1D4ZA

Crystal structure of chey-95iv, a hyperactive chey mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlated switch binding and signaling in bacterial chemotaxis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords CHEMOTAXIS PROTEIN CHEY
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 1999-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d4zA00
3BBLA 1NXOA 1W9HA 4RY0A 3A0UA 1JX6A 5EWJB 3OLZA 2JK1A 5EWLB 5DCLA 2PUFA 1QO0A 3Q7TA 4WWHA 4YRZA 3K4HA 2CWDA 2QR3A 3LUKA 4N03A 1PHRA 1TMYA 2FQXA 2QSJA 3LUJA 3OO0A 4QYMA 4NICA 2L18A 3IP5A 3HK2A 3N0RA 4FE7A 3SG0A 4IILA 1BAPA 2FMHA 4Z9AA 5TPZD 4E7OA 4OLAA 5FWYA 3N0WA 4YCSA 4KFCA 2F8SA 3H6GA 3OLYA 3HVRA 4KMRA 3QELA 4RK6A 2B1JA 1ZGGA 1VRVA 1GUBA 2H0AA 2YHBA 4W5TA 1QQAA 3OMXA 3OQMA 3RVQA 4Z9BA 1Z2DA 3K9CA 1JH9A 1USIA 3MIZA 5HM6A 5D2CA 2HQOA 4PZ0A 2VUIB 1NTRA 2NT3A 5TQ0A 4ZJPA 4PE5B 4Y9TA 4RSMA 4W5QA 1QPZA 1RXIA 4UHKA 4OATA 1YS6A 1Z15A 2E4YA 3VNBA 4JOQA 3QELB 1DC8A 3M9XA 1LJLA 2WJAA 4N0QA 3TMYA 3Q9SA 1SXGA 5JS1A 3OLWA 1QP7A 3EAFA 2A9PA 1IIBA 4Q7EA 5KI6A 3FFTA 5ABPA 4NV3A 2LBPA 2PUAA 1Z16A 1UDRA 1XWWA 2A9OA 3HV2A 1Y1LA 2WB4A 2QVGA 1T34A 5CNKA 4G86A 5I4CA 4MR9B 3CNBA 3D8UA 4NCBA 1ZVVA 4RK4A 3GT7A 4MLCA 1DRKA 1MAVA 4DN6A 1EWVA 2FVYA 3JPYA 3SQNA 1XHFA 3DGFC 3UK0A 2R25B 3Q41A 4MS3A 3JPWA 5TPWB 5T3YA 5TQJA 3LUHA 3RVPA 4HYEA 3O21A 3Q15C 3EODA 4KRFA 3CG0A 4YLEA 5DGCA 1D5WA 1U2QA 3KYIB 1SD5A 1YVUA 2PUCA 3DLBA 4JA2A 1NXPA 4KK3A 5JS2A 4CBVA 3C3KA 2FLWA 4HNRA 2MSKA 3LUCA 3RVKA 5TE9A 5JNVA 4EYKA 5BRJA 4MQFA 2PE5A 4JAVC 3NHZA 5JNSA 1YMUA 3LFTA 4RZSA 4XFKA 3FMVA 3RVNA 1DCKA 3HUUA 4RY9A 3Q7SA 4G0QA 2E4WA 3UUGA 5ED4A 1TVMA 2W42A 3CTPA 4JB2A 2FQYA 3BILA 2GI4A 1GCAA 2QVCA 2H3HA 3N75A 4QYWA 1YS7A 3B2NA 5IC5A 2FMFA 2E4XA 3HJFA 1E6MA 1JFVA 4S04A 3H1FA 3RVOA 4Z4CA 1JBEA 2JVIA 2JBAB 1SRRA 1JF8A 5KC9A 6ABPA 3I09A 4P1ZA 1GLGA 3HS3A 3KLOA 4E7PA 4KPYA 4OBBA 4TLLB 5KWSA 1FQWA 1JFTA 2NZUG 4WXEA 1APBA 2FXIA 1DP4A 3BRSA 3E3MA 1D4ZA 1EWKA 5IUNC 1XHEA 3QLUA 4RKQA 2AYXA 1MB0A 3QEKA 4RK7A 2RGYA 1JDPA 4PICA 1QQBA 5KQLA 2L19A 3JS5A 4KQ9A 2IPMA 1P6QA 3EULA 4Z4EA 5T7BA 1RXEA 2NZVG 3GV0A 1BDJA 1NXVA 3O75A 1HEYA 1QMPA 3OM1A 4LDAA 4YS6A 5HQJA 3UKJA 3URMA 3GL9A 2JVJA 1DC7A 5TPWA 3QX9A 1CHNA 2FTKE 1BDIA 1JYFA 4EGSA 1DG9A 5HSGA 3EGCA 3FFXA 4OLBA 3GBPA 2HSGA 1EHCA 1NXSA 2M1ZA 3G85A 3O74A 4GPAA 1DCFA 5FBHA 3A0RB 1GCGA 3DBIA 3N6VA 1W25A 2ZWMA 3LKBA 4RS3A 1VLZA 1YIOA 2PLNA 5IULC 4FE4A 1ZGZA 1URPA 4JASB 5KQMA 3QLUC 2LIVA 3D02A 4DADA 3ROTA 4F06A 1A0OA 1USKA 1ISSA 3E61A 5BR1A 3HO1A 2E4ZA 1ZITA 2FMIA 3IP6A 2ID9A 2JBAA 4WZZA 3N53A 1ISRA 3CU5A 4O5AA 3F7NA 4LE2A 2QV0A 4KQCA 2KYRA 4MR7B 5KC8A 3GRCA 1RPJA 1Z18A 4RK0A 3RH0A 4ETNA 5TQ0B 4EUKA 4LDZA 1Z13A 3F6PA 3ROFA 2MYNA 4EVSA 4MR7A 1LK0A 4RU1A 2GX6A 1JDNA 1KRWA 1QP4A 1USGA 3MYYA 4ETIA 2LP4Y 5EWLA 2FKAA 1MIHA 1PUXA 1MVOA 1TLFA 2RDMA 4IMJB 4LRQA 3OLVA 4MS3B 3HDGA 1ZN2A 4D74A 3I42A 2FEWB 4P98A 2QU7A 3L6UA 4G0XA 3LUDA 4ETMA 5TPZA 3H1GA 4MR8B 3OO1A 3GA5A 5B3JC 5JNRA 3IPAA 1DJMA 1M5TA 3IPCA 4N76A 5FWXB 4NCAA 4N47A 2FN9A 8ABPA 4MYRA 2R47A 4XLTA 2GBPA 5C5CA 3QX8A 4G0YA 3T38A 5TQ2A 3CZCA 3EQ2A 4ZYLA 3H6HA 5CNJA 3QLTA 1Z2EA 2VYCA 3H1EA 2IDMA 1MB3A 3I5AA 3KS9A 3CKMA 3HSYA 3SAJA 3RVMA 3GBVA 4KV7A 1FFSA 2GKGA 2HPHA 1P6UA 3MQ4A 4YR7A 2X7XA 4IMIB 2PUBA 2M98A 4EYGA 4TN5A 3LUAA 1AB6A 3O2QB 5IX8A 4MRMA 2MSLA 2YHAA 2IKSA 3CZ5A 5GQSA 5CNIA 1S8NA 3OMWA 5CNMA 3JTEA 3H5LA 3A3KA 3MF4A 4LX8A 5IEJA 2HQRA 4IF4A 5EWMA 4Z4HA 1Z25A 4M88A 2HQBA 1DCMA 4RKRA 1M2FA 1QKKA 2MYUA 2CD7A 1ABEA 3N8IA 4EYQA 1ZAYA 1EWTA 3LMKA 3NHMA 2MSWA 4ZMSA 1SXIA 4RK5A 4S05A 1L5ZA 1QP0A 4MRMB 3OM0A 1Z26A 2MYTA 3F73A 1PEAA 1EAYA 5IEBA 1PNTA 3C3MA 3LKVA 3O1JC 3TB6A 4EYOA 2FLKA 3RVRA 1R8JA 1YTUA 1DZ3A 1YK0A 2LPMA 3I45A 3RQIA 3OQNA 2PMCA 2WWVD 1U0SY 3OQOA 4ML3A 1NXXA 5EWMB 1ZHHA 4PYRA 5IBQA 1JWLA 3CRNA 3LUFA 5PNTA 2PJUA 5B3JA 5KQPA 3LUGA 2JB9A 2R48A 3H5WA 1F51E 2IPAB 4QICA 3VNAA 4HNSA 5FWXA 4IRXA 4MQFB 4YO7A 3HZHA 3HCWA 1ZY2A 1C4WA 4ZPJA 2FW0A 4MS4A 2A9RA 3MA0A 1LBIA 4XARA 4MQEB 4XAQA 3GYBA 3EQZA 2PUEA 1Z12A 2FEPA 1AB5A 3TO5A 4KZKA 3IDOA 4EVRA 3NNNA 3JY6A 5BQ3A 4WUTA 2FEKA 3ILHA 4UHJA 4LE0A 4G0OA 3CHYA 4G0PA 2FQWA 1FFWA 4B09A 2PUDA 3LOPA 1JHZA 2O20A 4JP1A 1M2EA 1RNLA 3KCNA 3O2SB 3T95A 4MQEA 4YV7A 3NBMA 5KQGA 2F8TA 4XASA 4Z4FA 4KREA 4Z0NA 2JRLA 3QK7A 3IP9A 4MS1A 5BRAA 1E2BA 4WT7A 1RZRA 5DKFA 1NXWA 3M6MD 3N0XA 1ABFA 4RXMA 1NXTA 1VPWA 1SXHA 3CG4A 4D6XA 4Z4IA 4Z4GA 3W9SA 3FGZA 4OTZA 1JFSA 3G1WA 1ZDMA 2PKXA 1K68A 2IPLA 2LUOA 2PL9A 3EJWA 2L17A 3C6QA 3TX6A 2PUGA 4RXUA 1OXBB 4L85A 9ABPA 2PAFA 3H5OA 1FFGA 4N41A 5DTEA 3DLHA 5E3JA 4G0MA 5JNUA 4DQDA 2WY2D 1ZESA 4QPJC 2VK2A 2I6FA 5CHYA 3KJXA 4F11A 2E4VA 2MYPA 2E4UA 1DRJA 4KK4A 1YK1A 4XXHA 3O1HB 5IUJC 6CHYA 2IYNA 1K66A 5DLEA 3RVSA 4Z99A 2WRZA 2PL1A 2QXYA 4YWHA 3KG2A 1NATA 3HDVA 2CHEA 1ZH2A 1F4VA 1VKRA 3H5TA 4HNQA 2P9HA 4FB4A 3QEMB 5GOTA 1EFAA 3T8YA 5C5EA 3Q7RA 1KGSA 2BGGA 4PEVA 2RJOA 3M9WA 4TLMB 2IOYA 2N9UA 4RXTA 4F8JA 1DBPA 4TMYA 1RZRD 3QLVA 4KVFA 3KYJB 4H3HB 1D1QA 5F64A 3RVJA 1FSPA 3KSMA 1I3CA 1LJUA 2FSPA 4W5RA 3DGEC 1WETA 2WMYA 3CLKA 2OQRA 2QZJA 1A04A 4Q6WA 5FWYB 4RDCA 1KRXA 4JB0A 1JL3A 1TM2A 1BVHA 2P4UA 1GUDA 2JVKA 3KKEA 2FMKA 3MM4A 3F6CA 4F3TA 4LZLA 2CHFA 3IP7A 3LTEA 3GWGA 3NNSA 3A10A 3QEMA 2A9QA 2QW1A 4MLDA 3R0JA 4MAAA 3HM9A 3ILYA 1DBWA 1P2FA 4WXMA 1B00A 3MMNA 3T6KA 1KMIY 3JVIA 1CEYA 4EVQA 2JCGA 2HJ9A 4O1HA 1JYEA 3H5VA 4KNYA 4YP9A 4G0ZA 4G97A 3JVDA 4RWEA 1OXKB 5TQ2B 4Q6BA 1TJYA 1DBQA 1P8AA 3SM9A 1H9CA 3EDCA 4RY8A 5FBKA 1D2AA 1L5YA 1BA2A 2ZAYA 3HUTA 4EY3A 2VUHB 1U8TA 1LBHA 4F12A 4RV5A 1YMVA 1ZH4A 2V0NA 1PEYA 3CFYA 4H60A 3BRQA 2RJNA 3FFWA 3O2JA 3KHTA 1J56A 2OENG 1Z17A 4L4UA 2GWRA 2AYZA 1BDHA 1U2PA 3L49A 3H75A 4GNRA 3O1IC 4IGAA 2B4AA 5HKOA 3BREA 2NT4A 3CS3A 3C97A 1QNLA 1NY5A 3KTOA 4D6YA 1M5UA 3C3WA 3HEBA 4RK1A 3SY8A 2IPNA 3SNKA 1E6LA 3NNDA 2ID7A 2TMYA 5EWJA 3FDFA 4W5OA 3DZDA 1JLKA 4W5NA 1C0EA 3S99A 1U04A 4OG2A 2FN8A 3H5IA 3HXMA 2WJWA 1CYEA 1PNRA 2L2QA 2NUBA 4MS1B 1D1PA 5IUKC 5JNWA 2J48A 3KLNA 3RVLA 4MS4B 4MR9A 4N0PA 2DRIA 3QLVC 3P9YA 5JNTA 4MPTA 2R4QA 4O1IA 4MGEA 4ZMRA 3TD9A 4MR8A 1E6KA 2Q5CA 3OLXA 4NQRA 4YGXB 1A2OA 1QO0D 4H3KB 4LE1A 2XDYA 7ABPA
chains in the Genus database with same CATH superfamily
2WYOA 5L6LB 5KYYB 4YPFA 1B3RA 3PPYA 2DXIA 4MP3A 1HGXA 4FWIB 4K05A 4WN3A 4OQYA 4Q7MB 3OLZA 4XCVA 5ER9A 1EFVA 5EWJB 4BVAA 2OFOA 1Z74A 2ADMA 5EXSA 2P7IA 1PHPA 5IAKA 3VAAA 1KI7A 1TZBA 4HPJB 2A5YB 4YJ3F 1VKHA 3GZNA 4I8IA 4GEGA 3OZWA 2OBFA 3MINA 3IBGA 2WSLA 4QYMA 1G6OA 3AF5A 3D7LA 4N18A 3RROA 1FLAA 1CY0A 3MGBA 2BTOA 2BMWA 4B3MB 1JMYA 4KQMA 4AKTA 4F1WA 3T3GA 1CULC 5C31A 4EW6A 3V3TA 5IZCC 2WKQA 1RJEA 3HYRA 1BS2A 5I7OA 4AKIA 2H1CA 1DTWB 3LYUA 4AY3A 1JQ5A 1WXWA 3KXDA 4PYOA 4K0KB 1CV2A 2W11A 4W5TA 3BHNA 1VZ3A 1QU2A 4R1QA 3EPKA 2ORED 4EKDA 1SOUA 2BLNA 3MJSA 3BJMA 2IELA 2N47A 3FZQA 1LLQA 5LQKA 3EOZA 4RIFA 2UZAA 1S4MA 5TQ0A 4LOHA 1L4HA 1E5XA 1M6VA 2WSIA 1RKVA 2X3UA 4MINA 2W5UA 4OATA 1YS6A 3TJZA 2QYSA 4DQLA 3F6EX 2V59A 1J2YA 2BKXA 1G21E 3AERA 3OIVA 3QSGA 4FPXA 4JI3B 3VZQA 3FBGA 1MB9A 1T9KA 5F23A 1DBSA 1ECLA 4BJ1A 3O8CA 5KI6A 5I51A 5H16A 3UEOA 2I6TA 2QTHA 5D1NA 3HDJA 2X86A 1RAFA 1E0DA 3U7RA 1RHKA 2HFKA 3UJ9A 1XE3A 2VBIA 2YWHA 1CUVA 1F6DA 3JZDA 5EHIA 1FP1D 3V8RA 4LRTB 5I45A 5AOBA 1ISJA 1XWWA 5ALMA 1HYQA 4AO7A 1CQIA 2D0OB 1JDTA 3D8HA 1H23A 1E7YA 1YZKA 2V6MA 4HF7A 4L73A 4A8JA 2H29A 5C4GB 3KTFA 1EWVA 5T4BA 1QVZA 3OFJA 4KFTA 3DGFC 1WCV1 3G0CA 5KBYA 3KSAC 3NEPX 3MTGA 4NCHA 3C3YA 1AGXA 5E38A 3O6VA 3PC8A 1UBGA 2ACVA 1HEUA 1MX9A 1I2MA 2GN9A 1D1SA 3M6UA 2C9MA 4HRXA 3KAQA 2W9XA 2CFOA 2I55A 3NTQA 3O21A 3SC2B 1FYEA 4HLUC 4AJEA 2B82A 1A72A 3CLHA 1PO7A 2YRXA 4NYMQ 3U3JA 3I64A 1MW8X 1D8AA 1PT8A 3PRJA 1HDIA 3Q0EA 2MR5A 4D5GA 1N33B 3KKQA 5EHZA 1HXHA 4HD8A 4K6HA 2IU3A 2ZRLA 4IHQA 1YJXA 4QA9A 2ZTHA 1HSOA 1SVOA 2CJWA 2JATA 4UMEA 1I2BA 1P1RA 1NAHA 4KGZA 4WZBE 3IUYA 4O8ZA 1VRWA 2WWRA 1Q22A 3UUGA 4M1KA 2V7BA 4GIBA 2JKVA 1L1EA 3GCXA 3VJKA 3QE9Y 2NMVA 1MV5A 1UZUA 2QJFA 3PIIA 1JFVA 4RYDA 3A4VA 1DRWA 4Y1FA 1UPTA 5JJ5A 3OTWA 4OXQA 4DNPA 5HS6A 1GA1A 2QMEA 3L40A 1UKAA 1Z4IA 2IHZA 3G8YA 3PV0A 4M9SA 4ZT3A 4AG3A 4BZWA 1F2VA 1EPUA 1N75A 1A7KA 1P18A 3IKVA 4E7PA 3BWXA 2VDLB 4ZDIA 3JQ6A 4TLLB 3T5GA 1FW6A 1COWA 1X0XA 4RYLA 5I7WA 2P41A 2ZYRA 4V2UA 2LR0A 2CZCA 1QC5A 2O2ZA 5LZ5A 3H5AA 1W1UA 2C07A 2C5LA 3UFXA 2J59A 5IDVA 3ZDAA 1TEHA 2GNPA 4HZIA 1E5DA 2V4MA 4K3UA 3CE9A 5TEVA 2PL5A 2EFDB 3P2YA 1PP4A 4OI1A 4INOA 1GIAA 4RK7A 5I3ZA 2WVGA 4MYCA 3WGKA 2P65A 4HWTA 3FXAA 3OPNA 3G2QA 3N7AA 2GRAA 4LSWA 2C5FA 4L8YA 3V1TC 4JCCA 4A8TA 1NIPA 3LJKA 5KNLA 4CDRA 2OCKA 3ENQA 2HH9A 4QG3A 3LH5A 4I9UA 4XCXA 4OQXA 7YASA 3EIFA 4QDKA 3SC2A 3K8ZA 2IBTA 3HNPA 4DG9A 4LOLA 3U0BA 1G3RA 1N6RA 2FA9A 4M0UA 3ZX5A 4YUWA 5IANA 1M2JA 5TARA 4R31A 2RE8A 3Q2KA 4O4HA 4WOBA 3UMFA 1LH0A 1LLDA 2HXYA 5AHXA 2OOKA 5F12A 3ML1A 4QTTB 4YV0A 2PUHA 3BRCA 3UGTA 3H1AA 4EPRA 1W7AA 3M9LA 5A3SA 4Y98A 1F9AA 5BPFA 4A2WA 5AHWA 2FUEA 3G5AA 4QO7A 1ZH0A 4WPGA 1QHNA 4JC8A 4JP5A 4PQGA 4R3UC 2CMDA 3TR0A 2OM6A 2JGEA 4N39A 5F9MA 4AY2A 2PLNA 3A1SA 4P4GA 5LQUA 1URPA 1JR3A 1PT9A 3R23A 4RABA 1SUIA 1PGNA 2R44A 2WUDA 1LXCA 2BGKA 2PXHA 4M9RA 4M21A 4MRSA 3Q3IA 4JXJA 2WINI 5KZMB 3GWZA 1WU8A 2PGXA 4OBXA 4L2IA 2VZ9A 1GQYA 1C7FA 3ZV3A 3HO1A 3V6LA 1JWBB 2VCYA 3ESDA 1R9MA 1Z0KA 3JD1A 3AV3A 2VJQA 4EPWA 3F7NA 4IH9A 2IIVA 4QE3A 4C05A 2H08A 4DV2B 2P9TA 4NJEB 2WJJA 4G4SP 4Y6QA 2FFQA 5A4AA 1J24A 3I39X 2RI0A 4RPHA 3JD0A 4HRAA 3BMQA 1UMCA 3UV7A 1BKYA 1S8AA 2XBLA 4LSZA 4XSVA 2DUNA 3CURA 5BNTA 1YI0A 1L8AA 1QE3A 2Z58A 2BFNA 4OI0A 1DWUA 3KZVA 5DHUA 4RPCA 4UREA 1LSOA 5DGXA 3A3PA 1C4KA 2LDBA 2WP8J 1OGIA 3HFRA 1G7TA 4FFPA 5FFNA 1H4QA 2O5CA 1Z8FA 1QCYA 3DDOA 1OZHA 3FGOA 4DSNA 1Z82A 3CX4A 3EXIB 3R24A 4Q1FA 3FTPA 4NCJA 2ZPAA 3BXPA 4ETMA 4ENTA 4M76B 1LRKA 3JZMA 4V39A 3CVVA 2J87A 1MPXA 3IPCA 4MW4A 10MHA 2J30A 5CA1F 4PC2A 4TX1A 1NNSA 4IDPA 2P8SA 3SNHA 5K6TA 4QRDA 5FTJA 4TLCA 1HE1C 2X40A 2XUKA 1QHIA 3QY9A 1NUSA 4UZEA 1AY0A 4R7ZA 3KZOA 2ET6A 2C2ZA 3IJ5A 4RZHA 1YFZA 2XA2A 3TOCA 3K9FC 1LW6E 1EVKA 2HNBA 4B7XA 5KPJA 3BZWA 5A9SA 3WWDA 3PKJA 3ZIAA 1YUNA 2RHHA 2CNOA 4NLLA 4M0CA 1M5RA 4MQ4A 5DHQA 5IDWA 1MGOA 1SD2A 2HHCA 4NFLA 2QRMA 3VO8A 2OV4A 3EEOA 1ZINA 3PQCA 1PGOA 1QANA 2G1AA 1O77A 2ZI7A 4TMWA 1I3NA 4K1LA 3B8EA 2VJOA 4R2XA 2EF1A 3A7DA 3LPNA 4P7BA 4B6OA 4DREA 4QG7A 1DJOA 2XZOA 4LJ9A 2HU2A 1G4AE 2FOXA 2R79A 1G55A 5B1SA 2VPPA 1R4AA 1KEPA 5KJ6A 4PNEA 3WKEA 5CDHA 2QMYA 3HZOA 4I6JA 2CFSA 3TG2A 1O94C 5JQWA 2NN3C 4G4GA 3O8NA 5AJHA 1Y3FE 4OSOA 4LI3X 1VJTA 5AKXA 3VOSA 5CK4A 1XNHA 3KDSE 3K31A 4L6CA 3U7FB 1JNXX 1PEAA 3GRYA 4HFMA 1N2EA 3EC7A 3I1JA 2ZRPA 4HGZA 3DTVA 4NBRA 2FLKA 3SVZA 1VBNA 1RIFA 3WIOA 4ZYUA 1WCIB 4G9BA 1RP7A 5KKNB 3C39A 1YK0A 4OU4A 3AYZB 5I7UA 1FLDA 3MFQA 4ZVQA 1AXEA 1W5AA 1IBKB 4NZYA 3BWYA 3CVJA 1HUQA 5JAOA 1XJWA 3N8DA 3ZHVA 4O3MA 5EIHA 2WLSA 3ETLA 3KHUA 4X44A 4CNQA 4ATNA 1DIRA 3HYCA 2JAPA 5EI5A 4PSKA 1IG3A 3TGPA 1S6YA 4QXMA 2CYAA 3LOQA 3SZLA 3DHVA 4LC1A 1XPRA 1NRXA 3WSTA 1BWPA 1FFEA 3DCYA 4TS1A 5HTKA 3MT0A 5KOJB 2WG1A 2IL1A 4JJIA 1O57A 2FEPA 4PCLA 4L8LA 5EJ9A 3LHSA 3UB4A 5BT9A 3AO0B 1RMYA 4QXRA 1NPDA 3DPIA 3K73O 1U8CB 1P77A 4YRLA 3IEUA 3CJQA 1G59A 2BUCA 2AZ4A 2AFRA 4NNOA 4MGZR 3CH6A 2SCUA 4L5CA 3C6YA 5FLXA 3KIPA 2NYUA 2NO0A 1OLUA 2HMWA 1XQ1A 2O2XA 2VVTA 4YJKA 1TM7E 1PF7E 1IFXA 2JRLA 2R8EA 3B3GA 1OUMA 5ADVA 2FOLA 1S2NA 2XOKD 3WYDA 4N5DA 4Z4IA 4D6XA 1RVDA 2EERA 1ACMA 4AXXA 4J0QA 1YACA 3I5MA 3I9LA 2AQHA 2RMKA 3MD0A 5DN6D 3KZ1E 1JFSA 3P9QA 1CQXA 3M3HA 4AYTA 2OFFA 5EIAA 3G82C 3TIIA 4P81A 2LKCA 2IEIA 2NV6A 1IUKA 2OBNA 2AHOA 5TF0A 3MMZA 4FDLA 1CRQA 1MF7A 4BVKA 3DLHA 4RO0A 4DQKA 4CMIA 1NYRA 2HEIA 2PV7A 2WKRA 4QPJC 1LBQA 2GZDA 2IEYA 2I6FA 1BGWA 4E03A 2A59A 3BQNB 1A9TA 3ELDA 1VJRA 3H16A 3P9IA 4H1UA 4RCZA 4WESB 3U4CA 3GLFE 2YXBA 2DAPA 3HSSA 1KO4A 1I7PA 2GTPA 1E5QA 4C4YA 1N6IA 1VLLA 4WRRA 3IQFA 3ONDA 4I4CA 3RIHA 3HDVA 3LHKA 4UHFA 3HVIA 2CYBA 2P9HA 3HB4X 3BN3A 1L4UA 4KIUA 4Q82A 2AZTA 4RFVA 2DQKA 1EZZA 1M76A 4A2QA 3OPYI 4BP8A 4B31A 1DXOA 3LCVB 3WYEA 1RLMA 1SKQA 2CDNA 3EC1A 4PEVA 4ZVNA 3T9EA 1B6GA 4ALNA 4D9GA 3ROEA 2P90A 5HKBA 2IXBA 1J4AA 2BKVA 2OGTA 5EMJA 4CF6A 4AY6A 1OV4A 4REQB 3HZRA 3IUSA 3K6KA 4URVR 4NAUA 4YR9A 4KXXA 3N8NA 5DI9A 3EGXB 4JT8A 2OTCA 4S2UA 4UE3S 2X2EA 4IQ0A 2VN8A 4F5DA 2V97A 1L5RA 4FWBA 1YR8A 4HQLA 4JB0A 5DM4A 2JJYA 4EWLA 4X91A 2X6QA 4HGPA 5JEEA 2JVKA 2N1MA 3BIOA 1AHPA 2KI5A 3KEGA 5IVIA 3OZAA 4LZLA 3WB9A 3X43A 4C07A 3IP7A 4GS5A 3LTEA 4NCKA 3NNSA 5EAIA 4QBTA 4K9PA 2YRFA 1RWBA 2QTZA 3ER6A 3GEMA 3HB5X 2R8RA 3P8ZA 4UM9B 4KRYA 1M6WA 2EG5A 1LTHR 3BE6A 3BHIA 1IZ9A 2C82A 4KXUA 5AI4A 4CIDA 4DLXA 4EVQA 3PT5A 2DJ5A 3CE6A 4LHWA 5AI8A 1IWBB 2CEAA 2JIZD 4JU8A 1E1RA 2ZVJA 4RA9A 4BPRA 3E2IA 4HAVA 4AMGA 4ZYYA 2CFTA 5IPFA 1EFKA 1U1FA 5TVGA 1LFAA 1B4DA 1UODA 2PCJA 4Q4AA 2C59A 2EFJA 4QEDA 1E1QA 1UWVA 2ENUA 3SBXA 2C5AA 2V58A 2ZWOA 2WQZA 2RCNA 4D3YA 2NZJA 1JIJA 5E7QA 3U19A 4FGWA 4MVJD 1WNFA 1SIOA 5AUPB 5FOXA 5BNZA 4E22A 4ZYVA 4UBLA 3TI7A 5BSGA 1NMXA 1PE0A 2REBA 4H27A 4JQYA 3A6JA 2D7DA 1JDBB 2VBGA 3DT8A 2PMEA 2A92A 5A5VA 2Y6UA 1WZUA 1VHQA 1Y33E 1U5CA 3IP3A 3TL2A 4QLAA 5JJLA 4TLBA 1T36B 3TAHA 3VR5A 1C5KA 3NKFA 4TWBA 2D0IA 3KEMA 3O90A 1I0ZA 1D7AA 2FWPA 4MGKR 4HUTA 3E5MA 2D13A 4OIMA 2HJSA 2EWVA 4MS4B 1LQTA 3AI3A 4WK0B 3W1EA 3ZK8A 2IHUA 3VH3A 1P45A 2EW1A 4MQUA 3ND8A 3AUTA 3E2PA 1V9CA 4MGEA 4D43A 2ECQA 4QOHA 3ELWA 4DLNA 2JLXA 4NQRA 1WP9A 4DILA 3IVMA 3QBTA 5BYJA 2QL9A 3ZIAD 4CV2A 4DTIA 2ZRIA 1LB1B 4ZK6A 5L40A 1U3WA 5AVKA 3FWPA 4HH3C 4RY0A 1II8A 1JX6A 5IJ0B 2A86A 4AECA 1JPVA 4D0LB 1PAUA 3C6MA 2IBSA 2JK1A 4BEWA 2CUNA 1UDCA 1Z88A 2APJA 4RZIA 3U80A 2CWDA 4ZT5A 5HGXA 1ITZA 4ZWNA 2EBHX 5FL7A 3CEJA 1DB3A 1MUUA 4KOEC 2X14A 1E6UA 4KR0A 2QNRA 4QNMA 1JQLB 1Y9JA 2SNIE 4FKZA 3W7AA 1SBZA 1WULS 1AURA 2BBSA 3CVOA 4Z9AA 3X2FA 1T3GA 4DEVA 1KYZA 5LBTA 4KAXA 4A8JC 3AINA 1EXVA 3QGMA 4I5GA 3ROKA 4CCAA 2WIJA 1V43A 4YJ2B 4P2GA 4KFSA 5K8IA 1ZGGA 4JWTA 3S2UA 4DNFA 1SBCA 3CW8X 4UNRA 4IIHA 3PJGA 3UPDA 5CA1A 4OB7A 1ZPDA 3PLAE 1DLJA 3W6NA 3K9CA 1U1EA 3BMOB 3ZU4A 3MIZA 1GNVA 3E58A 3C85A 4QARA 4QUIA 4UJ5A 2G82A 1QQAA 1F0NA 4G36A 4U7GA 5KCMA 5D87A 1D4AA 3ORRA 4FC7A 3Q12A 4ZV4A 1I3OA 4J43A 3T7IA 4DA0A 4NI5A 4GI5A 2FPOA 3W5DA 1F3OA 4KRXA 3U5ZB 3RIXA 2JLAA 2GPAA 2P35A 1JIVA 4FMCB 4BCCA 2IZZA 2PUAA 3WNCA 4LKRA 1I3KA 3TTUA 1DWQA 1OWOA 1OU0A 3VO9A 2A1UB 2EKBA 4D3SA 5K3AA 3T35A 1MHTA 2JEZA 1PS9A 1U4OA 3TMKA 4BGDA 2HBZA 4NCBA 1C50A 3SQDA 3G49A 3MZ0A 4RJIA 4PGHA 4D8VA 2Z8ZA 4MDHA 2EX1A 1DXYA 1OWPA 4O2LA 4QUDA 2D2FA 2J4DA 2PMBA 1O0CA 1SUCA 1WJGA 4I5EA 1NC1A 4JBIA 3DBHB 3JQFC 3L0SA 4I1RA 4W6QA 4XIGS 4FXPA 5E9WA 4ZA2A 3RRYA 2VJPA 3FJ1A 2P6PA 4P4LA 1NFQA 1E0SA 1OSNA 2VHQA 3PDWA 4R2JA 4FBMA 3RS4A 1PFGA 4QYTA 4HGYA 1E3QA 2CLIB 1Q1EA 1KYYA 3EBLA 3TVYA 1G16A 2VF7A 2GGSA 1UEIA 1KZ6A 1X8KA 5DGCA 4AN1A 1TJNA 4DSOA 2G6TA 1KI3A 2DU8A 2WWHA 1S3FA 1Z7YA 4NOMA 2AZDA 4BGIA 1X7YB 2J9FA 3QG5A 5CG2A 2CFCA 2ZROA 1M8KA 1OI3A 1VL0A 2O1XA 4BZXA 1UBJS 4HVLA 4P31A 5TE9A 1KNXA 3TPZA 1UQTA 5TY0A 4YAEA 1HQKA 3ACBA 4ZOCA 4BO5A 3D54D 2GAIA 2GF2A 2P11A 5EQDA 4KVAA 3VR4A 1UZNA 2GFHA 2YWRA 4I81A 5I8ZA 3HUUA 4OI4A 3SXJA 4A0QA 5J58A 4GR4A 3D0KA 4IWYA 5CTJA 4YAGA 2R66A 3GY0A 2HTEA 3NKVA 3PDIA 4H4CA 4AURA 3ICEA 3WGJA 1GLNA 4CLXA 2JJ2A 4WKOA 3D3EA 4MVYA 1USVA 4PO9A 1ZUD1 4GDMA 4Y2GA 5ISMA 3P20A 1COWD 2O0KA 4PBTA 5AKEA 3FNBA 5EJ2A 2QN1A 2QQEA 3C3JA 5TGTA 2WF8A 4EPVA 1D3AA 1XZJA 5AXBA 1VI5A 2F3QA 2Q3EA 4EPXA 3Q1KA 1W0KA 1WB6A 1K88A 2OHJA 4L5BA 1ZMTA 3RYTC 1I80A 1X7YA 2J9FB 3EZ9A 4GOND 4F6CA 4QTYA 3U44B 3DB1A 3NAZA 1CUCA 4TOIA 2WVAA 4KPYA 2ZUEA 1UM9A 2FGJA 4FS8A 3IT3A 5SYAA 2RKWA 1ZJ6A 3H18A 3LFUA 1ULBA 1JPJA 4X93A 5FWNA 3STVA 3KOWA 4HDMA 4MKXA 2BFBA 2BGTA 4GP6A 4J9VA 4QAJA 4MO2A 4S1PA 5HR5A 4RVFA 4F21A 5LP6B 3K0EA 2BFCA 4UM8B 4WNAB 5KTTA 3PP8A 1SQGA 3DBHA 3IRVA 1C3VA 1IOVA 3H9CA 4FYWA 1VMEA 4WADA 5IT0A 4CL0A 1NW7A 3IE0A 4XQEA 4B84A 4KR7A 4LZZA 5ESXA 2Y2VA 1MOPA 5AVVA 5A0FA 1J8FA 2IPMA 3A3OA 4W63A 4P2BA 3D3KA 4R9SA 1Y3CE 4GVPA 4IDOA 3I5UA 1TU0A 2ZTVA 1C30B 1NVWQ 1S96A 2X13A 3IBFA 3OQJA 3CF4A 1DQPA 1PYOA 3MWDB 3SEQA 1Z5UA 3R4VA 2AQIA 3VYWA 3ZHUA 3GL9A 3C7AA 3MPUA 2YYYA 2AMLA 1TO2E 3HJAA 2CMHA 1Y9ZA 4CV0A 3G23A 2LGJA 1XVTA 2H0RA 3SJ7A 2JIQA 4AYXA 1YQTA 2NQTA 1UPBA 4X20B 3BB1A 2I71A 3FFXA 4BX3A 4ECAA 1UINA 2J5KA 3DDZX 3E3OA 2O8FB 3FNRA 1P62B 5CGQB 4GX1A 1GPJA 2IITA 2EJVA 3A6KA 1F06A 1E2KA 3MERA 1D4OA 4C4TA 1JDZA 3K2QA 2GYVA 5JSQA 2J0SA 3QWIA 2GFQA 1K3TA 1GTRA 3LVBA 2GTIA 3D7SA 4ISCA 1AQNA 2PWAA 4URWR 4KGXA 1USWA 1X1EA 2M2IA 2ZJYA 3QVXA 4K28A 3WTBA 3ZNQA 3WYAA 4BRSA 1YQ9A 3H3FA 4R2MA 3PRHA 3ROTA 2FLVA 1ZCZA 1U7PA 4AN4A 2E18A 3R1IA 4UAVA 2FR1A 3P0JA 1UZAA 2ID9A 5DW0A 1F7UA 1MR3F 5HOQA 1PNQA 4FQ8A 1IONA 4DBLC 4KQJA 3QKIA 3RRJA 4B3HA 1Z18A 3RC8A 4EUKA 1PQ4A 4D8XA 3E35A 3AW9A 4PYIA 3HU3A 4M7OA 3UMMA 4EF4A 2WMDA 2B34A 2ORYA 4EJSB 1G9XA 1RYDA 4ZALA 3DMTC 5IKEA 3TNLA 3KCQA 3I6QA 2JFNA 2LNDA 1K7CA 3L7DA 4YT8A 3D81A 4E5PA 3M33A 1G0NA 4JIGA 4PTZA 2HA3A 1NZJA 4KUEA 1RYBA 3UANA 4HB0A 3KWLA 1XUOA 2W6MA 1HM5A 2ERCA 4OOEA 1R6UA 1GL6A 1K5DA 2Q0HA 3D3WA 1JXMA 4RZ3A 3EVTA 2K2QB 4KAAA 4UPDA 4D3FA 4N5NA 3HH8A 3AR5A 4WLUA 4Q3DA 5EG5A 1YZ3A 4MOWA 4URUR 5LD2C 3IPAA 1OA0A 1XQ9A 4UVIA 3NHYA 1T3ZA 3IOMA 5CCBA 1O6CA 1VLQA 2ZWAA 4N47A 1J5XA 1NJ8A 2W58A 1YOBA 2HBYA 3TN7A 4E0BA 5BSHA 3F74A 4JDPA 3LX5A 1G63A 3E53A 3ZGYA 1TUBA 3LGXA 2PGIA 2PT6A 3QX8A 3WLFA 3BL8A 2CYCA 1BFKA 3H6HA 3QLTA 2CXUA 4HEHA 4HXFB 4MH0R 5K45A 2IDMA 4LJLA 1N9GB 2YMLA 2C4KA 5D3ZA 2JJMA 4H0CA 4CRWB 3TFOA 3A36A 1JAZA 4DV3B 3PIDA 1ZGCA 3VU1A 2AEEA 2V6JA 4IMIB 1PEDA 1U7ZA 1YZYA 1U2GA 3CLRC 3HWX1 4KPFC 4F2HA 4U2BA 5F33A 4PSVA 2PMFA 4EKYA 1OOEA 1NXQA 1U0JA 5CNIA 2GLXA 2ZRGA 3WLKX 5CLGA 1ZNWA 2NTJA 2WR8A 2WUGA 3JTEA 3MF4A 3O4GA 4HZGA 4IOMA 5KDOA 4C3OB 3BVPA 1IOZA 3IAUA 5IZ4A 3TXAA 4FN5A 4M88A 2OR3A 5IC4A 1UBUS 4RPJA 2C94A 5HCUA 4X7BA 1M2FA 1S9DA 2Y0EA 1QKKA 5ADHA 2J07A 4PNPA 2GVNA 3V97A 4RVHA 3QF7A 3EEQA 1ZAYA 1JAHA 4UUBA 1TOAA 4LOKA 3L0OA 3WTCA 2MSWA 1NX9A 1V16B 2WNSA 3T7EA 3HP4A 2AWNA 3BSWA 1S2GA 3WWCA 1PNTA 4JITA 3W5SA 4Q37A 1XRRA 3VU0A 3W6OA 2I2WA 3CUUA 4DT1B 3PC6A 1WHSB 3E9DA 3K9GA 3OQNA 4F8EA 2YIDA 3U48A 2YFHA 1NY6A 3KUDA 2I34A 3LUFA 3RFFA 2ZIWB 2FETA 4P32A 3HKEB 2J3JA 5ARCA 3TSWA 1MOSA 1WB5A 2R48A 3HBMA 4E5YA 4MUJA 5I7SA 3OU6A 2AOXA 3NTRA 2I6XA 2C8VA 3V1MA 1YKSA 2HU7A 2ZUVA 2GJ8A 2WJVA 1JR3D 3C70A 1XMJA 1SVIA 4H59A 4NU0A 4Y1RB 1BHSA 5DT9A 3T4PA 5LMZA 1BX0A 4O5OA 4RJ2A 3UHAA 4C7XA 4GZ5A 3I8OA 1OGJA 1V5FA 1K7EB 1U8AA 3VR3D 1WZEA 3L5OA 5HCIA 1QV7A 2PD3A 2YINC 3TZQA 3ZE7A 1EP3B 4E3ZA 3BTUA 3THYB 3HA7A 5L3SA 1B1CA 4NE2A 3K1JA 4I50F 4RM2A 5TGDA 4DDUA 4A92A 1SQSA 3KVNA 2CV0A 1B16A 1ESDA 1X15A 4UHJA 2E5FA 4B85A 1ZK1A 3OFVA 4TYWA 2PUDA 5C37A 5KSOA 1UT6A 4OYRA 4YAJA 5ALWA 5MN6A 3V8QA 1FSFA 1M2EA 1UPXA 1Z6GA 2P1DA 3AVPA 3FYDA 5LDGA 2GPBA 2CLEB 2P9JA 4A91A 4Z4FA 2BJVA 4Y6SA 1C81A 4NULA 1T2NA 4MS1A 4WLNA 3HCCA 5CEJA 2PWYA 1ZOSA 2QSYA 4JVSB 1SHJA 3ETGA 2TECE 2XB6A 3DOIA 3N0XA 4AQYB 3HBFA 3X1MA 2XPCA 3GUCA 5BMVF 3ZIDA 1MKYA 3IPLA 4WFKA 1MENA 1N2ZA 4INJA 3GJ8A 3FGZA 3M5DA 4OQ4A 3GA0A 1CEQA 3K6RA 3TR5A 2HA4A 3RADC 1VJ0A 2I76A 1J8QA 1EP2B 3C7DB 2IWRA 4YX9A 3B7GA 4N3GA 1C9MA 2QLTA 5A5EA 2H2FA 2XF2A 3UZUA 4C76A 1M8JA 4E70A 4P5EA 4J8PA 3RR2A 5FNVF 1KBZA 2XA9A 3EVFA 1AIPA 1V8DA 1FYDA 1AUVA 4C3VA 3RIGA 1D2RA 5FBQB 1EFPB 4FS3A 4UUPA 4RVGA 3DC7A 1NZDA 3BEOA 2BGLA 3DW3X 3GLSA 1MC8A 1ZD1A 2OCDA 4EATA 3WGUA 2I3BA 3TSCA 1PD1A 2IQIA 4RMIA 1M2NA 4MGIR 1VJ1A 3OWHA 5CHEA 5TS2A 1CR4A 3WKDA 3L7LA 1U7OA 5IUJC 3ZLTA 2R1UA 4IFIA 1KMQA 2R751 3AF1A 3EK2A 3PUJA 2FYTA 3HPQA 4NZMA 4KNWA 4UU1A 4F5YA 4YJFA 4Z1OA 1Z63A 5GOZA 2CLOB 3LDGA 4DFDA 1FQOA 1XYYA 3FG9A 4WASA 2Q1TA 1GGJA 1MRSA 3FVTA 1G60A 2Q7OE 4IS3A 4BNKA 3K09C 3LT2A 4NPAA 5HUHA 3Q8MA 3QXHA 2JFGA 2W2KA 5ABPA 5JT1A 2JGFA 1GWNA 1O9GA 3ADDA 1Q2XA 2P4SA 3TLXA 4EGQA 3KQYA 4EFDA 1TW3A 4GQAA 4YJHA 1JHPA 1S8OA 1YU9A 3KQUA 4QXPA 4XRGA 4NOKA 3RVJA 4IXMA 4MA4A 4NYJR 3CN9A 3JQAB 5BV0A 1OPRA 2C42A 4HBZA 3ZWCA 4DY6A 4GZLA 3CLKA 5L7WA 5FWYB 2I9PA 4RDCA 2PKYX 4D4GA 1ODFA 3WLAA 4CM8A 1J5EB 4WXRA 1S2MA 1GUDA 1YULA 2HBQA 4LTNA 2YUIA 4CKYA 5LXTF 1H2YA 5IARA 4NWIA 3OIWA 4ODIA 4RHUA 3VC7A 3MT7A 3VMFA 3DQPA 1DHTA 1RC8A 2CHFA 5DXAA 1UC4B 4WCFB 4BASA 3KYDA 1I14A 2HDWA 5DTIA 3VR3A 1DKNA 1MQ9A 4G67A 4HPXB 1KR2A 1O5TA 2HXGA 2D2IA 5ESDA 1G19A 5JE8A 3JCZA 3FE2A 5K0CA 1X77A 3LLSA 2JPDA 2CNKA 4NBVA 4KAFA 2WJYA 1T0PA 3PHGA 3S27A 4JI8B 3VKGA 2CMGA 2GJKA 1NQ5A 1P5HA 2AFIA 4Y30A 4D8WA 2AWOA 5G4KA 3R5JA 1M34B 4HNTA 1Z47A 2IVZA 4LGVA 1LSJA 1JSXA 5FBLB 1VKZA 3PX2A 3ADKA 4IOJA 4FKBA 3GHHA 4V3BA 4IIUA 3BK2A 3CFYA 2XXBA 1NF2A 3BRQA 2WSBA 5CVJA 3LXUX 1K2WA 2CC2A 3D2AA 2Z1DA 3LYHA 5L7TA 1U0BB 1RBQA 2F1HA 4G1CA 1YNOA 1M5UA 4H7IA 4ZXPA 5A1JA 5ADWA 2Q3MA 1KEUA 4TZ0A 2E85A 2NPIA 3BXGA 1NOIA 2BKUA 1DIAA 3NUQA 1KDRA 1MH1A 2IYRA 3GMSA 4FFVA 1HT1E 1X9GA 1H1LA 1FU8A 3OESA 3F7OA 4BEBA 5FDFA 1ZUIA 3KP1A 1JIIA 2FW8A 1YRLA 1OB2A 3EXG1 2L2QA 1Q19A 1RP1A 4W7IA 1P4SA 3H2IA 4YECA 3GJ3A 1CS4C 5JZ9A 3DZCA 5AR1A 3KLNA 4PU0A 1SBIA 1V95A 5FPQA 4DNQA 1YB6A 5FWXB 2D1RA 2DRIA 2EJUA 2GH1A 3MK31 3ZS9A 5L4NA 2HU8A 2Z6UA 2COUA 1PZXA 3RVDA 1QUFA 4D0RA 2GK7A 3O4RA 3SQXA 1B73A 1SCNE 1O03A 1XCPA 5GM1A 1WBDA 4LJRA 2OV1A 5CD1A 4H3KB 1R0ZA 1BVUA 1A27A 1LBEA 1HMPA 3MRVA 3EIHA 2QG6A 5AXDA 2I80A 5FBVB 4TSFA 5JXJA 1XPUA 4XGQA 2CJXA 2BEVB 2XBMA 3O03A 4R68A 4YONB 4DM7A 1IUOA 5DCLA 1A9YA 3RO7A 2QE7A 2V45A 2PUFA 4QEKA 3PF9A 3FDZA 1K8ZB 3MB8A 4UULA 4DR6B 5ES4B 2QTVA 1BXZA 4OP1A 3TNDA 1IY9A 4ZCMA 4NJMB 1JJFA 5IAJA 3VYRB 2ZQZA 4K3VA 3BEDA 3TPCA 4DLLA 2IT1A 2OCBA 1Q14A 3M83A 4IQ8A 4CG2A 1RM4A 4CR7A 4BQIA 1QZTA 3FKSD 1J0EA 2C04A 3ZZUA 4LXTA 5LP6A 2F8SA 2GF0A 2FZGA 4QELA 4QQKA 5FF9A 2ONJA 3G2NA 2ZP1A 2PGDA 4P3KA 1RWWA 4RA9B 3W2GA 1BWSA 3EDMA 5DMXA 4WMLA 4B3BA 3WS7A 3H1TA 2V96A 3H8SA 1GU0A 1HRDA 1CS0B 2DTEA 3H9GA 2BC9A 5ALOA 3QHAA 2OSBA 1LWNA 2TMKA 2W6QA 4PX5A 2NUPB 5EEGA 1QQ5A 3E27A 1NNI1 3JTMA 4GP9A 3L0YA 4WOPA 4HN9A 4ER0A 1VMKA 1HNWB 4X1KA 1L1QA 5DWVA 1G4HA 3PWZA 1ZM3A 5E4FA 3JQAD 4NBLA 3FRJA 4ZC1A 3S4YA 2WBLC 4ADSG 2H4WA 4G25A 4C0SA 1QRRA 1O4WA 5ALHA 1IQRA 3GNQA 1RZ3A 2QUBA 3HDTA 4RLSA 4EPTA 2EZTA 3H9EO 2BP7A 1YT5A 2ZJ6A 1R4NB 4G4SO 2R6HA 4REMA 3TZ6A 3FNGA 4RBNA 4CDMA 4OQDA 3ND5A 1B43A 4LTMA 3A4MA 4BFLA 4D46A 2ZR9A 3UK0A 4MI9A 3Q41A 2C31A 1U9IC 3D7KA 3F5FA 3PFGA 4MV0A 3CBQA 3S29A 2PKQP 1W5FA 1X1DA 2GRJA 3MMPA 4P9NA 3V7WA 5CB6A 5EJ8A 3U3ZA 4GL4A 5GVRA 4OJKA 4Q48A 1KH1A 3KK0A 1KF0A 2NUAB 3DAHA 3IB6A 1N77A 5A0TA 4YLEA 1Y80A 2P27A 3B6IA 3WNDA 4LFBB 1T0HB 3KZNA 4TL9A 3JAWA 1AE1A 2ZOSA 1Q0QA 4QDZA 2CLLB 4PG5A 3KSRA 1J97A 2DQSA 3LUCA 5CGZA 4YQZA 1R37A 4M1MA 2I9KA 2DHEA 3VUEA 2FUCA 3DA8A 2OMEA 1LI4A 3ZNNA 1HBJA 3HRKA 4PFJA 3RVNA 2PVPA 1H3EA 4HZUB 3L1KA 3L8YA 4F3CA 2UUAB 1WXGA 4CL8A 2V3CC 1EX7A 4EY4A 3K53A 4PZLA 4O59O 3TRFA 3ED1A 4WFIA 3KBBA 3RSQA 2PKQO 3NV9A 4D8TA 2C7QA 1P3DA 1DADA 2BEUB 4LZOA 1SKYE 1UC5B 3LX8A 2EOAA 1PS8A 1SVKA 1ZEMA 5E9JA 1X74A 2YC2C 1M1NB 2JVIA 3I30X 3VBEA 1A97A 2RD2A 2HXSA 1GZHB 4NG4A 3UWDA 3Q72A 1ZRSA 2VTKA 4RKFA 1W85B 1JKIA 1H3FA 3V8VA 4W1RA 4TVSA 3LBHA 5JS8A 1EWYA 1YSCA 1BJRE 2IV7A 1WDWB 3BRSA 2VJNA 5JWRA 1LPSA 3OZFA 4LXXA 2GBGA 2DYKA 2M6KA 3SS8A 3VOBA 1KJQA 5AKJA 3SR4A 2GZSA 1E7MA 2XX3A 4LJSA 1VPLA 2GK3A 2G76A 2W0MA 6ADHA 4I55B 3HADA 2FK8A 1YXMA 3TSOA 3WDLA 2QL5A 3GPBA 1MB0A 3G9QA 2O5RA 3RSOA 1J8DA 2Q1XA 4GI1A 3CN7A 1KZ9A 1RABA 4BAUA 2GJ4A 3ZHSA 1UAYA 2WC1A 3OQHA 4QQ8A 3VAYA 1C29B 3EXG2 1PZHA 4UAUA 1L5QA 2SKDA 3LRPA 3RYIA 3ZHYA 2NZVG 5EOVA 4Z6KA 1ODJA 1TAUA 4LDAA 4M7RA 3OEYA 2CXHA 2HOQA 3IDSA 4DIUA 1Z6ZA 1RYEA 2CNWD 1V9SA 1ZRNA 2HHHB 4NFYA 1E99A 4N5HX 2QZSA 2X0JA 4AF8A 2GCPA 1GTL1 2XB9A 4OHPA 1AA9A 1GG2A 2R97A 1HC7A 2Q9CA 3KOUA 3ZZMA 4DRXB 1SC6A 1VL5A 1E9SA 1LQ2A 1WCIA 4MV8A 2DECA 1U0LA 2ZRKA 3HO6A 4KO4S 2ZWMA 1U9YA 2PR7A 2AJCA 1Y1SA 1E1YA 3MAGA 3AEZA 2E1RA 3EVGA 4KXWA 1VCIA 3PS9A 3WRXC 5ADUS 5KYWA 3OZSA 3QKSB 4JP8A 4EG4A 4B3XA 1THGA 5I4KA 1DO0A 3HYTA 3SIRA 4BQEA 3ORQA 1NW4A 2XMSA 3E4DA 2PKRA 2O8NA 4AULA 3T3DA 4IGFA 5AM5A 2WU1A 4QFBA 4RF2A 5T6MA 3UBMA 1RRKA 1W76A 3PNYA 4WLFA 3RS8A 3W4KA 2Y92A 4BCBA 4H9GA 2VDMB 2YXNA 3U7JA 2IP1A 1KJYA 4M8IA 3GRCA 3EBOA 2XDAA 2VLIA 3JAKA 1EBBA 1OZFA 1IH8A 4R8KA 4CGYA 1PEKE 1XZQA 3PDHA 3BTOA 3MJ4A 3V1LA 1C1DA 2PLAA 1GSAA 1VP3A 3PI6A 4Q12A 2X3FA 5D01A 4Z7NB 5CURA 4RPIA 4D9FA 4G1VA 2YJGA 4HJRA 2FKAA 2TSYB 3ZWBA 5BV2P 1MVOA 3IO3A 1DV1A 3ZY5A 2QD5A 2V7QD 2OV8A 2F48A 5F1OA 4D74A 4YN3A 4XWYA 1J0CA 1XCMA 4W1QA 4Y2HA 4S1VA 3LVRE 3Q40A 4NPHA 1W75A 3L6UA 1ML3A 3DKVA 3RF7A 4TGLA 4DC9A 2GK6A 3L82B 2I33A 4S12A 4YIKA 4MI3A 3WJ2A 1Q1BA 2ST1A 3K94A 4G8CA 1P3JA 3PRYA 5C0OE 3BJZA 4X6YA 2JAXA 1F14A 3DOUA 4IS2A 4A6EA 2V5AA 3DWFA 3N58A 3OQVA 3U3OA 5HWSA 5CBPB 2JLQA 3T3EA 6REQB 3WOVA 3BGWA 3CPSA 4EPYA 1XB2A 2RH5A 1O97D 2B8JA 2QSZA 3ZBTA 4XQ0A 5JHHB 2O6HA 2AG1A 4RVOA 3H1EA 3IEKA 1JLMA 1KNQA 4ZGWA 3EGXA 8ADHA 4U6SA 4A82A 4OHCA 4ZHSA 2AA3A 2DBRA 2YASA 4J7CA 1SNYA 3JRNA 4JNCA 1B8VA 4DKJA 2VP0A 4IF6A 1RWXA 1AB6A 1GNSA 4NBUA 3ZHCA 2HMVA 4LJ6A 4Z51A 5CAEB 2AMFA 1S8NA 2PH5A 3L0PA 1YI8A 3PFIA 5BSTA 1WSAA 1WXFA 3RHTA 4MYTA 3AVXA 1H6CA 4GICA 4P7GA 4JK3A 4UUOA 1Z2PX 2HQRA 1YR7A 3GEPA 4A26A 3A2KA 3AB8A 3L77A 5CH3A 3TJRA 5HKAA 3ESYA 1ZU4A 5K0TA 3RTAA 3MRXA 2H1FA 2Z9BA 1KAEA 3PDCA 4LOIA 3FPHA 2CW5A 4UATA 3TTWA 4IJVA 2G06A 4KO1S 1YI1A 4AY5A 4ZMSA 4IAOA 4ABYA 3B5EA 2NU9B 3P9KA 3M34A 2A9JA 4QGBA 5IEBA 4KPGA 2A57A 5E9AA 3O1JC 5SICE 2Z2JA 3TLBA 1YR2A 3GMDA 1DZ3A 5ICCA 2PH3A 4B45A 1NVVR 3EDYA 3NHUA 4CWAA 5JJBA 1ADFA 1RRVA 3LP8A 4GYWA 4D0NA 1SB8A 1IL0A 1ZK3A 2ONZA 1GGEA 4MIKA 3QFTA 3EFOA 3RU9A 3RWBA 2HX1A 1C9KA 1Q16A 5JV5A 2DVMA 2VQEB 1GGMA 5HHTA 1EE2A 3OTQA 5A4IS 3RHSA 3A1NA 3IRUA 4HYQA 3WLHA 1J1ZA 3OJ0A 1QYIA 3BQMB 5DCWA 3K2EA 1OROA 1T9BA 2W2MA 4J1NA 2NGRA 2JGIA 3K2BA 1PYGA 1RBYA 1DU4A 5ESRA 4QIHA 4U1RA 2ATXA 2EFCB 3CIFA 4YH1A 1UM8A 3W5UA 3LCRA 3RE1A 4RGBA 4XLLA 3RYHB 4EKNB 5JFOA 1TZKA 5F78A 2F4NA 2O05A 4FFSA 2VPYA 4GBED 5FTNA 4ZVUA 3RDPA 3ZCSA 3IKTA 3AY3A 3MWFA 1WL8A 2J32A 4FOOA 4PLPA 3ADCA 4DDVA 3EXFB 3OT5A 3T95A 3G5TA 2PDAA 3TW4A 5DSXA 1T3LA 1C0LA 2V7UA 1CQJA 5FOSA 3AONB 4AUNA 3BD6A 2RK6A 4IKPA 1QMGA 3CGGA 3WL7A 2VR1A 3GP8A 2GLUA 1U3FA 2Y0DA 3M6MD 4CGZA 2JGJA 4C2AA 4CLRB 2CV2A 4NZNA 1AHIA 1D0VA 4NMXB 3LIPA 2OQVA 1FZTA 4CG0A 1BO6A 4FB5A 1TJ4A 3M6LA 2WTUA 1F6BA 1IHPA 3ESCA 4KPUA 5SV2A 2Q0SA 2LCIA 3G1WA 1T1EA 3AHFA 4N82A 2G9NA 3AVWA 1DDGA 1SHUX 1Z7BA 2OC9A 4OO3A 2L17A 4QJIA 4BX0A 3RUIA 4R2HA 1EXNA 2GNOA 5AOVA 3V33A 1JBKA 4QGSA 5KJCA 3NQ41 1MJHA 2EAUA 2GXQA 2Z6VA 2AUTA 3BKXA 2PRKA 2WAYA 3D1JA 3OZEA 2G4VA 2C3OA 5BQFA 1ZESA 2C7OA 3X1DA 2VK2A 3U9TA 1FDTA 5JSHA 4QOFA 1V6CA 2MYPA 4MDEA 3UYLA 1E9DA 1LCIA 2HHJA 4GAEA 3I0MA 3OU7A 4KK4A 3A27A 3ENKA 5REQB 4CF5A 1VYVA 1W36D 2IYNA 2QRJA 2VHUA 1K66A 2WTEA 1TU4A 3SHWA 2RK4A 4MAFA 1NL3A 4IXTA 4C14A 2IYXA 4MWTA 4FLFA 4XIJA 4FFWA 4DM3A 1GU1A 4BLRA 4GKAA 1YJQA 3EASA 3LQKA 4Y9RA 1EK0A 1RJ9B 2ZIXA 3FN4A 3LAWA 3K0CA 3HZZA 5B57C 3ETJA 3MG9A 3FOZA 3EIUA 3M2TA 2HRZA 5F2OA 5C5EA 1Z4NA 2ROQA 1Y9AA 1V25A 3EMBA 3PFBA 3SSAA 3UAVA 1RWKA 4JN6B 4RHXA 5AW0A 1I7DA 5GJCA 4AUEA 2XOKA 1C7QA 3L84A 4X6XA 5EUCA 2EEPA 2O06A 4FP9A 2YZNA 3MCUA 3KSMA 4ZCLA 3UGQA 3AF3A 1A8PA 3FMOB 1TK2A 3WC4A 2J0EA 2FHSA 4B8YA 5LQNA 5MF6A 1JGTA 2A14A 3IR7A 2NXJA 3NGXA 1CUZA 2PRZA 3FTNA 4QQRA 4J4TA 2B9EA 2VK8A 4RSRA 4BX8A 5CBPA 2YKGA 1YB1A 3QYAA 3T5BA 5HIMA 4J2TA 4P6VF 4EJFA 5LIPA 2BTQB 2ZFUA 3CCFA 1RYZA 3FAZA 1WB9A 1HDYA 2QW1A 3M2PA 1JEYA 3E8XA 1K75A 1WRBA 1NVEA 2C5GA 2O2EA 2PH1A 3AU9A 4JJ6A 1DHRA 4LQ4A 3FCYA 3TTYA 1TO1E 3Q6MA 5K3CA 1I7SB 1V7ZA 3KQQA 3WWYA 4NPCA 2FZVA 3ZOKA 1KK2A 2WJ3A 4LRWA 1N6NA 2V7WA 2EZ8A 4NDZA 2OFWA 4Q47A 4L22A 2RHJA 4UU0A 5EIBC 2IZ1A 1K0FA 3HCRA 4LNHA 4NCIA 3INYA 3FYTA 1DEXA 1XFAA 3AUAA 4L4YA 5SY4A 1L5MA 1M7HA 3TBHA 1SR8A 4AWBA 4CW7A 5LOVF 1M33A 3REQB 4J1TC 2AC2A 4C43A 2BE9A 3FLAA 2J7PD 2E5WA 2NQ2C 4U6QA 4F12A 1YNSA 2XD4A 1TD1A 2YZ2A 5DGIA 3GEHA 3BMQB 1X38A 3FFWA 5CRIA 1CQJB 3LQFA 5KHOC 1ULTA 1U2PA 1WQ3A 2Z08A 4WESA 3O1IC 3O83A 4QXAA 3IPRA 3BREA 4XR9A 5IVDA 8LDHA 2CV1A 1WZCA 1CETA 1TYEB 4IL5A 4RWZA 4U7DA 1NP7A 3TTVA 3CF0A 4XDYA 3CA8A 4FI3C 3AIMA 4CEIA 1RI4A 4DAOA 1RAGA 1FX0B 1NDUA 3WL5A 3DJYA 5AI6A 1QHSA 1EK2A 4WZAA 4OG2A 1DOHA 3HR8A 3S2GA 2WZQA 5FAKA 3SEZA 3B85A 1M8PA 2XY4A 2XBUA 3AKZA 4B5KA 1XTZA 1ZN7A 4ROSA 5F98A 5D7BA 4NEHB 1C7JA 3HGQA 4G5RA 3PWSA 3KXLA 4F38A 2BDEA 1YB5A 1QHGA 3P2IA 5BN3B 1UFKA 1KGDA 1JN0A 1UMBB 4LXHA 1STOA 1NDHA 1SU4A 3N07A 2QVYX 2EF0A 5JG7A 2OYCA 4F9GA 4R9NA 3T3NA 2VT3A 4TVOA 1B6TA 1FF9A 1K86A 3D8RA 3MQ2A 3TW8B 1GV0A 1ZONA 1ZX1A 4JOSA 4LE1A 2DEUA 1GA4A 4UMVA 3R74A 2BBOA 2C9DA 2JLBA 3C6XA 3KQMA 1M0WA 3LQ4A 4RIEA 5DX1A 3HXQA 2C7BA 1ISMA 2AXQA 4HVAA 5LB2A 3EGDA 4UHHA 2AMVA 1IN7A 4BAZA 3OOJA 5C7LO 2PFKA 3EPPA 3TCKA 1SOWA 5LOVB 1MFZA 4QUBA 3JXEA 3DHNA 3L8MA 1YFJA 2OBXA 3DEYX 4LZJA 1ZL2A 1WKBA 3ZUPA 1VZ2A 2XYRA 3H2HA 4AJKA 3ST7A 4Q1EA 3EA0A 4LZAA 4WGGA 1IHUA 2IZOA 1CU1A 4LZPA 3U09A 2VZ0A 3RLFA 2FMHA 1F48A 2HDHA 3OA2A 3N0WA 4Q34A 4YAFA 5M3BA 2BOVA 2GARA 4LYYA 2C97A 4JT2A 2Q6IA 3L8FA 1CW2B 4PC6A 3W2IA 4B3SB 1ZP6A 3NIWA 2Q62A 1GUBA 1FP4B 2W8BB 2ZRQA 3G5LA 5EQFA 4HXYA 5JS7A 1AC5A 4HLCA 1SC9A 1PFQA 4Y8VA 3FCUB 3KJEA 1DKQA 5L3QA 4FC6A 4QTXA 4P3PA 1SCAA 1JG6A 1SQFA 3PGKA 4ZOQI 2CB0A 4GXRA 2BR3A 4PE5B 1B41A 1QPZA 1DKMA 3T5MA 4IJWA 1OLSB 1A8IA 4HLQB 5FLKA 3WLSA 4J0KA 4JOQA 3VNBA 5AHOA 4YDQA 3A6HA 2FSVC 1X1QA 3AIKA 1SVMA 3JYHA 2HWUA 3N59A 1YFLA 4GRAA 4HN4B 3EWAA 5DOZA 2I3GA 1F4PA 2GM9A 3UK1A 4NFSA 3LY7A 1AO0A 3DWGA 3BPSA 4IYJA 4NARA 2JGAA 3P9PA 5DE3A 3TLGB 3ZCTA 4X64B 2ZJ3A 3GZNB 1QYWA 2AN1A 4LYDA 4NMWA 4WHMA 2ZWIA 5DBGA 1GZ5A 4YT2A 5K8JB 5B6JA 1A50B 2QMHA 5T64A 2JFXA 2P6MA 1X2EA 1KAQA 2FKNA 2O07A 3CKLA 1P0CA 1QVVA 1S1CA 3B7WA 3IMCA 3ANLA 5C46F 3QPWA 1Z75A 4CPDA 3EGVA 4M9CA 5H82A 2LZ0A 5AK4A 5HKKA 1D09A 4AROA 2Z4TA 1ZL0A 3PD7A 3Q6IA 4B3GA 1DIGA 4LYJA 2HADA 3F5MA 3RRMA 5GGXA 4DJAA 2ES4A 1LNZA 1L9KA 3BWCA 3TL3A 1GRRA 3TZKA 4EARA 1JG7A 2P3LA 2Q6KA 2QL6A 2EU8A 3EYWA 3H8WA 3PQ6A 2ZBGA 3WQQA 3IOEA 3F6RA 4DB4A 2IYWA 4U5XA 1E96A 1PU2A 1SCJA 5AOAA 2HWKA 3UBTA 2REQA 2YZMA 5EHNA 3MOIA 5LB4A 1LNSA 1W88B 2CXRA 1GG8A 3OZBA 1DBRA 4NJEA 3RK1A 3TSZA 2VPXA 1P74A 3F5QA 3HWSA 1W8IA 4RAOA 4P93A 4LV5B 5F2KA 2Q49A 2W22A 3W8RA 2Z6QA 1HF3A 5H83A 3LFTA 3R4CA 4RGVA 1N57A 5CM8B 3DPUA 4DR7B 5AKIA 4FT4A 5AKGA 1XTBA 4R16A 4TN1A 2V5UA 1VCMA 3ZKWB 1TAQA 3U60B 2PXCA 4MMXB 4P36A 4G0NA 1DJLA 3UYKA 4CV1A 5AVUA 2W6IA 1GCAA 3WWEA 2AI2A 2F55A 3OETA 2WNHA 4JEMA 2ZT7A 3B2NA 2YH2A 4LMPA 5HIJA 1KPGA 2OXRA 1E3MA 5BVHA 4O25A 1R0RE 2R9VA 2J3QA 1M2HA 2X8BA 1RQRA 3L6DA 1X70A 4M0PA 4M9ZA 2P9BA 5DBEX 4DCPA 1EUYA 4I19A 5ES3A 5HS4A 6ABPA 4CNBA 3MCTA 4CM9D 3KLOA 2PUWA 1CZHA 4QVGA 4R84A 3GARA 3ZEAA 2IXTA 1M6NA 1EX6A 4L7VA 5AM2A 2NZUG 4CEHB 4N6GA 1YASA 3OSUA 3PA6A 4KUGA 4R1TA 3FVQA 4CKXA 2LIPA 4RSGA 4UBKA 4RW0A 4E11A 3VYTB 3GAAA 4FR5A 1EYZA 3SPXA 3HKDB 5AOCA 3EHDA 2P5SA 1FNSA 2DQ4A 3CLUD 3N7UA 1KAHA 1XRMA 4MPRA 1DAHA 1N2CA 4BC1A 3H0KA 1KHHA 2RGYA 2HGZA 1Q0UA 3PTLA 4PICA 2WFLA 3VSEA 4F97A 2OHVA 4S2EA 1DEHA 4F0JA 1WD7A 2QV7A 4YLGA 2BBTA 3ZGLA 3P0RA 4BY9E 3NHKA 1SEVA 2D5IA 3WFZA 3OM8A 2F3PA 1WXHA 1RRFA 3GV0A 3SXUB 2QXTA 3JWGA 3MLEA 2PS0A 4FSXA 5HQJA 1JZSA 2QM3A 4TQGA 8ABPA 5GVSA 2OP1A 3ZK7A 5JAIA 3GCWA 1Q44A 4BMCA 4J3FA 2FP3A 3SQMA 2FFAA 3FBWA 1VJGA 1JZQA 4DCGA 3TOSA 1P61B 1I2CA 3FA2A 4JL5A 1Z2AA 1Z0FA 1EHIA 5J1SB 2VNAA 4HH0A 5FI1B 1QYCA 5I9SA 1KDYA 4MYHA 2R2GA 3WRYC 1XMVA 1WV0A 2AC4A 4AZ0A 4BLQA 3L9WA 2Q99A 3CLTD 1IZ7A 2I8CA 4OKIA 5HG0A 5HE9A 1N25A 3FKQA 3REOA 1ZRMA 3D1LA 1IUPA 1GAEO 2Z57A 3WIUA 2Q3DA 4YRTA 5F76A 5KQMA 2XUJA 4FYHA 5JSKA 2F7SA 4R7GA 3BRWA 2MR6A 13PKA 3QI2A 1VG1A 3HJHA 3K8QA 1G8JA 3F9IA 1OWMA 1X7DA 1X7XA 3H5RA 4KQIA 1AF7A 4POAA 3WBKA 3LW8A 1IHXA 2GVDC 1YL6A 1XKTA 2H2AA 4U63A 5CW1A 4BDSA 1EU1A 3S55A 1MEJA 1MN6A 2I1WA 5EZSA 3WGZA 1OBFO 5A5FA 3KUUA 4CCSA 3VHQA 2AS0A 2ZIVB 3IPXA 3N8GA 5GADl 2XT9A 1XXHB 1ENYA 3O8OB 1LLUA 2IP4A 2IPXA 3I76A 1XRNA 2JZOA 2J3KA 2EJTA 2YXLA 4IJ5A 4KP7A 3EXAA 4MWBA 4Q3OA 3JWHA 2ZBUA 3FCSB 4TTSA 5I5GA 4HQRA 4IMJB 4JC5A 4M60A 2ZM6B 4IRUB 3FNIA 4XJSA 4P98A 4B2PA 1QDLB 1TQ6A 2V9CA 5TMEA 4JT4A 1E1CA 2QY9A 2ZSBA 3FUCA 3SQOA 2Y99A 2H1LA 3IO5A 4KRGA 3IVGA 2BHLA 1GL3A 5FHRA 2V5VA 3T7RA 3WSVA 5JDIA 2FN9A 1XZAA 1K06A 4EHFA 3ZYZA 3GC6A 2AXPA 1ZRHA 2JHCA 1IU9A 1M74A 2HD4A 1ZXXA 1SHZA 1WQ4A 2O6LA 3SBOA 2WMNB 3P26A 1QHHA 2P79A 3EQ2A 1KU0A 4GYKA 2QHXA 5C34B 2J5XA 5DRTA 5CA0B 1KARA 4HYYA 2XADA 9GPBA 2TS1A 5THXA 4PLZA 1DKPA 1PQWA 1I10A 1UJ4A 2FAXA 4H35A 4RANA 5ALIA 2E3JA 4XVCA 4YR7A 3NMUF 1K8YB 4D80A 1YVPA 2YJ4A 3AJAA 3UPUA 3K05A 1EINA 3ONEA 4LJAA 4F4JA 1NNLA 2EARA 3DPSA 3ODGA 2JKYA 1R3UA 2PZGA 5K0LA 5F7XA 5JSZB 1KYTA 3BGVA 4Y67A 5EP4A 1V5IA 1J2UA 4LNUA 3LWBA 4RTQA 2NP6A 1O9BA 2BL4A 3N28A 1MA0A 1Z25A 4Z4HA 1E77A 3K0HA 3FPCA 2JS7A 1S3SA 1J99A 2H06A 1IHOA 3KPYA 4C6SA 1ILEA 5I4BA 3KV3O 3AUKA 3A37A 1V6AA 1M0TA 4YAIA 1GILA 4BFTA 2FUG6 3ZHOA 1XNRB 5L9AA 1V39A 2C9OA 4R2KA 5T5QA 3T3OA 4K9NA 2HRCA 1PWXA 1NYQA 2R2AA 4JFAA 4L08A 2J7KA 2JIPA 1FRZA 1QK5A 1T1RA 2AW3A 2FJPA 2UZ1A 3RVRA 1R8JA 2CLSA 4IEFB 2PBRA 5A9SB 2COEA 1DJNA 2QVLA 4DMFA 2IXFA 3CLSC 1KEWA 3WQRA 3QUAA 4B1FA 3PNBA 1JWLA 4MVJF 2F62A 1RC0A 2ACWA 4QEZA 4D3XA 8ATCA 1FNDA 1Q7CA 2N3ZA 4HSEA 3HKBA 4PFQA 4RMHA 3TBKA 5AW9A 4D8YA 4DWOA 2F9FA 4BP3A 3DEZA 2JB9A 4EGAA 2AE1A 3NDJA 1B0AA 1KC1A 3OTHA 1VLJA 2BGJA 2NXCA 4KMMA 4H7KA 5AJUA 4LDJA 3RAEC 2P75A 3EXHC 2GYUA 1IYZA 1MEOA 3P32A 3STHA 4KL8S 1W36B 4XUCA 2EBUA 3NAQA 3QVUA 4MO9A 1KH3A 2IYSA 1IBMB 1YB7A 2PWZA 1WCWA 2O4CA 3A26A 2OGSA 3O4FA 3ZTTA 2GYYA 1P1BA 4NCNA 3TO5A 4JROA 3F3KA 4Z54A 1WW3A 4Z3OA 3V4SA 3GHYA 3R8FA 5M2QA 1PZFA 2G9RA 2W2LA 4K2AA 2FH5B 5HF8A 4FM9A 3M89A 1G8MA 3FYHA 2X4DA 2Q9BA 4PW0A 2YICA 3S1AB 4IX1A 5A4DA 1QG4A 4NR0A 2ZEJA 1TVEA 2CVHA 4YCBA 1YQXA 2I91A 5G0UA 3LO5A 3F6SA 4F3KA 1ENPA 4P7JA 4RQUA 4F6RA 4JVOA 2BMEA 4EABA 1KAGA 2UXDB 5HQTA 1Y81A 5LBUA 4CTJA 3ISTA 3U5TA 1Z6QA 3A58B 3E6AA 3N05A 3T34A 4DJJA 5HK9A 4GSLA 2C0CA 3X1ZA 4DMGA 3ASZA 2W0SA 4Q02A 3CLRD 3FTCA 2ZIXB 1B74A 1JAXA 3MTBA 2R62A 1HLGA 1BXGB 3I52A 4DKXA 1K68A 1KI4A 1D2HA 2PL9A 5PGMA 2VDRB 3LM8A 1EG2A 3L8CA 4ZAYA 3O7MA 5F4BA 1IWPB 3EQ6A 1CY6A 3H5OA 3VKHA 1CR6A 2RGCA 2QLBA 1ZVQA 2PA3A 4J16C 2O3SA 1GVHA 2QRVA 4KQKA 4ZDWA 2UVPB 3R3JA 3SLKA 3WA6A 3RUHA 4RTMA 1ESNA 2BEKA 2I6GA 1C41A 1TTTA 5E4JA 2HIHA 2IYFA 3QA3E 3CC8A 3HWRA 4WKBA 5GJBA 4G2TA 2FQ1A 1ONNA 1RPAA 1OLUB 2VPZA 3CH7A 1EUDB 2RI6A 3K15A 3KXIA 5E7JA 1BIFA 3CW2A 4YWHA 3E9EA 1I36A 3IVAA 4G63A 1CERA 5CB0A 3L07A 2BFDB 1PR4A 2OCGA 3BG5A 4CUZA 3TYXA 5I7VA 2AN5A 1ZKDA 1Y5NA 2YZGA 2FEMA 1HG1A 2K7ZA 4NH4A 4O0MA 2AW5A 1KVQA 3RF6A 3TRJA 3VSBA 2UAGA 4LCBA 4BX2A 3COZA 1CNMA 3FSEA 4I1OA 2PFSA 1KGSA 1SKAA 4OHZA 2J0UB 2TRSB 2ZKLA 3O8QA 2B4TO 3UH1A 4DMKA 1SCIA 2GB4A 1G7SA 1ID1A 4B7AA 1DBPA 1WPQA 1OKKA 2ZRJA 2JFBA 4JJFA 1BQEA 1PL6A 3OCUA 1LJUA 2FSPA 3R5HA 2IE0A 1E2GA 3DGEC 4LZWA 3W0LB 4EHNA 4UXJA 1E2HA 4HAOA 1UPUA 3C5HA 4KZPA 1Q74A 4QECA 1XC7A 4B73A 2OORA 1C0PA 4D9CA 2YWXA 2ZREA 3C3EA 3QTLA 4AJLA 2AKAB 5C1PA 5AM4A 1R12A 2BI8A 4ZRDA 3AM4A 3WYGA 3DYVA 3IV9A 3F6CA 3O5AA 4EH1A 4F3TA 5BWNA 1HORA 4IIGA 2HN9A 3KEQA 4BIMA 3QP9A 3GWGA 4FW9A 2XI4A 4RV4A 1GSOA 1OFTA 2XXJA 3ETNA 3F78A 1O95D 1P19A 4LW8A 2KS6A 3DMNA 3DUFA 2RAFA 2QMUA 3OQIA 1QGDA 2OV3A 3FX2A 5EE3A 3ASUA 3RW9A 1K6IA 5J4HA 5KYXA 4ZAFA 4CT5A 4KN6A 3T6KA 1ZD2P 3O8BA 4PV7A 4AG5A 1Y7TA 3EMKA 5CDTA 2IUUA 2O8BA 5AWFC 1JHMA 1BEUB 2NP7A 1Q11A 4NJOA 1RYNA 3WE7A 2B2CA 3ORSA 4QRIA 5JCJD 3VJRA 1H9CA 1FRQA 4D4HA 5E6UA 2IYTA 3A2NA 4HAXA 5FEUA 1ARZA 5ALYA 4DIOA 1LBHA 1T0UA 4XQ9A 1RXWA 2F9LA 6AT1A 3GJSA 4AJIA 5ALSA 4RTPA 2FPMA 3DUWA 3L79A 4ENVA 1K4YA 2P5YA 1CHDA 3WWPA 4ZTZB 3FDIA 2VRBA 1XZIA 2V6BA 3FYCA 4DY4A 1AKQA 1LPBB 1U7XA 2A67A 2Y4NA 3C3WA 1MJGM 4XD7D 3NJ8A 2FZEA 4KU4A 2SECE 3W5HA 3BZUA 4H0NA 3W7BA 3ZDZB 4AUKA 1JLKA 2AYYA 1OX4B 3ID6C 4YVFA 3WP0A 4C7VA 1A4XA 4I1VA 4NCAA 3R7NA 2XUIA 4H7DA 1PJ4A 2F90A 2XR1A 2H59A 3DXYA 4J4HA 2A94A 2PYDA 4XUGB 1UJCA 1GFWA 3GPCA 4YRQA 1I4TD 3K1ZA 2JD2A 3RWMB 5LIRA 1G0OA 2Q21A 1PWEA 3QVSA 4UMDA 1BNCA 3OKFA 4C5BA 2DUJA 3RVLA 3VFDA 2AR9A 3AUFA 3VKUA 3GDFA 3GEIA 1E2DA 1A5ZA 3LBYA 2ZU0C 3AHIA 3F67A 3PKZA 5EJGA 1IXYA 1HURA 1PLJA 3GAMA 3QU4A 1E6KA 4V38A 1AKUA 2I4LA 4G85A 2V6GA 5J4LA 4UASA 3ZWPA 4OUDB 5JMOA 5CDFE 4ID9A 4KACA 3O31A 4Z7JA 2CK3A 2CSUA 2ZTUA 4DPLA 2JIRA 1G66A 3A0UA 1GCOA 1YVRA 4W8OA 3OOWA 4JI4B 2XKJE 3BBPA 2HM7A 1JG1A 4GSKA 3LRTA 4O29A 4BNXA 1SBQA 4D44A 2Y3IA 1LWOA 4D9BA 2ZYAA 2DTDA 1Y6RA 4OH1A 1N2CE 4DV5B 5C8XA 3JX9A 4QUJA 4L8GA 1R7RA 1PTJA 1TCAA 3GR6A 4CKEA 4Q9NA 5DWDA 4IP0A 1Y4DE 5KEIA 4JJZA 5BUQA 1GFSA 4RHTA 1Q77A 4FE7A 5EXXA 3MOGA 5CFOA 3ACDA 5TPZD 2OCIA 1DTWA 2G08A 2GBIA 4LTDA 4BFZA 2BR5A 2QAIA 1Q7TA 3AF2A 4J0IA 3TSAA 2QLNA 2VP9A 3BDVA 3QELA 4AZ3A 1BGVA 2OQ2A 2OVBA 5JU6A 2VP2A 1M2VA 1P4GA 5LR6A 3HKEA 2ZM5A 3AOEA 3NETA 1WDLA 1W0KD 4HDOB 3K4QA 3OQMA 1TTQB 2VHZA 3NHFA 1IXRC 2C0QA 4BE4A 2IU4A 4HDSA 4ALJA 2UYOA 2Q2NA 3TQQA 4GM1A 4CFSA 1LS6A 2ODPA 4ENRA 4IIVA 1Z4KA 1AUQA 1N2GA 1P2TA 2EDCA 1XEWY 1O94A 1UXKA 1ZOIA 3IQZA 1VDMA 1ND6A 2Q5HA 4RKYA 2A1IA 4RV9A 2WYVA 4D8UA 1G42A 1NNUA 3NBZC 4S35A 4U5QA 5K3EA 4N0QA 1VXOA 4G2NA 4LKOA 3TMYA 1C8LA 2ZBEA 2Z2XA 4CR8A 1TYZA 4QJBA 2YC4C 2FPPA 3KFVA 1E66A 1SCUB 4P4TA 4DPMA 3KQNA 4F2PA 1H69A 1T3HA 1RJGA 3BAFA 2DHRA 5LL6P 2QTLA 2CCJA 2AFIE 2FU5C 2P7HA 1OYVA 3HVUA 3JQ8B 3OHPA 4S3MA 5JAZA 3AI7A 3VI4B 3PNLA 4AO8A 2PEZA 4QHSA 3WP1B 5IF3A 1QJCA 1X86B 1G9SA 1WUYA 3P45A 1TE2A 3IVCA 4GMDA 1GARA 1LF5A 2P4HX 3TQFA 2XD9A 2E87A 1G21B 2GETA 3UKOA 4EDFA 4DMRA 3EVZA 1XHFA 2AX4A 4FN4A 2HCRA 2HUNA 4IFBA 4ZQBA 1Q7GA 3MHTA 1ICEA 3JD3A 1CD5A 2BFMA 4YMUA 1G5RA 4J1QA 4DYVA 3BMNB 1QB8A 1GP2A 3NO4A 2PIAA 3WQHA 1R0LA 3DLBA 4UM9D 2I6UA 3HSKA 5JS2A 3FHOA 2FLWA 2NYAA 5C7IO 4FIDA 3I53A 3DHEA 1X13A 4YY3B 1PL0A 2PE5A 3LL4A 4JAVC 1BE0A 1W34A 4N7BA 3EF0A 3JVVA 4ERNA 1KVUA 4UBIA 4FMDF 4M37A 1XZDA 4OX9Y 5ERYA 5K3OA 5FX2A 2XHEA 4JGIA 5BP7A 1CR1A 4LI0A 1O8CA 1IZZA 1QYVA 2GA9A 3JASA 4HVCA 4MVJH 3CVUA 1PVDA 3P1JA 4OLFA 2H3HA 2WF5A 1VLMA 3NTLA 4JLKA 1E64A 4NV0A 3UUWA 3E7WA 4J49A 1Y82A 4S04A 2ZG6A 2XIQA 2QT0A 3OCZA 1Q91A 1A1SA 3S2SA 2FSIA 3DXXA 3U3XA 3UCXA 2I3DA 1H5UA 2AVNA 3QVJA 1C14A 1V3UA 5KTKA 3T7KA 2PWBA 3CRW1 1B23P 4JWKA 3I0ZA 3EFBA 4DDTA 2PX3A 1Z2CA 1FK8A 1FDUA 3MWJA 4NG5A 1Q0LA 4R8LA 5IH7A 5JD4A 2ZJ8A 1YCHA 2NSHA 1T5HX 3GFQA 2VWGA 5CX1A 4YDSA 4D0GA 1FPQA 1XHEA 5FL7D 4ND7A 1U02A 1Y5RA 2I2DA 1OH7A 4S1NA 3U7QB 1H85A 3ZVKA 2WWWA 1OH6A 1W1IA 4JI2B 4KYUA 4NBWA 1AGPA 1SC3A 1JHRA 1W29A 2HNAA 3IE2A 5K4HA 5LMCA 2WD8A 4LBWA 2YBEA 5CDFA 2R11A 1W2WB 2Z9DA 2A0YA 4YCDA 3TE6A 1IXSB 3OY2A 4IOKA 2AG8A 5CBKA 4TKUA 3IBCA 3LBFA 2BLLA 3JQ9A 3QFHA 1SC1A 4CI0B 3VH4A 3NT5A 2A58A 1X94A 1QIGA 2EV9A 1W2HA 1W4LA 4WX2B 1CHNA 4V0OA 4RTJA 2AEJA 2VXOA 3COYA 4HLNA 1KVRA 4PLWA 1OXTA 1OYYA 2OO5A 2IYZA 3URKA 4UTXA 5AW5A 2DHQA 3EW7A 3P5SA 1S2OA 4OQNA 2R6GA 1G8PA 4GPAA 4QT4A 1U80A 5FBHA 4Q3BA 2C88A 1UBRS 3EZYA 2X23A 1SEPA 2XEXA 5FULA 3ZV6A 1CC1S 4F7WA 2C9CA 2DOKA 2Y76A 3ZCRA 4UMFA 2FMXA 3OTIA 4WZAE 2Q5IA 3ZZNA 1U9IA 3PEUA 5EMHA 5EIEA 2LXNA 2RK3A 3D4PA 2QJOA 4OU5A 3CUTA 2OZPA 3AUYA 4U2FA 4N6NA 3MWEB 4OV6B 3DXZA 5AK5A 3M1IA 4ALIA 1RXSA 3ZW8A 4HDMB 4HWRA 3PFCA 2HW8A 4GRDA 4F72A 3UJHA 4G5GA 1JJBA 2EFGA 3EVNA 5THQA 1F60A 2MSNA 2FWJA 4GPD1 3VU9B 4EA6A 1M7BA 1Z13A 3F6PA 3ROFA 1XVIA 4UXIA 5JYDA 3DHWC 1J2RA 4JX8A 1DUVG 2Z09A 2DHCA 3OI7A 3P96A 1WOYA 5C4MA 5JXIA 4P22A 2D59A 3NFRA 3ZCPA 5BSKA 1WBBA 2ZIAA 4DLWA 4DQVA 4AS2A 2YS7A 4FBGA 1TLFA 5SY9A 2X22A 1KI9A 3AR9A 3QVGB 4IZHA 3BF8A 3FIJA 2NXEA 1XTRA 2VRNA 3DAFA 4Q01A 2GCOB 3G2MA 4MVJP 3WRYA 2OBBA 5KYWB 2QTAA 2AZXA 1SIUA 2XZLA 5FPHA 1QIDA 4GLJA 1R8SA 5K8VA 5G1NA 5A62A 2CGEA 1ZH6A 4LDPA 2P4EA 1PNVA 2C4TA 4RMNA 1HE2A 3TDNA 1T13A 2B8EA 4H17A 4J07A 1Q6ZA 5KB3A 4UNPA 2RC6A 4JODA 3SYMA 2VA9A 4WJZA 4NH0A 1M2KA 1JALA 2ETXA 4A4DA 2PSEA 5ITWA 3IE1A 2N75A 1FC0A 1OC4A 5TQ2A 3VDXA 3ZY4A 5GONA 1CX9B 1JNYA 3DZGA 4BP9A 2NPFA 2OKGA 3CKMA 3QWAA 2RCYA 4AMVA 2G8LA 2HC9A 2R4TA 4PSUA 3VR6H 4F85A 3PFHA 1PR9A 3AR7A 1FDRA 1GSIA 4XPIA 3SYKA 2NVUB 5KKAA 3AILA 3SOPA 3LLCA 4YP1A 1N9ZA 5JY1A 5MN5A 1IRIA 4BMOB 4FYPA 2ZDHA 3HBLA 4EW2A 2PD4A 4D26A 4AIRA 3MCVA 1A4RA 2JBWA 4ARVA 5MDHA 3FZYA 2Z4SA 1NF3A 3FPFA 1WZIA 1J49A 1OXUA 3BGDA 3HLYA 1N4DA 3K9LA 2YRWA 3CUVA 4O0LA 4TPKA 5BQOA 4IR7A 4S24A 1F2DA 4FEYA 2XGSA 1WMFA 3NUGA 4XUDA 5KVVA 2BGWA 2OG1A 4WJKB 4Z0TA 4ENPA 1TQ8A 1YDEA 1X80A 2C78A 2C7GA 2RGDA 3DW1X 4HFRA 4M36A 4YMWA