1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
1FSPA 3CZ5A 4RKQA 3EGCA 4LE1A 1ZVVA 3H5IA 1T34A 1ZDMA 1NXPA 2E4XA 4JA2A 5EWMB 3OLXA 4W5TA 4JP1A 1MIHA 5T3YA 3QX8A 3NHZA 2CHEA 2R25B 2QVGA 1L5YA 4XARA 2MSLA 4EGSA 2MSKA 5TPZD 2WJWA 4MQFB 1D1QA 5IULC 2ZWMA 3QX9A 1PEYA 2PMCA 4RWEA 4CBVA 3KLNA 3O1JC 3OMWA 1PUXA 2QVCA 1EWTA 1CHNA 4LE0A 4RZSA 1NATA 3DGEC 3VNAA 3IPAA 2WMYA 1MB3A 3RVPA 2F8TA 4QYMA 3NNSA 2GX6A 5CNIA 3CKMA 5IEJA 3H5VA 1JBEA 1Z18A 2PLNA 3IP7A 3Q7RA 4IRXA 3F73A 2JVIA 2WJAA 3O75A 4IILA 3RVLA 1FFSA 2GWRA 1QO0A 1DRKA 3JPYA 3TX6A 1JLKA 3SY8A 1NXTA 3K4HA 5EWMA 2R47A 2QV0A 4MS4A 5FWYB 4KPYA 1RXEA 3HSYA 4XAQA 3N0RA 3A0UA 5KQGA 2VUIB 1BDJA 2PJUA 3IPCA 5TQ2A 1JDPA 3SM9A 8ABPA 3F7NA 3ILHA 3IP5A 1A2OA 4NV3A 5FWXA 3RVQA 1Z2DA 1CEYA 4XASA 5HKOA 4FE4A 1TM2A 3I5AA 4RXUA 2R4QA 3RVRA 4WXEA 4IMJB 1JHZA 1WETA 1DG9A 4QICA 3E3MA 4F11A 3HM9A 1ABFA 3BBLA 2FN9A 2JVJA 2HQOA 5JNTA 3BILA 4PZ0A 4HNRA 5TQ2B 3W9SA 4ZMRA 3HEBA 4LRQA 3DGFC 4XXHA 2IYNA 2L2QA 3DZDA 4YO7A 1D2AA 1LJLA 3QLUC 3QEMB 4MS3B 5TE9A 3ROFA 2PUAA 1JYEA 1GUDA 5I4CA 1U8TA 2FN8A 4F12A 2GKGA 2CD7A 4TLLB 1APBA 1DBQA 3HV2A 1UDRA 1LK0A 2E4ZA 2QR3A 2P4UA 3OLVA 4MS1A 2MYTA 5B3JA 2JBAA 1Z25A 4G0MA 3LUAA 1M2FA 3CRNA 3M6MD 2A9RA 4JB0A 1YK1A 4O1IA 4W5OA 3NNNA 2JBAB 4B09A 5KQLA 3G1WA 4TLMB 4PICA 4JB2A 4WT7A 4DN6A 3HXMA 1TLFA 1YMVA 1USGA 3RVKA 4Z4FA 3D02A 1JWLA 2IKSA 1YVUA 4N0PA 4Z4CA 5BQ3A 1EAYA 4Z9BA 1W25A 1SD5A 3NHMA 1QPZA 1JL3A 3HCWA 4MRMB 2OQRA 3LUHA 1YS6A 3Q7TA 2LUOA 1Z12A 3OLYA 1J56A 1USIA 2PUGA 3RVNA 4ETNA 1JDNA 1BA2A 1B00A 2WY2D 2HQBA 1KMIY 4N0QA 2FLKA 3T38A 3KYIB 4RK1A 4XLTA 2KYRA 1E2BA 3LUDA 3C3MA 3KYJB 2H3HA 4QPJC 2WB4A 3EULA 3LFTA 1LBIA 2MYUA 1ZGGA 3N53A 3LKBA 4MGEA 1JX6A 1Z15A 3O21A 3BREA 2OENG 3LUKA 3MF4A 4KK3A 1C0EA 4OG2A 5C5CA 5KQMA 4EVQA 4ZPJA 4IGAA 1OXKB 3FGZA 1E6LA 4N03A 2PUDA 4OBBA 3HVRA 2E4UA 4DQDA 1YK0A 1ZH2A 2YHAA 2E4VA 4F06A 1NXVA 1YMUA 4KZKA 4D6XA 1ABEA 3OM1A 4MS4B 1GLGA 1D5WA 2V0NA 2IPLA 4LDAA 4JASB 3FDFA 4KV7A 2FSPA 2HSGA 5HSGA 2QZJA 1A0OA 2VUHB 3IP6A 3CTPA 5CNJA 1GCGA 1AB6A 4MS1B 4P1ZA 4G86A 2MYNA 1BDIA 3EJWA 2FEPA 3P9YA 2XDYA 1XWWA 1K68A 1P6UA 3HJFA 3H5OA 2PKXA 5FWXB 1Z2EA 2IPNA 1NXSA 1TMYA 2JB9A 4Z4EA 4L85A 1LJUA 4KK4A 3O1HB 1QP7A 5JNVA 2IOYA 3HDGA 4KMRA 3KJXA 3I42A 1TJYA 5E3JA 4EYGA 2LPMA 2FMKA 2GBPA 5IC5A 4Z4GA 3G85A 4UHJA 2L18A 4G0QA 4RV5A 2FLWA 1NXOA 4MYRA 4FE7A 1F4VA 4WUTA 1USKA 2J48A 3RH0A 1JFVA 3RVMA 1ZHHA 4NQRA 4Y9TA 1PEAA 4ML3A 5TQ0B 4MQFA 4E7PA 1ISRA 2FEWB 4YP9A 3SG0A 3TO5A 1QNLA 3Q15C 3OQNA 2IDMA 3GV0A 2A9QA 4W5RA 2CWDA 3SQNA 4LE2A 3EDCA 2O20A 2DRIA 1AB5A 1ZY2A 3BRQA 1FFGA 4MR8B 4LDZA 4N47A 4JAVC 5TPZA 3EAFA 4N76A 3JVDA 4EY3A 3QK7A 3A0RB 3N75A 3KHTA 3EODA 4PYRA 3C97A 2P9HA 3NBMA 4OLBA 2TMYA 3UKJA 2JK1A 1BDHA 4W5NA 3GT7A 4DADA 4MR9A 4MLCA 4EVSA 1A04A 1BAPA 4Z9AA 3VNBA 4S05A 3BRSA 2HJ9A 2PUBA 3IDOA 4G0ZA 1NY5A 4KVFA 4YWHA 1ZITA 4KREA 1Z26A 3TB6A 1Y1LA 3KCNA 1QQBA 2FMIA 3NNDA 3JVIA 5BRAA 5BRJA 2NT3A 4MAAA 5IUNC 1NTRA 1DCKA 2A9OA 1ZH4A 1W9HA 2L17A 3LTEA 1RNLA 3JS5A 4EYKA 4Z4HA 1ZAYA 4PE5B 4YR7A 1DCFA 3MMNA 2IPMA 2RJNA 3N6VA 1QO0D 1TVMA 3SAJA 5F64A 3H1FA 1MVOA 1P8AA 1JH9A 4D6YA 3T95A 3RQIA 2PAFA 1RPJA 3R0JA 4MR8A 3CNBA 4ZJPA 4O1HA 3ILYA 3C3KA 4H3HB 5DTEA 4RU1A 4RXMA 3GA5A 3RVOA 1ZN2A 1NXWA 4MPTA 4H60A 3EQ2A 4MS3A 3LUJA 2X7XA 3CFYA 3GWGA 3KSMA 4NICA 1S8NA 4H3KB 2H0AA 4KNYA 3N0WA 4JOQA 4ETMA 4OLAA 4G0PA 3DLBA 3FFXA 4YV7A 9ABPA 1PNRA 4O5AA 5TPWA 4RY0A 2FMHA 4MR7B 2A9PA 3HUTA 3M9XA 5JNWA 5CHYA 4D74A 2YHBA 2AYZA 3MA0A 4L4UA 1JF8A 2E4WA 5KC9A 4NCBA 2NZVG 1ZGZA 3CHYA 1Z16A 3MYYA 4TMYA 4RY8A 1LBHA 2PE5A 3N0XA 1HEYA 5EWJB 4IF4A 1DRJA 4G0XA 4G0OA 1DBWA 4OTZA 1D1PA 5ABPA 4W5QA 4RDCA 4G0YA 4WWHA 2JCGA 5TQ0A 1EFAA 1KRXA 2GI4A 5FWYA 3OM0A 5CNMA 1RXIA 3QELB 4UHKA 5EWLA 5IUKC 1QKKA 3H1EA 5T7BA 3LUCA 3OO0A 4MQEA 2LP4Y 4EVRA 3DBIA 7ABPA 5FBKA 4XFKA 6ABPA 1DC8A 4EYQA 3OQOA 4S04A 2QXYA 3TMYA 3KLOA 3QELA 3K9CA 4KQ9A 1RZRD 4LZLA 3FFWA 3GRCA 1U04A 2VK2A 4MLDA 4MQEB 1JFSA 1XHEA 4Q6WA 1KGSA 3O2SB 3QLVC 3QEMA 3CG0A 3H5WA 2E4YA 1VRVA 5DGCA 1E6MA 1SXGA 2RJOA 3N8IA 3Q9SA 5ED4A 2PUFA 2MYPA 4PEVA 4F3TA 3A10A 2NUBA 3Q7SA 3EQZA 3MQ4A 4EUKA 5DKFA 5JNUA 4RK7A 2QU7A 2WWVD 3H6HA 3QLUA 3HUUA 1VPWA 1YIOA 3CG4A 1DP4A 2CHFA 3KS9A 4OATA 3LKVA 4YGXB 1DCMA 1FFWA 2FTKE 3L6UA 5TQJA 1QP0A 1PNTA 1DBPA 3H5LA 4P98A 2FW0A 5GQSA 4NCAA 1Z17A 4IMIB 2AYXA 1P6QA 4ETIA 4HNSA 1VKRA 3FFTA 4ZYLA 1OXBB 3QLTA 4FB4A 2RGYA 3L49A 4RK6A 2B1JA 1U2QA 3FMVA 3OMXA 2JRLA 3HS3A 1NXXA 1Z13A 1JYFA 2IPAB 3LUGA 3UUGA 3C3WA 3HDVA 3OO1A 3MIZA 4MRMA 5IBQA 3A3KA 2L19A 4RKRA 2PUCA 2R48A 2BGGA 2FMFA 2W42A 5PNTA 5IUJC 3ROTA 4N41A 5BR1A 2ID7A 3CZCA 3LOPA 3OLZA 3O2JA 1U2PA 4RXTA 2FEKA 3LUFA 3D8UA 2PL9A 2LBPA 1L5ZA 3OQMA 3OLWA 5D2CA 3GBVA 3LMKA 3Q41A 2WRZA 1CYEA 1BVHA 2FQWA 4RK0A 5JNRA 3E61A 5EWLB 5KC8A 3HZHA 1E6KA 3T6KA 1URPA 1C4WA 1M5TA 1RZRA 4TN5A 5HQJA 5KQPA 2QW1A 3IP9A 4LX8A 3KTOA 4YCSA 1YTUA 5GOTA 3GYBA 3O1IC 5HM6A 4RK5A 3H1GA 3H5TA 3H6GA 5JNSA 1QQAA 1KRWA 4QYWA 1YS7A 4GNRA 1M2EA 3UK0A 2HPHA 3DLHA 2ZAYA 3I45A 4KQCA 1FQWA 3M9WA 4Z0NA 5CNKA 4KFCA 1EWKA 5KWSA 2NZUG 3CLKA 5IEBA 3KKEA 1GUBA 3H75A 3JTEA 4Q7EA 3TD9A 5TPWB 1EWVA 1U0SY 3C6QA 2PL1A 3RVSA 4RS3A 4HNQA 1I3CA 1QP4A 2FXIA 3B2NA 4KRFA 1SXHA 1GCAA 6CHYA 2HQRA 5DCLA 1H9CA 5EWJA 3HO1A 2MSWA 3T8YA 4RK4A 3JY6A 3MM4A 2VYCA 4WXMA 2FQXA 3RVJA 2F8SA 1VLZA 3JPWA 4Z4IA 4Z99A 1EHCA 2NT4A 1ZESA 2M1ZA 4RSMA 3URMA 4EYOA 1QMPA 4G97A 1ISSA 3CU5A 1MAVA 3HK2A 4YLEA 3SNKA 4F8JA 3F6PA 5B3JC 5JS1A 1DC7A 1PHRA 2M98A 2Q5CA 1M5UA 4E7OA 2B4AA 3O74A 3CS3A 3GBPA 4HYEA 5DLEA 5JS2A 1JFTA 2FQYA 5KI6A 2LIVA 3GL9A 1P2FA 4YS6A 4WZZA 1K66A 4M88A 4Q6BA 3QEKA 3I09A 3O2QB 2PUEA 5IX8A 5C5EA 1DZ3A 1SRRA 2ID9A 3F6CA 3QLVA 1SXIA 1IIBA 4MR7A 4YRZA 4ZMSA 1D4ZA 1XHFA 2QSJA 4RY9A 3KG2A 3S99A 2JVKA 4MR9B 2N9UA 4GPAA 1F51E 1R8JA 5FBHA 2FVYA 2I6FA 1DJMA 1MB0A 2RDMA 2FKAA
chains in the Genus database with same CATH superfamily
1ZMOA 1QBGA 2WHXA 4LE1A 4FBGA 1U7DA 4BGIA 5EAIA 4EYEA 4W5TA 2O3UA 3EF0A 4JP1A 4HS4A 5C8YA 3UGTA 4ZN6A 3NVMB 2CJFA 2XNDD 4UZSA 2R6CA 5AW5A 1R6TA 2ZUDA 4GZMA 2R25B 3OUTA 1F4LA 1G8MA 4P5PA 2CJWB 4AIIA 4QYSA 1E8NA 2CB9A 3F3YA 3WISA 4K05A 3L92A 3L8YA 4X1OA 4I5EA 3RKSA 4DM4A 1EJ2A 4IX1A 4ENVA 3DMRA 1BW9A 2XUJA 3KYCA 2OUKA 3L7DA 1PBTA 1P73A 3JQ8A 5CLGA 2IY8A 4RTPA 2O7SA 4S24A 3V97A 2FNAA 2ZYAA 4A1FA 1RHRA 2C82A 1NVMB 1WOMA 1CHNA 3ZHBA 1NZFA 4NJMA 4M22A 1HZZC 1N1EA 3GGJA 2QN8A 4S35A 4DA0A 1VLQA 1E4OA 1I24A 2ZATA 3HKBB 4L28A 1NXQA 5EJAA 5I9LA 4GPEA 3U5ZB 3FMPB 1SFRA 4N5MA 3V6LA 1ISJA 2MOKA 3BXFA 4MYDA 5BV7A 4JQZA 5CNIA 4ZVTA 3NYRA 2ZVJA 1P4JA 4TGLA 3GAFA 4NL4H 4NBVA 3KAKA 1J0EA 1QIMA 3Q7RA 5C8ZA 2R6JA 4GZ3A 3PPVA 4NARA 3ZG6A 1FRVA 1EWQA 3F73A 2KE5A 1KFJB 1TL7C 2ZI4A 1G9XA 2GAOA 4GICA 1RACA 2WT8A 3IQWA 4G1EB 3RRNA 3GB9A 1P5JA 1RYNA 4HX2A 3GH3A 1QO7A 5EWMA 4R83A 4DRYA 3V8VA 3F4LA 4ESOA 4CKCB 1V39A 2JIDA 1YA8A 2ZULA 2A35A 2NPIA 1NVEA 4O2BB 3UHFA 4DJDC 2VO1A 3VPHA 5IANA 3GLIE 1E60A 5JRJA 3LKZA 3UMBA 4DLTA 1N7IA 3M3HA 3EQ6A 4AKTA 4OLHA 5HG0A 2FFHA 3CH4B 1IHYA 3AJEA 5AESA 3DXXA 4K2HA 4K6HA 4M49A 3ZWWA 4YX9A 4JMPA 1GYQA 4E07A 4YQEA 1XRLA 5IJ0A 5HVNA 3MOSA 3ICOA 4DA9A 5J4YA 1V6SA 1DKMA 1Q57A 3T7AA 3LRXA 2QP3A 4OJNA 1NF8A 2XOKA 1QSGA 3AESA 4EY7A 3CLUD 3FTQA 2DX7A 1ZX1A 2WA1A 3ZE2B 2VBCA 1DDOA 1K92A 2JIPA 4BXOA 3I1JA 3K1AB 3K9NA 4Q02A 4PZ0A 5TQ2B 1YB6A 1CWUA 1T24A 3CUKA 3GJ4A 4RDIA 3ROXA 1XGKA 3KXIA 4RPHA 4HN2A 3TNFA 1GQ2A 2O0HA 4NZ9A 3OE7D 2C4MA 2XMCA 4NPHA 4TTPA 2PUAA 4YRBA 2ZJ5A 1AQYA 3ONDA 3CJRA 2CD7A 1QANA 3G89A 4YI3A 4WFKA 3K2BA 2Z2ZA 3TSWA 1ABBA 3S8YA 4JGIA 3O4RA 1FNDA 4MI6A 4LWOA 2FUCA 4DLRA 2D8MA 3V1NA 3K5HA 4MS1A 5KX5F 5IJAA 2QTRA 4WBXC 4PGHA 1G20E 3GFBA 2D1FA 4D6PA 2C99A 5DLYA 1POXA 2GD0A 1SC1A 3AVPA 5ELMA 4RULA 4TZ6A 2ZIUB 2PR2A 5I01A 2CV2A 1IL0A 1VA5A 2MSDB 1H4SA 5G4LA 1P9NA 1SVNA 4K9RA 5B7GA 1FSGA 1W88B 3HL0A 4W9NC 4D99A 4FVTA 2QQ0A 4NC9A 1E2NA 2OK8A 2YJTD 3L8FA 3ISJA 4FT4A 3WGQA 3PQ3A 2ODAA 9LDBA 3WXBA 3X0DA 1PZEA 1QYCA 2IIBA 3OY7A 4OHRA 4RYDA 4D9EA 4B80A 2OQRA 2PYZA 3Q7TA 3B13B 1IXRC 4TKVB 3FVVA 2W2TA 1USIA 2NP7A 3A1DA 3BKXA 3I9NA 4N0QA 5AVSA 3M4NA 3RHTA 4RK1A 2Q5EA 3P0RA 1OI4A 5G2OA 4G0UA 4M2LA 5TF0A 1RJFA 1X0XA 3HZRA 2MYUA 2XOXA 3V4RA 1TZBA 2W2OA 1GZ5A 3LUKA 1C30B 4ZJYA 4DSNA 5LKAA 4MHOA 4Q1BA 3INGA 5CGZA 1UMKA 4B32A 3NTLA 1A9QA 1AE1A 5JMWA 4ZDKA 2PUDA 2EOAA 4OBBA 1RWNA 2F6RA 4NBTA 1UBSB 1ZH2A 1EFKA 2Y1DA 3VC7A 3V9AA 4Q3OA 1P7YA 2FSGA 2OCPA 2ZTSA 2ATIA 4Z2YA 3VNSA 3WGYA 2AMFA 3FWNA 2ZRJA 4KAJA 1PJRA 5KU1A 1HM5A 1L0BA 4TUYA 5ERYA 4RLFA 1MGOA 3DE1X 1KYYA 1T6YA 3E2PA 3ES9A 5AHRA 1GUZA 4EFNA 5ULLA 1J39A 4TTRA 1N5MA 2IKQA 4EI8A 3HKDA 1V4VA 3TTUA 3CRMA 2RGWA 1C50A 2V5AA 4L8VA 5CBPA 2FEPA 3P9YA 4MW7A 5AVKA 4B5KA 4L5CA 4IWYA 4J7UA 3HR4A 3VISA 1M6VA 1P0IA 2IEGA 2IC5A 1KDVA 3ZZ0A 3ZCRA 1NXSA 1A71A 3H6KA 5FULA 4AP9A 4Y9UA 1PSZA 4ITUA 3T9BA 3RVBA 4ZP1A 5LP6B 5BSVA 1LQ2A 2IOYA 4UZEA 2RB4A 1CNMA 4M0KA 3I42A 1KPGA 4D96A 3JQGA 3I83A 2JH9A 2WSYB 4HWTA 5F2KA 2XB8A 4IVQA 4KQFA 1IVYA 2H11A 4UHJA 1YE5A 1MFPA 2FHPA 2RHJA 3B1ZA 4MKFA 5HKBA 1T8RA 3K71B 3U44A 2GVDC 4G0QA 1S2DA 1KKLA 1M2OB 2FLWA 1XTSA 1L5GB 3VU1A 2BKXA 2CLMB 2J48A 5F7ZA 4DMUB 4F93B 2OD7A 3QVTA 4J1TA 3TLEA 1TC2A 4DDHA 3LZDA 3D6FA 1WZ2A 2BY4A 1XRQA 2W48A 5I3CA 3I2FA 1XEWX 4LPKA 3CWCA 1JHAA 1MAUA 3GV0A 3R9XB 2G5GX 1P0FA 4W5RA 3LQQA 3SQNA 3ZTWA 3JAWA 1TM1E 1GZDA 3HCFA 1E0DA 3N2KB 4X1KB 1CZUA 1X94A 2ODTX 2QWXA 3QITA 1T9AA 3SQOA 3HFJA 4ZV4A 3BFPA 5A04A 5LJLA 3MQ2A 2ODPA 3UWDA 3U4CA 4EUEA 2BIFA 3UC9A 5IFLA 3O0TA 5CDSA 2FAXA 4YUXA 5FQOA 5JAIA 4HF7A 2X1VA 4BJ6A 3QPCA 4J0IA 3T4EA 3ETNA 1BO6A 2X77A 5CK5A 4EY6A 1JBQA 1NOIA 4NBSA 3C7DB 3MTGA 1X13A 5DF1A 4NQZA 1NY5A 1Q0TA 3BL6A 2AG5A 4CM6A 2VT2A 4U0KA 2VWGA 3VNRA 2YS7A 5JMOA 1AUPA 1GTZA 3JALA 3DFMA 2Z9DA 2HHLA 3CZ4A 3RJ9A 1CY1A 1NVXQ 1AZWA 5IUNC 2EGUA 1C7FA 2GFHA 1RI2A 2O1WA 2ZP1A 4B33A 1M2GA 2PNFA 2Q9UA 1DS6A 3C7AA 1JHUA 3TZHA 3S8EA 5DI3A 4DDKA 4LISA 1N4DA 3U9TA 1Y33E 2MT9A 4YRFA 3KHSA 5CLIA 3BRWA 3LXRA 4ZANA 2W83A 1KNQA 1QXSA 4IUDS 5CIQA 2VSOA 4NG5A 2OILA 1NL3A 1KIMA 4CTNA 4JWTA 5CFRA 3L8DA 3QQ5A 4NCXA 2DZDA 5CVTA 2XQGA 3CNBA 4FYXA 4TMKA 5LMNB 2PA3A 4Q9JA 1P9RA 3I73A 3VR3A 3X1WA 1J2UA 1F17A 1KIAA 1PK7A 1QYWA 2GSDA 3M7IA 3NT4A 1X7WA 2BHSA 4ENRA 2V7EA 3HV0A 4MVCA 1NQTA 2XDWA 2G8LA 3W7AA 4BWYA 3IULA 3SR0A 5CBKA 4J29A 3A31A 2N46A 1L8OA 3SMQA 4YV7A 4GP9A 4DNPA 3UPUA 1UK8A 2XXJA 4O5AA 1P5FA 1UJBA 3SVTA 1EP9A 3AIKA 4LV5B 2G9NA 3G0HA 1KO5A 4PNZA 2IXGA 2ST1A 2ZRHA 3HNOA 4NG4A 1ZM9A 4Q34A 4ED9A 5BSHA 3QUBA 2P9BA 2AF3C 4L4UA 3CISA 1K2VN 1XQXA 1GNPA 2DSTA 1QYIA 1H2RS 4HDKA 4PLHA 3P8ZA 4EW2A 1WDMA 3NVAA 1KA9H 2FKNA 1K3FA 3H17A 5EHXA 2XGJA 2IS1A 4PSKA 5DPMA 1ONSA 4IF4A 2O8FB 2ZIXA 1NJFA 4QJIA 1OFIA 3GLHE 4NOKA 4A0QA 4BNIA 2E55A 4WXPA 4BJHB 3C85A 6GPBA 5BNZA 3NO4A 3AHJA 3QX3A 5I5EA 1LB1B 1F8XA 2IOFK 2WHRA 5EWLA 3UMFA 3K6SB 5IWAB 4BN4A 4NE2A 3AESB 1P1CA 2E2WA 4MQEA 3FKSA 4X00A 3WNVA 1HLPA 4YDRA 6ABPA 2CCGA 2PZMA 4R1LA 4DUGD 3CR8A 3CW2A 1RKVA 3AXTA 3A37A 5AKJA 2NXEA 5J4KA 1IFXA 1HSOA 4J3JA 4GIBA 1XHEA 4IBOA 4US1R 1ZM2A 1PS0A 3TLJA 1C0IA 2WQZA 5BQFA 1DAKA 4EPWA 2NGRA 1MH9A 3PUWA 3MCTA 3L0YA 5TQVA 3LC7O 3TOVA 3RTGA 3U3ZA 3LS2A 3N6RA 2GO7A 3VHXB 4AT1A 4CI0B 2QU7A 4R84A 3BBPA 1B15A 1VPWA 1KU0A 4GRIA 5LYJA 2GN4A 1Z8HA 4FEGA 1CS0B 3FUVA 4D4IA 3MCWA 3C14C 2ACEA 3KKMA 3KYDA 1UUFA 4J16C 2GXSA 2DULA 1HKUA 2XGSA 3U7HB 2IEYA 1LQTA 4YMIA 1MC8A 2VEOA 4R31A 5CB8A 4GM1A 1RZUA 2PEZA 4HKTA 1B8NA 4JJAA 5G0VA 3DONA 5ICGA 5HUHA 2F43B 1XMSA 4K1XA 4S2EA 2VCYA 3FMGA 5KCMA 2FPIA 4R2LA 3T0IA 1ZWKA 4EHBA 3OFJA 4QBHA 1JTFA 1ZN8A 4MZXA 4RJLA 1EK5A 2NV0A 4TT3A 3IS3A 2NP6A 4A6PA 2CKDA 4FFOA 1ZVKA 1CF4A 4KN8A 3OKAA 4K9MA 3JZMA 2ZQ5A 2YQ5A 4YCBA 3UH1A 2XVXA 4BL5A 1D7OA 4A23A 2E37A 3PE4A 4TSFA 2PANA 2ZDHA 4PYIA 3R8XA 4RXTA 2CMKA 4D9IA 1TLTA 1DIGA 1NQ5A 1IH8A 3HB7A 1A82A 4ZKDA 1PD0A 1ZXLA 2P2CA 2XAAA 4OQ4A 4MW0A 4RD2A 3ZE7A 1ORWA 2HMTA 5LWQA 1VIDA 4KXFB 3AMVA 3PQ4A 2OV6A 1MOZA 3I5UA 1DELA 1KDRA 2GERA 4B83A 4W5NA 4H08A 1DDGA 4MRAA 3T1OA 2E4AA 4V0MA 1N8KA 1UWKA 3L05A 2VRBA 4WA7A 3BPSA 4LX8A 8LDHA 1DV1A 2GMWA 2H16A 2J3JA 3D0OA 3Q3VA 2JJYA 4LNUB 5F33A 4BVGA 4EJSB 1BWQA 1EXVA 2VHJA 2X9NA 3DV0B 4IJKA 5AT1A 2B3TA 3IOBA 2YXBA 3A4VA 1VL8A 1BN6A 2ZU0C 2EVWX 1JEAA 1EGVB 4ZOEA 5BSUA 1MZPA 1G6HA 3SOPA 3WWCA 4KO8A 4YCCA 2Z6AA 3TVYA 4N6NA 1I01A 4Z0NA 2H2DA 4JT8A 1R18A 3KZKA 1WSBA 1GZ6A 1FDRA 4LAFA 4LRXA 5LKRA 4ITVA 4EA8A 4OAQA 5JC8A 3TD9A 4ZYXA 1EUZA 2O2XA 3P4YA 5B4UA 1AD2A 3K6JA 1U0SY 2WZDA 1G8PA 1H4TA 2R7LA 3A9SA 4HLQB 4U3JB 1NRIA 2XUOA 2B9VA 4XIGS 4L15A 2I8LA 3VX4A 3EEIA 4EJ0A 2AC2A 1E4VA 3FR8A 4K9SA 1T5HX 1UQUA 2BFFA 3AB3A 3GLGE 3T8YA 1O9BA 1WP4A 3QYJA 3R1IA 4R9VA 4DCGA 1RYYA 4EY8A 5DGTA 3DMNA 4LJ7A 4JMLA 4WKCA 4L3WA 5EP4A 1UFVA 2Z4SA 1ORRA 2ZWPA 3JTMA 4X8OA 5AR1A 5MGNA 1EX6A 2B82A 5KWIA 1FB5A 5KYVA 3PQ6A 3ZKWA 3OP4A 3MQFA 3DKKA 3AVXA 1K1EA 3KUDA 4B2PA 1DUVG 3I2HA 4G4SO 4MI9A 4GF5A 5EIBC 1JFTA 3GBPA 4BN0A 5U1PA 2C2ZA 4WZ6A 3I62A 1RPTA 2CDAA 1Q1ZA 1G5FA 4BLVA 4PZ9A 4DAEA 1D04A 4ZDWA 3M3DA 5E7QA 5CA0A 2QD4A 3X1ZA 1R3DA 1JQ3A 1FRZA 2B6NA 2BCGY 3VR6H 5JQGF 4V1CB 2GZMA 4XYMA 1BDIA 5IVIA 2WSSA 1UM9A 4RAOA 1AUXA 3HRKA 2HMYB 4CYMA 2ATEA 3HJCA 4MRRA 1Q50A 2Y76A 5H16A 1PR2A 4I55F 1I4LD 2EAUA 1ZPDA 1XA4A 1XNHA 4J3FA 5EKDA 1EM8B 2PKQO 4RY9A 4BDSA 4E12A 1UBHS 1N2ZA 2N9UA 3AI7A 2W7TA 1NJ1A 3JVUA 4NYIQ 1R8JA 4JYCA 1UZAA 4RSHA 2GHQA 3QKSB 2M32A 1DJMA 2PT5A 2G17A 1YF3A 4DV1B 3O4JA 4YJFA 1H8HA 2H5EA 2NYVA 4M87A 4GKAA 2C83A 1ZDMA 3HCCA 1YZLA 2XBLA 1KXZA 1U6JA 4EARA 2XRZA 2YN4A 3LDFA 4E5NA 1CLUA 4JC4A 3EY4A 5T3YA 1W6UA 1CY7A 4GH5A 4NPAA 5J59A 4BNGA 1X7ZA 4HADA 2VJAA 4NZOA 5EHNA 2J9ZB 3DWEX 4MGZR 3CZRA 3G7NA 4OI2A 1OGYA 4DMLA 1JHOA 1IHUA 4MZDA 1OBCA 4KXUA 3WLNA 4HWOA 3TTTA 1UJNA 3NFRA 3N58A 2PH3A 3OE7A 1M2OA 4REMA 1ZRHA 5T4EA 4FBLA 3AF5A 1U3GA 2ZBQA 4HDNB 1IBMB 1DG1G 1I7QB 1E0JA 4GKBA 2R6ZA 4LE0A 3MWLA 1DIOB 3A6DA 1VA4A 4CQNA 2Z3WA 2ATVA 1ORVA 2JK0A 3PE6A 3AVWA 1J1UA 2WMYA 2I8AA 4QGSA 1MB3A 3C7CB 3GLQA 2BHLA 4X71A 4KOAA 4RL4A 4EMUA 3K05A 1EX7A 1XCMA 1Z7EA 4O4JB 2A14A 1HQDA 4DJ5X 5D85A 5H5JA 1QX3A 1R0SA 3LYAA 5DBHX 4K9DA 5K8IA 3ENQA 3ESCA 3ESXA 1FUKA 3T1YB 1HXHA 1J33A 1RMYA 2FR1A 5AKYA 4B34A 5KNCH 4G4SP 4H7DA 1R0BA 1PJTA 2WJAA 5A1JA 4NYMQ 3UHJA 3GRPA 1TU0A 2YXNA 4MRNA 3WB0A 1KAEA 3JR7A 5KOHA 2IHBA 4TKUB 1SUSA 1ZKDA 3B1KA 3EAGA 1KFBB 3CRW1 5HX7A 3U60B 2DG2A 5AHOA 1USVA 3RPEA 1VIVA 4OQXA 4QFBA 4Z1OA 1AZTA 1XLTA 3N5KA 1Z4LA 5TQ2A 2YVAA 1GNVA 1Y3HA 4Y2XA 5JBIA 1DTWB 3IP5A 4G0NA 3EA0A 4HMOA 2XWPA 4WNAB 4ERXA 3WSVA 1Z2DA 3ZKWB 2V4UA 1R6BX 4CDGA 1O5IA 1VJCA 3L6CA 2F4NA 1BYIA 5HUQA 4IMJB 2V3VA 5ALGA 5LA6F 3G0GA 5AWFC 5AVWA 1B0ZA 3UTDA 4COOA 3KTAA 4PC7A 3WYBA 1H2BA 4R05A 3L07A 1M8JA 5HNKA 3G2QA 4TT8A 3AKZA 3W9SA 3HEBA 4I3HA 3V4SA 4XXHA 4OMFG 3GX1A 4UTXA 4O4HB 1E5LA 3EBPA 3UCXA 2BMEA 3K32A 3M83A 2C20A 1N0UA 2UAGA 3PWSA 4MIKA 9LDTA 4BZQA 2VPWA 4TLLB 4UDNA 4YRDA 2YC4C 5DNDA 2OV3A 2E4ZA 4B3BA 3ZX5A 4FD2A 2QR3A 3IMFA 2IYUA 3H65A 5B3JA 1NJ6A 4G0MA 2CNLA 4PS0A 4BNYA 5HKAA 2VC2B 3M6MD 1I6LA 2DHCA 2H00A 3JAKB 3K30A 3KQLA 3LAWA 5AK3A 3ZE9A 4DIKA 4RTJA 1E0AA 4XVQA 1AXGA 1XCBA 1DHRA 1C7EA 2WBLC 3DUWA 1BOOA 4NBRA 1KDYA 2VZ0A 4JLPA 5L95A 4IIFA 4WT7A 5HF9A 4BASA 4D8XA 1VLLA 3MRTA 4UD6A 5JUWA 2CDBA 4AP6A 3U13A 1XTZA 2HPAA 1USGA 2NW6A 3LY8A 3RVKA 4YRIA 3ZNNA 1KS2A 2IHZA 2OXEA 3NFYA 3ZVLA 1SKYB 2JGNA 5CITA 1CDDA 3HWX1 2G6BA 3M81A 1QPZA 1F2UA 1JL3A 3L8GA 4R51A 1MRSA 4Z9YA 4DG9A 4HDAA 2AQIA 2ZYDA 3NB0A 1D2EA 1ENOA 2Q3JA 5FCDA 1MXFA 1S3SA 1DKQA 5B30A 2V3WA 1RWBA 3D4NA 2PQ6A 2I3DA 1EFVB 3H8WA 4I9NA 3VVMA 3L41A 4ETNA 2FLKA 4QUBA 1JQJC 4F5ZA 1FP7A 2ZB3A 4RZIA 4YVFA 3U9LA 2BGJA 3DSRA 2L82A 1I80A 3SSMA 1SHKA 5AQ1A 4X8MA 1AURA 2GM4A 1EYZA 4RLQA 5DTMA 4UQOA 3R2JA 4UNNA 2ZTVA 1XCOA 3GFFA 4LRUA 4PYOA 2JGFA 5D87A 3TBKA 5IYZA 1GZ3A 4ZYUA 3QI2A 3VPFA 3FZEA 1MT3A 2HGZA 3FMIA 4CL8A 1YK0A 2QMYA 1T6BY 3ZYZA 5DYGA 4WH0A 5E2AA 5FBVB 1Z08A 2Q9AA 3QXXA 3C5CA 4DIBA 5JVDF 5CK4A 5F3DA 1FYWA 4TSKA 2IV2X 4FMPA 4XCXA 1R10A 4AY5A 1Z74A 4OP3A 1RR6A 2AMVA 3P94A 2IYLD 4PX3A 2A57A 4WUVA 2XMDA 1ESCA 2J9FA 1U31A 2X8JA 4QIHA 1CUFA 4D4LA 1A77A 3KYDB 4HDQB 4UCWA 5JY6A 2H2AA 4CU2A 3MGCA 2IY9A 3IP6A 1TUEA 3P26A 2AFHA 3U9SA 4MDEA 4HMQA 4J0KA 4LCBA 1JA1A 3OE4A 1WPGA 2CMGA 4NE9A 5JNLA 1Z83A 1HOTA 2MCFA 4FHDA 2FR8C 3F9CA 5G40A 3IUEA 3RFCA 4Q4HA 1NJSA 5L3QA 2OHOA 4H0CA 4UM5A 4JLBA 2YZGA 1JJVA 2I99A 5JI3E 4EPTA 3ESBA 2G9UA 5H80A 2BISA 3GZJA 3K1AA 3W34A 2FSSA 4ZO9A 5LBUA 2D2VA 1HQYE 4RVFA 4DR6B 1I2ZA 1L7OA 1U1EA 2ZT5A 2GF9A 1LSSA 1KVTA 2IOQA 2OCGA 1N0IA 3C41J 4NFHA 1M1ZA 1WSAA 5HWSA 3TFWA 4DV3B 1J9EA 2CFRA 5LIRA 2YJ5A 1NF2A 1GPJA 1N8SA 2Y05A 3OPYB 4M98A 4L9AA 2QTWB 4ZZ3A 3LDAA 4UFPA 1Y1PA 1LK7A 2QK4A 4C0JA 4ARBA 3LJKA 1YS1X 1ZI6A 1YR8A 2GF2A 3K6KA 1XE3A 5BSRA 1GFIA 2FK7A 5HIJA 4YRGA 3E5NA 2DQZA 2Q1SA 3RRXA 1EG7A 2VHXA 1WDKA 5DMXA 5CAEB 4CKCA 5C1DA 2R85A 3TKYA 1UFKA 3KB2A 4EY3A 2QP4A 4CR8A 4ZA2A 3VV3A 2IXAA 4PYNA 4X94A 3RSSA 5A7FA 1Y8RB 2DT5A 4TL8A 1B14A 2B30A 3NBZC 1JXMA 5J5AA 1U0JA 2HCJB 4DLWA 1KVSA 5JHGB 5JADA 1SCAA 1B6GA 2GXUA 2WIKA 2C5HA 4G0ZA 1B2LA 4O4LA 2BCJQ 5JVDA 1BE8A 5A4AA 1A8PA 1BSVA 5JXJA 3G23A 2BJVA 3PC8A 1G59A 5LQCA 3AVVA 4BBAA 1VIAA 3IP3A 4KRYA 5FI5A 3I1FA 4CMGA 1HE4A 2HK9A 3MJCA 2B5VA 3SSNA 3UGKA 4F1KA 4N3CA 3CV3A 2FUKA 3NTUA 1ZAYA 5EE9A 2GHIA 2Y0CA 2GETA 3OTGA 4GP6A 1KQPA 3AUUA 4KVGA 3C0KA 2IPMA 3G2LA 3L5KA 1IRIA 3TW0A 5KKCA 2O7RA 1X92A 3S7TA 1FUIA 2HN9A 3DC7A 4U6QA 2B3DA 3E9RA 2AJBA 4YXWA 2HXYA 1HI9A 3TQOA 1U02A 1Y6JA 3QW2A 2I3AA 2QQ5A 4DJAA 4E2ZA 5KMGA 4JENA 1F0KA 1PFWA 2RH8A 2ZRAA 3BXEA 1BTOA 4JB3A 2IA5A 2P5SA 2JA2A 4PPQA 5DSZA 3RS8A 2OCAA 3DKIA 1M6NA 4JLKA 2BEJA 4F3RA 4OKNA 5H82A 4M89A 2VATA 2H0QA 3PSHA 5JJCA 2GD2A 2ZIXB 2WHPA 1J20A 3ANYB 4CIYA 3RYFA 2DLDA 4L8WB 5IBCA 2GBLC 2QBYB 2JI8A 4M1QA 1JEQB 3G0OA 3IP1A 4ZYTA 5GONA 1DC3A 1B8VA 2OHHA 3PC8C 4MR7B 4XRGA 3GT4A 3THXA 4RDHA 1VLHA 4RHYA 3S1LA 1EK6A 1W19A 3AUTA 3BXZA 5CR9A 3OEED 5IVDA 4NSNA 1JF8A 1J2JA 2V97A 4NCBA 3WJAA 1ZGZA 3CHYA 2OCDA 1JQ5A 3EXFA 2C96A 1QOPB 3GEPA 3CGWA 4Y6OA 3KHUA 2F1HA 3BE8A 3CUWA 4IO1A 1X8XA 1IN6A 3HCEA 4ALIA 4GPBA 2P4QA 3MTBA 4JI0B 2AHRA 3BGSA 4ZAWA 1ZEJA 4BLOA 2DR2A 2QJFA 2VKTA 5AIAA 1WLSA 4JI1B 2PZEA 1D5CA 1E1RD 1U7WA 1S01A 2IXFA 3SHFA 1YMQA 4BNFA 5BVGB 2A86A 4XWWA 3DE2X 4UEWA 4B79A 1NW6A 2QM7A 4DV4B 3OKFA 1LPMA 2G1JA 1V4NA 3I52A 5EMJA 4QQFA 3WIOA 5KUTA 5U4QA 2YWXA 3FIUA 3ZCTA 1N3BA 2J5RA 1U1CA 2KPOA 2CSUA 5LLDA 1GAEO 3TMYA 4RHUA 4OHVA 3BEDA 2HIGA 3JQGB 3CM0A 4KDCA 1Z63A 3IGFA 1U04A 3ECCA 3ZJVA 2O1SA 4B4WA 1RPAA 2HH9A 4AF8A 3KQYA 4LRTB 5K0SA 3LP8A 3WGKA 5FUVA 1CQPA 1QRAA 1NZDA 2M6SA 3C6KA 3VZSA 5KVVA 1XNRB 3PDJA 4LHEA 4CXMA 3P2EA 2MTBA 1YBMA 3ZEAA 5L4LA 3OOWA 2PWPA 1RIFA 4IVPA 4RK7A 5BWBA 3MS2A 5A0FA 1Q1BA 3SD7A 1F20A 4YGXB 4D3DA 4AKEA 4URUR 5KINB 1NVDA 1EVIA 4EKNB 5C31A 5AW7A 2P6UA 3T3PB 1Q12A 2PFSA 3BUSA 5EJ2A 1Q1AA 5FUBA 5HDQA 1B93A 1T4CA 3SJZA 4C4PA 2IU0A 1N6LA 2DUWA 4NX2A 2AYXA 4CMBA 2BGKA 1GNSA 4MARA 3K0CA 1MRNA 4Y6LA 4B6SA 2X0JA 4TPKA 2I4OA 4MW6A 4C4ZA 1C7RA 4BKRA 4MIYA 4D9NA 2B1JA 2M6KA 5BV1A 3OMXA 4FGKA 3SN6A 1P1RA 4MOWA 2LRHA 2VT6A 3RS9A 1GP2A 4ZEVA 1KQ3A 1I2DA 3IAM1 3W2TA 1SC9A 1VLMA 1L7DA 4QA9A 2C3YA 4LRWA 2J9YB 4M9RA 3FLEA 3KZXA 5A2GA 2VH2A 3HYCA 3UJBA 2HU2A 2ZR7A 2QTNA 3OTQA 1GUYA 1D9ZA 3H2GA 4Y7CA 4HFJA 3SF8B 3IC5A 2R44A 3BQNB 1P0QA 2QUZA 1I7LA 3GZNA 3FNBA 4RACA 5E95A 3O2JA 2YZNA 3ND6A 3DMYA 5CT9A 4MEBA 3RT1A 5FEUA 1RT9A 2G76A 3UAXA 4DWJA 4TKVA 3T1HB 3BFJA 2K4MA 1ADJA 1EK0A 3OOYA 4QT4A 4DV7B 2X6TA 3IQIX 1BHQ1 2OT3B 3M5CA 2ZUEA 5U9CA 4LY6A 4RK0A 3A4LA 4DMFA 1ZONA 1WBJB 2FJUA 4RM3A 2IH2A 2GLXA 5FADA 3W2HA 2CXUA 3DULA 1U63A 4AKSA 1B3BA 4LZPA 5TMBA 5BR8B 3BGDA 1PD1A 1XQVA 4TN5A 4NH4A 3TM5A 4BLWA 1FUEA 3C4VA 1CUEA 4Y9DA 3U1VA 2JLZA 2I03A 2Y1WA 3BE5A 3S2EA 5KNBH 1N1MA 1RP7A 1E9VA 1ZA1A 1VFNA 3BWVA 4CM5A 4GNRA 3PFBA 1JHVA 2HPHA 3PFWO 1KQFA 1NSYA 1CJKC 4DV6B 1SXJA 1Z3IX 3TTVA 2YC2C 3VR4D 1EWKA 2R751 2Q7XA 2NZUG 3IILA 3JSXA 2XAUA 2O8CB 1FJHA 1OYYA 4TTVA 3JTEA 4OOEA 3H9QA 1KAQA 4PZDA 5SICE 3T34A 4JI8B 1LVGA 2XRYA 1DX4A 3BAZA 3C6QA 1KE1A 2GILA 3PEEA 1E3MA 2EFEB 5HTKA 2X6QA 3OBBA 5FPKA 3TKAA 5HOEA 3J7TA 5FXMA 2J3EA 3JCZA 1PL7A 1NM5C 1OC2A 2ODWA 2JAUA 3FFBA 3KX2A 3OU6A 4JUIA 3IAM6 5L3QB 3EYWA 5E38A 3N1UA 1N1DA 4KXXA 1G38A 2NIPA 4RK4A 4HAYA 3PICA 5HKKD 2FZEA 2F8SA 3F3KA 3F9RA 3MBIA 4YMGA 1CERA 1T5TA 1U2DC 1MOSA 1WCXA 3CR3C 1DT3A 3PITA 4EG1A 4G97A 3JWHA 1MAVA 2OPBA 3HJHA 4UVEA 1G5QA 2REQA 2B8WA 3BDAA 1R66A 3KEFA 4K87A 5JS1A 1UFQA 3UAOA 2FMUA 2Z8ZA 3ZDZB 3PCTA 4HB4A 2YXDA 1UMDA 1BRTA 2W6MA 4QODA 4BVKA 4IQFA 2IUUA 4BLUA 5DP2A 4FZ5A 4PO3X 3H2JA 4PVCA 3B3QA 2B6HA 3KJIA 1K66A 2QVXX 3GEGA 4G37A 4NYJQ 4AMVA 4DCOA 1QB8A 4EJ6A 1F38A 4GU5A 5H3CA 5L4SA 4WBNF 3HCBA 4LSGA 3RU9A 3H8JA 1BHJA 3ZXYA 5E9QA 2ZWOA 1CNFA 1YFJA 1SXIA 3ENVA 2WOJA 4IRUB 1DQRA 1QQ5A 3SC2B 1KDOA 1EKXA 3D0RA 4HX9A 2AEEA 4N5NA 3EH1A 1GPDG 1WUYA 2UVDA 5FUXA 3GGDA 1ZJJA 1N5KA 2P5UA 3QU4A 3IPXA 4Y6PA 2ZS8A 5FBHA 3CUUA 4DABA 1MABB 2JI9A 2QN1A 4G0VA 4I36A 3RTBA 3NBQA 1DAFA 2OCBA 1JKJB 3RO7A 1PLLA 5ARDA 1PJ4A 2FPSA 1F2UB 3WLOA 5CFPA 4XWKA 1GAXA 2SBTA 2HT1A 4MQUA 5DT9A 3FMFA 3OX4A 5LXTB 5GP1A 4RF4A 2CLOB 4MKGA 3M2PA 1E3WB 1VL6A 5F1PA 2ZJ4A 3CSUA 5TPZD 5IULC 2RH5A 2IS4A 1SCBA 2CJWA 3PFKA 1WRBA 3O4GA 3O92A 1QHGA 2PJZA 3CT4A 3GJSA 2QT9A 1WUKS 2OV8A 1JI3A 2PX8A 1BIFA 2ICAA 3GPDG 1S5PA 3FYCA 2GZ3A 3ZXUB 1XTRA 3L7MA 2W5UA 4YQYA 3GG2A 3ZV6A 3AF4A 4BP1A 4JJ6A 2GB4A 3BSWA 4E15A 1PVVA 1PL6A 3NMUF 3G2OA 2QAGC 2AI1A 3N2ZB 4KGZA 3HKCB 2XBUA 4RKYA 3H11B 2ZPAA 4O2BA 4BLTA 1M1YE 2LKCA 5I45A 4R1NA 1PDVA 1QF9A 3QXSA 4OXIA 1TT5B 4QU8A 1XZFA 4Y9RA 3SIRA 4CKBA 2O2JA 6NULA 3R3WA 3FR7A 1Z18A 3WKAA 4AZ0B 2A88A 4EMBA 1JW9B 5J2UA 3ZGZA 1TCUA 3R7LA 4PZUA 3I6YA 4IRXA 3PDCA 4JI4B 4XJXA 2HA6A 1C14A 2BM9A 1QCCA 4C04A 2ZAMA 3FCYA 4DE5A 1QV9A 1RHUA 1ZSYA 3UCEA 1I51A 4RIEA 3AY7A 1BDBA 1G8JA 4L08A 1PT8A 1S2LA 2A0WA 1LPSA 1Z62A 1I6WA 2FW6A 4OJQA 5ICSA 3I37X 1VRCA 1DNPA 3QBTA 2VP6A 4G8DA 2HRCA 5EE3A 4AUEA 5EA2A 5D01A 2G82A 4NDNE 4KFRA 3CJQA 1CUJA 1TZMA 1YHZA 4MV3A 2Z2JA 3USES 5I7AA 4CKZA 4D7AA 2Q6OA 3EOBI 3C8DA 3FHLA 1PRYA 3WHIA 3UK7A 1EIWA 4ASUA 1A7JA 4E6PA 1E32A 3S6JA 1ZK4A 3M49A 3T4UA 4CDNA 1ABFA 4ZI7F 4MKIA 4RZUA 4B3TB 4DS3A 1E0KA 1BW9B 5E9JA 5J4VA 3OPNA 2YRWA 2JVJA 4LWZA 3TZEA 1EU1A 1P74A 4WOCA 5KYUA 3C8MA 3JX9A 4HNRA 1F6BA 2WHPB 1LNQA 3LO5A 3K1JA 4RNDB 2YV3A 1XU7A 3GJRA 4HNTA 1LJLA 2OCXA 3QE2A 4O4JA 4P3PA 3U4DA 3BKWA 5ALWA 1NVGA 1T0PA 2N3ZA 4M8IA 4RLHA 4AMBA 4IJ5A 1P80A 2IZOA 4Q0MA 1HDRA 2YWBA 4LMBA 1KEWA 3PX7A 4XB6B 4FFSA 1HE2A 1UF9A 2PH5A 3ZYCA 4I55B 5B4TA 4AG5A 3F3SA 4G07A 1NLZA 2XOKD 4DANA 621PA 1HQKA 1XRPA 3IAFA 5IKEA 2C03A 4RORA 3B51X 3G8YA 2CVPA 2QTHA 1GRNA 2NPOA 4WY2A 1CF2O 2ZBPA 4MV7A 1JIUA 1OI7A 4Y0NA 4ZMBA 2PSHA 4GPD1 4J0FA 3V4FA 3A6JA 1OOEA 4Z4CA 2GPNA 2CUNA 3LDHA 4TTJA 3QE3A 3T41A 1VDZA 2YX1A 5J3JA 4MW4A 2P2SA 2VQDA 4KQ1A 3WOHA 5D3MB 3FRJA 3FOAA 2VSYA 1HT3A 3LIIA 4HDMB 1J56A 5LIPA 4IDCA 5ALHA 1N6KA 5T5QA 1F6DA 2H5JA 3CC8A 4NABA 2MIIA 3CEMA 4YECA 1ISMA 1KSHA 2P1RA 2O59A 5B64A 5GM2A 3L1HA 5LVAA 4QPJC 4HH4A 4DXAA 1ZCJA 2W2XA 1U1IA 2XZPA 4UEJA 3CW8X 3A14A 3PPIA 1OW3B 3O8DA 3WAGA 2BGNA 2O57A 2RHTA 1R0XA 3GIWA 2FQQA 4WZBE 3HYTA 3AQ4A 1OPXA 5I8ZA 1E5XA 3VKHA 4GLOA 3W06A 1JG1A 5JC1A 1R0KA 2VJBA 5SY6A 4LF4B 4OHYA 1YJAA 2GPWA 1DAOA 4DC9A 1UBCA 5CPFA 3VR2A 4Q9LA 1OA0A 3SI7A 2X42A 2XR1A 1KZGB 2OXCA 1I7SB 1IPHA 1D5WA 1F2TA 1GGKA 2PMEA 3T1TA 3OC0A 4Z0TA 5HF5A 1E9AA 1W6RA 1FU4A 5BY2A 1RBZA 2Y9PB 4BZXA 1KXJA 4G5XA 4FNAA 1QH9A 4QHYA 4E1VA 4TS1A 2WYIA 3VUFA 1GCGA 7MDHA 1X9IA 3AIOA 4QVKA 3I0ZA 2NO9A 4PFJA 3I2JA 3R8CA 3EVFA 1LLUA 3GMIA 1NLMA 3H5OA 3PBKA 1C1XB 3QKUA 3WB1A 4RVDA 5JZMA 1W0JA 2RGNC 4O4LB 1U2SA 3RUEA 4BRWA 4OYYA 4CMAA 4DHEA 1L8AA 2YXLA 4BNDB 4KR7A 2CHUA 4EYGA 4U3JA 2YH2A 3ZWDA 4G1CA 5DSTA 2DCUA 1SBHA 4D82A 2G9ZA 1M34A 1FJXA 1NE7A 3NDBB 2V58A 3MN1A 2BTOA 5LB2A 1X1RA 1F4VA 5GZ6A 1QRDA 5IP5A 5ECGC 1XT6A 2C1EA 4DCVA 3Q6IA 3FDZB 3ZD9A 2WSBA 3BH0A 4BTEA 3RSFA 4CFYA 4EAQA 3BSYA 1I33A 4IHJA 1OU0A 4WCDA 3V4ZA 2YTZA 3ONVA 4TXNA 5ESXA 4LE2A 3K8OE 3TZKA 4C89A 4F92B 1V5WA 3C6ZA 3OFND 4AYTA 2X9QA 1X7XA 4POAA 5B7QA 4ARVA 2OZEA 2OLJA 3SEQA 3RSQA 4NE7A 3SSAA 3KHTA 2GTIA 3IV9A 1VCMA 4Q39A 2ZSKA 2BM1A 1DTEA 1EFRD 1P60A 2BR3A 3GQBA 3JQ9A 4GW3A 3LBAA 2EKDA 4AN1A 4D44A 3B38A 4GBED 1FP4A 2FX2A 4WFIA 5JW6A 3IKMB 4AULA 5AVJA 2JHFA 3K70B 1GZ7A 4XX0A 4YPOA 4ZVUA 4R4JA 4RGVA 4K0RA 3RB8A 3RIMA 3EC7A 2H1VA 3KVRA 3URKA 3Q8XB 3UW3A 1C41A 4EHHA 1IY0A 4MCJA 1JHDA 1EHIA 3U26A 1ZISA 4QLBA 4Y6QA 2C8VA 1HPLA 1YDWA 3PLRA 1KL7A 1OX4A 3GGCA 4R0NA 4RWZA 2JCYA 4P3NA 5COBA 3I6MA 2UUBB 1DCKA 4PYLA 2JAQA 2GAFA 4C6SA 1NQXA 1R0WA 2LVBA 2AFHB 3JS5A 5F4ZA 1EVLA 4K86A 3D8BA 1DCFA 1CRPA 1YVDA 2FW9A 2QM3A 1AQUA 4BMPB 4PLZA 1A7UA 4FMBB 3WLEA 3L6RA 2AUNA 5DHTA 4C2TA 3CSDA 1CIPA 1QYDA 1O6ZA 3RQIA 3ILSA 1IJKA 3FTCA 3R0JA 2QY6A 2DWUA 3K9BA 1X7GA 1W5TA 1GTMA 1RPNA 2BUAA 3RVOA 3KM0A 5AKHA 3DMFA 4FNGA 4PW0A 5EZ5A 5H3LA 3OTHA 5C7OO 3DHVA 3LUJA 4NCKA 5EUMA 5F9HA 4BEVA 5K0BA 2J45A 2QVLA 4H3KB 2ECFA 2HADA 1W48A 2WYUA 3KLPX 5K03A 1IHOA 4KRXA 4RO0A 1Z2OX 1WPRA 1YJBA 3AEUA 3DE3X 2P9TA 2GRJA 2C9BA 2FU5C 4BNTA 2W00A 2UZ4A 1ZIPA 4EKYA 3VJLA 1OX5A 3H8VA 2X58A 3LF1A 2V6BA 3FCAA 3IEIA 3TK1A 2G67A 2XWSA 2E9SA 2FPGA 1Z7GA 3FHOA 3NANA 2JGLA 2I7CA 3GJYA 3PNLA 4FT2A 3DOJA 2C8LA 1FFCA 4JYPA 4L95C 5F35A 5A6VA 4UNRA 1FP6A 5TC4A 4TMYA 1NDQA 4GLFA 2H92A 4KO1S 1ND5A 1DBWA 2ZSUA 4FX5A 4IZ6A 4DLKA 1JG6A 1I0IA 5CFOA 1VE1A 3MTJA 4FLEA 1LFAA 3OQ6A 3UEOA 4CTJA 1EBUA 3TKLA 5CNMA 4G0WA 1IAVA 5SV2A 2EERA 1LUAA 2FZLA 2HM7A 3A9UA 4K6OA 4L0QA 3ZHUA 1Y7TA 3SVZA 5J4LA 1GGHA 5ADWA 4UBMA 2BT4A 5IC4A 4D45A 2YHUA 3QELA 4LZLA 1XELA 4JLWA 1FXWF 3MB8A 2PZ8A 4GBGA 5EIHA 4B3DA 1BGVA 5CX1B 4AJLA 4Q1EA 1X70A 2PUVA 2R6HA 4X1KA 3O2SB 3FPBA 5CCBA 3U81A 4F5YA 4E09A 2RJOA 1JN0A 4ND5A 4QBTA 4F3TA 1BMDA 3RLFA 1LDNA 2HLPA 3FTEA 4CM8A 4KE6A 5BSFA 1TADA 2FPOA 2QYTA 4RL6A 3ZNOA 1N6HA 1ENPA 3RCBA 1IOZA 5A6SA 4K3UA 3MCAA 2ZQYA 4WCFC 3ETLA 4HB2A 1L7RA 3UWSA 1GDDA 2VHUA 5TQJA 1Y1QA 1PNTA 1Y3BE 3HL4A 1FS5A 1U1GA 5EMHA 1O8CA 2HQSA 3IT2A 5IXYA 2DECA 1Q11A 3L0SA 1PLKA 3KDAA 4L22A 1SOUA 3OIGA 3Q3IA 4DC1A 2WSSD 3GZNB 4TVBA 3VZCA 4ZI2A 1NBME 1Z0AA 2C5BA 521PA 1Z3CA 3WRYA 1OXSC 4HOYA 3BE4A 1E2FA 4UUNA 3EA4A 3ABIA 1XFAA 1DKLA 3OO1A 1M6VB 5CXUA 1TM4E 5FLEX 5IAAA 4M55A 5T67A 3JATA 4LF9B 1HTTA 4OUDA 5JDCC 1P81A 1Q2UA 2YWJA 1C0PA 1CRLA 2IW3A 1DGQA 1AF7A 1PR9A 4J2TA 4PQFA 2ZYGA 1DUSA 1NMEA 1KI7A 1RYHA 1A3CA 2PD3A 4N0EA 5DISB 2JAXA 1G2PA 3TG8A 2W6OA 1SIUA 3AV3A 3KQMA 2LCIA 2VP5A 1TYAE 4PGFA 1Z9BA 3UHAA 3G3EA 1H2EA 2G0TA 4JZYA 5AW2A 2O5CA 2FUG6 1UANA 2VI5A 2HQ1A 4WOPA 3TUZC 4JJ7A 3BMXA 1MEJA 3UXMA 1V8PA 4Z1MD 1SUAA 5ALUA 3V2IA 2PAAA 1U8ZA 3QNUA 1C9MA 3UMSA 4BO0A 4LK2A 1OZ0A 4U8HA 2CMHA 5I3ZA 5KTSA 1G5TA 3LOQA 4X92A 1P2BA 1M6WA 2PRKA 4ECEA 1GR1A 1OLXA 5HM6A 1P2TA 4OO3A 3H6GA 1IZYA 3P9KA 5AVQA 2J09A 5T3UA 5EZYA 2OECA 1JUDA 2VJYA 3DLHA 4I5IA 5A3RA 3EXHB 4IAOA 5DEIA 3K9QO 2NVUB 1TK9A 3BFVA 1IG0A 5JPIA 1NVKA 2B2XA 4YB8A 3IX7A 1IBKB 2P6NA 2FW1A 2BW0A 4NMLA 3DD1A 1TO6A 1B0UA 3BIOA 1GUBA 3HGTA 2YZKA 1CR0A 3T1VA 5KIAA 3JQAB 2EIXA 2F3QA 3I12A 3TMKA 2GCEA 1ZD4A 1BNCA 4BCBA 2I4TA 3DZFA 3B53X 2J46A 2VBFA 2YCLA 3CN7A 3GDGA 1I3CA 3TXYA 1OZHA 4HI0E 4HEA6 1P2DA 3H16A 3IMKA 3KQNA 3JD4A 1WJGA 2XCQA 1Q3TA 1B26A 3WB2A 1Z5OA 3Q2IA 3IE1A 2X0NA 5CM2Z 3OZAA 3PQEA 2B34A 4GOLD 2QORA 3VYRB 3W9UA 4C6HA 1K0FA 1B6RA 1HK7A 2G0AA 3F8SA 4PYMA 1XZDA 4WXMA 3U3MA 3PGLA 2G72A 3NPAA 1V5FA 2VTKA 4GXQA 4PX2A 4YT8A 4CM9A 1BX3A 5JH7A 3ZWKA 2I3GA 4B2LA 1C3JA 2PRZA 5F78A 5DNCA 1L3BA 2WT9A 4B0OA 3NWEA 4C88A 2FSVA 2XRFA 2BYTA 4AWBA 1C7IA 2Y1GA 4BBPA 4EW3A 4LGVA 4ZU1X 3OZRA 1LW7A 3HNPA 2NSHA 1X6VA 2FQYA 2IXEA 4HDCA 3WKBA 1T29A 4K9PA 4B76A 3GL9A 4OHZA 4DW8A 5JARA 2O8EA 1XKLA 3IQDB 1L4UA 4YS6A 3EVZA 4JD5A 5HKKA 3IFSA 1RTTA 1N9KA 3I9V1 5EHQA 1XAHA 5JXHA 1AQIA 4GOOD 2BI7A 4XYBA 2RHGB 2D4AA 4RE6A 2JL1A 3QLVA 5AKLA 3RS2A 1C30A 3MEQA 2RD2A 1WPXA 2NV2B 2X40A 3IV7A 4GI7A 5ERXA 4HDOB 2A84A 4IVRA 4JEIA 1NVTA 3N0VA 3KG2A 5BOSB 4F4JA 1J00A 1I3KA 3P9CA 4ZI3A 4U2GA 2AFVA 3WGHA 2E1RA 3L7KA 1VPLA 1U8XX 2C77A 4Q19A 4II2A 4WPGA 1KR5A 1QIIA 1RYEA 1QHHA 2GK7A 1E99A 1IB0A 4X93A 1WR8A 1LWNA 3RC8A 2C4UA 3IV6A 3M0EA 5CD9A 4DR2B 1A5ZA 3V80A 3FUWA 2RK4A 3NHYA 4H1TA 3DUFB 4LECA 2C5GA 4O6VA 5EWMB 4QJ3A 1W4CA 2XE8A 2YS6A 3CN9A 3PWZA 3SHTA 3NHZA 1E2EA 1Y7IA 5EIXA 2OL4A 1IE3A 1E0SA 1HOXA 2X9LA 3ZJ4A 1RQRA 2GLUA 2PO5A 3P52A 3EGDA 4B3HA 3D8HA 3PVSA 2XGMA 4P2GA 5J40A 3VOTA 4RGBA 1PEYA 3FKSD 5HQ3B 1A1VA 1PHPA 2PUHA 3OCWA 1WQ3A 4ZOLB 4U7GA 4G5QA 3EFOB 3P9NA 4NU6A 5FTMA 2FCAA 2Q21A 5ALRA 1P5ZB 5JTUA 3L6BA 1HRDA 1BXZA 2AL7A 3H4VA 4P93A 1Z4NA 3PUXA 1FPQA 4M9QA 5A0VA 2EU8A 5D86A 3ERCA 5CAEA 2QRHA 3PNVA 4UVGA 2AZXA 5FD8A 3O47A 2A5LA 2PMFA 3BCHA 1OIXA 5AOAA 1M0SA 4OXRA 2SCUA 5CA1A 1Y4AE 2RG7A 3SCZA 3E22A 2ON6A 4G5SA 5CLQA 5CU7A 4MB2A 1RI1A 2AFHE 1IATA 3HO6A 3KJQA 4E3WA 2PLNA 4XWGA 4QUJA 3WGLA 1L5HA 1VMDA 4CTOA 4Z8XA 3P9XA 3V7FA 3SKYA 3SIPA 1MC4A 3G2PA 5JD6A 2P3SA 1CUIA 1V3TA 2C5LA 3BAFA 3BHNA 3JPYA 4KW7A 5IC5A 4FONA 4J6FA 3UAYA 1OB2A 3C5WP 1SK8A 1GUAA 3TRIA 2P78A 1QE0A 5HS6A 3FJYA 4Q82A 4HHEA 4ALJA 3LA8A 4HJRA 1CX9B 3VR3D 4OM7A 1D3AA 3DZIA 2DQYA 2PJUA 3IDAA 3K1TA 4LXGA 1WMSA 1F9AA 4QQKA 5CVUA 3RUCA 3RUFA 1E7MA 2BE9A 4UC0A 5FWXA 3RVQA 5L40A 2Z6VA 2PO7A 1JXQA 2QRNA 2JJ2D 4JUAA 3BQMB 2D74A 2YV4A 4NMHA 4XGNA 1SOWA 1AIPA 1TM2A 3I5AA 5JMPA 1GJRA 4L4XA 3LBNA 4LHXA 4C3ZA 5KJ6A 1BKSB 3UA4A 1NBEA 1ZQ1A 3C4QA 2FHSA 3ET5A 4O0LA 2O7NA 2YIVX 3AV0B 1N6RA 1YNOA 2LR0A 5CJ2A 4A6EA 4CM1A 3LQKA 4RJTA 1II0A 2A30A 1I13A 4C2UA 3EVTA 4GQAA 2OO3A 4Z9FA 3ZLUA 3K0AB 1T9GS 3NWPA 4GR4A 1JIXA 1J6UA 4Q1CA 1T9KA 4YRRA 3WJ7A 1KYXA 3G17A 1T6ZA 2J3DA 1O58A 4Y8VA 4ZAXA 2J7PD 2Q6VA 3W8EA 3PT9A 5J43A 1JI0A 1GPNA 3WJ1A 4CT4B 3HV2A 1Q0LA 4UXHA 4J8PA 1JU9A 4ZDJA 3I8OA 5CH3A 3KU1A 2W2NA 3ZCSA 4YV0A 3FRIA 4LYGA 3GJ6A 5ITWA 3W5CA 5E6SA 3EIWA 1YK1A 3I01A 2VJPA 3EUAA 1WP9A 2NZYA 2YJ6A 1YB1A 4H7EA 2W6ZA 2AOVA 4LDPA 5CVVA 3X2SA 2PS3A 3NNNA 3VTKA 4F2GA 1PT7A 1K27A 2AK3A 2X7HA 5JQGB 3G1WA 2QW8A 1QQ7A 1J09A 4LSWA 2PTHA 2IYAA 1YMVA 3KEGA 5KTYA 3TF5A 5L6LB 3KP1A 2R3SA 2E6UX 1PGJA 5BURA 2YW2A 1E77A 2AWNA 3AHGA 4JBLA 3AI3A 5CPBA 1XEWY 3CCFA 3PS9A 4ZV7A 1SD5A 2VSFA 4B3SB 3FF1A 5LUBA 4JV5B 1PIWA 1R3UA 3HADA 4UPDA 1QDLB 3O95A 1AK1A 4UE3S 1NASA 1ZOIA 2CYBA 3LM8A 5EXPA 3L9XA 3UQYS 4ABYA 3ZCUA 2VYND 3MTQA 1YDMA 4MUIA 5BOVA 2HQBA 2EQAA 4ZOLA 4QOHA 2K7FA 4ZT2A 2G4LA 2QVZX 4X20B 1OWLA 3WGZA 3EULA 4AJHA 1PR0A 4XIFA 3EMBA 1ID8A 1TKAA 4ZPXA 1K7YA 3AFOA 4QG3A 5DHRA 1NPTO 5KQMA 1ZUHA 4ZPJA 1IMJA 4HZIA 4IGAA 4MCAA 3UMGA 1WZCA 1CNEA 2WM8A 2I2CA 3WQHA 1SKYE 4O4HA 2PT7A 4M0MA 1VB5A 2AYYA 4OJMX 2O3SA 4TMVA 4EHNA 4EJFA 2W2LA 3R9XA 4C7XA 4N3NA 2IL1A 3V2GA 2CJXA 3OF5A 4Q03A 4DT1B 5AW8A 1G17A 4JU8A 5I7EA 2WK1A 2J33A 4KXQA 2IPLA 3I53A 4W1QA 2VJMA 3T5BA 4GXNA 2YY5A 2NTEA 2C7PA 3FDFA 5CXQA 5IKXA 3SE0A 2KM1A 2ANCA 3WB9A 2FJ0A 2QZJA 2JLUA 1PJ3A 4KQKA 3SXUA 4EQ6B 1CUZA 2H7VA 3GFQA 2JLVA 1PUIA 3W4KA 1FX1A 2C88A 2O1EA 3ZDXB 4MI1A 4CJXA 1TQ4A 3HJFA 4DPLA 3QBJA 4WNAA 3E1GA 1RYZA 1G9SA 3QTLA 2PLRA 2P1DA 3QVJA 1KJYA 5F1YA 1FSZA 1I14A 4DJJA 2WTUA 1JEYB 4I46A 3B36A 1H4VB 1NIJA 3A6LA 4KMRA 5C37A 1CULC 4EH1A 5LQJA 2B78A 3AU8A 3FCEA 2O8FA 3TPCA 4B7UA 2I66A 1VKNA 1N25A 1CUGA 1YUNA 2RCYA 3IUBA 3PT5A 2JATA 2QSZA 2ZUWA 4NBKA 2G25A 4GWKA 4U2BA 4BNJA 3KJZA 4Z53A 1ZI8A 4I08A 4B4UA 3E9QA 4KI0A 3R40A 1QVVA 1W2HA 2KHZA 2VDKB 4HFRA 4JR1A 4RMGA 4XTCS 5GPBA 4D2IA 3S5JA 3RH0A 4EB8A 4FQ7A 4WBSA 4DA6A 3B2EA 3IVAA 4DY4A 3SX4A 5IAKA 3D1VA 2HHAA 3BD7A 4MQFA 3ZGYA 4FFDA 1U0NA 1PWYE 3IH5A 2QTBA 4FI3F 4J0QA 1F2DA 3PJFA 5DYNA 5JYCA 4FJ1A 1MZVA 1NNI1 3T5TA 4OSOA 2VLIA 3I39X 4P0PB 1WABA 1AB5A 1XQYA 1ZN9A 1ZY2A 1ZD1A 3G5MA 4HGOA 3EPJA 4ARIA 3SQLA 1PG2A 2XJ9A 4ATNA 1QHYA 2QG4A 4OHOA 3OT1A 4FGJA 1YCDA 3LXMA 2PK3A 3QK7A 4ND6A 3U7IA 2QRVA 5KNDH 1DOHA 1PVDA 1R15A 2HIMA 4GGPA 4JVNA 4EB6B 1RRVA 2IUTA 2P2GA 3NC0C 4GOKA 4QDKA 4N8DA 3E9NA 4OP2A 3VFDA 4B4DA 4ZHQA 4TVOA 2AN1A 1R6VA 2V7QD 4Z9AA 1IYZA 5THKA 3TQSA 2WAMA 4FZRA 2FWNA 2IQIA 2C58A 4AW9A 4C08A 3K2QA 5LP6A 3GZ4A 4MUBA 2D2FA 3SWWA 4O4HF 3SC3A 3KCNA 2BKVA 3ZJUA 2Q2WA 2K2WA 1YFLA 4P0TA 2JPDA 4MUEA 1KMNA 3ND9A 1H2AS 2GH1A 2XHZA 3N76A 3O82A 4NHOA 3UMYA 3CEJA 3N7UA 1JIIA 1DRUA 1QK4A 3L1JA 2A9OA 1CLEA 4P58A 4JQSA 4PXSA 5FDFA 3E2IA 1U2EA 1ZH4A 4W5WA 1UP4A 4KE9A 4M54A 1R8YA 4XX1A 4HNAB 1JPUA 1QR6A 4NI5A 3CJTA 2Z0MA 3GLIA 4CHTA 5LNK6 3FNEA 2IHJA 1WY7A 4QAQA 1FX0B 4P53A 4GL4A 2E85A 2WWHA 3ZQJA 4L2IB 3ZHXA 1TW3A 4PC2A 1OFHA 4RETA 1ONPA 3CF4G 1QORA 3B3FA 4G36A 4RXMA 3FE2A 3EGVA 2OSBA 3GRUA 3LRTA 2H1LA 4YJ2F 2X7XA 3CFYA 4FMCF 4J7AA 4D46A 1P8JA 3F6RA 3ZGNA 2AH5A 1LH0A 1O2DA 4U0JA 4MTCA 5KOJB 2VAMA 4YJ2A 4O5OA 2DWQA 4DLNA 4WZAA 1HTWA 4LJRA 3OUUA 4NDAA 1HZZA 2RFLA 2KB0A 3H0EA 3ZH9B 2OTCA 3Q40A 4XR9A 3KOWA 4HAXA 2CSXA 3OZEA 3IJEB 2GN2A 2VPYA 3HUFA 3PNKA 1Q7GA 4P32A 3TSYA 3UJHA 3S1SA 3ZE6A 2NN3C 4US2R 2ZI7A 4NFLA 3KOOA 3B1JA 5CHYA 1YKSA 2OQ2A 1BCRA 2TMDA 4G1BA 3UJCA 2ZR0A 1BJKA 5BV0A 2NZVG 5JMTA 2GN8A 1Z16A 1SIWA 2BFFB 1QV6A 2R66A 4D9MA 4B75A 3QWAA 1G1MA 1E2LA 2WPNA 3F67A 4TYPA 3KSUA 3ORFA 3OMLA 3SJBA 1TZKA 2H4JA 4HO1X 3ROMA 1Y82A 4O33A 1KR2A 3MRXA 1CUDA 2P6RA 1QYVA 1UOPA 2RI6A 3UT0A 5LP6F 4XSVA 1QFMA 1Q21A 3OO0A 1O96A 4M38A 4G4JA 1P7CA 2O4CA 5JLAA 3T5MA 4S0XA 3W0LB 3WL3A 1TVEA 3NP9A 4S04A 2W6CX 4JQYA 4C0LA 4KQ9A 3S81A 1IK6A 2WU3A 2OCIA 1ND6A 4C5AA 3UV3A 1QH8B 5KNDD 2XNDA 1U2GA 1DEKA 4I1PA 3CH5A 1KGSA 3G1TA 4MPJA 5AOBA 4XPIA 2QSYA 2YIMA 2YVUA 1FLVA 5IT9A 3L0ZA 1DAGA 421PA 2NUBA 4K5QA 4O63O 1LS6A 3NHFA 4UBLA 2CD9A 4DDMA 5JNUA 2E5FA 4NV1A 4PR0A 3HUUA 3M6AA 2Q4RA 4PV7A 1C3EA 4OATA 5JXWA 3B1XA 1RHKA 1SHZA 4BAUA 3LLUA 2QJOA 4CIAA 1Z82A 4HV4A 4BQNA 2BFNA 2QUKA 1ULBA 2C42A 4GPZA 4DQLA 5EGSA 4Z3OA 4MYTA 3LHSA 1QGOA 1H5UA 2GXQA 1FRNA 3CF6R 4LJSA 4M1ZA 2WTMA 4NWIA 4NYIR 2JAHA 2H1CA 1WD7A 1K4YA 2JIQA 2UZAA 3IERA 5TEVA 4AZ3A 4UM9B 4NXNB 4NS4A 1F0PA 2PLAA 4D9KA 1T91A 4UHBA 5C46F 1V9CA 1XXLA 3O91A 4IFEA 4WNIA 2XXAA 3R9KA 2R1UA 1BXKA 3SHWA 2OGSA 1C7QA 1IBCA 4NATA 1JHYA 3GAMA 1NFQA 3L04A 3KNZA 4HYTA 1M74A 1NN3A 3GNQA 2OY0A 4IHJF 4XW2A 4B3JA 4D0RA 5ALTA 2J0UB 2P2LA 2R60A 4Q9KA 4ZCMA 3IQHX 1U2TA 1WY5A 3GROA 1KSJA 1NFFA 4MUJA 3WK6A 3R7AA 3SDSA 1J8VA 3RAJA 2CVQA 1ZZEA 3AHIA 1HWYA 4K7JA 2CDCA 2OAQ1 2VHZA 3PF9A 3SQDA 3ZGVA 1PJAA 2E0IA 1P29A 3E5MA 4FFNA 4C4SA 1NW9B 2ZXFA 4WQMA 3BG5A 1G21A 2ECOA 1OGJA 2XF8A 2FW7A 2VA8A 1QR2A 2Z8YM 5FPPA 1CYEA 1BVHA 4TS3A 2WJ3A 5M34A 5LFAA 5E1BA 2Y6VA 2PRJA 3E61A 1JHQA 1BC5A 2YIJA 5FOUA 1L4YA 5EXSA 3VPBA 4ALLA 3DEYX 2B8TA 1YL5A 2X0IA 3IEKA 5G41A 1PK8A 2M2IA 3VYWA 3WBBA 2OBNA 4I9HA 2IIQA 2VJCA 1QO9A 3EWAA 3PNQA 5CYGA 4LZZA 4DJFC 1NUPA 5K09A 3TGLA 1GN9A 3FFAA 1BOFA 4D9HA 3AI1A 2Z8XA 2D62A 1OJLA 1R88A 1G6Q1 1RMQA 3D7NA 1TQ2A 5AJXA 5LP6C 4RZ2A 1UPTA 4UHFA 3LLSA 2GF0A 1OFTA 4K46A 4KPUB 4WOJA 5DBIA 3H75A 5DGHA 3C1AA 4MPDA 3WZMA 5IJ0B 4ZRNA 2CVFA 3F7TA 2R8XA 3F98A 3WL7A 3A06A 1OC4A 4B6QA 1POWA 4DVJA 1RAAA 3OSUA 4I1RA 5KYWB 2JLYA 1VPTA 4TL6A 4CODB 1HMPA 1MTOA 2D1YA 1MOPA 5SZJA 3ROGA 1NUQA 5JJKA 3PC6A 3EBLA 4PLVA 1FZQA 1RWXA 2PGNA 4I4TF 4IIXA 4LXYA 5TXGA 2QMHA 2V55B 5H59A 1BX1A 2O3JA 3RVJA 3T7CA 3TQIA 3THWA 3MJVA 1IU9A 4I6EA 2D06A 3DVSX 3JQCA 2QKYA 3FWYA 2XCUA 1AUOA 4A6XA 3ZWBA 4YLEA 3T3HA 3F6PA 2F1JA 1M9NA 1YR1A 2Z2IA 2ORWA 1JDJA 4F86A 4LJYA 5DM70 1JG2A 1M5UA 2RC5A 3AUFA 3KZCA 4KJZA 1E1CB 4LA4A 1XK7A 2X1HA 3HEMA 2PPLA 1XQ1A 2GQ0A 2PBZA 3AHHA 1QGAA 3T4XA 2HBRA 3V2UA 3OZTA 4H6PA 4EG3A 1SIOA 2YFKA 4QBKA 3GFTA 4ZVRA 4R9RA 3R3JA 4JSTA 8ADHA 4O3MA 2ZIVB 3LZCA 3AR6A 2ECPA 3ZGOA 4G9GA 3RIGA 1UXJA 1WCV1 5EMNA 2SKCA 3H1TA 4P83A 1XHFA 1YS2X 2BM8A 1K7XB 1WTCA 4M1YA 2MSCB 3INTA 3FCSB 3M2TA 4DNXA 4IDBA 3VQTA 5HCNA 2YICA 4DY6A 4JHLA 2ZUFA 1F51E 3WSWA 1SU8A 3AGPA 2AJDA 4YMHA 3G0IA 4YP6A 4AXXA 3ZW8A 4PO1A 1JDTA 2J9GA 4B84A 2IBSA 2C07A 2CXNA 3O31A 2ZZNA 2QY9A 4OY3A 1DFGA 1DPGA 1M2VA 3DM5A 4MJXA 4AUKA 4B47A 2A0XA 4MVJP 3IRUA 4EKIA 2FWPA 3T5CA 2OPHA 3F6BX 1B43A 2VBGA 1FDVA 4IOMA 2R96A 3DO6A 4LKOA 4QQRA 2DXIA 3UB2A 4XARA 3N6XA 5BOSA 3UGJA 3ZCXA 5B5SA 2IUFA 1FIUA 3ET4A 3EVEA 1Y9EA 4Z5XA 3JQFA 1ECFA 1AXRA 3N86A 5MFZA 4FC6A 1VJRA 1R4MB 3AY3A 4DTCA 4AY2A 3K0EA 3S2ZA 2NQTA 1E62A 2D0OB 5KYXB 3FLBA 3FROA 4QREA 4LBZA 1IJEA 2EEZA 3IPYA 4EENA 3NHAA 5C81A 5CA1F 4LGCA 1E2UA 2ERXA 3FPCA 2HR1A 4Q9NA 1MC5A 4L3VA 2FSFA 1N9ZA 2IHVA 1G5IA 1Z4JA 3JSAA 2EWMA 1OROA 3TQHA 1DC6A 1WMAA 1W5FA 5JSZA 3RC1A 5LDHA 2V7UA 4MULA 3CKMA 4QAJA 4RA6A 1RI4A 5K8JB 4MP3A 4J0DA 5ENZA 1GNLA 1JBEA 3ODPA 4A8JC 1RVV1 1VBKA 4HZGA 2YZ7A 2A0FA 2ZUBA 3TAUA 3WRXA 3MLEA 5FYQA 1AKMA 1KO1A 2GWRA 4IEIA 2IHYA 1KJ8A 1FFBA 5CFNA 1UKVY 3DKVA 1P4SA 2Y4NA 3B6ZA 3FOFC 4MUKA 1TMKA 4L5AA 1O1YA 4MS4A 5F51A 5AQEA 1RKBA 1GEEA 5CIYA 4TYNA 1JMKC 1JG4A 1GSAA 1C4OA 4EY5A 5LZ7A 2NUPA 3W6NA 1LGYA 3JQAA 1UBJS 4DMKA 1RW4A 2DGDA 3NXSA 5AH0A 1W0KA 3DBLA 4UBKA 3RNLA 4IY1A 3ISVA 3EVGA 5B7NA 3DPUA 3RVRA 1TJPB 2A1UA 4PO8A 1F1BA 4N3AA 4PX5A 5DM4A 4MVJF 1OUMA 4IYJA 2IEAA 3E3MA 1C1DB 2FPWA 5FFFA 1C5KA 2XUHA 4Q3CA 3EZGA 3IO3A 3TEMA 4BRSA 1CIJA 1MG0A 4OQZA 1KI6B 4BP8A 1Y9JA 3LT5A 3QYAA 1GG8A 2PJDA 3ELBA 4ZZ0A 3BILA 1SA0B 4YJ3B 1YHNA 1L5RA 3EXIA 1G21E 1EQUA 1ICEA 2L2QA 2R8BA 3DZDA 3FG9A 3HCAA 5AJVB 4M1MA 3RSLA 1SQ5A 1VSUA 1ESEA 1MU0A 1RKQA 1SC6A 4QEDA 5DULA 5DN6A 5DTIA 3ROFA 1U7XA 2BGUA 4EGQA 5I4CA 4QBFA 3RHFA 2PRIA 2BMVA 2PMDA 5DHFA 3JQ7B 2WIJA 3LYHA 3T5GA 5JYEA 4Q37A 3N8HA 4IX9A 3OLVA 3PPYA 5DX8A 2Q5FA 2JBAA 4J6EA 2UZ3A 1DAPA 3LUAA 3ROKA 4N8SA 2ECQA 3IA2A 1MMFB 4KQGA 4CIVA 4I9UA 3DMHA 1K06A 2DH5A 2X8JB 2WVJA 4DCSA 4WNYA 2I33A 1G18A 2FDRA 2GXAA 5J1SB 5DLDA 4B8ZA 2AW5A 3S68A 2B0JA 1KERA 3LHFA 1SCNE 1EXDA 2ZBRA 3M6UA 2QL6A 2JFOA 1P9LA 1KVUA 1FSFA 1PTKA 3T12A 1YULA 5A5DA 5KSYA 5T8KA 3Q7IA 3EZLA 4LYJA 1RYFA 2Z2KA 2ZKLA 3PVZA 4J0GA 4KO2S 3WC4A 4DDTA 5IZCA 1SG0A 4AO8A 2C7RA 2ZIZA 4BUCA 1QTIA 5AHXA 3FBGA 2I2WA 3OLYA 1SCDA 3SJCA 4PSCA 1OAKA 3GPCA 1E2BA 4XUDA 2HCBA 4QECA 1DIHA 4DEVA 1EFVA 3EC1A 4NEGA 2D5CA 3GVCA 4GHWA 3Q4GA 3TIXB 3GLGB 1UK7A 2I2FA 1G60A 4R8SA 1XF1A 2ONYA 4WAUA 1R64A 1QYRA 1YVEI 2BGRA 1XDDA 3ICWA 3H97A 5JYDA 1IZ7A 4KR6A 1OXKB 3L0CA 2FDCA 1CVRA 1IWPB 4GVPA 2IELA 1QIJA 4KG7A 4JQOA 4DG8A 4C7OA 4JP8A 3UJ7A 1EUYA 1T6XA 2IV7A 4NBUA 3QW4B 2I2AA 1U81A 3AP2A 2YVQA 1YJXA 3GH1A 4D6XA 4PRLA 2PBLA 1IHDA 1AZLA 4YP1A 2D0PB 4KB5A 4H7JA 5C5DA 4WCVA 5KNCD 3R7WA 1K89A 1PWEA 3OH8A 2JBWA 1PBNA 2ZRMA 4G65A 2EZUA 2A3NA 4PCAA 3QHQA 1P62B 1YJQA 1NBHA 1OVMA 2D1RA 3LVRE 3DTVA 3O9VA 4K2AA 3IL2A 3VVLA 2PWAA 3ER8A 3ZVKA 1XWWA 3RQSA 3HDJA 5D3KA 3MGAA 3UCFA 1Z2EA 1DKPA 2DH6A 3A3OA 1EJ6A 4L85A 1MVLA 4PC3A 3T52A 3I5YA 2ZIGA 2XIQA 1Z6XA 2B8NA 5AKKA 1CKEA 1WXQA 1RFLA 4AX4A 2O05A 2VA9A 3KLBA 4GXTA 5FTWA 2NTNA 4CGYA 3BMOA 1RABA 1OXMA 1L3IA 2YBEA 3SX0A 3UJ9A 3WZLA 4JXKA 3KTAB 3NAGA 2WFLA 2CNWD 4LVCA 5ECDA 1ZGAA 2O1XA 4Q47A 3ZK7A 1OFGA 2XKKA 3OUZA 1V5EA 3GDFA 4S3MA 4Z9XA 1ZUWA 1L1RA 3KIPA 4PYQA 4ML3A 4OQNA 2EW8A 1HLDA 2XNJA 4G9EA 4PLFA 5AVVA 4M7WA 2O8BB 2OFPA 1D0SA 2BFPA 3CLTC 4H7HA 4J7CA 4MUAA 4ZC1A 3UJPA 2JHAA 4IXNA 2ZRDA 5I7WA 4LYDA 1OLUB 5E1OA 3OEHA 4P31A 3GHYA 2EFDB 2QG9A 4B4VA 3U40A 5IJZA 1FFGA 2ZAIA 1QP8A 1MPTA 3GLTA 4A8JA 1EZ1A 1WV0A 1RRMA 2EKPA 4NY1A 3ESZA 1U9YA 2QXTA 4KDFA 3WLPA 2DF8A 3C97A 2C7BA 3NUQA 5C1PA 1Q7TA 3C1TA 3OEYA 3D3JA 5TGTA 3NBMA 1Y6ZA 2TMYA 1B76A 1BS9A 4C3VA 5BN3A 1NHWA 3L1UA 4LF8B 1WDLA 4UUAA 4R9UC 4YYZA 2AWOA 3LV8A 1PDOA 2Q3LA 2VT7A 3BRSA 2NSLA 2PCLA 1XLWA 4PHCA 5AVRA 2GJSA 1ZITA 2HA4A 4TL9A 3FW1A 4Q3NA 5FHQA 3RTAA 3TTYA 2AD5A 5B6JA 2I4MA 1A98A 1WLYA 3DAOA 1CUXA 2F64A 3EFEA 3JVIA 2JANA 1F8YA 1KGDA 1NA5A 2P8SA 4IIHA 1RYBA 2PGOA 5LQAA 4EW6A 5KJ1A 3PNOA 3TPZA 2DUMA 5ARCA 5FOWA 1JHXA 2DSNA 1GL7A 3I2YX 3TX2A 1JG7A 3ZX4A 1OXXK 3B78A 1EJ0A 5MDHA 1I4DD 1NN1A 1ECCA 1B8UA 2WIDA 3PPXA 5H4HA 2NU6B 2Y27A 4YCNA 1BCSA 4E94A 2X1LA 1TZJA 3IT1A 1IMOA 2VPPA 1K5GA 1U5CA 4IUYA 5JIBA 2GHRA 1J0AA 2Q1XA 3TIIA 1RAHA 4N7JA 1XG5A 1P8AA 3P96A 1BS2A 4Q3DA 3TMAA 3VI3B 2EARA 1EEHA 5TVKA 2HCRA 3ZE8A 1CXZA 2IS2A 4EG5A 2H1OA 3B89A 3BD6A 3LPDA 2XTMA 4RU1A 5NLLA 1DDIA 1E6CA 1KEEB 4UM9D 1SG6A 4G6ZA 3STVA 3I05A 4HQKA 7GPBA 4FR5A 2H65A 3NBXX 2HWUA