1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
5EWJB 3RVKA 1YMVA 4WXEA 1VKRA 4H3KB 5CHYA 3RVNA 1ABEA 1BA2A 1JFVA 1YVUA 1DC7A 2HJ9A 3MF4A 3UKJA 5T3YA 1ZH2A 3CZCA 5DTEA 3EQ2A 5TPZD 1C0EA 2VUIB 4HYEA 1USIA 1F51E 3NNSA 4EYQA 1E6MA 1EWKA 1NATA 3DGFC 1SRRA 1HEYA 4RK6A 3FFTA 5ABPA 1ZDMA 2WJWA 3MYYA 3E3MA 2QVGA 2E4YA 5IUJC 3VNAA 1D4ZA 4ZMSA 5C5EA 2IKSA 4KVFA 4F11A 3LUAA 1QQBA 5JS1A 5JNUA 1KGSA 2MYTA 1Z13A 5IC5A 2L17A 3M9XA 2QW1A 3RVMA 3C97A 5E3JA 1JWLA 2BGGA 4MYRA 1Z25A 3LUHA 2F8TA 3KYIB 4IGAA 3R0JA 1BVHA 2FW0A 1DCMA 4IMIB 4IILA 3DZDA 5JNWA 1DZ3A 4RXUA 3CKMA 2FLKA 2N9UA 3TX6A 1RPJA 4MR9A 1JFTA 4FE7A 4H3HB 2QR3A 3CG4A 3T8YA 4F06A 4TLMB 1DBWA 5B3JC 4NCBA 2PL1A 3C3KA 5DLEA 4RK1A 5IEJA 1SXIA 3BILA 3HDGA 1NXVA 1PEAA 2HSGA 5EWLA 4ETIA 1ZHHA 4ZMRA 3HM9A 1R8JA 4LX8A 2QZJA 3A0RB 1TM2A 2IPAB 3EODA 5KC9A 3ROFA 3HDVA 5IBQA 2HQRA 2JVKA 2WMYA 4DQDA 2PUAA 4KQCA 1YMUA 3B2NA 5TPWA 5TPZA 1QQAA 1ISSA 1TJYA 4MS4B 2PLNA 1K68A 1YTUA 4D6XA 3D02A 3O1IC 3RVOA 1Z18A 1MAVA 3BRSA 1QKKA 4F12A 1T34A 2M98A 3I42A 2JRLA 3FFXA 1NY5A 2GBPA 3OLXA 3QEMA 4G86A 3N6VA 4EGSA 4WT7A 2JK1A 1D5WA 3KG2A 1U8TA 2KYRA 2RDMA 3C3WA 3RVPA 1NXPA 1DG9A 5KQMA 3OMWA 5IUNC 3NHMA 3OQNA 2JVIA 5EWMA 2XDYA 2PUFA 4XFKA 2MYUA 2PMCA 2YHAA 1QO0D 3LUCA 1ZH4A 3QX8A 1XHFA 1JDPA 5GOTA 5IUKC 1B00A 2L2QA 1TLFA 4ML3A 3ROTA 2FMIA 4Z4GA 4YO7A 2QSJA 4RS3A 4WUTA 1JDNA 1IIBA 3RVQA 2PUGA 3NBMA 4IRXA 3CHYA 4XAQA 3VNBA 3OQOA 3LUKA 3H5WA 4PE5B 4L4UA 4LDAA 2GX6A 3IPCA 4JASB 5CNMA 1H9CA 5HSGA 3CS3A 3H75A 2R25B 1MB3A 1JF8A 3MIZA 2OQRA 4RZSA 5PNTA 2CWDA 3H6GA 2WRZA 4MQFA 4RSMA 3RH0A 3D8UA 3N75A 3URMA 1CYEA 3QLUC 3CTPA 4KV7A 3GT7A 4YRZA 4KFCA 3HS3A 1ZITA 3N0RA 1DJMA 3S99A 3HCWA 3OQMA 4RK7A 1QP7A 1JBEA 4MQEA 3T6KA 2F8SA 1QP4A 4KPYA 2NZUG 3LUFA 3MM4A 2NUBA 5EWJA 1NXTA 4HNSA 1BAPA 3H5OA 4MPTA 1FFSA 4KRFA 2FEKA 2V0NA 3L6UA 4OLAA 1QMPA 4UHJA 5FWXB 1BDHA 2IOYA 4CBVA 1MIHA 3O21A 1QO0A 1P8AA 2JCGA 4W5RA 4EYOA 4YR7A 3IP5A 2PE5A 3GL9A 4YP9A 1YIOA 4KNYA 2FLWA 4N41A 4B09A 5KC8A 5DGCA 1Z16A 3JTEA 4OBBA 3T38A 4F8JA 1Z12A 1P6QA 4LDZA 9ABPA 5CNIA 3O75A 4PYRA 3QELB 3M6MD 5JNVA 5TQ0B 4EYKA 3CFYA 4OLBA 3N0WA 4D74A 2LIVA 3K4HA 2FTKE 1ZVVA 1J56A 2GKGA 3O2QB 2JBAB 4LZLA 4QYWA 5C5CA 3CG0A 2GI4A 3CNBA 3KKEA 8ABPA 1AB6A 3SG0A 1P2FA 3GV0A 1JL3A 3HSYA 4N76A 1VRVA 2FKAA 5HKOA 2AYZA 1RXIA 4JP1A 2PUDA 2JB9A 1A04A 2IPNA 1ISRA 4YCSA 4HNQA 2LUOA 2IPMA 3LTEA 1USKA 3QLVC 3SAJA 2FVYA 4RY0A 5JS2A 3SQNA 3DBIA 3Q7SA 2E4XA 1USGA 3LKBA 2FMKA 5KQGA 4HNRA 4JB2A 4IF4A 3H6HA 2RJNA 4OG2A 4RDCA 2GWRA 2E4WA 3CZ5A 4RWEA 1KRWA 1OXKB 2Q5CA 4EY3A 1SXGA 4N03A 2MYPA 4O1IA 1JLKA 3A0UA 4O5AA 7ABPA 3UUGA 2LPMA 3OM1A 4Q7EA 5BQ3A 3N8IA 5JNTA 2FEPA 3O2SB 3IP9A 5IX8A 4MS4A 2NT3A 4E7PA 3KS9A 3Q41A 1JYFA 3GBVA 1LBIA 5IEBA 4ETMA 3QK7A 4H60A 3C6QA 2LP4Y 1M2EA 1BDIA 4W5OA 3OO1A 1D1PA 1F4VA 1U2PA 2ID7A 4OATA 5TQ2A 4EVSA 1QP0A 4XXHA 3TMYA 3HK2A 2CHEA 4MAAA 1GUBA 4IMJB 1GUDA 4G0XA 2X7XA 2ZAYA 3OLYA 2IPLA 2PKXA 3GBPA 5FBKA 2I6FA 4WWHA 3RQIA 1ZGZA 4RY9A 3H5TA 4KREA 2B1JA 3EQZA 4GPAA 2JVJA 3OMXA 3TO5A 1JYEA 1S8NA 3QX9A 1XWWA 1K66A 3MMNA 5B3JA 4JB0A 3BREA 2O20A 4S04A 3EULA 4JAVC 4MR8B 5IULC 3NHZA 1LK0A 1FFWA 1CHNA 2MSWA 4LE0A 4Z9AA 2YHBA 3ILHA 5T7BA 3MQ4A 4P1ZA 1D2AA 1WETA 4G0ZA 5JNRA 3F7NA 3FGZA 1EWVA 5HM6A 2ID9A 1L5ZA 1FSPA 2PL9A 4Z4CA 1DCKA 1Z2EA 1I3CA 2IYNA 3Q9SA 1FFGA 2PUCA 3HVRA 3E61A 2P9HA 4G0YA 1ZGGA 2FMFA 3Q7RA 2HQOA 4G0PA 3HEBA 1SXHA 4M88A 1QNLA 3LKVA 2MYNA 2NT4A 1JH9A 1ZY2A 4ZPJA 4W5NA 4EVRA 3H1GA 1JFSA 1W9HA 2L19A 1W25A 2R4QA 4WXMA 4XLTA 3GA5A 3EDCA 2PJUA 4KK3A 1C4WA 1YK0A 3OLZA 5KI6A 2CHFA 2PAFA 3Q15C 4EVQA 4G97A 1SD5A 5FWXA 4Z0NA 4MS3B 2FXIA 4Z4EA 1ABFA 1BDJA 1E6KA 3OLVA 1PNTA 2A9OA 2FN9A 3BRQA 3ILYA 3KSMA 3SNKA 4ZYLA 5JNSA 2E4ZA 3KYJB 3CU5A 4L85A 4ZJPA 1MVOA 1NXXA 3IPAA 3G85A 2FEWB 4DN6A 3TB6A 4MRMB 3KLNA 3GWGA 1YK1A 4ETNA 3HUUA 1DRKA 4QYMA 1EHCA 3A10A 5GQSA 3QLUA 1EAYA 1ZN2A 4MLDA 1U2QA 4N0PA 4OTZA 4RKQA 3QELA 6ABPA 3F73A 3KLOA 2TMYA 3O1JC 2W42A 5TQ0A 4MS1B 5CNKA 3H5LA 1KRXA 2J48A 2A9QA 4RKRA 3I45A 1XHEA 1RXEA 2JBAA 5FWYB 4MR7B 3P9YA 2MSKA 4DADA 2QVCA 1DBQA 2H3HA 1DRJA 3IDOA 1DCFA 3JVDA 2LBPA 4Z4HA 4S05A 1RZRD 1A2OA 1P6UA 1NXWA 3JVIA 1UDRA 1Y1LA 3LUJA 3I5AA 2VK2A 4XARA 3T95A 4LE1A 4RXTA 4YV7A 3EJWA 4W5QA 2AYXA 3CLKA 5CNJA 2WWVD 1U0SY 5KQLA 1ZESA 4KZKA 1M2FA 4NCAA 4QPJC 4RV5A 1U04A 3EGCA 3H5VA 2RGYA 4N0QA 1PUXA 1L5YA 2FSPA 3EAFA 1FQWA 2VYCA 3F6CA 1GCAA 3IP6A 2P4UA 4YGXB 4YS6A 3MA0A 4PZ0A 4MLCA 1M5TA 3O74A 1EWTA 2WY2D 2FQWA 1LJUA 4RXMA 1NXSA 4YLEA 5HQJA 1PHRA 3LUDA 3O1HB 4Z4IA 4Q6WA 2FN8A 2HQBA 2L18A 2FQXA 4W5TA 1DBPA 1NXOA 1Z15A 3QEKA 2IDMA 3N53A 4KMRA 1NTRA 3OLWA 3H5IA 1DP4A 3A3KA 4TMYA 3HUTA 5DCLA 1PNRA 2R47A 2OENG 2H0AA 2QV0A 2B4AA 1CEYA 1GCGA 3I09A 3RVSA 2A9PA 2M1ZA 3HO1A 3KTOA 4N47A 4LE2A 4EUKA 2R48A 1Z17A 2PUBA 1E6LA 5KWSA 4G0OA 3W9SA 3JPWA 3HZHA 3RVJA 1APBA 3DLBA 3HJFA 4MR9B 2RJOA 3QLVA 3H1FA 1RZRA 2E4UA 5KQPA 4E7OA 3OO0A 1JX6A 4MR8A 1KMIY 4RK0A 2MSLA 1A0OA 1LBHA 1MB0A 4RK5A 5EWLB 4P98A 4YWHA 5BRAA 1EFAA 2NZVG 3N0XA 4KQ9A 1VPWA 3JY6A 2E4VA 2FMHA 2WB4A 4RY8A 3LFTA 3C3MA 5TPWB 1YS7A 3DGEC 1RNLA 3DLHA 4LRQA 5TE9A 3KHTA 3LUGA 5TQ2B 4NQRA 1Z26A 3NNNA 3HXMA 4EYGA 4RU1A 3TD9A 4MGEA 2A9RA 3OM0A 5FBHA 4KK4A 3CRNA 3KJXA 3QEMB 5I4CA 3Q7TA 4QICA 2QU7A 1JHZA 4FE4A 1TVMA 1OXBB 4Z99A 3SM9A 3BBLA 3JPYA 4Z4FA 5BRJA 4PICA 2DRIA 5EWMB 4O1HA 3FMVA 5F64A 1VLZA 2VUHB 3KCNA 4NV3A 4Q6BA 5TQJA 4GNRA 1M5UA 3LMKA 3GRCA 4TLLB 3RVRA 6CHYA 3M9WA 1PEYA 2WJAA 1TMYA 1QPZA 1DC8A 4XASA 5BR1A 3IP7A 5ED4A 4TN5A 4MS3A 4PEVA 3LOPA 3HV2A 4JA2A 4NICA 3NNDA 3SY8A 4F3TA 3RVLA 1URPA 1LJLA 4JOQA 4UHKA 5DKFA 4MQFB 3JS5A 4MRMA 1ZAYA 3FFWA 1D1QA 1YS6A 4RK4A 4G0MA 5D2CA 3QLTA 4FB4A 3H1EA 4MS1A 3FDFA 4Y9TA 1GLGA 2CD7A 3GYBA 1Z2DA 2HPHA 3G1WA 4Z9BA 4D6YA 3F6PA 3O2JA 4G0QA 4MQEB 3L49A 5FWYA 3K9CA 4MR7A 2ZWMA 4WZZA 3UK0A 2FQYA 2PUEA 1AB5A 1E2BA 2QXYA
chains in the Genus database with same CATH superfamily
3DDWA 3DMHA 4OLHA 3V2UA 5KYXB 1G7TA 1KI9A 3PKIA 1TUGA 4W63A 2Q5EA 4I1OA 1SG9A 2JIZD 2Q2WA 1U28C 3OF5A 3UW1A 5L51A 4AN1A 4ZT5A 2FPGB 1T3ZA 3CEJA 4UMVA 4DSTA 2HU2A 3CZCA 1BW9A 4M0DA 5K0CA 1QPGA 1YS1X 5BWBA 3TGLA 2PXCA 5TPZD 3SD7A 3I3OA 4EITA 5F9HA 4U7PB 1WCWA 2J8ZA 2RHOA 3K5PA 3W1EA 1XPRA 2VRCD 3A2NA 4OP3A 5HTOA 1YVRA 4B6RA 1IXRC 1J2RA 3DBHB 4IEEA 1RWKA 3FG9A 2B25A 2Q5LA 1RCUA 2WR8A 3AFHA 4H7IA 1AA6A 2GPBA 2NG1A 1U5CA 2OORA 3P0RA 2WKSA 2V5UA 5TMDA 4JIMA 2E4YA 3QYFA 2RGCA 4IJ6A 2IKSA 2RKWA 4G37A 1IQRA 1AQLA 2VDOB 3OG9A 4CQMA 5BN3B 4CEJA 1VA4A 2F3QA 3K1AA 2O2SA 2WJYA 4XPZA 3OFKA 1YU6A 5IC5A 3GF4A 3ZWQA 4QG3A 2UUAB 1H2HA 3NB0A 1CQWA 4JDUA 2P79A 5E3JA 1I4OA 2G1JA 2VSFA 4QKQA 4G1MB 3DAHA 1E5DA 4KLRA 2R8PA 3JYHA 4XDGA 3WGMA 1UBRS 3E5NA 5BYJA 1VECA 1TAHA 3KVYA 1MDFA 3R20A 4S1NA 4CLRA 1HQYE 4MAFA 3PQ6A 5E3IA 1DKPA 2J67A 2E1RA 3AHIA 2P30A 4U7HA 2SKCA 4QWWA 4B2PA 3HDHA 5JDCA 4FI3F 4KEAA 4G5RA 5MN5A 4B3IA 2DSTA 5K0NA 4Q4HB 5EE9A 3FF4A 3WXMA 5ED0A 5ALVA 3O0TA 4Z7OB 1QLHA 1MJHA 1US8A 2X4IA 4KN9S 4KN5A 3C3KA 5JTUA 2QW0X 1CJCA 2HSGA 4TWRA 1QYWA 5LKAA 2A3NA 3QFHA 2JVKA 4Q18A 3CO0S 821PA 2PUAA 1FU8A 4BMYA 3EAQA 3Q12A 4PTZA 3OQ1A 4A6PA 1KU6A 1T9AA 2W4MA 3QMWA 1ZI9A 2OL4A 4Y2QA 3CRRA 3ECCA 1MORA 4Q4AA 4RHXA 1PR3A 4EA9A 3NHYA 3DYIA 3FJOA 4MVJD 2I2AA 2YMMA 1D2RA 3UGTA 4TYNA 1SXJA 2RGXA 2FVXA 2FPIB 4J1NA 3ACDA 3U4QB 2FUCA 3GD5A 1WPRA 3ESYA 3UQYS 4CTJA 4B34A 1PT7A 5ICEA 3MHPA 3PXBA 1NXPA 1G9TA 5DI9A 4IVQA 3TRHA 1DZIA 4I1RA 5H8WA 3WFZA 5EQTA 1VPDA 1HE8B 1QYCA 2X8JB 2ZTSA 1HG0A 5DHTA 4KQWA 1OD6A 3UH1A 1K86A 3O8QA 4MA4A 4NC9A 2NUTB 2Y1WA 1RRFA 4QQFA 2VQ6A 1BEUB 2V58A 2EBFX 2FMIA 3AU8A 3BF8A 4BO4A 2WU3A 3VSAA 3AHGA 5HCNA 1X86B 1Q1BA 1JDNA 4GPZA 1E7QA 1WMEA 3TVTA 1KTIA 3M83A 2HPZA 3MNFA 2G88A 1WCIB 2HPVA 2OHHA 4MAMA 1O95D 4YMUA 1E99A 2CYAA 4GX2A 4OM7A 2YHUA 3K70B 2BEUB 2OUKA 2OGSA 2ZXUA 4AW9A 3CCBA 3B36A 3LQRA 4OFWA 1BE8A 2NVUA 1C9KA 4V3BA 3FDXA 1DQNA 3NC1C 1EDBA 1DEHA 4NBSA 1RPTA 1AXGA 2C2HA 2QVBA 4F4IA 4ARVA 4ZMBA 2RHHA 3OD5A 2JFXA 4ABTA 3PXDA 2LNDA 4J49A 1A88A 1ENZA 2JGDA 4TVKA 5BT8A 5HIAA 1I4TD 3KJNA 3RKUA 4WFIA 1KQGA 2YNMA 4UNQA 4EIWA 1N2CA 2RD2A 3HBJA 4Q4JB 3LQQA 4ZI3A 5ILOA 4UUAA 1UMCB 1CK4A 2P27A 3DDUA 2WUEA 4OUDB 4EW6A 2F55A 1DNPA 2XUJA 1KYYA 1I1OA 3DZJA 1P33A 2SBTA 4X24A 2NZUG 3QPCA 1SBHA 3V7WA 3LP8A 3I62A 4E5SA 4MP8A 4B71A 5F9FA 3AINA 4R6WA 1CU1A 3CEMA 1SBZA 1TYAE 1XK6A 3JZFA 4DGSA 5A3QA 2YFYA 1QX4A 1YJ5A 5AIBA 4N0MA 3DTYA 3LLSA 3OQIB 1BDHA 4MJXA 4ZALA 3OTIA 1TUEA 1N2SA 4KPEC 2QTTA 4R7TA 5FO0A 5C2JB 2KLBA 4PC1A 5BYAA 4KNYA 5C8YA 3S5UA 1GNLA 4ILEA 3DZIA 2JGFA 4B33A 4N4AA 1KETA 5SYAA 3I6BA 2W6MA 4BY9E 2C0QA 4E3ZA 4KBYA 1P0CA 1SHTX 3L4EA 5H82A 3UCXA 1RJWA 5BOVA 4AURA 2IXGA 2C00A 3WL8A 3AL0C 2Q1TA 1W6RA 2H1RA 2NU6A 2H9IA 3VH2A 3BE5A 2F90A 1JE1A 3I1JA 2FTKE 2JHGA 4GAEA 1JU4A 1SOWA 3E70C 4R9VA 4F2DA 1OV6A 1Y6GA 3S2EA 3OPNA 2B4RO 1QIFA 3GRUA 2D1RA 5LDHA 1F7UA 1KPGA 4DQVA 2BGTA 3HSYA 2K87A 2FXVA 2F3UA 3W5CA 4XYMA 3N8HA 3EOZA 2ZVPX 3M4JA 5CCBA 1IQPA 1KJ8A 1KY3A 4LZWA 4Z8XA 1Q1ZA 3AIMA 3RANA 2C4MA 1A04A 3LX8A 4PQRA 1E2LA 1UKAA 1ACMA 1MX1A 2J41A 5BRNA 3ZGXA 1YFZA 1PKEA 4IHAA 4IYJA 4BP8A 2J6IA 1JDZA 5FYDA 4IAOA 5A4IS 1SQSA 3C16C 1BXGA 2G63A 2OY0A 1JHQA 2PWPA 3QJGA 4G5QA 5TR9A 3DNMA 4OHFA 1F2DA 2FMKA 2HDNB 4KGXA 4OQYA 3RUFA 4B81A 3U0VA 4ESEA 4Q7QA 2RJNA 4OG2A 3NTQA 4DWOA 3VR2A 4RH0A 2J59A 3K94A 3G7UA 4IYRA 4N03A 3WL7A 1Y5NA 5JS7A 1NJSA 2DFVA 4QNMA 2FPXA 1L7AA 5BQ3A 5KOJA 1YB1A 2FEPA 1W48A 1YA6A 4TRRA 2JI8A 4U7GA 3N0TA 5AVVA 2AJCA 3P27A 2C29D 2CEKA 3GBVA 2R1ZA 5LPNA 5I5EA 2X6QA 3OO1A 4REQA 3TZLA 1SUEA 1D1PA 1QWSA 2OGUA 3R9WA 2GCPA 3CXUA 3K05A 4QOSA 3ZWMA 2R44A 4OJYA 4HQFA 1VGVA 4HDQB 3V9AA 3C4QA 4EL0A 2FRDA 3BMXA 5FBWB 5LQKA 3FOAA 4GI7A 5ITVA 2A1UA 4R2MA 4Q47A 121PA 4PLPA 2GCEA 1N4DA 3QWHA 4JQCA 1WDTA 2QY9A 4PZAA 1UZMA 4OF4A 4BNUA 2X3FA 4A0RA 2ZPAA 3JWJA 4IF6A 5JQGB 1GR0A 2EKPA 4C0AC 1Z56C 1CIVA 1ATIA 1IOZA 2SNIE 3EVZA 3L40A 2C2GA 4BL5A 4Y6RA 4OHPA 2IEZA 3TDMA 4BO7A 1TB4A 3TF5A 3FGNA 1WUTA 4V2UA 3IO5A 5BV8A 4NBNA 5JQWA 2EL9A 3EXFB 3UYLA 4BO9A 1OMOA 5AW0A 5JXHA 1NLYA 5AW9A 4HEJA 3VZQA 4RBNA 2VSXA 2RONA 3FGZA 3UMFA 5HM6A 2ID9A 3H2BA 3MN1A 1WB5A 4ATNA 2GYWA 3MT9A 4RZUA 5KYTA 3OQHA 2G36A 3IILA 3Q9SA 3PUYA 1RJEA 2I1WA 3HRIA 1AIPA 4FYHA 1X3LA 4G0YA 1Z4KA 4DLZA 5AD1A 3OT5A 1XVVA 4I4NA 1R0CA 2VUTA 3BXFA 1ZGGA 2ZB4A 4ZAWA 1ULSA 3NEPX 3K6JA 4W5JA 5DF1A 4QG7A 1I2CA 2F17A 3LKVA 4U7FA 1RYHA 2CXRA 2GPSA 2NTYC 2Y1DA 3LSTA 5JAOA 4P6VF 3JW8A 2I4RA 4XQGA 3Q3GE 4URZR 5EZYF 3BJMA 4AJ9A 4B6SA 1OX4B 5AJZA 1YJQA 1VCHA 3R3XA 4G1EB 2DTDA 1ECGA 3DKRA 1W25A 1E9AA 2VPYA 5D1NA 2HMSA 4Z9FA 3GXOA 4EG6A 3LLMA 2BPOA 3LF2A 1GRRA 3EVAA 4I19A 4MYDA 1M6NA 4UUMA 1MX5A 1DIBA 2HCBA 3GCXA 4G1FA 1U0JA 3AG6A 3R3WA 2PUTA 3NOQA 5M3BA 1G16A 1X7YB 4IH1A 4JROA 5CG2A 4Z4EA 1AG9A 2WYIA 4OL0A 4A9AA 4DJFC 1CEQA 4Q1AA 2FN9A 1ULAA 1ZUNB 2A94A 4HVCA 5IJZA 3V1TC 3QE0A 4L85A 1U63A 2B8TA 2WTBA 1U2TA 3TB6A 1MXFA 4Z9YA 1L5FA 4QYMA 3IESA 4A1OA 3BGOS 4YVFA 4HL6A 4ZDWA 4MLDA 1W0JD 1G6KA 4ND7A 2Q6IA 4N0PA 1DKLA 4UTOA 3R5FA 2RIPA 4QULA 3EE6A 5D87A 5GVSA 3RADC 3JYLA 2JGMA 1H9AA 5DW0A 4PZEA 3QXCA 3H5AA 3VR0A 4DS3A 3I73A 4CMEA 3QNWA 1R66A 3D6VA 4YJ2F 5HF5A 3DBLA 2D3WA 4M0PA 3GEPA 3H4MA 5ITWA 1RAEA 1PQWA 3AESB 1B3RA 3IDOA 2QR2A 2B7CA 3FMOB 4U39A 4GMKA 3OSZA 3S1AA 2Z56A 3P45A 4DM4A 1M8KA 3KHUA 4UVEA 1KFBB 3WOHA 3NEJA 2L69A 1E20A 1FVHA 1SD2A 5IPFA 1ODTC 4R0NA 2DR0A 1IWOA 2QL7A 4OA8A 5CNJA 2FOIA 1V8BA 4LNAA 5KQLA 1IVYA 3L46A 4FOSA 1UP6A 1WP4A 2VK8A 3IVRA 5F2EA 1EJ0A 3H5VA 1BH2A 2B2CA 2JIRA 1ZIDA 1BHSA 2WHPA 1L5YA 2R86A 2Z95A 4KSBA 1YHNA 4FIDA 10MHA 3Q72A 2Z8YM 2CV2A 1XXHE 4X84A 4RO0A 4V0ME 1UANA 1UBSB 4BO0A 1W76A 4DA6A 1FOEB 2GZSA 2JEZA 2SHKA 3FKQA 3T4UA 4DCMA 1EBUA 2GWHA 4NG4A 4RZIA 2VUSA 1LJUA 2G1AA 2P9GA 2VPIA 3DVLA 4JJFA 4YLEA 1PJZA 4UE6A 4YRSA 2ENUA 3WJ1A 4MV4A 3DAPA 4HDKB 5CJPA 1PYOA 2VSYA 3VDMA 5AM4A 1NXOA 4NU0A 3ZZTA 3JZMA 3H4VA 5KHLB 4M0MA 5K8CA 5ADUS 1DTEA 3G9QA 5J2TB 1ZUD1 2OGTA 3QF7A 2DQSA 3KOOA 1XNRB 2B30A 4ZT2A 1MC1A 1M34A 3KU4A 2R48A 3N2KA 1AKYA 1E6LA 2ZRIA 3OKPA 1C14A 3Q6NA 4OB7A 3JPWA 4B0PA 3OUZA 3V4RA 2YVAA 2J85A 2RHLA 3NAZA 3DULA 4KGDA 4LQCA 3DXFA 3GQBA 2JFZA 4LXQA 1JT9A 5A1JA 2P2SA 5IF9A 2XUGA 5JCOC 1T2DA 3U13A 3OT1B 4RK0A 3ZE1B 5CCXA 5LWQA 4QSHA 2HC9A 2CE2X 3A3NA 4QDUA 3C3BA 1JA1A 3IQHX 4UEWA 4Z0PA 3JY6A 3T52A 2F4NA 1HFJA 4WN9A 3VHRA 5DYYA 2RI0A 5DIFA 3LZCA 5EGSA 1E7RA 2WMNB 2XEDA 3E5MA 3OP4A 1RNLA 4HQKA 2CEAA 4QDOA 2A1TS 4ZZ1A 3D0RA 5TQ2B 3Q1LA 1O94A 1RTTA 1NWCA 4QARA 4AZWA 1YZHA 4C3UA 4EYGA 3HXMA 4IL5A 3OM0A 2V6MA 4M36A 3UOWA 5KTOA 2Q5JA 3U6BA 3KJXA 3LW7A 3K0AB 4MRRA 5LOVF 1A71A 1QORA 3EIXA 4G1UC 4J0JA 2Y0CA 1YJXA 4FE4A 1MMFB 4A0GA 1M67A 2QX6A 5LBTA 2ERCA 2ZUFA 2Y0EA 5C51B 1QIHA 1GVHA 1L5HA 4B6GA 4YALA 1ST3A 4AP5A 5BV1A 3D54D 3JTMA 2CK3D 4BAUA 1BS2A 4MV6A 4X93A 2JJ1D 3FHLA 4OMUA 5EIFA 4E5KA 2AJBA 3DV0B 3KEQA 2PIAA 3RWBA 3MPOA 2ZYUX 2QE7A 3PX7A 2VSNA 1CPYA 3JQ6A 4RD4A 5JXWA 2I2DA 2ZUCA 1UBNA 5K0SA 3HXLA 3RASA 3GIWA 3PUIA 3ENNA 1WXQA 4W6ZA 4BNTA 1I01A 1B26A 1T5IA 2VHCA 5KMGA 1I3OA 4TN5A 3PDWA 1L7QA 4KCGA 1VDZA 2EFCB 1YZVA 2PVPA 3H2ZA 4O4HF 2ZB2A 3HN2A 3KZNA 2I3GA 4QDJA 2Y77A 4CQLB 3M6VA 4OK3A 4PLTA 3B48A 4KTVE 1IEVA 1XRSB 4C2AA 1Z33A 3MGCA 1QIEA 2J3HA 3VYRB 1REQA 3SNHA 2BR3A 1R6BX 1SBQA 2XMCA 2ZK7A 3SJZA 4LY9A 5G4LA 2AFHE 4MPPA 1Z28A 2X1LA 1RI5A 4P31A 4HYQA 5T6MA 3ABOB 3GJTA 1TVKB 2I9KA 1VJ5A 2WPDD 1HWYA 2FUNB 1XLWA 2G7ZA 1J0AA 2Q41A 3LGXA 2GYUA 4GEGA 3D9QX 3PL5A 1P45A 1V16B 2OVBA 4JQYA 4IM7A 4ZVNA 1B73A 1KBOA 3KR1A 4NBUA 3HABA 4OBXA 4PHGA 1ZH8A 2C2BA 4G0QA 3QKRB 1CSEE 4C87A 5C8XA 2CFCA 2R8XA 1VHTA 4LN1A 5FTNA 1IYZA 1I5EA 1I2ZA 4A2QA 1J2EA 3W5HA 5BVHB 1XTTA 3DTNA 5TF0A 1GTSA 1DWOA 3JD0A 1NDHA 2J30A 4IDGA 2PXXA 1YULA 4WZAA 4F7DA 1RKQA 1UIMA 4HUJA 4PLCA 5DBGA 2C31A 5FAKA 4H3KB 1JZQA 3IB6A 3UVEA 1E3IA 3MF4A 4U2DA 3C6KA 1CJKC 1ZOIA 4QJBA 4QXQA 4CWAA 4DW8A 4A15A 4K3VA 1QH1A 1P1CA 4RVDA 3A2KA 3PUJA 1P39A 2R97A 3DOJA 1PP4A 3KWJA 2XX3A 2QZSA 3AETB 3L0ZA 3IR6A 1KZHA 5EIEA 1DADA 4MWOA 1C0KA 3DGFC 1CERA 2HSEA 2IYVA 4NPHA 1UEJA 1G8HA 3WYAA 4EGJA 1G17A 3OEYA 4EDFA 4UMDA 3KE9A 3OETA 2V3WA 3AT1A 4TUYA 4Z9XA 4D3ZA 2PO5A 5DEIA 3MJ4A 2O2CA 2QIPA 2AQKA 2QG4A 4KSYA 1PZEA 4MKIA 4RVGA 3L7KA 4X00A 2WILA 4OQFA 1MT0A 4KG7A 5DHPA 1KGSA 2JLSA 3FAKA 4QU5A 3AM3A 5AKLA 2J9ZB 3WQRA 1C30A 4AKGA 1XGKA 2QX7A 4TM8A 1CDZA 1QGOA 2GD0A 3LUHA 4J0QA 3BJIC 4GSYA 3HACA 1T1JA 2GZDA 3D5EA 2ZXEA 1W1IA 2D54A 5E0OA 4L4SA 1NVUQ 4ZZ2A 5KKAA 1X1SA 5ECYA 3RC8A 4CI0B 3WLJA 1T8PA 3ANNA 3OF3A 2F8MA 4G2NA 4U9HS 1JIJA 3WDSA 3EF3A 3OTWA 3ZKAA 3L02A 3RS9A 3NYWA 2AHRA 4DLLA 4UE3S 1PGPA 2ZYDA 1Q57A 4OXXA 1BEZA 2EQ5A 4U00A 5K4AA 1H2ZA 2GAJA 2VP9A 5CX1B 5DV9A 1E1CB 2FR0A 4O4HA 2NQTA 2BFBB 4Q21A 4WX2B 2J31A 2EGUA 4ZANA 5F1KA 2A4MA 4ZWNA 4RPHA 3REGA 4A10A 5LDDC 4PO1A 1W96A 4R1SA 4ZMRA 3HM9A 4GS5A 5TIIA 4P80A 2QZJA 3A0RB 2AQHA 2IPAB 4Q0MA 4C3VA 1ANKA 4HQOA 2ACVA 3A6FA 5IC6A 3QBTA 4MTLA 3UUWA 4Q16A 4DQDA 3B2NA 5KHOC 1S2GA 1O8BA 1C0PA 3OCJA 3UKDA 4D80A 2D1TA 1YTUA 3QX3A 3RVOA 3L1JA 5LQAA 1MAVA 3UIEA 1QKKA 3UN1A 1YONA 1LI4A 4U5QA 1I14A 1T34A 2Y9MB 2YJ5A 2G9ZA 2GJ4A 3AEYA 2R00A 3BDIA 3WKDA 3U6KA 2QLLA 4F5DA 2BIFA 4G86A 2B4YA 1ETUA 1ZMXA 2H5EA 4TKZA 4JP3A 1I1QB 1SUBA 1GPAA 1BXZA 3TZKA 1V2GA 3IPYA 3VDNB 4LDPA 1XNHA 2ZRQA 1N9GA 1U2SA 2UZ1B 5EWMA 3UAZA 3UNXA 4E46A 1N3IA 3F4KA 4W1PA 1HZZA 3SU8A 1XHFA 2EGHA 3ZJVA 2L2QA 1M83A 1TLFA 2H06A 2TMGA 3LG2A 2C0CA 3PENA 4ML3A 1G42A 1XN1A 2YRXA 4QU0A 3REFA 3V1NA 4BLOA 2QAJA 2FEOA 4HY3A 4LHSA 5CLIA 5ESWA 1B0UA 4C78A 1P0PA 1UT5A 4JXKA 4R2WA 1Q1QA 5CIWA 5C4GB 4ME6A 5FNVF 4WESA 4PHTA 4JYCA 1B7GO 1MOZA 5E6SA 1KVQA 3N7UA 1J6UA 2FA9A 3KYCA 3FTCA 1Q7RA 5CNMA 5CT5A 3ZXYA 1GCIA 1A9YA 2QP9X 4I9NA 4JASB 4P7KA 3VPCA 4RPIA 3CX3A 1IZZA 4B3JA 3T41A 4NENA 1OFGA 2OQ2A 1OASA 3DBRB 5CXQA 1Q0HA 2CWDA 3QUTA 3WRWA 4I50B 1W73A 2QJTA 3V8VA 2ONZA 1II8B 3E9NA 3ZYZA 3LZDA 1BG6A 1F2TA 2WM2A 3GGDA 3VX3A 2DTEA 3PJGA 4DHEA 4L1KA 5YASA 3IQDB 1IBMB 3HS3A 3DVAA 3KTAB 4HXEB 1W19A 4NBLA 3UB2A 1IN7A 4AKSA 2N0SA 4QHYA 4B43A 2GRAA 2C1ZA 2PX5A 4LYDA 3MWJA 1VA5A 4MQEA 1LW7A 1CBUA 3EZLA 1Z36A 4YJFA 3V7YA 4CN9A 3AR6A 4CLOA 1IVNA 4DLNA 2F7SA 3MSXA 1WNFA 1N92A 1AVTA 3BUSA 5IAEA 2ZUVA 2NUBA 4B8YA 4RJLA 2W2QA 3LECA 1B23P 3LCUA 1IRXA 4I9FA 1LX7A 2AR0A 1CR4A 1BN7A 4GRDA 4R1UA 1FDTA 5BW6B 5C7IO 5A5VA 4O4IF 3JASB 2DUUA 4XX1A 1QO0A 1I6LA 3HBAA 4R9SA 4DMHA 4YR7A 1PHPA 1XZBA 3RD5A 1GNSA 3RREA 2B61A 3O4JA 3X1MA 3F8WA 2QD3A 3KKMA 4FFBB 1QHYA 5ALOA 1KMMA 4ZTBA 5REQA 1DXQA 2ENWA 3EY9A 4YQFA 1I36A 3DQPA 3QE9Y 2EKQA 1YR3A 4K9LA 2A67A 3JQ7A 1A3CA 3LM8A 2RKBA 4LDZA 3SVZA 1AGNA 4IX9A 4TM7A 3M6MD 5E9AA 5LXTB 3O8OA 2XV1A 4BX9A 2UZ3A 4OXIA 3RRJA 1PCXA 2HSZA 2JA1A 2NXEA 2PZMA 2VTDA 4WE3A 1UFVA 3OQ6A 4EA6A 1O97D 4NZMA 4Z0HO 2BCJQ 4U2FA 2LIVA 5F5LA 3M82A 3K4HA 3T7AA 1QCDA 1KOGA 2PEZA 5L6MB 2DB3A 3VR5D 2VYFA 1B0AA 2ZRKA 1LD3A 3C74A 2C99A 2JI4A 3LCJA 3T3MB 1UKBA 1WU7A 4L4XA 3PQCA 1FA9A 1NW7A 1P31A 5A06A 3F74A 3UXEA 3EDYA 5D51S 3GU3A 1NR1A 1XYVA 4YAOA 3WNBA 2PX3A 1K08A 3UTDA 3DOOA 1T3HA 3V55A 4ZYUA 1U28A 4HAYA 5D1HA 2WQZA 2A7QA 4O08A 1FMJA 4R9NA 1ID8A 1C9MA 3RG2A 2ROQA 1XCPA 3BICA 3RRMA 4M21A 2CDAA 4D9NA 3DKVA 5KX5A 4CU2A 1H4QA 4HWSA 3C7KA 5EXPA 3YASA 4KZPA 1T4GA 4LZOA 2H51A 1Z4NA 1J9GA 3PSAA 2NNLD 3LXXA 4XIJA 2C42A 3PDHA 4YUWA 1RAFA 2NZJA 2WFMA 1JLKA 3ELDA 4O1IA 4DWJA 4O63O 3G02A 4Q7EA 4I3HA 3GG9A 2IJGX 2ZBDA 3HMQA 2C7BA 1IJKA 1MOQA 2UVQA 2JL1A 5IX8A 3HB4X 2JGAA 2J5QA 4HNHA 1KZYC 4ZVOA 1IY2A 2GVDC 4UULA 1V26A 3WWOA 1P7CA 1E3EA 2IEGA 3OX1A 1KPIA 4IMPA 2YRFA 2H52A 4M9SA 4KO2S 4NOJA 3ZC3A 2W6IA 3RRBA 1DKNA 3L82B 5KYGA 1QP0A 1DELA 3HK2A 2CJXA 1A1SA 4DRYA 1NSYA 2O2HA 1GGVA 4E30A 2YINC 1TADA 4ARAA 4LI0A 4UM8B 2OCGA 1QFMA 2IZZA 1W75A 3DM5A 4RA6B 3W04A 4L08A 4H1TA 1MB2A 4RF3A 5DBOA 5HA5A 2Z09A 1H42A 1T9ZA 1KGDA 3AVWA 1XWWA 3HJNA 4CKBA 1SB9A 3RAGA 1G21A 1XDUA 2I33A 4B87A 1WS6A 3PNLA 1IM8A 1VBKA 2N1MA 2ZUWA 4FBGA 4I55B 4TPKA 5EAIA 1LLFA 1IZYA 4LTNA 1FMLA 5LC1A 1B76A 5CA0F 1HX7A 3D4LA 4HDMB 4KTTE 4AZ0B 3DAOA 4QQNA 4EJFA 3P9RA 3W2HA 3R0VA 5TS3A 2G4CA 4KGZA 3DD5A 3ISVA 1QONA 1YQXA 4JGBA 1QFXA 1EXMA 3I4CA 3NDJA 1YV9A 4GOOD 4HKTA 4A2CA 3S0JA 1DCKA 2IXBA 2QNIA 3LYHA 3M4XA 4V0KA 2BGNA 3E61A 4C4XA 1B6SA 3M5CA 3H2JA 4DG5A 2FW7A 1II9A 1YB4A 2PMBA 2R79A 4NJEA 4C88A 2KSQA 2KX7A 2X7JA 2X5OA 2GEUA 4IGKA 3OY7A 4DZZA 3KKQA 1RYEA 4ZYXA 4GSLA 4NARA 3AFIA 3W2EA 2CB0A 2W2LA 4RVUA 3LVRE 5I9SA 3L1UA 3SZLA 3VKFA 3BS4A 5GJVC 2P9FA 3C5WP 2BM0A 2G5TA 2HPAA 4V02A 4X1OA 3SOPA 3N8DA 4MV7A 4RQBA 2JLAA 1C4WA 3OLZA 1D5CA 3VVLA 5DCWA 3T06B 5EYPB 2AG6A 2XB9A 3HCAA 4PHFA 1PNTA 2CD9A 3BG5A 3BRQA 1HI9A 2NN3C 3ILYA 3P9IA 4MDHA 4UUQA 3C8MA 2E4ZA 3D4PA 3CGWA 1NVGA 3LE8A 3PQ8A 4DT1B 3NHRA 2QN8A 1MVOA 4HWRA 2MOKA 1FEZA 4D4HA 2R6CA 4M53A 1AF4A 2HWUA 3MELA 3BFVA 1E0AA 3QQPA 2BF7A 2PSDA 5IABA 4H7JA 4L3OA 2ZPUA 5K0LA 3VYVA 1H0HA 2WD9A 1U2QA 5T6BA 2PUWA 1A1VA 4EF4A 1GG9A 1USUA 4YXWD 3W5SA 1M5RA 1EFRD 5L7WA 3IT1A 1XL1A 1NLFA 3PF8A 4O02B 3TTSA 4DHWA 1NWHA 4WBNF 4HZGA 2FK7A 3CONA 2C95A 4NP6A 5CEFA 1PWHA 2XAAA 4QM7A 1I2AA 1L5GB 4C0WA 1L7MA 2GRUA 5LMCA 2DPXA 2X0IA 4IPTA 4L28A 5FWYB 3STVA 4BP1A 4ZOEA 5GINE 3FYUC 4FMDB 1J8MF 3PHBE 3LQ4A 4QTTB 4LHEA 4O3MA 3QBVA 2JLQA 2PSJA 1ACLA 3DE1X 3G59A 3H87A 2FJ0A 4JDPA 2VIIA 4V39A 4ZJUA 1NVDA 1N1EA 3OCUA 4LJKA 1R18A 3BRWA 2NSHA 2QUHA 2CXUA 1YZQA 3ETJA 4LJ9A 5J63A 4ZV9A 5K1ZA 3TLMA 3PL1A 4DJDC 1EZZA 1VL0A 3F3MA 1ZESA 4KXNA 5E8RA 1OPXA 3RNOA 1O58A 4PSVA 1DUSA 4N0QA 2AN9A 1E2GA 1TQDA 2VHUA 5JASA 2X9VA 4LQDA 3QM1A 2ATXA 3NZEA 1W52X 3QFSA 1PJQA 1QGAA 4J0IA 2OC4A 3JQBC 2NPFA 3RKSA 2VYCA 3I53A 1T2AA 3HP4A 4GDMA 4YGXB 2F62A 3FVQA 3LBFA 2EKDA 4HVLA 5I9IA 2FEAA 1MQSA 2OFPA 4RVSA 2OKGA 3U37A 4PYJA 3BMOB 4JSYA 3RIMA 5IXJA 4BJ1A 4L8WB 3SZOA 5B53A 1OJ7A 3W8EA 3B6MA 3T0GA 2W4QA 1CIPA 3NT5A 4KR6A 3VMMA 4JV5B 1Q92A 3EWSA 3R3HA 2FQXA 5A3RA 2AEFA 4I4CA 2JCYA 3IMCA 2AR7A 3PPIA 4R40A 4TV8F 4X91A 4BNLA 2QUJA 4C6TA 5K0JA 1D2MA 1PV2A 4UAJA 4C6RA 2D1SA 2DULA 4IDQA 1CEYA 3KOMA 4M83A 3QPWA 2FHPA 3M4NA 1AV6A 3Q3EA 3M5PA 4HAWA 1XK7A 4I6GA 5BV0A 3GC6A 3WYNA 2ZSDA 3AJ9A 4D0LB 2RJOA 4O2AF 1Y4SA 3GLGE 3ADOA 4DR7B 4L02A 4ACAA 1RI1A 2X9QA 1OWMA 1H23A 3VV2A 2R1TB 1ORTA 4NRDA 1ISPA 3W7VA 2AJLI 1XUOA 3ONFA 4ZQFA 4D3YA 4JFRA 4KQ9A 3PRYA 4YAKA 3P2IA 3VBCA 1K8YB 2E4VA 3LDGA 1QYIA 4A6DA 5JAUA 4S1PA 1YVEI 3MAGA 2NSYA 1VQ1A 5TPWB 2R65A 3A32A 3FVVA 3K0HA 3MOGA 4J0DA 1MOSA 1A9OA 5L40A 3E27A 4ZP1A 5TE9A 2C20A 3UJDA 4KPUA 3KZKA 3VU0A 2Z6VA 4S1TA 1YBVA 1IXKA 3I6MA 3SYLA 2BEJA 5BSGA 2Y76A 1QRUA 4WBNA 1AK2A 1MO6A 1Q16A 2DPLA 3LX6A 1VJ1A 2WC1A 1NXQA 2HCRA 3WQBA 4CTOA 1N7IA 1SC6A 2OO5C 4IDFA 2QU7A 4NULA 1TVMA 3SM9A 5C7YA 3CZ4A 5CXSA 3THYB 4Z4FA 2FGJA 1EQ2A 4R2LA 3E7FA 4PZCA 4RLFA 5TB5A 3H2KA 1MBZA 1X9IA 3N70A 3THWA 4XD2A 3WMGA 4IXMA 4OY3A 3SBXA 4FR2A 5JALA 2ZRPA 5G2OA 3RBXA 4IIBA 5ISMA 3KEOA 4M46A 1SEVA 3M9WA 2VYQA 2X22A 4EHJA 5EQJB 1Y82A 1AXRA 4IIYA 1AHIA 1D1SA 3AEKA 3OIUA 2B6NA 2XE6A 4L2IB 3KT6A 3A1EA 3GFQA 5ESXA 3ZDZB 4FCCA 2XE8A 1YDHA 2Q29A 3IPLA 1LV8A 1OIWA 4GZ3A 4E88A 2K7FA 2UYQA 2PWYA 4X60A 1BS9A 1Q91A 2QL5A 4CM8A 2I9PA 1ITZA 1YH3A 3BMNA 4HVTA 1BQEA 4CG1A 2YV5A 3UJAA 1ULHA 4N0DA 3RRXA 2VDRB 2BGMA 1D1QA 3TTWA 1K7YA 3QF4B 1EWRA 1O95C 3JQ8B 1RE1A 5U4XA 3IFSA 4RMNA 4RFSA 3D0KA 5C3UA 3IDFA 4Q1BA 3JR3A 5HYVA 4M9QA 1E62A 2TMKA 1KQPA 4HSGA 4ZVLA 2OHIA 1R4MB 1NW5A 3FDFA 4PSDA 4FSHA 3L1VA 1LLUA 4CQJA 1J1UA 2O5EA 3AR8A 2VSOA 2ORIA 3LRPA 4O0MA 1JU9A 4D6YA 6REQA 1PGOA 1R6UA 3GA7A 3M1IA 3CNOA 3OFNA 3RHZA 5AOCA 1PQPA 3AR7A 3SYNA 1EA7A 2I8AA 1D1TA 4MI1A 5DH9A 1AHNA 2XDQA 2JDIA 1Y4ZA 4NYJR 3TI9A 2QW8A 1K2WA 2DBVO 1Z0KA 4CNBA 3GLFE 1UK8A 4PYLA 5B6JA 4MQLA 2CV1A 3HUDA 2A5JA 8MHTA 2G07A 4DF3A 1XFDA 1L4YA 2O8BB 3VNSA 2P4QA 3O7WA 3V4PB 2ID4A 5FPQA 1M1YA 3PC8A 6NULA 1Z8FA 3RWMB 1F51E 1W9MA 3QVTA 3UA3A 3MEQA 1RYMA 3OFVA 4DIUA 2G83A 4XVHA 5IVPA 2C97A 4TS9A 1L8AA 1NC1A 2PH5A 3DAFA 5IUJC 2WU0A 3PVSA 1OLOA 4JXXA 3P9QA 2HI0A 3LUAA 3HN7A 4Y2VA 2ZQYA 1Z8HA 2OYRA 3W06A 2YJNA 4E12A 4XDYA 1ZUWA 2XT9A 5FR1A 2R5FA 1ISIA 1UZUA 1ZOPA 2N42A 2X9GA 2VHWA 3JWEA 1BGVA 5ECGC 5J58A 1G2QA 1VPEA 3CRW1 1M3SA 2P4SA 1X8LA 3CVOA 3MLAA 2A5LA 2G9NA 2IHVA 1GFIA 4HPXB 1JHOA 3RS4A 4ZARA 4B35A 3L3BA 2YY7A 4G1CA 1YRYE 2COKA 4WZ6A 2P11A 3AP3A 3JVUA 5KU7A 2ZSAA 3HYRA 3D3NA 3EC1A 4WK6A 1DJLA 2IUEA 4WERA 4AK9A 3O4IA 3SSAA 4M8IA 4OGFA 2E49A 4WADA 1EP9A 1CS0A 2H59A 3NALA 2JW5A 1BX1A 3SBEA 3U4CA 3E53A 4BO8A 2D7DA 2ODEA 4Q4CA 5K09A 4IIFA 5T4BA 4X61A 4TV9F 4M6WB 5EJ2A 1XEXB 2JFVA 1TLTA 4LX8A 2D0PB 1NMSA 2B35A 2NV2B 4ZAVA 2UYGA 4RX1A 5KC9A 1O0CA 3K70C 2WF9A 2C4NA 1DHTA 4MQ5A 4CCAA 1GDTA 4UFOA 4GP9A 1A9TA 2QU8A 3IEUA 2B99A 1QH9A 4UDNA 3KBBA 1NZFA 2VF2A 2WKPA 3HR7A 5DX8A 1PLKA 5FA5A 2XVZA 4URUR 1DDOA 4GHWA 4V0SA 5H3LA 5T3UA 5I45A 4F2GA 4CMIA 1N3BA 4MHTA 1DKUA 3GBSA 3OLXA 4YCJA 1OI2A 2YHIA 3ZJYA 2OCLA 1VXOA 3MAAC 2B4KA 2G1UA 1G18A 2NO9A 2NAPA 4N5NA 4OHUA 4QUBA 3WLKX 4DY6A 1ZI8A 4ACBA 3UMVA 2YHAA 1QRTA 3LC7O 2GH1A 2PRSA 2ZBRA 3GLGA 3M6AA 1PW5A 1PD1A 4WXRA 2PS0A 5IUKC 2Z57A 1W4BA 1KZ6A 3EZYA 3OIFA 4KX5A 4PLVA 5EVJA 3TNYA 1N5DA 1PL6A 5JCOA 3IEMA 1OUMA 2I99A 3MWEA 4UUNA 3A4NA 4NOLA 1XKQA 3K7EA 1GLVA 4DIOA 5FUBA 2PUGA 1G3RA 1Z5PA 2OMKA 3FWYA 3GFFA 3IKJA 3OQOA 2LVBA 2OD7A 1MH9A 1SUFA 3E7DA 3JAKA 3RC7A 1ZBDA 3VAYA 1GN9A 5K0EA 3HBMA 1FNCA 4X90A 4EHNA 4FFRA 2X41A 4Y9RA 3RT7A 5BUCA 1XO1A 3BF7A 4AJLA 1HYBA 3IUEA 4DLPA 3L8HA 1MX3A 2O23A 3DVQX 1KEWA 1QAQA 2AI1A 4RGBA 2W5UA 5TV2A 1OILA 1RWNA 1HDXA 4I36A 1CY6A 2AE1A 4P5PA 3FROA 3TCKA 3HKCA 1EFTA 2QMHA 2DTXA 1P1JA 3HDQA 3KHSA 4Q1DA 5KTYA 1E1DA 1MC5A 2PH3A 3VOBA 3I04M 2AJTA 2UXDB 3L7OA 1RCTE 3G8CA 2R7LA 2XBLA 3OZXA 3ESQA 3EUWA 5HK9A 2J5BA 1O5IA 5ALZA 3BB4A 5ARDA 5EWJA 5BSEA 1NXTA 1G3MA 2FUEA 2R11A 3O8BA 1A7JA 1ULUA 1ZVQA 4ARCA 1KH3A 2EJCA 3LBAA 2CMKA 3SXJA 1KY2A 3E4CA 2Q3CA 3LCCA 1JLMA 1BQ4A 1NW8A 2IOYA 4RHYA 2WE8A 3GARA 4P7JA 2AG5A 4X7MA 5KWEA 4LFCB 4EYOA 2K6GA 1JSXA 4RPKA 3D6AA 1CE8A 5HKLA 3M6FA 4HBGA 3MMZA 1BX0A 1SUDA 1AE1A 3L6OO 2IXFA 3AXSA 3LA8A 4Y6QA 4LECA 4X6LA 2RMKA 3FR7A 3RS5A 4GLFA 2GVNA 3FLEA 3ZU6A 3T38A 2XKBA 3EVFA 3PU6A 1I2BA 4CM9D 2GK7A 3W79A 9ABPA 4MUNA 4M0EA 1GL3A 2VJNA 5G1PA 1VE1A 2OFXA 3RFUA 2VDKB 4BO1A 1Z4MA 4ZU3A 4A6XA 2XT6A 3EIFA 4DSNA 4IP0A 4IQ0A 4LCJA 5JRDS 4GLOA 3PQDA 1TYCA 4FW9A 5C5CA 1P1IA 1S6YA 2DECA 3ZWYA 2A9JA 4CR8A 1JL3A 3BQNB 3MD0A 4NFHA 3SQLA 3TZ6A 3GRFA 1NQ5A 3K9WA 4GDFA 1J21A 1WXHA 3SBOA 2EJWA 3G89A 1I3MA 2WUFA 4UHHA 1SOMA 4S12A 2PD3A 1M73E 3B9BA 1I9CA 1JP7A 1RXUA 2F3RA 3FKSA 5AM5A 3TEJA 4H31A 5JPCA 3KFLA 3SAJA 1XCMA 2C82A 2DWPA 3C1UA 3U56A 1YCHA 5AO9A 1MENA 1Z7WA 3H1AA 2W2KA 2YWCA 4GIBA 5EEHA 2AZDA 4R8RA 5ALJA 3IULA 4TMZA 5IAGA 5LWHA 2ERXA 4R2JA 2Q5IA 1X1CA 5EJGA 5TEWA 3VZCA 3KQOA 3NXKA 4BLUA 5G53C 3L7LA 3N8IA 3KKLA 2O2YA 3HHPA 1YKSA 2XB6A 3LL4A 2V4ZA 4AMUA 4R31A 5EKXA 2V5VA 4BKRA 2E5WA 1CD5A 3WRXC 4BQNA 2CLFB 4QIHA 1EFCA 1LI5A 4Y1GA 4QQRA 3GRAA 4W5OA 4F1WA 3R3JA 1U5AA 4LWQA 3K15A 3K5IA 4NCJA 5HOEA 1WF6A 1JQ5A 4K40A 1NBWB 1WDLA 3FNQA 3OOSA 2ZAYA 4L8FA 2DE0X 1KIAA 3Q0EA 4G5GA 4PZUA 2PN1A 5FFNA 3WE7A 3FVRA 3ZDEA 3NX4A 4LJYA 3BH0A 2C61A 1Y9EA 3N3BC 3OWHA 4XYBA 1Z07A 4IWYA 4FYPA 5DBEX 1JYEA 4YDQA 3PLRA 5HP4A 3A6KA 3ZIDA 2ZXFA 4LGVA 4V0OA 3TE7A 2J0VA 4JB0A 3LRXA 3V32A 2P7HA 3HCOA 2WZBA 3PFKA 4JAVC 4HAIA 4M8NE 1KOFA 1ZKDA 1H1LA 4RAOA 4RETA 5JCJA 5JNLA 2Z1NA 1Z0ZA 2FNAA 4X71A 7REQB 1JR4A 4BLTA 5BW4A 2VP2A 1VIVA 1FMCA 3LWBA 3MQ4A 4ZYZA 2GKOA 2VJMB 5FQNA 4IIJB 3ENKA 2H4YA 2AGVA 5FV7A 1RW4A 2OLEA 4U2BA 3WGZA 3L7BA 4NXNB 3PCTA 4RVFA 4URHA 1TQ4A 4K6CA 4QUJA 4RIHA 2PQ6A 5BOSA 1T36B 2IPOA 4YDRA 1HO3A 1RACA 3SHQA 2HLNA 3CISA 2O1SA 4Z4CA 3DTVB 1W4RA 1Z2EA 1RWMA 2E2WA 2WIFA 3BBPA 2O54A 2P9HA 2O05A 1G8JA 3CLSC 3HB7A 1JRLA 1RC1A 1GNPA 1NA5A 4KWCA 3OZDA 4ZT3A 3HJHA 1T2NA 2CC2A 3C8UA 2EZ8A 3FPKA 3HKBA 4D98A 3AVTA 3TG2A 2WLSA 4JJIA 1GG5A 2W70A 1ESNA 1OT5A 4C4ZA 3FSRA 5CM9C 2ZLBA 4F9TA 5EHNA 4MCHA 1S3GA 1UDCA 2MMCA 4MRAA 5LYYA 2CHGA 2R4QA 3NONA 3W6PA 2POCA 4CV2A 4POOA 5BSFA 4OJNA 2PFKA 3IKVA 3KXIA 2XMQA 1E77A 1RC0A 4CIDA 4HEA1 2IP1A 1OXSC 3RTAA 2CHFA 2PAFA 2KE5A 1KS9A 1PR6A 3MJVA 4TRJA 3ZWNA 4OX9B 3E35A 3R5HA 4S35A 3KSMA 3P94A 4DV4B 3WDLA 2CVQA 1VHJA 3KYJB 4JJ6A 5HRUA 3QVOA 4AXXA 3MJHA 3ZBPA 1EE9A 5IANA 3U44A 3HPRA 5CYOA 2YKGA 1NRIA 3G85A 2BFDB 3K0FB 1YRWA 1IY1A 1ZLXA 2EIHA 4DN6A 2JZCA 1VMKA 3DFMA 5D6OA 3WFIA 4MV9A 4XCVA 4K6FA 5DXAA 2UV8A 4PGMA 1XMQB 2NYVA 4H7DA 1BH6A 1VLMA 2Y05A 2ZB8A 3KVRA 1FP4B 5B2ZA 6ABPA 5BV2P 3T7TA 2ZRDA 3OJOA 4RLHA 4EB6A 3QVUA 1PK7A 3B6JA 4QRIA 3N2NA 3WSWA 2JBAA 4DRXB 3HJRA 4ZTZB 1OLUA 3NBZC 4JT4A 4G0UA 1DIGA 1V8FA 1VP3A 2HZBA 3G17A 4P53A 3WWEA 5IARA 5D01A 4HDSA 2CNDA 1LRKA 1DDIA 1H2XA 1U99A 1VL8A 1WSWA 1QRDA 3D4IA 3LDUA 4G84A 3FIJA 4OD0A 3SEQA 3DBOB 3UMCA 1SXJE 1FFXB 4KJXA 3R77A 5K3OA 4Q19A 1NAHA 2VYVA 2Q6LA 4D3DA 1LS6A 3PGMA 2WWVD 1FFCA 5ENZA 5EJMA 3CZQA 3SKXA 3Q3HA 2V1UA 4AIRA 3P5SA 4BNGA 3T0IA 1PLLA 1FX0A 2V1XA 2VJOA 3SMVA 2CVFA 3GELA 2GEKA 1WB4A 4AF6A 1I5OA 1Q1GA 1QE5A 1RYYA 4FC6A 3U40A 3UHPA 3BT7A 1SVLA 4EENA 4X3CA 1TMGE 3F6CA 3IP6A 4EO7A 1BS1A 3DTVD 4Y2RA 2PS1A 2ASVA 2J3LA 1I4LD 2IWHA 2VHQA 4EI2A 1R6XA 1SWWA 3MLBA 3IR7A 3UV6A 4YV2A 4ND5A 1O77A 4B46A 4NU8X 3SBDA 5HQ3A 3OE5A 2ZE5A 5FRDA 3GUHA 4J29A 1EDZA 2M1XA 5HEKA 4JLOA 4IZ6A 4NG5A 1NHGA 4Q7KA 1O6GA 3ZV3A 1NT2A 3LY8A 4FB5A 5HJEA 4FR0A 3TGWA 1KI4A 2HA2A 2YXLA 4XSHA 1VKOA 4HEA6 3ANSA 1BKSB 2I1LA 3MERA 4HB0A 5CH5A 3RK0A 1AU9A 3KL4A 1D6MA 3WK4A 3PQ5A 1Y4DE 3B85A 3GVXA 4XGRA 1PBNA 2PGNA 4TMVA 1QFJA 2PR7A 5J4HA 1MNAA 1Z17A 2BFCA 3NRJA 1FXWF 2QUBA 5CHEA 4RD6A 4TT3D 3G2IA 3KZXA 2DPHA 2H8KA 4HRAA 4QDTA 2IU3A 1N2CE 1KIFA 3ECSA 1T5BA 1KXJA 3PUXA 2E9SA 1O6FA 2C9ZA 5I9LA 1RM3A 1C3EA 3AB7A 3EVEA 4UEQA 4UASA 4TKUB 4E3WA 3RIHA 4RK5A 5F7JA 2ZJZA 4QUEA 1D2NA 1HEIA 3SF8A 3ZI7A 4HLQB 3WGQA 1FK8A 1HEUA 2FG7C 2WWGA 4JODA 4D44A 3R8CA 4OIFA 4UFNA 3WNCA 3K0BA 1E4EA 2PT7A 2ZGVA 2YBEA 1RKBA 2HCTA 3UMMA 3KR0A 2VP3A 3E9RA 1KVSA 1C7JA 4NE9A 2Y71A 3IXMA 5TT1A 3U3JA 4NJMA 2A9RA 2ZTVA 4KVAA 4D9EA 3SJAA 6GPBA 3W5BA 2NXJA 2GZ3A 3WNVA 3ZVNA 4I81A 3GMSA 3WHIA 1WXWA 4RNDB 4YY3B 1QHSA 4LJ7A 1MAAA 2FWRA 4OBEA 4NATA 4F6LA 4Y9UA 1JLSA 3I39X 4TSFD 4WZBA 4G4SO 4HV4A 4IICA 4ZZ3A 2IPXA 2VI5A 1R0RE 2UXBB 1WOMA 3LT0A 4EDHA 2D5AA 2GD6A 3H2YA 5K3SA 1PQYA 4E11A 1VMDA 1HLPA 3IQEA 3I5XA 2XODA 3T5PA 1BWRA 2FR8C 1KO5A 1NYQA 2X7HA 4DUGD 3C45A 3HCFA 3WGOA 4RD1A 5IKMA 1D4OA 3OQPA 3P4UA 3RPEA 1MCZA 2YRWA 5B1SA 2GA9A 4OHRA 4Z3KA 1IBKB 2GEVA 1P75A 2FYTA 3K16A 1VI5A 2FPUA 4MS3A 4YJHB 2D2EA 2G28A 3FSGD 4C3ZA 3VV3A 4YI3A 3CWZA 1QVZA 4G8CA 1JQBA 4MNTA 1BKYA 1NX9A 1DIOB 1JH8A 2VWQA 1CUHA 1NBHA 2C9BA 3OX2A 2AF4C 5FEMA 2AZTA 3QUAA 5TS2A 2VNKA 1DO2A 3HNOA 3DWIA 1E2QA 4MUYA 4AM8A 1TCUA 2QJRA 1JQAA 3E9QA 5LQRA 3LHFA 1RXYA 4KYVA 3P19A 3QVMA 2GRJA 1IAVA 3PIRA 1QTRA 1E7SA 2H18A 5CT9A 5G0VA 3VOAA 4IH9A 3SX4A 5LVAA 5A5DA 3Q3VA 4CCYB 2IUTA 4MR7A 3TM5A 1KEKA 4QO7A 5A5GA 3OOHA 2RAFA 4PX9A 4AJ1A 4IKOA 2DLDA 3GROA 4D8VA 3ANYB 5DHFA 4EKGA 1AB5A 3GEEA 4KW7A 1XCLA 5IFKA 1A4IA 1KO7A 1YU9A 2HCJB 3EH2A 1C3OB 5HJ7A 3O8NA 1WZEA 5IJWA 3AUYA 2GARA 3EF1A 4OU4A 1GQRA 1Q0SA 2PQ0A 4I9UA 1YVUA 2ODNA 2IY7A 3ENZA 3L05A 5CAEB 1KEEB 1AO3A 3FCCA 4LVUA 4S2UA 4LKRA 2ZDHA 2EWWA 2IYXA 4Y30A 3X43A 2BYTA 2A5FA 3K09C 2V6GA 2FG5A 3KUXA 4FILA 3VR4D 2BFAA 4A27A 2BFPA 2Y99A 4BFYA 3FLAA 1RJ9A 2OZEA 1G2IA 3NNSA 3OVMA 4FX5A 4GBJA 3BGWA 1SKQA 1ZICA 2AFRA 3TRIA 4CDMA 2V6IA 3R75A 1KO1A 2G5CA 2PT6A 3ZY5A 4OAOA 4TXMA 2AX4A 4ZZIA 1P0MA 1U90A 4NLLA 3CTMA 3GAAA 4OIMA 2QVGA 4Y0AA 4CCWA 3F1KA 4XX0B 3G5LA 3MQFA 3E4DA 1V9SA 3E82A 3H8JA 4UDYX 4AJIA 5IXYA 3FPCA 4CUKA 5B6IA 1UKCA 2HTFA 3LCMA 3O83A 1SMKA 1EX7A 4DBLE 2WD7A 3M9XA 2GD2A 2IF2A 3HCBA 3IUJA 3NWOA 4II7A 1UH5A 1MKYA 1X13A 1XQVA 3H13A 3LT1A 4WNYA 5E2BA 2OA0A 3RWOA 1V39A 1Z68A 4BIIA 4MYRA 4WECA 3FYUA 4BV3A 1CQJB 1QCYA 3D1VA 2CNWA 1BQ3A 1O97C 1DFIA 1J9EA 2A9KA 3F5MA 3TW0A 1N2BA 2RIRA 3VR1A 3G9UA 3LCVB 3TSAA 1FLNA 2E89A 2QJWA 1V5IA 4TTJA 1ZM9A 2X9LA 2EDCA 1H22A 3TX6A 2YN4A 2BUAA 3BMCA 2QR3A 3CG4A 2A86A 4LIPD 1ETHA 5B3JC 1XIVA 1KEZA 5BQOA 3B3JA 5EPEA 1USVA 2O8VA 4BUJA 5DLEA 2GXSA 3C48A 3HZRA 2O7QA 3QP9A 4NKRA 2B5VA 3JQBA 1BSVA 2JIZA 3BX1A 2BGIA 3DHYA 1UDWA 2QLFA 1BJTA 1BCSA 1H6AA 3EUAA 3ROFA 3NEYA 5IBQA 4D97A 5LQDA 2IZ7A 4DA4A 5GONF 4V1CI 2QSYA 4E5UA 1BE1A 4TZ0A 5TPZA 5T4EA 3WJAA 2R7KA 2ZYTX 3TSCA 1QQAA 4L78A 5JH7B 2WT9A 2VRCA 1GY8A 3PWSA 4J7AA 4D9BA 1WXDA 4EPVA 4S2EA 1QLWA 2IU0A 3WC4A 5JDIC 3EC7A 2AD5A 3OQVA 4PXSA 2RGBA 2GBPA 1K97A 2IX9A 4G67A 3U81A 3RUIA 2WU8A 3GNSA 4MB6A 4H3SA 1Z0JA 3RSCA 3WHKA 1GNTA 4N82A 4DQLA 1HYHA 1NT4A 2CNOA 2Q0HA 1CQIA 3T9CA 1KYVA 4J0KA 1HGXA 1PJTA 1QOPB 4B76A 1OAOC 1G9SA 4YCDA 1JEJA 1F3OA 3LUCA 4QNRA 2Q6OA 3GZNB 2WKWA 3D31A 3WWDA 2VZLA 4O4LA 4FS8A 1HT3A 2I3AA 2GNOA 2JHAA 4N6GA 3WBJA 2OCKA 1JIXA 4CGYA 5IN4A 4JJ4A 1THGA 3LY9A 4WAUA 4WUTA 5B3AA 4JZYA 5DWQA 3STUA 2GN2A 1WHTB 3VKGA 5HRCA 2Y3IA 3EPJA 1FJGB 4RKYA 1FFAA 5FBZA 1Y8RA 3RS8A 4BQIA 2A3RA 1BJRE 2HZ7A 1AS0A 5ER6A 1UMKA 3UMJA 3X1YA 3PUHA 3JALB 3Q2OA 3PWTA 3THXB 3A2MA 2W8BB 2HIMA 4PG4A 3TLGA 1ODKA 3CLTD 1JUDA 1NQUA 5K3CA 5TJHA 3KKOA 3S8MA 4COKA 3BTOA 3O92A 5L4SA 4RSMA 4L5YA 3OURA 2PRZA 3W77A 421PA 1WULS 3G2KA 3CTPA 3GP5A 2R8OA 1R10A 4EUSA 2AC4A 3SQOA 4E14A 4GOMD 3Q7PA 1A7UA 4GZ6A 2OO5A 3KQSA 1MABA 2ZPTX 4OCZA 4CKEA 3R7BA 4MRPA 4QUKA 5JYEA 4CF4A 1ZNWA 2XNJA 4EG4A 1WU8A 5BPFA 3DKKA 4MI3A 5K3FB 3RQSA 5AVWA 1AURA 1U7ZA 2RHRA 2VBIA 3K53A 4MZXA 1GPMA 1JBEA 1PFVA 4GOLD 4MVJA 4JHXA 3T6KA 5AK6A 4ZIRB 2ZJ2A 1FW6A 3NM4A 3RUPA 2I5PO 1I8TA 2V7XA 4LDRA 1V6CA 2BH9A 3AHDA 5DLDA 5KYXA 3K0KA 2VSQA 2ERYA 3NBFA 4ZVPA 4B5KA 4MDEA 4W5HA 4FUTA 1SQ0A 5CDYA 4UHJA 2Z6UA 1DTWB 1Y5MA 1X15A 2I4NA 2X76A 2FPGA 2XJ4A 3DSRA 2RH8A 1Y48E 3AM1A 1M34E 3PYXA 5EVCA 2Y0BA 4KODA 1SHJA 4J9VA 1NOJA 4ZU1X 3FM9A 2R6FA 5AW5A 4EO9A 3DBHA 4ZO8A 2V9CA 2P6RA 4XRRA 1BCRB 3S55A 4B82A 1Q7GA 2IIVA 2OCIA 2OEPA 3AERB 4QGFA 1O95A 1T1SA 4L6IA 1CVLA 5CNIA 4P33A 1WXEA 4NZYA 2QB5A 5I9TA 5CLJA 5KTMA 2YOGA 3EZXA 3DT9A 3H2HA 4C21A 3NBAA 5BN3A 2M9MA 4M9ZA 2X0KA 1Q83A 4XTCS 2FQQA 2AMVA 5C1IA 2JLBA 2NO7A 4WDRA 1E6CA 4HRVA 1CUSA 1T8RA 3A1CA 1XDSA 1IB0A 4N8DA 4XB6B 2YXEA 5IT5A 1KVTA 2JG3A 4X8HA 3EPHA 3E23A 5G0SA 5T4FA 1UUFA 3PDIB 1CUUA 2JB9A 1TTHA 2WA1A 1Q7TA 4N5DA 1E0KA 4R9RA 1J5EB 4LJLA 4HXYA 4CF6A 2IF0A 4DMFA 2IHJA 1Y42X 3T3OA 5JS2A 2OAGA 3FOWA 1NSFA 4XM0A 4A4DA 1HV8A 1FFDA 3L7YA 4KSCA 5EMNA 1LDNA 4HFJA 2YZ7A 2A1IA 1GQFA 4AJHA 1N1GA 1OZAA 2YWDA 4PR3A 3C39A 3CZ5A 3N8KA 2PGOA 2QLTA 5FI5A 1LX6A 4D79A 4Q7JB 4YROA 2WVHA 2C1EA 3GLKA 4DVGA 4EW2A 1RRVA 1LEHA 4IOJA 2QGFA 4YNBA 2CUTA 2IZ5A 5JNTA 1T8TA 3A6JA 3EMKA 3DLCA 3ENVA 4LEIA 4ZDIA 1TZMA 3NTUA 3NASA 5ELLA 2DFPA 4GR4A 3D7RA 4D82A 2X2PA 2X2EA 5IHXA 2LP4Y 4R1LA 3WLSA 4CM1A 1XBTA 3BXXA 1BDIA 2C94A 3NW9A 4W8HA 1NFRA 4G4IA 1G6HA 1NRWA 2FPIA 3JAWB 3V4SA 4KAAA 4PAOA 4R54A 1LC3A 3U4QA 2XUZA 4UTXA 4ZAFA 5LZ2A 1XMOB 1LBSA 5K3AA 2PKXA 4JA0A 4S0XA 4YP1A 3NTVA 2IU4A 1ZBQA 4NEGA 4X1YB 4UM9B 2PWBA 4RY9A 3RQIA 4D5GA 4OSPA 2X8JA 3W6ZA 4M1EA 1OX6A 4G1VA 5H4GA 3H99A 521PA 3FPBA 1N2HA 2NUTA 3N3AC 1JHMA 1E2UA 1K66A 3Q88A 3PE3A 2RARA 1PNQA 3PS9A 3ID6C 1E1MA 2AC2A 3EFHA 2OBFA 4RHEA 4TGLA 3SC2B 2ZRJA 4P86A 4S04A 1X38A 4JMLA 3WYBA 3ZXIA 2FR1A 2IU6A 1YZYA 5KO2A 5JC1A 4WZAE 1WCIA 4DCNA 4P1ZA 3GEMA 3SC3A 2BEUA 3T5MA 3GUCA 3ECAA 4CDNA 3AY3A 3SIXA 1DAKA 2CMDA 1DLIA 4GXRA 1XZJA 3LVFO 1K8ZB 5DTQA 5T41A 2R6AA 5CD9A 4LBYA 3EYAA 1SZPA 2JGKA 2Z9BA 2R8EA 3L6BA 2MHCA 2WQ6A 1KJZA 4NX2A 4R3WA 1DKMA 3M8KA 2VPPA 4FINA 4I5IA 3GLRA 2PUCA 4AIIA 4AJPA 3KQHA 1DOAA 4TMTA 1CP3A 1FB5A 5LCXA 1QS0B 1UPFA 1V48A 2V4MA 1V1MA 4PRLA 1DVRA 1R8YA 1PWZA 3E81A 1XT6A 4BV2A 4M88A 4YJ3B 1BDMA 2I34A 3CXRA 4Q4JA 5HQTA 1NL3A 3IE0A 1UMCA 1LVUA 2H2AA 2G8LA 4OUDA 3ZQJA 2HIGA 4AQ7A 4C4SA 3I76A 3TOZA 4BBAA 3GFRA 5FAXA 2SICE 4JJ8A 1FNBA 3RE1A 4KAJA 3WMXA 1ZIOA 1Z0IA 3GA5A 2XD4A 4B9AA 2OM6A 1AUVA 2X2FA 1KAQA 2IYTA 1CUIA 3OZCA 1XU9A 5FLKA 3VOSA 3UPUA 1E3DA 5LD2B 3AVYA 5KI6A 2H17A 2WG2A 3DDCA 3EFBA 3BB3A 3OQIA 1AX9A 2C03A 3ZCXA 5LA6F 3EZ9A 1ZOOA 3Q87B 2QZ4A 3NBUA 3UJ7A 1K4KA 3ODGA 1QJ4A 5CFOA 1QOQB 2CF5A 2HNBA 5I4IA 3DNFA 4EY5A 3OIYA 1VSVA 1QBGA 5KTPA 2YWRA 1G98A 4Q9JA 4K6KA 3E8MA 1IPHA 1JE0A 2NQ8A 3KXDA 4TTSA 2AOVA 1ADGA 2QI9F 1BD4A 1U2RA 2Z4RA 1PLJA 1DEOA 5E2AA 1WL8A 2LCIA 2ORVA 4BJHB 2O2EA 3QVWA 1CZOA 1ZWKA 1W5BA 3H5LA 3QKSB 5DNCA 2J48A 4INAA 3X2EA 1VCNA 4EFKA 3O6VA 3DV9A 4JQSA 1DS6A 1TIPA 4RKRA 1PL0A 2XUAA 5BORA 5JSUA 3BSFA 3R24A 4H17A 3F67A 2XRMA 1A7KA 3ABSB 3K1JA 4TL7A 1Y1RA 1ZSNA 2QVCA 2EQAA 4P5DA 1JR3E 4CLHA 1CTQA 4CL0A 1XZKA 1A2OA 3D6NB 4IV8A 4RUKA 4U2KA 2ODAA 3FE2A 2XI4A 5ILQA 2HF7A 3VVBA 1MDBA 3ZDDA 2BFMA 1WIWA 1GUAA 4URVR 1EXNA 3RGGA 5AMXA 1WM1A 2Z83A 2P3SA 4PRKA 4AF8A 3WOVA 1M2FA 3TI7A 1U04A 1R1DA 4DMGA 1RQLA 2VQSA 4HK4A 1PR0A 1VGRA 3EAFA 4GT1A 4P4SB 3B1WA 4QOGA 2VHYA 3JZIA 4Z3DA 1DV2A 3ZQKA 3FCSB 4MIYA 3BVPA 4P4GA 3O26A 2BR5A 3G5MA 1TM3E 2O8NA 4MUAA 3GLSA 3OQJA 3L0PA 3OOEA 4H6WA 4D3XA 2DCMA 3NUQA 3W78A 1UQTA 3SC6A 4M49A 2JAQA 1Z4PX 3EZ6A 3MTQA 4LJAA 5H4HA 4ER0A 3UWOA 4P54A 3AILA 3O1LA 4ENQA 2BCEA 3C4VA 1FUKA 4HO1X 2I4LA 4WEOA 3ZS9A 3LWDA 4XH9B 5KYVA 2WHQA 3HLYA 4XCXA 3I2KA 1PNRA 4MQ6A 4WSOA 1W0JA 1RIFA 3BSSA 4C4RA 4TLCA 2PG3A 2B4AA 3HB1A 2FPMA 4MDYA 1RS0A 3AVVA 2GK3A 2ZAMA 2FP3A 3FVWA 2HDOA 1UXIA 1U6KA 3HHEA 4G5YA 4KRXA 3VKWA 1UADA 1APBA 2GJKA 1N8NA 2Z2KA 2PGXA 1IDOA 2RK3A 1JAYA 2VHVA 4FGUA 5LZ5A 4MLPA 2C9YA 2HYIC 3SVLA 2I62A 2PZKA 1XAGA 2HLPA 5F73A 5JQGA 1WCYA 1NZDA 1Y7LA 2RHJA 3CZRA 4K1XA 4M98A 1FSSA 1U0HC 3SYKA 1CQZA 5TJ9A 3QPBA 1W4ZA 1DAEA 4YWHA 3BCRA 3V4VB 4DEVA 4GC5A 3NGXA 1G38A 3RFXA 3IQXA 1Z7EA 1YOVB 1JKFA 2BEWB 3EXFA 3HC7A 4RMIA 2P4EA 2PV7A 3RC1A 2Z9DA 5IT9A 1TFUA 2AUNA 3DGEC 4IDEA 5EIBD 1DC6A 1SUAA 1MHTA 2IH5A 2F2TA 5KWJA 3LPNA 4YRDA 3WRXA 5CB8A 1VI6A 4KO4S 2ZRBA 3DQZA 3QVGA 1V41E 4KK4A 3WZ2A 1G4HA 3R0XA 2FZKA 5I4CA 3QEOA 4DNOA 1FYEA 1KP2A 2Q9AA 3RU9A 1N5OX 3AZOA 3PUZA 1W87A 3TS1A 4N39A 3N74A 3T7IA 1FBNA 4BNMA 3WAGA 4OJTA 2KS6A 1KYZA 1CB0A 2G3YA 1SCUB 1DQYA 1OX4A 2VUHB 2XE7A 2LR0A 4NCNA 2ZAOA 4Q6BA 4E07A 5KSWB 4D4IA 3CYFA 4ZPXA 1TU3A 1YQGA 1WP9A 4X95A 2Z2ZA 3A4TA 2ECKA 3BZBA 5EXTA 2HQ1A 3W1WA 1GDHA 3K8YA 4Q3NA 3TE6A 2ZWIA 2X58A 4B45A 4YRRA 4GX0A 4M8SA 5AW3A 5LL6P 1OPRA 2BKUA 1UQUA 2I7CA 3DMFA 4C0JA 1V5EA 3AM4A 1A5TA 2IOQA 4QE3A 1X7YA 4IV5A 3S28A 4DA0A 3HVUA 1TKRA 4L75A 4NZ9A 5HJ2A 1ZUNA 2H7CA 2FY8A 1KQNA 5AVXA 4K9DA 1RC8A 3PK0A 4C08A 4DV5B 1W6UA 1EQUA 1LKZA 4P32A 3TMAA 1ES9A 4EEKA 3EVBA 3K8QA 1ZZGA 3OJLA 4IIVA 4PRZA 1JKJB 2B92A 4G36A 5GMOA 5JAMA 3TBHA 2CNLA 5EG5A 4ZAGA 2ZRMA 1NVTA 4TWJA 5I01A 4F9EA 1LC0A 1VLQA 1IJFA 4R1MA 4Y6LA 2VWPA 3F6PA 3O2JA 3V7UA 2DG2A 1BYIA 2JFGA 1U0RA 3CUSA 3QVSA 5DCUA 5ESRA 1N1MA 3ZU4A 1IQUA 3AESA 3LT5A 1T9BA 3DZGA 1IXSB 3UV7A 4WCDA 2NMVA 1YA4A 1ZJZA 1M2JA 2LE0A 2QXYA 3BFPA 3DHVA 3VJKA 5IKXA 3RVKA 5GADl 1K92A 1ZKMA 4B32A 4FYIA 2WFZA 3LRTA 4AMBA 1ZFNA 4BFCA 2C78A 2CK3A 2QIOA 4CMBA 3A9WA 3UXYA 4ZOBA 2JJ1A 3Q40A 4IEFB 3CVYA 4J0HA 2RHCA 1MW9X 2CMGA 2OBYA 3EY4A 1JHRA 4LI3X 5FH9A 1EGQA 3T7SA 4AY6A 5BT9A 1SR8A 2BVNA 1FPQA 1DARA 5JZSA 5GPBA 1Y6RA 5HRAA 3MUNA 2JRCA 4ZYTA 1IBLB 4KFTA 1QTNA 1ODLA 1U1DA 2Q4DA 2ZTHA 1M72A 3F6BX 3TQIA 1ZDMA 2HBQA 2GM9A 3B1FA 4UHDA 2VNHA 1G21E 4A36A 1ZJ5A 5AK4A 3W5JA 2XF2A 3ROEA 1U7TA 1D4ZA 2PSFA 2QROA 3GUYA 3D6HA 5FHRA 5FOWA 3W2IA 4IJKA 1IK4A 5TNXA 3RBAA 2HGSA 4OI4A 3RCBA 3IOCA 4HDKA 3HA2A 5BNZA 2ZRHA 4PGHA 1AS2A 4HRXA 3RUEA 1UMBB 3WB2A 2WNSA 3CKLA 1ZO8A 3DF7A 2BGGA 1K7SN 2BD0A 1V71A 1Z25A 2ECFA 2QXUA 3FDJA 3M6WA 3OLCX 3ZGZA 5J2TA 2WPDA 1GSAA 4PAMA 1WMSA 1U0EA 4B74A 3QVLA 1BVHA 1C7EA 1P4RA 3GFGA 2D5IA 1UBGA 2PSSA 3FTFA 1JTFA 1LPMA 4DVJA 3HVKA 2HYDA 1KF0A 4MIKA 2KPOA 4E15A 5HZMA 1RWPA 3QU2A 3T8YA 4XJTA 4D9MA 1WUYA 2NTNA 1GZSA 5FOUA 4CKWB 1WB6A 4HEQA 4E5MA 4F38A 4EW3A 2C2XA 3DZ8A 3OT1A 2AXEA 1EFHA 1EFLA 1U0LA 3BFKA 1H65A 5DVZA 2OGZA 3MWLA 1YL5A 3GH3A 4MYHA 4JP2A 2D3TA 4HEHA 1GZ5A 3ZDRA 1ORVA 1T9DA 4K6HA 4PCVA 4OMDA 4P4NA 3QY0A 4ZO9A 4XDHA 2SKEA 4V1CB 2QNRA 2NZXA 4PAGA 1ISSA 4AKEA 1FMFA 3LL7A 1QIIA 1YBFA 4X1IB 3EX7C 1GSIA 4MGZR 3UAOA 3AVUA 4F12A 1RHKA 1ULTA 2FZWA 5EZYB 3W8FA 1KI8A 4W8GA 3GEBA 4LF4B 2BN4A 4C2TA 4UARA 2RG7A 2QN6A 4QJ3A 1U3WA 2CBGA 3K0AA 1CZRA 4GMXA 4Q7LA 4YRLA 1M34B 4K6GA 4MB0A 3U0BA 3N2KB 3PXCX 3ZWVA 5H80A 4BMXA 4J07A 1X94A 5CJ2A 4BPBA 1CUVA 2QMQA 3OPYB 4KFSA 2FZGA 2OYCA 4GPEA 1HQDA 5AXAA 3JWIA 3NHMA 1IM5A 3DEZA 4YFYA 3ZEIA 2O7VA 3EVTA 1E79D 1THMA 2GN6A 4BKPA 1ZH4A 2Q50A 3IEPA 3DV0A 4JC4A 1YUMA 1EB8A 1V7PC 3BFXA 4BVJA 1EVIA 1M9NA 2P5UA 1TC2A 4NWIA 2K7ZA 3I9MA 4YMIA 3NIBA 4WN9B 4DLKA 3U19A 1L8OA 2Q0QA 1MJGA 2WU1A 4F2PA 1ESCA 2GILA 1ZMBA 1WW8A 1X8KA 5CYPA 4BB0A 3ITEA 4TYMA 4UMFA 4E21A 1ZH0A 5KDOA 2BGKA 1SFRA 2C4HA 2JFBA 1DTSA 5GWXA 3KV3O 3OJXA 5BMVF 4DXDA 1YUNA 3QKTA 3TM4A 1OH6A 3H75A 1L3CA 5IHPA 1JF8A 3CKYA 1RLOA 1L3IA 2P3LA 2TSYB 3PNQA 3ICQB 1W5SA 1JFFB 4IGEA 4YJ2B 5B1EA 2O3RA 5ALXA 4LVOA 2X8BA 1UDBA 2ZCVA 4GP6A 3FCEA 1PZGA 3A37A 4EQZA 1VG1A 4UNIA 3BDAA 1IDN1 3U7IA 3K9BA 3R44A 1HOXA 3T1QA 1XR3A 1M0EA 4HAXA 1F12A 3D7LA 1NVXQ 5CEJA 1IEXA 1RADA 3WAJA 4HNTA 3ZS8A 3N0RA 1WXIA 3B3FA 1GGJA 4ERNA 3E6AA 1V16A 3UXHA 2P68A 4K9QA 1T0BA 4UBKA 2BWJA 4IWNA 2WWHA 2WWWA 1J49A 2NXCA 4X65B 4IX1A 4IQ4A 2PY6A 1WF3A 1TK3A 3K0EA 4JLAA 3ZH2A 3V1LA 5BVHA 2FR8A 1X6VA 3MM4A 4L22A 4LF7B 5KMGB 4C6TB 1VLLA 3MCAA 1SXQA 2GZHA 1CFZA 1KY5A 2WTNA 5LJIA 2LRHA 3G2MA 3P97A 3CX6A 1OHHD 3GAFA 3F1LA 1KSHA 3HLTA 1NW3A 4X3PA 1PFGA 4CBVA 1ENOA 2P65A 5D6NA 3LV8A 1E9SA 3CPHA 3N2LA 2WIJA 1TD9A 2I7TA 3AETA 2GB4A 4YPOA 2DPYA 3UT6A 4B09A 2IHTA 3H17A 2XQVA 1OC4A 5IZCC 4C14A 1J0EA 4WK0B 1J06A 3AY0A 2F43A 4ASUD 4RTOA 1KNQA 3KKKA 2RCNA 4JEHA 1JXOA 3A6EA 4CIYA 1UP7A 4BQEA 1WPGA 3MWGA 1Z0UA 1ZM4A 4N9WA 2RSLA 1QH8B 1DX6A 1V2HE 1YR2A 1YBMA 4U6NA 2YN2A 3TLEA 3R7DA 1M2GA 5ARBA 4DJTA 5IYZA 1GCUA 1O57A 1VBFA 4EG8A 4IQ8A 3TG8A 3ZI4A 2PA0A 2GLTA 5G4KA 1OXUA 3GJSA 5FTJA 3X2SA 3I8XA 5MN4A 4MGIR 2NU8B 3IDAA 4AY4A 4QOJA 2FPOA 4Y6PA 1WDKA 2LGJA 2ZYRA 1E1RD 4JP1A 4DREA 2M2IA 4FFLA 1PL8A 1QRRA 3HFJA 3LQKA 3MT0A 3R0IA 1PR5A 2IYPA 3ISJA 4UW9A 2Z2JA 2W43A 1JDSA 2HRZA 3EEBA 3K09A 3SQNA 1JYSA 5CX1A 2WSIA 4ARIA 1UPTA 3STYA 1AN9A 1E1CA 1HLFA 1RWWA 4LK3A 4LXUA 4EKDA 2BFBA 4K9NA 3VR3D 1WVMA 2DHRA 5KKNB 1NVAA 3EGDB