPHA 1EWTA 1VPWA 3IP6A 1PEYA 3RVOA 2HJ9A 4EVSA 2FLWA 1MB0A 3CHYA 1W9HA 2MSWA 2QVCA 1NATA 4YO7A 5PNTA 3CLKA 1D1QA 3RVKA 1DP4A 1ISSA 1ZH4A 4IILA 4NQRA 1ZGGA 2GKGA 1QO0A 3I5AA 1JYEA 3GRCA 5I4CA 1FFGA 1ZITA 3C97A 1JDNA 1E2BA 1IIBA 1XWWA 1Z17A 3HZHA 1GUBA 3H6HA 3H5TA 5EWMB 3CNBA 4YR7A 1RZRD 3MA0A 3EJWA 5GQSA 1P6UA 3CKMA 3FFTA 3MIZA 5B3JA 1ZVVA 1YK0A 5BRAA 1CYEA 5TPWB 2MYNA 4KQ9A 4MR7B 1BDIA 3BBLA 3Q7SA 4JB2A 4UHJA 4ETIA 1ZY2A 2FXIA 4F12A 1TM2A 3QLVC 3DLHA 1C0EA 1PNTA 2A9RA 3Q9SA 4G97A 3O2JA 1U2PA 5HM6A 4KPYA 4W5RA 3CZ5A 3LUKA 2A9PA 4WXMA 2QZJA 3TB6A 4RKQA 3GBVA 2A9QA 2FMHA 3CU5A 3NNDA 3HDGA 4UHKA 3M9WA 2E4WA 2P9HA 1USGA 2I6FA 4RXMA 6CHYA 3EODA 5IUNC 2L18A 3LFTA 4PYRA 1DC7A 1W25A 1Z16A 2TMYA 4KQCA 4Z4CA 1CEYA 4YCSA 4RK6A 1WETA 4LZLA 2LPMA 2FKAA 3LKVA 4KMRA 4Z0NA 1JF8A 2E4UA 4Z4IA 4D74A 3SAJA 4N47A 2PJUA 3DZDA 1U2QA 2L19A 1DZ3A 2F8TA 1GCAA 3IPCA 3KLNA 4XASA 4EYOA 5B3JC 2HQOA 3OLWA 3QELA 1A2OA 1DRKA 4JA2A 4ZPJA 1KRWA 3N6VA 4PEVA 3G1WA 5EWMA 4F8JA 1BVHA 3HCWA 4LE1A 4RXUA 4G0MA 2WY2D 4ETNA 2HQRA 2E4VA 4ZMRA 1CHNA 2IPLA 3JPWA 5DTEA 1YS6A 2ID7A 3HS3A 3MF4A 5TPWA 4MR7A 4EVRA 1NXTA 1GLGA 5TPZA 4F3TA 3SM9A 4YP9A 2FN9A 1JFVA 5IEBA 3RVNA 1PNRA 2IKSA 3LUFA 3CZCA 4MGEA 4RXTA 5JS2A 2R48A 4W5TA 1OXKB 1K66A 1PEAA 4IRXA 5CNIA 4MS1B 2W42A 1Z18A 1SXGA 3K4HA 4KRFA 2LIVA 4ZJPA 1ISRA 3O1IC 5JNSA 3ROFA 3OLYA 3MMNA 4N0PA 4HYEA 4MYRA 2R25B 1DCMA 3BRQA 4B09A 4E7OA 4WT7A 4LE0A 3F6PA 2IDMA 2NUBA 1HEYA 2VYCA 5DCLA 3S99A 1D5WA 3RVMA 1DG9A 3LUJA 2PKXA 2PAFA 1MVOA 1E6KA 1M5UA 3Q41A 1SXIA 3F73A 2DRIA 5DGCA 5JS1A 4JB0A 3EGCA 2ZWMA 5GOTA 1DBQA 3MM4A 4TN5A 4RWEA 1ZN2A 2V0NA 4S04A 2LUOA 3FFWA 2YHBA 3OQMA 4KVFA 4NCAA 3KSMA 1BDJA 2KYRA 4MQEB 4PZ0A 4WXEA 4D6YA 5T3YA 3IDOA 3TO5A 3ILHA 5F64A 3SNKA 3SQNA 5KI6A 1ABEA 5KQGA 1K68A 1ZDMA 2ZAYA 3A3KA 3T6KA 3O21A 1FFWA 2FVYA 3NBMA 3NNSA 4F11A 2BGGA 2PUAA 4O1HA 4YGXB 4Z4HA 4MS1A 1C4WA 3I42A 1JFTA 3O74A 3N75A 4RV5A 4ZMSA 4PE5B 5JNVA 4LDAA 4YRZA 2F8SA 3N0XA 4L4UA 2PL9A 1YMUA 3B2NA 1XHFA 1NXWA 3N53A 3H1GA 3OLVA 5E3JA 3C6QA 1M2EA 3ROTA 4Q6WA 2QSJA 3QELB 2FEWB 1JYFA 5IBQA 1D2AA 1VRVA 4Q7EA 4Z9AA 4S05A 3HO1A 2AYZA 4QYWA 4EYKA 3P9YA 3LTEA 5HSGA 5BQ3A 1A0OA 2IPAB 1GCGA 2RGYA 3H5LA 1MB3A 4F06A 3CRNA 1P6QA 3EQ2A 3MQ4A 1MIHA 3QEMB 3FMVA 2IOYA 7ABPA 1RZRA 4OG2A 3KYJB 1QQAA 3EULA 4Z9BA 2A9OA 2WRZA 8ABPA 4W5QA 3KJXA 1VKRA 3LUHA 2B1JA 4IMJB 5CHYA 4D6XA 5IX8A 1LBIA 3HJFA 2FW0A 4DN6A 2VUHB 3OLZA 2VK2A 4G0YA 5TE9A 2OQRA 4FE7A 4YV7A 4MQEA 4WZZA 3GV0A 3W9SA 2FEKA 4G0XA 3R0JA 3H6GA 1NXOA 3A10A 3O1HB 1Z13A 4GNRA 4WWHA 2GWRA 1RNLA 5ED4A 4W5OA 3HXMA 1F51E 1EAYA 3CS3A 4GPAA 2JK1A 3H5VA 3LUAA 3QX9A 4RU1A 5JNWA 2M98A 1YVUA 2PL1A 2RJNA 1D1PA 3E3MA 4YS6A 5JNTA 5IUKC 3QLTA 4M88A 1NXXA 4XFKA 1Z15A 1Z2EA 1DBWA 2J48A 4YWHA 5HQJA 3C3WA 3OQNA 1QPZA 4KZKA 1H9CA 4TLLB 5HKOA 2PUFA 2L2QA 4Z4EA 3UK0A 3D02A 1E6LA 4Y9TA 1USIA 4E7PA 3RH0A 3QEMA 1TLFA 4EVQA 1S8NA 2JVJA 3BREA 5T7BA 2PUGA 4LX8A 1M5TA 3KTOA 4WUTA 2CWDA 1Z25A 3GWGA 2CHEA 1EWVA 1J56A 3IP7A 2X7XA 3KKEA 1B00A 2ID9A 3A0RB 2PUEA 4MR8B 4TMYA 3OMWA 1EWKA 1BAPA 3QEKA 3CTPA 1GUDA 4MAAA 3H5OA 4OBBA 1EHCA 5FWXB 5FBKA 5IEJA 3H75A 2H3HA 3D8UA 1XHEA 2NT3A 3OO0A 1A04A 4NV3A 3L6UA 5BRJA 1ZHHA 1JWLA 5EWJB 4ZYLA 2P4UA 3GA5A 4HNQA 3RVQA 1DCKA 3GT7A 3NNNA 2NZUG 2CHFA 3VNBA 4H60A 4RKRA 5CNMA 3SG0A 4H3KB 5KQPA 1U0SY 5DLEA 5IULC 3EDCA 4HNSA 4MRMA 4XARA 1U8TA 1Z12A 1TVMA 2FEPA 2QW1A 3HEBA 2IYNA 4LDZA 1R8JA 3OO1A 2O20A 1QP4A 2AYXA 3QLUA 4N03A 1NXVA 4MQFB 2OENG 3H5WA 4JP1A 3KHTA 2MSLA 3IPAA 3DGEC 3GYBA
chains in the Genus database with same CATH superfamily
4Q7LA 1KVQA 2W2QA 1LDGA 1KR2A 5G41A 3KOUA 2ISSD 1UBEA 4GI7A 5BO5A 3THWA 5KHOC 2ZSFA 1WP9A 4LF7B 1RHMA 5ER9A 1WUTA 5TC4A 3BQ9A 4E3ZA 1WB9A 1QS0B 4HDSA 1DC6A 2PGAA 4RF3A 4EW6A 4NCJA 2YIDA 1TJ5A 4O2AF 4KPFC 3LBNA 5IBRA 5LQCA 4G1EB 1Z6YA 4FWIB 1L5YA 1MB2A 3KL2A 3KB2A 2EQBA 5LBUA 1OKKA 3D3NA 1OX6A 3GROA 5F4ZA 2HH9A 5T6BA 5DGHA 1T36A 1R8QA 3RVBA 2P3LA 3RTDA 1CR0A 3E8XA 3PF9A 2CFCA 3DT6A 5KVAA 2IXFA 1TVEA 2ESRA 5IC5A 1N5MA 4TVOA 2P2ZA 2XRFA 3QLVA 2GF2A 1RFLA 2XVMA 2ZW9A 4I5EA 1KS2A 5EPOA 4BBAA 4DS3A 4PZYA 4OJQA 1DDIA 1MJ5A 2CVOA 3EC7A 5JDCC 4AQDA 4EJ2A 1W47A 4ZYTA 1EUDB 3LUBA 2AWOA 3FBTA 3SDZA 3SSOA 2DBVO 2HHAA 3N8IA 4HQRA 4XGRA 3R44A 1YQQA 3TLZA 3KIPA 1U0LA 3UJ9A 4I6GA 5EA2A 1DJMA 1LLUA 3QPBA 3B51X 3TW8A 1GZHB 2Z3ZA 4GFDA 3PGJA 3NYIA 3ESYA 3MZ0A 3T61A 3WLNA 1TTTA 4XGIA 1EVLA 1J5XA 3DDUA 3BD6A 1OGJA 2W6IA 4LQ4A 5FLKA 3HCCA 4ZVNA 5JC1A 1UDRA 1WNFA 3IUSA 3QSGA 4QBKA 4R05A 1N75A 4N82A 2IHKA 2CUTA 4QIHA 3IXLA 4YASA 4K9DA 5DIFA 5C5EA 3G79A 4LRWA 1AKNA 1C1DB 1E60A 1Y9AA 2C5AA 1FFSA 3IKJA 3QV2A 4W7HA 2FQXA 3TRDA 2WUEA 3PFNA 3ZHCA 4A5SA 3ISTA 3K2IA 3TKAA 2XKJE 1U4NA 2PX2A 1SWVA 1GR1A 2WMNB 4INJA 1U8ZA 1SZDA 4XI9A 3R5JA 1RXCA 1UJMA 1W75A 2B4KA 3WKBA 4WOKA 1MQ9A 2P9ZA 3W3AH 4IGAA 3R77A 3T9FA 3V5NA 4CF4A 4YAKA 3RSLA 4HP8A 1O6FA 3CIOA 3AYXB 5FA8A 3LY7A 3MWEA 5I9SA 2CLLB 3DE0X 1FNNA 2BD0A 2J59A 2OV3A 4IUDS 1WKCA 5IF9A 3T38A 1Q57A 1TJYA 2PNFA 1TI7A 2YN0A 3CG4A 4UXIA 3V8NA 3ZNPA 4EHBA 2QNIA 3CUWA 2BTQB 4KQHA 3REQB 3DAFA 2XB6A 5EY5B 3THXA 3DW3X 4BMNA 4E5MA 5CLJA 3VPDA 2IXEA 2JGDB 5BUCA 2YZMA 4JITA 3ELDA 3RFFA 1N34B 2NP7A 1QIFA 4LYGA 2WVAA 1QQ6A 1C1YA 2AVDA 2CNOA 3F3KA 2BRUC 3QKUA 4FBLA 4X7RA 3NT4A 1X7XA 5CVCA 5TQJA 4EI2A 5TQ0A 4J0CA 3V80A 3OCYA 4WASA 1MA3A 2QMUA 4KLNA 4LHXA 1Y8QA 4PO3X 3VKUA 1U0FA 3KYCA 1S8FA 2QZZA 1U7XA 5DHSA 1R8YA 4OVKA 2QD2A 3QK7A 1S02A 2OFFA 1Y6QA 2I3BA 3GDOA 3DL7A 1NQTA 2AD5A 3LUCA 1DX6A 4LECA 5DTRA 2UZ0A 3D4NA 2WSLA 1CQXA 1WAMA 2JLSA 1G7TA 3FSGA 1Y3BE 5DGDA 3UM9A 4B8YA 4W5JA 4Z4GA 4A03A 2M9MA 1E2IA 3PC8C 3W4JA 3B12A 4MW4A 3AHDA 3EYAA 2C4KA 1JR2A 1XI2A 2J32A 2FB9A 3K15A 4V2UA 1WTAA 3O8BA 4UNIA 4LS3A 4X8HA 4YP6A 5ICEA 2QD3A 1ARZA 3PNVA 3RQIA 1ODCA 4N65A 2HMVA 5K8LA 3GGJA 3BRSA 2FPGB 3PP8A 1XDUA 1HSZA 2WZQA 2X23A 1X1QA 4M21A 1TFUA 3GG9A 4PICA 4W6QA 5DLDA 4JI8B 1NKTA 1FP6A 4O4IA 3Q3CA 3TX2A 1ZOSA 2G5CA 1Z7WA 1G8KA 1NRJB 2HOQA 1IOZA 2VHQA 2I55A 1YZGA 4GF5A 3JQ9C 5ALTA 3NC4A 1FZTA 2CYBA 5FBQB 3P71T 3FNGA 2J4CA 3JWEA 3TH5A 4HO1X 4KDCA 3RBVA 3OCJA 3ADKA 3IODA 2P2DA 1TKAA 3W79A 3VPAA 2JH3A 3TD6A 1I1NA 4XLTA 4YRRA 1U9IA 2PGDA 2B8NA 3C5WP 5ALYA 4G63A 1DQNA 1XYVA 2J3HA 3KYDA 4RMGA 2XITA 2Z43A 4LNHA 4QODA 1W0JA 4REMA 2GZRA 3EFHA 1B42A 4B48A 1KRHA 3UPTA 2A5DA 1YZUA 3FUWA 6AT1A 5EJ8A 3PDIB 2QPOA 1HX7A 2ZZNA 4UPDA 2FTKE 2YJ5A 2FWMX 3UMFA 9ATCA 3NC0C 1Q0ZA 1DUSA 1Z5PA 1E9FA 1DIHA 2B1IA 3BDAA 3CEPB 3EUEA 4L07A 4L5AA 5H16A 2BZ1A 4C0QC 3FLEA 4BEBA 1H4QA 1I3CA 4MMYB 3L0BA 2Q28A 1DO8A 1OASA 3GLVA 3GVHA 4KLCA 3ZEAA 1H69A 2ZE7A 4HGPA 3N76A 1N2CA 3C14C 4BNDA 1FFXB 5F35A 1RCUA 4JX9A 4NK4A 2YMQA 4R81A 5TQ2A 4ENSA 4DC9A 4EY6A 1HMPA 4K6MA 3DQPA 1A2BA 1UADA 4BC1A 2IHNA 3RBAA 1K4MA 2DULA 4K6GA 1IUKA 3BCUA 4MI1A 1G3RA 2SECE 4NHOA 3V7NA 4DC1A 3ZWOA 3IAUA 3EHDA 1SA0B 3PYMA 4FMPA 2CLEB 5D7BA 3OTOB 1QZXA 3HG7A 2ZIXA 3V4SA 2Y92A 2IZZA 1OD6A 4LRSB 1OHHD 2VQ3A 1E6WA 5KVQA 3SC3A 4IFEA 1VIVA 1JBQA 2P4EA 4MUXA 1XWWA 3DZKA 3WV5A 4BPBA 4YRMA 4F5YA 1BCSA 5C8VA 2F1OA 1ZNZA 3Q8MA 4LXGA 1CERA 2GH1A 2BT4A 1DXQA 3SEAA 4IYJA 5JS6A 1E7RA 3H2YA 3JQFA 4H7FA 4NDNE 2ZBUA 3VR4A 3GLQA 2GEFA 3BXZA 2M32A 2UZAA 4ZO4A 3W78A 4EHIA 5AK3A 4CRWB 4LRYA 1LVUA 3O9VA 1XKQA 4DLUA 1HEUA 4NENA 1T25A 2GZMA 3PHBE 4TRNA 3TLKA 3EIQA 1U3UA 1UPUA 3TG8A 4OP3A 1YKGA 5HM8A 2EF0A 3KTAB 5G0VA 1UKYA 2HRDA 3JXEA 4V0LA 3LS2A 4B74A 4DIKA 1E3WB 4DNQA 3ZJTA 1W5AA 3MQFA 3H8WA 3SGLA 3CW9A 4BDTA 5K5EA 1K7EB 1DUIA 4P4GA 2E4WA 4ZTUB 4G5XA 1W25A 3JARB 4KQCA 3DS8A 4YCSA 2VT2A 5FI0B 4ZMBA 5K51A 2CDAA 3PNQA 4DEVA 3M0EA 4HYQA 3EX7C 4RUKA 2HV9A 3ZCSA 4PZCA 3W8RA 4C6TB 1QFSA 4OYLA 4CODB 2YFYA 5AKHA 1KJNA 3OLWA 3PGKA 1JSRA 4GZLA 1SCBA 1RMQA 2FW6A 4HZUB 2ZB3A 2I1WA 1FFYA 1MFZA 3LA6A 4GLJA 1NBMA 1ZG3A 1YS9A 2WVJA 4YRDA 2E4VA 2CCJA 3ANYB 4QQFA 3CX8A 3A14A 4BVLA 2Y77A 4MR7A 4E46A 3ONFA 1N8KA 3BVPA 2ZJ6A 3V8EA 4YT4A 5CVTA 1QH1B 2ODPA 2JLQA 13PKA 1I2ZA 1NRWA 3TZ6A 3OCVA 2BEVA 2E18A 2RCYA 3EEBA 3U3KA 3UMRA 4B4UA 1RVDA 2J0QA 5IKMA 2P9YA 4B7AA 5FTLA 4JX8A 4PY2A 4L4XA 2RB5A 4RIEA 5F76A 1XZDA 3VBEA 2DKFA 3HR4A 4MROA 3GJ4A 4H0FA 4MUGA 4PNZA 3WWCA 1KMNA 2QRUA 5FULA 4NZYA 4DA4A 1HXHA 1MO4A 1I8TA 1D9ZA 2GHRA 4H7IA 3G7SA 4OFXA 3ZNQA 2QAGA 4F9TA 4Z7JA 2YICA 2I7TA 2F67A 1K2VN 2YMMA 3VUEA 1JR3E 2B36A 4HYEA 1H2BA 3VR5D 3IS3A 3CMMA 3G5MA 4LHYA 3E03A 1E6EA 4H7DA 3AO0B 1IJEA 1AKRA 4PYMA 1D6JA 3LKZA 2J0UB 4E22A 3NVKI 1NVEA 1U0GA 5M7EA 2DWQA 3PXDA 4LXQA 5KPDA 4N5MA 2G63A 4HMOA 4JI2B 1CUWA 1RU3A 4OXIA 5BYKA 2C5FA 5FNVB 3KKZA 4TMKA 2IEZA 2X2PA 2PGLA 2QE6A 2WKPA 3LUJA 5CBPB 4RVUA 3NDBB 2O2CA 4LBVA 3ZV4A 2HMTA 4HNAB 1DX9A 2WJPA 5CVUA 3FSEA 3EXIB 5FHQA 5HCNA 3AF6A 1AS2A 1WUYA 2DRIA 2AQKA 2G88A 1QYVA 2FSVA 1NUSA 1V1JA 2ZRMA 3EGXA 1ZMOA 4HX9A 4I1IA 5GOTA 4QJ3A 2D4HA 5F7XA 3NEJA 1EGAA 3TL2A 2Q2WA 4N5NA 4YBZA 5JSUA 1Q15A 4H7PA 1OWOA 2UZIR 2VBCA 3PDUA 3FFWA 4P92A 2KBFA 2V5VA 3RTBA 5E4JA 5ANRB 4M8LA 2RARA 3BHNA 2JHFA 3IDOA 3TO5A 1DWPA 2PD4A 1N8NA 3RS4A 4BCDA 2XAUA 5JI2E 2WSSA 1KYQA 3AF5A 4IJVA 3TK1A 4LJRA 1UC5B 1EFRD 1JEQB 1J9EA 2FVYA 2RD2A 5CGZA 3OX1A 3HBNA 5HZHA 2Z5GA 1B0UA 3FYUB 3PWZA 3KSRA 5AUQA 1JFTA 4S0ZA 4O0LA 3JQ8B 2Q99A 2SCUA 2WZDA 3L6CA 3QVWA 1Z0UA 4HBGA 4FIZA 5AVOA 1H3EA 4B4DA 1S4MA 3DEIA 4KXQA 4MW6A 2I87A 4XUEA 2FEXA 4M0EA 3FF1A 4RA9B 2ZJ8A 3RF7A 821PA 4C7OB 4F92B 4NYJR 4LXIA 2V97A 2QSYA 3I92A 1M34B 4O4LA 2IHJA 3GJ6A 3HO1A 4YJKA 5THQA 2QAJA 1NPTO 2EYQA 1CB7A 4W1PA 3VZRA 4A73A 1KYTA 3H5LA 3TPZA 2DFVA 5C7IO 3CRNA 5CX4A 1RZRA 4PC6A 2QDKA 3OFJA 3VVMA 3L7MA 3QXXA 4QJIA 2ZSHA 3EDQA 3H65A 1O96A 4FXOA 5CDTA 3I6IA 3P9XA 5BVGA 3PT9A 1FXUA 1UMBB 1KJJA 4FW9A 5JPIA 1T43A 2LE0A 2NU7B 1SQFA 3INGA 3ETGA 1J0AA 2C59A 4GX0A 2Y0CA 3BHMA 2I4MA 1CNFA 2J7KA 2QUIA 1DXHA 1MC1A 3G2MA 3HKDB 3M6UA 4FE7A 1J6UA 1E69A 4CIXA 1P1RA 1XZKA 2DY0A 3PFHA 2NP6A 1F12A 2B20A 5HUHA 5EXEA 2BMJA 1J39A 2FZWA 1VDZA 3PZRA 3KZNA 5BSRA 3H0EA 1CE8B 5FL7D 1Q12A 4OQPA 4JCOA 3B7GA 1EFPA 1N8TA 4S1PA 1A9XA 4KQEA 1AU9A 1L7DA 2AJDA 2FLVA 3LC7O 3MRTA 1E2MA 3SEZA 1N9GA 3L41A 2BFEB 3WWOA 3VKHA 3EAQA 2H2AA 3PWSA 2BFCB 3AEQB 2FPOA 3E22B 3EUFA 3H7IA 4LQCA 2JKVA 1ZPDA 3I9MA 4LXXA 1YVUA 5LQAA 2BI4A 3YASA 2I3ZA 4TKMA 5C35A 1EZ1A 5J2TF 4RS4A 3RAJA 1QXSA 1RKUA 1PF7E 2PMEA 1N3LA 1N3BA 1NM5A 1R9JA 3LUPA 4G0NA 5IVPA 1ISGA 2E9SA 3Q4GA 4PPGA 2G0AA 3UH1A 3GFPA 5E1DA 2B34A 1A2QA 2C9YA 2NUPB 3FJYA 3HMQA 3NWJA 4IPTA 4JLVA 4KVZA 1QYIA 4KXLA 1T13A 4BCBA 5JXJA 4K9KA 4B35A 3EH2A 3D6MA 5EKTA 1N6NA 3ED5A 4PBTA 3E27A 3CUUA 2REBA 5AKLA 4X92A 3GDGA 2QYHA 3PXEA 3TEMA 5FBLB 4EY5A 1QE0A 1FYFA 9MHTA 3OMWA 5G0WA 3N2YA 2MU1A 3CTPA 1Y5LA 2BP7B 3UMYA 5IJ9A 3NBFA 4V0QA 3X3HA 4IL5A 4CUKA 1D8TA 1QDEA 4TZ0A 4BGUA 5CXQA 2O2YA 4HFMA 3ESBA 4E5PA 5EJEA 2B5OA 5TX7A 4CDGA 1DKQA 4PGHA 4WACA 1IQ0A 1PJLA 1CZRA 4OHWA 3U56A 2BVNA 4ZIRB 4AMBA 4HGNA 4ABTA 3BMOB 1SCJA 2CHFA 3DPIA 3K5PA 3NANA 3P9SA 4OSOA 5WRFA 3LSTA 5BSKA 2DETA 3VNBA 1G3MA 1ANKA 2I54A 4H60A 4TWAA 2C4WA 4EG6A 2WTMA 5KQPA 3LC2O 1JXMA 5IKEA 1AXRA 1P72A 2CEAA 5CLLA 3AVPA 2K4MA 1NLMA 3I2HA 2HB6A 3O8QA 4X41A 4NBVA 2EW8A 1YB1A 4E6EA 4EK9A 2G9UA 1LDMA 3PNLA 4E07A 2C20A 3K4PA 3U3ZA 1TNDA 1G8FA 1NXVA 4NBUA 2ZSIA 3H5WA 4UW9A 2IXAA 4PHCA 2TS1A 3TPFA 2H59A 1PK7A 1FQJA 4IJMA 4MWGA 4XYLA 4ADSG 4KUEA 4ZQGA 2WD9A 3NALA 5ECGC 1Y1SA 2DMRA 2H63A 1PD0A 1Y8RB 2Z98A 4TM7A 4CKCA 4B0OA 5BY2A 1RQRA 1YB6A 2VSXA 2C4UA 3GB9A 1NV9A 1OLSB 2OCGA 3TE6A 1YQDA 5IF3A 2BEWA 3OKAA 4D79A 1I32A 3L0ZA 1E6MA 5EHGA 3D64A 3N2EA 3DPSA 1VE1A 4NFSA 5BR8B 3SHFA 2P1DA 1NZFA 3JPYA 4FYKA 3FPFA 4G37A 2O3RA 2QXYA 3PEEA 2C3UA 4GOOD 1LY1A 1N0HA 3EXG1 1BHSA 3NKFA 2BL4A 4MV6A 4QGBA 3I8XA 4MVJF 4Q4CA 3MTGA 1YBMA 5CXSA 4I0WB 4RK4A 4GKAA 1T5OA 1U0TA 2XYQA 3R6LA 3ZDQA 3WK9A 3K96A 4OB6A 3OCWA 3STXA 3VV2A 3LQQA 4CQLB 4R83A 3CPEA 2BWJA 3DFZA 1WBDA 3RSQA 4B7XA 2J6HA 2VF4X 3CLTC 5YASA 5L3SB 4LMBA 5IZCA 1EFAA 3VNRA 3X2FA 4ZYWA 2GN1A 3UUWA 4CEHA 1PRYA 3WK8A 2VUTA 5B6IA 4QOIA 5KNDA 3K0FA 2NXJA 4HLDA 4CZ2A 2IHTA 1M33A 1O95D 2AC2A 2X14A 4JQOA 3TCXB 5HPYB 4IZOA 4NXMB 1OTXA 1MQ8B 1MV5A 2JIRA 3P9CA 1P61B 1J99A 5IANA 3TSZA 1B15A 3TB6A 4Q12A 3ADOA 1QM5A 3MELA 4HC4A 4IDOA 4PO9A 1BOOA 5BW6B 5ENDA 4DLKA 3F4LA 2YX1A 4F7WA 2OTCA 2ODBA 4UD2A 1PBNA 2PY6A 3E70C 4X1YA 3UKOA 5A4DA 1V47A 3OZWA 3FFXA 2UYQA 3HV0A 2M2IA 2A86A 3HY4A 2R47A 4MQ5A 3S7ZA 3DPUA 3JQAD 3VSBA 4R41A 2AJTA 2YMPA 4AUEA 3A4VA 3SIWA 4BU0A 2BCJQ 3GCDA 1IZ9A 3QF4B 1NBHA 1U8XX 4G85A 4GM0A 4L4ZA 4CIVA 1RZUA 5CA1B 5CFPA 1STOA 4RJIA 3NM5A 1FTNA 1KXJA 3AR9A 3CUTA 3DZFA 1FOEB 1E4YA 1N2GA 3LBIA 3RVPA 1TZJA 5J58A 1X80B 4MJLA 2AN9A 1UAYA 2EWWA 7GPBA 3RBXA 4FFOA 1BA2A 4HNHA 4NU8X 4D25A 1L1FA 4HHEA 1OLXA 4HCJA 4F4HA 2YS7A 3PA6A 4HEJA 5HIMA 1JDPA 5T5QA 4Q15A 3ZN2A 1P91A 1UPFA 3JVDA 2CHQA 2Y1DA 3M33A 2B2NA 1KK3A 2CVQA 1QKKA 5DGXA 4EF5A 3ECAA 4EG3A 2DERA 4GRAA 4YPOA 3KUXA 3P2KA 1CFZA 2IPNA 1XD9A 2XSZA 1IDN1 1TLLA 1BS1A 2J30A 3ZE6A 1U04A 3GMIA 3KPUA 2EFGA 2JATA 4OGKA 4ZVTA 1APBA 1AQIA 4ML3A 4ZYUA 4QT0A 2OHHA 4W63A 5EZSA 1H4VB 4J6EA 2EXXA 2ATIA 4R4JA 1JECA 1WB4A 1V4NA 2R6JA 1C7RA 5LR6A 2Q4DA 1M2NA 4CCYB 2WWVD 2A57A 5F1KA 3F4BA 4NAUA 1RM4A 3ROEA 2FPWA 3AKEA 3VSEA 3G2PA 2BZ0A 3HL0A 3NRCA 1SK8A 1YGPA 3DKIA 3FA2A 4KOAA 3ZK9A 5CDHA 3ZQ6A 3FWKA 1A7KA 5HDBB 3OQPA 2JI9A 3VU9A 2WF9A 4L74A 4P2GA 5KTRA 1XTPA 3ZZTA 1VSTA 2WHPA 2PXCA 3KG2A 4FQ7A 1Q7GA 3T3MB 3WHPA 4ZCSA 1XEXA 1GPBA 4B6OA 3H1TA 3X2EA 4YJ2A 3V6MA 1TT7A 3E23A 1RPZA 1C2TA 2REQA 3O3OB 1JFSA 1ZQ9A 3IDSA 5I9IA 4ZCIA 1ZA1A 1JKMA 2O2XA 2XB9A 3H2ZA 2X6RA 4M86A 1F2DA 2YCBA 4C3VA 1Z39A 4R9NA 2HSWA 3ZZ0A 1KBZA 3M6FA 4DG5A 5BN4A 5AW1A 5JS7A 1K6IA 1JIJA 2JJ2A 1T9HA 2MYPA 1F0PA 5AW2A 4H1WA 3UT5A 3TSCA 2CUZA 4JL6A 2G4CA 2JC3A 1SVLA 4GBED 4H1UA 1JIKA 3SXPA 4IDDA 4V0KA 1MO6A 2NZVG 3HV2A 3TMKA 2AKEA 4ED9A 3IBSA 2IPMA 1GR0A 3S55A 5AKGA 4F1WA 3KHSA 1JXAA 2ATXA 4X8OA 2HRQA 5JFTA 1DIBA 3GMSA 7ADHA 3ZD7A 5FWNA 1WJGA 1LS6A 2ZYUX 1A71A 3A4MA 4MQBA 3PRKE 4YTEA 3WLIA 3HADA 1NR5A 3BTSA 1L0BA 4II2A 4MW5A 3X44A 2CB9A 2J5KA 4QDXA 1T5HX 5IMSA 4MB6A 4A7PA 1YCDA 2IYAA 1CP3A 4O4IF 1WSDA 1JE1A 1SRQA 1VLLA 3SBXA 3CZMA 5LXTA 3QE9Y 2FZCA 2JA2A 2O5EA 3AY7A 2NXCA 3A4NA 3Q7EA 4YLEA 4BUJA 5HS6A 3ESAA 4JC8A 3QVMA 1PDWA 1UMCA 1OQAA 3W5AA 1IEVA 1QGUB 2YWJA 3S7TA 3GUHA 2HWKA 3LQ1A 3UMSA 3QNMA 3T1NA 1QU3A 2BF7A 1W9HA 1GP2A 3D4IA 4KN9S 4WAUA 4DFDA 2C03A 4RV9A 5EIOA 1I80A 1QHIA 3CLKA 4OHUA 4S3MA 4UAVA 3JQDA 2AB0A 2X5XA 4TL9A 5EE9A 3ZJ5A 4YIKA 1RRMA 1J2YA 1W5EA 1SD2A 4WERA 1JLLA 1IIBA 4MKXA 4BGVA 5BV0A 1KP2A 4URUR 3OKCA 2FSHA 1ODSA 1FP4B 1E79A 4QGGA 3CKMA 2ONYA 2GHQA 4TKVA 3IMEA 4XM1A 5A03A 1Q7CA 3H7AA 3ZCVA 3OZFA 1CJUC 1F8YA 5BR7A 2WTBA 3L0CA 3Q7SA 4NXNB 4Z0HO 2X0JA 4HGOA 1VG9B 3AP2A 3WB2A 3SFTA 3WFIA 1QPGA 1Z0ZA 1CRLA 3G59A 5C4GB 5JH7A 1C0EA 3KWLA 3K05A 5JLJA 2JCSA 4JC5A 3E9RA 3RB8A 2W4QA 4Y1FA 2Y1EA 4B33A 3KR2A 1EK2A 3G5LA 2RH9B 3WLSA 1LLQA 2QTBA 5ERYA 2J3MA 5JTUA 1ML3A 4W1SA 2F3PA 4B2PA 1P5JA 3UMBA 4JA0A 2Y1CA 2PX6A 3CURA 3MWKA 6CHYA 1HT0A 3EODA 1QUFA 3EXHA 2EHDA 3WO1A 4OXNA 3R0QA 4P4UA 2RI1A 1SXJC 3PCXA 3ZKWA 4NU6A 1Z0FA 5EE0A 3EIOA 4DUGD 3RYCA 5IM5A 4RL4A 1B1CA 2H00A 2UZ3A 3OI7A 1XVUA 4OQ4A 3SAJA 3TYXA 5L9AA 3S8EA 2PJUA 3T7SA 5IYZB 1R50A 3V3KA 5JISA 2DUWA 2ILVA 4J4TA 3E81A 3SQLA 4GGOA 2H65A 2HQOA 1N33B 1T0JB 3QELA 5EP4A 3DYVA 4I9HA 1MEOA 1OXTA 4S35A 1A8HA 2OLEA 3FI9A 4WZBB 3WLKX 4BFSA 1BVHA 1GARA 1MGPA 4G0MA 2ENUA 1JZSA 2V6JA 4N0DA 5HE9A 1NBIA 5IBPA 4EVRA 1ULHA 1PL6A 4ZVOA 3FOAA 3KEQA 2PYDA 1H6DA 4PX9A 2QMZA 1YRYE 1E7WA 1OROA 4GL4A 4OUDB 4WOCA 1G21B 1PBTA 4XEHA 3LZDA 5DSXA 2WJYA 3RGWS 4N6NA 2O5VA 1RD4A 1I24A 2WT9A 2R00C 1K3UB 2DFLA 4KGVA 1P0QA 1VZ3A 4X60A 2XYRA 2EJVA 2IKSA 5JATA 4WW0A 4WN3A 5I8ZA 3BL8A 2IHVA 5LIPA 2OB1A 4Y9RA 3X1YA 2IIQA 2R48A 3FY4A 5DW0A 1ZUIA 3H6KA 2UVPB 3EGDA 1V7PC 1GN9A 2VZ9A 1KFEB 2AOWA 2B25A 2FGKA 4QYIB 4RIIA 1HURA 4UHDA 3D31A 3KZXA 3PV0A 2P79A 2WZCA 1MX5A 4GR9A 4PLWA 3E6AA 2J7PD 5EIFA 5CFLA 2J3EA 3ZWWA 3QY9A 2QVBA 2XHEA 4MYRA 5F4BA 4FZJA 4TUYA 5IWAB 1Z3CA 1B26A 1OMOA 1TD9A 1QHYA 4CTMA 1KVUA 2VDQB 4YCNA 4XRGA 1U3FA 4MVJD 4Y2PA 3K16A 1OT5A 1TQDA 2VYCA 1M0WA 2JHCA 3KB6A 3M8KA 1X1CA 1QOPB 2QIOA 4QYSA 1BXGA 4URWR 3OCCA 2CLKB 4CNQA 3Q6NA 1E4EB 3GQBA 4DR6B 4NPCA 5EIAA 4UTPA 4JBGA 4YRNA 5DDIP 3CNHA 4M0DA 1R16A 2C2YA 3CISA 4MO2A 1RKVA 4KG7A 3T5BA 4DCCA 3H4MA 3KKNA 4UOZA 1Z5ZA 5AI6A 1W8DA 4KNVA 3GRAA 2CEKA 1E9SA 2DY1A 2XMGA 4HVCA 3V6LA 1A77A 5KYXB 2ZPAA 1VSVA 5B1DA 2Y67A 3EXEA 4NYMR 4ZI3A 3E2PA 1X0VA 3A70A 4UAUA 2BBSA 2ZWPA 4YXFA 1NPDA 1ZNQO 2ZAYA 1GL3A 1PN3A 2VTKA 1XKXA 3AI1A 3GNLA 4MV0A 5DBEX 4KXUA 3W8NA 2I3AA 4W6ZA 3UHOA 5BWCA 2O8EA 1P18A 1OKKD 5FV7A 3RUAA 2JFGA 1OIVA 3DMYA 4D41A 1L3CA 1LC0A 3FVTA 3JYHA 4MDYA 1Y6GA 3CWQA 3ZD9A 2CV0A 1MVNA 2NZXA 1AY0A 4EF6A 4QA9A 3DQQA 3EGWA 4U1RA 4PYOA 5E9AA 4C5BA 3A32A 3EN0A 4JLMA 4Z9AA 2AYZA 3U39A 4FCTA 3P2MA 3I73A 2DWUA 3LTEA 1O9GA 2XUJA 5HSGA 2IPAB 2J9XB 4FCCA 5G3YA 3ZS9A 2QTFA 5DASA 2W71A 4AXXA 1NMYA 3NWPA 5CDYA 1CF9A 3L8ZA 5JHHB 5LLDA 4K05A 6GPBA 1T2AA 2CVFA 2W6ID 3RRMA 2VN8A 3PCTA 4YCLA 4FYVA 4E5NA 3D8TA 4J0GA 4MYUA 4ZT2A 5JBIA 3GN1A 2HQSA 2CLSA 1KQNA 3V46A 1KHTA 1OLUB 2GKOA 3I39X 3Q8XB 1TCAA 2QKYA 1NL3A 3S2YA 3GAAA 2OYSA 2DHRA 1P2TA 1M2GA 3EA0A 4BNVA 4F8YA 5KSYA 4KPUA 3HE3A 1CS0A 3ZGZA 1RJDA 2OAEA 2ZJ4A 2VSOA 3R0JA 1JB9A 1ZH8A 2C3OA 3QF7A 5EMJA 1Z0AA 3E5NA 3HVJA 3QOXA 3LPLA 5CX1A 5GJVC 3W2TA 5MGNA 2AV6A 5ALLA 1Z13A 1OF1A 3NUQA 3QVLA 4O4LF 5T57A 5FJJA 2F3TA 2ID4A 1I3OA 3GP5A 3PFIA 2QN8A 3BYZA 1ADFA 3UW1A 4F3RA 5E7JA 5JJ5A 4W5OA 1N0WA 3GP8A 4K46A 1CZNA 1QZUA 3CS3A 2IBMA 1P3DA 3QX9A 4PRYA 1FBNA 1YT5A 2RC5A 2WF6A 1GPDG 3ENZA 1DJOA 3JQ7B 3AJ8A 2R8PA 3BRCA 1HTWA 1KI3A 2OP0A 4XGQA 4XR4A 4RLHA 5BWMA 1TA0A 1ZRNA 3NTVA 4X3CA 1A9RA 5KBYA 4B9AA 2OXRA 3EF3A 1SKYB 4YWHA 2Q7OE 2RH4A 2ZJ0A 4RACA 3IKLA 5EZ6B 5ICCA 3HB9A 3GLGA 4Z4EA 4GSKA 2V4UA 4IIJB 2K7ZA 2J3QA 3BREA 1RHRA 5H8WA 1Z25A 5G0SA 3IJEB 3GBSA 3VXKA 1VLMA 2R6DA 2IQ5A 4N3NA 3VYVA 3ZK7A 3IUYA 3OQ1A 5ELLA 2RFLA 2B4TO 4MPPA 2PA3A 2BI8A 2E3JA 2PJRA 1KHHA 3WWYA 1MV8A 2R3SA 3KSUA 5DNWA 3M2TA 2KHZA 1EUCA 3FSGD 2RGBA 1JDUA 3OO0A 1YZVA 1JMKC 1M0TA 1RXSA 3DMFA 5CYFA 3BJIC 3DBOB 5EWJB 4ZVUA 4MIYA 5TDHA 3UT6A 3WBJA 4HNQA 3ELUA 3HKEA 3A6GA 4GC5A 1GPWB 1GL7A 3FVWA 3GP3A 1KEPA 2A14A 5FL3A 1PV1A 4WJKB 1XVVA 1FUEA 2WD8A 3KV3O 4X44A 3QX7A 3D8BA 2L0XA 4JGIA 5DO9A 5AXCA 2PXHA 4M1WA 3KNZA 3OOYA 4K26A 4MWZA 3SJUA 3AFHA 5U1PA 4DJTA 1JWBB 1MX3A 3JAWB 2AZDA 2GZHA 2NO0A 1K4YA 1TVMA 2OCPA 3DBRA 2X9GA 2GZDA 3VOSA 4DZRA 2UZ4A 1T0IA 4OHCA 1TYBE 4FDVA 4AJNA 4OKSA 2O14A 3E35A 1VMKA 2MSLA 3L7NA 4MPDA 4UFNA 4FFDA 4LDQA 2BEUA 2G7MC 2PH1A 1T3GA 1TT5A 3PRHA 4OH7A 4CCSA 4INZA 1Y5NA 1RM5A 2HRRA 1KAQA 4BPRA 4E12A 2GGSA 4J8PA 2X5JO 4BJ1A 1PFWA 3I28A 1HO3A 5C3UA 4J1NA 2X0FA 4JENA 1PZNA 2RONA 4HNVA 1W0JD 2TMDA 2A9VA 2RHDA 4AU1A 1AHPA 2GPYA 1PJZA 2X1MA 4LYFA 1HV8A 5LBIA 4R1UA 1OYYA 1UT6A 3DULA 1FW6A 1EDZA 3OZCA 1IY1A 1WMAA 1X8XA 4RIHA 1VBKA 3ACDA 4CMAA 5B7GA 3ICEA 4LMAA 2E4XA 1OU4A 3FF4A 3CEAA 2QTTA 3H83A 4GLOA 5FPYA 3BEDA 4DKJA 2CVHA 3O83A 4RMJA 5K9ZA 4GL2A 4NY1A 4Y7DA 2X13A 3F8SA 4KP7A 4MVJP 4E30A 3F97A 2D5BA 2L17A 3IMCA 5A9SB 4ZT5A 4DJFC 3G8AA 2GBLC 2RBEA 4IIUA 4LSWA 1W36B 1YHZA 4C7VA 2QMOA 3DTVA 3T99A 1OH7A 5TT1A 2E4YA 3DZGA 1A4XA 3C3DA 3FJOA 1WL8A 3MJTA 5HMMA 3KSZO 2BFBB 1UOPA 2XF2A 5K4HA 3UB3A 1Z6PA 2FETA 5LU8A 1LW7A 3L7KA 3OT4A 2W43A 5GTDA 4W9NA 1QMPA 2YN4A 3ZH2A 3WJAA 1CQZA 5KSPA 1WDLA 2PU7A 1SUCA 5KOJA 3T9AA 2Z6UA 2GI4A 4M1YA 2VPPA 2QX7A 1T9GR 2RGUA 2I66A 3DOCA 4PQEA 3KALA 3KLMX 5E8JA 2H11A 3M6AA 3B38A 3PHHA 4QUEA 2OV6A 1DTWA 2ZVDA 3DNFA 4I2VA 1UOEA 4ZHQB 5FLYA 4QUHA 4WCFB 1GGMA 2M1ZA 3G2JA 1YDHA 4LXTA 1LWOA 2WF8A 3LQYA 1V45E 2RKBA 5FWYB 1DWOA 1ZK0A 4OX9Y 1BC5A 3VPBA 1L4NA 4PHHA 3RSFA 2B4AA 1ZESA 1V4BA 3QMWA 2ST1A 4OHKA 3JZFA 3Q5GA 5KQMA 4IF6A 1WZ2A 2H7VA 4C7MA 5SYMA 4JYBA 4GM1A 1YB2A 2QTGA 1GVNB 1R12A 1UDWA 1W2HA 4HDQB 2GKSA 3DE7X 4L08A 4QBTA 3SSMA 1QP7A 4FFBA 4B40A 5ALWA 4UMEA 3KYBA 2R11A 5ALQA 2HK9A 4EJSA 4BVAA 2IELA 4PYNA 3BFJA 1EP3B 2XCIA 3GGCA 1BW9A 4B9EA 5IAAA 3I09A 1TZKA 4KVAA 4XDYA 3O82A 1KY5A 3RVSA 1ZCZA 5ITZA 2UUPA 2ZRBA 4JUIA 2PBZA 2RIRA 1BE6A 2HRBA 3ML1A 1Z29A 4L9AA 4RZIA 4MUYA 5K0NA 5SZJA 4EA7A 3L7DA 5BSUA 3H5AA 2JFYA 2ON6A 3ETCA 4XD7A 1EG2A 2V98A 3LOPA 4AMVA 4PVCA 3WL6A 2QVYX 2BBOA 4O8CA 5ERGB 4EMTA 4LJ6A 2QVLA 5CK5A 1XO1A 2EX4A 4RADA 1NY5A 1XN4A 5BPHA 4KUHA 4RMIA 3OOSA 5E4FA 3C1OA 3IBFA 4UPEA 1R4MA 1YDWA 4HRXA 3AOEC 3GLHA 4Z54A 5J43A 5CT4A 5HUJA 2WJJA 2OCBA 3H5IA 3MN1A 2A1TR 4ZVSA 3COJA 1W73A 1WB5A 4IDGA 3UOWA 4RSGA 4QYTA 2FY8A 5F7JA 4RPLA 4RZSA 3INNA 1G8YA 1OAKA 1WIWA 2A59A 2FP3A 3ANNA 3M9LA 2GRUA 4LNUB 5B7PA 2X8JA 4QPNA 2HW8A 4L78A 5JS8A 4LKRA 1QNFA 4DUYB 1DOAA 3RFXA 1M54A 4IRMA 5GGXA 4AULA 2ORVA 3A1UA 4XWAA 5AWFC 4DLBA 4RD4A 3S81A 3L01A 2YH2A 4ZALA 2CJWB 4YAUA 3ADBA 1EP1B 2GCOA 1LS1A 1RLMA 3RJTA 1ORIA 3HHPA 4GEGA 3I04A 1O2DA 5SYAA 1J8DA 3MS7A 1CJTC 1P9LA 1YA8A 2OBXA 3P9ZA 4QL3A 3A9RA 3HU3A 4U0KA 2YXLA 4RNDB 5AFSA 1ISHA 5E95A 1PS9A 3BZBA 3PFKA 3BGWA 5L7YA 1Y1LA 4BTEA 1AZSC 1FX0B 5TGZA 3CT4A 5BYJA 4CFYA 4DLPA 4ALKA 2BE9A 2CGEA 1E99A 1M75A 1IN8A 1T6ZA 2PL5A 1DKRA 2H48A 2Z9BA 1W34A 1ZINA 2PX3A 1YNOA 1M0SA 3FYTA 3RREA 3W5DA 1IY8A 1NHWA 1SHTX 2H52A 1MH9A 2R2AA 3ROMA 1HOXA 3QBJA 3S70A 1ZA2A 2XYVA 4OKNA 2HPZA 4LWPA 2X8LA 4X24A 4TV8B 3KOZA 5F2KA 4UBIA 3D0RA 1VMIA 2EQ5A 2MSNA 1M2KA 2WVGA 1UFRA 1M6YA 1OCEA 1D04A 3TLXA 4YJ2F 4R71A 4B6JA 2RHWA 3E4DA 1JDZA 1P0FA 3JD1A 5DNYB 5L6LB 3L7JA 1N1DA 1SBYA 2DHDA 1REQA 4EG8A 4IDFA 4B2IA 4ZO9A 2WSSD 2X8AA 3ZXSA 2LRHA 2CFSA 4CMIA 3TXYA 2BTEA 4KE7A 5EKDA 4LCBA 1GAWA 1SC9A 3GARA 3FYCA 4K9LA 5C5CA 1AHHA 1BVRA 3U37A 1OGYA 1WKVA 2IXTA 2WSYB 5CXXA 2WAAA 3A1WA 3R6TA 3BTVA 2FX5A 3ER9A 1OREA 4GDFA 1EK5A 3ZE7A 3QYPA 3EGIA 4DC0A 2VJBA 3GNQA 3RIGA 5AVYA 1P7WA 3L7AA 3NIBA 4IKEA 4RD1A 1BXRA 1VHWA 4IVPA 2IOFA 3GDWA 2P5SA 3RARA 1PJQA 2P4HX 4Z9FA 3ZVNA 1BMTA 1ZL0A 3KQOA 3DV0B 3ADPA 4I5IA 1C3JA 2X2EA 1SQGA 1MF7A 1NVVQ 1QO0A 4DQUA 3V2GA 2Z3VA 1RE0A 5HMLA 1QVZA 2XUPA 3HVUA 5JRJA 2R1TB 4RVFA 1CF2O 4D0SA 1ZMRA 1VPDA 2OV4A 1PWZA 1ZW1A 2FEAA 3BOSA 3OJWA 2BW0A 4OA5A 2Z56A 5EWMB 1RZRD 4K0KB 4UBKA 4P54A 5B3JA 3T0GA 3NJRA 1XCJA 2V8BA 1GDTA 3TE7A 2I2CA 3OOJA 2K5UA 2Q0SA 1ZRMA 5LXTF 5BRAA 3C8ZA 1MD9A 2DFDA 1UMDA 4GBMA 1MT3A 4V2IA 5F5XA 4ALIA 5C8YF 3L6OO 4UHJA 4MGHA 1C30A 3NH6A 3OEHA 3U7JA 5LP6C 2C5HA 3NWEA 2GD2A 3X1DA 4CIBA 2YVKA 4GKVA 1NGSA 3I12A 4INPA 4X3PA 2EZ9A 1E5LA 1P60A 2QZJA 4FGKA 1PQWA 4YGYA 2EL7A 3A6ZA 3TZEA 4DMMA 3BS4A 1TECE 2JCVA 1J97A 2QN2A 3CU5A 4H9GA 4LMPA 4QJ4A 4UQPA 2P2NA 3AQ4A 1MQAA 1WDWB 2GPBA 3O8OA 2RC6A 3P2IA 4UHKA 4HDNB 2Z2IA 4WFIA 1DNPA 1FS6A 1ZHFA 2XUQA 1CEYA 3RPEA 1KEUA 5AKXA 4UZFA 1NIJA 2WU1A 4IINA 4WBNA 1BCRA 4ESVA 3Q5DA 3ASVA 2O4UX 4IDHA 4PSAA 3HP4A 2YZGA 5JD3A 4OJKA 3ZYZA 2IA5A 1Z4JA 8ADHA 1SOMA 3NBUA 4BZWA 5AW7A 3GCZA 2AG8A 5K03A 1UQUA 1DZ3A 2I3DA 1P3JA 2MOKA 4K6KA 4PR0A 4YY3B 3OF2A 2HMSA 1LV7A 4TS9A 4I55A 4P5EA 3ZY3A 5JH7F 3TVTA 2IIBA 4E1VA 1RSZA 3BORA 5JG7A 3T54A 4EHLA 1ORHA 3Q6MA 3ABIA 3D5EA 1JQKA 1FMTA 4RFSB 1N5JA 4KUGA 3U0BA 4OB7A 1NYTA 1AO3A 4J0KA 1F3LA 4HDRB 4LY6A 4C3ZA 1N5RA 4Y18A 4EEZA 2OCAA 4GSLA 3JAKB 3T5AA 2FG7C 3TTUA 3K70B 2I6TA 4HQKA 4FFNA 3KQMA 2ZETA 3LP6A 1PZFA 4DB4A 1PZMA 1Y6JA 1ML4A 1DG1G 5ARCA 5HK9A 3RU7A 2UUOA 3RVNA 3E3LA 3G17A 2AOTB 4KXXA 5H02A 3C6MA 4WY8A 3NHKA 4FPXA 1FNMA 1Q20A 2P2SA 5HRCA 4DR4B 1F4PA 3SJZA 1C9EA 3HL4A 2TYSB 2JLVA 4P5PA 2Z2ZA 4FR5A 1CULC 3KZ1E 2EERA 1Z4MA 5JPCA 1FSZA 1ISRA 2DTEA 4QQNA 5EMMA 5JNSA 1J5PA 1L4MA 4J94A 4YREA 1DKPA 1JHAA 4JU9A 4Y30A 1Y3AA 4FHZA 5GM1A 1THGA 4R68A 3I72A 3PLNA 5I7OA 1XTJA 1DAFA 1V7CA 5JYEA 5ICFA 5L45A 3RS0A 2GASA 1L8AA 1V8FA 5EMLA 3ZOZA 3PJFA 4KWTA 3UWMA 3LYHA 4AUMA 3D4LA 1SVMA 4F4CA 1L7PA 4HOYA 3UMMA 1DG9A 4N9QA 2WAOA 1JMVA 1H85A 2DE0X 2C9MA 4TTQA 4LRXA 1KL7A 1D7AA 3C3JA 4PAOA 2UZ1A 3GEDA 2ODNA 4LQDA 1T4CA 4IFBA 1DC3A 3ENNA 1DFIA 3OPYA 2A58A 4PFJA 2JLXA 2PV0A 2IV2X 4BB5A 3HCRA 5GZ6A 3LX8A 5EJ7A 1JR4A 3OOHA 5DM2A 5BN5A 3KVVA 4DV3B 2IYRA 5T3YA 5ISMA 3SQNA 2ET6A 4EKIA 1PGJA 1XRPA 5B1HA 3NAMA 4KV9A 1FU7A 4TUYF 2AEEA 3KT3A 1QE5A 4XX1A 1VYHA 1Z0SA 4G84A 3BMCB 4YGXB 1Z0IA 3JQBC 5FPPA 4QREA 2E5WA 3SYTA 5I4KA 4O2BA 2QBYA 1L5HB 1V7QA 3BHJA 3L6BA 4XYBA 2DPLA 1JHMA 3UBTA 1EVQA 4ESEA 3WMXA 4MV9A 3BK1A 5BUQA 1WWKA 2GZ1A 2V54A 1E9RA 3WNQA 4TTPA 1M83A 1P1BA 2ZPUA 3SVLA 1N5LA 3DF7A 5A02A 5AUNB 4WNYA 3TRHA 1WEKA 1JEJA 4G8BA 1Q11A 2PR2A 2QZ4A 2Q50A 3E7FA 4Y2GA 3IRUA 3WV4A 4Q7EA 4UFPA 2DM6A 5BSVA 4P0QB 2BMVA 2GVZC 1Z56C 1PL8A 1R37A 3BERA 3EJ6A 3HFGA 3MT7A 3Q3EA 4HLQB 5K3CA 3U9TA 1RAEA 3NTRA 2O2DA 4U00A 4CUJA 4LZPA 3HPQA 1XEAA 1NT2A 3PR2B 5IKPA 4CPDA 1FFAA 2OLJA 2P1RA 5SY6A 9LDBA 1CPYA 2FGJA 1Z2OX 1PQPA 4D6XA 1EVEA 1U2DC 1IRXA 5HOEA 2C98A 3W05A 4P3OA 3VGJA 4N6OA 1OWMA 3NOVA 2IYZA 4MQEA 4ZV9A 5F2OA 5D8DA 2WG1A 4WKPA 2FEKA 1QHEA 3ND6A 1BS9A 1GYPA 1TEHA 2P65A 1JG2A 4TOIA 4GPBA 3WLQA 3CZPA 5DMHA 1HL7A 2QVXX 1JJIA 2EFEB 3HI6A 2NTEA 3HZZA 3BIJA 4NAHA 1DX4A 1KZ4A 2PLAA 2PZBA 4HDKB 4IXMA 2IEIA 2CNNA 2PQ0A 4ZT7A 2GQ0A 2WSBA 1CIVA 1Q14A 4PLPA 4R9SA 3VA7A 2JLYA 5ALGA 2OVFA 3FPLA 5DSZA 1PEDA 4B83A 4C0LA 2ZDQA 3I4FA 3C6XA 4GWKA 4YS6A 3W6ZA 4TYWA 2ZQ5A 4FOLA 4M88A 1PKEA 3QVJA 3K2EA 4BQIA 3GEBA 4R1NA 3WQQA 1JAXA 5AMXA 1Y6RA 3AV0B 4LJ5A 3WYNA 3I6MA 4CLEA 1GZ6A 1FMLA 2QLJA 4EYSA 2HK8A 3N2LA 1C4XA 4Q1AA 4BEVA 4TTVA 3VBCA 1OX4B 1RHQA 4GU5A 3HKCB 5KTMA 2XSZD 5FEUA 3TI7A 4BN5A 4EFNA 1EBUA 1V9CA 1IBSA 2A0FA 1BJTA 3R09A 4LX8A 4NG5A 4V3CA 1KDZA 7REQA 4CEIB 1ESZA 1YZLA 2P6MA 4I9UA 1TUEA 2ANBA 2JEZA 4J2HA 4P4SA 1UC4B 1CDDA 4QDJA 4MR8B 4RJLA 1M2WA 3FCUB 3ISVA 3MJRA 1N7JA 3NTUA 4AMYA 2O8DB 4JI7B 2WE7A 2E21A 4YQZA 4NR0A 4BQNA 5ADVA 2FRXA 1EB9A 1JFLA 1WCXA 5E4TA 1NJFA 1QGOA 2HYDA 1WX1A 2J46A 3JTMA 1OFTA 1PK9A 2VUSA 3QXCA 5ITSA 2WWFA 2V6GA 3RYCB 2I4RA 3RYIB 3TSOA 2ZYAA 4WKBA 1ZOOA 4OREX 2R1UA 3IEUA 4GT1A 4LJAA 5BWOA 1AH2A 1DRWA 3KTFA 2QJRA 4YJHA 2Q9UA 3CIFA 1QHFA 1T9CA 5C34B 4F4FA 2BGKA 1V5EA 3B5IA 1WCWA 3HEBA 4PCLA 3MJFA 3WAGA 1P4AA 4LDZA 4URFA 5J23A 2O20A 1W49A 4YQYA 5JDCA 2AYXA 4I4LA 5J2TB 2JJ2D 3DZBA 2BFWA 4OD0A 2OGZA 2RHRA 4RF5A 4IRUB 4TXNA 5KCZA 3A4IA 4AY5A 4I3FA 1WF3A 2HWUA 2YWBA 4MNTA 4WKGA 4CYMA 5IXYA 3W7BA 3MTBA 2Z2JA 4JBWA 3EFBA 1V6SA 5DYWA 4DB2A 3IAHA 3OM1A 1JX6A 4AZSA 2QB5A 4FFSA 3I6QA 5KDDA 1HYQA 1ZCFA 3LFHA 4H2DA 2RK4A 3N3AC 2UU9B 1X7WB 1CUSA 3FCCA 2HSGA 3OEEA 2XMCA 2VJOA 3ND9A 4UMVA 2E85A 3S0JA 4B79A 2H5JA 2O3UA 4JLPA 3JQGA 1ZKDA 4PZEA 1GFSA 3QUAA 1JW9B 3LIPA 4XVQA 4TWZA 2XUHA 2AXEA 2XA9A 1R0ZA 3SLRA 3ZZMA 4BC0A 4DT1B 2A92A 5JOQA 3WAKA 3EPHA 1YJ8A 4LJLA 4HBZA 1ZFNA 3K30A 3MLAA 2GETA 5DMXA 3TQQA 1L4BA 3F7MA 3BULA 3N5CA 2HU8A 3SIPA 3FTNA 3WA7A 3BQNB 4FLMA 3UJNA 1J23A 3KXPA 4EAQA 1QAOA 3EG9B 1HWYA 5LL6P 3HACA 2FPUA 2P9FA 1KNQA 4MINA 2JGMA 4EGJA 3THYA 4JFAA 3K9LA 4G36A 4XIFA 4YP0A 1HNXB 2ZSBA 1KYVA 2IYSA 2Q9AA 2ZYSA 2QRKA 1Z5VA 3FDZB 3QU2A 3RHSA 2YY6A 4QEDA 1T1SA 3NTLA 3ZBTA 2VYNA 1ZVMA 1AMNA 3Q7TA 5FUBA 1JIXA 1GPNA 1W30A 1U1GA 3OQ6A 4NX2A 2JZNA 1VRWA 3W5HA 3T3NA 5F9FA 1DQYA 3TB4A 2KBEA 3DZ8A 4F2HA 3AVTA 3VPHA 5M2QA 3I0NA 3KDPA 5K3DA 3RG2A 2OFWA 3BDIA 4YRQA 5EJMA 3UC5A 1P0IA 3U3MA 4ALJA 1VKHA 2BRUA 3VI3B 3EISA 1YQ9A 1E79D 3B20A 2Q0QA 4CDMA 4DZZA 4FYPA 1E4OA 1EEXB 4FFLA 4LQLA 1R00A 1ZGHA 2DUJA 2OUIA 3WXMA 1IAVA 1OBOA 3MBKA 3FCSB 3DVAB 4Y7CA 1G7RA 2NOAA 2Q1WA 3FUXA 4Z86A 5T8KA 1A96A 1T6NA 3UY4A 3TZCA 1UK8A 2ECKA 3ZCQA 4DJJA 2ANCA 4C7BA 2IXBA 2QJTA 1RKBA 4AJLA 4Y2VA 1ZIYA 1WCIB 3R24A 4JGBA 2QF7A 2ZROA 4L51A 3R76A 1NW4A 3HY3A 4U7TB 1QHSA 5G4KB 1EWQA 5L7TA 5BT8A 3ECSA 2OFXA 3PC8A 3Q15C 1X7GA 4AO8A 2QI9F 4UXHA 1II8B 4OTZA 4IZIA 1HDRA 5IAEA 2OZLA 1NF9A 3KQUA 2A9FA 2FRDC 3JWJA 4AZ0B 3K31A 3OCZA 4DSNA 5B3LA 1P2BA 2BTOA 2X3UA 1X38A 2HU7A 3G2QA 2BISA 3AUXA 3L8MA 4KFRA 4MI6A 4X90A 3NRBA 2ZRAA 3T52A 3G5TA 5FFMA 4CM6A 3MBOA 1M3SA 2A5YB 3JWIA 3TR0A 2NTYC 1RQLA 2QGFA 3URKA 2OR3A 5I3CA 3PTZA 3ASZA 3EFOB 2FDXA 4LJ7A 4WL0A 2XLCA 5HEKA 2G06A 1PSZA 4EHKA 5A0VA 2R65A 2IVFA 3WADA 1MXHA 1UWVA 3GEIA 1KY2A 4PNHA 4F60A 4RM3A 3UMGA 4G5GA 3HSYA 4DZTA 4P3KA 4F85A 2C83A 1UPXA 1ZM4A 3A1FA 1KDRA 3PDWA 3RS9A 3S40A 5IZ4A 4GOMD 3FAKA 1QFJA 5E7IA 3OMLA 4URZR 1UP6A 3PC2A 2J45A 3D43A 3EBPA 4ZOLB 4UQOA 2L42A 5EWLA 1TUBA 3NV7A 1FNDA 5KHAA 4LZAA 1RAAA 3N2GB 1AMUA 2XTJA 2IWRA 2AF3C 2Z6QA 3O7WA 3GIDA 2CXPA 5HIJA 3SZGA 4MO9A 2IP1A 4JYZA 2PS1A 1SNYA 4G23A 3RCBA 2JRLA 2Y1KA 4JK3A 1OFHA 4IQGA 3AF0A 4XCQA 3KCQA 3A06A 4R7ZA 5B30A 1PYDA 4IO1A 1JA0A 2RGAA 2Y99A 3RVLA 3HJRA 2PBRA 4Q3CA 5AVUA 4HUTA 3QOWA 2WQZA 3MYYA 3K8YA 2HA6A 4DQKA 2WQ7A 2VF8A 3IB6A 3LC0A 2PWBA 1FDUA 1L9KA 1Q0HA 3L1HA 5ECWA 5F7OA 5I45A 4UD6A 4MSUA 2P1ZA 3K35A 3OD1A 3WNCA 2CV2A 2BGJA 4AUNA 4A92A 1GOTA 1UJNA 3I61A 2N3ZA 4MRVA 5T6MA 2EJUA 2IY8A 3MWDA 4FWBA 4UEQA 4AJPA 5TEVA 4EFDA 4QX6A 2CBGA 5K3FB 1JU9A 3EXFB 3CXUA 1XZLA 1WHTB 3G5AA 4I4TB 1NXSA 5AOBA 1CEQA 1H2YA 5K3SA 5LD2C 4KAAA 1QLWA 1FYDA 4GZMA 3SC2B 1C3OA 1KC1A 4BQFA 4DQVA 4Q4HB 4OYHA 2CNKA 3IOCA 5JCJA 1G55A 3IQHX 3VM6A 3EXAA 3H1EA 2IYLD 1E32A 4ON9A 3BIOA 1HLFA 2H1OA 4NJMA 3ZHRA 4U7GA 3FVRA 3QVGA 5F3DA 2MSKA 5IK2A 2I65A 3JYNA 3ORQA 4WZAE 2ONCA 3NHZA 2XMDA 2VH2A 1ODIA 2HA0A 1WXGA 3DZJA 3A9SA 4KJZA 2E37A 4JLDA 2X4IA 3B70A 4JT9A 1C9NA 4YDQA 3TG2A 4FR2A 5CCXA 2I9KA 3ETDA 3QPDA 3STYA 1KA9H 1U3DA 5A7HA 6ABPA 2CL7X 1FTYA 3IXQA 4R69A 1O77A 4G0UA 1J0XO 4CG0A 4CLDA 1QBGA 4YUYA 1Q5PA 3EVBA 4JS0A 5B1IA 2VK1A 1VBMA 1MB0A 3LKDA 4JP2A 4DJDC 4QAQA 1JEAA 1LB1B 5PNTA 4TMFA 1J25A 1C4KA 2EP5A 2Q4EA 1X7XB 4QVIA 4Z1OA 3CH7A 4O2LA 2H7YA 4BMOB 2ACVA 5K6RA 3EQ9A 1PT6A 4JYAB 1JJBA 2B4RO 3BWBA 1AV6A 5FR1A 2DQZA 1Y4AE 5A6VA 3K6KA 5AHXA 3C97A 4UBLA 4AS2A 5BSHA 5DN9A 1CY6A 2VAVA 3E2IA 5C46F 1I5RA 4DW8A 4PLYA 3LXMA 4HB0A 1PZHA 4KTTE 1W93A 3SBDA 3ZHUA 4BATA 4FQ5A 3MA0A 5GQSA 2FPIA 3DKPA 5CGQB 2DWCA 4CUZA 5TPWB 2P9TA 4ZU3A 5IJXA 3SSAA 5KNCA 1FP7A 1Z4LA 1T3TA 3LPDA 1TM1E 5CT8A 5THKA 1HPLA 1DQZA 4N7RA 5T67A 2J9FB 2W5UA 3PD0A 2F1RA 4KJXA 1AJEA 3AP1A 3CRVA 4HVAA 3LX5A 4TSFA 3LUKA 4C4YA 3NTQA 1ZCBA 4WXMA 4D3XA 1BYIA 3EPPA 4URVR 2YVLA 1IPHA 4M2LA 2X5KO 4OLFA 2OXFA 4MEAA 4RIGA 1NUAA 1Z0JA 3GD7A 3J7AC 1G2OA 3UAZA 1GGFA 1JAZA 3E9EA 2ZWOA 2XCQA 4IS2A 1TVKB 2MSCB 1Z16A 2TMYA 3QYJA 4IR7A 5HG0A 3U7QB 2P9JA 2X9QA 1H42A 3B2EA 1P74A 2I99A 2FN7A 3JYQA 4MV5A 5BN3A 3IJRA 5AP9A 2IYYA 3CW8X 1PJ8A 1JHUA 2E4UA 5D3QA 4D74A 1CZHA 2ZBVA 3W6UA 1YUMA 3LSYA 3ORSA 3WDKA 2FVXA 2YL2A 2HBQA 4NCIA 1L4UA 1I4TD 2FP4B 3LGAA 3MTAA 3PUHA 4X9XA 2F8TA 5IG2A 4HGYA 1ECFA 4QWMA 5DHTA 4C76A 4TTSA 5DWDA 3I8SA 3RS8A 2FUG1 4DM3A 5CW1A 1KRWA 3KWFA 4FUQA 3PJGA 1Y9ZA 3TDMA 4I1UA 1WXHA 1V1RB 2A88A 1GHTA 2HQRA 1T2FA 1RJWA 3N2NA 2XCTB 2ILTA 4UNQA 3CLRC 1XCBA 2WF7A 2E0IA 3I1FA 4Q93A 4M0FA 3V9PA 2QX8A 3FROA 3NGLA 5HF8A 4MAMA 2OO3A 2PTHA 5DBGA 3LQKA 4XVUA 3B6EA 5BQ5A 1PT8A 1J9ZA 2C7BA 1TPYA 5AVVA 3B1JA 3TLGB 5IFLA 3MMZA 3PXAA 3RTAA 3T7DA 4WBNF 2YASA 4B3MB 2NAFA 1JP7A 2AKYA 2CXHA 2H2WA 2Q5JA 5L53A 3CCBA 1Q44A 3VO2A 4WVFA 1GM5A 4LOLA 1K92A 3HPRA 1V16B 3Q0EA 2Y9PB 4I55F 1KJIA 4KH0A 6REQA 4LUCA 4C2TA 3T4XA 4CKEA 2IS4A 5B36A 1UT8A 1IY9A 4ZODA 2Q7DA 1GNSA 1ZSNA 4XGKA 4WDRA 4F9FA 2VPXA 3CLHA 5CCEA 1QTIA 3QXJA 1YI0A 3UHJA 2AZXA 3C1TA 1BCSB 2HU2A 4PYIA 3VTAA 2DLDA 3BXXA 4DRXA 1QRAA 4BVGA 3M4XA 1D5WA 2WPNA 2H2FA 3TF5A 1NKSA 2C5SA 2HRCA 2PAFA 4O3FA 2XHZA 1O6ZA 1OC4A 1E6KA 1VL6A 4DAOA 4BOYA 4D97A 2P4SA 3HA5A 1GKYA 3CNLA 2IEYA 3KR9A 2M6KA 3U3DA 3QI2A 3K70D 1PWHA 3M1IA 3PKJA 1ORVA 1U2SA 1HNZB 1JSLA 4MEJA 4TWBA 4BNJA 4YAGA 2O3SA 3I6BA 5KJFA 3OQMA 3B89A 3T0IA 4N39A 2VWHA 4IQ0A 4UAGA 3V4RA 3QKRB 1LJ8A 5ALDA 1Q0PA 2HSDA 3NGMA 1WHSB 3MNFA 5BV7A 1ZDMA 3NBZC 2BGGA 2ZI4A 3DC7A 3OE1A 2CSXA 2VWQA 2PUAA 3ILSA 1I4LD 1OJ7A 1ZVKA 2RHCA 4UEKA 5FTMA 3IGFA 3QWBA 3HB7A 4D3YA 2X3FA 2E5FA 4TXMA 4OHVA 3WGVA 3FZEA 1UBMS 1Z7EA 2XNDD 3PQEA 5GONA 2ISCA 1A69A 4JN6B 8ATCA 2ZXFA 3S3TA 2ZULA 1X74A 1A9ZA 1O97C 3PUYA 3N0VA 5I7SA 1C7IA 2AMJA 1CIJA 1NF8A 2O0HA 3DTVD 2F2TA 2YQ4A 1LH0A 2PKRA 3DZHA 3LL4A 4DARA 2FEWB 4S05A 1EVKA 1VYVA 1TLTA 3ZLUA 2MINB 2C2WA 2ZTHA 1GCGA 3AFIA 3VVCA 3LP8A 1TZBA 3AZOA 1KWGA 1I3NA 2OGUA 2ZU0C 3RNOA 3SU8A 3CF6R 2GYUA 1FUKA 1RMTA 1U31A 3KYJB 3MMSA 1W46A 1M1NA 1GEEA 3NDIA 2XPCA 3ZBQA 2GBCA 1OVGA 5L6MB 2RMKA 2Z1MA 3H2GA 1OOEA 3D3KA 5LQDA 1GZVA 3F9RA 4O2BF 4G24A 1Y7PA 4UU7A 5AICA 4BNNA 2PK3A 3ROZA 3WK4A 4DDUA 5FIUA 3GV0A 2W2OA 2XAAA 5DXFA 4OOFA 1KPHA 3WY9A 3WIVA 2CXSA 2FFQA 4DGSA 3MJDA 1RPTA 3HZRA 1IQRA 4CMHA 1IUNA 1Y7IA 1YRAA 3K2QA 1HDYA 2WJ6A 1EMDA 2PUJA 3P97A 1RYHA 3AERA 4XQCA 3DLCA 4IWYA 4LV5B 2CW5A 2W2KB 4JB3A 3L4SO 2PWPA 4RU1A 1XPJA 1UAAA 2Q1SA 1YQWA 1DJQA 4LJ4A 3L4JA 1OH5A 5JNTA 3BJEA 2WJIA 1QQ5A 2IZ1A 3DBLA 3L4EA 4QNMA 1XPRA 2D8MA 1CY0A 4B8ZA 1KH1A 1W5TA 3EEIA 1IXZA 4CVNA 2Q49A 4HB2A 4GKKB 3AKZA 4MUAA 1HSOA 2VHWA 3OZUA 3BH0A 1JVNA 5AR1A 3Q8WA 3EASA 1TCCA 4XPIA 3BD8A 4E4TA 3CKKA 4WE3A 1CUVA 5T41A 3TBFA 4DJAA 1QDLB 1YL6A 1ZISA 1FFDA 1NDQA 2JVJA 3AEXA 3QKSB 1M10A 2PN1A 1BTOA 1OWNA 3K7EA 4Q1CA 2GD0A 4JKYA 4YV0A 5DYTA 5LZ7A 4P0PB 2UXCB 1E9CA 2BZSA 1EK0A 2QAIA 2V3CC 1CUHA 1T1EA 2XZDA 3AUFA 3DXZA 3HM2A 3NFYA 4EB3A 4OMFG 2R6GA 3WP1B 4DV5B 5FOUA 4WCFC 1IH8A 3DDHA 1WULS 1YASA 1XDDA 2WT8A 4EB6A 1B6TA 4D02A 3FYUC 1DBVO 1P4SA 4H35A 2WMDA 3ACBA 5EJ2A 1B41A 3P0IA 1F2UA 3A6LA 4JWTA 4P22A 4DV4B 4A2PA 4RDXA 3ONDA 4JKIA 3NT2A 1O94C 1G2PA 2YYSA 3FPEA 3STHA 5IXJA 3OTGA 3K0SA 1C9JA 1R5NA 4DMHA 2BBTA 4ZVMA 5B4TA 2EVWX 3B5EA 1PGNA 1NVTA 3BWXA 2GT1A 5CNMA 2R97A 4EB8A 4BASA 2NTVA 2YIJA 2ZVQX 3KXIA 4YRSA 2QTVB 3HU5A 1L5FA 3ZUPA 5FBVB 1Z12A 3N58A 2WYVA 2RIPA 1BN6A 2O8NA 3ORRA 1SUSA 4BMYA 3F1LA 4F97A 1JIVA 5EZYA 5BV1A 4EYEA 2EFDB 5KSZA 4KQXA 3SOZA 1OV4A 2ZI6A 1F6BA 1O96B 1TCBA 2AKAB 2FWIA 4N03A 2YOFA 4ZKDA 5DHRA 4NMXB 1H1LB 2ZYGA 1IJBA 4Q19A 1ZOLA 3BIWA 1CJMA 4M46A 4OAPA 4EPTA 2A1IA 2G8NA 1TUIA 1IE3A 3T7JA 1XJWA 4DXHA 4JP5A 3Q7RA 4YHHB 3NEAA 3A4LA 3EIUA 1FPMA 1KYWA 4OKIA 5K3BA 3S1AA 3F6EX 3QLJA 4HLUC 4L3WA 5LUAA 1O0SA 1PI3A 4BN4A 1NQXA 3ZWKA 2H0RA 4B6RA 1RRPA 4HB4A 5HZGA 2M6LA 1FSSA 2LBPA 3D0QA 5FWXA 3TQCA 3L8FA 1KVRA 4E33A 4CKBB 1DC5A 3DAGA 1N9GB 3I9LA 1ZM9A 2YWCA 3MYRA 3I9JA 4H77A 1NE2A 2ZTVA 1PJRA 2PX5A 1OZFA 3KS9A 1M8JA 1RZ3A 1WS6A 3QE4A 2QHXA 4JVLA 4X1IB 5DYGA 2GSDA 5CG1A 3LPAA 5TF0A 4EGSA 5HP4A 3A3NA 1YK1A 2F3QA 3ZWQA 4UDOA 3L07A 3FTEA 4FFPA 1SUIA 4FKBA 5IDQA 3HDHA 4NMWA 1RQXA 4CMEA 4PG4A 3V7UA 3IHKA 1YU9A 3R5TA 4GG1A 3VC1A 5CH3A 1C2YA 3QTTA 2CHUA 3BD9A 4Y9DA 3QX3A 1ZGZA 2VP9A 4FFVA 3JYPA 3RF6A 4QT4A 1DIGA 1VA5A 3PQDA 4Y6SA 2CL5A 1QO0D 1H23A 3BA1A 3AYZB 5SY9A 3VPSA 3QJ5A 4N6GA 3ZNNA 3EAFA 4A6EA 1F9AA 1GFIA 4LJKA 3W9YA 1CY1A 1RI3A 3AIIA 1UEJA 4A16A 3QX8A 5CG2A 3QUTA 1BD3A 1GTVA 4RVCA 2NUAA 5ENZA 5EHXA 4JJGA 2VT7A 4RJJA 1T34A 2NQ8A 5E38A 5LBTA 5LWHA 2DEUA 3A9CA 3UFXA 2Q2NA 1WDKA 1NR1A 4PN7A 1P5ZB 4CLXA 3HB1A 3OEHD 2CWWA 1UZMA 1TW2A 3KSBC 2ZJOA 2ZWAA 4WK2B 4JHLA 3G2OA 1YUNA 1Q7EA 3CSSA 1PVOA 4QPPA 2YJ6A 4MRRA 3WWEA 3PWKA 5HR5A 2AA3A 3GEEA 1YR1A 3DHEA 3HLKA 3MAAC 1U8CB 1Y33E 2C2BA 3HNRA 1II0A 1IXYA 3VU0A 4XJSA 3I83A 5GP1A 4EA9A 3G5UA 2IS2A 3AM5A 3O8QB 3KD2A 2EHJA 3PGA1 3BGDA 4H4EA 3W6PA 4YMWA 2JL1A 1G5RA 2R1ZA 3HCAA 5E3IA 1NUHA 4HX2A 2OECA 4BV8A 1UBJS 4ENPA 2JB9A 3PU6A 5DULA 3AM4A 5KPJA 4AY2A 1QG4A 1XEFA 3AKYA 5JAUA 1WOYA 1ZCJA 3DF9A 3AG6A 1ZKMA 4OFZA 2BKVA 4B6EA 2H1FA 4MH0R 1JSZA 2BDUA 3IR7A 4ZPXA 2CK3A 2VJLA 2PSHA 2XMZA 5EXXA 5LYJA 4OK6A 5JO9A 3GCWA 2OCLA 3KKKA 3QPUA 721PA 1NUUA 1E2KA 1LFAA 3TEFA 1J42A 1ADYA 1RAGA 1YZTA 2CXTA 2DUNA 4UPVA 3T7KA 2CLHB 3O3MB 3GAMA 1YAJA 3HDJA 1N2IA 2F43A 1J0BA 2WTNA 3AU8A 4WXHA 4ZI7B 4M7WA 4P7KA 2RGDA 4ZQCB 4RENA 2IDZA 2PX8A 2R8BA 2HAEA 2HA4A 1NMSA 3N05A 5EGSA 4AG6A 4IDQA 2ZWVA 4DBVO 4C4ZA 4II7A 5DVZA 4J3NA 1PVVA 3LU1A 2H8GA 2VXYA 3GFRA 4IJ6A 4C0XA 5IVIA 2DPYA 4CMGA 3J80A 5EJ4A 3DBIA 4MV4A 3SD7A 1E0JA 3CWZA 4BFYA 1W4BA 1NN0A 4L73A 1ZD9A 3E8MA 1XSEA 4FB4A 2CB0A 2V5AA 4H1HA 1KC3A 1XTBA 1E66A 1NYLA 2F9LA 1A9QA 4FJ1A 3L0PA 2DFNA 3A3YA 5KTTA 1I7PA 3DDZX 2WAXA 1BU8A 4Q37A 1JPVA 2GYYA 2HREA 3EBOA 3FTFA 4WINA 3NIWA 3F96A 1JHZA 1OWPA 3I8OA 2BR5A 4D42A 1HI9A 2W37A 3MS2A 2ZR0A 3RADC 5L3QA 3JX9A 4V03A 1U7PA 3T4EA 3U7GA 2C07A 2EARA 2PT5A 3PQ8A 4LGCA 2VR1A 3WL8A 2V7WA 3RYFA 2JLUA 4GKBA 4NE2A 2ZB7A 3VH4A 2C9ZA 3OQIB 4YXWA 4AN4A 1JKXA 4L85A 3Q2KA 2ZIEA 4OQXA 5ALKA 1XXHE 2HUPA 3LGSA 5TR9A 4IIHA 3SYLA 1KDTA 1V3QE 2O2JA 3FNIA 3IE2A 3RDPA 4ANFA 3OURA 5B1YA 5HQTA 4FDAA 4MUEA 1ZEJA 5ARBA 2OILA 2IYPA 2O0MA 3TD9A 2FMUA 1D2NA 4EUKA 4AQYB 3ZHZA 1F4LA 2O8FB 2EGHA 2FSGA 2FZLA 2GA9A 3NQ41 5JZBA 3IBTA 1BVUA 1DAMA 2C94A 1D4ZA 2VP2A 2CLIB 2ZJFA 4FMCB 3AJAA 3TS1A 2XKKA 4JT4A 1I2BA 2OB2A 5AK0A 4BB6A 3R7BA 5JWRA 2RAPA 3KVRA 2WIFA 3GFBA 1I3KA 4D7AA 1JA9A 4F3KA 2YVQA 121PA 3ZVMA 4YP5A 2CC2A 2VBFA 5IUJC 2QTHA 3WQHA 3DAOA 5CR9A 2VATA 2JG3A 3UK2A 4L8VA 4CQJA 1YMVA 4FFRA 1OLXB 2YHIB 5DLYA 2INGX 1K9VF 1ZUHA 2Y1WA 2ZTMA 3JD2A 2ZZKA 3QVXA 4E08A 2YXBA 3PZBA 3KJNA 1NVVR 3D7RA 3VFDA 1VQ1A 1YZYA 4F9GA 3FOEC 1GIAA 4X20A 3H13A 1VPWA 4A6PA 3IP6A 4HRYA 1WR8A 1XTKA 4CCWA 2HXGA 5A9RA 4ZTZB 4Q4JA 1NATA 2AWNA 3OZXA 4P7BA 3ET5A 2YIVX 1BE1A 2WJZB 3G89A 4ESOA 2BGIA 2W2MA 3Q3HA 4MP3A 2GKGA 1H2FA 4G5YA 2K87A 3TQFA 1LDYA 3BE5A 2A3NA 1M8GA 5LLSA 1JDNA 4PSKA 3Q9UA 4TQUS 4HPWA 3GFTA 1DRVA 3H9UA 1QO7A 1GEGA 2J67A 3BBPA 4QARA 1X2EA 1N6LA 3A2LA 1E1NA 3KX2A 3BWCA 1LC3A 3LPCA 3WTBA 3GUUA 1ZJZA 3DMDA 1MAUA 4YCAA 4C2BA 5DSTA 4FMDF 3W2GA 4I99A 3DEHA 1ZY2A 3EOZA 2PRKA 4F1KA 3R7FA 3TW4A 1N6IA 2DKOA 3Q98A 5IDVA 5BWBA 3HDQA 2CFIA 1P9OA 1OA0A 3CZ5A 1ADCA 4EW2A 3DC2A 5E6RA 1GV0A 1EAMA 1VLQA 2C54A 2R00A 2OORC 4IX9A 5ECDA 3U0VA 1H66A 2R8YA 2O0LA 2YHUA 3KOYA 4MP6A 3UJCA 1FPQA 1JVSA 3AF1A 3A58B 2NVUB 1J2TA 2Q4BA 2EGGA 4YIHA 3LV8A 4FYJA 4ZRNA 5LQNA 2VPWA 3C87A 3TTTA 2HCRA 2X4DA 3KFLA 5BN4B 1N2XA 2QD4A 3PR3A 3WVNA 3FVQA 5DYIA 5D85A 4KMRA 4DWJA 1ESDA 1VKZA 1R8XA 1JF8A 2KSQA 4Z4IA 1HE8B 2WIBA 5ITWA 5KEIA 1UKEA 1QP4A 3AU9A 5E1OA 2CSUA 2G9ZA 3W06A 4BLPA 5K2MA 3LIIA 2V74B 3DWIA 3D8SA 1U6JA