1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
3RVMA 4HNRA 2LPMA 4MLDA 3MF4A 1Z16A 3RVJA 1D4ZA 4MS4A 5TQ0B 9ABPA 4YS6A 1ZY2A 8ABPA 4Z4IA 2JK1A 3Q41A 4TLLB 2FQWA 2R48A 4MQFA 4RDCA 2LBPA 3CHYA 2HJ9A 3NHZA 2FTKE 2PL1A 4KK3A 1DCKA 4N0PA 5DKFA 1EWTA 3DLBA 1Z26A 5KWSA 4RK1A 1E2BA 5EWMB 3LUKA 3A0RB 1C0EA 4OLBA 2MYUA 4DN6A 4F11A 3QLTA 3HVRA 1NXVA 1ABEA 5IC5A 4F3TA 1JYFA 4G0ZA 3LKVA 1JHZA 1DC7A 4Z4CA 4YCSA 3Q7RA 4PICA 2IDMA 3H5OA 4ETIA 1BDJA 1NXPA 2R4QA 1JFVA 1J56A 2WWVD 3RVLA 3CKMA 3JS5A 3KKEA 4YLEA 2GKGA 2MSLA 4MR8A 4RU1A 1PUXA 3RVQA 4IILA 2FEPA 1L5ZA 1WETA 1U8TA 6CHYA 4F06A 3A0UA 4P1ZA 2PAFA 3M9XA 4YGXB 4KREA 2CHFA 3QEMB 3NHMA 4OG2A 2PUDA 5IUJC 2IPMA 1YIOA 1QP4A 2TMYA 4Z99A 4CBVA 2PMCA 3F6CA 3I42A 2B4AA 2O20A 3D8UA 3GT7A 1M2EA 1TJYA 3KLOA 1SXIA 4G0YA 4MRMB 3FDFA 1TLFA 2MSKA 4RKQA 1GCGA 4MQEB 5TQ2B 5IEJA 1QP0A 3RH0A 5D2CA 1QNLA 3FFTA 3MA0A 3QEKA 1TM2A 1ZN2A 3BRSA 2YHBA 3KTOA 4MPTA 3RQIA 1T34A 3T8YA 4ETNA 2QW1A 4ML3A 4E7OA 4NICA 3F7NA 2JVKA 3SNKA 3VNAA 2FW0A 1ZH4A 4IRXA 3H5WA 4N47A 5DTEA 3SM9A 5BRAA 4TLMB 3DBIA 5FBHA 3BBLA 3IP5A 4LX8A 2FEKA 5TQ0A 1VKRA 2MYTA 1Z17A 1ISRA 3LKBA 1NXXA 3EGCA 3EULA 4D6XA 2GWRA 1RZRA 3FMVA 4RK4A 2CWDA 5DCLA 3HEBA 2JBAA 3QX9A 4G86A 2L17A 4MS3B 3OMWA 5ABPA 5KQGA 3F73A 2MYNA 2XDYA 3CG0A 5EWJB 2E4ZA 3NNSA 1RXIA 5EWMA 4RXMA 1LBIA 1JF8A 2NZUG 4YWHA 5CNKA 3O1JC 4TN5A 2JB9A 4NCBA 1SXHA 1JWLA 3Q7SA 1NATA 3S99A 4Z4FA 3RVOA 4MS1A 1DZ3A 5TPWB 4H3HB 3URMA 2ZWMA 2FKAA 1ZDMA 3K9CA 2ID9A 3DZDA 4GNRA 1P2FA 2FXIA 2L19A 5C5EA 3R0JA 4W5TA 4IMJB 1VPWA 4XLTA 3KHTA 1APBA 4W5QA 1D1QA 2VK2A 3H75A 1ISSA 2NT3A 3MM4A 1DCMA 2FN9A 3BREA 3EDCA 2FLKA 1MAVA 3O2QB 4YO7A 4F12A 1JH9A 3SY8A 2F8SA 3W9SA 3QEMA 3EAFA 3QLVA 2CHEA 4LE1A 1MB3A 5HKOA 4RXUA 3OQOA 5CNIA 5FBKA 4EVRA 1DBWA 3EJWA 5IULC 3OQMA 1A04A 1XHFA 2E4WA 3F6PA 3CNBA 1FQWA 4MQEA 1DCFA 5FWYA 2X7XA 4G0QA 4KVFA 3ROFA 1U0SY 1P6UA 3LFTA 5JNUA 3N0WA 1OXBB 3E61A 2VUIB 1D2AA 1L5YA 1Z2EA 3HUTA 4QYWA 4MYRA 4L85A 3DGFC 1KMIY 4N41A 4N76A 1YK1A 2E4YA 1DC8A 2ID7A 3B2NA 4QICA 3A3KA 4RZSA 4PEVA 3KLNA 1ABFA 1LJUA 4UHKA 2MSWA 3GA5A 3VNBA 1CEYA 1FSPA 3T6KA 1YVUA 4KMRA 1EFAA 5T3YA 4Q7EA 1YTUA 4ZPJA 3LUJA 4O1HA 5IX8A 2M1ZA 2HQRA 5PNTA 4Z4HA 3OLYA 4OTZA 4OLAA 2AYZA 3HK2A 3SAJA 1DBQA 3HXMA 2R25B 5EWJA 1XWWA 4ETMA 2PUBA 4KPYA 3FFXA 3QLVC 3RVRA 2E4VA 4WZZA 1PEYA 2F8TA 3O2SB 4KQ9A 3C6QA 2QZJA 1CHNA 4LRQA 3QLUA 4PYRA 4QYMA 3H5TA 4RK0A 4EGSA 5JNRA 1ZHHA 4WT7A 1JFSA 4DADA 3NBMA 2L2QA 3H1EA 2JCGA 3GWGA 4N03A 3ROTA 4W5NA 1YMVA 2AYXA 3HCWA 1PEAA 2L18A 1RNLA 3T38A 3CG4A 4D6YA 1KGSA 1BDIA 1JBEA 3OO0A 3TD9A 1RXEA 4FE7A 3HO1A 2QR3A 4NV3A 5JNTA 1ZH2A 1EHCA 4EY3A 2WJWA 4YP9A 4HNQA 2KYRA 4RK7A 5EWLB 3I45A 4WWHA 2Q5CA 4Q6WA 3GBVA 2GBPA 1BVHA 3LUCA 2JVIA 2A9OA 3I09A 4NCAA 5BR1A 3P9YA 2VUHB 5TQJA 4OATA 7ABPA 3CZCA 4UHJA 1USGA 1YS7A 4D74A 2HPHA 1M5TA 3TX6A 4IF4A 1RPJA 1ZGGA 4LZLA 1DRKA 1LBHA 5FWXA 1JDPA 5IUKC 3MYYA 1EWVA 3JVDA 3OO1A 5GOTA 2M98A 5HSGA 5KQPA 2P4UA 3QLUC 4Z4EA 2FLWA 3H1GA 3KYJB 3L6UA 3M6MD 1NXWA 3OMXA 4Z9BA 1U2PA 3KJXA 4MR7B 3KS9A 2JVJA 6ABPA 4EYOA 5JNVA 3HM9A 2OENG 2IKSA 5IEBA 3D02A 3HUUA 4EUKA 2FVYA 4WXMA 1QQAA 3CZ5A 3GBPA 1HEYA 3N0RA 3QK7A 4IGAA 5JS1A 3TB6A 2QV0A 3H6HA 3EODA 4TMYA 2NZVG 1FFGA 1K68A 3RVKA 1SXGA 1QP7A 4QPJC 1FFWA 4F8JA 3UUGA 2OQRA 4MQFB 5C5CA 2A9RA 2IPAB 1RZRD 1H9CA 4RKRA 3JPYA 1BDHA 2PUEA 2LIVA 4JB0A 1LK0A 4RSMA 4LE0A 1E6MA 4LE2A 1AB5A 4RY9A 1U04A 5B3JA 5KC8A 2NT4A 3Q15C 1JL3A 1QPZA 5CNJA 3OLXA 1VLZA 1SD5A 1Z13A 1A0OA 5HQJA 3LUHA 2FSPA 4Q6BA 1GCAA 3GYBA 2RGYA 3C97A 1ZGZA 4H60A 4RWEA 3KYIB 5TPZA 3RVSA 4XAQA 4ZMRA 1JYEA 2VYCA 4MR8B 3JVIA 3GV0A 5BRJA 2WJAA 1FFSA 3Q9SA 2FQXA 4P98A 1AB6A 1ZESA 1IIBA 3LOPA 3O1HB 3MMNA 3OLVA 4WXEA 3EQ2A 3IP7A 4MRMA 1YK0A 1URPA 1D1PA 4XARA 5IBQA 5TQ2A 1YS6A 2PUCA 2PUAA 4Z4GA 3SQNA 4EYQA 1PNTA 2V0NA 1C4WA 3N75A 4MLCA 5TPZD 4WUTA 3H1FA 3OLZA 1F51E 4ZMSA 1S8NA 1GLGA 2QU7A 4LDZA 2E4XA 1USKA 3N6VA 1LJLA 2H0AA 3QELB 5JNSA 1Z12A 2IPNA 5B3JC 4XFKA 4EYGA 2LUOA 1NXOA 3C3WA 4MR7A 1QMPA 4W5RA 2WRZA 3IPAA 1A2OA 3CTPA 3HZHA 1K66A 4MS3A 2NUBA 3EQZA 3C3MA 3I5AA 3N0XA 4KRFA 1DBPA 2WB4A 4MR9B 1M5UA 4XXHA 2RJNA 4KQCA 1JLKA 1P8AA 1UDRA 3CFYA 1EWKA 2FN8A 3G85A 4N0QA 2I6FA 3DLHA 2HSGA 3MQ4A 4MGEA 2MYPA 3JY6A 2JBAB 4G0MA 4O5AA 1TMYA 4H3KB 4NQRA 2PUGA 5TPWA 4DQDA 3K4HA 3MIZA 3N53A 4O1IA 3UKJA 4JA2A 1QO0A 5E3JA 1JX6A 2PKXA 3HJFA 1Y1LA 4EYKA 2WMYA 3IDOA 1Z25A 5JS2A 4RXTA 5KQMA 1PNRA 3NNDA 3HSYA 4ZYLA 4MS1B 4G97A 2PL9A 2QSJA 2B1JA 1MB0A 4E7PA 1XHEA 3H5IA 2JRLA 3JTEA 4KZKA 2IOYA 2DRIA 5KC9A 1QO0D 1JFTA 2HQOA 4KV7A 1GUBA 2GI4A 3O74A 4RK5A 4YR7A 2RJOA 1KRWA 2CD7A 2PUFA 3CLKA 4Y9TA 3H6GA 3TMYA 1M2FA 3LUGA 2PLNA 3FGZA 4KNYA 4EVQA 3H5LA 3OQNA 4Z9AA 1JDNA 2PE5A 3M9WA 3C3KA 2J48A 5TE9A 4L4UA 1VRVA 2N9UA 3ILYA 4JOQA 4G0OA 3OM1A 1NXSA 1QKKA 3CRNA 1U2QA 4HNSA 5HM6A 1P6QA 1YMUA 4RY8A 1ZAYA 3QELA 3A10A 3E3MA 4JASB 2YHAA 4MAAA 2RDMA 5ED4A 4PE5B 4YRZA 2PJUA 1E6KA 3O21A 1KRXA 1EAYA 4RY0A 4KFCA 5FWYB 2QVCA 3HV2A 3IP6A 5IUNC 1Z15A 4XASA 3GRCA 5F64A 2QVGA 4MS4B 2W42A 3SG0A 5GQSA 3LTEA 3O1IC 4KK4A 2BGGA 1BAPA 2FEWB 1GUDA 4JP1A 1ZVVA 4S04A 4MR9A 3G1WA 4JB2A 3N8IA 2IYNA 1DP4A 2FMIA 4EVSA 3LUFA 1MIHA 4G0XA 2FMHA 4HYEA 5T7BA 1W25A 4LDAA 3HS3A 1Z2DA 3GL9A 4YV7A 1QQBA 3H5VA 1B00A 2ZAYA 3CS3A 3HDGA 3OM0A 4OBBA 3RVPA 5DGCA 2R47A 4Z0NA 3KCNA 4M88A 1I3CA 1D5WA 4IMIB 3BILA 2H3HA 4B09A 3L49A 4FE4A 5EWLA 3KG2A 3DGEC 3IP9A 1DRJA 3T95A 2FMFA 2IPLA 3UK0A 1NY5A 1SRRA 2A9PA 2FQYA 1F4VA 4JAVC 3ILHA 1R8JA 3HDVA 3RVNA 4RV5A 1ZITA 2P9HA 3LUDA 5KQLA 1MVOA 1DG9A 3O2JA 3O75A 5BQ3A 4RK6A 3BRQA 3QX8A 1NXTA 3FFWA 2QXYA 2A9QA 1BA2A 2GX6A 1NTRA 5JNWA 3JPWA 1PHRA 4GPAA 3IPCA 2E4UA 4FB4A 3LMKA 3OLWA 1W9HA 1Z18A 3LUAA 3KSMA 4ZJPA 1CYEA 1OXKB 1DJMA 3Q7TA 1E6LA 5KI6A 2FMKA 1TVMA 4W5OA 2LP4Y 3NNNA 5I4CA 5DLEA 2HQBA 5CNMA 4S05A 4G0PA 4RS3A 3CU5A 3TO5A 5FWXB 4PZ0A 2WY2D 1USIA 5CHYA
chains in the Genus database with same CATH superfamily
4WHMA 2XWBF 3OOEA 4UTZA 1G1AA 2HF7A 2Q4OA 3VVLA 2ZSDA 5FBVB 3AI1A 4DY6A 2WHXA 2PZJA 1AQJA 1QIIA 1WMEA 2QQGA 5A6VA 1U1FA 1U9JA 1V7CA 3FUCA 1Z6QA 2G36A 3QPWA 1Z0IA 1H2RS 2JFUA 3BAZA 3BD6A 4LJ6A 1VYTA 1PU2A 4ALJA 2CNBA 4CL8A 1EWTA 3GG2A 5FV4A 1WLSA 4C3UA 1NZFA 2OHGA 4GLJA 1VSUA 2A67A 4KXYA 4BZQA 2J7KA 4O02B 1A9PA 4W8HA 3JAWB 3ZDYB 4TYMA 1II0A 1GRQA 1VYUA 2XOEA 1ABEA 1REQA 5FNZA 5IC5A 1IBRA 1XALA 3ZH2A 2ZCUA 1N3IA 3WBJA 1JHZA 2B61A 2X5OA 1P0QA 4M1EA 5DTRA 4FZRA 3ZXUB 2C83A 3ZYCA 4W5JA 4UTRA 3W5HA 1XZCA 1SG6A 2JARA 2WUWE 1ECGA 2I4OA 2WAOA 2JIBA 3OZDA 2JH9A 4NNJA 5GVSA 5KOHB 1DU4A 3C0KA 5KYGA 1NYQA 1BHJA 1VLVA 4IH4A 1BU5A 4XRRA 3VDQA 3WJAA 5KTYA 3WS7A 2JGNA 2FEPA 5IT0A 1M6NA 2QN2A 3TNDA 1GTVA 5CFQA 5DV9A 1D2MA 3PFFA 1XPJA 3C1TA 3PNPA 1ZL0A 4OB8A 4PZLA 4UFOA 5I48A 1ZIPA 3GRYA 3TQFA 3FTDA 2AXQA 4OB7A 3VBEA 4EY5A 3PQ8A 2C9YA 1OH6A 1IHOA 3T4EA 2HR1A 2MJLA 5K45A 5TC4A 2EERA 4ZI7A 3W34A 4KGVA 8GPBA 3O8CA 2I2CA 3GT7A 3HG7A 1TJYA 1ONPA 3D9QX 3KLOA 4MO2A 4I5GA 4MRMB 3VH4A 1K0FA 1XQ6A 2DLDA 1SIUA 2VK8A 4HPJB 1XCJA 2H29A 2Q5EA 2VYND 1UBGA 3EIQA 3MOGA 1ECFA 4IL5A 4LSZA 5TVGA 3NBUA 2HJGA 1KDVA 1KORA 1RLJA 1N2GA 1KY4A 1YWGO 2IYSA 3WIBA 4B75A 3PI7A 1PVOA 2LCIA 1F14A 1U0JA 2ZSHA 1EVJA 3VC2A 4LC0A 2ZOSA 1ZIXA 1ZVKA 3RBXA 1DHTA 1FNDA 3KOXA 5F78A 1Q15A 1Y33E 5F7XA 3BBLA 1RXWA 4LX8A 4FHDA 3EUEA 1NZDA 4G1MB 2ZR7A 1ISRA 2PZLA 2PS3A 4UCXA 1HT3A 2NYVA 2IYFA 2GWRA 3QVTA 1WDTA 1E1CB 1QYWA 4PLYA 4EG3A 1ZD2P 3PENA 4JI8B 2XKAA 2L17A 3PRYA 1F0NA 4MS3B 3TEMA 3RJ9A 5REQA 2Y2UA 1XTIA 1FPMA 3F73A 3HCPA 3LPAA 3T9AA 5JAOA 4R8SA 1I2AA 1YCGA 2NZUG 4QJ4A 1C9KA 1Z2AA 1HT0A 2GF9A 3BB1A 3R5JA 2JLCA 3A4TA 4OLJA 4H6WA 1IY9A 3Q7SA 4K6KA 1BU8A 1VE7A 1Y37A 2VR1A 4QGFA 2JASA 5DP2A 1KE1A 1KAQA 3SYKA 3VO9A 1TO1E 4PQGA 2IF0A 4OXYA 3PUJA 5AKHA 2GMWA 4GRIA 3MS7A 4J1QA 5TPWB 1OPRA 3MSCA 3W78A 3OD1A 1YCDA 2VC2B 1JHRA 4J0QA 3EQ7A 1WX1A 4PGGA 4I8DA 4EW2A 4XYMA 2ZI7A 4HHEA 1ZO8A 3K0KA 4OAOA 2BSQA 3NRJA 3OJEA 5GGXA 3TNLA 1BQ3A 1AQLA 3EZGA 1SFRA 4U2EA 5AJTA 1A8SA 3H75A 1OSNA 2XE6A 5DGIA 5JNUA 3H4IA 3U0VA 4I1PA 2IP2A 3Q87B 4PIVA 3VDRA 4EKGA 1PL0A 3ZU6A 1XZPA 4WKNA 5SYNA 4EFKA 2NX2A 3ZDBA 1NI4B 2F8SA 3F7TA 1CC1S 2QUIA 1NSTA 2BELA 1U3DA 4HQKA 1MB3A 1PVVA 4UDYX 4HGZA 4DCTA 5KNDA 1O6FA 2HYDA 3LLUA 3ZH9B 4CEIB 3PIIA 5AHOA 4EA7A 1BX1A 2GM4A 1OB2A 1DLJA 4A0QA 4CEHB 1UWVA 2IZ7A 1YUMA 4LHSA 2GS9A 4F1JA 4EFMA 1XEXA 3EY4A 4ZYVA 4MQBA 2C8LA 3WOVA 2NQTA 2I8LA 3OZWA 4I3HA 4EPWA 1JG6A 1XZKA 2FCAA 1KO7A 1V8OA 1FLDA 2YMMA 3EFEA 4GDMA 2IZ5A 3Q10A 4NE9A 1W4RA 1UP4A 1FFHA 1Z5VA 3EG5A 3QPBA 4Q7KA 1USVA 1SC9A 2PA0A 3V8RA 1X19A 4WLFA 2ZYGA 3EHDA 1Z8NA 3CUKA 4JB8A 4J2TA 1YI8A 4OOEA 3WYEA 1KMNA 3QXGA 1JR2A 1NZJA 1P0FA 1YHZA 2AW5A 3TRDA 1DTWA 3LFUA 1FZQA 4CMKA 2GZSA 3OFSA 3L4BC 4Q7EA 4XR4A 1L5VA 3LUJA 1H8ED 1U2GC 4X8LA 2PH5A 1WULS 2IHYA 2CDRA 3DOUA 3ZGYA 1X92A 4QEKA 2OBXA 2VH5R 2ZAOA 5KBYA 4OJQA 2R79A 4OP3A 3E15A 5FOWA 3IEVA 4ID3A 4YCAA 4LNUB 4CLOA 4QPNA 1RWQA 4WCVA 1OAKA 2D2XA 3NS7A 3GCWA 3ZBTA 4DNQA 2WM2A 2B5OA 4N7JA 5FAKA 1XVVA 2PG3A 1MU0A 5KEIA 3PNKA 5A4AA 3VU1A 1TKBA 3OWOA 4L9SA 3ZJTA 3M5CA 3H5TA 4QYMA 2JAPA 3ASZA 4TGLA 2VXOA 3DFIA 5AWFC 2GK4A 1EX6A 4XDGA 1EVYA 4XFJA 4CIXA 4WH0A 1JFSA 2R1ZA 3GD7A 4FBGA 4C5BA 4B3SB 4BZPA 3ROTA 1AGYA 1CZLA 4RMJA 4UBNA 1SBTA 1FRFS 1KAOA 1DXQA 2EARA 1DAHA 1IATA 1K6MA 3AETA 4NZZA 3UPDA 1WO8A 4JB3A 2R7MA 4NESA 4LSMA 1IBMB 3DDOA 3QVJA 4PLPA 1KE2A 1A8UA 3HABA 5JNTA 5LQJA 1CB0A 2XUJA 1XB2A 4ABTA 3BMXA 4MYTA 4ER3A 5MGBA 1PUIA 3I45A 3ZVNA 4NYMR 4TMKA 5L3VA 2OD2A 1I4LD 1FW8A 2Z3VA 3O8BA 1UBHS 1UMCB 4UQLA 2QJWA 5BR7A 3FROA 4RJJA 4YJ2A 3R77A 3SQLA 5JSZA 1SHLA 5JRDS 3RS0A 2YIJA 3ADOA 3SJCA 2AKEA 1E69A 5MFPA 1J39A 2B30A 3LL7A 4QTTB 4WESA 1LKZA 4Q18A 1Z7EA 3CRZA 1Q7RA 1V7ZA 4PN3A 2GRJA 1YZYA 1ND5A 3IMGA 3MYYA 1EWVA 1M2VA 4WZBB 2VTDA 5C1PA 4BLSA 2X5NA 5K8IA 3P1JA 1VI6A 4MXDA 5JHHB 4CMCA 4GKJB 2RE8A 5H8WA 4RS4A 2JVJA 1LRKA 2OZLA 3HM9A 2J59A 3PT9A 2OCKA 3B70A 4HEA1 1ISIA 4JL8A 1U1IA 3AEQB 4RF5A 2FUNB 2NU6A 3A6LA 2IBMA 4LFBB 4QGGA 3OJCA 3TNJA 1N1EA 2VO1A 3FCUB 1HEYA 3E7XA 3NKVA 5CITA 1HPLA 2CLSA 3WRXC 3QA9A 1QIFA 4OYRA 3E84A 3QMMA 2JLYA 1BW9A 3DPIA 1RADA 1UZNA 3PQ3A 2HLDD 1MP0A 2RGAA 5FJJA 3IQIX 3AQ4A 3RAGA 1KEKA 3AVUA 3KQPA 1KQGA 4FGWA 3I05A 1XJWA 4IFIA 2Y1EA 4QX6A 4XD2A 5EERA 4DNFA 1R6AA 2IY9A 2IE8A 3AZOA 5CFNA 1GZ5A 2G0TA 1H9CA 1T8UA 5EE3A 1Z7WA 2WF9A 4DXDA 1QYCA 2R7AA 1VMIA 5A7FA 1EFVB 4RY9A 2EV9A 5KYXA 1UMBB 1X13A 2A84A 4TM7A 5K4AA 5BQXA 4KO4S 3GFBA 2H1VA 1WZUA 5J59A 1RLUA 3FF4A 2C2ZA 5C8YA 4FCVA 1UC4B 1J8FA 4HC4A 1RE0A 3D8BA 2GJAA 1XU9A 4LHXA 1IRIA 2DSNA 3PVZA 3E5HA 1QFJA 4H60A 3KYIB 3E48A 4OAQA 2V58A 3NGMA 4RVSA 4H0NA 4BN0A 4B7UA 3DSRA 1M8JA 3BSYA 5EJ2A 1I51A 1UBNA 2HJHA 4OXNA 1HFKA 1GYQA 1KAMA 3QJ5A 1ZESA 1Z35A 3O1HB 2YFKA 1S9HA 4CLDA 1PK9A 4C04A 1GCOA 2HI0A 3TKLA 1E1YA 1Z62A 4N7BA 1RXCA 4Y9SA 3FG9A 2R6GA 4EHFA 1OXUA 2CLDX 3O83A 3R7WA 4YRSA 4D57A 3PXAA 1LJ8A 5TPZD 4RL6A 3VJLA 5CUQA 5MN5A 4M1WA 4DLAA 1DC5A 1Y48E 2OAQ1 2ZYAA 4N0EA 3VBCA 4RJTA 1U0RA 1XZMA 3K32A 1H22A 3DW3X 1ZK0A 5B7GA 1LJLA 1YZQA 3VH2A 3TRJA 1XPRA 4MKIA 3HWWA 2ZVDA 4BP9A 1XDDA 3UF0A 2MSEB 3ESXA 1N3BA 1SEVA 2VJAA 3ZV5A 4R1UA 4EYGA 2LUOA 3NHFA 4GEKA 3GVIA 1XDUA 1QWOA 2EFEB 2QD5A 5F73A 1U90A 1MC5A 1NVMB 1QZUA 1NU6A 2V0CA 1KNXA 3GP5A 3UB3A 5ITWA 5K8LA 3QFHA 2QTGA 2XMDA 3V1KA 2YXPX 1KKLA 2WVGA 3IPAA 3ZN2A 5ES4B 3RVDA 5LXTA 1OTXA 4KPFC 1K66A 4WGGA 1KMCA 4YH1A 1YC2A 3NV9A 5JBIA 5T41A 2C4VA 2UZ1B 1JKJA 1T1IA 3VJMA 5D87A 4DJJA 2Z6QA 1NC1A 3HCEA 2BEWA 1XCMA 4HYQA 4BLUA 2WM8A 3GELA 5HIIA 4CQNA 2PYZA 4N0QA 3DLHA 5IKEA 4EY8A 1NNEA 3F8SA 4BNKA 2EZ8A 3ZIAD 1OB5A 3W2EA 2YFYA 3OF2A 3NBFA 4R51A 4W5WA 4ZYUA 1VTKA 5EC8A 4O1IA 5E1OA 3ZY2A 3L6BA 2X4GA 1Z4PX 1RXSA 1FQKA 1S8AA 2YHIB 3QBTA 4FIDA 1SEPA 4AJ2A 4JY7A 2WF6A 1FXWA 3G7SA 1CDZA 4BVHA 2O8FB 2FEXA 2OT3B 3FDIA 3TVDA 2XXAA 5TLSA 4HRXA 2X1LA 1CS0A 5TXGA 4MIKA 3KSZO 4M21A 2B1JA 2D0PB 2JRLA 3RUFA 2XF8A 1X9GA 1IOWA 2W2LA 3C98A 2YWCA 3V1LA 1CT9A 2P78A 2IOYA 1JLLA 1L3BA 1G55A 4D3YA 2WDZA 4IDNA 3FMGA 5T3UA 3GLVA 3T5GA 4F4FA 1NPYA 3DDWA 1NMZA 2R1VB 5LUAA 3QYFA 1XRQA 2EFDB 4WUVA 3FZYA 1LNQA 3HCOA 1RQ2A 3QPVA 5CEJA 5LP6F 5A4KA 3G2PA 1DTSA 4ZRNA 4C87A 1T2AA 1SXJB 1GKIA 1K4MA 3Q6MA 4FQ8A 2AEFA 4P82A 4UNSA 1R0RE 2SBTA 1DO8A 1QAMA 4FVTA 2B7BA 2M6RA 3LZCA 4MKZA 1O8CA 3TXXA 3WWEA 1WHTB 4KX5A 3TUIC 3KHUA 4PC2A 5I9IA 1J2TA 1E5QA 3QELA 3SHOA 4CM1A 4BKMA 2EP8A 3T7SA 3VOBA 1E6KA 1IZ0A 3ESRA 3TR5A 3HB7A 1Q19A 3VHXB 4IOMA 2YMPA 1Y3IA 4MKGA 3RTDA 5DEIA 1XTSA 3HN2A 1WV1A 3K5PA 5TJ9A 2PX0A 1KYYA 1LXCA 5LLDA 2YV1A 4MOWA 4PGHA 4QO7A 121PA 2DPLA 2XUIA 3IV7A 4H4EA 4IOKA 3RB8A 1RQRA 2HUPA 2J3IA 1T4BA 1XFDA 3GLIB 2P9EA 1E4OA 2BHLA 4LJ9A 4Y67A 3VO1A 1AURA 1HNXB 4OX9B 4IO0A 4WA7A 4JP8A 5JDCC 4Y2PA 5AIBA 1MIHA 2CZGA 3CISA 4CLOB 3NP9A 1PWYE 1SK8A 2D1FA 4OVKA 1FE8A 3IAHA 5CH8A 1Z2PX 3DJYA 2A30A 1Z2DA 5DDIP 1DAOA 2C3MA 1TZBA 3HV0A 1ZVMA 2JCVA 3ZWYA 5TJHA 4CN9A 3TTYA 1JEEA 2DBYA 3ZLBA 1JT2A 4M83A 2M6SA 2P2NA 3ZTTA 1JAIA 5IDXA 4DSUA 4RHCA 2BMAA 5ENDA 3GGOA 4BBAA 1A9RA 2ECFA 2Y68A 4KKVA 4TTAA 3VKWA 4B09A 4DEXA 2G1PA 3Q8LA 3CCFA 3BG5A 3DB1A 4K46A 4EJMA 3B78A 1VKNA 4RIEA 1JVBA 1KSGA 3WB9A 2GZ3A 2I9KA 3QQPA 4YO8A 2B4RO 1MUUA 2RBKA 3S1AA 4K6MA 1T2DA 3K0BA 5C1DA 3DKRA 2OD9A 2XOKD 1P9NA 3AW9A 4D8UA 2WD9A 2X5KO 1KFJB 3PGA1 4FR5A 2W2XA 5B53A 4CQLA 2EJTA 1N8KA 3BJRA 1I24A 3CNOA 2VJPA 1UPAA 2NO1A 2QXYA 2A9QA 3L8YA 4YT5A 4F4HA 2FMXA 4GPAA 1PHRA 5CBPA 1QC5A 2AJDA 5JSZB 4R3UC 3ENNA 2IXBA 3TS1A 1ZL2A 1PWZA 2UVPA 5DMHA 3K6KA 1SVWA 3IH5A 3I0ZA 2NYUA 1C4KA 4EHKA 2FF5A 3K70D 3DFKA 4MQ4A 1EUQA 2W2NA 2HQBA 2BUCA 3CR8A 3OTHA 3QI2A 1O6CA 4EGQA 5BURA 1EE9A 3TO5A 1JLHA 3QW4B 1CUWA 3BIWA 5AXBA 2DR3A 3DE3X 1M2VB 3S40A 4QKQA 1F8GA 4WD3A 1C81A 2QG4A 1Z16A 1A9SA 2FQQA 5B1EA 1AA6A 1L6IA 3IKJA 1NR7A 2Z5GA 4YMIA 4ER0A 3IQGX 4ZVTA 3GJZA 5EJ6A 5JIBA 2YBEA 1UM9B 2VSXA 4LF5B 4BX8A 3HRHA 1JG7A 2V5VA 1YMQA 3U4AA 3KFVA 1U4OA 2VDNB 4MRSA 1TVKA 3X1ZA 5I3ZA 2ZU0C 3ZY4A 1BW9B 3A0RB 4M38A 3V7WA 1F0YA 4I9UA 2ETXA 1E8NA 4HZIA 4IDCA 1JYFA 1L5SA 3LIIA 1PTKA 3DVAA 4KQMA 4X7MA 1PT8A 2NVWA 4X8MA 1NXPA 4MAFA 1V5FA 5ADVA 4K3UA 1SXJC 4KNWA 1IXYA 3PGXA 5FKJA 5KYXB 3CEPB 4YRIA 1Y3BE 2GKGA 5HGJA 3EGXB 4IIJA 2J3JA 1DEXA 1V5IA 2CW5A 2J0EA 1LC3A 2VQSA 2J5XA 4KQFA 1L5ZA 4NH4A 3PC2A 1WETA 2I2WA 1UBRS 1Z34A 1AKTA 4J6FA 2Q9AA 4F06A 1DKUA 2VJDA 3MGKA 3T5DA 1EXDA 2PUWA 4IUDS 1XTQA 3TW4A 4QFBA 2R44A 2FQ1A 3LGAA 2MCFA 1D03A 5IYZA 2FZWA 2EAUA 1P4AA 2A0WA 4ILEA 2WWYA 1K4YA 3O8NA 5IVDA 4PX2A 4JP2A 1NQAO 2GSWA 1PW7A 1DFGA 1VHWA 2PMCA 3OJ0A 4KO8A 2B4AA 2VT2A 2BI8A 2NUAA 3E1SA 4LVNA 3EEOA 3QE9Y 5BV2P 1M1YB 1DBSA 3BTUA 1JSLA 4MQEB 3U3DA 3OX2A 1X1BA 3Q5GA 2DXIA 3UMRA 4AYXA 1WZIA 4FQ7A 2Y0DA 4MPTA 3R7WB 4CF3A 4EDFA 3CBQA 4Y2QA 3EPJA 1JLRA 1KP2A 1QRAA 4R16A 1QLHA 1U7HA 1E2DA 2PS0A 3BE8A 3M4JA 4AKIA 4F92B 4WDQA 5IJZA 3A06A 3OBBA 1NVUQ 5G0WA 1YS4A 4LW8A 1I0LA 1NNSA 1NR1A 3D3KA 3F8TA 1T10A 3GPCA 5EG5A 3KZKA 3C43A 3SBXA 3D4BA 2PXCA 3NOXA 2ATIA 1BXGA 3E58A 2OO3A 2AUMA 3X1JA 1SZPA 4MNTA 4YONB 2FRDC 4P7GA 5FPHA 2CKMA 1EBFA 2Q3CA 5FADA 2HRDA 3SEZA 1EKXA 1GTL1 1KDTA 1KSFX 3D3EA 4LHYA 4WBNF 5KUTA 1C9NA 4J9VA 1Z8HA 4TVSA 1K5GA 5BT8A 3T34A 2MYNA 2OZPA 2XDYA 1VB5A 3OURA 1RLTA 1NUPA 2PE5A 2BEWB 2WOJA 1TD9A 3IBYA 2X0JA 1EDDA 2JB9A 1QK3A 2WKQA 3LO5A 5IPFA 1T1JA 3S99A 4EHJA 2YINC 2I7TA 4JBGA 4JCCA 4YV2A 3ZE1B 4RBNA 5L3QB 3RVOA 4MA5A 1QH1A 1T2CA 1NHWA 1NRJB 1PEKE 2YOFA 2VK1A 4QREA 4EPXA 3L0IB 2OC4A 2PSHA 3NDJA 5FX2A 4Z9XA 2B35A 3CLUD 3LY5A 4KGXA 4M8LA 4OHVA 2I7XA 1C8LA 4LJLA 3OY7A 1KR2A 4ZKEA 3QFSA 5A1TA 2O3TA 4IUBS 1A9XA 1IXSB 1X0VA 5AW0A 1TKAA 4TTRA 1K2VN 3UAOA 1O5IA 5IF3A 3IQZA 4EW3A 1HDOA 2OHVA 3BREA 3PFIA 3KZCA 4KWHA 1MJHA 4NCJA 4F0JA 2IX9A 2F17A 2JIMA 3N0VA 3QUTA 4GZ3A 2JAOA 4FQ5A 3SY8A 3R5TA 3ERCA 1E0JA 1QU3A 4WL0A 1JLLB 2CHEA 2WABA 2HH9A 1TZKA 2A9JA 2ESRA 2ODBA 3I32A 2K7FA 1Q1QA 3E0XA 3GLQA 3R0VA 4GE3A 4R98A 1J06A 5KAMA 1GCUA 5E1MA 3SSNA 3CNBA 1ZSNA 3BE4A 5C0OE 4BC0A 1WCYA 1ESNA 3AL3A 3K2EA 3B1ZA 3LPNA 4Y1FA 5KWJA 1I9CA 3LL4A 1FFBA 3W8FA 1OX4A 3CIFA 5CAEA 2IYPA 3CEAA 4LFCB 4C0SA 2IHVA 3TLAA 1IM8A 1Z5OA 2G28A 3AHHA 2IPOA 3HUTA 5FR2A 3VAAA 4C4YA 5JBQA 5KJ6A 3UT5B 4UZFA 4M89A 5FCDA 5FD8A 1N9GB 2J7PD 2ZBDA 1ZZEA 1RYFA 3V4LA 1PJ4A 3W5DA 4C0KA 5IJ9A 3N2LA 1RXYA 1SHJA 2VA8A 4BV8A 1IE3A 4GX1A 3QUBA 1WUIS 1Z2OX 2IP4A 1G17A 1PW5A 1KWKA 1CD5A 3GJ5A 2JHCA 1CUEA 2GCIA 3NFYA 1A69A 1ZBDA 4ZPJA 1S2LA 1TIBA 4O1HA 2VATA 4RLHA 2FSUA 4GLLA 5DM0A 2BUAA 1YVDA 2G4VA 1MX5A 1NA5A 2YKGA 3WXBA 3SIXA 4MGYR 3TEJA 3D6TB 5C5DA 1WZCA 1ZH0A 2Y1CA 4FX2A 4UD6A 2ZAMA 3DZGA 5EWJA 3TBHA 4BMVA 4BO2A 3U13A 5THXA 4OUDA 4EKDA 4F21A 4UFNA 1NF9A 4K6CA 1PEYA 2F8TA 3WMGA 4B5KA 3HRIA 3EXHC 1Z6GA 1UAGA 2QZJA 3LDAA 4GUDA 2G3YA 2I2BA 2QBYB 2ZZMA 2CCKA 3ESYA 1EX1A 2RB5A 4MWGA 4K9NA 4PLWA 5IJXA 4AKTA 4BKUA 4D02A 1LPOA 2ZBVA 3P2EA 4R2MA 5IKPA 3LT1A 5B58C 3DFZA 3KTDA 3NB0A 2DSTA 2JCGA 5MN4A 1DOAA 1N2IA 1CULC 1JIUA 3GWGA 3ETEA 1TF7A 3CA8A 3PX2A 3PVSA 2BMDA 2DLCX 4Z5XA 1WP9A 1USUA 1WEKA 4RW0A 1RZ3A 1KGSA 2QZPA 1P91A 4DPLA 1VL8A 1BDIA 4COOA 2HU5A 1K8ZB 3HO1A 5CU7A 2J87A 5DBHX 3TZEA 4ZT7A 1ZH2A 1S1MA 1OZFA 2XYRA 2PCJA 3OE1A 3OPVA 5AJWA 5EIOA 3E3AA 3MBOA 4C4ZA 3TPCA 2HSZA 3IT0A 1DIRA 4WY8A 4G1EB 2ZI5A 3IEPA 2HEIA 2F43B 1GTRA 1AV6A 3TCXB 5JBNA 3S1AB 3TJRA 3M6VA 4AKHA 5GVRA 3B1FA 3MD9A 3D2LA 3UMCA 4PFQA 4FOSA 2JIPA 4PC6A 4UDXX 1RD4A 2HK6A 1OFGA 2H4YA 3RARA 3TX2A 3OQPA 2CHVA 1GD1O 3CUUA 3V7UA 3IE1A 3F6BX 4YRGA 2P9ZA 3FCEA 5E38A 1IOLA 2M98A 5CBPB 4KHZA 4JMPA 3I6IA 4M36A 1ULTA 4PZZA 1QHEA 3CW9A 1WD7A 4RM3A 1RCFA 2OXTA 2G5GX 2P5TB 1QIHA 2R2AA 2OENG 3RHTA 3OF3A 2JEZA 4B83A 1Z0AA 5AI6A 4CKCA 5IEBA 5KJCA 3HUUA 3KSAC 5SY6A 2EDCA 2FVYA 2YOGA 1V4VA 2W0SA 4IDBA 2FPPB 3GEEA 3DFFA 1L4NA 1HE5A 5CLHA 2ZCJA 2C8KA 4EH1A 1JAXA 1K68A 4K1LA 1DQNA 4DXHA 2F1JA 2ZI9A 4DCJA 5J2UF 3NIDB 2GVZC 2Y1DA 2XXJA 3P9XA 4LMBA 3JARB 4DGQA 1E6WA 1JDVA 1HDXA 2RFLA 4EP1A 5I7VA 1Z9BA 2RHHA 3ETJA 3I01A 1ZSYA 4O33A 3LCJA 5T57A 5IBCA 4C03A 2LIVA 2Y0EA 3OFVA 4L8WB 4DLLA 2GPTA 1T1EA 4KTTE 1OI7A 5LQCA 1I3KA 2WMOB 2FJUA 2PSFA 2F1HA 3C7TA 2H1LA 5CPBA 3DMGA 3RU9A 4IJ5A 5H83A 3KQKA 5SICE 3DVAB 5HS6A 3V5NA 4F4UA 1TRKA 4V1CA 3F97A 5H59A 3RJMA 4B6EA 1UP7A 4ZV9A 4DDHA 3OU2A 2B25A 1E7WA 1J8YF 3R8CA 2C99A 2CLEB 3EVFA 4FWBA 4BO6A 4KR6A 5TPZA 2PT7A 2REQB 3N59A 3LCVB 2GBGA 2HT1A 4JYAB 3WWCA 4D3SA 2VQ6A 5JAZA 1BJRE 2RK3A 2ZRNA 3GNQA 3P9RA 3OX4A 5AKXA 3RIYA 3C87A 3GVHA 3OU6A 3FNFA 3L0ZA 1TL7C 3VI4B 4XARA 2F1OA 3I6MA 5B6IA 1JALA 3SQNA 4BO7A 4N3NA 1B8PA 1RM3A 2OV2A 3EE6A 5AIAA 4JGGA 1PR1A 2DB3A 2DKOA 2JFZA 1VBFA 3D1JA 3GRAA 3Q3CA 4OPMA 5B55A 4XDZA 2WKPA 5EKUA 4FN4A 5SY4A 3ORRA 2CUNA 5HA5A 5ER6A 2B8EA 2Q3FA 3F4KA 1KWGA 2IHJA 2NYAA 1O97D 2NXEA 4YJFA 4BNMA 4Y6QA 2OILA 5FOXA 4LYFA 4KRXA 2BZGA 3CURA 4O6VA 3UATA 3WNVA 1DIOB 1T0UA 5C8XA 2ONJA 4N12A 4DUGA 4HDRA 2VWHA 2ZUCA 3DT8A 1KDOA 3FUVA 3ANYB 4RD6A 2JJ8A 3K9NA 4YFVA 1XZHA 1KK1A 1Q16A 3QX3A 1P3DA 5LYJB 1T5TA 1T2FA 1YAHA 4ILKA 4ZANA 1TCVA 2XLCA 4HVTA 1IN4A 1Y8RB 3PKIA 4Q9IA 2LCQA 1P8AA 4A2QA 1EWKA 1OXMA 1RQ7A 3IRUA 4OQMA 1G59A 4KAJA 3I5XA 2VNIA 1T9CA 4EATA 3P9KA 2HDHA 2HXYA 3PR1A 4Y7CA 4RTMA 4G85A 2JGJA 3RODA 4CR7A 1M9NA 4J7XA 3L0OA 2CXHA 2PUGA 3MINA 3ITDA 3WTBA 3CNLA 3LY9A 1YASA 3N05A 1HA3A 1JAYA 4FW9A 4MVXA 1TQ2A 2HO5A 4O4IA 3W1EA 2GNAA 4MI1A 4E1AA 4H6VA 3RFXA 5K9ZA 2OY0A 1K7FB 3MIIA 5JC8A 1Y3FE 4EARA 1ZH6A 5G1NA 4EFDA 2Y93A 2P65A 4XJSA 4BFYA 1T1RA 3D64A 3EK2A 1C9DB 2A5DA 3GJYA 5ALGA 1RZUA 2QVBA 3DEAA 3IJPA 1L1RA 4YHHB 5KC9A 2BGLA 3AKEA 1SCUA 4HBZA 1ZNZA 1RFGE 4LPSA 1NYLA 1E5DA 1VKJA 2GI4A 1A9XB 1D0SA 4IR7A 4OGWA 2C5EA 3AWIA 2WTMA 1P8JA 1TK3A 1G18A 3L41A 5FP0A 1YU9A 3OP4A 4J6EA 4RJIA 4AECA 2J4FA 4KNYA 3KEFA 1C7EA 4HP8A 3TSYA 3EWSA 2XB8A 3TM5A 5AW2A 4H16A 4GOMD 5G4LA 4ZVVA 1IOZA 3UK1A 1SQGA 1V47A 3H4VA 1QDLB 3ILYA 5EUMA 1EXNA 2BHRA 2ZUDA 3ZR4B 1J21A 5AUPB 4OJTA 4C6TB 3GLGB 5DBFA 4LFAB 2PA3A 2VDVE 2Y3IA 3KZNA 2FPWA 3PTZA 1MT3A 4JJ6A 5HOEA 3SC3A 1W88A 4DA9A 5H68A 4EUHA 2HA4A 5LMNB 5KOIA 4EQ6B 1Z7YA 3PXUA 2Q2WA 4G4SO 3O21A 2PKWA 3U4IA 4RGBA 721PA 1UBKS 2VRCA 4QUIA 3I37X 3EGOA 3D6FA 5G40A 2F00A 5HKBA 1RRCA 3H16A 4QVIA 3DV0A 3DWGA 4QVGA 2AB0A 2RI6A 3GFPA 3GMIA 1WB6A 1XTKA 2GFQA 4HXEB 5AM0A 2IDZA 1VJTA 3EPKA 5FFNA 2QM0A 5EXPA 2FXVA 3SC4A 2JI9A 3DMTC 4ZO7A 3ZWBA 1SCNE 4B79A 3PEYA 3ZE0B 2ZULA 1E20A 1JQ3A 3OJLA 3IAAA 4RH3A 4LOKA 2WTNA 1UEIA 3GDFA 3IQHX 5C5IA 3MAAC 4LVUA 1ETHA 3DMDA 2FMIA 4RABA 3ZY6A 4LZZA 2OAP1 1P7PA 3ZKWA 3FSEA 3WHKA 4LDRA 3WLEA 1TK2A 5M04A 2LGJA 1PLLA 1WW2A 2ORWA 2VOEA 1E2QA 1ZW6A 1NVWQ 2JAQA 3CPJB 3PRHA 4NBUA 1R00A 1WSAA 2EWWA 2IWRA 3TQTA 4B71A 2AE1A 4NPAA 1WXFA 3UPTA 1Z63A 1QORA 2JA2A 4GPIB 4ZRDA 5JWHA 3Q8WA 1BQEA 4LYYA 4P3YA 1ZZGA 4GPBA 3ZWMA 4A8HA 4CKXA 3K4QA 3AVTA 1CF2O 1TTTA 1EFPA 3E2PA 1NMSA 4ZJZA 3OKFA 3OCYA 4M55A 3G2QA 5F35A 3VR3D 3ZHSA 3A1CA 1YQQA 3LVRE 4AZSA 3OOWA 4KIGA 2NXNA 3P7MA 5K0BA 3L4SO 1PZMA 4WW0A 2AXPA 3QE3A 4JXJA 5GM1A 2E18A 5FEUA 1R8JA 2IJGX 1GFIA 5EL0A 3UJPA 4ALKA 1J1ZA 3BJMA 3AJRA 2JLRA 2PKEA 4HQLA 4R5HA 2FUKA 4FNMA 4AUMA 2R11A 1O2DA 2GN8A 3V1TC 1SJ9A 2DETA 2IXEA 3ZE9A 1G5HA 2F3RA 1SELA 1G21A 1SVMA 5CIQA 3LQ4A 4ZT6A 1JJIA 3F6SA 4JLPA 3LAWA 2AN5A 2GZ2A 4ZZ3A 2EIHA 4EF4A 2E4UA 2YVLA 3RIMA 1T9AA 2VDKB 3LMKA 3SXUA 3HDQA 1KBOA 1W9HA 1WLYA 1L5FA 3JZAA 1CJMA 2PFKA 3OLWA 4JBYA 1PEDA 2CL7X 1HDGO 4X1KA 4XQ0A 5DULA 4DCPA 4FHEA 2P2DA 5JT1A 5K99A 1MC4A 3ODPA 3ZCXA 2O7RA 3FCYA 1PFUA 3MB5A 3OE7A 3UZUA 4JQCA 4G0PA 4C2UA 3N8NA 2SCUB 4NH0A 3NC0C 3H05A 4QLOA 5AVYA 3D4LA 4V0KA 3JTMA 2DJ5A 2RKWA 2ZWIA 3O0DA 1DQZA 2LPMA 1B6GA 3AUUA 3D2CA 4FOOA 4H6XA 5NULA 4YDQA 3CCCA 3U62A 1YB6A 4PPNA 2N47A 3SF8B 4N0DA 2JS7A 3BHIA 2IXDA 3DM5A 4HY3A 4F6LA 1U9IA 4W7IA 4ECAA 4RGVA 3PFBA 4U7JA 3TLXA 2UXCB 4NSNA 2GFIA 1QVWA 4NMHA 4R9VA 5BWOA 2FTKE 4KK3A 1XZIA 5EHIA 3W5VA 1ST3A 2D4HA 4BNVA 1JPJA 3LJKA 2ACWA 1KI3A 2JCSA 4AMVA 3LUKA 4DMFA 4RQTA 1Z38A 2JGFA 5GP1A 2XWPA 3R6TA 3AUYA 3EDYA 4MWTA 4C06A 5KMGA 3HVRA 1X8XA 3QUCA 1G63A 4QUHA 2X9GA 3LC7O 4YA6A 3HLTA 1EH5A 1J6UA 2GR9A 4L9RA 3GU3A 2BFFA 2FFQA 4CCYA 4KAAA 1G0OA 5AHXA 5KSPA 3RBZA 3JS5A 3DAHA 5LD2B 4CCWA 3LBAA 4FFWA 1PI3A 2FPGA 2QTNA 2UYCA 2HCBA 2MMGA 4IILA 1FNCA 1Q1AA 2TMKA 4GZ5A 5LJLA 4V1CB 3PDIA 3ZX5A 1CR6A 2D7JA 3PNYA 4P1ZA 1O1YA 4YGXB 1VG8A 3FAZA 3FGNA 2OUKA 4CV1A 1KDRA 3GMSA 1O0BA 2VTKA 1GZSA 1BXKA 3A7EA 4HWSA 2JGLA 1T0BA 1V8FA 4KBYA 3GX1A 4M0EA 4URFA 3EDQA 4GYKA 1L5NA 2WG1A 3NHAA 1ODTC 2ZJ1A 3QWIA 4FBLA 2J30A 2WT9A 1EQAA 4JQZA 1G8AA 1SXIA 4PVDA 2NW6A 2O6HA 1T91A 3C70A 2PAAA 4LHVA 4Q47A 3R8XA 3EVGA 1EUZA 3NAQA 2XMSA 2JFFA 3FGPA 1KJ9A 2GAIA 2ONCA 2QPLA 5D2CA 5TMEA 4EB6B 1A5ZA 3PD1A 1DEHA 4LJSA 2ENWA 2IP1A 1R6BX 2OYCA 1AQNA 4O4JF 4B3XA 4ZYWA 1W35A 1GQOA 2P91A 4QOJA 4MUXA 4ER7A 3EC2A 2Q41A 1S3IA 4HEQA 4N5MA 1EFDN 3KPUA 5C31A 3BA1A 3M7IA 5T4BA 3SF0A 4AJPA 2ODPA 3MJFA 1GN8A 1WNTA 1N2SA 1XTBA 4WY2A 5EMNA 5HDQA 4N47A 2WTXA 1HNZB 3O8DA 2WMNB 4TLMB 3QU5A 3TTUA 2FPLA 2DP4E 5HQTA 4CTMA 1NBAA 1DARA 2PT6A 2HK8A 3FPSA 3KT6A 4QATA 4Z6KA 3HSSA 3NVKI 2HIMA 3LKBA 3QNWA 2RHTA 2I6QA 4UD2A 1FNNA 2AX4A 5EKSA 2JBAA 2QAGA 4W99A 3TR0A 4H4CA 4TYWA 3F47A 3JQPA 2CMHA 2IYYA 1RXIA 2IZ1A 4GNKA 4ID9A 1A1VA 1YAJA 4XOUA 2PJRA 4J7CA 3LECA 1J99A 4HAIA 1XBTA 2JZNA 3NTXA 1E3QA 4G1BA 3HDJA 2VZ9A 5BMVF 4PSUA 1T36A 3HB4X 1Y9JA 2IYWA 3BKWA 4PINA 5E7IA 3A9RA 2YUTA 4PSVA 3WLNA 5IC6A 5BOSB 1F5NA 2QROA 1ISMA 3MINB 4R69A 2D06A 2YRWA 3HC7A 2D2FA 3S27A 3IVCA 2JBHA 4PZYA 4I9GA 3OZAA 1R0ZA 1UKEA 1V9SA 1XJCA 4FBMA 3PT5A 1Y8CA 3G2MA 1WUKS 2Y77A 1H2AS 3R0JA 2LD4A 1CFZA 2PNJA 4KXUA 5DWQA 3W8RA 3E7FA 1LPAB 2P11A 5AK3A 3A9VA 4LXHA 3UOGA 4W5QA 2VK2A 3W3AH 2WIDA 2I2AA 2OGTA 2DHCA 1JH9A 2E7ZA 2E6UX 4NU0A 4F7DA 3UWKA 5EGSA 1P4JA 3OIGA 1HTBA 4HQRA 4FEYA 4DEYA 2VG8A 2D0IA 3COWA 1PL7A 2HB6A 2VFAA 2IHZA 5AXCA 1B8OA 2J7PA 3HO8A 3OA0A 5K3CA 1Q0TA 2NO6A 4FMCB 1MW8X 2WW8A 4GT1A 4LV6A 4KPEC 5B36A 1IXKA 1JZTA 2VYQA 3IPRA 1XZAA 1OROA 3FHCB 3W9BA 1QF7A 1VCIA 2W4IA 3BGDA 1OXBB 3FYUA 2MHCA 4EGFA 4DQUA 4N48A 1XLVA 2VPZA 4YXFA 1PZHA 2IW3A 1ISJA 1RQPA 2GLXA 3EPRA 3RT1A 4ZDIA 4RSHA 4HLUC 4ZYZA 5JS6A 1XUOA 3WOHA 4N41A 4LYJA 1FFXA 2YWXA 3SI7A 2JANA 3P26A 5CA0F 1W88B 1PCXA 5H16A 1XSEA 3ND7A 2IEGA 3I62A 1N33B 2MSWA 1OAOC 3CNQS 3T6KA 4O29A 1JPUA 3KVRA 2V4MA 7MHTA 4QTZA 4IJQA 5IX8A 4B48A 1NP6A 1HSZA 2BBSA 2HQRA 3JQ7A 3QXSA 2D1SA 4ANFA 4E13A 4ZCMA 1PNOA 4RIGA 1ZD5A 1EEHA 5FQOA 3TSOA 4N0MA 4P38A 3A6GA 1N2XA 3MB8A 1SKBA 5DPMA 3V1YA 3WRVA 4IZ6A 2IEZA 1KO1A 1Y5NA 3G9UA 4OGKA 3R74A 1ES9A 1P73A 3KTFA 3O2SB 4L8FA 1VHTA 2P2ZA 2M2IA 4CV2A 4EGSA 3W6PA 2F3TA 2GPBA 1CY4A 3TE7A 4H0CA 4YAJA 5E6SA 5D86A 2WZBA 5EZ6B 5SZJA 4DADA 3WDSA 1VMKA 4HWTA 1B4DA 1FIUA 3IDFA 3IPXA 3KQUA 3K1AB 2ZB2A 4ZDJA 3CLVA 1YKSA 4NBTA 3H86A 1SD1A 4B81A 3JX9A 3WKDA 2O5EA 4ZOLB 1IB0A 1JBEA 1W4LA 2Q4BA 3BZUA 1SKAA 3FD8A 5CCXA 5ITSA 5IHPA 2HPAA 1CK4A 2QRUA 4I4TA 4JYMA 2YYZA 3P0HA 3ZXXA 3EVTA 5M5BA 3SVLA 2D5BA 5CG2A 3U44A 3UJ3X 4N1AA 2AHOA 3OZVA 3I09A 1RBYA 2Q1WA 4H6PA 3MVEA 3F49S 4PYIA 5EZSA 1JECA 1QR6A 2IE0A 4OATA 2I1QA 2DU8A 3K70B 3CONA 3T3DA 3GUVA 4TQUS 5I9MA 5B4TA 1FS6A 1SBZA 1OASA 2CXOA 4I9HA 1AZWA 1SC6A 4DSZA 1E89A 1G21B 1V6CA 4ZTBA 1U28A 3H11A 3T7RA 4TL6A 5BSFA 1WB9A 2J6IA 9MHTA 2DVMA 3BZBA 1ORRA 4ZOEA 3GJ8A 5CH5A 4HAXA 3SXUB 1AS0A 2GZDA 5JXGA 2NGRA 5DRTA 3AWDA 1SKUA 2Z56A 4X1KB 2Y27A 3B2QA 3UG6A 2WAMA 2Z2JA 1HDIA 3M6IA 4JIGA 3ZE2B 1B73A 1PWXA 1L3IA 3TWOA 3CRMA 4MITA 1U0HC 1NIJA 2HDWA 3TB6A 1CQXA 2DOKA 2OZVA 2X8BA 4ETWA 3CYFA 4Q0MA 3RVKA 1SXGA 3U4CA 1H2WA 2D54A 1FFWA 1SG0A 2AOXA 3UUGA 1PJ8A 3KSUA 4QT4A 2PZKA 3BCHA 4O8CA 4GSLA 2QJTA 1S3GA 4GWKA 3RTEA 2CSUA 4B6OA 3JPYA 1S8OA 5GMOA 1BE6A 4UEWA 5ALUA 4BTEA 4J1TA 3ENWA 1VDMA 4PZCA 3OPYI 5GWXA 4NVRA 1KF0A 2RGWA 3L82B 3KSRA 1TAGA 4RHXA 1IAVA 1RIIA 2ZUUA 4DMGA 5KMGB 4HGRA 2WE8A 1UBFA 2KQUA 1R8SA 4KPUA 4KWCA 3EOZA 4BC1A 3DPSA 1LK5A 2SKCA 3F4BA 2RGYA 1ESZA 3KJNA 3PDWA 1NRWA 1DXYA 3UB4A 2BFFB 4QLAA 4CCYB 1Z29A 3BMCA 3GLFB 5ES3A 1RKUA 1XTUA 1CUZA 1ZQ1A 4DXAA 1ZU5A 1RBQA 2FPGB 3GD5A 1AQUA 4CKBA 3UMGA 3IAM1 4C3OB 4NZYA 2FRVA 3WADA 1W85A 1KI7A 1YZ3A 1Z06A 4WXEA 3S6JA 2CBZA 3M5PA 1URPA 4Q5IA 1N5LA 3Q3VA 5DM1A 1ZRMA 1G19A 3GCGA 1I7DA 5DW0A 2I2DA 3A4MA 5FOQA 1UBEA 3DNFA 1M6YA 4WUTA 1EB8A 2ZEJA 1S9DA 4WJLA 3OCUA 1YDMA 4TKUA 4UNNA 4X7BA 5J1TB 1L7OA 3IP3A 3JWHA 3BWDD 4X1OA 4C7KA 4QUDA 3WQSB 5HK9A 3R7AA 1R4NB 4TYPA 1JDTA 2FSVA 2GBLA 4M0LA 1HI9A 2NSHA 4UCQA 1MOPA 5EFZA 5J5CA 3KQTA 4HLCA 3EB9A 3A4YA 1WD5A 1N6LA 3AR3A 5IBRA 2P0AA 1SHKA 3WLIA 3MK31 4B6JA 4DM4A 1M2HA 2OV8A 3HSKA 1JIIA 1D8TA 4Y30A 3RRXA 4MHTA 2IK8A 3PBKA 4OX9Y 2ZANA 4C7VA 4UDOA 5EFOA 2JD2A 1H6DA 1J20A 3C6XA 1NFRA 3I4CA 2OGSA 1VJGA 1LDEA 4MYSA 5CT5A 3N0XA 1ZLYA 2QORA 5DBEX 5EIHA 4NWIA 2FWRA 1DBPA 4QLBA 4MR9B 1SXPA 1MB2A 3BWVA 5I9NA 2ZTMA 1HM5A 2NZJA 3HBLA 3P2JA 1NV9A 5HKKD 1WDWB 3IIJA 2FN8A 3PGMA 3D43A 1P45A 4QXOA 1YVEI 3MQ4A 3QF4A 3PI6A 4F3CA 2JBAB 2F9FA 5T8KC 2NXWA 1AXEA 1TFUA 1MOSA 2ZS7A 4NYIQ 1M74A 2YS7A 2OP1A 4F4CA 2UXBB 1M2KA 2C5FA 1L5GB 3TTTA 1Y1LA 4NBRA 1AU9A 3K70C 1BOOA 4JJEA 1E3JA 4Q9KA 5KVQA 3AJAA 3FUXA 5TGTA 5A62A 5LP6A 4EHNA 3U6BA 4IVQA 4OK5A 4GMXA 2WJJA 2X3YA 1PR2A 4F2WA 5B7PA 1CJVC 5CYPA 3VR6D 2OGUA 3PFKA 1WNFA 5LMCA 4HFJA 2EKZA 3GEHA 4YGYA 5AVOA 3QOXA 5CYFA 5HILA 3DV2A 1H9BA 4PC3A 3KWFA 5DBIA 5BT9A 5DNEA 3TAXA 2ID4A 3ADCA 1VGRA 3DKVA 4MGKR 5JFGA 4M6WB 2B99A 4Y0AA 3PC7A 3CN7A 4M1KA 4F3KA 1QRSA 4FJ2A 3PFWO 1ARZA 3F46A 4M1ZA 2XTMA 4C3VA 4AKGA 2IHNA 3T9DA 3WWZA 4DA8A 5DHFA 3MJTA 3KR9A 1CZUA 1CUGA 1NJ6A 3EDRA 4BNUA 1GA1A 2HWXA 3SIWA 4ZD6A 1ZMOA 2VNAA 2G8NA 4J90A 1S6YA 1FYXA 3RTBA 1HMYA 1KHHA 4CIDA 1CFJA 1MHTA 3E3MA 5A6SA 1AA9A 3F5FA 5DSZA 3Q98A 4U8HA 5F3RA 4LZPA 3WTCA 1KRXA 4G8CA 1GZ7A 1T2VA 3HCBA 2CSXA 4KR7A 3C6ZA 3S68A 5GADl 1BRTA 1R8QA 1PFGA 4EUEA 3MRTA 3T15A 1CY7A 1GPAA 1MJNA 1FFXB 2Y6VA 2G4LA 1MIOB 2J9GA 3GEDA 4QTXA 5IVIA 1NT4A 3WNBA 1NMYA 1WB4A 2RKBA 3FR7A 2WFLA 3QU4A 2W4MA 4KK4A 3E1GA 1JMYA 1OLXA 3BHMA 1YDHA 3C45A 3QHQA 4GL4A 5LZ9A 1EP2B 1BMFA 2G1UA 1QGUA 5K6AC 1RAEA 4PZUA 2O7SA 5BNIA 2GN2A 2X7JA 1P5RA 1TEVA 1Y8AA 4GRAA 4NV0A 3VR3A 4UKDA 4IQ4A 4BP3A 2QN9A 2OFPA 2P9JA 3O47A 1TU0A 1T15A 1PK8A 4IVNA 5KHAA 1XCBA 2O3JA 3ETGA 3PC8C 2C2MA 2C1XA 1P1JA 3C3DA 1HZZC 5EMLA 4QQNA 3ZLUA 3HXQA 1BKSB 5GAJA 4NOKA 3OCZA 5LIRA 2EIXA 5M29A 2IRWA 1OILA 2ST1A 4K9RA 3ICVA 3OQ6A 5FPTA 3MS4A 3O8OB 5HGXA 3NTOA 2EJBA 3DMHA 3LI2A 3EFOA 4UREA 2FFBA 4AX4A 4QG3A 3DG9A 1OBVA 3Q0TA 4M88A 4BB0A 2ZXFA 3CJQA 3M4ZA 4O3FA 3TVTA 1DIGA 3W8EA 3ZEAA 3W6NA 2ADMA 2JFQA 2YV5A 1C1XA 3R3WA 4MV8A 4ZP1A 2FFAA 2CDBA 4XVUA 3BXHA 3ZNNA 2AQIA 4XWWA 5KTKA 3IQFA 3NYQA 3QOFA 3IT1A 2XDWA 2NO7A 1E2UA 1NC3A 1HOTA 4LXQA 4P58A 4HF7A 2OAEA 1ZUWA 5BQ3A 2ZXEA 2VHYA 4I4TB 4UNIA 4ISCA 5A5EA 2ZPTX 3V1NA 4RLFA 1O87A 1P2SA 3DEZA 2ORED 2G6TA 1YDEA 1YZFA 2GK7A 3IUQA 2BSXA 3BXOA 3L05A 3L43A 4OMFG 1WPGA 2PMEA 5IHXA 4N01A 4UNPA 1TJPB 1IUNA 2QIPA 4U8GA 4AZ3A 1T0PA 3DBHB 5DI3B 7YASA 3CN9A 1E6LA 2E3JA 1RACA 3CLUC 3PQ4A 1CP2A 1OA1A 1NBHA 2PPLA 4I1RA 2JJ2D 2YNMD 1SIBE 1YKGA 1U7DA 4IZIA 5CNMA 1TCCA 1U3FA 3H11B 4R1PA 2R8EA 1KQPA 2C2WA 4W1PA 5GPBA 3HXKA 4HNRA 5E8JA 2OB1A 3DCJA 1P74A 3C6MA 5ALIA 3WGKA 2QRKA 2ZU6A 5ISMA 2JK1A 3F9IA 3IIEA 1TIPA 1CDDA 1SD2A 2I4RA 1LDNA 1YBVA 2GCPA 3GLTA 1BVYF 4OK6A 4YCDA 3VVMA 3WIEA 1OGIA 4RQUA 4CMHA 2XUDA 2UZ3A 3DLBA 1S0UA 4F5YA 1Z83A 4QODA 4UHCA 2VHZA 4PFJA 1BROA 1ZXXA 1QHNA 4K8OA 5FPPA 3TZLA 1CJKC 1U8EA 5C4IA 1XEFA 4DN6A 2C58A 1MVLA 1R12A 4XWGA 4FWIB 3IO3A 4F3TA 4P8RA 1GGEA 4HWOA 5AM1A 3MZ0A 4JZYA 3WAGA 1GNVA 1SHZA 3DVQX 3FOCA 3KVYA 4X3CA 2QVYX 2B78A 2QL9A 3RI3A 1Q0UA 1X7XB 2BN4A 3GLSA 3GYGA 3NIFB 4IJUA 4WEQA 4JI6B 1XJ0A 3TLJA 1P77A 3IUYA 4AF8A 2C20A 1IZ8A 2O6LA 2IUSA 2Q4RA 5DBGA 4JQYA 3E8XA 3TIVA 4NZ9A 4EQZA 1GO2A 2AQ8A 4M0PA 3KAPA 3F90A 4Q66C 4DLZA 1ADYA 3OQBA 1K89A 3PQ2A 3IIKA 1RZVA 3WV5A 2CHFA 3BMCB 3OI7A 1P5FA 1HE8B 3EF0A 1HSOA 2JHAA 3G89A 3I73A 3H0CA 5SZKB 2BBOA 3KYCB 4JU9A 4JBNA 4R7GA 1BKYA 2IPMA 4BN4A 4DDWA 3I28A 1R37A 1MH9A 1XQ9A 4CKBB 1BCRA 1YT5A 3EZ9A 3F6CA 3L7DA 1ILEA 1EUCA 1H0KA 4UAUA 1MABA 4Q3CA 5JZMA 3T3OA 1VIDA 3B2EA 1E1MA 2FI1A 4OHOA 1W6UA 1M6EX 5CB4A 4L0CA 4YAEA 5ECGC 3RKSA 3D3NA 3TUJC 1RJFA 3VPFA 4BVBA 2AF4C 3FI9A 1TW3A 4NQZA 1LF0A 3GFSA 3RRZA 2FW0A 3RUPA 1E2NA 4C2AA 3FCCA 1WCV1 2O23A 4IRXA 3PDUA 2RHLA 2PZEA 1WOYA 2J4CA 3NIBA 5CXSA 4G1UC 1H23A 2V65A 5F52A 1M34E 5LBUA 1X7YA 2B4QA 2W6JD 5FBHA 2H1RA 2FEOA 3RDPA 4BCDA 3FNQA 4G5OA 3L0CA 3WNQA 5KNCH 3EWAA 1L5QA 4K9SA 1AZTA 4P3PA 3C24A 3G68A 5DNWA 3STUA 2DFPA 4A3SA 2ACVA 1K6XA 3UMFA 2X0KA 4BHTA 4C76A 4H0FA 1XZBA 3HTXA 4ZREA 2Y1OA 1M34A 3TQHA 4PTYA 3EAGA 2OCXA 2WIGA 3I3SR 4FIZA 4BLQA 5ABPA 1TIKA 2ZBEA 1HDRA 1NXQA 1X38A 2VT7A 3AEKA 3M89A 4GM4A 5D1NA 1NQVA 5EZYA 2J0UA 3HJUA 2QS9A 4FLFA 5DOZA 1X80B 3OPXA 2C57A 4AY5A 3AUXA 4S3MA 9LDBA 1JA1A 1RRPA 3B3FA 4FEEA 3CF6R 4NNPA 4IW3B 5LUBA 2W8BA 2PT9A 3DP9A 1F60A 1U4NA 1ZDMA 2HBYA 2ZJ2A 3BAFA 4PSAA 1ZK1A 5KQSA 2Y4NA 1ISHA 3PFCA 1DPFA 2L19A 5FEMA 2GN6A 4UU1A 5JYCA 3HJBA 4BZWA 2XNHA 2HU8A 3KV1A 1JA0A 4GO1A 3VZPA 1PJ2A 5CM2Z 2W58A 1RR6A 2GO1A 2EVWX 1FFYA 4XGQA 4B8ZA 1GQQA 2WBLC 2FN9A 2DTDA 2NU9A 2X8WA 1U1CA 4LYAA 1EM6A 4TXLA 2ZRQA 4A27A 4YIHA 4JOSA 3T7KA 4TWJA 2CC2A 3NASA 1EFKA 3ADKA 1N6KA 2Q29A 3BGWA 4ISBA 1N1MA 1F7UA 5HKOA 1U3GA 3A11A 3KZMA 1CQJA 3LT0A 4GVPA 1CUFA 3EJWA 3DH0A 1G98A 3OQMA 8ADHA 1UMDA 4INZA 2ZTLA 4MRNA 4MWOA 3P9IA 5E7JA 2C54A 2FPRA 1KO5A 3VNRA 2R1TB 3LX4A 1B74A 2W6PA 3LP6A 2Q3BA 4UHHA 2WILA 1V3UA 2G9QA 2V3VA 3AP2A 3H87A 4KFUA 3TSAA 1NQOA 1LV7A 2SNIE 2NADA 1MC1A 3L7IA 2FFHA 1YRAA 2M32A 2ZKLA 3I4FA 4GKAA 2HMAA 1T0IA 1Y6QA 1HLFA 2Y76A 4TS9A 4UAVA 1KDYA 2H2FA 2X6QA 2YN4A 2CE7A 1A77A 3LDUA 5E3HA 4R2JA 5K8VA 2XKKA 4YCMA 3PEVA 1NDHA 3Q2IA 4D8TA 2NO9A 2R8ZA 3GJ7A 3WLHA 4EI2A 5KVSA 4BTVA 2JZOA 3VNBA 1R0BA 3CZ9A 2UUBB 1K8YB 1QBGA 3GGPA 5FOVA 4N9QA 4L51A 5A4DA 1K86A 4FM9A 4RVNA 2Q50A 4JVOA 4ZU1X 1X7ZA 2YV3A 1MMFB 3TNFA 4GOXA 4TYYA 4EG5A 2H1SA 3FIJA 4BO3A 2WFLB 3AIKA 1ZICA 3AJ8A 3N86A 3R0QA 3RANA 3X1YA 1OLXB 1XWWA 2QSZA 1GAWA 4IV0A 4TMZA 1UH5A 5DX0A 2EQ5A 3RS2A 4ETMA 3IEMA 2PMDA 2EKPA 3KKPA 4R9UC 2IGTA 1A9QA 2QRMA 5JXJA 4X8OA 2HV8A 3PQDA 4MGZR 1O97C 4IYRA 2NVUA 4WNIA 3QJYA 3UKOA 5CDTA 2RH5A 1YBAA 1NLYA 3KELA 1J0CA 2LDBA 2WNSA 3OAAD 3RE1A 5F98A 1U0BB 5HIJA 3R6GA 3H1EA 4JZKA 4TUYA 4KQ1A 4D8VA 2FHSA 2WZQA 4LJAA 5D3ZA 3GPLA 4IKPA 4C14A 1O95A 4G5GA 1WHSA 4KMMA 2BHSA 3AGQA 5FRDA 1VE6A 1X1TA 2YVUA 3JQ9A 3IURA 1IJFA 3FZNA 3G0HA 2DUJA 3EFOB 4NEQA 1M2NA 5EYPA 3V48A 1LRLA 3QPAA 3ZX4A 4EY3A 1QRDA 2BBTA 5A4FS 3LG2A 1BSVA 1CYEA 4QELA 5JAMA 1C1XB 4Y2YA 3RBAA 5KO2A 1N7GA 1L4MA 3MWYW 2RHJA 3HKBB 3IJEB 4I19A 3TCNA 4M9SA 2VUHB 3WG9A 4E5KA 3I5MA 4ZOQI 3U1VA 1ATIA 3RKRA 1ZR2A 4TKZA 1V9CA 2HPHA 2PDAA 3MQFA 5F4ZA 2R5NA 1Z6AA 5EKTA 5JD5A 1C80A 1I6WA 2PKYX 3CO5A 1G64A 2CJXA 4L2IB 3VR5D 1CY2A 3T3NA 3VM6A 4UULA 1U8AA 5JVDA 1Y81A 2BDEA 3LXUX 2O2DA 3PCXA 4FYPA 2QLNA 2GRUA 2AFIE 2B0CA 1XAIA 3VUFA 2P4QA 3VKUA 1X8JA 2X58A 4XX0B 3O8RA 3D02A 4EUKA 4EENA 1LGYA 2QIOA 4WXMA 4A2WA 5C7LO 4F46A 5KKNB 2Q46A 2HO4A 4YP6A 2D2IA 2FMUA 1KRHA 2O0HA 3IBFA 4TMYA 5AUOB 3VSBA 1QYXA 2AFIA 3MT0A 3UAWA 2QYTA 5KZMB 3QTTA 3EGEA 3UFXA 1OYOA 4OOFA 3G13A 4FI3F 1QTIA 3Q9LA 2IPAB 2OV1A 3RYIA 3ZNPA 4JLUA 1ZIDA 4UVDA 4ZVPA 1EESA 1EZZA 2PUEA 5HFJA 3UMSA 1NWHA 2PVPA 2QV7A 4LWPA 2GN1A 3E9EA 2QENA 3UHAA 4UMFA 2CXXA 2PU7A 4BB6A 3UH0A 4BRUA 2HHAA 1I7SB 3PX7A 1C7JA 2JFBA 4LCEA 4F6CA 2JEYA 2HYIC 2IUTA 2XODA 4LXUA 4XGNA 3VJRA 4Q03A 5BXQC 2HKIA 3OIFA 2JFGA 5TS2A 4RH0A 4TLDA 4LXXA 5ILOA 1PFQA 2ZRKA 3NBAA 3JV7A 5BUCA 1I1HA 1KKUA 3ZJUA 2YY7A 4XAQA 4YNBA 1GZDA 1V2GA 4JSRA 4FE3A 4LJRA 1I32A 4UOEA 4ZIRA 1YA8A 2VJLA 4P98A 5ELXA 2BFBA 2P3LA 1V3TA 1BH6A 2HZ7A 2ORVA 4C0JA 1FVXA 4ZU6X 3QMVA 5B2ZA 4YRLA 1V5WA 2AL7A 2V8BA 3IE2A 1E32A 1YK0A 4O4HA 5DX1A 5ADHA 1NYRA 5TQ2A 2XNCA 4IDQA 4ESEA 3IO5A 2GHQA 4PX9A 2WIKA 4HAUA 2V9PA 4NEGA 1SR8A 1RMYA 2WZCA 5C3UA 3UNXA 4B6FA 4KLZA 5CMLA 2B9VA 2OB2A 1OF1A 3DVLA 4LJYA 4GEGA 4PANA 5JSKA 4Q1FA 2ZYRA 4DT1A 4YUXA 1MABB 2A59A 4DSTA 2UVQA 2P7HA 1FLVA 1VPLA 2ZQYA 3G0DA 3R3XA 3E2IA 3S8EA 4BNDA 5LKAA 2H0AA 2A0FA 2EW1A 3UC5A 5CB4B 4DCSA 4XIJA 5HKKA 5DXJA 3VAZA 5K3DA 1GGNA 4IM7A 4F8EA 4H2DA 1QUFA 1DQSA 3C1UA 4Q4LA 3C3WA 3TI7A 3SM3A 4YJ3A 2VCYA 5J47A 1L7PA 1OV6A 3BX1A 3PNQA 4GICA 3RABA 3WO1A 4P0PB 4EA9A 2G17A 5T4EA 4LXIA 4JUBA 4B3CA 2NUBA 4U9UA 4JLBA 1FXUA 3IUEA 2B94A 3E9NA 2EFHB 4KHPB 1HY3A 3NTUA 1UIRA 3G5UA 4CKEB 5EVCA 2BM1A 1UDWA 3AESA 4G25A 5FFMA 2PGNA 5HMMA 5BRNA 3LF1A 3RG2A 3RTCA 5FL3A 5KIAA 1YFJA 4WDRA 1TMGE 3F1KA 3W7BA 3FPFA 3LLSA 4RTOA 1PV4A 3ROPA 2A78A 5F4BA 5JASA 3GJRA 3K4HA 1F0PA 3RCBA 1PT6A 5IJ0A 4G2NA 3K4PA 4LXGA 3IB6A 3H2ZA 3HVJA 1QX3A 2CFTA 2Q5FA 1RYYA 3PE4A 1V6AA 4DDVA 3I1FA 5EZYB 1NT2A 1FFDA 1ZYUA 2J0UB 5J58A 2HWKA 1T8RA 3KJFA 3TTXA 4S2UA 5CHEA 3HSYA 1NPTO 3G2LA 1WXIA 1WXQA 2QUHA 2VIIA 4I81A 1TQ4A 2W8BB 4GI1A 3TN7A 4LKOA 1CUCA 4EY7A 1B41A 1T3GA 5ECWA 5CYGA 1SBHA 4DAOA 1N2CB 5A5DA 2GASA 3QHPA 3TW0A 2WVJA 1Y8QA 2IYXA 3KQSA 3V8BA 1CBUA 1QU2A 1E9FA 2EJUA 5CYOA 1UJ4A 3H9CA 5FL7D 5HCIA 4PSDA 4Y9TA 1L2TA 3C3AA 3KVOA 5HZKA 5LQMA 3I8SA 4YDSA 5THKA 1FP6A 2WJ6A 3KQQA 1KVQA 3ONVA 1O6GA 3T99A 4UUNA 2X6RA 3BFVA 4O4LF 2D1TA 2OG2A 1NAIA 5CTJA 4G0VA 3Q7PA 1CQJB 4JOQA 3LGSA 3VPSA 1QKKA 3GJQA 4NHEA 1J1UA 2CVPA 1LFAA 2VAVA 4HNSA 3TJMA 1P7YA 4M49A 4WCFC 1HKHA 4J76A 1CY8A 1CR2A 3A10A 3JQ8B 4YAUA 4J0HA 4YN3A 4RZXA 3OTIA 2WF5A 3CY6A 4LX0A 2PX6A 4L9WA 4KFCA 4ESVA 4LSGA 5FWYB 1ODJA 1L4YA 1YC5A 1LC0A 3M9LA 4XASA 1EBBA 3D6HA 1ONNA 3WMFA 1QO9A 1UK9A 3WXMA 1GNLA 1LPSA 1LZLA 2H8KA 3AO0B 3QXXA 1KR5A 3I4LA 4OI4A 3VR4H 4BIMA 1FB5A 4BKRA 1NFQA 1C0PA 2Q4DA 1JEQA 2OZKA 4S24A 3RF7A 2JF0A 3WZLA 3KR1A 1XA3A 4L6AA 3DLAA 1I4OA 4KVZA 5U4QA 4DKJA 2W93A 1RRMA 2Z30A 3R4VA 3D3WA 1H4VB 4P5EA 5EKDA 3E3LA 5F5XA 1XD9A 2RGNA 2CNKA 2G6BA 4XWYA 1X3SA 4DE5A 1MD9A 2QVZX 1WW8A 3EN0A 2MINA 4FDVA 4G5SA 1A71A 2G9NA 2F48A 2YWJA 6Q21A 1X7WB 4KMOA 4OJKA 3DBLB 1ZUHA 1M2OB 4MVJG 2IA5A 3V8QA 3KJQA 4JJFA 4B9EA 5GINE 1X42A 4QFCA 2NVUB 1EDOA 4TLCA 5DGCA 3CVVA 2HSJA 5FUXA 1GGHA 4TUYB 3GPDG 4GU5A 4IMIB 3HZZA 3R23A 1BEUB 1Y98A 1WB5A 3KPVA 4QQ8A 3K53A 1YULA 4EPTA 2CMDA 3BRWA 3UK0A 5MN6A 1SRRA 4DC1A 5AVSA 4A5SA 4L73A 5EYPB 4ENTA 2GEVA 3IRVA 4HLQB 2PBRA 3OESA 1UXIA 3D7NA 3L6OO 5KQLA 4MJLA 3DMYA 1GL9B 4X91A 5BQPA 2XRYA 3U3JA 1QFMA 3COSA 1P1FA 3BRQA 5K2MA 2C4TA 2VJMA 1CWUA 4YROA 5C4MA 1RJ9B 1OZHA 1S2MA 4YASA 1LBEA 1OKKA 2AX3A 4D2IA 2OCAA 4Q1VA 4FB4A 4RFVA 2DBVO 2G9RA 3DZCA 4ZJPA 2OMEA 5DNYB 2O5CA 1C3JA 1A8HA 2FMKA 3W4IA 1ZUIA 2EGGA 2DY1A 1PJAA 3P2MA 2QP3A 4E12A 3CO0S 1GTG1 3PX3A 1OTYA 3A36A 2HRQA 3HVKA 2RGXA 3DO6A 2C0PA 4TZKA 4V2IA 2KB0A 2VKQA 1V45E 3PEFA 3AHCA 4XCVA 5JVDB 5TQ0B 3A9UA 4AMGA 1C8VB 5J1SB 2V6GA 4GZMA 4I4IA 4E2FA 4Z4IA 2D1YA 3ZBUA 4H7JA 3IOCA 3Q88A 1VFPA 1Y9AA 4FZVA 5JYDA 1B76A 5A9RA 3E81A 2JLXA 2CJPA 1BE0A 2LBPA 4CEJA 2DUUA 2GK3A 2PT5A 2VLBA 3FMFA 2OTCA 3MJSA 1EHIA 1HGXA 3N7AA 3AV0B 3HJGA 1E2BA 2Q5OA 2B20A 4RPKA 5ICGA 3N2GA 1O0CA 3ZG6A 4OLBA 5IAGA 3HDYA 4DJFC 3ED5A 3QA3E 4BVLA 4DCUA 1E3SA 1NXVA 1VP9A 4YQFA 3REOA 1D9ZA 2E37A 4YLGA 4DRXA 3RYIB 4KMSA 5EVJA 4D80A 2XWQA 4PICA 2PD3A 5DP1A 2FOIA 4RVGA 1SCAA 1IMJA 1BDJA 5CK4A 2WWVD 2R7LA 3BGSA 5E4YA 1AHIA 5JJ5A 1EP1B 5JQGB 5BSHA 1PYOA 2FZGA 2GLUA 3IYLW 3WLPA 4XSHA 4OJYA 1UT5A 2IHBA 2XJ9A 3BC1A 3UV7A 2XUHA 5JXHA 1YXMA 1FFAA 3T9BA 3P2IA 4YJHB 3T1QA 1K9VF 2KMLA 1B2RA 3GH1A 2HM7A 1ZFNA 1R50A 1ZRSA 2C4HA 2PZBA 4YQZA 1TT5B 3IAUA 4GECA 4DLSA 5C46F 2SKEA 4K0KB 3ZWOA 4DQVA 4DMUB 5SZIA 2YXDA 4HDOB 1YTLA 2G67A 3IBTA 2R00C 3L8GA 1J49A 3SZMA 1RWVA 1NBWB 1RKVA 2EOAA 2PQ0A 2A1UB 1G6Q1 2BFBB 2YJ5A 2H4HA 3GIDA 3JQGA 4IDDA 4MQMA 1SHUX 4PLVA 5BW5A 3PV0A 3QVOA 4LY3A 4YRKA 5JZ9A 3GA7A 3VI3B 2B3TA 2W6JA 4O4HB 1PD0A 3ESCA 1HYHA 5TQ2B 4DHWA 5KVCA 3FJ1A 2Y1KA 3BRSA 3DA8A 2PMKA 2JJYA 3K05A 2ZJ4A 2PMBA 3GH3A 4DTIA 1Y6ZA 2DQYA 4MB0A 3CJRA 4DLVA 1ORTA 1SKQA 2RAUA 7REQA 4DMKA 4LVCA 5LBTA 1SKYE 1U4SA 2OP0A 3EIFA 1ZH4A 2Z1MA 3TSWA 3NPMA 1U8CB 4LOIA 4CRWB 1RP7A 4GSKA 4E2WA 3WGLA 5JJCA 5COAA 1JIQA 1R64A 1QG2A 1B8NA 1J2UA 1KJJA 1XLTA 4JLNA 4KOEC 2CXUA 4JROA 5HBGA 4PNHA 4PBRA 3TJZA 1XA4A 2HJSA 4YJ3B 1Z4MA 3OHPA 2Z8YA 2QL6A 1NX9A 4GXNA 4I14A 3SLGA 2WSYB 3QU9A 5EAIA 2C61A 5IBPA 821PA 4PN7A 3S2EA 1C4OA 3ZY3A 1NW4A 2CV0A 4C29A 2GYWA 1GPLA 1XJ5A 1YRQA 2V7TA 3EVEA 3JQ9C 4LBYA 4MP3A 4F2GA 4YRMA 2FZKA 1C9YA 4NONA 1ISPA 3U7RA 1Y3AA 1SXHA 4QNMA 4JENA 3ELYA 3GXOA 4IIUA 4YAKA 1T5DX 4U7HA 2ZYUX 1YZLA 4KYVA 3R7LA 3VSCA 4DIBA 5JOQA 1IXZA 1G2PA 1KTVA 3O8QB 3QENA 4K28A 1ADGA 1CIJA 3ELDA 4MW4A 4CMEA 2R87A 2Q3LA 2XKBA 1B7GO 4QULA 3OETA 3WNCA 4JLOA 4OHPA 5IJ0B 3VSEA 2GCEA 1BYIA 4G01B 1VIYA 2AN9A 3DTNA 3SYNA 1ZBQA 4D46A 4G4SP 2ZWPA 3BBPA 1YR8A 1KYVA 4MYDA 3SDSA 2DHRA 1Q21A 4M1YA 5HE8A 4Q7QA 2NV2B 4DDMA 2IITA 5FXMA 1E1LA 3FOZA 1T2UA 1X70A 2BGKA 4ES6A 1F38A 5K09A 1WY7A 1M1XB 1DAGA 3I53A 1YKFA 3IHWA 1Y8QB 1GDTA 5AM5A 5CA0A 2OCGA 2VSNA 2ZIFA 4NBVA 5I4IA 2HRRA 2CT8A 3WP0A 4UZSA 4JI3B 3O31A 4R71A 4AZWA 1H05A 1RM5A 2WTBA 1FQWA 3JQFC 2GT1A 3EVCA 1QB8A 5IXSA 3B60A 1U81A 5JG7A 2WJVA 1Y5MA 2QGNA 2RC5A 3WLSA 1G6OA 2H2IA 2YJ6A 4POAA 1NN5A 5E2AA 1PQYA 1JE1A 4QOFA 4DYVA 5BR4A 3W3AA 3H6KA 2O7VA 1T3LA 2A5GA 1I36A 2W6IA 1SOUA 3HNRA 3MT9A 3ZGXA 4CMIB 3REFA 3TQQA 3QW2A 3ZGVA 4N3BA 3L0DA 1DC8A 4CLRB 3OA2A 2HQ1A 2NP6A 1MQ8B 3PWTA 2V98A 5DTQA 3ZC3A 1R8XA 3VR2D 1FP4A 1KBZA 5BSRA 4G1VA 2XWJI 4JX8A 4KMRA 4YWJA 4F9FA 4AULA 4PLHA 1Z08A 1FZTA 1ZGCA 1TU3A 3X2EA 3OAAA 1JHOA 4Z4HA 4OP2A 1Q12A 1OU4A 5B7NA 3OWXA 4EUNA 1FP7A 5JCJD 1ATZA 2GLTA 4OL0A 5DU2A 2N0SA 5EIAA 4C6SA 5CDFE 1L8OA 3CZ4A 1KIMA 1ZCZA 2CN1A 2HF9A 1PFVA 2IVFA 3LY8A 4X44A 4XQ9A 2PO5A 3V00A 2ZATA 3VC1A 4XWOA 2JCBA 3IVXA 4FXPA 2KHZA 5EP4A 3D3WB 2I4MA 4Z54A 4PHFA 3V2HA 4MEBA 5JNRA 3QLUA 2GXUA 1HL7A 2H2AA 4QGSA 2V7EA 4X71A 3WIOA 4G26A 4UJ5A 4DLNA 4DQ0A 5AW4A 5CDFA 3C7DB 3QP9A 3C15C 2ZJAA 3NANA 3OOSA 1P61B 1CUVA 1GG2A 2IFTA 2P35A 3K1YA 4GLOA 4IICA 3L7CA 4XIFA 5EHZA 4KXMA 5BXYA 4BP8A 2VP2A 1X9HA 3IDSA 4AURA 3G9XA 3Q0EA 1VA5A 1SAYA 4KI7A 1J4AA 1Q91A 2E55A 1JGTA 1XL0A 2OXRA 4JHXA 2W43A 3USZA 3SJUA 3BK7A 2SHKA 3ND5A 1CEEA 1X94A 4OCZA 2DFTA 3CZRA 3TD9A 3BDVA 1ZM3A 1Y1KE 4B9AA 5C8ZA 4O5OA 2KPOA 2Y2VA 2LNDA 3B5IA 5EP1A 1B6SA 1KEVA 3CCBA 4RO0A 1BWPA 3MHTA 1QAQA 4H7KA 2XCRB 5JZBA 2C3YA 3SS8A 2A9OA 4CN8A 4NCNA 1L9KA </