1SXGA

Structural studies on the apo transcription factor form b. megaterium
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
275
structure length
275
Chain Sequence
b'KKTTTVGVIIPDISNIFYAELARGIEDIATMYKYNIILSNSDQNQDKELHLLNNMLGKQVDGIIFMSGNVTEEHVEELKKSPVPVVLAASIESTNQIPSVTIDYEQAAFDAVQSLIDSGHKNIAFVSGTLEEPINHAKKVKGYKRALTESGLPVRDSYIVEGDYTYDSGIEAVEKLLEEDEKPTAIFVGTDEMALGVIHGAQDRGLNVPNDLEIIGFDNTRLSTMVRPQLTSVVQPMYDIGAVAMRLLTKYMNKETVDSSIVQLPHRIEFRQSTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Structural studies on the apo transcription factor form B. megaterium
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Transcription
total genus 96
structure length 275
sequence length 275
chains with identical sequence B, D, F, I, P
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxgA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1sxgA02
4EUKA 1Z2EA 5IBQA 1XWWA 3F7NA 1RZRA 1KRXA 1JBEA 3I09A 4RKRA 3VNAA 4IMIB 1ISSA 3QLUA 5DLEA 2CWDA 4MR7B 3KSMA 1DP4A 1JFVA 3M9WA 3NNSA 4XLTA 4D74A 3I45A 1APBA 3HO1A 4RK4A 4MRMB 2PAFA 4EY3A 3CHYA 3G1WA 3RH0A 3A10A 1ZN2A 5EWLA 3F6CA 2F8TA 1CYEA 1Z16A 3OO0A 5TPWB 1P8AA 3TD9A 3QX8A 2NZVG 2YHAA 5TPZD 3HDVA 1ZVVA 3RVOA 4MQEB 1DCKA 3QEKA 2CD7A 1Z25A 3F73A 2E4XA 2PUFA 2VUIB 1LBHA 4OBBA 2IDMA 3T6KA 4FB4A 1RZRD 1C0EA 1USGA 4PE5B 1D5WA 1PHRA 4Z9BA 1NXOA 3GBVA 1UDRA 3FFTA 4G0OA 4MYRA 3H1EA 4Z99A 3IDOA 4IGAA 3O1IC 1TLFA 3N75A 1BAPA 4DN6A 4MR8B 1RXIA 4PICA 1PNRA 1VLZA 4LE1A 5IEBA 1C4WA 3HJFA 4Z4GA 3BILA 3GA5A 4N47A 3BRQA 4JP1A 1Z18A 5IUKC 4TLMB 2PUDA 3KG2A 4KNYA 5BQ3A 3KS9A 3MM4A 4NV3A 2NUBA 4F11A 5FWXB 1U8TA 2ID7A 3M6MD 4IILA 4GPAA 5HKOA 1EWKA 3T38A 2GWRA 3JY6A 4PZ0A 1JDNA 2FMHA 6ABPA 3LTEA 1QP7A 4MRMA 2L2QA 2HQOA 1I3CA 2BGGA 5JS2A 2A9OA 1JL3A 4QPJC 3TX6A 4D6YA 3HM9A 4Z4EA 2AYXA 5FBHA 2HQBA 4OATA 5TPWA 3H1FA 2QSJA 1MB3A 1NXSA 3Q7SA 4KPYA 4KFCA 2FQYA 2PL1A 3RQIA 1P6QA 4MQEA 4P98A 4W5RA 1NXPA 3C6QA 1FQWA 3RVKA 3HK2A 2TMYA 4RK7A 4W5OA 5JS1A 3HCWA 3OO1A 4MPTA 3QLTA 1DG9A 3NBMA 3NHZA 4S05A 4Z4IA 4KREA 3RVLA 2QW1A 9ABPA 4Z4HA 4HNSA 4N0QA 4YO7A 3CKMA 4Y9TA 2J48A 3RVRA 2CHFA 1YMVA 1QP4A 7ABPA 2FVYA 3A3KA 3LFTA 4RS3A 3N0XA 4H3KB 4NQRA 3LUJA 1J56A 3DGFC 1URPA 3H5LA 1A2OA 3O75A 3RVQA 5IUJC 1RNLA 3MIZA 1DRJA 4KQCA 4UHKA 3FFWA 3JPYA 3IP9A 1LJLA 1ZHHA 3LOPA 1GLGA 3GL9A 4RK6A 4F12A 4TLLB 2JVKA 3MMNA 1EWTA 3Q15C 3KCNA 3I5AA 4MS1B 4RU1A 2PLNA 3CS3A 3R0JA 3SQNA 3CG4A 3O21A 4EVRA 1F51E 1BA2A 1JH9A 1D1PA 4YS6A 2JVJA 3CRNA 3IPCA 4KZKA 4JAVC 3LMKA 5C5EA 3JS5A 1LJUA 3B2NA 4RXTA 3QK7A 5T3YA 3QLVC 1E6MA 4ETMA 1P2FA 4E7PA 4NCBA 1ISRA 2GKGA 2M1ZA 3S99A 2VYCA 1TJYA 4G86A 3C3KA 5JNUA 4H60A 5HQJA 2E4ZA 2PUCA 5TQJA 4W5TA 3H1GA 1YVUA 4L85A 1KMIY 1RPJA 4LDAA 3RVNA 2ZAYA 4KK3A 3Q7RA 1K68A 2PE5A 2RJNA 1TM2A 5TQ2B 3KYIB 4RXUA 2RJOA 4OTZA 2WJWA 1BDIA 4JB0A 1W9HA 5IULC 2WY2D 1ZITA 3L6UA 5BRAA 3C97A 2MYUA 3CZCA 3DBIA 3OQNA 3JPWA 4WXEA 1QQBA 5KC9A 1ZGGA 3N0RA 3C3MA 1XHFA 3KJXA 4PEVA 1YS6A 1JX6A 4MS1A 3HZHA 5GQSA 3CLKA 1YMUA 2JVIA 3FFXA 2R47A 2FEWB 1MAVA 2MSLA 2WRZA 1DRKA 4LX8A 3F6PA 1DBWA 4W5NA 1Z26A 1EWVA 1M5TA 1SD5A 3CTPA 2B1JA 3K9CA 2FLKA 3N53A 3LUFA 2FLWA 1EFAA 1NXTA 2GBPA 2IKSA 1XHEA 3HDGA 4EYKA 5KQPA 4ZMRA 1AB5A 2GI4A 1DC8A 3HS3A 1DBPA 3HUUA 1Z2DA 5CNKA 4XAQA 4YLEA 1VPWA 2JRLA 3FDFA 1GUDA 2M98A 3N0WA 5JNRA 2PUEA 1CEYA 3A0RB 4YR7A 1YIOA 4KVFA 5BRJA 3E3MA 1U04A 1KGSA 3Q9SA 1NY5A 1YK1A 2FN8A 2IPLA 3GBPA 4ZPJA 3DZDA 3GT7A 3Q7TA 3UK0A 4N41A 2PUGA 4O1HA 4MR7A 3T8YA 1JYFA 4QYWA 4WWHA 3EJWA 5TQ2A 2HSGA 1HEYA 2P9HA 2YHBA 2E4WA 4PYRA 1FSPA 4DQDA 5F64A 2GX6A 5HSGA 2X7XA 5E3JA 4N76A 5CNMA 5TE9A 2LPMA 5EWJB 3Q41A 5ABPA 4YP9A 3EAFA 3H5WA 4RY0A 3H6HA 4EYGA 4W5QA 3MF4A 2QV0A 3EGCA 1ZESA 3NNDA 4FE4A 2HPHA 3LUHA 2MSWA 1JDPA 3IPAA 3GYBA 1YS7A 3ROFA 1QNLA 4Z4FA 1S8NA 4MGEA 5DGCA 5IX8A 3TO5A 4JB2A 4LE0A 3GRCA 3C3WA 2FN9A 4YWHA 3O2QB 3LUCA 4O1IA 4ETIA 4OG2A 4ZJPA 4MR8A 6CHYA 2A9PA 3EQ2A 2A9QA 3LUGA 5EWMB 3I42A 4LRQA 5GOTA 2O20A 5HM6A 1OXKB 1USIA 1ZH2A 2JCGA 1DBQA 3OLVA 4IMJB 3N8IA 3RVPA 5DKFA 5CHYA 1EHCA 5FWXA 2ID9A 4ZYLA 4HNQA 4MS4B 1Z13A 5IC5A 3CNBA 3OLWA 2LIVA 4UHJA 5B3JC 1MVOA 3OLYA 1K66A 4EYQA 1ZAYA 1YK0A 1W25A 1ZH4A 3L49A 4RSMA 1FFWA 3KYJB 3G85A 2R25B 3N6VA 4O5AA 1QQAA 1D4ZA 4YGXB 3O2JA 4G97A 2E4YA 4RY8A 5EWJA 4YCSA 2PMCA 4F3TA 5FBKA 3D02A 1QP0A 3ILYA 2W42A 3H5VA 4Q7EA 1T34A 4MLCA 2VK2A 3VNBA 3LKBA 5EWLB 1SRRA 3QLUC 2WMYA 3KLNA 1JFTA 2HJ9A 1PNTA 3HVRA 2L19A 1SXHA 4MR9B 4EGSA 3OQOA 4OLAA 2H3HA 5KQLA 1TVMA 2LBPA 5D2CA 3JVDA 3IP5A 1DJMA 3BBLA 5T7BA 4E7OA 1NXWA 5KQGA 3OMWA 1FFSA 4RWEA 4RKQA 2FMFA 3D8UA 3O74A 1FFGA 2H0AA 3E61A 2MYNA 3MQ4A 5EWMA 5PNTA 1GCAA 3SY8A 3UUGA 4G0MA 5TQ0B 1JHZA 5DTEA 2PKXA 2OQRA 3GWGA 1JYEA 3O1JC 1E6KA 1DCFA 3HSYA 2R4QA 3DLHA 2P4UA 2IOYA 1E2BA 4CBVA 1F4VA 4XXHA 2PUAA 4B09A 5CNJA 5JNWA 1A04A 1QO0A 1Z12A 2L18A 4H3HB 3QX9A 3UKJA 1OXBB 1VRVA 4ML3A 3CU5A 2IPNA 1TMYA 3QLVA 2PL9A 4WZZA 4G0QA 4GNRA 1ABEA 4WXMA 3QEMB 3JTEA 3SNKA 3O1HB 1H9CA 1JFSA 2LP4Y 2JB9A 3H6GA 1M5UA 2HQRA 2LUOA 4RK1A 4KRFA 3EULA 2NZUG 4DADA 2FQWA 3OLXA 4Z4CA 3SM9A 1NATA 4KK4A 4LDZA 3RVMA 1L5ZA 2CHEA 4MR9A 4MS3B 1BDJA 3O2SB 1QO0D 3SAJA 4WT7A 4F06A 2IYNA 1NTRA 4KQ9A 4G0XA 4JA2A 3OM1A 4RK5A 3OM0A 3OMXA 4MAAA 5KI6A 2QR3A 1QPZA 3OQMA 4L4UA 3TMYA 3EODA 3K4HA 5TQ0A 1AB6A 2V0NA 4NICA 3CFYA 1RXEA 3RVSA 3CG0A 4RDCA 5FWYB 4IRXA 4D6XA 3SG0A 3GV0A 2VUHB 4OLBA 4XFKA 1PEAA 2MSKA 4EVSA 2FQXA 1U0SY 3H5TA 4N03A 4JASB 4MQFB 4YV7A 3FGZA 3KTOA 4P1ZA 4XASA 5JNSA 2QXYA 2A9RA 1WETA 5DCLA 2JK1A 3FMVA 3EQZA 5KC8A 3KHTA 4KV7A 4RXMA 1R8JA 1ZDMA 2PJUA 1JLKA 1LBIA 2IPMA 3LUAA 3LKVA 3QEMA 2PUBA 2FTKE 2MYTA 2RGYA 2DRIA 2RDMA 3HV2A 3HUTA 1CHNA 3HXMA 4ETNA 3URMA 2FW0A 1VKRA 3P9YA 1Y1LA 1YTUA 1Z17A 3H5IA 3IP7A 4Z0NA 3ROTA 3DGEC 1MB0A 3NNNA 5BR1A 1U2PA 3MYYA 3DLBA 5C5CA 4MS3A 2MYPA 3QELB 4EVQA 1JWLA 3LUKA 4QICA 5I4CA 1D1QA 2N9UA 1MIHA 3CZ5A 2FSPA 2JBAB 4JOQA 1QKKA 2FMKA 3HEBA 1D2AA 1ABFA 4RZSA 2I6FA 2XDYA 2FEPA 2QVGA 4F8JA 4WUTA 3KKEA 5ED4A 3RVJA 4M88A 5FWYA 1USKA 4YRZA 3BRSA 3T95A 5JNVA 5KWSA 4NCAA 5IUNC 1BDHA 4MLDA 4RK0A 2WWVD 3TB6A 5KQMA 1ZY2A 4ZMSA 1DC7A 3OLZA 2NT3A 4RY9A 4G0ZA 4MQFA 1GUBA 3KLOA 8ABPA 3MA0A 4Z9AA 4LE2A 1QMPA 2FKAA 1DZ3A 1M2FA 2QZJA 4N0PA 4S04A 2WB4A 1GCGA 4KMRA 1PUXA 4LZLA 1BVHA 2E4UA 4TMYA 4XARA 4IF4A 3JVIA 2KYRA 3BREA 4G0YA 2AYZA 5IEJA 3IP6A 2L17A 1PEYA 2FXIA 1ZGZA 1E6LA 2F8SA 4HYEA 2OENG 2Q5CA 1L5YA 3M9XA 3LUDA 4TN5A 2IPAB 1SXIA 2FMIA 3H5OA 2R48A 2WJAA 4Q6BA 4QYMA 4EYOA 1U2QA 3H75A 4Q6WA 1KRWA 3NHMA 1M2EA 3QELA 3W9SA 1IIBA 5JNTA 3EDCA 1NXVA 2QU7A 2B4AA 1Z15A 5B3JA 1LK0A 1A0OA 4G0PA 2ZWMA 4FE7A 4HNRA 1SXGA 2FEKA 4RV5A 2QVCA 2JBAA 1P6UA 5CNIA 3A0UA 2E4VA 1NXXA 1DCMA 1B00A 4MS4A 3ILHA 5TPZA 2NT4A 1EAYA 1JF8A
chains in the Genus database with same CATH superfamily
4E5MA 1EBUA 2QLMA 2DR0A 4LECA 5H3HA 1H0KA 2DH5A 2XLBA 3R6TA 4NPAA 2NVOA 4V2UA 4BLQA 4XRGA 5C52B 1LVGA 5SY9A 1IBMB 1A9YA 3WAJA 4D9BA 2F62A 2GJ9A 3M9WA 1OX5A 4TL6A 3BAFA 3DV9A 4RK4A 3WGJA 4B1FA 5BYKA 3AYXB 1T25A 2XXAB 3HBMA 2ECFA 4HAZA 3AM3A 2VDPB 4MX8A 3A10A 4N8DA 4ABYA 3NGLA 3B20A 5CEFA 5J23A 2IS2A 1L4LA 4OHOA 5H02A 4ZZ2A 4Y2GA 2QAGA 1P0FA 2PO5A 5JROA 2PX5A 2QJOA 3OPMA 1ADFA 2H18A 3GT0A 5FADA 1T0BA 4I4TA 2CW5A 1W5FA 1X0VA 4YXWA 2WMOB 4JMPA 3MB8A 2W83A 3ZGVA 2PUFA 1BCRA 1HEIA 1W5BA 4W1RA 2CNKA 2YTZA 4X20A 4FB4A 3BICA 1WBDA 3G89A 4RIEA 1DJQA 3SP1A 1HPLA 1G6Q1 1K8XB 2WG0A 4GP7A 5A1TA 2F6RA 4B3FX 1ZUNB 2VSOA 2C88A 4QG3A 3GDWA 3KYBA 3UJBA 1NF9A 3FPAA 3AOEC 3JVVA 3LBFA 2JIBA 5FPPA 2VDOB 4RTRA 4JLWA 1OKKA 4ZOLA 3AB8A 1ZR4A 4K87A 3NMUF 3CV3A 1UF9A 1V1RB 3BRQA 3PPIA 4ZC1A 1XKQA 1DX4A 1GIAA 3X1MA 4AURA 4BNZA 1CR4A 3DBVO 6ADHA 1VI2A 1E4EB 1HZZC 4C7VA 3X1WA 3A1DA 3P2OA 5CG1A 2XT6A 1JG1A 1E69A 2HJVA 1UJ4A 2CMFA 1UQTA 5A62A 2ECKA 3JY6A 1JWBB 1QIKA 3RSSA 1JDNA 3AZPA 3FPLA 1M8FA 3IXQA 4ID3A 4K6MA 2RAPA 2HIMA 2FZLA 1NONA 2W0MA 3AWDA 2G9RA 3HKBB 4UHCA 4IFBA 3L7CA 2LD4A 2FLVA 4LISA 1E4YA 2R68A 1C9YA 4QPJC 4KR6A 2C4KA 2H5JA 3CTMA 1UKZA 3EVZA 1RHJA 5FBHA 3PI7A 3SHOA 1KFEB 1E5LA 2AN5A 3THYA 2QSJA 4DV0B 3V34A 3LL7A 2OAP1 1UBHS 2WM3A 3MJEA 4HQOA 4IGIA 4XTCS 1QZUA 4EUHA 4GVPA 4EUEA 3VNVA 2GVZC 2A5LA 3UK2A 2C59A 4NTZA 5K6RA 2HH9A 2LCFA 3L3BA 1QAOA 8ATCA 4OXRA 2CJYA 2WB2A 3QBEA 3NYWA 3TIGA 4LV8B 3WC4A 4AUEA 5BWOA 3RVRA 4HDSA 1PD0A 4RELA 4Y9TA 2J48A 1IC6A 1BS9A 3AHFA 3E27A 2QXUA 2I54A 4H6XA 4MULA 1ZIDA 1EESA 4YRJA 2DBQA 4J3FA 3LO5A 1IAQA 1OB5A 3BIFA 3GJ8A 1YC2A 4ESHA 1YIDA 4FYMA 1A2OA 5HZMA 4D9EA 5T4BA 4PG8A 4EWLA 1W0JD 1VBMA 2OHHA 5IH3A 3STTA 2DUJA 4K2HA 1CQZA 5ARCA 2B9VA 2WSSA 4L5YA 5IJXA 2DFTA 1UBGA 1XJQA 3PIRA 1CY2A 4X93A 3GMTA 5CXSA 4EPWA 1P2DA 1YZQA 5BQPA 4PS1A 7REQB 4UQLA 2NZYA 4U7DA 4RDIA 2IS6A 2HJHA 4GKKB 3IALA 2JGDA 4GI1A 1A9TA 1CJSA 2PXAA 2YFQA 4RGVA 3CS3A 3K9GA 4FMCF 3WK6A 2VBGA 3O21A 2PYZA 1RM5A 1M1NB 4I1VA 1B73A 4ER5A 1IVNA 3DPSA 4BVJA 2PUTA 2YJ6A 1FNSA 4I50A 4KU4A 3RRMA 2X8JB 1KEVA 4KV9A 2V8OA 3DWGA 3NOXA 1TUBB 1FYWA 5K45A 3FMGA 3P9PA 4UATA 4ZIRB 3IESA 3LQFA 4F1JA 8OHMA 1TI7A 4AK9A 3OZIA 3DAGA 3N2GA 3GIWA 4IOMA 4H7JA 3PDIA 1P31A 4B7ZA 1FLAA 1GFWA 1L8QA 4U00A 3ELWA 1VYVA 3FYSA 1R9GA 3R4CA 4GOJA 2GD1O 3RREA 4AQ7A 4CDMA 1Q2UA 1GQRA 2QU8A 4GXRA 4NNOA 1ECPA 4KK3A 3JASB 3PQ3A 1PKEA 1EFPA 3BE5A 5K09A 3A6DA 1KP9A 2CL0X 2RJNA 5TSDA 5ITZA 3PRHA 4AZWA 1BXZA 4NYIR 3EF1A 4JJ4A 4ND6A 5JSZB 4ZVLA 2V7WA 2D4AA 1J99A 2YDYA 3C5WP 3EZ6A 1RHMA 1ZITA 3JZMA 3KEFA 3OZUA 1WUIS 4AUNA 2FU5C 4KMSA 2JGKA 2DQ4A 2QYOA 5K6TA 4BEVA 4ZHQA 4PC7A 1TM3E 2JD0A 1PZFA 3NLLA 4WV3A 4A9AA 2B4TO 3EZNA 3GLSA 1YR7A 3SI7A 2UYHA 2XWQA 1QIJA 5JZSA 1BE8A 2XKAA 3CLSD 4UU7A 5ALMA 1DL5A 5K0ZA 1MEEA 3E5HA 3FI9A 4ZAGA 3ZX5A 4EHDA 3ZYCA 2C7OA 4WESA 1WY5A 5DSZA 3QE9Y 3M4XA 4ENTA 3NYIA 2BZ1A 3G0OA 2WUGA 5CA1A 3K0FA 2YVLA 3S1AA 5IABA 1U2DA 2HU8A 1ZN9A 3O9VA 4JX8A 1KE2A 3CF4A 2BOVA 3DA8A 3K1JA 4WKNA 1DRUA 4LY0A 1K98A 4GP6A 3SJZA 1RM0A 4RCZA 1VPWA 2X9VA 2PUDA 2JRLA 1XFAA 2XGGA 3COJA 4G5RA 2QTLA 2ZYGA 3Q87B 5TGDA 3TCNA 2E9SA 5KYVA 2OPBA 4B5LA 3DZGA 3L40A 2HAEA 2F4NA 1ZMXA 2C42A 2C8KA 3BB3A 3TLXA 3Q7TA 4MRRA 4WXPA 3UKDA 3VVLA 1CD5A 4N41A 1N0UA 5CPBA 1TTHA 3EPPA 5EXSA 5A3QA 1SM4A 3O3NB 1Y3IA 5EUQB 2VDVE 3CZ4A 4TROA 3QJGA 2Q5HA 2QTWB 3AVQA 1E8MA 3K20A 4QGBA 4RD2A 3U7RA 5FTLA 2GHRA 3L43A 4Y2XA 3DULA 3ZD7A 3AHIA 3VI3B 4RY0A 5LR6A 2FZKA 4ZGBA 2VJDA 1CBUA 3IQEA 4KQKA 4FPXA 3DV2A 4Q7JB 3K2QA 4PX5A 4B3IA 3GU3A 3FIUA 1WLYA 3TR0A 1Z4IA 1WEHA 4K6HA 1P1RA 1WAMA 2HW8A 5C46F 5JG7A 1JAYA 1YBAA 4PC2A 3PJFA 4FWIB 1RWMA 2PZGA 3BZUA 3A4VA 3DC7A 1KHTA 3FCAA 4BDTA 4EY8A 3LQ4A 1L5MA 3RAGA 3S44A 5LB4A 4ARVA 2Z8XA 2FKNA 5T6BA 4OLFA 1CJBA 3B85A 4OQQA 3OKFA 4QIHA 1WTAA 3A7DA 2A59A 4TWIA 3UOAB 1W34A 4DBLE 621PA 2ZPUA 2A9PA 1JLMA 4O6VA 1DQRA 3A6KA 2PH1A 1LPMA 4D25A 1YCDA 2Q4TA 1YRAA 1QGAA 2WJZB 1K9VF 2FPGA 3EDQA 2NAPA 1KVUA 4G3XA 1MG0A 4I5FA 3NTUA 1GRRA 1RQ2A 2HRDA 4K9QA 3RVPA 1EHCA 1TTPB 1L5RA 1W94A 3I6MA 2N47A 4C0JA 5BPFA 3PR2B 4G8BA 4F92B 1VCIA 3A1VA 4HDMB 2GHIA 4HFMA 4WVFA 1V5WA 1QYWA 4JOSA 5B3JC 4UBMA 1PJRA 3EAQA 4OGGA 3TMKA 3Q8KA 1ZAYA 1XDDA 2O3JA 3TQSA 2O7RA 4IX1A 1E64A 1EFCA 3DWEX 1JILA 3TW0A 1W36C 1SG0A 1E94E 1MO4A 3TM5A 4MVJG 4G97A 4OBWA 4MINA 5MFPA 1BKYA 4FDLA 4NV0A 1V48A 3DDSA 3QEOA 4N3BA 4BV8A 2NUPA 1P73A 3O8BA 5H16A 4DCGA 3ISTA 3LC1O 3NWBA 1VHTA 1QQ7A 3QQ5A 4H4EA 2X77A 1BD3A 4TX1A 1L5KA 4DA6A 1D6SA 1HDXA 5EA2A 1SRRA 3K0EA 4NHEA 3E81A 4MUNA 3QLUC 3TUIC 1LUAA 4WFKA 4GLBA 2IXGA 3BE4A 5FOXA 5A03A 1R9JA 1KY3A 1SXQA 1TK2A 2M1XA 3R3WA 4GPZA 4JP5A 2ST1A 2A86A 2EVWX 3BBLA 3AP1A 3D3NA 2C29D 1LV8A 2WHRA 5BXQC 5AOCA 3I4CA 1FSZA 3RYIA 3EC2A 3G8CA 1QGED 3H4TA 2KE5A 3I05A 4OP3A 2JFOA 4YLGA 2B2CA 5JCPA 1YDHA 3M4YA 4BRSA 1NF8A 4UARA 3HWSA 5HBGA 4BLVA 5DN6A 4LGCA 1DGQA 1GNSA 2GS9A 4M9SA 4QTTB 5D51S 1UDWA 2BI8A 3HSYA 4HPJB 4IHJB 1UDCA 1W0KD 4W5JA 5GP1A 2OCAA 2P4UA 5DI3A 3I1YA 1HC7A 1CJMA 3JATA 1X7WB 1A04A 3CRW1 1E2QA 4K0RA 4OHMA 1BRTA 2FFAA 4NE2A 5K0LA 1OXXK 1EDDA 3NGXA 5AKIA 2ZSDA 1UZMA 3EW7A 4YT5A 2AG0A 5DM2A 3E22B 3UA4A 4GNRA 1IZ0A 2GH1A 1NGSA 3TSCA 5TF0A 3CUWA 1HY3A 1YHYA 3QBDA 3SNKA 1U7UA 3U49A 1JIXA 4C88A 3P96A 2XCTB 5EJFA 1FSFA 4IW3B 1AKNA 1N5KA 1G1AA 1N2IA 2IY9A 5J4KA 3HMKA 1PE0A 1OD6A 3RFUA 4K9MA 2JAPA 3PTZA 4IAOA 1SJ9A 3ADOA 1FJ2A 1NATA 4KK4A 3G1TA 4FKMA 2HTEA 1Z4KA 3TI9A 4RJKA 2JA2A 3K9LA 3UV7A 3ZDQA 3KTAB 3EDRA 3SAJA 1Z4NA 3DVAB 3R7FA 1P3Y1 3SS9X 2C9DA 2KI5A 1C3OB 4YBRA 5JW6A 3OCYA 3B52X 2PBLA 1W4LA 4NEGA 1XCJA 1M6YA 2ONZA 4NC9A 4LQCA 5GTDA 2Q0HA 2PUVA 1K6XA 1UK6A 4X1IA 1X9HA 3BH7A 3H9EO 2X2PA 2DETA 4TOIA 4B45A 5BWNA 4AJNA 1E0SA 1KC3A 3VX4A 2YRFA 1OYWA 4FCWA 4GI2A 3UBTA 3ZU3A 1KBZA 1SC6A 3WGVA 3AKYA 5IWAB 2I0FA 1YF3A 1QKJA 3E9DA 2HIHA 4MQFB 1QLHA 2IF0A 1GA6A 1ZC4A 3INTA 5LNK1 4AL4A 3UJNA 1S4MA 1CEQA 4Y1FA 2ZVJA 3RJZA 3WGTA 5DT2A 3F47A 1V6AA 5IANA 4U6NA 3GZJA 4DM4A 3KM0A 1GV0A 1TK9A 3MZ0A 3GLHA 4PZCA 4WECA 4CMKA 1NWCA 3A11A 3BCUA 5HS6A 1ZWKA 5IM4F 1YACA 1RKQA 4KXXA 4YRTA 2K2QB 2OD7A 4CU5A 2PFGA 5JJIA 5EE9A 3IBTA 1HF3A 1OY1A 3NNNA 1XE3A 4TL7A 4O5OA 2QD1A 3FHLA 5GIOE 3PXGA 4JJFA 1E2EA 1OROA 3TD2A 1I4LD 1R4MA 4QPNA 1DQYA 3F5DA 3D2AA 4JD5A 4EVQA 3B9BA 2I22A 3LGSA 3VJKA 1YQ9A 4MRPA 4WPGA 4LUCA 3SHWA 4BNNA 2A1TS 1SHLA 8GPBA 1U6IA 3L1IA 3W9UA 1LI5A 3BHIA 4L8VA 3QKTA 4AMUA 2Y4NA 4JOQA 1QKKA 1VLVA 4ZVNA 1KJJA 4BV9A 2HA5A 4KPGA 3W3AH 2BGLA 5CIYA 3T3OA 2M6KA 2WD9A 1ZGAA 1KJYA 1FRQA 1ZYUA 2V97A 3S5UA 2VL7A 1JG6A 3OQBA 3P2YA 1DRWA 3CF0A 3TNFA 1JECA 4BZPA 2GUGA 4PPNA 1OIXA 2HZBA 4B2PA 4ZD6A 3N3AC 1MPTA 4B6JA 4AVYA 1MC4A 4B4KA 2VAVA 5CLGA 721PA 4QLAA 2Q1XA 3IEIA 4MJXA 4BQSA 5KTTA 1SA0B 2FSVA 2G77B 2OBBA 1RWBA 2XRYA 2CXRA 2ZOSA 3K2EA 3MBOA 1UZAA 4MV6A 4NAVA 1DZ3A 1CR2A 4LJRA 3IYLW 3GFRA 3CE6A 1R8SA 1ZUIA 3SC3A 3HDYA 4AZ3B 2XMSA 3GFGA 1HE1C 1XRQA 5H82A 3WMGA 5KYWB 2A4MA 2CHUA 4MUMA 1PEYA 4M4SA 3UV6A 6YASA 1SUFA 2YCBA 1BVUA 1YDMA 3I37X 4QLOA 5HVNA 4KN5A 1YB2A 4GLLA 2HLDA 4M98A 3ZQ4A 5AW8A 3ZWYA 2B6HA 1L5NA 5LMZA 3E9CA 5JMPA 3MQ2A 3W5UA 3E9MA 5DE3A 2HWKA 2CK3A 2YMLA 4PTZA 2EGGA 2QU7A 5TJHA 1CIVA 3SMQA 5K0BA 3SJ7A 1POXA 4GSKA 2YX1A 2IEBA 4KWEA 2FEKA 1GQYA 3A14A 1HSOA 1TF7A 1L9XA 3RASA 3FVRA 3RS4A 3W9YA 4MGIR 4OJMX 4PFKA 1C4KA 2MINA 1XKXA 1I9GA 1KBOA 4IBOA 5BMVB 5TPZA 2CEKA 4WNAB 3WE7A 4UDOA 1CP3A 3C3PA 2QD4A 3RG8A 4PQGA 1JZSA 1F0YA 2JHAA 1JBEA 2QLJA 3CLHA 4H3VA 4IZIA 4OJKA 1KO4A 4NZ9A 3C6BA 4IMIB 2IUSA 5B58T 4ILEA 3V32A 3DPIA 1J25A 2JJYA 1U1GA 3V00A 3K70C 5FQNA 2RHOA 3CWZA 3VDRA 3VVBA 3L4BA 2IZOA 3R9XB 4DDTA 2Y93A 1OF1A 3MT8A 5EWLA 2VHXA 1BVYF 3U7QA 2X5NA 4K86A 5C5DA 5FUYA 1P8AA 3PYXA 3ZE7A 2OGWA 4BTVA 2V3VA 2GCIA 1W44A 2QVBA 3PGLA 1UJ5A 1GHTA 2YBEA 4QUIA 1ESCA 4BO1A 3ZY4A 1L4KA 2VF8A 1AXGA 4HXYA 1P9NA 1Q5PA 2GARA 3IMGA 4HBZA 4BVHA 4DPMA 1PHRA 3MOIA 4CHGA 2JIOA 2PX4A 3VOAA 1CLEA 3W6NA 2AOXA 4ER0A 2HNKA 3WLTA 2JEYA 5D3KA 5JNLA 5BN1A 4EARA 1V7ZA 1FDRA 2W2VA 3AEQA 3DZCA 5ER6A 5GGXA 1BFUA 3IDOA 4UTPA 3SKVA 5LLTA 5FBWB 1JTVA 1QHHB 5CTJA 1M1UA 2IYFA 4XSHA 3M5WA 3TZ6A 5IXYA 4I55B 3PUZA 3BILA 4K9DA 3TK1A 2H2IA 4QJ3A 1CERA 4KE7A 4CXMA 2H0RA 2UXDB 4IH4A 2D7JA 3BMOA 2IYZA 1PJSA 2JGLA 4QWMA 3GJZA 3UMVA 4BGEA 1QFXA 2SCUA 4NV3A 1AUXA 4KGXA 4M9QA 4TWBA 5E6SA 2XRMA 2IFTA 4DIDA 4ITUA 1UOQA 1P1IA 2ZANA 1L4BA 4RLQA 4W8HA 1V1MB 4O25A 2H48A 3ROEA 3VRHA 1SHUX 4HGZA 2BHNA 1TKBA 4HRVA 5D87A 4MHOA 1JXAA 3Q3EA 3VGPA 3IKTA 2H6EA 1Z0UA 2FRXA 1RZVA 2VWHA 2WAYA 4PG5A 1FZQA 5K03A 1HDGO 1JHVA 1OKKD 1TO6A 1TQ4A 2OXFA 4UUQA 2A67A 2HQBA 3JSAA 4QYSA 3W4KA 4X92A 1X42A 2NYRA 3MAGA 3TVTA 5JRJA 3CW8X 1KI8A 3CXRA 3QXJA 4HT3B 4TV9A 3KSBC 4A8PA 4MQEA 2H85A 1UXOA 3R5KA 4RTNA 4MYSA 2YRWA 1AQJA 5JSHA 3FTFA 4R8MA 1JRLA 1R6VA 3AF0A 4RK7A 4MWBA 3IIJA 4MZXA 3TLYA 1XZEA 4JV5B 3PTAA 1GT6A 1YI0A 3K5PA 1OXVA 3CPHA 4UVIA 1X7GA 4BUCA 2QMZA 2Q9CA 3QJ5A 4O4LB 4TL8A 4ENUA 2GRUA 2VQSA 5FUBA 5SZKB 1JPVA 3K09A 4UU1A 1Q91A 2EJBA 4ZWNA 5CHEA 3RUPA 2FA9A 1QP4A 1XNRB 3Q7EA 1SCNE 3DOFA 1T9BA 3REOA 1J56A 2PV0A 2Q4BA 2H2HA 4ALLA 4TTTS 4ZREA 1DFHA 1Q19A 4W99A 4DVGA 3JRWA 5IUJC 2NP7A 1D2HA 1C30A 2QTMA 4KQCA 3MK31 3KALA 5JRZA 1Y6FA 2PGLA 5DIFA 4RVOA 5BYBA 3GLTA 2Z30A 1RBQA 3EOAI 4QULA 3E7PA 1LJLA 3Q3GE 5L7TA 5CT5A 4UC0A 3H0EA 2QRVB 4CLHA 1EVIA 2ACEA 2JVKA 2ZIGA 3EH2A 3TECE 5F98A 1NNLA 2IYQA 4LGMA 5B1SA 4B3TB 5ALJA 2YWDA 2ZS7A 3V3TA 3DKPA 5DRTA 3QIVA 1AT1A 1NBHA 5AFSA 1OXUA 1DFGA 3FGPA 3W3ZB 1N5JA 4CCYB 1T1SA 4F8EA 1R8QA 1ACJA 2R00C 3E3NA 4BE4A 4G1MB 3W8NA 3BXXA 4C04A 4GMXA 5IBRA 1RZ3A 1XI2A 2JVJA 3E1SA 4KZKA 1QIDA 3L7LA 3C3CA 2IV7A 3LAWA 4JWKA 5KYUB 5LYJA 1ISFA 3JS5A 3NWPA 4P31A 4U3JA 4JI8B 2VVTA 3KXDA 1PGJA 4KRYA 4MKIA 1F0KA 1QC5A 1E3TA 1PWXA 2XIJA 2WSSD 3LT1A 4HDRA 2W70A 4BNTA 1T13A 3DOUA 1YUMA 3M5DA 5TMBA 1H22A 1Z33A 4HWPA 2ORED 4IIDA 5D5PA 4X91A 1G21E 1J2YA 3P26A 1QLWA 4B3MB 1N6NA 5K7SA 4MKFA 4XLZA 3PR1A 1U0EA 2AJ8A 3T7CA 2Q5JA 1Y8RA 5IVIA 4UTRA 2I6XA 4RMGA 3T15A 3A1NA 3KXIA 3BD9A 3O8OA 1FNNA 2SKEA 3TW4A 1ZOIA 5LMNB 3RVNA 4BMZA 4EW2A 1C7ZA 2ATVA 2GFHA 2QZSA 3A36A 1N32B 1O94A 1QOZA 4EO4A 5A0VA 3CUVA 1GJRA 4Y2YA 1XMQB 2WIAA 1GZ4A 1LFDB 1FUIA 3ELDA 3ZY6A 4C0WA 3WA7A 5F2KA 1SY7A 3IVXA 4TL9A 1J20A 4Y0AA 1XZKA 1T1EA 2WIGA 4OJYA 4TSFD 3FOFC 3T94A 3JWGA 4AS2A 1KQOA 4CIBA 1IVSA 3P9ZA 2YVUA 3QVKA 5JBNA 3OQNA 2BSQA 4OL0A 2GNAA 1ZXXA 3N0RA 5FI3A 5EERA 3ZW7A 5HFAA 1Z63A 3HZHA 5LQJA 2PR2A 2NV6A 5CDFE 2BC9A 2JVIA 2MSEB 3K1AA 4BFCA 4IDHA 1H5UA 5EIWA 5LVAA 1FFAA 3AOGA 1XDWA 3MWDA 3QYPA 5U9CA 1QGUA 2FOXA 1KI9A 4R84A 3F5QA 4WEOA 3OZRA 4GMFA 1U4OA 3TTTA 2H07A 5HQ3B 4C2UA 1Q50A 2HUPA 2A0XA 2XMZA 2AZMA 1P1KA 4BFSA 2J3DA 4H7DA 2GBLA 1JEEA 4IDQA 5KQPA 1EFAA 2PJRA 5DMHA 3L07A 3UOWA 2NV0A 4L8YA 2NZ2A 4GZ6A 1HYBA 2BGRA 1G4UR 3E48A 4UU8A 2VP0A 4D5GA 1UK9A 5LZ7A 3SZMA 1K3FA 1R88A 3FCYA 4GPBA 2Y1GA 2OAGA 1QWSA 4KYVA 3KJZA 2Z57A 3RF6A 2QYTA 1N2JA 3B6ZA 1M5RA 4I4CA 4ZV9A 1Y1TA 1HEYA 1UH5A 3AM1A 2J31A 3C6MA 4KFUA 4B17A 4PYRA 2YASA 2GX6A 3LHSA 5CYFA 4QBKA 2JGJA 3T12A 1EK2A 3Q41A 1T0UA 1W5TA 3OU2A 3IULA 4KQ2A 1FBTA 4FGUA 4YP9A 3ZJVA 1KI6B 1MDBA 4L76A 2VTBA 3G2LA 4M8SA 4MV3A 4Q1BA 5K0TA 5ALNA 3RUHA 1PNOA 1FXWA 4JEUA 2J46A 4C4XA 4CT4B 3MFQA 3H9JA 2PIAA 2WSYB 1K97A 1KAQA 1WDTA 2G8NA 4HX5A 4ZI7A 3GDGA 4LC9A 2XVAA 1Y7PA 1OHHA 3TPFA 1EUCA 3F49S 3NOVA 4CM8A 1U63A 1M7BA 1OLUA 5CX1A 6CHYA 4YJHA 3VDMA 3HDHA 4J1QA 4MWTA 4M22A 4EA8A 4LRQA 2O8FB 2GF0A 2Q8PA 4YK7A 5HGXA 3GUYA 5L3VA 1XMIA 1EB9A 4NESA 3UCEA 3GMIA 3HVHA 1Y6JA 2GM4A 3H3XA 5E6UB 3ZGZA 3VR1A 5FWXA 5CLIA 3QFSA 4DBLC 3NIGB 4EDHA 2HLHA 1OXSC 4HN4B 1E2LA 2HCTA 4JLBA 5FV4A 3UK1A 1QYIA 3D3WB 1MJFA 3BK1A 3OIGA 2JBWA 2G9QA 4II2A 4QECA 4DLZA 4IHJF 1AZTA 1TJ3A 2Q21A 2OTCA 2HMVA 2Z83A 2Q6TA 3UKOA 3G85A 2R25B 4O63O 5ERGB 1MR3F 2DPYA 3PX3A 2GBGA 5IYZB 2R86A 2HYIC 1WL8A 3COWA 5CBPA 3BKXA 1ZISA 2FXVA 5T41A 1EPUA 3QGMA 1W4RA 3QH4A 3TSOA 1ZWLA 2E21A 1PHPA 5BQOA 1VL8A 4WLOA 3NHAA 4BUZA 4PNHA 4CHTA 4MLCA 1H94A 2D2VA 1V5EA 4MTLA 4P3YA 4EGFA 4ZDIA 2BGKA 2ZK7A 2H4JA 2H11A 2AMJA 3KR1A 5JZOA 2BCEA 2CV2A 1AHIA 2BY4A 3HY4A 3IDSA 3OE4A 2OECA 1JI0A 5B5SA 4Y0VA 3F46A 3HUEA 3A4TA 2OXIA 3ER8A 1W4ZA 1PSZA 1G5IA 4EH1A 4R1SA 1H0SA 2XOXA 3WK5A 8AT1A 3MMZA 3GUZA 2XHZA 4BFXA 3MMPA 2AWOA 3T0FA 2VN8A 1SCDA 1H0HA 3IS3A 4QAJA 5CXXA 4B2LA 4C4SA 4JVSB 3HCAA 4JCOA 5BN5B 2GMWA 4GRAA 3WQRA 2QX6A 3ETNA 2P9BA 3IXMA 4HAYA 5HJ2A 1UP7A 1UMCA 3F5FA 4DM3A 3CSDA 5J3JA 1RBZA 4BB6A 2PKXA 3GWGA 2PV7A 4MJ7A 4QA9A 2X6RA 2CDNA 3VZBA 4MYHA 3F4BA 5AVKA 5GZ6A 5KOJA 1E2KA 1S8AA 1I7SB 1DQPA 3O3MB 5AVJA 2FK7A 2Z04A 2AQHA 3P0EA 1O97D 4P53A 3PE4A 1LS1A 2Q50A 4CMEA 3HSKA 1IHUA 4M46A 1SZJG 5C3MA 3JYLA 2PA0A 1DI0A 2QG9A 1XTRA 3M6WA 5H4HA 1PV2A 2CB9A 3HEMA 3V2HA 4JUCA 1S3IA 4D9MA 5HS4A 3UM9A 3H6GA 4NECA 3LG2A 5DN6D 5TXGA 1Y5IA 4DCPA 3QU2A 3WK8A 3ORHA 3ZZTA 3BORA 4C6RA 2EJWA 5C4MA 3PENA 2QUIA 2DFDA 2W2LA 3ASVA 2HBRA 5TARA 2J5KA 1HE8B 1I5OA 3D5QA 3TUJC 4JUFA 1MN6A 1WOMA 3R41A 5IS2A 2Q7XA 2YHSA 4ZCLA 5HRUA 1ZEMA 4Y7DA 3IO3A 2XB4A 2LW7A 4G0XA 3OH8A 4EF4A 5HBRA 5B7GA 4GECA 1GKLA 4KKXB 3SEZA 1P80A 1T2FA 5T67A 1QHEA 5A5VA 4IYRA 4BBZA 2WICA 2SHKA 4A10A 4BUJA 4JSYA 4CEIB 2P41A 4N3NA 1XK7A 4FIDA 2OC9A 2ZUBA 4PANA 5IH7A 5B1HA 3TS1A 5A5EA 5FHRA 2MJLA 5DSXA 1EEXB 1CUYA 1XZGA 2HRQA 2JFVA 4EVSA 5BOSA 3FG9A 3OOYA 3UWOA 1UUFA 2F1KA 2FR0A 2DFKB 4R98A 1JSRA 3ZNNA 1PF7E 4PZLA 4PCAA 1E4VA 1D4FA 4OHBA 3J81k 1LU9A 1N3YA 1QF7A 2AMYA 3EISA 1YS1X 3VHLB 3DXFA 4Q5IA 4D45A 4P3OA 4EI7A 5FTJA 4TKVA 5EIXA 1LEHA 5ALKA 2RGEA 4TRMA 3W6UA 4F1KA 1WMDA 3VDNB 1V2GA 1UBTS 2H1IA 1CUSA 3P2JA 3R6WA 4G25A 5GJCA 2NSDA 4MVWA 5B6JA 6AT1A 1YQDA 1FYXA 1CQIB 2OHOA 1Y33E 4GM0A 1G8HA 1L8XA 2ZR0A 2V1UA 3MJCA 2DVMA 2CLSA 1O0BA 3DGEC 4KYUA 2VQFB 4OP2A 3W4JA 4JX9A 1ZI9A 2AUMA 3CLRC 3KWMA 4HB3A 3AGPA 4K3UA 4QTUB 4U7TB 5JCOA 4R7GA 3STUA 1Z7BA 2WYWA 5FH9A 3KJQA 1CUAA 1CQXA 2VHEA 5DNUA 2VCYA 3G6WA 2C95A 3IMCA 4DEYA 2EF0A 4JROA 2PN1A 5FORA 2F1IA 3P4YA 5AOBA 1ECLA 2P0YA 1NY6A 4K9OA 3DZFA 2ID4A 3ETEA 3HCBA 4DBZA 2XDYA 4L6AA 3QWHA 4ZYWA 3ZX4A 1OBCA 3AF2A 2FFHA 1EYZA 1ZU5A 2VO1A 4Y9DA 3RVJA 3G5AA 4FUQA 2QRLA 4JGBA 3EGDB 4RV9A 4HZGA 4Z7OB 4G5GA 1ZLXA 5DVZA 2KJQA 4RIIA 5K01A 1RVDA 3P0IA 4ZCPA 1GNVA 1T5SA 4PLGA 4RFSA 5BMVF 1TFRA 4BKMA 1P9LA 2YWRA 3VPGA 1I7LA 1QIHA 4H9GA 1X7YA 5CVVA 5HF9A 4ZYYA 4W9NA 5EHXA 3TSYA 3LVQE 1AK9A 1IQ0A 4EGJA 3LQRA 4TVKA 3G2MA 2Q2VA 2WWTA 2WM8A 2WB4A 4KMRA 5C8VA 1JSLA 2O0MA 3T1QA 1AS0A 1YZNA 4NFYA 4PIVA 3IUPA 4MDFA 3OY2A 1MAAA 1QJCA 3JVIA 4E3WA 5B1DA 3FI0A 4JC0A 2YC2C 2AYZA 5FJIA 3QKSB 5WRFA 2BF7A 1T43A 2FXIA 1II0A 2FGKA 4UNPA 2JFBA 4S0ZA 5I9SA 2R5FA 1EUZA 1UPUA 3T9CA 3TOXA 1JQ3A 2V6IA 1NQ5A 4O3FA 1W2HA 1NVAA 3U1VA 3SIRA 4G0UA 3UT0A 1YB1A 2YNMA 3C8UA 1CJVC 1MORA 4CLOB 4URZR 2Z1NA 3D6MA 5BNWA 3EPHA 1EQUA 2HT6A 3W9SA 3PX7A 2JGIA 4NU6A 1G3RA 3GGPA 2WVAA 3ACDA 4CMIA 1G8JA 3U37A 2NTVA 1AO0A 2QTBA 4B3XA 1TYCA 3O93A 4B80A 1U28C 4FE7A 5F5LA 4TXLA 4EFLA 2W4MA 2OY0A 2QVCA 4G01B 3MMSA 4D4MA 1XIVA 1H23A 4RZIA 1NMXA 2ZETA 1H2EA 1S2IA 2JIRA 5I9NA 1CWUA 1FTQA 1Q0ZA 4GQAA 1A9OA 1WCIA 4OQ4A 4DJEC 1PGPA 4FYXA 5KQSA 5H7XA 3COZA 4P4LA 2B2NA 4RS4A 5JANA 2NUAB 4I55F 1X9GA 4MB2A 2BKLA 5GMOA 1N6OA 1MQSA 3NV7A 3VU0A 2HLDD 3DEFA 4Q4AA 4TN1A 3VBCA 3LYHA 2XPCA 2EKQA 3KX2A 2Y71A 2RK3A 2EAUA 1KYXA 3Q98A 4KXYA 4D74A 4RFLA 2CK3D 4UDXX 3Q3HA 5BP7A 5CITA 4WEQA 1S3FA 5IBPA 5I6DA 5KPDA 3HO1A 2A57A 1IEXA 2XQIA 3U6BA 3AR6A 1NX6A 2HCFA 1ZN2A 4EQZA 3UWDA 1V9LA 5AJXA 2AJDA 2JAOA 2L82A 3WRYA 2VDNB 4ROSA 3AUSA 1CS0A 3D8HA 1KVRA 3P9KA 5TPZD 2PKYX 4X7BA 1KFKB 1O1YA 1SUWA 1SEVA 1V7CA 4U39A 4WJKB 5ALQA 5BT8A 1C29B 1Z25A 3GLKA 4OBBA 2O1SA 4CCWA 2VKTA 1OZAA 2JH3A 3BWVA 2H8KA 4Y2UA 5ICEA 3IP1A 5LJLA 2YS6A 4D8YA 2CB0A 2CL5A 4Z9BA 5EQFA 1INLA 2P78A 2QNRA 5CVUA 4AKSA 4X1KA 3UJHA 2PYDA 1PJBA 1CY0A 1OU0A 3PX2A 1XXHB 4N65A 3AW9A 3RU3A 4BCDA 4TTSA 5ESWA 1EUQA 1PWHA 3FLMA 1K8YB 1REQA 3CNHA 1E77A 1TYZA 1Y8AA 4LE1A 1AUOA 4EW6A 1OQAA 1HQYE 1YZHA 4JBIA 4LHSA 2JH8A 1Z18A 2WEKA 5HMLA 3DJYA 2CV1A 4MVCA 3FCSB 5BQ3A 1ZJ5A 2XB8A 2H2WA 2C3YA 2OHJA 1JHUA 1YU6A 1Z07A 4G9GA 521PA 1RWXA 3P4UA 3UB3A 3U44B 3N86A 4FD3A 4H1TA 4AF6A 3OT1A 5K0FA 2FP4B 2G40A 4P2BA 4KIGA 3D59A 1OPXA 4DUGA 2I5PO 4GWGA 4D02A 3Q88A 3ESZA 4HRYA 1ZW1A 1Q57A 1L7RA 1YQGA 2DPLA 1IM2A 2OM2A 1ORHA 2CDBA 3WP1B 3W5DA 3OP1A 4EB3A 5DLYA 3TX6A 2GOYA 2PZLA 5AJUA 3CT6A 3NJRA 1NNI1 2X2EA 3EHEA 3I6BA 1TFUA 5AR1A 3NBAA 3IVAA 3SBDA 1J1IA 2Z43A 2A0YA 3FR8A 4Q93A 5BQFA 3SE0A 4D44A 4OYRA 4W5RA 4C4PA 3GG9A 3C6QA 3PKIA 1PJZA 4UVGA 2TMYA 4US1R 2ECPA 4RHCA 4LA4A 3EF3A 2UUCB 5L95A 1GZDA 5JXJA 5LKAA 2FFQA 3LH5A 3L7DA 2ONJA 4CW7A 4XWGA 1Q0PA 2I62A 5EZYB 3OUUA 1O95A 4H0NA 4AN0A 4MGHA 3A3OA 2NU8A 2I7VA 4R8RA 4RVGA 4UJ5A 2HU7A 2ZE5A 3DEHA 1SVWA 3Q72A 1Z29A 3WJ2A 3HJRA 1Q1AA 1N0VC 2WG1A 2IOQA 2N3ZA 1YRWA 3CSUA 3PGKA 3L7IA 3Q7IA 2IXEA 4ZVKA 5CEJA 2P9ZA 5DGHA 1JGTA 4A6PA 1RNLA 3G8YA 4HRXA 4LYFA 4O2BA 1QH0A 3L7YA 3U39A 2FOIA 3VU9B 2HDNB 3JPYA 3T99A 5JFTA 3EOZA 1UMDB 3K5HA 1ZR2A 2H4YA 1ZJ4A 3ZHBA 2BFPA 3RUEA 1YR6A 3KUDA 4C6HA 3N2KA 1FF9A 3R7WB 4WCFB 3E6AA 3HCPA 3A8TA 3T3IA 2BM9A 2W6IA 1U8XX 3VPDA 4BO2A 4CL8A 3QFTA 1UMBA 2ZJ5A 3FJ1A 4INAA 4NR0A 2HJWA 4IJ6A 2VF4X 3ZDXB 4IIHA 2VAWA 2FK8A 4I9FA 4H7HA 2WHEA 2DLNA 2JGNA 1BX3A 2VH1A 3GJ7A 3K73O 1ORWA 3CRNA 2DMRA 3NIWA 3QHAA 4FX2A 5AOAA 3TLCA 3WZLA 2OE2A 4CTOA 3K9FC 1EX9A 1CY8A 2XMRA 1AD2A 1UBCA 3GAMA 3KKMA 5CFLA 3DNFA 3KAKA 4BO5A 4UBNA 2E4AA 5J2UB 3RIYA 3GFSA 3KZXA 2FPWA 3RNLA 3BGDA 3ZZMA 4BZWA 3NH9A 4Y1EA 2GCOB 2O1EA 5A6SB 3GOHA 2VYCA 1HBJA 2DPHA 4IUBS 1Y4SA 3E82A 2ZITA 2CMKA 4HG2A 4NG4A 5DO9A 1GLNA 2VUTA 5A3SA 2PZAA 1GPH1 1MHPA 3UF0A 2FUEA 1DEOA 3DMTA 1OI3A 4PW0A 1WV1A 1SMKA 1WW3A 5ELMA 4DQUA 3BSSA 1HR0B 2XUHA 1Z4PX 2GFIA 4RTJA 3R8FA 1PJTA 2RHJA 4AJIA 1VCMA 2XYVA 3HN2A 1K68A 4BQOA 4MW9A 4QJBA 3VDQA 2COKA 4LI0A 4CL0A 1OREA 4RJ2A 4MA0A 3W5BA 4FDTA 2H5IA 3QF4A 2NACA 4AYTA 5KYNA 5GONB 2ETVA 3DE7X 1ZD9A 5TV2A 2Q0SA 1XHFA 3AKDA 3HB9A 5KX5B 3CT4A 1LBEA 5D7BA 1P7YA 2QPLA 4RVDA 3FFXA 2IHBA 2P9YA 2WWIA 4N6GA 3DBLA 4QL3A 3WMWA 3K9NA 3R3HA 4V0NA 1K5PA 4WK4B 2RIRA 1NP6A 3B53X 3RU7A 3MELA 4BB5A 2D2EA 1N6LA 1NVBA 4AJHA 4WBNA 4RVUA 1W4BA 3BTOA 4QXRA 1O94D 1XZMA 3QVJA 1E9CA 1N0HA 4OHFA 5AI5A 2JHPA 1IUNA 4ZXPA 4EK9A 2QT0A 3ZNQA 4DR7B 3NKLA 3N53A 3TQHA 4F3CA 3HZRA 5T4FA 2VK4A 3K9QO 4QATA 2CLMB 2X3FA 1XHEA 3CVWA 1RTKA 1YL7A 4QFCA 3E2PA 1UWVA 1V95A 1L7EA 4OAQA 5B37A 2QMQA 4ZDKA 2ZB2A 3DHEA 2R6R1 3OCCA 4IIXA 2X7JA 3P2MA 5H59A 4UE6A 4PY2A 4IIEA 2M98A 2UZ4A 2JCYA 2HA2A 3WNVA 1H6AA 3EE6A 2DH6A 3PD7A 4F5ZA 3ZVNA 5CIQA 5TS3A 3AESB 4HXGA 4FGKA 4FFVA 5JEEA 4OU4A 2QJFA 2BUCA 1MKYA 1NY5A 3ZHSA 3S8YA 3GT7A 5JADA 2JI6A 4L22A 4I0WB 2C4HA 2PUGA 1A8QA 2ZJ2A 3B1FA 4QBHA 3T8YA 1RAEA 4UAGA 5AI9A 5DTIA 2E4WA 2WA1A 1FFYA 1J7JA 5F64A 5B53A 4NIMA 3RANA 5JY1A 1NDHA 2WM2A 1TEHA 2LPMA 5EWJB 1HLFA 1O96A 4DCJA 2FR8C 1J2JA 1YA4A 2Y27A 2YVKA 3G2OA 3H99A 3VO8A 3WLOA 4JI2B 3AQIA 5AI0A 4P0QB 2XZOA 2R1VA 5IYZF 4MV0A 4D9FA 3MILA 2VIIA 5LB2A 3EGCA 3R8CA 3TBHA 2BGMA 1CUUA 4IWYA 1U7DA 4X1YA 2PKCA 4TTIA 4EG8A 1GNTA 2RHDA 3AOEA 3JD2A 2JW5A 1DAGA 1G20A 1XMJA 2ZJ6A 3NDRA 4WW0A 1R8XA 4ZQBA 4C89A 1X8KA 4FFDA 3NO4A 1DMRA 3VJLA 4DNQA 2ALJA 3KB1A 4J6FA 2JAUA 4E6EA 1LCIA 4ZJPA 4TYNA 4KE6A 5LIPA 1JKJA 5I8WA 5GZ1A 1ZSYA 3ME5A 4KVGA 3P0FA 4C3VA 1V7PC 1TMGE 1M6HA 3B3JA 3I42A 3HLTA 5IT9A 3GT4A 4YV1A 2O20A 2R65A 5DGTA 2NGRA 3B9PA 4Z3DA 4CM5A 1IPFA 1Z4QA 3KQMA 1P0PA 5CLQA 1XJCA 1YJBA 5B55A 1Z9BA 2SKDA 4FFNA 4G9EA 4TKUA 1YCFA 1G5QA 1ZPDA 3NYRA 3Q7PA 2BFMA 2E87A 3AG6A 3L18A 4X94A 2O59A 3G5UA 4YMHA 3D8BA 1K66A 2WKQA 1YK0A 1MIOA 1ETHA 1NM5C 2Q5OA 3GNSA 4TWRA 3SHFA 3U4HA 1OHHD 3A3NA 2WK1A 4N0EA 4O5AA 1LTKA 2YXPX 1W7AA 1OI4A 4OJQA 5E7MA 5J1SB 2OB1A 2QQGA 4M21A 4U02A 4LXUA 4ZZ0A 5FBKA 3BC1A 1Z0KA 1UDAA 4Q82A 1IN4A 5KTRA 2O07A 3DP7A 3LUBA 3K6SA 1CQPA 3KQWA 2XT9A 3UHAA 1QIMA 1RWKA 2ONCA 1L3IA 4LDRA 3J81A 4MUKA 1IIRA 4EABA 1PYGA 2O1WA 4KFSA 5ICCA 3MPOA 3F97A 4ECEA 4X95A 1YZLA 2CDCA 1E3JA 3ICWA 4QSMA 4WA8A 1MO3A 2QPOA 1Y6ZA 2DSTA 2RGNC 3BXGA 4MXDA 4RJJA 2YH2A 2E49A 3PGA1 2EZ9A 3JVDA 4WKCA 2PX6A 2ZTVA 1U0RA 2CFRA 3IUMA 2XB6A 1IE3A 3OMWA 2G6BA 2QVZX 4JT9A 1VZ2A 1Z37A 3JARB 4S35A 1V8BA 2B4YA 2HF7A 2QD5A 1ZG3A 1WB6A 2JFPA 4ZK2A 3UUGA 2PDAA 1Z8HA 3F3MA 3C41J 3T3NA 1EM8B 3EGIA 1K6EA 2XMPA 2ZRKA 1GN9A 3TI7A 3QXSA 2B0JA 2IYWA 1VPLA 1Y8QA 3GFPA 5DHQA 5CNJA 5B3AA 2E2WA 3S28A 5CH5A 5LWHA 1G2PA 4F6RA 4E5KA 2OSVA 2BFFA 2QSYA 5HW0A 2L18A 3ER6A 1RI5A 2PXCA 4X41A 3EXAA 3IMEA 2RARA 2YV2A 1JJVA 2G5CA 1OXBB 2CD9A 1QE5A 3JZFA 3Q0TA 2MSCB 3TZHA 5L51A 4CUKA 4YRDA 2PSEA 4EI8A 3IHTA 2Q5EA 2QM0A 3O90A 4RF4A 3JTEA 4FHCA 4HZUA 5CCBA 2VOEA 1CETA 5JH7B 1NF3A 1T9KA 2LP4Y 3P0HA 1RJ9A 3MTDA 4KKVA 4XQ9A 1LLUA 2I9KA 1KYVA 2XZPA 2GZSA 4ZCQA 3OFVA 2X8WA 4LZZA 5FYDA 3WWDA 4MEJA 1IQPA 1SHJA 3EK2A 5FFNA 4E2WA 2NZUG 4XRRA 4Z4CA 4BRUA 4IG9A 1B2LA 1Z6GA 2AZ4A 1T5DX 2O2HA 3DEIA 4JBYA 4J0JA 4K81B 3ORRA 4QFMA 2EF1A 1L5ZA 2ZYAA 3AVPA 5E4TA 1X1BA 2FE1A 4MS3B 2FWAA 3BMQB 2ZB7A 3LDGA 4B6GA 1P4HA 1XMSA 2VNSA 3JR3A 5AJHA 4FZ5A 3ZTTA 1T36B 4YCBA 4URUR 1P5FA 1QAMA 3KV3O 2VA8A 3OM0A 4HGPA 4DLWA 3TOZA 3UUWA 2WUDA 1XA0A 4PYIA 5AM4A 4OKNA 2JFXA 1HZJA 4HB0A 4NABA 1RXEA 5CURA 1OXMA 4OHPA 2J4FA 5BORA 1EVKA 1SXJE 1B8VA 1D7OA 1DKPA 2GYYA 2KQUA 1LI7A 2XNCA 5COBA 4ALJA 1A1VA 4FE3A 1HWYA 2V7PA 2W2LD 4DSNA 3FOCA 4N03A 2XKJE 4IDAA 1FUUA 1L7NA 2VP5A 2RIPA 3RTCA 3OICA 1SVIA 1IOWA 3IMFA 2O6LA 1SQGA 4AMYA 4G5SA 1MABB 2V7GA 5HF5A 3WKCA 4OX9B 2JK1A 2DR2A 3EMVA 3MWKA 1UJ2A 2XQGA 1LBIA 1NP7A 2QUKA 4HH1A 2FTKE 3KTFA 2HSWA 3ABRB 2YQ4A 1P9RA 3W1EA 2YFKA 3SS7X 4CF7A 4ETNA 4BO6A 4Z4QA 1CF2O 1T24A 1ENYA 3UMBA 1KJZA 2IYYA 1GRCA 1VKRA 2PWPA 4ND3A 2PRSA 4QJIA 1X7HA 1XQ9A 4OQMA 2XBLA 5JU6A 4XYGA 4L8WB 3CQ9A 3GFFA 4Y2RA 3TXAA 5A0TA 1KJ8A 2PMDA 4AG6A 4Y2JA 1SO8A 2WJ4A 2P1RA 3F8TA 2OP0A 4IZOA 3QELB 2R6CA 4JODA 2X9NA 2AG5A 4S0XA 3U3DA 3ZXYA 3WAGA 4MJ3A 2EKLA 5BN3A 2HA6A 4BNFA 4IQGA 2O19A 4HQ6A 3X1JA 5E9WA 1CUBA 4L6IA 4ND8A 1UJBA 3UJAA 4Z7QB 1WW2A 4TV8A 1WUTA 3T7IA 4D4JA 3D54D 3R9KA 5M7EA 2JEZA 1TGYA 4QNRA 5AM5A 2Y4OA 2J08A 4XB6B 4HP8A 1D8TA 1LBSA 1U5BB 3UQYS 3LECA 2DG2A 4YJHB 4R9SA 1PTJC 4F8YA 1KJQA 4RA9A 4KYTA 5KQMA 1X39A 1Y1QA 3M3PA 1KY5A 1L1FA 4Q3AA 3IVGA 1Q2XA 4JB8A 1FTSA 2BRUC 2F64A 1MNAA 1M6VA 2QM3A 3CGGA 2GXAA 1XT6A 1H3EA 1JZTA 2CF5A 4BMVA 2J30A 3E2IA 4KR0A 1TM7E 5IT5A 3ASZA 2X9GA 5D8DA 2ZS9A 3V4FA 1DXOA 3VGJA 2Q3JA 1LDNA 3ODGA 4ZO9A 1AQYA 2H4XA 4DQLA 2WU1A 4XEHA 5AI4A 5C7LO 4S04A 1ADGA 4U7WA 1D5CA 5LXTA 3OWHA 3SKYA 3TGLA 3M1LA 1GRVA 4IQ4A 2VPPA 4PV7A 3LCCA 2HHCA 1JR3A 2C54A 2PWBA 2AVNA 1P72A 2KHZA 3EXIA 1MB9A 5AHXA 3QMMA 2F8SA 4J2TA 2CXOA 1JB9A 2PPVA 4WKGA 3EHDA 5FB3A 2GK4A 2PJDA 2WHXA 3HL0A 3EIUA 4QYMA 3RRNA 4YI3A 4EECA 4B3RB 1EWRA 5KYTA 2Y1CA 3K9BA 2WYVA 3ZCUA 1M2EA 1OR8A 2D5BA 1UQUA 4HEA1 1UBSB 4P7FA 5B3JA 4JHXA 3T4EA 1WVIA 1C0PA 1CJTC 2OHFA 1T0IA 4JLPA 1UKAA 2EARA 4LPKA 3RT7A 2H1OA 4O1MA 5D5HA 3IAS6 4R7ZA 4QEDA 4F4CA 1ORDA 3HV0A 1EXDA 2ERCA 4Q3KA 4DV3B 1RYFA 2PH3A 2C2YA 2REQB 3F6YA 1Q15A 2I6GA 4NNJA 5GY7A 3FUXA 4FONA 4FJ1A 4IJQA 1K6IA 3AR5A 4N5HX 1Z2EA 4XCVA 5E2IA 4IFTA 1E60A 4NYIQ 1WZ2A 1I3KA 2P27A 3SQWA 1NUAA 4AP5A 4CE6A 3SS8A 2YNMD 4G41A 3VNAA 2ORWA 1GXSA 4TZTA 3QLUA 3AL3A 4NBKA 1U3UA 2XGMA 3KSMA 3O9ZA 5KVQA 3KJHA 1JJ7A 3C3YA 5ENVA 2X0JA 4CG3A 5AQ1A 1NKSA 4MYTA 5AW4A 1APBA 1U80A 1QPBA 1QGOA 1YOVB 4HN9A 4U7FA 2R8OA 5EIBD 3WHPA 1Q7EA 3NT2A 3TLGA 3VKGA 3KZ1E 4EDFA 2F8TA 2NXWA 2VDQB 4P7JA 3ST7A 1MB4A 2C2HA 1YI1A 1H1TA 4IEFB 1B1AA 4OLHA 3SR4A 5BUQA 3D5TA 3QX8A 2FFRA 2QRHA 4UBJA 3R3ZA 4DQ0A 5BT9A 2ASEA 2YHAA 4PSKA 1ZVVA 5FUWA 5A7HA 3N74A 1ZD1A 2EKDA 3RRFA 4B9AA 1S8FA 4DA7A 4PYJA 2PANA 3ZDDA 4EENA 1P0IA 4BP9A 1Z73A 3LFUA 3FGNA 4YACA 4PFJA 2J9ZB 2IHYA 2AVDA 1B41A 4P82A 5EKSA 1RKUA 3QWAA 1R0XA 5EHIA 1P3DA 2VI5A 3KE9A 1XXHE 3PVZA 5EJ2A 4MDEA 5HRAA 3H3FA 4L2IB 3K6RA 2COUA 3S2SA 1I3LA 4U7HA 3D6VA 3I32A 4AO8A 1NN5A 2FG7C 1SU7A 5BURA 3HJFA 3C3AA 1M2OB 4ZYUA 4G85A 1BROA 1ULTA 4K7JA 4WXYB 4BFVA 3BMCA 5KNCA 2IX9A 3IAAA 3L6EA 3O8QA 4GYJA 4P08A 1I4OA 4YNBA 4Q15A 3TAUA 4OK3A 3N8HA 5ARDA 5ARBA 3V2UA 1CUEA 1U8TA 1MAHA 1T4GA 1U5CA 2WFAA 3PRKE 3R8XA 3RTEA 3UJCA 2A1TR 3IKVA 2HMYB 2YUTA 2LZ0A 1P1JA 1OBVA 2CLFB 2I7CA 4N5IX 3FWZA 1XRLA 4YAKA 1XCGB 4OF4A 4P7KA 4Y9SA 1G41A 4R7TA 2XYRA 3L46A 4DJ5X 1E98A 1M2KA 3R5FA 4MVJM 2L2QA 4ZYTA 3HTXA 3BK2A 4MGKR 3ZXSA 1PBTA 1JLSA 1YQUA 4WRRA 1QRTA 3IJ5A 4Y2PA 3KVNA 2CCGA 3L1KA 4OATA 3NAZA 1N8SA 3H1FA 4NU8X 3WMFA 3ZCVA 3KQUA 1MB3A 1C8LA 2GTPA 1DKUA 2P5SA 3EN0A 2H08A 2OMEA 1JV2B 5IG2A 2GSWA 4C4ZA 3N1UA 4JQSA 2YFHA 4Q9LA 121PA 4PAOA 3KVOA 4YDSA 3SZOA 3F9IA 1TCBA 3WL4A 5KINB 5JS1A 2C4TA 3MGBA 4MPTA 1DX9A 3P9XA 3NHZA 3CGWA 4OI1A 4PX9A 4KREA 2ACVA 2ID8A 2NADA 3BBPA 4PS0A 4DUGD 2JBHA 3H0KA 3OFKA 4NS1A 3VOSA 2CHFA 2Q6LA 3MHPA 1BRMA 7ABPA 2FVYA 3I58A 3EWSA 4BCBA 3KE8A 2OWEA 1LC0A 1Y81A 4HQLA 3ED5A 1DJNA 2ZJYA 2BBTA 3LY7A 4INPA 3PFHA 2FPOA 1F3OA 1ATZA 5DP1A 4XFDA 4XR4A 2BM1A 5EUCA 1ITZA 3AFHA 3CZPA 4A4DA 4W1SA 5CAEB 3CBQA 3EVNA 5DX8A 1C1XB 2YXEA 4ZRDA 3A6EA 3KPUA 3TLBA 4QOGA 3LOPA 3JQGA 1GLGA 3GL9A 1JKIA 1XDBA 1Z83A 2A9KA 1ID1A 4TLLB 1IZZA 5FA8A 2YDXA 5JVDB 5C37A 1MC1A 2X4DA 1FU8A 4ZJZA 1SBNE 3EDYA 2QW0X 2ZJAA 3QVOA 3ZHQA 4F4DA 4YMTA 4IIGA 4CNBA 1W1UA 3OT4A 2A1UA 1EZ4A 4MUJA 5GONF 3SVZA 3PXAA 5KKCA 5EHQA 4GD3Q 4L5AA 2CVHA 2YL2A 5KX5F 2XBUA 5IJ0A 2RMKA 1D0VA 1VHWA 2Y8EA 3I52A 4RHFA 2HX1A 1VKZA 3PKZA 5IARA 1J0CA 1Z6YA 4YUYA 3QLVC 3U7GA 10MHA 1FQJA 1O57A 4NEHB 3ZUGA 1V43A 1W47A 4DT1A 3IEMA 3SJAA 3ADDA 2GKGA 3OQIB 2Y76A 1NRIA 3M82A 3OX3A 4BO0A 3HKCA 5I7UA 3SYMA 4DYVA 3D43A 4XD7A 3C39A 1F0PA 2HJRA 3AB3A 1FBNA 3DV0B 3QOFA 3BMXA 1C3LA 2W6ID 3INGA 3L8YA 1V8DA 4I8IA 3H1GA 4MW2A 4YRPA 3CF6R 2WNIA 3ZGXA 3ESCA 1VHLA 1KSGA 4WINA 4MROA 3QUAA 3DYBA 4G5XA 4D3ZA 3B1XA 4QXMA 4CIDA 5KSYA 2PWAA 1N8NA 2GZMA 3ZY3A 3RIGA 4P3XA 3TDMA 3LTNC 3IV7A 1FVFA 1N5OX 3HDTA 4Z7JA 3MRTA 3I6ZA 3V7YA 4D41A 3JQ7A 1P1FA 1XA3A 2GXSA 4KWTA 4RM2A 5KKAA 3ZQUA 1BDIA 4OHVA 5DFAA 1N78A 1GPUA 3M34A 2G1KA 4PO1A 2M6SA 1L8LA 3BWDD 4WXEA 2DLCX 3MRXA 1G18A 4MHSA 1PX0A 3KOUA 1ICIA 1RD4A 3W8RA 1DZIA 4M0UA 1MH9A 2FEWB 4JVLA 1WLSA 4DA4A 1VXRA 2ZT7A 4M8NE 4TMZA 1UZUA 1V8ZA 1Q7BA 4FW8A 1I13A 4WVLA 2FWMX 3FNFA 3HR8A 1WVGA 4BKQA 4Q12A 4GT1A 3PLRA 2QLLA 3L6DA 4WZAE 5JISA 3PE6A 2VP4A 3N76A 2CC2A 1IHYA 2A88A 2B8TA 4MB0A 3R5TA 2GN1A 1AZWA 1P2SA 2IXFA 6REQB 3VTZA 5JSFA 3PFGA 4KN9S 1L5HA 1XRNA 2XMBA 3HS3A 1Z2DA 4PSCA 2ZJZA 3H17A 1OI2A 2ZRPA 4PHFA 3TOVA 1D2RA 2NVUB 2G25A 5D00A 4Q34A 1U04A 3BT7A 3OE5A 4UOZA 3AERB 1EBFA 3ETLA 5FPYA 3DDZX 4BVFA 5M2QA 1K3UB 1IBSA 2IHZA 2WR8A 3OWXA 5EP4A 1NQTA 4HGRA 3OI7A 2W6ZA 4GQIA 1SNYA 2IZ7A 1Y37A 3ZWMA 4E32A 1EX7A 3NTRA 2EFEB 4NAHA 1PJ8A 1O8BA 1YZ3A 1P77A 1P7PA 3VI4B 3NDJA 1OLOA 2BELA 3LCMA 3PPVA 4OUDA 4C76A 3R5SA 5JOQA 3THOA 1NT4A 3MAJA 5JZVA 3KR0A 1L7QA 4X54A 3VMFA 1Z38A 1GAXA 2OGUA 1G19A 1AF4A 4GMGA 5EXXA 4YFYA 3T06B 3ZHYA 2W2PA 3T5PA 5FO0A 3HKEB 4BY9E 5JCJA 2XRFA 4MGEA 1DT5A 4B3DA 4PWYA 1L2TA 2AEJA 2PZ8A 4FBMA 2ZEJA 1XPRA 1XQXA 5D85A 1G5HA 1RM4A 1UOPA 2WIDA 2ZIWB 5LP6B 1MXHA 2O0HA 3UJ7A 1ZGBA 4BXOA 3EDMA 4D81A 1QRSA 1RXYA 4LVCA 1ODFA 2F90A 3GGSA 1ADJA 2ZSIA 5JS8A 5FIUA 2GJAA 2QJRA 2VDWB 2ZRJA 3TFWA 3UATA 3IC5A 2PZJA 5CHYA 3DE0X 4V03A 5TIIA 4UCWA 4KE8A 5LU8A 3OX4A 5ALYA 3F78A 2ID9A 2NV2B 2X6TA 3U9TA 1G7RA 1NFFA 5CM2Z 1C7QA 2W8BA 1FZTA 3BD6A 5C8YB 4C29A 1ZI8A 2B5OA 1HFJA 4RAQA 3LHIA 4AWBA 2J3EA 3DXZA 1HDYA 2YKGA 2GPSA 3NC1C 2WHQA 1SCAA 4YGXB 3I5MA 2H59A 4IWXA 1GR1A 1ODIA 3HB1A 4KDRA 4REQA 5JJKA 1Y0BA 3H9BA 4D3YA 2Q3HA 1BWRA 3JR7A 4AECA 3E4CA 3VR5H 4OXKA 3RIXA 3G68A 4JI3B 1T34A 4OAOA 3C48A 3O2NA 2NG1A 3TTYA 3V7UA 1WBJB 1YZFA 3JAKB 3JWJA 4I1IA 2JL1A 3U13A 1QXSA 2C3MA 2CYAA 1VPDA 2EZ8A 4DUYB 1J5EB 4PX3A 3MWFA 3HJBA 4CL3A 5JH7F 5KKNB 4GWLA 1QG2A 5AH0A 5AM2A 4MGZR 3HVRA 3KKPA 3D3EA 3V1TC 1J06A 2BM8A 2HRCA 3LZ6A 3IQXA 1UR5A 3FOZA 4AS1A 3P9IA 3QVVA 3G2QA 4KR9A 3UQZA 3H2GA 3RSZA 3T7DA 1QFJA 1B26A 5I5EA 4C6SA 3UWKA 1O6BA 3FZGA 3WP0A 1VE9A 4BNDA 4BBAA 5IK2A 3KVYA 3TTXA 1LBQA 4CI9A 4YUXA 4ZFNA 1J33A 3Q11A 4DRYA 5EMKA 4C14A 4FNGA 1HI9A 1D8AA 3WB9A 4F9GA 1TNDA 4YRAA 4YRKA 5ISMA 4RTPA 1FP6A 3WRVA 1E6KA 4V1CB 1TAGA 1G3MA 3ECSA 1MP0A 3IT3A 2ZWOA 4D1YA 3B7GA 4EL0A 2R00A 2NPOA 5IC4A 1QR2A 1SQFA 2X6QA 4LCEA 1NU8A 5JV5A 1QO0A 3D7RA 1RAAA 3T9FA 3IAHA 5JCZA 1NV8A 2QIOA 3KNZA 1W8DA 3UKJA 2HK6A 4EPTA 5ICMA 5BNZA 4I08A 2Y1XA 2RKOA 3SYKA 4N5MA 2PGJA 3OQ1A 4KHZA 4D4IA 2D1QA 2F8LA 4R9VA 3PHHA 5L53A 3HJCA 4RE5A 4KCGA 5EQJB 4IZ6A 3SHTA 3UVEA 5I48A 4G1BA 5JYBA 1UEIA 4XE5A 2B3TA 1QG4A 5A7FA 3EUWA 3GEGA 3PUWA 4GR9A 4ARBA 3I9KA 2FGJA 2XITA 4J0DA 4FR2A 1QCCA 3EULA 1WXIA 2ZJ3A 4OMUA 5FTKA 1T6NA 4UPEA 3WGGA 3HVIA 1IUPA 1IG3A 4PGMA 3OF3A 4BRWA 5BSFA 5LD2C 3CZQA 2FN7A 3D3KA 4N7BA 4UVDA 1M2VA 1JPUA 3O2SB 2QRPA 3GJ4A 1F2UA 5KTKA 5KIAA 4IFIA 1NBIA 4WT7A 5K4GA 3D6TB 4R2LA 1RIFA 4U9UA 1UZLA 1NTRA 4IKEA 3F2IA 5EJ8A 2GO7A 1FDVA 1WXQA 1Z2AA 2HSZA 1TEVA 4P4SA 1JIJA 1KU0A 2NUTB 4RSGA 1A72A 3D6HA 3VR2A 4DMMA 3EX7C 5K0NA 4HAXA 1DBIA 1XTQA 3BF7A 3LPDA 1D07A 3RK4A 1ACMA 1RPTA 2GPBA 1QRDA 1UMKA 1TZBA 2CYBA 4IRXA 4XWTA 5AVWA 2ZQ5A 2AC4A 1QCDA 3L8HA 2PQ6A 5MGBA 3DO5A 4KJZA 2QORA 1FU7A 1Y1KE 2J3MA 1Z5NA 3LQ1A 3AY3A 5B2EA 3I8XA 4MPPA 1V3VA 4YV7A 3F4LA 5BR8B 1YB4A 5JNSA 2BI7A 3OAAA 1UPCA 2IH2A 3IR5A 5E3HA 1SXJC 4LF9B 2HSJA 2XF8A 5E3IA 4A5SA 1E2DA 1JLKA 4MNTA 1VLQA 5F1KA 2P4QA 1TQHA 2JIPA 2YRXA 2XEXA 5K8UA 3NUZA 1QZ3A 4HS9A 3V2GA 2R9VA 4P81A 3URMA 1G5PA 3EDOA 4PZ9A 3AW8A 4S1VA 4E15A 5AVSA 1Y1LA 2Q3DA 3KJIA 4ED9A 3CRRA 3BTSA 4IVPA 4NH0A 3ITEA 3AG5A 5ALVA 2E89A 3GOQA 3IVMA 5DNEA 3RROA 1J97A 2QN1A 3DAFA 1DNPA 5FAXA 1YSCA 4A73A 4XWKA 1FQOA 1D2MA 4NK5A 5JASA 2HMWA 2ODBA 3QVSA 4ZCRA 1EBBA 3CXUA 4KXNA 1HL3A 1F20A 4P33A 1D1QA 13PKA 2YJZA 2FYTA 3VKVA 1XU4A 3RLIA 1DC6A 1GDDA 2QTAA 5LQAA 4NCNA 3HUFA 4IX9A 3H8SA 4M3NA 1ECJA 2FEPA 5TMPA 2I1VB 1QTNA 1J49A 4K1LA 1N2CB 1S2NA 3HMQA 3H1BA 4LRTB 2J09A 1A9XB 3O03A 2C3PA 4BCCA 3GNQA 3S70A 2WWVD 5D3MB 2NT3A 4OIFA 4PONA 3REQA 2YWFA 3T5AA 2F00A 4EHBA 1GUBA 5JS7A 5IT0A 1R4NB 1GOTA 1L4HA 1Z45A 4EAQA 1RYZA 3ZW8A 2CHGA 1U0NA 4J7CA 2BEKA 4MSUA 4P86A 4CV3A 4WZBB 3WGUA 4BP8A 1BVHA 2RSLA 1NG9A 2XECA 4XARA 3TTSA 4B46A 1DDOA 4DLUA 2OAEA 5FNVA 2IIPA 2CJWB 1BHQ1 2WJVA 3F7TA 2YV4A 4HDNB 5DWVA 5U1PA 1E6LA 5IXSA 2OENG 2Q5CA 2CXQA 1QMGA 5JMTA 3C6YA 4RVHA 2WQ7A 2VJNA 3ORYA 3JCZA 5FPSA 3SC6A 3O26A 4KOAA 1U2QA 4DLTA 4NZYA 1YT5A 2NU7B 2H57A 3EWAA 2QTFA 1NXVA 2P0EA 3AUFA 3PHIA 3R3SA 4KYIB 4M99A 4NYJR 1P18A 4UHBA 3IAS1 5HX7A 1A0OA 3BMNA 2PSJA 4G0PA 1A8SA 1BS2A 2H7CA 3UT5B 5C2JB 2IV2X 2JBAA 1P6UA 1E1RA 2X9QA 4BVGA 4YAIA 3LX6A 2ZAGA 1OU4A 1PRYA 1UKYA 1NXXA 2JDIA 1JR3D 3ICCA 4HLNA 4MS4A 4OJNA 2GYUA 1N4DA 1S2MA 3QUTA 2IF2A 4JVMA 4MITA 4M9XA 1KO5A 4TWZA 4FKZA 1VCHA 2AZDA 2XA1A 2GVDC 4M6WA 1WXDA 1V25A 2R96A 1YBHA 2VWGA 4JK3A 1W5AA 2AXPA 5I45A 3I6QA 1E62A 2RC6A 4ZGWA 3F3YA 4XJSA 4IUYA 1RAHA 3CUKA 4IVRA 1A2KC 3GZTB 4OSPA 3LVFO 4V39A 1W87A 3EXEB 5AHKA 5IC6A 3F1LA 1T35A 4I6JA 421PA 4TMFA 4UAVA 5F4ZA 1DJLA 3K7EA 1PYDA 4EJSC 1T9CA 1W36D 3PWKA 4R8SA 3QLEA 2VJOA 4KX5A 2WTXA 5HP4A 3OHPA 4QDOA 2J85A 1H2YA 5HE8A 1JEDA 1GQOA 2LNDA 2O2DA 2QA5A 4EEKA 4ZJYA 4YAOA 2YICA 1NI4B 4MO9A 5AVUA 3F73A 2O3SA 2YCLA 4JR1A 1Z7GA 4GXNA 4JITA 1MX5A 1SUCA 2RGXA 3ILVA 5F7OA 3ZV4A 4WOBA 1SPBS 2C2XA 3M5PA 4PZYA 3ETHA 4X00A 4EHKA 3MS2A 3EC1A 3PFFA 1YFJA 1I51A 4IQFA 4NX2A 4WFQA 4BFWA 3PDUA 4KLRA 4ENSA 3A2NA 3KKOA 2CJXA 3OECA 3OTIA 4MW1A 5JAOA 5AUNB 5IJAA 1VCOA 2HSEA 2B7BA 2PIDA 3F6BX 3L7MA 3PWSA 3VDXA 3CEAA 3EGXB 3H16A 3LBAA 3LIIA 1SCBA 2WU3A 1MQ8B 3WV5A 2F1RA 2QAJA 3K1YA 1WXHA 4CQLA 1A5BB 2FMTA 2WZQA 2AOTB 3CLVA 4J1TC 2GM5A 2C4VA 4FR0A 5EMMA 4E46A 1V0JA 1I1NA 1J0XO 2CNBA 1I7DA 3M81A 4QUAA 3TTVA 1PWZA 3UANA 3DAYA 4H31A 1TZ2A 2W48A 3FYUC 3REGA 4I19A 3QQPA 1GPMA 5A02A 5ADWA 1FJHA 5ESXA 1PR2A 1QP7A 1I3CA 5JVDF 4Y3UA 1JL3A 1TO2E 3NR2A 1R6TA 4RQTA 3H8JA 2IVFA 4QU9A 2QUHA 4RABA 5KNBA 1XZ8A 3FVTA 1ZCBA 1NSTA 4FN5A 4GR5A 5JRDS 1KFJB 4KFCA 4F2WA 5KNCD 1W52X 4YBZA 4N4AA 5EFOA 4CEHA 2XF2A 3WAKA 2OFFA 3KB2A 1AY0A 4IS2A 1NXQA 1L5WA 4DJTA 1PT9A 2JKYA 4WN9A 2WTMA 3D4OA 1G38A 3HP1A 2WJGA 3RVLA 3RYTC 1IXKA 5G0VA 2YZGA 3CSSA 4JC8A 3ANMA 2ZU0C 4KEAA 2B7LA 1HK7A 3J80A 3NXSA 1TGVA 2Z2YA 4H3KB 4RS3A 3R7LA 3A9TA 3TL6A 1UPAA 4YJ2B 2O8EA 4RA6A 4GYWA 1I6LA 4K9SA 4V0ME 4R1QA 3ZDBA 3DUFA 4CMBA 1F06A 4ZAFA 3UGTA 2XYPA 2O3QA 1DRJA 4IEIA 5EMNA 5DHRA 4PTLA 3WL8A 3OFJA 1I1HA 1S01A 3FVVA 1W6UA 4F12A 3NBZC 4H1VA 1G98A 1MJGA 4J2OA 5IXJA 1CDEA 4JQCA 4MWOA 2C8JA 4QOJA 4I9NA 4M0MA 5G1PA 2ZIVB 3MT7A 4HNAB 1P4GA 4PX2A 4YJDA 1P0MA 4S3MA 1V8FA 3LLUA 1B42A 5A9TA 1YXMA 3DOEA 4BTEA 3BXEA 3RS9A 4GLFA 5AMXA 4P32A 3DTVB 5DZSA 1YFLA 4WCFC 4Z9YA 1GZ7A 1NI5A 5K0JA 5GADl 3EGEA 4B79A 4RPGA 4ZICA 3AUYA 4DE5A 1IY1A 3RG2A 4MRNA 2NXCA 3AIKA 3GNTA 5BUZA 1F8FA 1Q1EA 2BR3A 3BWEA 4CKEA 3S99A 3DFKA 2GDZA 2YHIB 3MWEB 4MQ4A 5L3RA 3DOCA 1MQAA 1ZJJA 2EWWA 4KIWA 1V3UA 3U16A 2FEAA 3QTBA 3CCBA 2Z8ZA 3BXZA 3KB6A 3QKRA 4J29A 3RC3A 4MK4A 1DKNA 4TXNA 3IAM6 3IILA 2P0AA 4KTTE 1NC1A 4DIEA 1WHTB 5E38A 1KMIY 3IBFA 4BMXA 2BEUA 3U3KA 4QTZA 5THQA 1CF4A 2BMWA 1V3QE 1U8FO 2FZWA 4Q19A 4PYMA 2R0QC 2OBMA 2J3KA 3S1SA 2Z1MA 3OF5A 1RHKA 4KACA 4OTZA 1RWOA 4X3OA 3STVA 2FDCA 4JB0A 4URWR 5H5JA 5IVDA 3SQXA 2WY2D 3GJ6A 2FPLA 1XZIA 3UJ3X 5IM4A 5F9FA 4DJDC 1XZQA 3A4IA 5BV0A 4KR2A 3PUIA 4F38A 4XD7D 1YS6A 5GQSA 1TC2A 5F3WB 3IB3A 1P4RA 4NMXB 1WB4A 1HM5A 1S3SA 3PUHA 1PG5A 5K2MA 4XJXA 1G7CA 3MWYW 4LHVA 2FPIA 4YB8A 3EOBI 1PEKE 1HFKA 3GNLA 3TH5A 3TRKA 5EZ6B 1U28A 4IJ5A 2VZ8A 4FGLA 3RRJA 1C7EA 4TRRA 1QQ5A 1HRDA 1U90A 2PXHA 2DSNA 2QGNA 1SUIA 2ISQA 2B1JA 1SULA 2C2BA 3II6X 3OKCA 4PPQA 4WACA 2FLKA 4LC1A 4HMOA 5DOZA 1GNPA 1PT8A 1T2NA 4CJXA 2VQ6A 1EFKA 4DLKA 3G2KA 4L5CA 4M86A 3TF5A 4R1OA 1WDWB 1XEXA 1CHDA 2NO4A 2P2NA 1CY6A 2VNJA 3ZNPA 2B69A 5A3VA 2FPKA 4A3SA 4YR7A 1YIOA 4UKDA 4M38A 1FSGA 3WWYA 1N7GA 3CX4A 3L8DA 3AUTA 4RO0A 1UWKA 3K3PA 2XQKA 1WW8A 1YHNA 4EX6A 1LRLA 4R2XA 1QYCA 1ZD8A 2DQSA 3CUTA 2XB2A 4B0PA 3EEBA 3D1JA 1KAOA 5J5VA 1JAZA 1MT0A 3QVGB 4MMZB 1IBCA 1PVVA 1OMOA 2I6TA 4JIGA 4A0SA 1MU0A 2HM7A 1G66A 5BR4A 2XXAA 3ZGOA 5CK4A 5LDGA 3DCIA 5C8YF 5KOYA 4JBHA 2VF7A 4GOLD 3G2JA 2DXIA 2UV8A 1EK5A 2VYQA 5ER9A 3O7WA 5GVRA 4B75A 3B5EA 4HR7A 5FTWA