1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
2IPLA 1D1PA 1DBWA 3CLKA 4MR7A 5JNSA 1RXIA 2AYXA 3KYIB 3IPCA 4YCSA 2LP4Y 2QU7A 3MMNA 4MQEB 4RY0A 5JS1A 3QK7A 1U2QA 3SY8A 3RVPA 1KRWA 1SXIA 3CG4A 3QEKA 4HNQA 4RZSA 4ZPJA 2JRLA 3CFYA 3H1FA 4RDCA 1JFTA 3DLBA 3H1EA 4MAAA 1T34A 1RZRA 3JPWA 1Z2EA 9ABPA 1QP7A 2IPMA 3NBMA 1FSPA 1GCAA 1J56A 5TPZA 1I3CA 3E3MA 3ILHA 2Q5CA 5CNMA 3CS3A 5KC8A 1P6QA 5EWMA 4JP1A 3CHYA 1L5YA 2JVKA 3TO5A 4FB4A 3QX9A 3HJFA 3LUAA 3DGFC 1M5UA 2RJNA 4XAQA 2FMFA 1JBEA 1NXVA 1DCFA 1NXPA 1YS7A 1NTRA 3C3MA 4KQ9A 3ILYA 4YP9A 3RVRA 3SAJA 6ABPA 4LDZA 1A04A 4MR9B 1JFVA 3GBVA 2WJAA 2N9UA 3M9XA 4YRZA 3OQNA 1P8AA 4S05A 2QZJA 5FWYB 4D6XA 2QVGA 1Z2DA 3N0WA 4TLLB 3DBIA 1NXOA 5TQJA 3TD9A 3F73A 2FLKA 2E4WA 1NXWA 3EODA 4M88A 4LZLA 5BRAA 4G0ZA 1EFAA 4Z99A 2FMIA 4ETNA 2ID9A 1K66A 1JF8A 3T6KA 4RWEA 4HYEA 3B2NA 3GV0A 4H3HB 4KZKA 5KQLA 1PEAA 1W9HA 2A9QA 1D1QA 1Z26A 3KSMA 3N6VA 3KHTA 4Q6WA 1LJLA 5ABPA 4IMJB 5KQPA 1Z16A 4KK3A 1ABFA 3K9CA 1TJYA 5IUKC 3DLHA 1BVHA 4LE0A 4YR7A 3KS9A 2PE5A 3KTOA 1ABEA 3IP7A 5GQSA 4KMRA 1MAVA 3NHMA 4G0XA 1PUXA 5FWXA 4ZYLA 3O1JC 1JYEA 2JK1A 1MVOA 3BREA 3D8UA 1YK1A 2RDMA 5HKOA 1ISSA 4OATA 3NHZA 4JAVC 3LOPA 2A9RA 3EULA 5PNTA 1F51E 2MSWA 4H60A 4RK4A 4F12A 3OQOA 2ZAYA 2FEWB 4H3KB 5JNWA 3GA5A 1QMPA 2QV0A 2IDMA 4XFKA 3K4HA 2PUFA 1DC7A 4Q6BA 5TPWA 2HJ9A 4WXMA 3QELB 1XHFA 3R0JA 4MRMB 3Q7TA 4RXUA 1GLGA 2ID7A 4RS3A 4EYQA 1QP4A 4JB0A 4G0MA 5DGCA 1QKKA 3EQZA 4JASB 4LRQA 1RPJA 3IP5A 3GYBA 1JDNA 3CZCA 2R48A 3DGEC 5EWLA 2E4VA 1BAPA 3EGCA 3OLZA 1GUBA 3MM4A 1NATA 5TE9A 2L17A 1MB0A 4Z4EA 1S8NA 1FFWA 2VUIB 2GKGA 1D2AA 3QLVA 4OG2A 5HM6A 2IPNA 2E4XA 4MR7B 4N0PA 1U2PA 3C6QA 2PUGA 7ABPA 3FGZA 3RVSA 1APBA 2FQWA 3IP6A 4RV5A 4ML3A 1KRXA 1VRVA 1SXGA 4TN5A 1D4ZA 1FFSA 2FMKA 2MSKA 5T3YA 1U8TA 2PLNA 3O1IC 3KKEA 4UHKA 1DRKA 3FFXA 2FMHA 3JS5A 1TM2A 2CD7A 4XLTA 1SRRA 1VLZA 4G0QA 4MS4A 4YO7A 2H3HA 2PUDA 5DCLA 1PNRA 1JYFA 1ZGGA 4CBVA 1DBQA 4F06A 3L6UA 1CHNA 2P9HA 3I5AA 4NICA 3IP9A 3H6HA 3Q7RA 2FN9A 4PICA 3HO1A 4MYRA 1CYEA 2R47A 2YHBA 3CZ5A 1C0EA 3OM1A 1OXBB 5EWMB 1JDPA 1ZITA 1JH9A 1LK0A 1DC8A 1TMYA 1W25A 2NZVG 4EVSA 1BDIA 2H0AA 1RXEA 3N0RA 2FSPA 3RVOA 4DQDA 1KMIY 3DZDA 5JNUA 2PUEA 1JLKA 3MYYA 5B3JA 3HUTA 3LUCA 4NCBA 3M9WA 3EJWA 1PEYA 3LKBA 2PL9A 2FN8A 4LE1A 1PHRA 1VKRA 2JBAA 1EWTA 3MQ4A 4FE7A 1YS6A 4G86A 4O1HA 1NXTA 1ZDMA 3O75A 5ED4A 2FXIA 1QQAA 1M5TA 3OM0A 3QEMA 4MGEA 3P9YA 1ISRA 1E6MA 2F8SA 1YMVA 5IBQA 2RJOA 4RU1A 3O2SB 3A3KA 3OMXA 3H5TA 4LX8A 2JCGA 3BRQA 4MS3A 1B00A 2R4QA 4W5OA 4LDAA 4MPTA 3OO0A 3HDGA 4W5QA 2JVJA 1U0SY 2QW1A 1ZH2A 5KQMA 2WWVD 2VYCA 3LTEA 1ZH4A 2FEKA 3HM9A 2FW0A 3FFWA 3KG2A 2RGYA 3Q9SA 3TB6A 4RK1A 2FQXA 1M2EA 3OLYA 1QQBA 4IRXA 5CNJA 2E4ZA 3QLUC 1BDJA 3C3KA 1EWKA 3O2QB 1CEYA 3OLVA 5KQGA 4NQRA 1TVMA 2JB9A 3I09A 5BQ3A 4L85A 1NXXA 2CWDA 3C97A 5EWJA 2MYUA 3H6GA 4PZ0A 4P1ZA 2WJWA 2WMYA 4N03A 4QPJC 1XWWA 4Y9TA 4EY3A 3NNNA 5FWXB 4F8JA 3I42A 3OLXA 3RVQA 1Z25A 1E6KA 4RY8A 3UKJA 2CHFA 4KREA 5TQ2A 1K68A 3LKVA 2FLWA 1URPA 1DCMA 2VK2A 4E7OA 2BGGA 2OQRA 5E3JA 2M98A 3HZHA 5TPWB 2LUOA 4D74A 2B4AA 1UDRA 3MA0A 3SNKA 4MQFA 1ZESA 3HVRA 3RVLA 3C3WA 3E61A 2L2QA 2GBPA 3GWGA 4N0QA 2NT4A 3QLTA 4JA2A 4RXMA 3UK0A 3UUGA 5FBHA 3GT7A 3TX6A 2PAFA 5EWLB 1IIBA 1AB6A 3GL9A 4UHJA 4WT7A 1P2FA 3O2JA 5IEBA 3ROFA 5IEJA 1SD5A 1KGSA 3CRNA 5IX8A 4JB2A 4LE2A 3CU5A 2FEPA 3H5OA 2MYNA 5IULC 1NXSA 1VPWA 4RKRA 4KFCA 2QSJA 3HS3A 4ZJPA 1P6UA 4EYOA 3KYJB 1GCGA 2GI4A 3G1WA 1DBPA 3OMWA 3Q15C 4EVRA 1NY5A 1USIA 3LUDA 2A9PA 2XDYA 3F6PA 4PYRA 4NCAA 2W42A 4MS4B 4F3TA 3OO1A 2HSGA 5HSGA 3Q41A 4EYKA 1Z15A 1YMUA 4Z0NA 2QVCA 3H5WA 5CNKA 1YIOA 2A9OA 1QPZA 2V0NA 3ROTA 4RK0A 2HPHA 2PL1A 2O20A 4Z4IA 1XHEA 1D5WA 2MYPA 1L5ZA 3I45A 3LUJA 3LUGA 3VNBA 4OBBA 1AB5A 3IDOA 3SG0A 4B09A 4XASA 4G0OA 3HXMA 3G85A 3KLOA 4KVFA 4MS1A 4YS6A 4Z4CA 3W9SA 1DG9A 2LBPA 4YLEA 3LMKA 1JFSA 3CG0A 2ZWMA 1QO0D 2JBAB 4Z4HA 8ABPA 3EQ2A 4JOQA 4G0PA 2E4YA 3A0RB 3NNSA 3QEMB 2NUBA 3RVNA 4QYWA 1QNLA 2HQBA 2L19A 3HV2A 3H5LA 2X7XA 2M1ZA 4MR8A 2QR3A 4WWHA 3QLVC 4MS3B 4OLBA 2WB4A 3HUUA 1ZN2A 4YGXB 1DRJA 1RNLA 5CNIA 1MB3A 5TQ0A 1ZVVA 2FKAA 3RH0A 3EDCA 1LJUA 3VNAA 5F64A 4WZZA 3H75A 4G97A 2HQOA 4ZMSA 4Z9BA 3H5IA 4OTZA 3F7NA 4OLAA 3QLUA 2PUCA 3O21A 4N47A 3N0XA 1YVUA 4HNRA 4KQCA 5GOTA 4NV3A 3GBPA 2B1JA 2MSLA 1EAYA 1LBIA 2FVYA 5HQJA 2R25B 1OXKB 3BBLA 3CKMA 4MQEA 1JHZA 3JY6A 3URMA 1JWLA 1E2BA 2WRZA 5EWJB 1C4WA 3S99A 3L49A 2GX6A 1DCKA 3KLNA 1EHCA 3HCWA 4E7PA 1ZY2A 3N53A 3OLWA 3HDVA 1RZRD 4XARA 5JNTA 4HNSA 3RVKA 1SXHA 2JVIA 2QXYA 4MLDA 5C5EA 5TPZD 1Z13A 4Z4FA 1USKA 3IPAA 5BR1A 2PUAA 4KPYA 5TQ2B 3T38A 1QP0A 3QX8A 5B3JC 2KYRA 5I4CA 5T7BA 2HQRA 3KCNA 4IILA 2CHEA 3EAFA 1F4VA 3H1GA 2GWRA 5JNVA 2YHAA 4MQFB 4EYGA 3JVDA 1JX6A 3NNDA 2L18A 6CHYA 4RY9A 4W5TA 2IPAB 4GNRA 1ZGZA 4MR9A 5DTEA 3O1HB 5DLEA 4ETIA 3LUHA 2AYZA 5FWYA 1YTUA 4PE5B 1A0OA 1DZ3A 4EGSA 4F11A 1U04A 1MIHA 1EWVA 4ZMRA 1A2OA 4TMYA 4QYMA 4EVQA 4N41A 2PUBA 3TMYA 4DADA 1E6LA 1USGA 1Z12A 2LIVA 3JTEA 2MYTA 1FQWA 3N75A 1Z18A 3T8YA 3HK2A 3M6MD 1BDHA 2F8TA 3JVIA 3A0UA 2IYNA 4PEVA 4Q7EA 4QICA 3F6CA 3BRSA 4IF4A 3CNBA 4GPAA 3LUFA 3CTPA 4WUTA 4YWHA 1ZAYA 1ZHHA 1WETA 1PNTA 2NZUG 1HEYA 5IC5A 3OQMA 3HSYA 4W5NA 4O5AA 5FBKA 4ETMA 5KWSA 1TLFA 1GUDA 3SM9A 3KJXA 5JS2A 4KRFA 3RVMA 4Z4GA 3Q7SA 1Z17A 1BA2A 1R8JA 3GRCA 3LUKA 4RK6A 4IMIB 4Z9AA 5DKFA 2PMCA 4YV7A 3HEBA 2LPMA 1JL3A 3A10A 3FMVA 2P4UA 1YK0A 4RK5A 4TLMB 1M2FA 4RK7A 5C5CA 4O1IA 3JPYA 5CHYA 5KC9A 4KK4A 4MS1B 4W5RA 2PJUA 4MLCA 3RVJA 2IKSA 5JNRA 4L4UA 1H9CA 4RKQA 2E4UA 2PKXA 2TMYA 3FFTA 3FDFA 4D6YA 3QELA 1QO0A 5BRJA 3LFTA 3D02A 2NT3A 4KV7A 1DJMA 2DRIA 4MRMA 4XXHA 2FTKE 5IUNC 4RXTA 4FE4A 4MR8B 2WY2D 4S04A 2J48A 4P98A 3T95A 3SQNA 1DP4A 1LBHA 4KNYA 5D2CA 3O74A 3N8IA 4RSMA 4IGAA 5TQ0B 4G0YA 2VUHB 3H5VA 3MIZA 5KI6A 2IOYA 4DN6A 4N76A 3MF4A 3RQIA 1Y1LA 2OENG 3BILA 1FFGA 2FQYA 4EUKA 4WXEA 5IUJC 2I6FA
chains in the Genus database with same CATH superfamily
2DJIA 2W4QA 3A6LA 1DOZA 4TYMA 3GA7A 1E59A 2X0IA 1E5LA 1DARA 2QG9A 3IPCA 4W7HA 3VH4A 4YONB 4NYJQ 1K92A 2BJHA 5DK4A 2CLHB 3E4CA 2WJ3A 2W4MA 3QPUA 2NUTB 4PLFA 5DTIA 2BGTA 3WB9A 4OH7A 1SXIA 3SZUA 1PR2A 2ZYGA 3WLLA 3A4IA 1E79A 3OAAD 1CS4C 4RJIA 4X6YA 3O7MA 2VJYA 1QDEA 2P2DA 3FB1A 4LY9A 4QOJA 1UBGA 1WIWA 4PG6A 4AJPA 3DZGA 4DLTA 1LZKA 3ANMA 2TS1A 4EELA 3GDFA 3G0BA 3HBLA 3BD6A 3P52A 4PTZA 1GSIA 1GCAA 4U3JB 1ONBA 5CEJA 5JJBA 1NOIA 2GOYA 3NVMB 3DZBA 4ZV7A 4DLSA 1O95A 1OU4A 3OE5A 5CXXA 4F4HA 4TVSA 4LC0A 4O2RA 1JQEA 1K9SA 3LP6A 1DINA 4F6RB 3I53A 2GR9A 1G6KA 1UQTA 2BTOA 2I33A 2ZYIA 3HCRA 4K6KA 4LFAB 2ZYHA 2B4RO 2UVPA 1LSSA 2X7HA 3GY0A 1V7QA 1DCFA 2G9NA 2VHQA 3QU7A 2BJVA 4MPJA 1ZCBA 1SOWA 2OAEA 1JFVA 1PJLA 3BIFA 3NKLA 4MR9B 5A9SA 3ZGZA 1SAYA 2Q4BA 2X40A 3DYIA 2PMKA 1C3OA 3FH0A 2C61A 4AJIA 4FFMA 5A5FA 1FVOA 4A0FA 2RGRA 1SCUB 1J8QA 4HB0A 2HNAA 4KAXA 1FP6A 4B44A 1ESNA 1YIDA 2G0TA 4LBYA 4KVAA 3KV1A 5DHUA 1V3VA 4HVTA 4DUYB 3F3MA 2A0YA 3NDRA 4ETNA 5KOIA 1MHTA 3F47A 1O6ZA 4R8SA 1JI0A 3HA7A 1UZNA 3AEUB 3VPXA 2JGAA 1NMXA 2BKEA 3HO8A 1DBVO 3U3JA 4REQB 4PHCA 1U7HA 4IFBA 4LPKA 5CURA 5FBQB 1KJWA 1V4BA 3M33A 1Z26A 1DKUA 1CK4A 3IQWA 5JNLA 1WO8A 1Z16A 3CVJA 4DNOA 4CM7A 4P82A 4DDTA 1SO8A 1BFKA 4TMKA 3RT9A 3H13A 3DEKA 1HT2E 1SWVA 2FW7A 2QMZA 3JASB 1MQAA 1UMBB 1SD1A 3L7IA 4L28A 2W00A 2UVQA 2IA5A 2Q0QA 4TTVA 5FPTA 1QRUA 1KOGA 1Y5MA 4OFXA 3U0BA 2C5GA 2F64A 4K9SA 4R01A 3WRYA 2ZIAA 1WP9A 3B2QA 4FUQA 4UTOA 1AZLA 4UEJA 4OBWA 5DNYB 1E3WA 4TSFA 4KVZA 2V7GA 2B8EA 4HF7A 3S29A 3CRVA 2I8CA 1ISSA 1TMKA 2I99A 2VP9A 4KWIA 2C3UA 4N8EA 3QXGA 1WXIA 3PYMA 1I9GA 3DW3X 3WWPA 1M5RA 3FVTA 3GJ4A 3WLNA 4PO3X 5AM2A 2JKVA 3C3YA 2BEWA 3DT8A 1ESDA 2JGIA 2KWIA 1EVEA 2IW3A 1INLA 2G3YA 3FB4A 4ZZ3A 2JIOA 5FNVB 3ZZNA 5FHRA 3I9FA 2W70A 4BNUA 1LRKA 2GCNA 4FNOA 1IZ8A 5EEGA 4RMIA 1JIJA 2BCEA 1P4AA 1YBHA 2YL2A 5KYUA 1WZUA 3GGSA 1FFYA 4CMIA 3OQJA 1VYVA 1RPJA 4KQXA 5AJHA 2EJCA 3LK6A 4ZYVA 2ZP1A 5K0LA 3OF2A 2B94A 1ZQ9A 2ZB7A 3SJAA 1Z75A 1M2JA 2E1RA 2OY0A 4TTPA 4RESA 1RC1A 3T7DA 2VNKA 3IR7A 5KJFA 2D5IA 4IW3B 2Q7DA 2WFLB 1SKYE 5KPJA 3UFXA 4Z5XA 2VUSA 1GFWA 2V8OA 2VQSA 3QLEA 5FP0A 3G2MA 5H16A 3RS5A 2BEUB 1YQTA 2OZLA 5J43A 4ENVA 4Z7QB 2JBHA 5HHTA 3ID6C 5ICGA 2CUNA 1AN0A 1DXYA 5TMDA 3N0TA 2CXUA 4B7XA 3W6UA 1SEPA 3RS8A 1YZNA 3V8PA 2G7MC 3LA6A 2DGDA 4MVWA 3FYHA 3R40A 2B4YA 1DG3A 1TM2A 1K98A 2O54A 2Z8YA 4ND8B 1K89A 3V7FA 2UVDA 1YAJA 2Q2OA 4TWJA 5K1ZA 4JBXA 1HLGA 4WE3A 3RIYA 1RE1A 4YJHA 5K8VA 2BTEA 3A9RA 1TTTA 4GM4A 4OO3A 5FBZA 4ZICA 2J9YB 3R6WA 4GXTA 2O2SA 4RVSA 5LBIA 1IVNA 3I0ZA 1SCAA 4OQFA 4DCTA 3D7KA 2O5CA 1XQXA 5HF6A 3H8SA 3RU3A 4J94A 4TLAA 3E5RA 4EHBA 1T4GA 3MOSA 5DE3A 3FBGA 2PL9A 1LD3A 3H11B 1Z4KA 3O4VA 3HL0A 1BOOA 4EUNA 3HMQA 5D3MB 1UPXA 4EPXA 4KQKA 4INPA 4ENUA 3MUFA 3L0BA 4NYJR 2GD0A 5EXEA 4J43A 2NPIA 5IBQA 1EG2A 1ZD9A 4Q3CA 2AR9A 4E2FA 4ENSA 1OPRA 1JU4A 4OK6A 3VZPA 2PS9A 1NJFA 3BRQA 2P5TB 1FC0A 3DVSX 1GCIA 2EFCB 4GO1A 4RD1A 1YFLA 2EP7A 4YPFA 3TNDA 5CVTA 1TK2A 2F6RA 1OWOA 2FW0A 3FFWA 4MGKR 1QHSA 2CL5A 3SICE 1KI2A 1MPXA 1XD2A 3AEKB 2XRYA 5EKUA 4Q39A 3UA4A 2YXEA 3GQBA 4YTEA 3L7AA 3P2EA 5E7MA 3OIWA 1LS6A 2VO1A 2CYCA 1KOLA 1RXCA 4QYSA 3N86A 2C9ZA 3DBVO 4FSDA 1JJVA 2C7RA 2UUBB 1XJ5A 4C07A 1ICIA 1NXXA 5BVHB 5I9TA 4L9AA 2I65A 1G2PA 2R8XA 2X9LA 1IVYA 2R44A 2WMYA 5DHFA 2HYIC 4M9ZA 3PNSA 4P53A 3ED1A 3WTCA 5BXQC 2HZBA 1R6DA 4BUCA 5JFGA 4JLJA 3RSZA 4XPZA 3DVAA 3ZWNA 2YXPX 1XCLA 3S81A 4KACA 2DH6A 2GF0A 2OG2A 1ZU4A 4R9RA 3KOMA 1XCJA 1JNYA 2BF7A 3N2GB 3OIVA 1F9AA 2H1LA 4ILKA 4YUYA 4P5PA 3ZCRA 3IPYA 5DNUA 3C3EA 3ZR4B 4Q01A 1O4VA 4IIJB 1Z4PX 1HT3A 2I7TA 3OZGA 4N7BA 1KDOA 1SBIA 2I80A 4H4DA 3TRIA 3R3HA 2ATXA 4CTJA 4AXXA 4HQOA 3RVLA 5E7JA 1Y7HA 4QQ8A 2QQGA 2YZGA 1TXGA 2ZIWB 1CPYA 1RWMA 3GWGA 1E1LA 1H2FA 2XF2A 3P8ZA 3EIEA 4PBSA 3ZVNA 3BSWA 1LH0A 4FSXA 4ECEA 2VT7A 3C4JA 3HJCA 5TEVA 2PLWA 3OZWA 1T1RA 3LBFA 5ICCA 1T8RA 3GRKA 1G5IA 3PEUA 2FWPA 2RKWA 3NBKA 2F48A 3DHVA 4P34A 2ZE7A 5DT9A 3R4CA 2ZI7A 4KN8A 3K73O 2J0UA 4PPGA 2CV1A 2VSYA 2YN2A 3SR4A 5IC6A 3W8DA 3OD5A 3RYFA 1ZVJA 4CM3A 1BKYA 4OKNA 1R37A 1Q2XA 3L7NA 2BAGA 5LWHA 2BPOA 1SKYB 1T91A 1IN6A 1GTL1 2AQHA 2DKOA 1QG2A 4IR7A 4QYXA 5BSMA 4BVEA 1HDYA 4IJUA 4DANA 2HR1A 3OJXA 4UCXA 2G6TA 4CQLA 3FJ1A 5DCYA 1AHPA 2FUNB 4PYRA 3WGHA 2YQZA 2J3DA 2DF8A 4F2DA 2HSGA 1ORTA 2B34A 2X4IA 4OU4A 3N76A 3F67A 1HDOA 2QP3A 3BJIC 2BBSA 4MUMA 3U60B 2LZ0A 1NVWQ 3SYNA 5K3OA 2CB0A 1A69A 1GL3A 4MUIA 1NV9A 4YCJA 4WKBA 2B4TO 2W6JA 1WNTA 2O20A 5GJCA 2JHCA 3CXRA 3T1NA 3TE6A 1D3AA 1F3OA 3SXPA 8ATCA 1G3MA 2OQ2A 4CF7A 4MWEA 4CLRB 1QYDA 1C3LA 4OK3A 2OA0A 5FBVB 1TX4B 4HH3C 1UBUS 4B09A 2PZJA 8MHTA 3ZBQA 2G4CA 4J0DA 3ZDRA 1HZZC 3MGGA 1TCAA 3G88A 3KLOA 3RBVA 4MS1A 2E7ZA 1XFDA 3E3NA 2FN3A 2HK7A 4YI5A 3R7FA 1E2HA 1QKJA 4KO8A 4HWPA 3CG0A 2ZWMA 4DLUA 4BTEA 1J8VA 1RVV1 3KM0A 2VJOA 1UKYA 1QFJA 1KP2A 3ZTWA 1CQPA 3BE4A 2GASA 1IQUA 3DTVB 3M1AA 3RVNA 1NBIA 4W5WA 1I7SB 3UN1A 4BE7B 1L5MA 1E0JA 2QR3A 3COPA 3OC6A 2JFHA 1G8AA 2EATA 3GDHA 3KYDA 3CZAA 4IX9A 4DYVA 5FOSA 3ER6A 1NVTA 1OWMA 3ZIAD 2QD3A 2PYDA 4AUKA 3RUCA 5KKNB 2YFYA 4FMDF 1C2TA 2VBIA 3CONA 5LU8A 5CB4A 1E98A 1X94A 1X7WB 3FE2A 1AZSC 2CMHA 4Z9BA 2B5WA 2RHWA 3FX2A 4Q9DA 4R83A 3W7BA 2WQ6A 2N46A 1XEAA 1YD7A 1XRJA 1DG1G 2CB9A 4C05A 2DHCA 2QYOA 1QJ4A 2FVYA 3A9VA 3D0QA 3VPDA 4YMTA 4M0KA 4WOJA 1C30B 2JIPA 2NUTA 2PFGA 3ROXA 4V38A 2JFWA 4GPD1 3S99A 2XA2A 2Y1WA 4H7DA 4Z1MA 2OHOA 4ZP1A 2JFQA 3MPOA 4RQAA 4B3CA 4D1YA 1XRQA 4LF9B 2UZAA 3P9SA 3N5KA 1K6IA 3PHIA 4MOWA 1GT91 3KKNA 3RVKA 3BFVA 4MLZA 3KJIA 4LUCA 3WL3A 4C3OB 4GR5A 5F2NA 1C4XA 4GGOA 4HQNA 5C5EA 4U3JA 4HMPA 1QV7A 1XK7A 3NT2A 2XYHA 3OLQA 3TD6A 3MLEA 1RLMA 4JC5A 2NPFA 1A9XB 3TAXA 1I6KA 2CNWA 3RQSA 2XGMA 2D59A 4LRSB 2HQRA 4OSPA 1KK3A 1M2VB 3ZVRA 4IILA 4AYXA 4BO3A 4F6RA 1QZUA 3C3CA 3U19A 4D9GA 2Q29A 4Q21A 5JY6A 2YHAA 1EUZA 2DVMA 1Z3CA 4GPEA 2WHEA 4KQMA 4CR8A 3RSQA 1UCFA 1JA9A 4MR9A 3ZLTA 3ZXUB 5F1KA 1EFHA 2WAYA 3DMRA 3DCNA 3O1HB 4CMHA 4R8KA 1SVSA 3FPHA 1N5LA 4G5SA 4PE5B 5CITA 4AUNA 1A0OA 3AKDA 3D9QX 3KU1A 1SCUA 2BN4A 1NXQA 1QHHB 2HA2A 2IBMA 4CU5A 5KVVA 5IVHA 4CYMA 4FBLA 4UDYX 4EVQA 3LDFA 3UAZA 5ETJA 4IIBA 4PC6A 3K0EA 4P4LA 1O8BA 1BU5A 3JTEA 5AW7A 1JIQA 3AEUA 1KY2A 4BRZA 4CE6A 3PKJA 4FYMA 3VKUA 4BO5A 1YS9A 2H11A 2QTHA 1UZAA 3T94A 3NAMA 4REQA 2ZIZA 1Q1GA 1SQ0A 2C07A 3FLMA 4BP9A 2QVZX 4OX9Y 3R6DA 4KNVA 5JAHA 3B36A 4UJ3A 1C3EA 2HF9A 3E23A 3JV7A 2WUDA 3LUFA 4ZTZB 4LGMA 4X8OA 1IBLB 2QX9A 3DEZA 5IC5A 3LUPA 1MC8A 4B6EA 1POWA 3OQIB 4ETMA 1GRCA 4H7JA 4YAIA 4KQFA 1W4RA 2ZRAA 3I9V1 4B47A 3JASA 1UMBA 4X8HA 3KLPX 1Y7IA 5F21A 1BRTA 3RC3A 3GC6A 3OC0A 3QIVA 5BWBA 4IFTA 3WY9A 3DKIA 4G1BA 4PWZA 1CF2O 1RZUA 3N2IA 3CMCO 3GEGA 3HUDA 4JSYA 1Z0UA 5C52B 3I9MA 2Z5FA 3ERCA 1M2FA 4BMSA 1SQ5A 4BO0A 3MILA 3ADDA 3MNFA 3R23A 2Q9BA 3I58A 2C2ZA 3OIFA 3U09A 1E9RA 1KZ9A 1PYDA 1X1RA 3K20A 3OE1A 4ZOEA 4Q5IA 3ZHQA 5FNVA 4B80A 1ILWA 5I7VA 1Q20A 3G7NA 5H4GA 5JW6A 1PT5A 2VHXA 3VO2A 2XCUA 3ORHA 4MGZR 4NDNE 1SZCA 4U9HS 2VNHA 2FRDC 3K94A 4BQIA 4GOJA 2IVZA 1F2VA 4F3RA 5A02A 3U3DA 2GXUA 3K31A 3D2CA 2Q4RA 3LCJA 4EM6A 4NOMA 1KZ1A 3V1LA 4KR7A 4JJAA 3NCTA 4PANA 2O0KA 5TQ0B 1AZWA 3TFWA 1E5VA 1PQWA 3AFOA 3H2SA 4DM4A 5JCZA 5JXIA 1YZVA 1LX7A 4QGFA 5LYJB 4IJWA 4PRZA 2WFLA 4P93A 4B71A 1Y1LA 5IT5A 3T7SA 3VC3A 1A9PA 3GJXC 5HMMA 4B7AA 1V95A 3HFRA 4YPVA 3C1TA 5A4DA 2BEUA 3RANA 3LQ2A 4L3VA 1D1PA 3TOVA 2J3LA 4OUKX 1UR5A 2DWCA 4RVHA 4MQEB 5JS1A 3KXPA 5FI3A 4L8VA 3KEFA 4LMRA 2JJ2D 4W6ZA 3N2ZB 5L40A 3BGOS 5AIBA 2A4MA 3HCNA 1E5QA 3PHGA 2G1KA 4DV1B 4XH9B 2OM6A 4ND8A 4CKWB 1SNYA 2C1ZA 4F9TA 5BSTA 4XX1A 4E22A 3WX0A 1RZRA 1YB2A 2I1QA 4Y0AA 4ZVMA 5A3VA 1V3UA 1A5ZA 1GARA 1AGPA 3DDOA 3F7OA 4TQAA 4O4HB 3ECSA 5EIBC 5C3MA 1Z0IA 2JIBA 5KVSA 4EFMA 4YUVA 1HE5A 5AO9A 1OWPA 4IFEA 4MW5A 4C0XA 3TO5A 3IDQA 2JFFA 1KYXA 2PT7A 2VA9A 3PQ6A 5D01A 3QZUA 3R1IA 3EZXA 3UJ6A 4MYCA 2JI4A 2R6FA 2OORC 1UIRA 1QORA 1SC9A 2FQ1A 4KIFA 3AEZA 2QXTA 3RC1A 2WVHA 1VFPA 2P6OA 4OKSA 5JSUA 1DIGA 2FR0A 3SPXA 3D6AA 4ALIA 4JJ6A 1C50A 3H11A 3HWWA 1JDBB 3F4KA 3CO0S 4X64B 3DMFA 4ARBA 4AUEA 5LVAA 4ESEA 4WJZA 5E6SB 4D6XA 3E1SA 1PIWA 1KQGA 5D3MA 4R1SA 5MDHA 1Z2DA 3N0WA 3OIYA 1VA4A 1Y7TA 1JTVA 4IDAA 4M88A 1C0LA 2PGAA 5BRAA 1EWRA 4L8WB 3JXEA 2I2XB 2RK4A 5CX1B 5EC8A 4EFLA 1K63A 2AN9A 2PBRA 1YQUA 4BKUA 1H0HA 4R9NA 2HAEA 1E3SA 3NEAA 3DFUA 3IJRA 1D6NA 3IULA 3PHLA 1I5RA 1NMYA 3AEKA 5D8DA 3SKYA 2OFFA 5KQLA 1W9HA 2K7FA 2D3TA 1OLSB 4GMFA 4LQDA 2F67A 2EZTA 4C21A 2GUWA 5BUSA 1NW9B 3NGLA 1R2QA 4WVLA 4RAQA 4TKZA 1HLPA 1WF3A 1YUNA 3UXHA 5ESXA 3VYWA 5BV7A 3MCAA 3IPRA 3BDIA 5HF8A 3V1MA 3QI7A 1NW7A 2ONCA 2QJTA 5J1TB 5BVHA 5LQRA 9GPBA 4LJ6A 4KLAA 4B3HA 1Z8NA 4BLRA 4BAGA 2PE5A 5I7UA 1WTCA 3IP7A 3MCWA 4LNHA 1U6KA 3ITKA 1X15A 1LCIA 2WYIA 3ENNA 1USWA 3UPDA 1DUIA 3SIXA 2Y3IA 1XTJA 2GN4A 4EO4A 1VJDA 1NBAA 4NJOA 3QX3A 3NHZA 2IUTA 3EMDA 1ZGHA 3N2GA 5T6MA 2E2WA 3LKDA 4M1KA 4Q7LA 3R6GA 3N0VA 4P84A 2WZQA 3FDIA 3RARA 1JLRA 4FWIB 3PLAE 1KSHA 4IIJA 4BQNA 4B84A 3EGEA 3K4HA 3RUPA 3CT6A 1H1TA 3TTYA 1J2TA 3FWPA 4R3WA 2ZB8A 5JLAA 3USZA 5CDSA 4HAZA 2F1KA 3IUPA 4HYYA 4TV8B 4UEWA 4BJ5A 3SC4A 2NVUA 4P5DA 1N4AA 3GZ4A 3EN0A 3UF0A 2VPZA 2J7PD 3D4PA 3NANA 3UMSA 1U5AA 2DWPA 2PVCA 3K5HA 1N7HA 1VMDA 1CY4A 1ZJ4A 4ZT2A 3SSOA 4C4TA 3LK7A 5CDFA 3L6CA 1EP1B 5FQNA 4I3GA 4Z2AA 5IM4A 2CK3A 1FYVA 4YRIA 5L45A 1UP4A 4ZVKA 5C32A 1GUBA 1MO3A 1C0IA 1EINA 1SZDA 2KBFA 3KUUA 4LHZA 1MX9A 1ORVA 3Q6MA 4LF7B 4ENQA 1A5BB 2O5VA 4JQCA 5KKCA 4KR6A 2CL0X 2GKGA 3GFTA 1K2WA 4DYHA 4V02A 2W6PA 1TDJA 5CVDA 2QXUA 5HM6A 3A4VA 4EEXA 3HGTA 4URXR 1DV2A 2PKEA 3AP3A 3IIMA 3JWJA 1FP2A 4YRNA 2C7GA 5B1EA 3RTAA 5CVVA 1KZYC 1L9XA 1N92A 4MKXA 4UZFA 3SEQA 2XNJA 4WDQA 2QUHA 2A94A 3BE8A 4HQRA 3KKEA 2RARA 3N7UA 1Z5VA 4IV8A 1WP4A 4K6MA 4C7MA 3V4LA 2CD7A 3KWFA 3QMPA 3QVMA 3P2JA 1RPTA 4TRNA 1DEXA 2BHRA 1T1SA 4TN1A 1D8TA 2VDUE 3W5JA 2AE2A 1BMQA 1OROA 1TO2E 2H5EA 3MUEA 4IHQA 3K70C 5AJUA 4AKGA 1KSGA 2IGBA 1C8LA 2H0RA 3T34A 4E88A 3WGJA 5JECA 1IN1A 1Y5RA 4KAJA 3GMIA 1FXUA 1XN4A 2WJ6A 1ULUA 3CZ5A 2OYSA 2WT9A 1C8KA 4MYRA 1VP9A 4U1RA 4FYXA 4WH0A 5DTRA 1JDPA 4KMSA 4CLRA 1OWNA 4OXIA 4WX2B 3ESYA 3DE5X 5K99A 2CNLA 4ASUD 4RKFA 2LV8A 5KVQA 1IPEA 1KS2A 5DPMA 4B6GA 5BNWA 1ENZA 4JP8A 1K6EA 2Q6TA 2W2TA 1LK7A 2FOXA 3U48A 4CMGA 3GD7A 1JTFA 1TIBA 2JAUA 1BA3A 1CJCA 1VGRA 4BBPA 1XLTC 3Q2KA 1QQAA 3OM0A 4P3KA 3P9YA 3DTVA 3R3WA 5TGZA 4CFYA 4ZZ0A 4F45A 1EDOA 3LPCA 2B2XA 1U0JA 2XYPA 4GOKA 5HKLA 1SHLA 2G08A 4B3IA 4JVNA 1G41A 3OP1A 3FVWA 5M5BA 1QRAA 3HDGA 3HB5X 3BXGA 3G8DA 4MA0A 4CPDA 5B2EA 3R5TA 2O1WA 3CYFA 3EQ8A 3JR7A 1ZM3A 3PFFA 4YXWA 1ZFNA 1X7WA 2P2YA 1OC2A 4KDFA 1Y34E 3I6YA 5TEWA 4RLQA 2FCRA 3EVTA 4MP6A 5JY1A 1HEIA 1OI7A 3CLTD 3OLYA 1MQ9A 4MUHA 4Q1CA 1NPTO 5KUTA 4CXMA 1XU9A 5FUYA 5JDIC 1J21A 1NUQA 4OHWA 1IN4A 1FQKA 2JB9A 4NBWA 3GNQA 1CUWA 1C30A 1VE5A 1WSDA 2XR1A 5FI5A 2XYVA 5E4FA 4CTNA 2HADA 4JBWA 2RHGB 3ZBPA 3QY9A 3WMGA 4FFDA 2VDPB 4O3MA 4FHEA 4PQEA 5FWXB 1C4KA 1DX6A 2VPYA 3I6QA 2R3SA 1JSRA 3FPSA 4RDHA 2ORVA 1CUIA 3H3FA 1RXVA 1AKWA 3NBZC 3C6ZA 1LF5A 4L3WA 1NVAA 4KREA 1J7JA 1VLLA 4BNWA 3WSVA 1A9XA 1SC4A 2AMYA 1W93A 3H9QA 1Z2PX 2IU3A 1ST2A 5ECGC 1M2VA 2AJTA 1NWHA 1F2TB 2V7WA 4NZPA 5AKJA 3NBXX 1EVZA 2M98A 2W2KB 1EG7A 2V7TA 1NLFA 3CRQA 4O0LA 4XVCA 3HVRA 2YIDA 5AKXA 1ZISA 1Y4SA 2GKSA 3RKRA 4DHWA 4L95C 3CPSA 1GRQA 1ONOA 2GXSA 1J1UA 3DQZA 2AHRA 2WWTA 1AGXA 5EZ5A 3FF1A 1TAQA 3STWA 5TMEA 5KTTA 1QHHA 3DBOB 1DE0A 1ZSNA 3DPSA 3FFBA 1YB5A 3EIFA 4IIGA 2IDZA 5EI5A 1TO6A 2Q8PA 4IDNA 3A26A 4MGIR 1T4BA 2WYHA 1ZYUA 1PBTA 3B3AA 4WY2A 5AVXA 3GJSA 1BC5A 4EPWA 5JATA 1XTIA 2X22A 2CNOA 2HA5A 1NXSA 3T5DA 3QE9Y 2XKKA 1X7DA 2DFLA 5AKLA 4C4SA 1M34B 2G8NA 4UHBA 3S8YA 1YF3A 3WB1A 2YZ7A 3GCGA 4W9NC 1GLVA 3E7FA 3H7IA 2HHAA 3CF0A 3OMWA 1J33A 1JEAA 1ZOIA 4IICA 1OU0A 2A8YA 3GMSA 2XDYA 3KVVA 4ZVTA 2QAIA 3QUTA 5I48A 1HDXA 1P4RA 1R5JA 1PKEA 1N2BA 1PT8A 3OQIA 3FHOA 5I8WA 3ANXA 7GPBA 1JUDA 3UYKA 5C35A 2XEDA 5TSDA 3AKCA 3IJPA 4KMMA 1K8XB 1E94E 1TLTA 4QUBA 5KAPA 5FDFA 1SXJB 1YZTA 4JMPA 5FL7D 4ZTBA 5BSUA 2ZRFA 1ZD3A 3EQ6A 1ZXXA 2H17A 2JJYA 3K70D 3UICA 4ZXPA 2BZSA 4WA8A 3W8EA 2PD4A 4PCVA 1QDUA 5JARA 4B48A 3UMFA 1RWOA 1EA7A 3D4IA 3ZKWB 3SYTA 2BI4A 4US1R 1FS5A 2ZSIA 2X9VA 4BCCA 2HJVA 4KVFA 5CB6A 1T43A 3PDCA 4G65A 1AKTA 4EMUA 1E7QA 4AQDA 2RHTA 1F06A 4QGHA 3GRVA 1UMDB 4JT9A 2XTZA 1NF3A 1ZD5A 2B9VA 4RV9A 3GN1A 4R2XA 2ZYAA 5JFOA 4GC5A 1HFEL 4UXJA 2Q8NA 4PY2A 1YR6A 4W6QA 2WQ7A 1CERA 4Y2RA 1CRPA 5DX1A 3A3NA 3KKQA 3IQIX 4M38A 2NTYC 2IZ6A 2PL5A 3SI7A 2TMKA 3FN4A 3PK0A 3NBFA 2AF4C 1XZMA 3CVOA 3CZQA 2APJA 4UBJA 3R41A 5DM2A 5TQ0A 5HRUA 1NVEA 5LYJA 4WJLA 2YJGA 1TYAE 1HYHA 3IDSA 5HJ2A 6PFKA 2VHVA 2PH3A 4GOXA 4WKPA 1C3VA 3PPVA 1AH2A 3T3HA 1JTEA 1R0ZA 1AG9A 1IG0A 4JJGA 3ZZUA 1AUQA 3ND7A 4FCVA 4MQEA 1CDOA 1JHZA 1V8BA 3DVRX 3IA2A 2H4XA 3UEOA 1JR6A 1L2TA 3JYQA 3M4ZA 4LQ4A 2C92A 2QLLA 1Q74A 3AQIA 5H9WA 1XNRB 1G5HA 3UAXA 4CKWA 3WDMA 1Z68A 1S4QA 1XRNA 1SUDA 3VC1A 4AJ9A 1GTJ1 4QOEA 1F6WA 2LVBA 2V59A 4DPKA 1C7EA 5SY4A 4E1AA 5FTJA 1QFYA 4FXOA 5A03A 4M8KA 1FFAA 4O4HA 4X3OA 3D3EA 3LXUX 2OHGA 4CM8B 5I4CA 4EX6A 1NQXA 2PX6A 4GD3Q 4X1IB 1HDIA 4ESVA 2CXRA 5HRCA 1GN8A 2OT3B 2CHEA 2AKEA 1M72A 2P3OA 2VRCD 4CGYA 3JVDA 1DWQA 1XGKA 1LB1B 2ZSHA 1CW2B 1D2EA 1R5NA 1HLFA 1B1AA 1R3UA 4JWKA 4DDKA 2SBTA 3KBBA 4F5EA 6CHYA 5FLEX 2H7CA 2XEXA 4D9FA 1GP2A 3RAGA 2NNWB 2PX2A 4U7FA 4ZRMA 5LMCA 5EIEA 3MG9A 2FX5A 5E6SA 2XTAA 2ZJ4A 1S8OA 2J09A 4KKXB 4DG5A 1KPHA 2DE0X 2V98A 1AQNA 1U04A 2FUG6 4G0NA 1MIHA 3OZAA 1F7UA 5AK6A 5ALHA 3RKUA 3PWZA 4XX0B 4ZMRA 4OBEA 4MMZB 1ZBDA 2JCYA 4IXTA 4J2HA 1PLKA 1ZJ5A 2WKQA 4BFCA 2JFXA 2VHTA 4OF4A 1PJ4A 4AZ0B 1RZ3A 4DIBA 3P9XA 4DLXA 1RPZA 1HF3A 2XXJA 4IF6A 3PJGA 5CX1A 4J16A 3HCOA 4YROA 2G9UA 3I4FA 3JATB 3M6MD 5WRFA 4S1TA 1VSTA 4ZVSA 3TYXA 2ZZKA 1IBKB 1PO7A 4OI2A 2XQIA 3RWBA 4UTNA 3BRSA 3V2HA 1SGWA 5EIWA 1IM8A 2GZDA 2JJ8A 1OLSA 4S1VA 1F20A 4TWIA 2GRUA 1CETA 1P2BA 4G1EB 2VDLB 3QV1A 4C6TB 2O57A 4IFIA 4WBXC 2X2EA 2W7TA 4WHMA 3EBLA 3I01M 3B8EA 3Q3IA 1VHQA 3OUZA 3DDSA 1Z17A 1EA5A 3ZYCA 1RYFA 3SJBA 1JE0A 5D6OA 4ZAYA 1BMFD 4BGIA 3I2HA 3UJ7A 4F85A 1KHTA 4HXYA 3EEBA 3T4UA 1UC5B 1H5UA 2AN5A 2ZUCA 3IOCA 2NPOA 5IJ0B 1A9YA 3SR0A 2PD3A 2O2EA 3I3OA 3E7PA 3SLKA 1WQ4A 3MBKA 4F92B 1RYEA 5I47A 2FWJA 3FPBA 1QCYA 3JPYA 3ESCA 5ERXA 2REBA 3R7SA 3VVCA 3HXOA 3D31A 5EVJA 1QV6A 4TTIA 1YCHA 1RKUA 3SLRA 1PJRA 2AJLI 3E9YA 5L4LA 2PKXA 2Z56A 1KDVA 3JZAA 2QG4A 4TV8A 2NT3A 3ROMA 1X1TA 3I04A 1QHYA 4RIEA 3U3ZA 2Q2VA 3RRFA 4A36A 3WKEA 3WSTA 5KTKA 1D0VA 3FSEA 1HSOA 1U8FO 2MWMA 1TTQB 1VGQA 1T29A 2Y1EA 3I30X 4II3A 1FDUA 2CXPA 1P3DA 1VZ3A 1R4AA 4XR4A 4ZT3A 1DP4A 1NI4B 4FBMA 2C8LA 4L51A 2X77A 3QPDA 3ITNA 1QIGA 2GM9A 3IYLW 1U63A 4OHKA 4LDPA 2IUFA 4BPRA 2BKVA 4F4CA 3EGDB 5B58C 3T5GA 3ZDBA 3VGPA 5JAQA 3V1YA 3VR4D 1YVEI 2J7KA 3MWFA 4MHSA 4G4IA 1IB6A 4D56A 3RUIA 4DWOA 4EIWA 3STVA 4J4BA 5IJAA 3TZKA 4AJ4A 2Q4EA 5K0BA 2VF5X 3JD2A 2QU7A 2ZRNA 3MMNA 2P5UA 3RO7A 2GDJA 4M8SA 5LJLA 1MVLA 2JFNA 4UVEA 1X86B 2C96A 5JVDB 4GMGA 3EMVA 3RVPA 1HRDA 4EYEA 1KRWA 1YR1A 2QSZA 4TWBA 1D07A 1XVLA 3DEYX 4NCIA 4YR9A 4FDVA 4LISA 1UQRA 4JQYA 3CVYA 4Z3OA 3ST7A 2LKDA 3QVUA 3ROGA 3IKTA 4KQJA 5EUCA 2VJLA 3NBMA 5C53B 2CLFB 4FFPA 4F5ZA 5I4BA 2YDXA 2NO5A 1OIWA 4S0XA 5E1OA 13PKA 1Y6FA 2Q5CA 4G24A 4RPLA 1K4KA 4QQNA 4ZI5A 2RONA 3MJDA 1N6IA 1TUEA 1R66A 3H9EO 3DC7A 1LPBB 2GARA 4HD8A 3UCEA 4F9GA 3IBGA 3DGFC 3QE4A 1M5UA 4XWTA 3X1ZA 4A2WA 3WGQA 4F4FA 4LY0A 4PXAA 4AG3A 1Q44A 1B16A 3OMLA 2JI6A 1GQFA 3IV6A 2NXNA 1DHTA 3KQPA 1IK6A 2XOXA 1P5HA 4HLUC 2JGRA 3IQFA 3REOA 2C5FA 4D8XA 2XQFA 3C4VA 2HN9A 4WFQA 2GBFA 5BV2P 3HBJA 4AL4A 3PIDA 3AILA 4ZVOA 2FN7A 3BGSA 5THQA 2CXSA 3AUKA 1BD4A 1NXOA 5TY0A 4A0HA 5K5EA 1LA2A 1N5RA 2FPRA 1BXKA 3CISA 3OHMA 3TINA 2NXCA 2VNSA 1NDQA 5AVZA 1ORIA 2W2VA 2NAFA 3T3GA 1TMOA 1WEHA 5BQXA 1L8XA 2CBXA 1U9CA 1UEJA 4I14A 4LBVA 5L8VA 5CEFA 5BV0A 4JXJA 5M3BA 2OXTA 1OX6A 1V11B 1I5EA 3QENA 3MWJA 3QHPA 1ECCA 4OMFG 4P8RA 2QMUA 3VR5H 4C3UA 3BMCB 4ZHQF 2FVXA 4NPCA 1E2GA 1WHSB 2CFCA 3HKEB 3PA6A 1E2LA 2WG1A 3M3DA 3LH5A 1N0UA 3LLCA 1XZFA 2PTGA 3G59A 1RYBA 1VLHA 2O8DB 2GO7A 5HX7A 2WHRA 3DE2X 1ESZA 1S96A 2HA0A 3T5PA 3BRCA 1NN0A 1R0LA 4ZYXA 2YMQA 1GTSA 2JJQA 2VHZA 3OFSA 4OA8A 3ODGA 5FWXA 1PUXA 3RUHA 5B2FA 4M6WB 3WKAA 1JYEA 2HJWA 3PXXA 4H08A 1DEHA 3GH3A 5F23A 1BEZA 2R79A 4BN5A 4IVQA 1B42A 4P58A 4ATNA 4JAVC 1IDN1 4D5GA 3QOXA 4Y2HA 4OLJA 2D5CA 4L4SA 1IZ0A 2XB9A 4ZZ2A 3FMFA 2FEWB 3B13B 4RVGA 1SB8A 3O4JA 2BE7A 2GPBA 3K72B 5K8UA 5M04A 3DMDA 2O2HA 1BDMA 1FP1D 1F2TA 4X7PA 3LOQA 4JB3A 2HRDA 4XOIA 5K0CA 2W2KA 1ZIYA 2ID4A 4B32A 3STXA 1DC4A 3CZ9A 4QXPA 1P72A 4UHDA 4XCVA 3ROQA 4E31A 3T1VA 4RXUA 4KJZA 2IKQA 3U9TA 5CBPB 3G0IA 3L8EA 4JVLA 1H6DA 3CLVA 4EB6B 1JALA 2X86A 4S1WA 1H5QA 1ZVKA 4QUDA 1E1RD 3IP5A 2BISA 4MI6A 3PX7A 1V7PC 3PFCA 2QTNA 3MHPA 1K9VF 1KZ7B 1NONA 4QJIA 1DZIA 2E4VA 1JQDA 5SYAA 5JCJD 1T1GA 1L1FA 5TE9A 3ACDA 1OH7A 1UAAA 3EY4A 1S8NA 1ZIOA 2PX8A 3TRJA 1BJRE 3EYWA 1BD3A 2H1OA 1UBEA 2V6MA 3G7UA 3AV3A 3HYLA 5AR1A 1GOTA 3C85A 1MXFA 1CQIB 1AHNA 1FPQA 2RB5A 4Y0NA 4Q4CA 5DIFA 4TZKA 1M34A 1CUZA 4YH1A 1G3QA 4QIHA 3ZDEA 1JILA 4FT2A 1GNLA 3ROEA 1S2GA 5JH7F 4CG0A 1X8XA 3KOYA 3LVRE 3NWPA 4CL2A 2J6BA 4W1QA 2WM8A 1EUCB 1IU9A 2WP0A 4G07A 4G0VA 3EBOA 1VQ1A 2EZ8A 5EZQA 4BEJA 5DCLA 5T4FA 1PNRA 3WB0A 3L77A 3P26A 5K0JA 3UWPA 3OCJA 3TD2A 1DBQA 1SBQA 3P5SA 2GD2A 4EZIA 2QTGA 4IV0A 3ZDDA 1JKXA 3TG8A 5IARA 1L4GA 1N6HA 1QFSA 1SXJA 4MH0R 4UU1A 4ZOBA 5IYZB 1G42A 5I9NA 3O5AA 4NJMB 1XTTA 1AOXA 1ICEA 2BRUA 3H8JA 1LK0A 1DC8A 5CDHA 2J32A 1SU8A 3WADA 1Q91A 2YN4A 3WWYA 5GINE 4BB6A 1N5MA 2HDOA 3O3CA 4KN5A 4XUDA 3ZKWA 1JSZA 1U1GA 1WZNA 2AFHE 4EH1A 1DJPA 2H1VA 3MYYA 5LUAA 4HEA6 4UM5A 2YKGA 2FZCA 4G84A 3TKYA 3E03A 3IE1A 4YJ3B 5ALZA 3WLJA 2EP8A 3DZ8A 1H4TA 4WCFC 5EIOA 3UT0A 3VKHA 5DFAA 5FLXA 4O1HA 4YMWA 2OPBA 1UMDA 3ZE8A 3D3KA 3G89A 4KG7A 1JMYA 2J8ZA 5GWXA 4URUR 4F3YA 2V4MA 3FYUB 1S3IA 1N8NA 4CMAA 1YMVA 4Y3UA 4ZC8A 4EJSB 3V4VB 1KYQA 4LC1A 4JL6A 4UM7A 4KFRA 4XD2A 1MAUA 3KJHA 4PIMA 3FVVA 1B00A 1OAOA 2R4QA 2D8MA 1CUFA 4Y2XA 2YV2A 2VTVA 1OC4A 4XWYA 721PA 4RVNA 2XGJA 1TQ6A 3RSFA 3IAEA 5AOBA 5EPOA 3RV3A 4KWEA 4I2NA 3WFIA 4CTMA 1EX1A 3THOA 3TW0A 4JJZA 3EAQA 3C3DA 3TB6A 1AU9A 1VLQA 2HJGA 3E58A 2OL4A 4O4IF 5CLLA 4ND4A 1REQB 1RI5A 4KHPB 1LPAB 4RTQA 1THMA 3I09A 2AD1A 3KB8A 1LSOA 2BIFA 2XRMA 2PX0A 3C5HA 4B35A 3A4TA 5FAKA 3GJQA 2WM2A 5IZCA 1OTXA 4S24A 1KEUA 3KQMA 4DRZA 4N03A 1FW6A 3DPIA 3TF5A 2XZTA 4EY3A 1QQ6A 3AIIA 3COWA 2JLSA 2Q0HA 3RVQA 1X2BA 1Z25A 3BICA 1PLLA 1HFJA 1Z33A 3WKDA 3F71A 3JZFA 4MVJG 4ZCMA 1SCBA 4RKWA 3JYOA 2QJWA 2C1EA 4NZMA 1K68A 3CRMA 3KVOA 4BLOA 2HT1A 4CM8A 2RB4A 4HWGA 4X1IA 3H4MA 4O8CA 3OZEA 1Y98A 4UM9B 4XKJA 4DLLA 4V1CI 3I8OA 2XKJE 2XNHA 2ODTX 2VF2A 4D74A 1EM8B 2B4AA 1RXSA 4UDOA 1MFPA 1SG0A 1RAGA 1JVNA 4BY9E 1GGHA 1U90A 1SC1A 1UXHA 4XIGS 4B0OA 3PUZA 3E61A 2L2QA 3ZHVA 4ES6A 5D3QA 3ZDQA 3HY6A 3A7EA 4NZOA 2H2DA 1W36C 1V5FA 4M98A 4B31A 1XEXB 2WTMA 3UMBA 5LBTA 3EARA 5IANA 3QXCA 2REXB 2GA8A 1FTGA 1LX6A 4PRKA 4UU8A 2A67A 5C8DA 3HCDA 1ZRNA 5C8VA 3NHPA 4D43A 4HLQB 4LGVA 4F38A 4AZ0A 4G8JA 3ELUA 4ZJZA 2Y1DA 1U11A 2QP4A 1EJ2A 1LKZA 2QW8A 1YBFA 4QJBA 3CEHA 1NULA 3SBXA 5F3WB 3JATA 1NW5A 1SOMA 2GM5A 3I39X 2X2PA 3P9PA 2R87A 3UUEA 1EFCA 5ENDA 1MX3A 4B6JA 3PPXA 1OBVA 4OOEA 3CJRA 5CFZA 5FV7A 3ZD7A 3IAM1 4F91B 3DOFA 1K1EA 2FEOA 2WYUA 4C6TA 3S1SA 4BNKA 4Z86A 3EA0A 3FPLA 2W42A 4GVPA 1CUJA 3VKFA 5IXYA 5G2OA 3K2QA 5L3ZA 4EHJA 3IIJA 4J0IA 5E6RB 3VR5D 3H2YA 2VDQB 3RBXA 2J0QA 1U2ZA 1T2VA 1SIBE 4R71A 5JJLA 1KKLA 1M75A 1TAGA 3DEHA 4GPTA 4IOLA 3U4AA 4M0MA 3SX0A 5EJMA 3T0IA 8ADHA 4P54A 3A2LA 2DP4E 4R68A 2GK7A 4OM8A 5JAOA 1WXXA 2MIIA 4YJFB 3TOSA 4FE3A 4WOPA 3P27A 5IJ0A 3SE7A 1F5SA 2X15A 1G63A 3PLNA 5B36A 3JAMA 3GFPA 3ZU5A 3C5CA 4I55A 3EXG2 4Q19A 5JADA 3WKCA 1HBJA 2XXBA 4EI7A 4DB2A 2H8KA 4GRIA 3RV4A 3OEYA 3RS9A 4Y6OA 4J91A 3ZXXA 1WV0A 1VKZA 3A1VA 4BJ3A 4U2KA 2Z6AA 1HMPA 2QD5A 2E4YA 1PDVA 1WDTA 3WGVA 4TL9A 3TVTA 3UK2A 1V16B 1ZJZA 5DLQC 2OD2A 4L4RA 1U6IA 2QZPA 4HS4A 3ZX5A 1PT6A 4DZRA 3NDJA 4S1OA 1P5RA 1Z0SA 4WWHA 5JZOA 2ICAA 1NI4A 1U5CA 1Y8CA 4YGXB 2OHHA 3VJRA 2J08A 2P5SA 4AF7A 1WMFA 1X7HA 3B3JA 1QYWA 2PRZA 4IWNA 4B0PA 1OCEA 6REQB 3NYIA 5JFTA 2XODA 1E5DA 3UH1A 2Q4TA 3HWX1 3EGDA 3ZE7A 1QF7A 2X1VA 1WEKA 1QHXA 3H5IA 4OTZA 4A5SA 1AXGA 3HE3A 4N47A 3KD2A 2FCAA 4JUFA 3R9IA 3TH5A 4DQ0A 4F8EA 4Q03A 3G5AA 5CLGA 3B7PA 5FOUA 4HFRA 5KNBH 2HWWA 3K2BA 3X1XA 1G66A 2A5YB 3R0ZA 5IKXA 1R0BA 2H92A 4JS0A 1BMDA 5L6MB 3DB2A 5JVDA 4DTCA 4RIHA 4R16A 1E2BA 1S0UA 3ADKA 2BY4A 3OE4A 3U4MA 2I71A 3PHBE 4DG8A 1UM9B 4C89A 5KZMB 2XQVA 1QOPB 1P3JA 3C98A 1GADO 1TC1A 4MRNA 4YP6A 4YT8A 4ZTUB 1X1AA 4LI0A 1LVHA 2IS1A 4LXQA 3U3RA 1UK9A 4MLDA 4D4LA 4PGHA 4A15A 3WBFA 1NM5C 4CEHB 2PUAA 4BCBA 4FBGA 4OQQA 2FB9A 5HF5A 3TQOA 1LSJA 5DYIA 1CY7A 3FXAA 2ZR8A 5DHPA 4GKJB 5JD5A 1W2WB 4DV7B 3WRXC 2OHJA 1GR1A 1YTLA 5KOHB 3TPZA 1X19A 3PFGA 5KJ1A 3RYHB 3KFXA 1S2IA 1UADA 1JXOA 1N3LA 2B20A 1CUAA 2GK4A 2IE8A 3LHKA 5KVCA 5KYWB 2CLIB 1PR6A 1J2RA 1LPSA 2QENA 5BO5A 3UNXA 4GFDA 4W5TA 1WZIA 2IP2A 1EJ6A 4RY9A 5DW3A 1ZGZA 3TQIA 2G88A 1W5TA 3VISA 4DQKA 1U8XX 4IDGA 2JRCA 2EW1A 1X74A 3DCYA 1W0JA 2O4CA 4FR2A 7REQB 1ZI8A 4R1NA 2ZYTX 1DZ3A 3KXDA 2UZ4A 1WZEA 1WS6A 1DO8A 2F43B 3V33A 4DLVA 2XB8A 1ZLYA 3HB7A 4LXIA 3EZNA 3OURA 4R2WA 4COKA 1T3LA 4JELA 4J1TA 4PS0A 2BE9A 1UBCA 3AM4A 1J49A 1U0TA 3SYLA 1FQWA 2VXYA 5TF4A 3ZV7A 4E5UA 3FAKA 3ICQB 1MG5A 5AQEA 1NT2A 4TWZA 1V11A 3Q7PA 4HXFB 2MCFA 2B3TA 3BMCA 3F6CA 4R6XA 3WTBA 3W3AH 5EHXA 4JI6B 3DSRA 1WHSA 2XMCA 3NXKA 4K9OA 3HKEA 3P97A 1VJ0A 5TC4A 1R0KA 3U4GA 3LT2A 4RMGA 1H6CA 4ZODA 5EIHA 4TLCA 4DSAA 3QUCA 3A32A 4LWOA 3K9FC 4W5NA 3LM8A 1N5IA 2O8DA 4F3KA 3EA5A 2J5BA 2O07A 2W4IA 4GG1A 5JS2A 1UBRS 4JLAA 3MTGA 1MGPA 3PI7A 3GLFB 5C4IA 2WG0A 3OP4A 1GPWB 4XSGA 1H66A 1E7WA 3QVJA 4M6WA 1G18A 1YR7A 1NE2A 2PK3A 4I6EA 2YJTD 5AW5A 5IT9A 3FF4A 1NBEA 3GCXA 1BVRA 1RADA 1E1DA 3HMKA 2DHDA 1UBKS 1N9KA 2P4UA 2W2LA 4G81A 4L5CA 1Z5OA 2JFPA 2JW5A 2JH9A 2CFIA 3V32A 4KK4A 4M7PA 3BCSA 4Q12A 1Q1QA 1T5SA 4EJ6A 1KORA 2QR5A 4TV9B 4XB1A 3CJQA 3NDIA 3ONNA 4NBRA 3L0YA 1JWAB 1PR9A 4KV7A 3T3DA 1JR3D 1WOYA 2C2GA 2D1SA 2X4GA 4OCZA 5CBPA 1NBWB 3AGPA 1RI4A 3WBBA 1U2TA 1EU1A 4FR0A 1G19A 3H42B 5HTKA 1P9LA 3JQ9A 4EB6A 5BURA 2Q2WA 3C87A 4N5HX 3NCHA 3ZV3A 1HNZB 1JSLA 1AN9A 2WVAA 3F7TA 3HVHA 3TLGB 2VRWA 3FCCA 1TQ8A 3IEXA 2V8BA 4K05A 1BGVA 2HCRA 1BKDR 2OXRA 3UGKA 1Y8RB 5K05A 1SOVA 3B1XA 3MT0A 2BFOA 1EE1A 1QYCA 2H4ZA 2LNDA 2WWGA 3LG2A 4TRRA 5F5NA 4N76A 3BGDA 1FFGA 5DN6A 1XVUA 2GQ0A 2IIBA 1U3UA 2JL1A 3IBTA 3GAFA 3IUSA 4K2HA 1CQIA 3FFAA 3FSGD 2V3WA 3IBSA 2JHGA 3P0IA 1KQNA 4BX8A 3GEDA 2G82A 2ZJFA 3I6IA 1Z7BA 1R4MA 2R8PA 3JVEA 3PD1A 4EMSA 3TCNA 2LP4Y 5AHKA 5HQ3B 3N2YA 3CPHA 1KE1A 4RC9A 2OXFA 2WIKA 4CV1A 1ISMA 4MRVA 3TAUA 1EUCA 5KSOA 3G1TA 1GHTA 4R2IA 3TUIC 1B6TA 2H08A 1JFTA 4BXOB 2JI9A 3H1FA 4Y1RB 1XZBA 3STUA 1ZVMA 3MWLA 4GWKA 3U13A 3USES 1GNSA 1QQ7A 2D13A 3H1EA 5TV2A 4BMXA 5FULA 4OK5A 3QMMA 2Z9DA 4QBTA 4ZQFA 4BWVA 5AUPB 3IPLA 2IPMA 3PP8A 5DM60 1EK1A 5CW2A 4DCNA 2NUAB 2PSEA 5BPFA 2ZJYA 2VCYA 3ZE9A 5IYZA 3LVFO 4LF8B 3A6EA 4D4GA 4NJMA 5L4SA 2FWNA 4AP6A 5LZ5A 1QIKA 4LTNA 1G8PA 2PEZA 3VX3A 1LI5A 3VSBA 3GUCA 1GGNA 4M99A 1J0AA 1T5DX 3AUTA 5JCOC 3HDTA 2JFYA 1IRXA 1NTRA 1XRRA 1YO6A 2GCGA 2ZWAA 4IOKA 4IXWA 2V7PA 4WI1A 4YJ3A 4RH3A 1NT4A 1TFUA 3SAJA 2WJAA 4CQMD 5J2UF 1P1KA 2R66A 1KU0A 2QB5A 4GBGA 4LV6A 4NEGA 3UV7A 3UHPA 4CODB 5FH9A 3IHLA 1JHXA 1QQTA 3FYUA 1LFAA 2GM3A 3N2EA 1J0CA 5IDYA 3UAWA 3TE7A 4EJSA 2O2GA 5C1BA 2H59A 4H2DA 3TLKA 2WD9A 3V1NA 1H6AA 1N0HA 4KV9A 4R9VA 4B7UA 1C80A 3CSDA 2YMLA 4ACBA 4CMEA 3AR2A 2DR3A 2R7NA 3QNMA 1JQ3A 1NYRA 3EDQA 1GA4A 4MRAA 1FX1A 3WGTA 3LCUA 4O4JF 4DF3A 3QOFA 3EUAA 2ZRMA 3H9CA 1CP2A 4BTLA 1DIOB 1S2MA 4Y2VA 1B26A 3H2IA 1AKEA 4Q4LA 3M49A 4C5BA 3F5DA 3HJHA 4IDEA 4I1IA 3RRYA 1REQA 4KWHA 1FVXA 1IATA 3VR3A 3RSOA 4UDXX 2H1RA 4TX1A 1N77A 1ZK2A 2XITA 1IL0A 3HSSA 2O50A 5KDDA 5H68A 3T1YB 3E9MA 2H2FA 3NVDA 2HCBA 3F98A 3OJFA 3FROA 3FTNA 3JZIA 1WXEA 3OOYA 1UUFA 3AF0A 4FIZA 9LDBA 5C8ZA 5KYTA 3HP4A 5EJAA 2YJNA 2E82A 3HNOA 4DEXA 4MVXA 1VSBA 4HGOA 2VXOA 1F51E 1MBZA 1M54A 3OQOA 1VKOA 4ZANA 2A5FA 4LXXA 5J4YA 3R7BA 2ZIUB 3OUUA 4DJDC 1ULHA 1CUVA 2PUFA 5L7YA 5DN9A 2WIBA 2WSSA 4Q6BA 3QH4A 1EM8A 4IXDA 5CP8A 2M2IA 3CUUA 1OE0A 5HUQA 3A1DA 1L1RA 2C98A 5ITZA 1E66A 3VMFA 1GQSA 1OJ7A 5CXSA 5AT1A 3C24A 4BMNA 3FZGA 4G0MA 4FQ7A 3I34X 4MRSA 4PAWA 3EQZA 4CF6A 2ZE8A 3U81A 4TUYF 3O31A 2DBZA 5KB3A 1XEXA 1PTKA 4K6HA 5IU6A 1ID8A 1K06A 2Q0SA 3ZPXA 2ZUVA 1RFLA 2G8LA 2QL5A 1RAEA 3BCUA 3WE7A 4AD8A 4S3MA 3DULA 5SICE 3JQBC 4PN7A 4J49A 5A4JA 2F9MA 1G8KA 1K8ZB 2C20A 1X14A 5MGBA 1AJEA 1GZ5A 1U94A 2P6PA 1F8YA 3DKKA 5F9MA 4DLYA 4GR4A 1CR4A 3TTUA 3A14A 3ZJTA 2LE0A 1MJNA 2QAGC 1Q7EA 2PUGA 3FGZA 1NF8A 1R7RA 3H5AA 2OOKA 3HDJA 1VRVA 4OSEA 1MORA 3MT7A 4FYJA 3VTFA 2FPIB 2ZBDA 1ENOA 1NVXQ 4IJMA 4R31A 4REOA 2QE6A 3BEDA 3ETHA 3W6ZA 3JS5A 4M53A 4GOND 2HBZA 4IGKA 4UD2A 4CIVA 5LLDA 2SKDA 3KYBA 3OAAA 4UASA 1YONA 1Z2OX 2DBQA 2ODAA 2I6XA 2XJ4A 2QMEA 5E6RA 4ZCPA 1XKTA 3I5AA 1YVPA 2OFOA 3ZZMA 5JPCA 3CLUC 4NABA 4YCAA 5K6AC 3QEAZ 4ZYYA 4B6RA 4BVFA 1U1EA 3S5JA 2FF5A 1HG0A 3K32A 3KZVA 1AMOA 1S2OA 1W59A 5EWMB 1G6OA 2HL6A 3D3JA 2IUUA 2BHLA 3MAGA 4ER0A 4YJFA 5C7YA 4JGIA 1SCIA 2PMDA 4DMLA 4A4DA 5IUKC 2FSPA 3R74A 3KWJA 4OL9A 4D4MA 2AK3A 2VTKA 3SEFA 1JLKA 3V9PA 2FZKA 1NR7A 3CUTA 1VP3A 4L9RA 3W2EA 2ZZNA 1Z4MA 4QAJA 2BGJA 1U9IA 3JAKB 2XQJA 2NGRA 1U7WA 2WDPA 3HHPA 4K6FA 3CNLA 1CFJA 2VHUA 4GOOD 3VSEA 1BMTA 4YBRA 2Y99A 3ZDYB 1I2ZA 1WKVA 2TSYB 5KHOC 5K8TA 1KPGA 3BTSA 1V16A 2J6IA 3IMGA 3KHUA 1H4SA 3I28A 4UBLA 1ZR2A 2LCFA 3ZY4A 3ZWWA 3L7CA 3CGWA 2CKDA 3OMXA 4LX8A 2I7XA 3L8YA 3MXOA 4WCVA 2CV0A 3GHHA 4CRWB 4CR6A 4JIMA 1CUHA 1JMVA 1LW6E 3NI2A 1FJHA 6REQA 3UANA 2O3QA 5JSZB 1TVEA 4QG7A 1KEZA 1RD4A 2XDQB 4QLAA 1JT2A 5H70A 4G5HA 5ALYA 3T3MB 4JYAB 1C1DB 4YQFA 2XUAA 4ZZIA 3OE7D 2WUWE 3R09A 4D9MA 1R5BA 4IRXA 2OSVA 3TRDA 1KI1A 3L1JA 2IV3A 1E0SA 3BEOA 4O4LF 4JODA 1G6HA 1UFQA 1KC3A 3LBIA 1RJGA 4AURA 1O95D 5CIYA 5CA0F 3PQ4A 3ZV4A 4QTZA 1VM6A 1PK9A 4G4JA 1UM9A 3I3SR 3F5FA 4H6PA 1JG3A 3E4DA 4MV7A 3TIVA 4M1YA 2ZTLA 5CJJA 2R1VB 2QZSA 3AY7A 3TPCA 2EJWA 2P3SA 1ZCFA 1NSYA 3LRXA 4RM2A 3W34A 4KR3A 1ZRSA 1SOUA 1I2DA 2XA1A 5ADUS 4HNTA 4UUNA 3O73A 4CEHA 2DSNA 3LKZA 2PKWA 3EA4A 3P45A 3VAYA 1OBFO 4YAEA 3I2IA 1HOXA 4TKUB 4IWYA 2DYKA 2JZOA 1YZHA 4W8HA 4NS4A 1NP3A 5KOHA 1WABA 4FFNA 1B76A 1E5XA 3RYHA 1AA9A 1LDBA 2MOKA 2I8LA 4FOPA 4D8VA 5KYWA 5A4KA 3HZHA 4PFKA 4EITA 4JEIA 1NYLA 3RFTA 4MVYA 1P60A 1ZGAA 3HSKA 2CUTA 2F1OA 1H93A 3LZDA 2VJNA 3KXIA 3QLTA 4ROSA 2YZ2A 4O2BF 3VNVA 3UMCA 4RQTA 3K5WA 7REQA 5HM8A 5KSYA 2XQKA 4H6VA 1U0EA 1R4ZA 2UXBB 3SU8A 1XD9A 1DTEA 2UKDA 5EWLB 2Z08A 1XLVA 2F43A 5A7GA 4C6SA 4H3VA 2QN9A 2PYIA 3HU1A 2YFQA 3L82B 4IDOA 5B5SA 4GW3A 3SLGA 2VSXA 3HC7A 1BFDA 3PQDA 4IGEA 3EVBA 1UEXC 1TJNA 2WIJA 4HUTA 4L4YA 1ZPDA 1DAMA 1UWCA 3D8HA 1U2GC 2AG5A 4RO0A 5B2ZA 5JSKA 3EJ6A 3GMDA 3TOZA 2A1IA 4KRYA 3MHTA 2E85A 3LX8A 1AO0A 1D8AA 4KFCA 2YBDA 1GM5A 4EARA 3AVOA 3TQFA 4EYOA 4IO0A 1DBPA 3J7AC 5ENVA 2DXIA 1USIA 2R00A 1PSDA 1IHXA 3LUDA 4M4SA 2RH4A 3Q8KA 3Q4GA 1OT3A 2EIHA 3AK4A 4BPBA 3KWLA 3TQHA 3ZIUA 1VBFA 4XSVA 2UUAB 5K7SA 3NFRA 3JWGA 1J9EA 1I4LD 5MFZA 4PPNA 3GLFA 5JWHA 2ZBPA 1NFFA 1ZXBA 3FHJA 3GG9A 1CVIA 5MHTA 2LDBA 2ZT6A 5CPFA 1T10A 2X6QA 3ZDXB 1XHEA 2Z3VA 3OKFA 1D5WA 1R0WA 3N28A 1HDZA 2GHIA 2Y05A 2ET6A 3WR5A 1G6Q1 2C2OA 1XAJA 1G3RA 1L9KA 1Z0KA 5L3QB 1M6VB 3BK2A 1PL0A 3CX4A 1GT6A 3L02A 3IUNA 2YWDA 4H16A 4I1YA 2IQ5A 1XA4A 2ZU0C 4XASA 4K1XA 4BLPA 5DCWA 3KL4A 2DWUA 2PNFA 2EXXA 5CGQB 3PQEA 3W9SA 1Y6JA 2I2FA 4PYMA 4TV9A 2VPXA 1Y4AE 4M54A 5LZ7A 3I01A 1HFWA 2X3YA 2H57A 1D5CA 3E5HA 4JKIA 1A1SA 2YJ6A 4Y6GB 4WBSA 1GAWA 1S5PA 2C4WA 3DXFA 2IXBA 3OQ6A 3HV2A 5K0SA 1IAVA 2WV7A 1I51A 1GEEA 4GQBA 2YXLA 2VCEA 3CUYA 4KGDA 3TLGA 4IQ0A 5EMNA 4FZ5A 4OLBA 1ZN2A 2Y76A 2XX3A 2J6HA 3A37A 3RI3A 3WGUA 1CSEE 1NBOA 3D5QA 1Y8RA 3SEZA 4V3BA 2ZRIA 3A6GA 1THZA 2BSXA 3II6X 5TJHA 2AUMA 1Z63A 2V7BA 5IRCD 1CR1A 2HT6A 3F7NA 3LYLA 1S2DA 1V5EA 3PYLA 4HNRA 4XYBA 3D7MA 3BD7A 1UKZA 3GBPA 1HDEA 5LQDA 4HFMA 3RJMA 3W5VA 3I6MA 1TTPB 4XQGA 2DPMA 5HQ3A 2BMJA 4FSHA 5AK0A 3SF0A 4LHYA 4TXHA 3JD0A 1Y9JA 1NNSA 4NU0A 1ZC4A 4B79A 4GKVA 3L49A 1C8VB 4I99A 4TMTA 1BIFA 2HSEA 3KQYA 4PYOA 5DTMA 4Y1RA 5H81A 1C5KA 3UXEA 4HN9A 3U3XA 5BNTA 1WTAA 3ZWCA 1P62B 3ZU4A 4FWBA 2AOTB 5IPFA 5IT4A 3ET4A 2RIRA 4CG2A 2HA7A 2YYYA 2ZTVA 4WY5A 4ZT5A 5AVQA 5CCEA 4LY3A 2NUAA 2QPTA 3PD7A 1NVMB 1KAGA 5HE8A 5T7BA 3AZPA 3IAFA 4X44A 1I2BA 1NRIA 3RODA 3TSYA 1QB8A 3AI1A 1F4VA 1GGMA 2WOOA 1U3DA 2IYRA 5ADVA 2SKCA 2H1IA 3D4BA 5BORA 3B53X 5CFMA 2VJCA 5LP1A 5DM1A 4EHKA 3FYCA 3EWAA 5HW0A 3VHRA 3PT5A 4UBKA 4RGBA 5ALXA 3TCXB 2GAOA 2F4VB 2ZT5A 2WM3A 3GLVA 4PHHA 3RYIB 2VI5A 1LXCA 2G63A 3THSA 4OB8A 5ALRA 1JLHA 2P9EA 4KAFA 1R6VA 4LN1A 1H2BA 1U0RA 4C0KA 3OQ1A 4BU1A 5JSQA 4F72A 1IIRA 3WYEA 4LVOA 2OHVA 4KDEA 4ZPXA 4C20A 3KQNA 5AOAA 1QCZA 1UJMA 2OO7A 2XD9A 3M3HA 4UUMA 4Q9HA 2AR7A 1KC1A 1R0YA 1KSJA 5IM5A 4TRJA 4LX0A 3ETNA 2OHXA 2WILA 1SPXA 4PLTA 3FYDA 1LWOA 1Y89A 4L5BA 3WWZA 3ENZA 4EUSA 1YAHA 1UKCA 3EDOA 4YREA 1CF9A 3JQ6A 1M0TA 3QG5A 4KAAA 3FPKA 3W4IA 1OI4A 2XVXA 2ODQA 2HWYA 2GSDA 4QU9A 4N0EA 5G53C 3DDHA 5DBGA 1A76A 4GEKA 5I51A 3Q8LA 2R7MA 4YMIA 1W5FA 2NSHA 3MJ4A 1ONNA 1ZD4A 5U4QA 4GKAA 1KK2A 1KYTA 1NSFA 1BRMA 1GO2A 2R62A 2V65A 1GTRA 1II0A 3D0RA 3B6IA 2PMCA 4QRDA 3NVKI 2AMFA 2P8JA 2V7VA 1Z5WA 2V55B 3PL1A 1NQAO 2HIHA 3FMVA 1Q5PA 1Q7CA 2IZ0A 2WKSA 3EWNA 3FCXA 5G4LA 5HS6A 3U80A 1N0IA 1T9GS 3V46A 4PPFA 1USUA 3R3JA 1V5GA 5CPBA 4EF5A 4DLKA 5KU7A 3CVWA 1KQPA 2XRFA 4RVOA 5E2BA 5CH8A 4TS3A 3RVJA 3RSSA 2V7UA 4HG2A 3DM9B 2FG6C 5LXTB 3DHNA 4WLUA 1K8RA 1SY7A 3K30A 4QO8A 4AZ3B 2V97A 2OSBA 5LA6F 3VDXA 2WVGA 3VJMA 1GKUB 3CSSA 3G5TA 4Z9YA 1T5IA 4NFHA 4YQEA 1UKBA 4EB0A 3JQ7B 5CLHA 3PRHA 3T95A 2VPIA 4RTPA 3TTWA 3PNLA 3BTVA 4KNYA 2XE6A 4G5FA 4G5GA 3ZIAA 2FR8C 3VMMA 1ZONA 5K6TA 1NWCA 3NV9A 1JIXA 4DN6A 4MV8A 1K88A 2QP9X 2R1ZA 3L0DA 3MF4A 4C01A 2EF1A 1PGJA 4RGYA 4F97A 3DLIA 3NDPA 5DRTA 2HF7A 2UV8A 4FHCA 2GJ4A 4AFNA 4PG5A 1ZMTA 2Z57A 3SIRA 1NPDA 2X6TA 2QPOA 2Z0MA 1NJ1A 3C39A 3KYIB 4TYYA 1YZYA 2IY9A 1P9NA 4BU0A 3ENQA 2YZNA 5BSKA 2Y66A 4Y7DA 4OHYA 3TQSA 1YDMA 4DV6B 1TK9A 1LI4A 2FPIA 2YJ5A 2ZJ6A 1XYVA 3QEKA 4HZUB 4UNPA 1V0JA 3RT7A 1K3TA 4Q3LA 4V0ME 3SYRA 5EL0A 4YJDA 4DJFC 4WASA 5IXJA 5KIAA 4GYYA 3RU2A 3PE4A 4GNKA 1QP7A 1D2CA 2ODEA 1X13A 1X70A 3JD3A 1JB9A 1I3CA 1KDPA 1WUKS 1B14A 3CS3A 4IAOA 1QO7A 5B64A 3HP1A 5EWMA 1W75A 1P44A 4HB2A 1DHRA 1IDOA 3HADA 4PV7A 2C4KA 3R20A 1P9RA 2UZ1B 3NM4A 1F6DA 1R88A 1WULS 2CJYA 2RJNA 3I2JA 4IIEA 4AM8A 2G76A 4P7FA 1X1DA 5D7NA 2E5FA 2CHGA 1ZKMA 4G85A 4BC1A 5IT0A 5C80A 3JAKA 3G8AA 3UT6A 4JKOA 1DELA 1O2DA 4NFLA 2IH4A 1FSFA 3NGMA 2VH5R 1C7RA 2W48A 3TEJA 3C7AA 1PF7E 2Y1CA 3FW1A 5DNWA 4C4PA 1PD0A 1CQXA 2B0JA 3DBIA 4FZJA 3N6XA 4C0QC 3HVKA 1S1MA 1Y80A 2HBQA 3NZEA 2YDYA 1WB4A 4NBNA 5LOVB 2JEOA 4G0ZA 2G9VA 2C9CA 2F3TA 4FGWA 4OI0A 1NI3A 1DIHA 4NCHA 2RAVA 1PGPA 4FCTA 5EE0A 3ZBTA 4BNHA 4EUEA 5JSZA 1R16A 2QRGA 4Q3BA 1C7QA 1NZDA 1T2UA 2P3LA 2QW0X 2XDQA 3H2BA 2JCSA 4Z1MD 5BSWA 3I64A 2ZM6B 1C1DA 1JS1X 2B8JA 2B6NA 3KPVA 3KPUA 3KKLA 3ZWBA 2ZUUA 4QYTA 5E7QA 5BYAA 3IL2A 4TQGA 1EP3B 3N6VA 1AKVA 5D51S 5KHAA 4UEOA 3KAQA 4PG7A 1CNFA 2AN3A 3DL2A 3EVNA 4L4ZA 4EB3A 2Q6VA 3C3BA 4S35A 2FYTA 1R12A 3DLHA 4LE0A 1RJFA 2BHSA 3ZWAA 1E6UA 3D6MA 3MMSA 3KRTA 1ABEA 4H1VA 5BP7A 2COUA 2DCUA 2BFFB 2R1VA 3JQCA 2X0FA 1RQNA 4B4VA 3ACCA 4NNPA 4P3PA 3NHWA 4KYIB 1JKJB 3W4JA 4JLDA 3K70B 4NY1A 5HKOA 2D4HA 1QAMA 2QTZA 2VWHA 2ZKIA 4JP5A 4NYIQ 4UVGA 1KFBB 4K2AA 5AK3A 1K97A 4H60A 4TKUA 4F6CA 5EMMA 1AT1A 1U1CA 5DXFA 1YV9A 3W77A 2RKOA 1H42A 2QRKA 3GCWA 4C0WA 1OB5A 1QO9A 4JXZA 1E4VA 3KT8A 3NHKA 5GONB 1SIOA 1FA9A 1X8KA 1RHKA 2Q28A 2PGOA 1G60A 1WDWB 2NV2B 4C43A 2HJ9A 4LBWA 3SM3A 3G9TA 4CG3A 3WQHA 3IT3A 1U28C 3CLHA 3E3OA 4CKEB 5TGTA 1YB1A 3TFQA 3WP1B 1N1DA 1HZZA 1UBJS 1G291 1OFUA 2ID8A 2QJRA 2VPQA 4GLJA 1Z39A 2ZJ8A 1JQ5A 3OD1A 4JSTA 3RUEA 2OHIA 4Z0PA 3U7FB 4C4ZA 4EDFA 2XWPA 4BN0A 5K4GA 4DSUA 2WV9A 1P1JA 4JQOA 4RHCA 4WFKA 3KEOA 3DP7A 5EWLA 3IUQA 3LFHA 1N2SA 5GAJA 1L4HA 3DDNA 4GR9A 4L7QA 1Z6XA 2NNLD 2PLRA 3QTLA 2GJ8A 3D59A 4B6PA 3WDLA 3OX4A 2GN6A 2J5QA 3QW4B 4K3VA 2ZQ5A 4A2QA 4WK2B 2BTQB 4O2LA 4OG2A 2JI8A 4IIVA 4E33A 1HX7A 4MR7B 4LY6A 2B2NA 2LGJA 1KDYA 3C6QA 1I2AA 1FMJA 1THGA 3E3AA 1FP7A 5J5VA 2FEAA 1EX7A 3RTGA 3E22B 3W04A 1J20A 2JJ2A 1DJOA 1PFWA 4LQLA 4RA9B 2C9YA 2J5XA 3FLAA 4EHNA 4NFSA 4LSGA 3HB0A 2OBLA 2FI1A 1T3GA 4KIJA 1Z29A 3KZMA 1P7YA 3L0OA 1X87A 1EFUA 4CBVA 4URZR 4EG6A 4P0PB 1CJSA 1P2DA 2ZRBA 3CY6A 2O1EA 2BMVA 3CWCA 3HJRA 3PR1A 1ZH8A 4Z0HO 3L6RA 2JGNA 2WPDA 3NG1A 3WFJA 2CLMB 5G4KB 4KR2A 4QPCA 1R8QA 3GT3A 4NARA 4C7OB 4OYHA 1WY7A 1X8LA 2D0IA 3FI9A 4QUHA 1W6UA 4F2WA 4LRXA 4YPOA 3RVOA 1GKKA 4AJHA 5L3QA 1M6VA 2CHVA 2AC4A 3WIDA 4N01A 2H4FA 5HK8A 5P8WA 2PUEA 1UH5A 2C4VA 2AMLA 1Z2AA 2CJFA 1QDLB 2XDWA 1G8YA 4KPUB 1P2TA 4YT5A 5A3RA 1E7RA 2I4MA 1ZNYA 2A2ZA 2I6TA 2LXNA 3BIJA 4J0KA 4S1PA 2Y1XA 4UTXA 3W8NA 3WLKX 2IEGA 3Q8MA 5FX2A 1YRHA 4EBBA 4UTRA 3DHEA 5FTWA 3IQEA 3TDNA 1HSZA 1ECPA 3MS7A 3F6EX 4RD0A 2QL9A 4JVSB 1PS0A 1G5TA 2OBNA 4DMHA 2JCGA 1FQJA 3IVGA 3IHTA 3DD5A 4NULA 1JHUA 3C8UA 3R6LA 2D7DA 4MWZA 4ZO9A 3M6UA 1FIUA 1R6UA 3HXLA 1EUQA 3MRXA 1HL7A 2FGJA 3Q9UA 4XR9A 5KCMA 2C2YA 1RHMA 3AF1A 3G1UA 2G9RA 3H9GA 4WJKB 3PFHA 2ZSAA 3DZKA 2XHEA 4ZU1X 5KDLA 3T5MA 1HURA 1M2EA 2BDUA 2EFDB 1EK0A 3UV6A 3B1ZA 4M8NE 2UUOA 3P19A 4TVOA 1ZD8A 4Y6QA 3CF4G 3ZTTA 4ZOQI 4Q05A 4C7OA 1JEDA 3H65A 2ADFA 4EOGA 2FN4A 4KE6A 5BQ3A 4RD6A 3TIIA 3FOCA 3L6EA 4JGBA 1E2QA 1CZHA 4DXDA 1GDTA 4B9AA 3ESXA 4J7CA 3FTCA 5ALNA 3ZHXA 1YDHA 2HGZA 3AX6A 3Q3HA 1XZHA 1FDRA 3QVWA 5DASA 3R9XB 2OKGA 2VATA 3OLXA 1LLUA 1CRWG 2AOTA 2F1RA 2AC2A 2DUUA 2HWXA 1HLDA 4X61A 1DKNA 1JSXA 2HCTA 2NXWA 1G5PA 5JEEA 1T0HB 3LS2A 1G17A 2F17A 2QL6A 4OAQA 5J58A 2CDCA 4U6NA 4BP1A 4EG0A 3BYZA 2DB3A 2WT4A 2E3JA 2UUPA 3AW8A 4WXRA 2FUKA 3B82A 5GM1A 5AJTA 2B83A 4MWBA 3RTCA 5TPWB 4NMXB 3RLFA 3QKUA 4B6QA 3QVKA 2BGLA 5DGXA 2EJVA 4MK4A 4ZCSA 2JLUA 3WGGA 5C7OO 4V3CA 4KXFB 3ROKA 1KAHA 4Q48A 3FPCA 4KITB 2CJWB 1TM5E 3JD4A 2OXEA 4Q1DA 5HZGA 2J7PA 2QTLA 2HFKA 5I9SA 1JFFB 1YL6A 1CJKC 2WF5A 4YUAA 4OQNA 4E3ZA 3KUCA 3EFEA 3DFMA 4U7GA 4B85A 5FBHA 3R5FA 4TL8A 3RYIA 3GT7A 4E07A 3PE6A 4NYMR 1GSAA 1WLSA 2YY6A 2HH9A 2FRDA 4RTLA 5EJFA 3PGA1 1Z5PA 2VAPA 5AICA 3NB0A