1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
1NATA 4HNSA 2R4QA 5IX8A 3OLZA 4Z4IA 1ZY2A 3DBIA 1P6UA 1SXGA 3F7NA 2GKGA 4L85A 3JVIA 1PEAA 3Q7TA 4RY9A 3HM9A 4W5NA 4TN5A 5TQ0B 4G0MA 3HCWA 3SM9A 3O1JC 1KRXA 1GUBA 4TLMB 1JX6A 2MSKA 3RVJA 3VNAA 1J56A 2HQBA 4F3TA 2KYRA 4MR7A 5IEJA 3LUGA 4MR9B 5JNUA 3MA0A 3FFXA 5FWYB 3H5VA 5TPWA 4YR7A 3HO1A 2JB9A 3Q15C 3CNBA 5FBKA 4YV7A 4EYOA 1QO0A 2QVGA 3T6KA 3TX6A 1RXEA 3VNBA 1JFVA 2JVIA 3G85A 4EYKA 4W5OA 1DC8A 2QSJA 3UUGA 4W5QA 3DLBA 4JB2A 3EODA 2JVJA 5TPZA 4MRMB 4MR8A 4MLDA 1YMVA 2AYXA 2PLNA 3RQIA 2MSWA 2PUAA 1EHCA 1JF8A 2VK2A 4OATA 3SY8A 5KQMA 3OLYA 2B1JA 3GWGA 4KFCA 3OLWA 2PUCA 3GYBA 1NXOA 2PE5A 1D4ZA 3Q7SA 5IUNC 3EAFA 1OXKB 2LBPA 2ZWMA 4CBVA 2IPAB 4DQDA 2FVYA 1PNTA 4UHKA 1E6LA 2CD7A 3L49A 4JOQA 2Q5CA 3N53A 1USKA 3N0RA 1QQBA 2HJ9A 1SXIA 3F6CA 1DRKA 4JB0A 2TMYA 2ZAYA 1NXXA 2HPHA 1YMUA 4OG2A 1DG9A 3FFWA 2A9OA 4OLBA 4E7OA 5TE9A 2FLWA 3BILA 3ILYA 4RKQA 1CEYA 3BRQA 4MQEA 3ROFA 2PJUA 4F06A 2PMCA 3QELA 2I6FA 5IBQA 5TQJA 2NZVG 4MS3A 3CFYA 1C0EA 4IF4A 3NHMA 4ZJPA 2PAFA 1TMYA 3G1WA 4MS4B 2R25B 2RDMA 1S8NA 3A0UA 3QEMB 1PHRA 2MSLA 3IP6A 4N47A 1EAYA 4RU1A 4F12A 3KHTA 4HNRA 1ZVVA 3NNSA 1EFAA 1BDJA 4Y9TA 2PL9A 3RVSA 2RGYA 3KSMA 5BRAA 1YIOA 1ZGZA 3JVDA 4O5AA 4ETIA 2FKAA 2M1ZA 3O21A 2W42A 3H1GA 2FEPA 4EY3A 4KVFA 4RK1A 2PUDA 5JNTA 4LRQA 2FQWA 4RDCA 1H9CA 2M98A 3SNKA 3OLVA 1NXPA 4RK6A 5KI6A 3O2SB 1QO0D 1JLKA 3TO5A 3QEMA 1IIBA 2A9RA 3KYIB 4WZZA 2BGGA 5DKFA 2E4WA 1ISRA 4L4UA 1DJMA 4XLTA 2QZJA 4KRFA 4JASB 3I5AA 3C3MA 3H1EA 1P2FA 2HQRA 4YO7A 1PEYA 3OO1A 3URMA 2MYNA 4WXEA 4W5TA 3LUHA 4RXMA 3T95A 3MMNA 3QEKA 1ZDMA 2R48A 5DLEA 2WJAA 3I42A 3GA5A 5KC9A 4N0QA 4D74A 3OO0A 3EQZA 3D02A 3JPWA 5CNKA 3HDVA 2FXIA 2H0AA 3RVPA 1DBPA 1UDRA 4ZMSA 3LUKA 1MB3A 4EVSA 3OM0A 4WWHA 1JFTA 4PEVA 3HDGA 1ZHHA 3H6HA 1DC7A 3Q9SA 4WT7A 4RK0A 1AB5A 1FFGA 4KQ9A 4RK7A 3Q7RA 3H75A 2XDYA 5F64A 1OXBB 2VUIB 3OLXA 1JDNA 4MS1A 2WB4A 4G0XA 1Z17A 1QQAA 2OQRA 3TB6A 2PL1A 3EGCA 3HEBA 1TLFA 1CHNA 1ZAYA 1URPA 3M9XA 3H5WA 3M9WA 1D2AA 1Z2DA 2E4YA 1D1QA 4P98A 1EWKA 3O2QB 4RY0A 2A9QA 2QXYA 2FN9A 5CNIA 4B09A 5EWLB 4NQRA 4KNYA 3QX9A 5EWJB 3I09A 1APBA 4IMJB 1ABEA 3CG0A 4YWHA 1ZITA 1D5WA 2QVCA 1JYFA 5EWMA 5PNTA 4IRXA 2CHEA 1VPWA 4FE7A 3RVQA 3EULA 4MGEA 1JH9A 1RNLA 2ID7A 4FE4A 1MB0A 1F51E 2P4UA 3E61A 3SG0A 3JS5A 2IDMA 3W9SA 4DADA 3MF4A 3CRNA 1DCMA 1USIA 3K4HA 3OMXA 5TQ2A 5FWXB 1LBIA 4Z4EA 3KCNA 2MYUA 3O2JA 1D1PA 5T7BA 3IP5A 5HQJA 2JK1A 3CHYA 3CKMA 4F8JA 2L18A 3N0XA 1JFSA 5GOTA 3SQNA 4HYEA 1C4WA 5TQ0A 1HEYA 4H3HB 4KV7A 4EVRA 1AB6A 3LMKA 5TQ2B 2N9UA 1GLGA 4KK4A 2H3HA 3LOPA 1ABFA 1DCKA 2CHFA 3S99A 1K66A 3N8IA 1TJYA 3SAJA 2E4XA 4Z4HA 1DRJA 3LKBA 1B00A 3H5IA 1USGA 1YK0A 3JTEA 2IYNA 3H5TA 3IPCA 1U0SY 4RS3A 1ZN2A 3KS9A 4RKRA 1DP4A 1Z26A 3QLUA 1LK0A 2HQOA 1QPZA 4H3KB 4KMRA 4RXUA 4JA2A 4QYMA 4D6XA 3EQ2A 3RVKA 3LUAA 4MQFA 4YS6A 2FN8A 3KJXA 4ETNA 2RJOA 4N0PA 3OM1A 2E4UA 3N75A 2L2QA 1Y1LA 1PUXA 2RJNA 2YHBA 1YK1A 4O1IA 3OQMA 1SRRA 3B2NA 4RSMA 4XASA 3RVLA 2CWDA 4EVQA 2GX6A 3O1IC 5CHYA 2JVKA 2LUOA 1A0OA 1KMIY 2GWRA 2HSGA 3FMVA 1YVUA 4PICA 2IPNA 4MR8B 4ML3A 1Z25A 5D2CA 5C5EA 7ABPA 3EJWA 5JNWA 1RZRA 1FSPA 1M5UA 5BRJA 2YHAA 4KQCA 1NXTA 4RK5A 4M88A 1ZH2A 3C3KA 4KZKA 4NCAA 3GV0A 4MQFB 4NCBA 2DRIA 4HNQA 4KPYA 4FB4A 1W9HA 5KC8A 2J48A 4LX8A 1VKRA 2F8SA 5ABPA 3TD9A 1Z2EA 4IILA 3N6VA 1QP0A 3HSYA 4OLAA 4YGXB 2ID9A 5IULC 3QLVC 4ETMA 5CNJA 2X7XA 3DZDA 4Z99A 4RV5A 3H6GA 1Z12A 3BBLA 4DN6A 5ED4A 4Z9BA 4MYRA 5C5CA 2GI4A 2B4AA 2JCGA 1QP7A 1Z16A 3O74A 3RVNA 5KQLA 6ABPA 3JY6A 3M6MD 3UKJA 3QELB 5IEBA 2NUBA 4XARA 3F6PA 1JHZA 3DLHA 4MS3B 3E3MA 4NICA 5T3YA 2FMKA 3T38A 1QMPA 5B3JA 1CYEA 4MR7B 1XHFA 4G0OA 1FFWA 2FW0A 4G0ZA 1VLZA 3CTPA 1VRVA 5KQPA 5I4CA 4OBBA 3FFTA 4PZ0A 2VYCA 5JS2A 2OENG 1U04A 3O75A 2PUBA 4EUKA 2MYTA 3GBVA 2QW1A 4LDZA 4RXTA 1ZGGA 2MYPA 3MIZA 3FDFA 4JP1A 4XAQA 4YP9A 4G0YA 1ZESA 3IP9A 2WY2D 1TM2A 3T8YA 3LUDA 2GBPA 5EWLA 4N76A 2IPMA 2FSPA 2NT3A 2AYZA 3QK7A 5FBHA 5EWJA 1LJLA 3CG4A 1BA2A 2QR3A 3LUJA 3LTEA 8ABPA 4LZLA 2E4VA 5JNVA 1FQWA 3FGZA 1GUDA 3CU5A 5JNSA 1A04A 4WUTA 2A9PA 3QX8A 1F4VA 3HK2A 3HXMA 4IGAA 4MQEB 2V0NA 5BR1A 1MAVA 3OQOA 1DZ3A 3MQ4A 3KLNA 3BREA 4ZPJA 3GL9A 1DCFA 3NHZA 2O20A 3ROTA 4OTZA 2JBAA 2FMIA 3KG2A 4MR9A 1YTUA 1JL3A 4MS4A 5HM6A 1E2BA 1U2PA 4PYRA 3GRCA 3QLTA 4LDAA 4QPJC 3K9CA 5JNRA 1RZRD 4G0PA 3KLOA 4Q6WA 4ZMRA 1EWVA 3HS3A 4W5RA 4GPAA 1JWLA 1PNRA 1KRWA 3LUCA 2NT4A 2PUEA 4H60A 4NV3A 1EWTA 1L5YA 4Z4CA 1KGSA 1SXHA 3QLUC 4KK3A 3N0WA 9ABPA 3O1HB 1QP4A 1NXVA 3A10A 2FMFA 3NNDA 2FQXA 2JRLA 4LE1A 4D6YA 1NXSA 4F11A 2PUGA 1M2FA 2L19A 1DBWA 6CHYA 5DTEA 4Z0NA 3TMYA 4E7PA 3HUTA 1JYEA 1Z13A 1LJUA 1Z15A 1RPJA 3HJFA 2QU7A 3I45A 3BRSA 1GCAA 2LP4Y 4Q6BA 2WRZA 3EDCA 3IP7A 3Q41A 5HKOA 1TVMA 4XFKA 3HVRA 1DBQA 1QKKA 3H1FA 3D8UA 1K68A 4G0QA 2R47A 2PUFA 4IMIB 3DGFC 4O1HA 3JPYA 4MPTA 1P8AA 3UK0A 2FEWB 2IKSA 3CLKA 5GQSA 2FQYA 2FMHA 2VUHB 4KREA 4RZSA 3RH0A 1SD5A 2L17A 3HZHA 1XWWA 4WXMA 1M5TA 1YS6A 3OMWA 1T34A 3IDOA 4PE5B 1JBEA 1E6MA 5DGCA 4MLCA 3LKVA 2PKXA 1WETA 2IOYA 4EYGA 4EYQA 5KWSA 3MYYA 4G97A 5BQ3A 1QNLA 1LBHA 3RVRA 1RXIA 2WJWA 3C6QA 3C97A 5TPWB 5FWYA 4Z4GA 1R8JA 1W25A 3QLVA 4P1ZA 4RY8A 4TMYA 5IUJC 3CZCA 3GBPA 2FTKE 2F8TA 4JAVC 1XHEA 1BDIA 1ZH4A 4Z4FA 2IPLA 1BAPA 3OQNA 1U2QA 4S04A 4GNRA 2P9HA 1L5ZA 4YCSA 5KQGA 4MRMA 1A2OA 4YLEA 1MVOA 2NZUG 2LIVA 1Z18A 5B3JC 3CZ5A 4QICA 3RVOA 4S05A 3HUUA 3LUFA 3A3KA 4QYWA 4UHJA 2JBAB 4Q7EA 2WMYA 2WWVD 4MAAA 1E6KA 3H5LA 4MS1B 3LFTA 4RK4A 3NNNA 5CNMA 4LE0A 3P9YA 3MM4A 3RVMA 3IPAA 4N03A 4XXHA 3KTOA 3F73A 1I3CA 3CS3A 4EGSA 2FEKA 1ISSA 1NTRA 5IUKC 3ILHA 4ZYLA 4LE2A 1NY5A 3C3WA 1P6QA 2LPMA 4YRZA 3KKEA 5DCLA 4Z9AA 3HV2A 4G86A 3NBMA 5EWMB 3KYJB 3H5OA 5JS1A 1YS7A 2E4ZA 2QV0A 5FWXA 3DGEC 1GCGA 4RWEA 1NXWA 5IC5A 3GT7A 4TLLB 1FFSA 1BVHA 1M2EA 5TPZD 3A0RB 2FLKA 1MIHA 1U8TA 5HSGA 1JDPA 4N41A 5E3JA 1BDHA 3L6UA 3R0JA
chains in the Genus database with same CATH superfamily
1J8FA 1XZFA 5DHTA 1UDAA 3UA3A 1EX9A 2ZK7A 1M6WA 4WCFA 2VZ9A 4NZMA 5HKKA 1RXVA 2EKBA 3DEIA 2QI9C 2W6CX 4MHSA 4G37A 4ED9A 3A04A 3JALA 4UXJA 1E89A 1D0IA 3T61A 2QY6A 4IDHA 1CNEA 5SZJA 4CMGA 3QTLA 2OHHA 2VAPA 2W2OA 3RS7A 1TEHA 3N2EA 3I2KA 3OTIA 3RVJA 1EBFA 3TJMA 4EX7A 4EZIA 1JVSA 2ZM5A 1G0OA 1ZD4A 2PK3A 4Q0MA 5LLDA 3LWZA 3RPEA 3FLMA 3AVTA 1QUFA 3OCYA 1AN9A 4YR7A 2OCKA 2ZYIA 4PLHA 1R15A 4MEAA 4CMKA 2XB2A 2XUHA 2JANA 5IJZA 3CRZA 4UU1A 2G1JA 2YICA 4ILKA 1JAXA 1EWRA 2HOQA 3AHCA 3P2OA 1W73A 3A6HA 4IH9A 1Z6ZA 2IYEA 3EZ7A 4JB2A 2HMYB 2OBXA 5E38A 2CFIA 4PO9A 3ZXXA 4WXHA 4RA6A 4OHRA 1L4BA 1QTIA 3PE3A 2ODTX 4IHAA 4BV3A 5BMVA 1R10A 2R6FA 3CY6A 3ZH2A 3SY8A 4DQKA 3CVUA 3LP5A 2DQZA 3KETA 1CS4C 1XXHE 2C5FA 5KQSA 3FPBA 3GYBA 3UJPA 2PE5A 1U0FA 2G7ZA 3GEMA 1OXKB 3DXZA 3I6ZA 4GPD1 5KYKA 5DHSA 3VVBA 2YYYA 4OB8A 3PX2A 2GAAA 3UMYA 1Z8HA 2GCOA 1OBHA 3OE4A 3SMVA 3BJMA 2BGIA 4JB0A 1GRRA 4EJSC 2XF8A 1KDTA 4P80A 2QQ0A 4UBIA 2E4AA 1QYXA 3D8RA 1WSAA 1Q1EA 13PKA 2HV9A 2P30A 3HMQA 1V11A 3S5UA 3USES 3WK4A 1E3DA 5BNZA 1Z5NA 2FPGA 4Q3DA 5J5VA 3V8PA 3QPAA 2PMCA 3BK2A 2I6FA 4KQGA 4AF8A 2IHTA 3I6MA 4PSVA 1GTL1 1DS6A 1C0EA 2O1EA 1WXHA 1TRKA 3NBZC 1E5TA 1WXXA 1FVHA 2P35A 4J7AA 1QG6A 4ZCLA 4A0GA 1X8JA 4B7ZA 4JI7B 1T8WA 4HEA1 3GOHA 4GM4A 3PCRB 1OWPA 5M2QA 2XMDA 4Y1RA 3B6EA 1T1GA 1UC5B 2A9FA 1Y5LA 3R7SA 3BE8A 3A6DA 3U44A 1YJ8A 5FEMA 2EVWX 2HY7A 3A1FA 5J2UF 3NH9A 2PT9A 4HAIA 1WZUA 3QYFA 3G0DA 4DCTA 2XNJA 2FKAA 2JH8A 1DJLA 3GLSA 3O21A 4W9RA 5T8KA 5CCXA 1XRMA 3AXTA 1CKEA 4QDZA 1UK8A 5F5NA 3WS7A 2PVSA 4FPXA 4G23A 4YAOA 5I7OA 1V5EA 3VO1A 5C32A 1U0RA 2ZJOA 1GNPA 4RPCA 1KYQA 3K1ZA 4BBZA 4EIWA 3ACDA 3MSCA 1SAYA 2QLLA 2XSZD 1FNDA 4XIJA 4IXTA 3ZEIA 1P3Y1 4LBZA 3MLBA 4LJYA 5AHOA 3VH4A 1NSYA 3HNOA 4U63A 4ZT5A 3X3HA 2KMLA 2P1DA 1KTIA 3IMEA 4X64B 1RC0A 3U3RA 3G5MA 3GO4A 2YFHA 1N6HA 1G5FA 5FPHA 1NULA 1Z0JA 3H8SA 3PGLA 2I3AA 3FYUA 5FPPA 2UZ4A 2CV1A 3URMA 5IKPA 2Z5VA 3OC0A 4RXMA 1YZLA 2B7CA 4LZPA 3DE7X 2FMUA 1QG0A 2QTMA 3Q7EA 5BW6B 2OFOA 3AL2A 4LK3A 5FFFA 2HWUA 5HK8A 5KX5B 3ZEAA 1ABBA 3PUKA 4QO7A 3ZW8A 5BSMA 1C9NA 1JSXA 1OIWA 1QK4A 1V5GA 5F1OA 3RGWS 5AVQA 1UAGA 2WI8A 1L7OA 1R0SA 2QVLA 1ZH6A 3G2PA 4UMEA 4C4TA 1AQLA 3F96A 1S3SA 1TPZA 3KEGA 1IUKA 2ZT7A 4GM0A 1QM5A 4JNCA 4CL0A 4QJ3A 2WJJA 5BSEA 4EVSA 4WWHA 1IN7A 2G7MC 3IAUA 2B20A 4PEVA 4H0NA 4BLPA 2EKPA 3H6HA 5F33A 4GI1A 4PN7A 5AM3A 2XPCA 2ZS8A 4QM7A 3NIWA 3E82A 1SFRA 2XMQA 4WVFA 2OLKA 3S2SA 5C7LO 1SHTX 1TEXA 2I66A 4HWGA 3CZAA 4IUBS 2GK3A 3Q85A 3SM3A 2PL1A 1QQAA 1KOGA 2GEVA 1ZD9A 1SBNE 3E3NA 1ZP6A 3AJ8A 3KB6A 4FMPA 4W1PA 3LL7A 3DBHA 2ID4A 1KH3A 4B09A 1KVUA 3ANXA 5CNIA 3ENWA 1XTRA 2PIDA 3BGVA 1G8FA 1MQAA 1RR6A 2VJNA 4UMDA 4YRRA 2VTVA 4HGRA 1NLZA 5LNK6 1KVQA 1ZK1A 3G2KA 4BFTA 4CM9D 2QYTA 2XMGA 2WPDA 4M0MA 1K6EA 1ZFNA 3MT8A 4RH3A 1IATA 5AI0A 3BXEA 2CNDA 1XTBA 5D7NA 4C4AA 2FG5A 4JJ8A 3IP3A 2DR3A 2DT5A 2ENUA 3HR4A 5JW6A 1IB6A 3FBGA 4GWGA 2NP7A 4RSHA 2D5BA 1AKRA 4XWOA 2BHRA 1QTQA 2PUTA 4G4JA 2PQ0A 2NTNA 3M6AA 1L5FA 4N39A 2NTEA 2R2GA 2CZCA 1GAJA 3MF4A 4R2IA 3MJFA 1H2XA 4K9DA 3CSUA 2RB4A 1E9FA 1GQ2A 2R9VA 3WBKA 4KNWA 3FNBA 1SKMA 4HLNA 1R8YA 3N2KB 3UYKA 2JG3A 2AH5A 4LI0A 4AKEA 3JYHA 2QXUA 1KAHA 3H4VA 1J0BA 2IY9A 1IZ7A 4HS9A 4HAOA 1AZWA 1WKBA 4MK4A 1XA4A 1CYDA 2V8OA 2A88A 3OUZA 3HYNA 4R01A 5HCIA 3TKAA 2XT6A 4OU5A 3WK8A 2ZGVA 1D3AA 4P4UA 1XUOA 3AFGA 2FZEA 4GGOA 4JIGA 1OX5A 4DSOA 4RE5A 3ZD6A 3DW1X 3O92A 1XFDA 2JAOA 2PBZA 3RU2A 4ZU3A 4HGOA 3GRVA 3T7IA 4GOMD 4YCMA 4WEQA 4DL9A 1DCKA 1X14A 3HN7A 1DQSA 4P36A 4ZOLA 3AU9A 3HB0A 3EGDB 2PDAA 4RVNA 1X7WA 1DFGA 5KOJA 1FVXA 1NV9A 3K72B 1L4NA 2JFFA 2PS1A 2XJ9A 3TRJA 1KWKA 3DMPA 3MFQA 1BXRB 4JQYA 2PY6A 4Z1OA 5AW8A 1CRZA 2IYNA 2JAXA 2ZATA 1T5DX 3ZNNA 5E2BA 3KJGA 1K5DA 1XZPA 4Q9HA 2NXEA 3EYAA 3MUEA 3OLCX 5AR1A 8LDHA 2WT9A 2YXEA 3PNBA 3T9CA 3U44B 2RH5A 4JLUA 2VT2A 1K7CA 2J6HA 1KEZA 2WJPA 3OBBA 4Y6PA 2ODWA 4TKVB 4FSHA 5IKOA 3B36A 4F2GA 2RAFA 1CDEA 2GNPA 2B8EA 3ASZA 3D1LA 3QUCA 3HKEB 4JCCA 4MUXA 2LZ0A 2P6NA 2R7LA 5IJXA 3H1TA 1MO2A 4IPTA 3EGWA 1K6JA 4FWIB 1UFRA 1Y1LA 4H7PA 4K6OA 4ZVKA 2IP4A 4MRAA 1YK1A 1RRVA 3QUTA 4MEJA 4UZFA 1CR4A 1YCGA 4XASA 1M72A 3PEEA 5FAXA 3U4CA 3D6AA 1K5PA 1SC1A 2GPWA 3M9LA 3ER6A 4JY7A 4BJHB 4EUFA 4YV0A 3I4LA 4LYYA 4OHYA 3OQIB 2BGRA 1SK8A 3W7BA 1YAJA 3MWYW 4EEXA 1QKJA 1T0HB 3PCXA 4HB0A 4C0BA 3QVJA 3EGDA 1YS4A 4UHDA 2WZBA 5BRNA 3NBUA 4F7WA 4QTYA 2AMFA 3GG9A 4NNPA 3IEKA 2FN4A 1WCXA 1EXWA 2C54A 1PFKA 3GX1A 3KPWA 4MW1A 3R5SA 5JLAA 4NCAA 1N2EA 4Q9AA 3KKZA 1VKRA 2BFEA 1EGHA 3VDMA 4KYUA 3RIYA 3T99A 1A71A 1H65A 1P0PA 2IE8A 3Q2OA 4N54A 3KOZA 4YEDA 4CF7A 4IX1A 4YC7A 2MSNA 2ZIFA 1VKZA 1E2IA 1VRWA 3HJCA 2YV4A 1TX4B 4B4KA 4HAVA 2ZZNA 1IQRA 3BBLA 1HE2A 3LWBA 2Z8XA 4BQFA 2D5AA 3JQFA 3O74A 6ABPA 1ADJA 2UKDA 2HCBA 3JY6A 3FDZB 1LNZA 1XIVA 1RWXA 2GERA 5FOQA 5JEDA 3DLHA 4G0WA 2ECQA 2AE1A 4U00A 3SI7A 2XTZA 3WGIA 2WFLB 4MAMA 4RX1A 1OBVA 4TVOA 3WP0A 4F5ZA 3CO0S 2QD1A 2GLTA 3BD9A 3AF2A 4JODA 4ZAVA 4O2AA 4F4CA 4Z54A 3A9WA 3NW9A 2OCGA 3IDZA 4WJLA 2L82A 3NONA 4R8KA 2HLDD 1W9MA 3N07A 1PT5A 1WNFA 2QW1A 1F2UA 3CSDA 1H2YA 1MG5A 3EXEB 3BFPA 3C41J 5CVJA 4AF7A 1FXSA 1Z6YA 1EYZA 2PT7A 3RKRA 2XXAA 3DMTC 3WK9A 3EY4A 2VJDA 5G0SA 3OQJA 1RRMA 3MPOA 1AK9A 1GN9A 1PJ8A 4WH0A 1Q14A 1BD4A 5K7SA 1SXJB 2R4TA 1ADYA 3E18A 1W5AA 1VKHA 3OZDA 4ZVTA 5JWOA 3Q0TA 1KDYA 1M75A 4YRLA 2A84A 3CU5A 3HRIA 3LX6A 4NLLA 4NZZA 4OO3A 5COQA 1UL1X 3IVRA 3QX8A 2HWWA 1EFLA 1RRGA 4DDTA 1EDBA 4NOKA 4QXRA 4CQMA 1G9TA 4ZDKA 2B8TA 2IU4A 4K9SA 2H2HA 3H65A 4RJ2A 5JH7A 3ESDA 4WZAA 4NDZA 1DCFA 4CU2A 3ZCXA 2O19A 1H2FA 2JBAA 4B47A 1GCIA 1KS9A 4JS0A 4MR9A 3USZA 3KUXA 1E2BA 5B12A 4XTRA 1S9HA 4O3MA 1JPUA 2IWHA 1E0DA 3OP1A 3IYLW 4QC2A 3OBIA 1NQXA 5NLLA 1EWVA 1Q77A 4OP2A 4UFPA 2PQMA 1E5XA 3QVSA 4QHYA 3UIEA 1PNRA 4GNKA 4QDKA 5KTRA 2ZUEA 1M2JA 1Z22A 1XMQB 2D2IA 2NT4A 1IOVA 4G24A 1P91A 2YBDA 1K3UB 4ABTA 2JDIA 3I1YA 3AHEA 4H77A 4RPKA 3X0DA 4WY2A 4P3PA 4BE9A 3NORA 3ERCA 1C0KA 1HRKA 2ZYSA 2ZIUB 3OJLA 4OU4A 1SVNA 3AESA 3ETNA 2VZ8A 3JWPA 5AJWA 5M34A 2JRLA 3RAGA 3A4VA 1LWNA 2FOXA 2QWXA 1UQTA 1V8OA 4U6QA 5D8DA 4B3SB 2V7TA 2LGJA 1ENZA 4IG9A 5DGTA 5B53A 2FPKA 3D4OA 1PLKA 2HNKA 4AO6A 4IL5A 3MCTA 1U7DA 2VK4A 1TA9A 3FDZA 4RPJA 4M98A 1MT3A 2R8RA 3H0EA 3RE1A 5LP6A 3OZXA 1OAOC 1DV1A 1QKKA 4I36A 4RESA 1G5QA 5FFMA 4V0ME 1L5RA 5JO9A 1EH5A 3W3AD 2AWNA 1A5AB 1CZLA 4UVHA 1U0HC 4GKAA 4OGWA 2GJ9A 5ALKA 2FQYA 4RTPA 2WWYA 5G4KB 2N1MA 4TV8F 5EG5A 1ZZEA 4U3JB 1P1JA 3Q1LA 1RQLA 3LP8A 4HRXA 1XX6A 2GS9A 3PDHA 2P3QA 2J7PA 3MJCA 3EC2A 1OT5A 3MYYA 4G97A 3IUYA 2XDQB 5BSRA 4JQZA 1CRPA 1G3IA 3NP9A 4BNWA 3RRJA 2BC9A 3KZOA 1MZVA 1AGXA 2OPBA 3L4EA 4FK8A 4E51A 4BDTA 5D5PA 5BN5B 3CF4G 5H68A 2EJVA 2IS4A 1D2NA 1SNYA 4PONA 1F1BA 1EUZA 3HO6A 1UBOS 2ZT6A 4ND3A 4NZ9A 1G8GA 3MWKA 2I1QA 4ZRDA 2C1XA 2WDZA 3AJRA 2HDWA 3FVQA 3WB1A 5E1DA 2WILA 3PR2B 4X8HA 3V9PA 1JR2A 2W2LD 4G5RA 4L7VA 1ZUNA 4ZQBA 2PH5A 3BTSA 2WWVD 1GLNA 1YVPA 1X1AA 3PDCA 3R2JA 4MAAA 1QONA 2EERA 3L3BA 3LFTA 2GN8A 4RK4A 3S3TA 3UMSA 3FDXA 3HVIA 4AICA 2VWGA 2AG8A 1P29A 4R51A 1U5CA 3JAKB 4NBWA 1JHQA 2YWRA 2ZSAA 3R7BA 1BMQA 1N2HA 2YVLA 5BN4B 4CL2A 1B7GO 1OI7A 1U4SA 1E2PA 2CVFA 4H4EA 4X7RA 5JXWA 4X92A 1XMJA 3CF0A 3PX7A 2AXPA 4KDEA 1CJCA 2FEKA 2PSHA 1QS0A 3BMQB 4KXQA 1Y1QA 3ND9A 1N9ZA 2DECA 3CYFA 3IXLA 1PW7A 3C6ZA 1E94E 2Y77A 3FR7A 1DQRA 2J41A 2ZJ4A 4K6CA 1GDHA 1MIOB 3WAGA 4IHJF 4BATA 1P6QA 1NVEA 3OT1B 4KJXA 3UG6A 3EUEA 1ZMXA 2ODNA 2B69A 2WWHA 3IQIX 3QVMA 3MCZA 3DHYA 3W7AA 2ESRA 3G79A 4URUR 5EZYB 3X1MA 1FYXA 1SCJA 1NJ6A 1UOPA 1XEXB 3C74A 3HCPA 5DVZA 3T94A 4IJ6A 4DEVA 1U94A 1KI3A 4ZVPA 1M2EA 5BUCA 1JALA 3DBLA 5EUQB 2BI4A 8MHTA 3ZWDA 1KDOA 3F6SA 2IODA 1PTJC 3LRTA 3TTVA 1A9PA 4ZP1A 4C3OB 4DG5A 2GHRA 4EF6A 4EKEA 1OLOA 1IRXA 1S8FA 4JI4B 5FP0A 5IC4A 2DMRA 3O90A 1OU0A 1NJ8A 4L02A 5KAPA 3ZHZA 4W5NA 1RLMA 2H1RA 2IXFA 5BN3A 3AIIA 4HWTA 4PHFA 5ECGC 1FK8A 1LS1A 3R0QA 2QLBA 4G84A 1Y5IA 3V4PB 3CRW1 3FZQA 2BM1A 3UH1A 3CJTA 1JX6A 1QXSA 1UP4A 5B37A 4D41A 1XRPA 2WNSA 1PZEA 1ZUHA 2ZSIA 5ITWA 3SQMA 5LMZA 4UDOA 2ORED 5TX7A 1O97C 3ZXSA 4PPFA 1UJBA 2JB9A 1T2UA 5WRFA 2A4MA 5K0BA 3ILSA 1RXEA 3DTYA 1YU6A 3S1AB 1T6BY 2AUMA 4E4YA 1C4KA 2V1XA 3L05A 4HBZA 2AIRA 4HDQB 1QAMA 3IPLA 4LGMA 4TQAA 1RRCA 1WU7A 4D25A 2BZ1A 4V0QA 3A4YA 2QMHA 4NBLA 4S1WA 2IPOA 1YMVA 1VHTA 3NT2A 4DW8A 4EEKA 2VK2A 1I3NA 4CLRB 3TSOA 1VCHA 1M2OA 4C29A 3PPWA 3OLWA 4TLEA 4KFCA 3UJ9A 3X43A 2VJQA 3M4XA 2JAWA 2ZWMA 3LX5A 3OSUA 4JL6A 3SFZA 4XCXA 3N0RA 3NGMA 3PHLA 4K81B 3IJPA 2HJGA 2ZIAA 1Q1QA 3OOYA 1GTRA 4LZWA 1W0JD 3D4BA 3Q40A 2VLBA 2HCRA 1EGAA 3AT1A 3EIWA 3NUZA 4L6AA 4YMHA 5AH0A 3SHFA 1YZTA 2D4AA 5ICEA 3JQ9A 5BN1A 1GKKA 2I6GA 2JAHA 1VMIA 5CAEA 2WTAA 4MWCA 1JKIA 4TX1A 2RAPA 4LNUB 3NDRA 4H1WA 4X91A 4DA0A 1BQEA 1RIIA 1TJ3A 1M66A 3NHFA 4INPA 4EJFA 4MGHA 3STHA 4JKOA 3U0BA 1Y6FA 5D01A 2MSLA 3GIDA 5CDTA 1HSZA 1MV5A 3AOGA 5F1KA 3ZCQA 1IK4A 2XV1A 4R3NA 4LFAB 5B3LA 5CEEA 1SC4A 2OT3B 4BP9A 2IKQA 2PL9A 3PVZA 1U3FA 2RGYA 4BZWA 1THMA 4M1WA 2FHPA 1C9EA 3FSEA 1ATZA 5KJEA 4O5AA 3AZPA 4PAWA 2OXIA 2I9PA 3B7WA 4NNJA 4RO0A 1S5PA 3GUZA 1CQZA 4IHKA 3U3MA 3WGKA 2Q29A 2FQWA 3H0CA 4HLQB 4CKWA 4BFCA 3LA6A 1TJ5A 4FYKA 4QDXA 4EFKA 1CUEA 1NXPA 1TQ8A 3K0FB 5TF0A 5BSWA 1JIUA 1X7XA 1T15A 2ZRJA 4DCJA 3QEMA 4WZZA 4A1OA 5ELLA 4K6KA 4AD8A 2NGRA 1C0IA 2G77B 2DXIA 2NTJA 3RJ5A 5KTNA 3HVJA 4HHEA 2HMTA 4R2KA 3NG1A 2JARA 1X80B 2VRBA 4MA5A 1JKXA 1NHGA 2WYOA 3T9AA 1SRQA 3OO1A 4GWLA 3C3AA 3A3PA 4CLOB 3L41A 1L3IA 4OI0A 3I0NA 2MYNA 3BCSA 3UGTA 4CKZA 4RJJA 4WRRA 3ZU5A 1ZDMA 2IITA 3CBQA 3KDSE 4LI3X 1E9AA 4QA9A 3MLEA 5EXPA 4PZPA 4PNHA 2WJAA 2D1RA 2DY1A 2QX4A 1NMSA 4R1OA 4AZSA 1N5RA 1RKQA 2JHCA 1DEOA 2EARA 1CP2A 5ERYA 1SB9A 1TYBE 3I9LA 2GFQA 1QFZA 4W5WA 3RTBA 4EPXA 5BYKA 5KNCH 3KPVA 2UZ0A 1OI3A 5KVAA 3FB1A 3RYTC 1A98A 2W11A 3PEUA 4OBXA 2F59A 5IKEA 1UDWA 1CJBA 2AN9A 2O50A 4M1YA 3KXIA 9LDBA 1T4CA 4RK0A 2ET6A 1BXKA 4L3VA 4C7XA 2X4GA 1T1RA 3DAGA 4CF3A 4BQQA 5AMXA 4G0XA 4G09A 5LNK1 1KQPA 3C7AA 3P32A 4LY6A 2AJCA 4P31A 4FR2A 2NO1A 3M9XA 3I2HA 1BX0A 1F9EA 3NR2A 3M1YA 2E7ZA 3BC1A 1JAYA 3OD1A 5AIAA 2RHMA 1K6MA 2OK8A 2TMDA 1E2EA 3SZ3A 1ISHA 2IXBA 2YHUA 3OICA 3NBAA 3V6MA 3U7HB 2VAWA 2WUFA 1ZJWA 4FLMA 2QW8A 1W94A 2C5HA 4JU8A 4O2BF 1E60A 4L2IB 4LY9A 4JU9A 1L2TA 2HCJB 3HXPA 1YZKA 4OB6A 4Q1VA 4V0KA 4WADA 1GPLA 2C82A 2P91A 2VP4A 3A6LA 3FNHA 4V3CA 5C2JB 3RVQA 3VR5A 2Y1KA 3HZZA 2X0KA 5LVAA 1OTHA 1C3XA 1NT2A 1PD1A 4KI0A 2WSIA 4LJ8A 3K1TA 4DLPA 3ZJVA 4BP8A 3PEVA 1WXWA 2YYZA 5JDIA 4B8ZA 4ZHQF 1Z8FA 2PH1A 3R75A 5BW4A 3W9SA 3Q8WA 4INJA 3ZY2A 1ZOSA 5K4GA 2JIQA 3GDOA 1S02A 5LXTA 3PGXA 4O1MA 3EIHA 4KYVA 1LSUA 3C2QA 3V8MA 3VZPA 5DHPA 5ALEA 3H7AA 3KZCA 1TYEB 3V55A 3AUKA 2BFOA 2FPIB 3IURA 2IEYA 2IEDA 3NM6B 4DBLE 1AUOA 2OXRA 4PC7A 5GOTA 4B6RA 4IWYA 3CVJA 4HYEA 1KZHA 3UJBA 1M6YA 4JBLA 4RMJA 4I2NA 3VOSA 4DIKA 2OQVA 4D1YA 2ZVQX 2JFNA 2YZMA 4DR5B 2VR1A 2Y68A 5FCDA 3L7MA 3TCKA 4A8JB 3H2YA 3RDPA 1H4QA 2G9NA 2Q2OA 4PW0A 1UOEA 3VU0A 4NCXA 3TZCA 4FOOA 4JVOA 2NVUA 4MRPA 4XPIB 5SYMA 3U4GA 3ZQ4A 4HI0E 1LVUA 5AW3A 1GUFA 4PFSA 3SAJA 1XGKA 1CTQA 3FF1A 3L04A 1V4BA 4OQZA 4X3OA 2VTEA 3LKBA 5GAJA 3TTXA 3UW1A 4BTLA 1Y1SA 5GMOA 4W8HA 3GMIA 1YK0A 4C20A 2O2XA 1UFQA 3GLKA 5KKNB 3K1JA 2W6OA 1IAVA 1QDUA 3FKSA 3HKCA 3TE7A 2X0RA 5GJWC 1RC1A 4IOMA 3REQB 1QPZA 1KPIA 4D6XA 1DX4A 1CG6A 4RENA 1PQ4A 4RFSB 4BNGA 4BUCA 4NULA 5DU2A 4OLJA 3WAJA 2QT1A 3RWMB 4IDCA 3H9EO 1FDVA 4PNZA 3OM1A 5FR2A 1MN6A 3Q7IA 3DKRA 4C7OB 3OY2A 3PFGA 4I9UA 4E2YA 3ZZUA 4P84A 4C6RA 1XMXA 2PANA 1KEVA 3GLFE 2CYCA 2CFTA 1JHRA 2XKBA 3EEYA 3O1IC 2VNAA 4I1VA 3ZU3A 1QRUA 3L1UA 3BERA 3EARA 2ZR9A 4FHCA 3DB2A 1QGAA 3EF3A 4J6FA 3T3NA 1QGUB 3MQFA 2ZTMA 4B33A 2V5UA 2ZSHA 1Z25A 1L5QA 1FYWA 2GK7A 3FJOA 3KKKA 4L0QA 4LX0A 5H3HA 4CJXA 4NCIA 2YHAA 5LJIA 3FWZA 2GN2A 2DWOA 2W6IA 2IZ6A 2WG0A 5DEOA 3ONDA 4WW0A 5DN9A 5IDYA 2VDJA 3ETCA 1CJKC 1CR6A 3GV0A 4KE8A 1K75A 3TECE 1LPPA 2JLBA 2QUKA 1X9IA 5GZ6A 3VSDA 1WBDA 2IXTA 2YY5A 1FLAA 1MKYA 1U2EA 1UXJA 4O2BA 1YRLA 3B8HA 2Z3ZA 1PR2A 1MXFA 1IJEA 3ISVA 3WL4A 5ICGA 4JYZA 2FQQA 2WMOB 5DISB 4OV6B 3M4JA 4TL8A 5G2OA 2X7XA 1U4OA 3QIAA 3A26A 3D0QA 3VDXA 1EWYA 2Q5EA 4R9NA 1BWQA 3QEOA 4NF2A 1TM1E 4LV8B 4C7JA 2JCGA 1GARA 1U7OA 2VOJA 3H16A 1L5SA 2BMDA 4XM0A 2RKOA 4FXOA 4A16A 1JDSA 1M2KA 4FNAA 4YLGA 2JGLA 4ZCSA 2VJCA 3WDKA 4W7SA 1KAOA 2O3TA 4DEYA 4H3VA 1PWZA 4TT3D 4GMDA 1XHFA 2VA9A 3KD2A 4C0XA 3EWIA 4XD2A 4DLXA 1SHLA 1U31A 4RD2A 3ZBQA 4PZ0A 1U6KA 1QHHB 3AM4A 3K32A 3U26A 3BEOA 1AC5A 4EUKA 4F4JA 5DOZA 2P65A 1P18A 4R2JA 3MIZA 1AY0A 1HOXA 4G0YA 4BRWA 2Q3DA 1P7PA 1XXLA 4NR0A 4YP5A 2IYAA 3HGTA 1RHMA 1OU4A 1T24A 3OOSA 5IZCC 5EWJA 2CKMA 1IZZA 3CUYA 1BMTA 4EHAA 1RWBA 2BFFB 1KR5A 3PLAE 1KDPA 1SCKA 4YJ3B 2P2GA 2PZEA 3TAXA 1C50A 1XJ0A 2AV6A 1BFKA 3UK7A 1E61A 4UVGA 2CJFA 2CXOA 2Y1OA 3R6GA 4H1VA 4GLJA 2FRVA 1QIKA 1RHRA 4YCJA 4YN3A 5JV5A 3PS9A 1JJVA 1HNNA 5KNBD 3O5AA 3WQBA 1OH6A 1P7VA 1TVKB 3L2OB 1DAMA 3V80A 1V1RB 3OM9A 1H93A 4L07A 2O0HA 3DZ8A 4IXNA 1TKRA 3F1LA 3VPAA 2BSQA 1BHQ1 5ALTA 3EZXA 2W0MA 3LPAA 5HM6A 4PS0A 2B78A 2PZMA 1PUJA 5CTJA 2OZPA 1O96B 3TTWA 1E9RA 1O03A 1Z0UA 1Z56C 3AR6A 4RCYA 3S40A 1DXYA 1E2FA 3KLOA 4YIKA 1N2SA 4W5RA 4R9VA 2WFMA 5HFAA 5SZHB 2G1KA 3SYKA 2CC2A 5BUSA 5BSGA 5EJ5A 3KKQA 1X3LA 4Z2YA 1K0UA 4UDYX 4IFEA 3I2IA 4UU7A 1O94D 4MJ3A 1KMQA 3GEBA 1IC6A 2W2QA 1B23P 1JEOA 5BUZA 2H2AA 5BSKA 3AEKA 2V4UA 1F9AA 1U0BB 2MT9A 4REQA 3DWIA 1N0WA 2JLAA 3A10A 1IZ8A 4MDFA 4D0NA 4EHBA 2IOFA 1N2IA 3NC0C 5HRUA 5F7OA 1AM4D 1AMUA 2G6BA 1NSFA 2EC5A 4WZBA 1H69A 4C4PA 4TMTA 5HS6A 3GU3A 3MJHA 3IIIA 2GA8A 2Q27A 4LFBB 1XZMA 4EG0A 2N47A 1OOEA 4MVWA 1IY2A 1DBIA 3OPYB 4MAFA 4EG7A 5ES4B 3LF2A 4B48A 2VLIA 2H1OA 2J31A 1B2LA 4AIRA 3PNMA 3T4PA 1DVRA 1X3SA 2D7CA 1K68A 2GTPA 3AM5A 2NG1A 3E2PA 3NTOA 2D1SA 1TCVA 3OQVA 3EDQA 3M0EA 4PXSA 1IBRA 5I4KA 4D26A 2WP0A 4LWZA 3ZE7A 4PVCA 3JSXA 5KYYA 2HPAA 1I4OA 3D3WB 4ND2A 3RH0A 2DUNA 3C3YA 2HI0A 4W4TA 2Z6QA 2ACEA 3M5CA 1WU8A 1ZH0A 2TS1A 4B3HA 1XJ5A 1Y3BE 1Z5PA 1ZKDA 2O06A 4HAWA 1A69A 4OXYA 3V3TA 4XX0B 2JGJA 3L6CA 2GN6A 4QYSA 1ISPA 4MVJP 3OT5A 1JU3A 1HQKA 4LZNA 1XDZA 4KHPB 1A88A 4TLCA 2O8EA 1PYDA 4FYJA 1XMVA 4U9IS 4TSFA 2IX9A 3U81A 3VPGA 1GUYA 1UPXA 3DEZA 1UM9A 4M3NA 4JUDX 2Z9CA 1I2ZA 3F6RA 3O2NA 3N5CA 4ZEWA 5U1PA 2Y6VA 4G63A 4BEWA 3WYDA 3DDNA 3BFVA 5B1SA 3I05A 1Y8QA 1A2OA 1RWWA 3KUCA 1CD5A 4LJ4A 1QGZA 3CZ5A 2YYAA 4KAFA 4KO8A 1WV0A 4PV7A 2F55A 4N3CA 2HL6A 2VF5X 3BUSA 3P97A 1MRZA 3BRWA 2E1PA 3PPYA 4RVSA 3ZY5A 3DG9A 4EUEA 3BTUA 3LE8A 1TU3A 2UXCB 3TF5A 3VNVA 4KR0A 3GZ4A 3HP4A 4ZOLB 3LCRA 3IH5A 1UXGA 4D56A 3VVMA 4E13A 3NT4A 1GG5A 2JFXA 4KKXB 4ERXA 1L7EA 1TT5B 2PKYX 4P82A 3IPAA 1TQ6A 2OGZA 2NU6A 5JSHA 4X66B 4ZYVA 4DUGD 2ZRCA 4LJKA 5C1DA 2VXYA 2DC1A 5I7AA 3HRKA 3PKJA 1ZEMA 1U2TA 1YI1A 1VHJA 2XBMA 2Q2VA 4WLOA 2G9ZA 2K87A 4M99A 1GZ6A 4YROA 2FN7A 4OM8A 5CLQA 3KYJB 4BGEA 2C2YA 2NO4A 2NU6B 1G7TA 4IWXA 3AKCA 3ZDXB 2XNCA 4IH4A 1GCGA 1EQUA 3ZI4A 5A6VA 2WG1A 3GT7A 4RMNA 3WGGA 2JLSA 3MVEA 4XJSA 2GB4A 4N5HX 1U8TA 4QU9A 5AW0A 1VCOA 1C4XA 2P5UA 2HM7A 3OETA 1JTVA 4Q66C 5E3JA 4DSTA 4YA6A 4DFDA 2PXXA 3LNTA 3HPRA 4EB8A 1PJSA 3RSCA 3HR8A 3P2JA 2PD4A 5GZ1A 1IVNA 1LFDB 5E8RA 5H02A 5LCXA 4IDQA 3D2AA 5CUQA 5C34B 1E64A 4Q4HA 4HV4A 5E6SB 1Y6QA 5JU6A 2F7SA 4GX0A 3H9UA 5KYNA 3OEYA 3SM9A 4OUKX 4PO8A 2JGAA 4F3TA 3CZQA 1R0XA 3PA6A 4R81A 5D51S 5ALUA 4CMIA 4FJ0A 1RWOA 3DBRB 2DWPA 3IKMB 2CXPA 3P4UA 2WAAA 4MP3A 2ERCA 4P92A 2EX4A 4JBWA 1SU7A 3ZK9A 1XI2A 1JDBC 1CF4A 5A05A 4WASA 5TIIA 4I1PA 5DE3A 2AEEA 2Q5OA 3CH4B 3F7MA 1CK4A 4IZHA 5K8IA 4EP1A 5MFZA 1HDOA 4YQFA 3BXPA 4Y9DA 3UHPA 1Z6PA 3ITNA 4G5GA 5KWEA 2R6R1 4DV7B 4MI6A 2CUTA 1JHOA 5EKDA 1E3MA 1TC1A 1BKYA 4IUCS 2X8AA 3BTOA 4OQNA 1TYZA 2MSWA 3GROA 3GMDA 4Q7QA 5B7NA 2ZTHA 4NH0A 5CDUA 2BOVA 2AKAB 1A9XA 1VSVA 4BNVA 1H2HA 1MJ5A 5DFAA 5EMMA 2ETXA 3ED1A 3L9WA 4MV9A 3JR7A 5IAGA 1DG3A 4LMAA 2D74A 2HMAA 4AO8A 4BWFB 9ATCA 4JOQA 3NAMA 4Y1GA 1NBWB 3AU8A 5B1EA 4NJEA 2SHKA 4LV5B 1G2QA 3QI7A 3JVEA 4TTSA 4AZVA 5L3SB 3ZDBA 3QYAA 4MOWA 4HGQA 1VIAA 2X2FA 4RKQA 4F84A 3KQQA 4ZZ3A 4DCVA 2XD9A 4P81A 4X71A 3IODA 1R9NA 3JU3A 4XRGA 4HP8A 4TWBA 4EW3A 2J85A 2XTAA 4NYJQ 5A4JA 3M7IA 3M33A 3UXHA 1NUQA 2BKAA 3D9QX 3BGSA 2JFUA 2YMQA 3A4IA 3ULKA 1J99A 3G1WA 1B6GA 4BB0A 1JJFA 1ZRSA 2HZ7A 2XODA 3KQMA 3PXBA 3VH3A 4XOUA 3LDGA 5DP1A 3ZLJA 3P9XA 3QE2A 8GPBA 3I32A 1V2HE 4EQ6A 4F12A 2BBWA 4KU4A 1TEZA 2VN8A 3LXXA 4KO1S 2XCRB 1CY0A 5FBRB 4PQEA 1EESA 1DSSG 1OWLA 2Q5FA 4FFDA 1UJ2A 1NOKA 5A2QA 2OBYA 4W8OA 1PHPA 2JI9A 2PM8A 3C5EA 3GD7A 3M3HA 1OZGA 4O63O 1TO1E 4N9QA 3TL6A 1K98A 4LXYA 1DWUA 1PJQA 5AW4A 1ZO8A 3L7CA 3RS5A 4KVFA 1A5SB 4II3A 5JNTA 1YJCA 5EP4A 3TXAA 2QQEA 5HF8A 4E5YA 5JLJA 2YDYA 5FTKA 3LBFA 5DLPA 3WB9A 1KORA 1WXIA 2M98A 4FNMA 5ESWA 1UWKA 3OLVA 3QPDA 1NFRA 1NNSA 1SCIA 3A6KA 3NAGA 4IIDA 3TIIA 3OOWA 2ORYA 5KOIA 2GD1O 2RHRA 4MWGA 1N75A 1XALA 2P9YA 2I4NA 3EY9A 4RHEA 4F3YA 4OAPA 4HDNA 2GGSA 3MTEA 5BNIA 3L0IB 1MC8A 4MWSA 4ZVLA 4JFAA 1GRVA 3OIYA 3AFNA 1ORHA 2IJGX 1J25A 3ITDA 2G3YA 4N6NA 4NI5A 4WFIA 4XD7D 5DLQC 1P2FA 2G0TA 1SULA 5KSOA 3QX3A 4MW7A 1Z88A 1HORA 1QZTA 2PMWB 4FDMA 3K05A 4UBOA 4FFWA 1W1UA 1M8GA 3K9NA 3KYBA 3SE0A 2D8MA 3GLFA 2VDQB 5E9QA 4CUKA 2C20A 1OV4A 3AUJB 1KP2A 1S6YA 1XZDA 3GZTB 4DARA 2I7XA 2PZ8A 3GA5A 1F2DA 5EGNA 5KC9A 2HZBA 5L6LB 3ETDA 1LSOA 3PHGA 1ARZA 2VYVD 2ZIWB 4GMFA 4QQKA 3WFJA 2Z5FA 1SUIA 1I7QB 2X3UA 4BBJA 5IANA 4G0UA 4WERA 1F3LA 2H0AA 2HAEA 1FFEA 4F8EA 3S28A 1NJ2A 1OLUA 3ITKA 5JSZA 2G76A 3I0ZA 5DCYA 2SCUA 2F67A 1OW3B 3NTUA 1SG9A 1TCCA 2C9CA 2V54A 1VGQA 1L4MA 1HL7A 1ZHHA 3ITEA 4QECA 3T5DA 2EU8A 3JZMA 4MVJD 4NX2A 4B6EA 1SR8A 1GO2A 1U3DA 1UBRS 2QTGA 4LGYA 4O2AB 5E4FA 4B7AA 1CWUA 3EFBA 5ICMA 2IYQA 2XUAA 1PKEA 1YQDA 1MC1A 2VT7A 4IOLA 5DM60 2I34A 1E63A 1U7XA 3GGGA 1W8IA 3BMNB 4JBNA 4O2RA 2UYHA 3I6IA 5CTAA 4KX3A 4G9BA 3FY4A 1CUIA 1A5ZA 3CUEF 3W04A 4R2WA 4A8HA 3S8YA 4ZARA 1ZZGA 1SQ5A 1WRBA 1K89A 3BD8A 3NTVA 2WU1A 4ZO9A 5BWNA 1MIOA 1OX6A 3SN6A 1TPYA 3CG0A 3G49A 3M70A 1THZA 2QTRA 4KQ1A 3WYCA 3U4AA 4JHXA 4BX0A 4HDMB 1T29A 1Z5ZA 1U02A 3KTAB 4YASA 5PNTA 1WUHS 3WNBA 2GPYA 3GRRA 2A57A 3OWXA 2F3TA 4KLAA 4M87A 1KIAA 3ZH9B 1G8AA 1F51E 2P4UA 3A1SA 3H04A 1YE8A 5H16A 1OXUA 2QB5A 4E5MA 2RHWA 1CEXA 1EVEA 4B3MB 4RZXA 3AV3A 1TEVA 1UBTS 4A7PA 1JG6A 1XAIA 2PZGA 3SXPA 2BRUA 3GD5A 1N7IA 1G3MA 3NHLA 3O8QA 3K4HA 3TRFA 3BE5A 1RLUA 4JEIA 2C4MA 2VAVA 4KN9S 4QTTB 1KQNA 4HD8A 5EHXA 3A6GA 2P2CA 1EZZA 3DD5A 4P33A 3TW8B 1UMCB 3EPJA 4XYMA 3ESBA 3TIXB 3LL4A 2DOKA 2O2EA 2UYYA 3W9BA 1MAHA 2R7MA 5TMDA 1Y98A 4BXOB 3IE1A 3HB4X 4NG4A 2AFHB 2P8JA 2ODQA 2M6KA 3VV3A 4EY7A 5FYDA 4D98A 3BSYA 2EX0A 3ST7A 2I5PO 5A7GA 4G41A 1Z33A 2BZ0A 3LW8A 3GFOA 3WLFA 1XZ8A 3OQIA 1N4AA 1FTYA 3FPSA 2BBSA 5CGQB 3MLAA 2IF2A 2Z43A 3V7YA 3CZ4A 3HJUA 1P1KA 4OP1A 2YJ5A 3P9SA 2XUGA 1BMDA 2VBCA 1IXRC 1XCPA 5JYCA 1UKCA 3MS4A 4CMEA 4Z4HA 3ONNA 3S1SA 5JZBA 3H5IA 3U2QA 1VSQA 2H63A 4L27A 4Q01A 4UFNA 5CFZA 5K5EA 4ZYYA 1GTJ1 1G21A 5D3KA 1A1VA 5EEHA 1WB4A 3ASVA 3TW0A 1Z26A 5BV8A 3PHJA 1QE3A 4NVRA 1X7WB 1NWHA 1OLSB 1XTKA 1V45E 2C2XA 4MQFA 4YS6A 1O5TA 1IUNA 4HRVA 5J59A 2PJRA 1Z0IA 2GCEA 1J2UA 4FZ5A 1J0AA 5AOVA 5U4QA 4ENVA 5BVGA 1DAPA 2R8BA 4OGKA 4ZK2A 3S0JA 3OU7A 4FVTA 1T35A 1D9ZA 1GYQA 2DULA 5JD3A 4Z86A 4YAWA 5E4JA 2GWRA 2XUJA 3AB7A 3HDHA 4J94A 3TTSA 1ZD1A 2AK3A 2IPNA 5KJFA 2WKRA 3OIFA 3CH5A 4WTOA 4KL8S 3ZCTA 3IP8A 4C08A 1YC2A 4L15A 4AF6A 4BE4A 5A9SA 5AUNB 2NWQA 1L9XA 1RPZA 2E48A 4IVRA 3TQOA 4EGQA 3R5TA 3WDSA 1JG4A 5HJ7A 1DJPA 1JIKA 4EB3A 1UP6A 2FWNA 5IBRA 3MWGA 2B94A 3KT3A 1S96A 3JD1A 3T1OA 2O7NA 3M6LA 4PR3A 3QEJA 1SN7A 4J0DA 4HN4B 3IRUA 3F71A 5BQFA 1UFKA 1UZUA 5I45A 3G2MA 4N8DA 1AQ6A 5ILGA 3D6TB 1J0DA 2C59A 2K6GA 1E7SA 5EJIA 1CUAA 2RAUA 5EINA 3PQ6A 3UG7A 1DRVA 4OSPA 4C7BA 1LDMA 2ZIVB 1CZUA 1GL6A 5GONF 3TBKA 3W6PA 4BLOA 2X8WA 5K8CA 2IU3A 1M1YE 4YP0A 4DNPA 2GILA 1AK1A 1ULZA 3D64A 1KYIA 3LDFA 4PC2A 4UW9A 4DQUA 5B3JA 1CYEA 3KT6A 4Y1FA 4NWIA 4QXQA 1KOFA 1E5LA 3UXMA 1NW7A 1VLZA 3UJNA 4E94A 2AMLA 3KPYA 4Z1MD 3PD1A 3UHOA 2AE2A 3ISTA 2OZKA 3AHIA 2B2NA 2EL7A 2A3NA 2GT1A 2QROA 3G7NA 3MS7A 3PI6A 4X9XA 3KSAC 4M7OA 1WG8A 2Q1XA 1QV9A 3HA2A 4RXTA 5J1TB 4HVAA 4DYDA 3S1AA 3FUCA 3H05A 1DU4A 3A27A 4J7CA 3F98A 3IP9A 2WY2D 1JU4A 2C8JA 3MD0A 2FSPA 4KC0A 4KGVA 2YJZA 3WLLA 2H06A 2VSFA 3MMZA 1E62A 3HLTA 5AJZA 3LPLA 2D7JA 3UAXA 3WK5A 1LBQA 4KQXA 4TWJA 3EXFA 5DV9A 4ALNA 4RADA 1MR3F 4JCOA 5EE0A 3EA0A 1HTTA 3RVBA 3TQHA 1XB2A 3UAVA 3ZJUA 3DOUA 2P27A 3IQDB 4M46A 3PZBA 4HDCA 3ZWYA 2VHQA 2WVGA 2CJPA 2NZWA 2V0NA 2VSNA 1NQOA 1PR9A 2PH3A 2J3HA 1WNTA 3N8GA 1B16A 3EBPA 4HWRA 4BO3A 2FPXA 2R44A 4D97A 2Y4NA 4XYBA 3FYCA 1DZIA 2XQIA 1IDN1 4OMUA 1JSRA 1I51A 2PPLA 2A92A 3MHPA 3U7FB 4N0EA 1W96A 2XB6A 3VAYA 4BWVA 4EABA 2XTNA 4HEHA 4EHLA 4CRWB 2QRLA 1FMFA 4M9QA 5IAAA 3OFND 1G59A 2YW2A 4HFNA 1NPDA 3VVLA 4C5AA 2O8VA 3ZWAA 5REQA 3DYBA 2YQ4A 4P86A 3RLIA 3ZX5A 4E4RA 3GFQA 2J09A 1RBMA 2R85A 3EZ6A 4WOKA 5THXA 1F7UA 4E21A 1Y7PA 2WM9B 1DXHA 3N2GB 3BA6A 3IVGA 3JZFA 1VPVA 2NVOA 3TS1A 5T4HA 2XGJA 3N58A 1XRLA 2EWMA 2J3LA 3RWBA 1IRIA 3CJRA 1OFGA 4EG1A 1M8FA 1EFPB 2L19A 3WGUA 3PFWO 1WE2A 1V5IA 1ZGHA 221PA 1KARA 3LWNA 1H5QA 3JQFC 3BD7A 5GINE 1RQPA 2RHTA 2J9ZB 3HCRA 4F0JA 2EZ8A 1K8XB 4M7RA 3VR5H 1VL0A 3G1TA 1CVRA 1L7VC 1AKMA 1TW2A 5TNXA 3SJUA 2IYOA 3KXLA 3P0JA 5EJ2A 4WNAB 3ZKWA 1EM6A 1GZDA 2Z6VA 4UCXA 4YCCA 2QRZA 4ZI2A 2C1ZA 1SWWA 3UK0A 1GADO 2IKSA 4MPRA 3HEAA 2FMHA 1W44A 1X2BA 2PT5A 3JQ7A 1KY5A 4G4SP 2PXAA 3ZK8A 4EAQA 3K9FC 1ISGA 4KG7A 4WXRA 3F9IA 3B9PA 4OD0A 1L8AA 4O4HF 5J2TF 3UKDA 4BQSA 1XTQA 2BEUA 2HR1A 1AX9A 3L1HA 2EDCA 3C4VA 4J4HA 3EGXA 3GAAA 5KWSA 2XGGA 3OTOB 4BFSA 1GCOA 1W5SA 3KOMA 5EIBC 4DQ0A 1JLRA 1ID1A 5JMPA 2GO1A 2FFAA 3U7JA 1I33A 2F8TA 3LRXA 4MMZB 1L5VA 1SEVA 4DR4B 1NF2A 3DA8A 3DTVB 3V4SA 5B4UA 3L6EA 1EGQA 3ZGYA 4BCDA 3V00A 3R7LA 1CY4A 1VIVA 4UCQA 5CDFA 1U2QA 1S4QA 5C81A 5F73A 4GNRA 2YIVX 4R8VA 1AQNA 1BA3A 2YXBA 2HNBA 5K8TA 2PQ6A 2ZREA 4M89A 1XROA 2EXXA 3EUWA 2R6HA 2CXSA 1IL0A 4NY1A 4YCBA 2AI1A 1I2AA 3LPMA 4AMYA 4EI2A 3DOCA 5FULA 1NBMA 5CBKA 4ASUD 1QLWA 2A0XA 4ZTBA 3HBAA 3ML1A 3KNZA 2BFAA 3IBFA 1GNLA 3H6KA 1RWQA 1UZAA 1L1EA 4OFZA 4AJNA 3HPQA 3AF3A 5KCZA 2XKKA 4S2EA 3IAS6 4D4MA 1N2ZA 1LZLA 1WUIS 1LA2A 2YBEA 2CBGA 1P4JA 1G2IA 1RHUA 3F9CA 3LXRA 4HB4A 1P3DA 1VMKA 4V2IA 3U3DA 3UFXB 3PD0A 1S2MA 3HCFA 3CPEA 2NPFA 4O4IB 4BKQA 2Q21A 1IWPB 3RNOA 4LCBA 4CFYA 1NTRA 2OUKA 3B1FA 1GY8A 3D8NA 4DC9A 1RWVA 3IKVA 2AW5A 2VF2A 2XD4A 1JLLB 3V3KA 1VI5A 1AF4A 3DYIA 1YS7A 3GB9A 5P8WA 2ZCVA 4YT2A 1CUYA 1XK6A 1T0BA 4M9ZA 4GLOA 4NBKA 5JC1A 1IIRA 1SG0A 5EXEA 4E5DA 4O25A 3TQFA 2AFRA 1X2EA 1XNJA 3OEWA 2EGUA 2C9DA 4F3CA 4GKBA 3C8DA 1KERA 1IBSA 3H3JA 1KAMA 3BWVA 4BIIA 3L6UA 2GOYA 3PI7A 1CJUC 4MA4A 3RUDA 2XRFA 4EW2A 3KQLA 4HVCA 3WMWA 2A59A 1W19A 1GQSA 4Z4IA 1ZY2A 4R7ZA 5JMWA 4IINA 5HIMA 3WNDA 5B6PA 4R1SA 4AECA 3AEXA 1PKXA 5TQ0B 2ZR0A 2I1LA 4WLNA 4JJKA 2YW9A 3SEAA 4B4OA 3WLNA 2Z1MA 1J9GA 1MU0A 4MR7A 1NVFA 1E3WA 1UIMA 2PKQO 3DHEA 3WJ2A 1DAKA 2BUCA 2O6LA 1XTPA 2C3YA 3BAFA 5UKDA 4C30A 5IJWA 3P9KA 5FWYB 4JEMA 3HC7A 2R8XA 4PZYA 5TY0A 5IRCD 1XZEA 3THYA 3V7NA 4OOFA 4LTNA 4DLAA 1IOWA 1QRAA 2PGJA 5A5GA 1FYEA 1CE8B 4H6PA 3EBOA 1KRHA 1SQ0A 3PFNA 1FSZA 3GZNA 4FC6A 2C98A 2R6CA 2VHYA 4D3DA 1RRPA 1QWSA 3QEBZ 2CCJA 3DZCA 2BIFA 1SO8A 1EHCA 4HLUA 3I53A 3O31A 4OATA 3ICQB 4LXTA 1KO7A 2F1HA 2Q6OA 1ZM4A 2H57A 2WIFA 4JJGA 3MQ2A 3UV6A 2BYTA 4L3OA 4WCFB 2Q1SA 3HCDA 3Q6NA 1DX6A 3ZHTA 1N6KA 1GM5A 1O9GA 3VR6H 1RXCA 2IW1A 4Q16A 3GNSA 4D92A 4ZYZA 4TUYF 3JALB 3GJSA 4RTLA 3VPHA 3EIQA 3R41A 3NOXA 1JTFA 2HJ9A 4LF7B 4K8OA 3F6CA 2PWYA 5DEIA 1HXHA 3I6YA 2O2HA 4A26A 4BAUA 4BP3A 4DUGA 3CEJA 2J46A 4IQFA 1P2TA 4RULA 3ME5A 1T3LA 2BM8A 2O2GA 3FUWA 4NAVA 5A4AA 4GQIA 1J7JA 3AYXB 3E7PA 1GG2A 4DSZA 2GAIA 3BICA 4CCAA 4FXPA 2OOSA 4L73A 3F5QA 1ZIDA 1GGHA 4UUBA 3D8BA 2WA2A 5IXJA 5TQJA 2HCTA 3THYB 4PYJA 1RU3A 5C1PA 2C8KA 5IAEA 2OECA 5CU7A 1SVSA 1ZNYA 4RL6A 3V8VA 2O5CA 4Z3KA 4QUKA 4RVUA 4COOA 4Q3OA 4RVDA 2OO5C 1CEQA 2N3ZA 4YRPA 4K46A 3J80A 2QOEA 3SS7X 2GTHA 1Z38A 4N47A 2G07A 3HVKA 3ND6A 2GA9A 1SQSA 2DH6A 1ZVVA 5K8VA 3SU8A 3H86A 5KDDA 3WA7A 1DKQA 4TSFD 2LVBA 2IT1A 2UVQA 5GJVC 3KB8A 5BRAA 5F3RA 1ZGZA 2CVQA 3AVQA 3G89A 1NOIA 3NDJA 4GRAA 4JK3A 1ICEA 3EXHA 3ZIAA 1HO3A 3VKFA 1B2RA 3VVCA 1HY3A 1L4UA 2IIBA 3H2BA 5F12A 4KOEC 1CZRA 2OC9A 3IUJA 3NVDA 2WP8J 1H9CA 5CFOA 2KBEA 5FUQA 2OHXA 1K4KA 2BT4A 4FSXA 2PA0A 4JP3A 3VDQA 3SVTA 2BI7A 2IYRA 1SBYA 1AGPA 2A9RA 3DHVA 4D9JA 1GLVA 3K6RA 3R8FA 1VHDA 4BPBA 2BTOA 4QGBA 4FC7A 5HWSA 3QMMA 4X1IB 2FWAA 2ATEA 4C4ZA 3VFDA 4GBGA 4OHZA 1PGPA 3M3PA 5JAIA 1K88A 2BGMA 3GJYA 1O95A 1KBQA 1Q15A 3QTBA 4OVKA 4JLWA 1HE8B 3GEIA 1ISJA 1QOPB 1KO5A 2Y1CA 4CW7A 1SBTA 1XD9A 4PVDA 3BB3A 5J47A 3FFBA 2IUSA 4BECA 3MOIA 1XNGA 3WLHA 1D6NA 2Y0EA 2O3QA 3ANSA 2SKEA 3C8MA 1E7WA 4ZMBA 4LXGA 2YS6A 3WX0A 4YRDA 1D0SA 5NULA 3DO8A 3A32A 2BKLA 2HRZA 3NIFB 3QU5A 4OXIA 5AW2A 5ALZA 1D6JA 4QODA 3FLBA 3CVXA 1VMAA 1PSWA 1WZNA 1V4NA 3MJSA 5EA2A 2ZI6A 2VH1A 4GOLD 5E8JA 4JKYA 2OY0A 1TQ4A 4YBZA 1R6XA 3PC7A 4XOIA 3PWZA 4G25A 2H17A 4CCYA 1N36B 3EPHA 1UBGA 1QP8A 4RCZA 3PNQA 1EFHA 4OQYA 4UTXA 3U37A 4NYMR 2KHZA 1GR1A 1T5LA 3EZLA 2JLZA 1FU4A 4M0KA 3HGMA 3W6OA 2V5VA 1TE2A 3AW8A 3KAPA 4PLPA 2ZZKA 4D6PA 3KCQA 5K03A 2I03A 2BH2A 3K2QA 2A8YA 1M5RA 2L42A 1PR0A 5AXDA 4KNYA 4MGZR 3EQ8A 3NGLA 3IILA 5JPIA 4WECA 3JQCA 5JJCA 5TGTA 1GXSB 2FJ0A 1WIWA 4WHMA 4E07A 4B4VA 1D5WA 1WXGA 2ZTSA 4OHMA 2IYLD 1GA1A 3BXHA 3CZPA 4WZBB 4Y7DA 2R86A 2FRXA 2COKA 5C7OO 2F3QA 2NXJA 2BD0A 2QGNA 2ZBEA 3E61A 5KMGA 1TTTA 4DLTA 4II2A 5HHTA 1FQKA 4BYMA 4F5DA 5C1IA 3CF4A 5FI3A 3ZLVA 1V5WA 4GX2A 3IV6A 3ZTYA 5FYQA 1RM3A 3U1VA 1OBCA 2YVAA 1M8KA 3FBWA 4L9WA 3GVCA 3KFXA 3D4IA 4E5SA 5D3MA 3RFUA 1MX3A 3FF4A 4ZOCA 2JK1A 4XIIA 3DONA 4DIBA 2HMSA 1IK6A 1K97A 3KQVA 1EQ2A 2RGGA 4EITA 1T8PA 3AUXA 4TT3A 2XZTA 3MAJA 2DSNA 2O5RA 3DT6A 2BTEA 3ZZNA 3K70B 4HDKA 1ZVMA 4NOLA 4RKYA 4COKA 1DT5A 2B1QA 2F17A 1RHKA 2AVDA 2OB1A 1JYSA 2IXAA 3T5BA 4CR8A 4NNOA 4MMXB 1U2DA 1LQTA 5KKAA 3B1WA 2C3MA 4WKBA 1FNNA 4Y67A 1TI7A 1ORVA 1H0SA 1Z75A 3DS8A 3R4VA 2PGOA 4RFVA 2C84A 4B5LA 3KSDO 3N86A 3T3PB 5F23A 1Q17A 3TW8A 3CLTD 1VG8A 2UXDB 3U4MA 3DDCA 3SXUA 5LC1A 2HC9A 1TZCA 2XVYA 2YRXA 5EERA 3PXAA 1YWGO 2REXB 2J9GA 3WYEA 5H5JA 2ZB7A 1U1CA 5BMVB 1XRRA 2VHUA 2HA4A 1VIMA 4Y2JA 2R7KA 3WLPA 1U3WA 4L6CA 3G9QA 5E9JA 4A8TA 4BMYA 1VG0B 3FPCA 2XXJA 1CJTC 2NAPA 2W6ID 3S70A 3TGWA 1GFIA 1D4FA 2C5BA 1WZEA 2EWVA 4I4CA 4H4DA 4U2FA 3RC3A 4ETNA 1EVQA 1N6LA 1T9GR 5LXTF 2A0WA 1LLQA 3A2NA 1Q2UA 1QCYA 3KYCA 1BW9B 1JHAA 1Q84A 3FZEA 4RPIA 4TZ0A 5DHQA 3O3MB 5A4DA 3WRVA 3IMGA 3GVHA 4MQUA 3GGCA 5CM2Z 1BE0A 2ZBVA 4IXMA 1RPNA 3SHTA 1DUIA 2ZFUA 5HJEA 1FP1D 2PXHA 2VUSA 4YRQA 1OXSC 2IZZA 1I3OA 4HSGA 5JFTA 5JT1A 5DNYB 4BX2A 1ZISA 4F9EA 3KXDA 3AIMA 3FE2A 1B74A 2H59A 3ZDAA 4KPYA 1KR2A 2GBLC 3QHQA 1UMDA 3OJEA 5C37A 1CUFA 3SIPA 2F8SA 1G291 2PZBA 5CX1B 2ZT8A 1ONPA 1ORTA 2G5CA 1CY7A 3CUUA 5AXBA 4EPRA 1YRBA 3K1AA 3PGVA 5FADA 5DULA 1KL7A 1EZ1A 3COZA 4Z99A 4QVKA 3EVDA 4L4ZA 3BD6A 3QVLA 5CPFA 4B31A 2G04A 4GE0A 4POAA 4KQ2A 3VZCA 1KFKB 4W9NA 3LTNC 3D0KA 3L84A 3QWHA 5EGSA 1YXMA 3WSVA 4S35A 3LH5A 2D8AA 3IIJA 2E1RA 3INRA 4YT5A 3SF0A 2QRQA 4DWOA 5KOHA 1V8DA 1TL7C 1W49A 4H2DA 4V3BA 2OA0A 3OCXA 4A92A 2CCKA 2WC1A 3C3EA 4L95C 4LSMA 1I6KA 2HFJA 4NCKA 1QRSA 2G5GX 2IEBA 5EUCA 3KPJA 2J8ZA 1VRVA 1ESMA 3SFVA 1KYTA 4V02A 3D7RA 2DT8A 5JS2A 4CIDA 2P6MA 2C94A 3WIBA 4DNQA 2GZHA 5LBIA 2IYVA 3M49A 5KYUB 3LGSA 4D7AA 4XVUA 2MYPA 4IF6A 1EVJA 2R1UA 1PJ3A 1WQ4A 1U3CA 3U7IA 1MJGA 5A62A 1U0EA 2Z2ZA 3QI2A 2GBPA 1QPBA 2IHUA 3DWEX 5HIAA 3RC8A 2PQ2A 1KK2A 3QUQA 5FO1A 1EDOA 2GHQA 2DBZA 4B4UA 4CTNA 2ZZMA 1JLMA 1NQAO 4N65A 3K31A 4KDRA 4BE7B 5IF3A 3G2JA 3KR1A 2B4YA 4KHZA 5IFKA 1VG1A 4MKHA 3KQUA 4Y9UA 1D2HA 3I9OA 4A2PA 1KFBB 5JNSA 3LQQA 3OZTA 1M74A 3LK7A 4RGBA 1KI6B 1KGDA 3RRXA 1W7AA 2FW8A 3HXMA 4B85A 3HK2A 2ZVJA 1J21A 2RI1A 4BQNA 1MAVA 2W6QA 1POXA 3OCCA 4IIJA 3KLNA 2X1MA 2IHKA 1DEHA 2HU5A 2OGTA 3Q5EA 2PX5A 2O8BA 1O6CA 3PGJA 3WNCA 1N1EA 2XWQA 3OJWA 4QBGB 4BL5A 4C7OA 4N8SA 5ELXA 1ZJ4A 3QXSA 3H2KA 3W4KA 1X9GA 1XAGA 4TRRA 5I7HA 1PVVA 1BKSB 1GOTA 1P0FA 1YJQA 3QF7A 2IWRA 3M4ZA 4IDOA 1RS0A 2VPTA 4N6OA 1NW9B 4WA8A 2WIAA 1WHTA 3LVQE 4I8DA 5EP1A 3IAXA 5LKRA 1JWLA 1NXQA 3LX8A 2B1RA 1D09A 3LUCA 1L4GA 2H9AA 1P9WA 2JIZA 4NV3A 2DQYA 4QJ5A 3O7WA 3GRAA 2CXQA 5JECA 1C9DB 3I1JA 3N0WA 4UOQA 2YQZA 2NO9A 3EWAA 4Q4JA 4HWOA 1HZZA 3C3DA 1IN8A 4AAYA 4Q1EA 1AV6A 1PZGA 2AB0A 3NM5A 1K86A 1AHIA 4LSZA 4OKSA 2WU3A 1ZN9A 4KXMA 4MW9A 4F45A 2X13A 1BCRA 1H5NA 2QL9A 2D54A 4D8VA 5DM1A 1M1YA 1J8YF 1Q7CA 1RPJA 3ENQA 2V9ZA 2OPHA 3DL7A 1N78A 1FW6A 9LDTA 5L4NA 1Z4QA 5I8PA 3EXG1 1KEPA 1N3BA 4M0PA 5GTDA 4N48A 2PKWA 4MRRA 1SKAA 2X42A 1TFRA 2XIQA 4P5EA 2VP2A 4H9GA 2XDQA 2Q3EA 3PHCA 4C4OA 3EX7C 4JI2B 4RZSA 4LHYA 3I2JA 4DNOA 1FPMA 3TQIA 1Z2AA 2FZCA 4WXMA 4P3KA 2BHNA 3NJ4A 4CTJA 1VL8A 3F5FA 1OV6A 4F86A 1HT2E 5DM0A 1FDIA 1LLUA 2BY4A 3M82A 4I50A 1E0AA 2PX3A 1H2BA 2DP4E 1J7KA 3KSRA 3BQMB 1VE1A 3GJ6A 1WLSA 3TR5A 3UTDA 3WBFA 5BQ3A 1R4MB 2QUJA 1YCHA 2X86A 2D2FA 1VFPA 2ZSDA 2ZBFA 3CRQA 2CF6A 3K96A 3U9LA 1ODIA 1W1IA 3BM5A 3EZFA 3KJQA 3TE6A 4IZIA 2X6RA 3MAAC 1JECA 2FTKE 3I30X 5ESRA 1U8FO 3M5DA 4JAVC 2FZ5A 3WIEA 2G8LA 1XHEA 1SZDA 2YWGA 2EKQA 3Q1KA 4AXXA 1H85A 2ZTUA 5TGZA 3GGJA 1V4VA 5CA0B 5TGDA 1GGFA 5F78A 3UOAB 5KINB 5EIFA 1T2DA 1XEAA 4YAFA 2ZITA 5JC8A 1NN5A 1QK5A 5HF5A 5A0VA 3FNFA 2ACKA 2JNWA 5J5CA 1JHVA 1M2GA 2YMMA 2ZI3A 5AM5A 1DC5A 4S05A 5AVWA 5LFAA 4UHJA 3A3KA 1FDTA 4IV0A 4JUFA 4S24A 5L45A 4AI6A 4BO2A 4DXHA 3ZVRA 4KWHA 1ODKA 1EAMA 1JNYA 1TLLA 5C8YA 3H5LA 4PX9A 5FOXA 2X41A 3B38A 5ALSA 1NAIA 1IYZA 3KAJA 3NGXA 2PPVA 3SZLA 3T1YB 1H2AS 1LLCA 4UULA 1TRHA 4WJZA 4OQFA 3K2BA 1LS6A 3KTOA 4MUYA 1OB5A 4EGSA 2QD3A 2OHVA 3E35A 4RFSA 2W93A 4TZTA 2RSLA 3KKNA 3EE6A 1J24A 3GLFB 1VPDA 5TVKA 1R00A 2HJVA 3CPHA 3K8YA 3NZEA 3SBEA 3HKCB 1R50A 5M3BA 2C57A 3C3WA 5DT2A 3WIOA 4FDVA 4YRZA 2XMBA 5BQXA 4EPVA 1I7PA 2QE6A 3TSCA 4WBNA 2UVPB 1X9HA 3TRKA 3OX4A 5DNEA 3A9RA 1YR9A 2O8CB 2O8DB 4QUJA 2ZM6B 3TD2A 5LDHA 1XZIA 4WY5A 5H82A 4C2BA 2VCEA 2OO5A 3R7NA 2O4UX 3MIIA 3ZKAA 1XTIA 4NQZA 4OJNA 3DNPA 4B34A 1OH7A 4CKBB 2KWIA 3ORSA 4TYYA 1INLA 4G26A 3R0JA 1KZ6A 4S2UA 1OC4A 5B30A 1TCUA 2AF3C 4HNSA 5E7JA 1M1ZA 2VDWA 3O73A 3PR1A 4H17A 3DZIA 4D02A 4HNGA 3F7NA 3AVUA 5DSXA 1UZNA 4EGCB 4D2IA 4EJ6A 2NO0A 3OFKA 3BJEA 3OH8A 4TN5A 5CCDA 4F1KA 2DJIA 3ADOA 1AS0A 3F5DA 2ZE8A 3D4LA 1J8VA 2RBKA 3T1QA 5AI5A 3W2GA 1ODTC 2CBXA 3EEQA 3PFHA 4RUKA 1JZTA 1ZQ9A 4CUJA 1GSOA 2PTHA 1OYYA 4A9AA 3H5VA 3H8VA 3E2MA 2ZJ7A 3CNBA 1H0RA 2YY7A 4Z2AA 2BMEA 3VTAA 1NI4B 4LMPA 2P4QA 3G5AA 4RZUA 1K27A 3T6KA 1H6DA 3K1YA 3VNBA 3W5CA 1QVRA 4XVRA 4ENPA 2QSJA 1J07A 1YVEI 4BNXA 2DFTA 2V7WA 1XZBA 3WKEA 3ZWKA 1IB0A 3REFA 3MN1A 1NF8A 1DWPA 4HQKA 4XB1A 5KNDA 1IE3A 2B3TA 5FPYA 4R31A 3IO3A 3BAZA 4EG3A 2V9CA 2VBFA 3O4JA 5EEGA 4Q9IA 1CJSA 4E2WA 1P9OA 3WMXA 3ZDFA 3Q7SA 3L8FA 1S2LA 1A3CA 4DLWA 1T6YA 1X70A 4IJMA 4LXQA 5DBOA 2XGOA 4WKCA 3WK7A 3T15A 1R6UA 3RREA 3U80A 3CEAA 3MFYA 4IH1A 3UMVA 1EZ4A 4BRZA 4DY6A 3GFVA 2GXUA 1EJ6A 3AF4A 1K7SN 1FP6A 4NYJR 4RZQA 1UQUA 1VSTA 5CA1B 1XYVA 4CEJB 4E7OA 1XPOA 5E1OA 4G1FA 4LY0A 2HMWA 3EISA 4FT2A 1ECCA 4DWVA 3WNVA 4KLRA 1OAKA 2O05A 3QRWA 5IBQA 1C3OA 1M0EA 2NZVG 2P69A 4MS3A 4R40A 4EHKA 3OQBA 4IF4A 2K5UA 4J9UE 2CXUA 3NHMA 4JJEA 1YL5A 4NE2A 2FWPA 3B9RA 3D5QA 2ODEA 5JSYA 1SVUA 4EATA 4EKYA 1S8NA 3KQYA 4XWTA 3KEOA 3TFWA 3AR9A 1W2HA 4D3SA 3TSWA 2P6PA 3S8EA 2OESA 3JWGA 1TLTA 1V1RA 3EH1A 3NNSA 4EZBA 1C3OB 3N3BC 4RC9A 5LL6P 3H5NA 5EE9A 1UOQA 3RRZA 1V8FA 2PV7A 3RVSA 1PJZA 1VKJA 2VDWB 1J9ZA 5AJHA 5JCOA 4ZI5A 5CA0A 1X0XA 1DFHA 2JRCA 5SICE 4R6XA 2BLLA 5KNDD 4LY3A 2JFWA 3A3NA 3OUTA 4F93B 5JCZA 4HMOA 3GLGE 2J7PD 1E6EA 1NZJA 4HO1X 4ZDJA 1ZW1A 5B3KA 5IDXA 4WN9A 1NMQA 5SV2A 4A6XA 3ZY4A 5HPYB 2JI6A 3CUWA 1NVUQ 1IY1A 2FFHA 1DINA 4BUZA 3PGKA 1DC4A 1HURA 2JEZA 3U3JA 2P5SA 5JRDS 3JATB 4EG8A 4QULA 3E3OA 1P1HA 1I6MA 3D6JA 3G3EA 3VJMA 4ACBA 3TZQA 1S2NA 3DMYA 4DY4A 2G09A 4R1NA 5CURA 3DFFA 4JASB 2I7VA 4TMKA 2JKYA 3BFKA 4IFBA 1ONOA 3RU7A 1RI1A 4KN5A 3PQFA 1QIHA 2IXEA 4FQ8A 4I5GA 4YMIA 5GGXA 5JYEA 1OGYA 2ADMA 4HKTA 3T95A 4F56A 3MMNA 2UYOA 2V98A 2B8WA 1FDSA 2QU8A 1EGMB 4EF4A 1K3FA 4FYIA 2PUHA 3AY7A 1WSDA 4KQKA 3TPFA 3WTBA 5BP7A 5CB6A 2A94A 1SK9A 3TLGA 3BS4A 1BFDA 3CNHA 1QV6A 2YJNA 3U62A 4HAXA 3TEMA 2BCEA 1ITZA 5A3VA 3KR9A 2FXIA 2LW7A 3ADKA 3QP9A 4REMA 3ZIUA 1JP7A 2G17A 1Y0BA 2D0OB 4J43A 5GONB 3GPLA 1R3DA 2QMOA 1NGSA 2DBVO 3HWX1 4AZ0A 1RQ7A 3AP2A 1WXEA 2VRCA 4JQOA 1QC5A 2WQ7A 1T8RA 1YNSA 3SQXA 1QOQB 1MXHA 4RY2A 4IKOA 3IC5A 1DLJA 2QDXA 2JGKA 1XRNA 1Y80A 2X22A 2ZUBA 3OPXA 3T3MB 1HZJA 2WWXA 3WKCA 1E5VA 1NURA 2E4YA 2HJRA 2IP1A 4N3GA 4QGFA 3RC7A 3ZZTA 3MBKA 2RKBA 4ZIRB 3FTFA 3FIJA 4WK0B 1PFQA 5T67A 5CFRA 5KYWA 1JIQA 3AUYA 1WB9A 1R88A 2HU8A 5JIBA 2FZLA 3VH2A 3VNRA 2HV8A 3L4SO 3C6YA 3V1LA 4NJMB 2PG3A 4FHZA 3V4RA 4A36A 4AP6A 1SHJA 4QQRA 5IC6A 5KHAA 2CHEA 5FL3A 1VPWA 3NWBA 4P93A 5EYPB 5GM1A 3UNXA 1QANA 1PL0A 3T1NA 3MGBA 4FOPA 5IJ9B 1EXMA 4KIUA 5ITVA 5JUWA 4GZMA 5GJCA 2B1GA 3HCAA 3L7JA 3F3YA 5HJ5A 5C1OA 2J45A 2VDRB 2XEXA 1UFOA 4F4HA 3VI3B 1X1QA 1E2UA 2QJFA 5CT8A 4JI6B 5A4FS 3NO4A 4MV7A 4BRSA 2LTAA 3PF8A 5CRIA 1PYGA 1FVFA 1RYDA 3PD7A 2HLDA 4OIFA 3SD7A 3DC7A 4X24A 2F3PA 3VYUB 5A7FA 1Y5RA 3X2EA 3CINA 4ZEOA 5HQJA 2AUNA 1FUUA 2IC5A 5EPUA 4ZZ2A 4XDGA 5JALA 1WEKA 4YMVA 1HTBA 2IYUA 5IDVA 3RJZA 2PRZA 3A9CA 3LIIA 4R9RA 3WLOA 5TMPA 1L8LA 2HA0A 5TQ0A 2HWYA 1EK0A 2EJCA 3RUAA 3KQKA 2ZPTX 1WCYA 3VGJA 5AJUA 1DQYA 1D7OA 3FH0A 3DAPA 3IPRA 4PWZA 5TQ2B 4E6PA 5KWVA 2V3CC 4PBRA 1U7UA 2O2IA 1U9JA 4IDEA 5JWRA 3QFHA 1ABFA 2W6NA 3K9GA 1GL3A 4NPAA 1I0ZA 2DPLA 2H0RA 3P2EA 4RMIA 1NVVQ 1XG5A 1YQUA 2H5JA 4AJIA 3PA8A 1TTPB 4HXGA 2M1XA 2JLQA 1I1NA 3KVYA 1FSFA 3R23A 2WT8A 3HJTA 2CKDA 5T8KC 1VP3A 4MKZA 1WQ1R 3FHLA 1A27A 1YRYE 1MH1A 2NQTA 2CK3A 3I34X 4FIDA 3FKQA 3KS9A 1U9IA 2XWPA 4UBMA 5FIUA 4A6DA 4BZXA 1LXCA 2RG7A 4UE3S 3R3VA 3HJHA 1NN1A 2XYRA 2NXCA 1A8SA 4TUYA 4QBFA 2HUPA 1DAOA 3GRKA 2IHJA 4HNHA 5AI6A 3S6JA 5FH9A 2I54A 1L5HA 4I6GA 1Y3CE 4TV9F 2RGWA 1ORDA 2HHCA 2OCBA 2PGAA 4WN3A 3LY5A 1RPTA 1UKVY 3M6IA 3ZGVA 3PE4A 2GZMA 4XUGB 5CJJA 2ADOA 1S3GA 2O1SA 2YHBA 4HQFA 1PVDA 3W2HA 1G3RA 3DE6X 4TS1A 3KTFA 3PLNA 4FZVA 4AS3A 1BXRA 2LUOA 5IU6A 1CQJB 5LWHA 4KPUB 1TU0A 1V11B 3GHHA 1D4AA 2DUJA 4ML3A 5D2CA 5E6RB 3L46A 5HG0A 1M5UA 4TYPA 4J0EA 5BRJA 5EHZA 2GK4A 2W9XA 3MW8A 1Z4MA 1NVKA 4RK5A 2HA2A 4M88A 5FDFA 4OX9B 5EHGA