2EWMA

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
233
Chain Sequence
TQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-1-Phenylethanol dehydrogenase
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus
molecule tags Transferase
total genus 78
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ewmA00
2VTDA 3BTSA 3JQFA 1NFRA 5G4LA 3L4BA 4TRMA 3H9UA 2EERA 5BNFA 2VZ9A 4Z0HO 1ZSYA 4RDIA 2Q46A 2UYYA 1E7QA 1EFKA 2ZJ0A 4CL8A 3KYCB 4DQXA 4P38A 1C1XA 1M6HA 3E48A 3IQDB 3ZV3A 4EEXA 4L4SA 3RVDA 1WAMA 4P22A 1GUYA 5B1YA 3H6KA 3QVTA 5AQ1A 5ICMA 3FWNA 2RIRA 4E0BA 5BT9A 1KVUA 3Q11A 1WW8A 1SOVA 1HDGO 2NVWA 2RAFA 3OECA 1OMOA 5FEUA 3S2EA 3ZNOA 1HYGA 1CYDA 1RPNA 4FC7A 3HZZA 4KP7A 1LEHA 1WVGA 4ZQBA 4B8WA 3N7UA 4D7AA 5JAMA 4UVGA 4Y6PA 4E21A 3JD2A 1GR0A 5L4SA 3WTCA 2G1UA 4IJKA 1ISFA 1IOLA 3OETA 4DRYA 1PU2A 4L4RA 5CEFA 3FTNA 4IUYA 2D4AA 2DFVA 1FK8A 1SC6A 4LISA 4EJ6A 2GZ3A 1DIAA 3I9KA 4YCAA 2Q45A 3B1JA 1GYPA 4RLSA 2HSDA 1IZ0A 2FPIA 5FYDA 5JYDA 3DB2A 3EDMA 4E5YA 4WJZA 1U3UA 2A92A 2EG9A 3DFZA 3MEQA 3FPLA 4CMKA 1PZGA 2VUUA 5GMOA 1I3KA 4DLBA 1C3VA 2TMDA 5G2OA 4E12A 1GYRA 5F5NA 4NBWA 1YQXA 3ETDA 1Y9EA 4R1TA 2VQ3A 3OEYA 2PKRA 2PH3A 3ENKA 4CV3A 1E3WB 3JQ8A 4NDNE 4BO7A 3A4VA 4A03A 2YY7A 4P8RA 4PVDA 2Q4EA 1G1AA 3PFFA 2NWQA 4KWIA 3ROQA 4E32A 5I9LA 4WCFA 1KS9A 1FMCA 4I9NA 2Q1UA 2FP4A 2Y67A 4WLNA 3WICA 5JDIC 2AA3A 1V3VA 1YBMA 2NTVA 1C0PA 4YJHB 1LRJA 3VOSA 3BMCA 1UXHA 3N58A 4AJ2A 5AXDA 3GNTA 4XEHA 1B16A 1PR9A 1TT7A 2AG8A 2PA3A 2VYNA 1QXSA 3OQ1A 5BQFA 2I67A 3ICCA 3VVBA 2EV9A 4PG6A 1E3LA 3DHEA 3PQDA 2NVUB 1EMDA 2PGLA 2Z1MA 2E48A 3M6IA 4XYBA 2RBEA 4K6FA 1VLLA 2PNFA 4RLHA 1E0DA 1UXIA 2DBVO 1U2DA 5ADHA 4HP8A 5HTOA 3FTPA 4TRNA 2OBNA 5H81A 4BNNA 5F1PA 2JL1A 3LC7O 5MGBA 1GAEO 4RDHA 4A0SA 4XX0A 4EW6A 3H2SA 4O63O 4CR7A 1A7AA 3NT2A 1BG6A 3DHYA 4L4XA 4PG8A 4PLWA 2C20A 3TWOA 1NM5A 4PLTA 1I3LA 4WEQA 1ZK1A 3V2GA 1IPEA 2O3TA 1Y8RA 2Y1FA 2ZTLA 1JDJA 1RM4A 1VL6A 2O3SA 2VHWA 1HYEA 5I9MA 2J6IA 4KQWA 2Q1SA 3IOYA 3RBXA 5KNLA 3IAHA 3ANLA 4GVXA 1GEGA 4GSKA 3JTMA 3O8QA 4YJFA 2CF6A 1Y8QB 1WP4A 2X8LA 4RVHA 3ZWXA 2X5JO 4R01A 2DKNA 1CDOA 5EMHA 3RC2A 4DMLA 4M87A 1Z45A 4C7KA 1YL6A 2GN6A 1QV7A 3DBRB 3MTJA 4IINA 4KUEA 2HMSA 4MJLA 1F17A 2ZTVA 2ZKLA 4ZVVA 4K9DA 2Q49A 1PR3A 2HK7A 5F3RA 4N5LA 3GVCA 5LC1A 3DWFA 1I2BA 4NJMB 4ZGWA 1EBFA 3QY9A 2ZYDA 4QSMA 4MVJA 4PG5A 4GWKA 1HL3A 2E37A 1K89A 2X0NA 1YGYA 4IDCA 1BTOA 3NAQA 1AHIA 5JAZA 4XQ9A 1DO8A 3OEWA 5JO0A 3VH3A 1RM5A 3GDOA 2H9IA 3E9QA 5JBIA 3I9MA 5TQVA 3DONA 1GQYA 2NQTA 4JN6B 1ZUD1 2C5EA 2JFHA 4IZIA 4Q3BA 3IC5A 2CF5A 1I2ZA 2WE7A 3GR6A 1KEWA 2HDHA 2O50A 4CMBA 2Y1OA 3TQHA 4MKRA 2JFGA 3IP3A 3IIEA 2GLXA 3RUDA 1E92A 3WGTA 2IXBA 4Q3AA 4E13A 1I0ZA 3HB5X 4YJHA 1EBUA 3K6JA 1BDBA 1MUUA 1Q1NA 5L9AA 1W4ZA 9LDBA 1PS0A 3TOZA 3QLJA 5ITVA 5AVOA 3M1LA 1ZH8A 1LU9A 1UUFA 2GDZA 1DJQA 2EF1A 3G1TA 4YJDA 3NJ8A 1UAGA 1KEUA 1YDWA 4MVJM 4DQVA 3MTGA 3AM5A 3GRPA 4XKJA 5A05A 4Y67A 1TT5A 2NTJA 4QECA 4R5HA 3VPFA 1HT0A 3S2FA 1IE3A 3OIDA 5H83A 3I52A 4YYZA 3FBGA 3KYDB 1KVSA 3NYWA 4NBTA 3ZWPA 4N54A 1NFQA 3VZRA 3ZW8A 3C1TA 2BLLA 3AK4A 3OSUA 4A5OA 4D3FA 2Y0CA 4J9UE 2WD7A 4BO9A 4S3MA 1A72A 4GBJA 3VC7A 4EI2A 4P4LA 5DF1A 1XKQA 3ASUA 3ROMA 1ML3A 1U1IA 3OH8A 4ND2A 1H9BA 1RKXA 1I2CA 1IY8A 4OKIA 1IL0A 1ZJZA 3AM4A 3SLKA 3KSZO 3KOUA 3DZHA 1LRLA 1JTVA 1AUPA 1E6UA 2DM6A 3MJSA 2PKQO 2PY6A 3WNQA 2FPGA 2GZ2A 2V6FA 3WJAA 1DLIA 4OQZA 4UUMA 1XYGA 2NU8A 7ADHA 3PLNA 3WGIA 1LDYA 4PIVA 2G5CA 2J3HA 3DXFA 1NHGA 2TMGA 1ENZA 2W2LD 5F21A 2OXIA 5TLSA 3TZHA 1X14A 5EIOA 2AQ8A 4H7PA 3TL2A 4IQ0A 1X0XA 1HYHA 1J49A 1SNYA 3DC2A 3JQCA 2CVQA 3QVSA 2X9NA 4OXNA 4BO8A 3TDKA 3ZW9A 3PDUA 1NP3A 1NAIA 3DBRA 3UXYA 1HETA 3AOGA 1BHSA 2Z95A 3ZWYA 5ER9A 3KHUA 1DLJA 1EDOA 1I36A 1XU7A 2POQX 2OP1A 4R9SA 4WK6A 3LC2O 2ZCVA 4R41A 1JVBA 3LU1A 4O5OA 3DO5A 4PLCA 4OKNA 2WYWA 4LMRA 4Y8VA 3I9NA 4J49A 4W82A 3KXDA 1E7WA 3H4VA 4IZHA 2OFPA 3SC4A 1BMDA 2C07A 3GEGA 5BR7A 3L9WA 5HWSA 2EW2A 2VOEA 2P4HX 3JQ7B 2W2KA 4Z0TA 2GGSA 4XGNA 3ROKA 3ZWAA 4X54A 4BNUA 1W6UA 4RV9A 5DULA 1WLYA 1VI2A 4GWGA 1BXGB 2RCYA 3D0OA 4PVCA 1HLDA 1MB4A 3ICPA 1ZKMA 1PJ3A 4RPLA 1OZAA 4JQCA 3RUIA 2FOIA 1PQPA 1N7HA 4Q3CA 3PGJA 1K0UA 1XIVA 4IS2A 4PLPA 1OI7A 2B5VA 4IDEA 4YQZA 4BO6A 5L40A 3GY0A 2DC1A 5H82A 1NYTA 2ZQYA 4R16A 2Y0EA 5K0ZA 3ON5A 4M49A 2IYOA 3W4KA 5U4QA 2B36A 2I3AA 1D7OA 1ZJYA 2PLAA 3C7AA 3ZWWA 1EZ4A 1SB8A 2Y05A 3HFSA 2FZEA 4FFRA 3IJPA 4OGWA 4TZTA 2GR9A 4FIZA 4RJTA 3K92A 1K3TA 1O89A 3PXXA 1CWUA 3FNGA 2ZQZA 4GX0A 5L7YA 3U49A 2DPGA 3PWSA 2BELA 3EVNA 3FI9A 4GAEA 4Q3NA 1L1FA 1VJTA 1YXMA 1GUZA 4Z9FA 1NXQA 2QHXA 2UV8A 3E9NA 3DTYA 5TF4A 1DJNA 3NDJA 1BXKA 2VHYA 4EDFA 4J2HA 4CM9D 3ZNPA 1LDEA 2HAEA 2CVOA 4RZIA 4AJPA 3V2UA 5CHEA 4CM1A 1YJQA 3W4JA 1IHXA 3C7DB 4NG5A 1PGJA 4Y6RA 1P1HA 4Z6KA 4CM8B 1H2HA 4NFHA 2A35A 2X5OA 2VUTA 4U0KA 4ITUA 4HUJA 4I5GA 4XQCA 3AM3A 1W0CA 3ZU2A 4BO2A 5COQA 1QKIA 1QYDA 1UZLA 4F3YA 1ISJA 1G0OA 2VWPA 4K6CA 1JVSA 3OBBA 3IMFA 2G76A 3ZHZA 5JFOA 2D5CA 2PR2A 4CM5A 4BKPA 2WM3A 4FOOA 3OA2A 4II3A 3DDNA 2E82A 2OO5A 1H93A 2NQ8A 3JD1A 5TX7A 1WDLA 1XEAA 2XOXA 3MWDB 4KWHA 3BMQB 3U4DA 4NBUA 3WB9A 1L7DA 3DAPA 4WCDA 1MP0A 1UDCA 2O4UX 4KDFA 3HDHA 1BRMA 4NPCA 4U0JA 2HJSA 5AXCA 4RL6A 3T4EA 2DT5A 3PHJA 5JMWA 2D59A 1JKFA 4WCFC 5BSEA 1X1TA 2NVBA 3OIGA 7MDHA 1XLTA 3GQVA 1UJMA 1PSDA 3H9JA 4XR4A 1Z73A 4CV2A 4HFRA 3JQGB 1U2GA 1EVJA 1DDOA 3OQ6A 4DGSA 3WGZA 3WYBA 5BSFA 4CLHA 4AJ4A 4MIYA 4JBGA 2B69A 1EFLA 1NPTO 2C5AA 3ITDA 3EVTA 3O4RA 1HZZA 3CEAA 3GDFA 3IKTA 3GEDA 4HNHA 3HN2A 3UCXA 3H5NA 1T2DA 3WNVA 4HKTA 3ZNQA 5IXSA 5JCXA 4R4JA 5A9RA 4NBVA 4E6PA 2VHZA 1PS8A 3K2EA 2J3IA 3EK2A 1TB4A 1C14A 3CTMA 1H6BA 2D5AA 1FDVA 1ZK4A 3M1AA 3S8MA 3ZWOA 5LDGA 3G17A 3C24A 5AXAA 4CODB 1KY4A 4HFJA 3VZPA 1H6DA 3JQ6A 4CJXA 4A73A 1X15A 4FGSA 3HN7A 1DRVA 2OZPA 3JQDA 3UOGA 4DBVO 2P5UA 1KERA 3C1OA 2Y93A 1Y5MA 3UW3A 1NWCA 1HDXA 3OMLA 1E6WA 2ZYAA 3DBVO 4BNFA 4IQGA 5G0WA 1O0SA 3EAGA 3G0OA 4L74A 3DHNA 1B8UA 3D64A 2GCGA 2JCVA 3DMYA 1VM6A 3QWAA 5I7FA 3VPSA 1T26A 4DA9A 1YRLA 4CMHA 2HK9A 3TSCA 1M75A 2EJVA 4WEOA 1C1DB 4DYDA 3C85A 5T8KA 3BHJA 4CPDA 3ZCXA 5IDXA 2EEZA 4BO0A 2VRBA 2XPCA 4K26A 3RC9A 3I1JA 1D1TA 1A9YA 1X7DA 2D3TA 3ZN2A 3RJ5A 1P44A 3S2IA 1Y1PA 3KBOA 4FOSA 4BNHA 4D41A 4KMSA 2JCYA 3CPSA 4OJNA 1Z7BA 3O26A 3I23A 2WEKA 5FF9A 3I83A 2EXXA 3F3SA 3VTZA 1A5ZA 5TT0A 2DFDA 4E5MA 5EQDA 4WLUA 3WIDA 4BKRA 2IZ0A 3SBOA 1H6CA 3KEOA 3F1LA 4NU5A 1ZK0A 4BNKA 3I9OA 1AE1A 2AHRA 2FPPA 3U4IA 1DC4A 1I33A 1E3SA 4ZICA 2AQHA 3P5SA 5KVVA 2OORA 2VRCA 4RPGA 3DQPA 4U8GA 1QP8A 4F45A 3AI2A 3OF2A 1KEPA 4WOJA 4B7UA 5CG1A 4QFCA 5IN5A 4YAGA 2HRBA 3AOEA 4AL4A 1PWXA 2Q2VA 1V9LA 4YBZA 1B15A 4FFNA 4CUJA 3H8VA 1J0XO 1P1JA 2Q99A 3IJRA 1HDCA 1QRRA 5IDQA 3F5SA 1LC0A 2VYVA 3T7EA 2RHRA 3LK7A 3RWBA 1FXSA 4OQYA 5KJEA 1F06A 4CL3A 4NZ9A 3M2PA 1Z74A 1J4AA 1ZMOA 5KTKA 1T25A 1UAYA 5GZ3A 2PKQP 3R1IA 3LT2A 4XD2A 1UP7A 3ZV4A 4C7JA 1FJHA 3AUTA 1DHRA 1U7TA 4XGKA 5I8ZA 2XXBA 5T64A 5THKA 3VZQA 4XDYA 4CLRA 4E3ZA 1LJ8A 2VWGA 3RBVA 1XQ6A 4FFOA 4EITA 2NTNA 4J43A 4J0EA 2DBQA 4GQAA 1T2EA 1DB3A 1A71A 4J1NA 5HRUA 4FSHA 1N2SA 4XCVA 2EIHA 4IMRA 4Y98A 2Q50A 3ENNA 4UUNA 4D45A 4ND3A 2J3KA 2X7HA 1VE9A 3NDIA 2DU8A 5IDYA 2EP5A 3ZWNA 1TLTA 2C2YA 1B0AA 1JKJA 1V3UA 2BFPA 2V6BA 2ZTMA 3WG9A 3JQEA 4WOKA 4QTZA 4BMNA 2EHDA 3UAGA 1DFHA 4Q39A 3WIEA 1GEEA 4J1QA 2ZK7A 2AEFA 4EBFA 3ANMA 1M76A 3PHIA 2DAPA 3ZU4A 4NU6A 4CLOB 2PD3A 3DBHA 5JSFA 2IXAA 2X9GA 4B4WA 3LLSA 3RD5A 1CJCA 1C0LA 3HDJA 3MZ0A 5KIAA 3JD0A 3D4NA 3V1YA 4BGUA 4EYEA 2P68A 3I9LA 1XQ1A 1LI4A 1T4DA 1AXGA 3LQFA 1K5HA 2C54A 4UVIA 2C2XA 4J3FA 3RUHA 3CUKA 2B5WA 4WLOA 5K6AA 1G6KA 4CMIA 4R69A 4OM8A 1XHLA 1RYDA 4NJOA 4PLZA 4F6LA 4CQLB 5FI5A 3UCFA 1ZMTA 1I3NA 4JROA 5JS6A 3VPGA 5IAAA 1HLPA 2NSDA 4RCVA 3MJTA 4XQGA 1EUDA 1GDHA 1GY8A 3M2TA 2PZLA 4KDEA 4FC6A 3RFXA 4TVOA 1QORA 1V35A 4WUVA 3PYXA 2I6TA 4F6CA 2Y66A 3K73O 1H6AA 4AICA 4HFNA 4Z0PA 1MX3A 3EZLA 3WMXA 1L7EA 1I30A 4ZA2A 2JCXA 3JQAA 2D2IA 3W8DA 4JK3A 3KRTA 1LTHR 4G81A 4TSKA 4O6VA 3GN2A 1PIWA 1QG6A 2R6JA 4BUCA 3RQSA 2IEBA 4AVYA 1U8XX 4J1TA 1HZJA 1RYEA 3DZKA 5JC1A 1DXYA 3GF4A 4FQ8A 2FY8A 3TZ6A 4BIIA 1BDMA 4OMUA 3ZU5A 4ALKA 3LF1A 3LVFO 3ANNA 2W4QA 4XJTA 1G0NA 1VKOA 3ASVA 4MIEA 1YONA 2ET6A 1MG5A 5K9ZA 3DZGA 5C3MA 3C8MA 1I24A 4IGFA 1YBVA 3NDRA 4GH5A 4Q9NA 3JYLA 4II2A 4N5MA 5L53A 1OBFO 3PHLA 1U5CA 1WXDA 5ICSA 3CSDA 4CQMD 2PH5A 4D0RA 3I4CA 1NVMB 3VKUA 4IDAA 1U5AA 4OOFA 4YVFA 2YFHA 4IBOA 2UUOA 4UVEA 4LRSB 4CM4B 3QQPA 2GO1A 3GN1A 3GOHA 1E7SA 4WECA 1QLJA 2XXJA 3H2ZA 1WDMA 2I65A 4MVJI 3DZFA 1LSOA 1TEHA 3LT4A 3LYLA 3MOIA 5JMPA 4FFPA 3RKRA 4KTTE 5F1OA 3RU9A 5A9SB 5JCJA 2BI7A 1DHTA 1K6XA 2ZJ1A 4RPJA 3U0BA 4D43A 4B4UA 4WLVA 2C7VA 2ZCUA 5BSGA 4AJJA 5ES3A 1M6WA 3PGXA 2V7PA 3Q3CA 3JQBA 2EP7A 2J8ZA 4GKBA 4J7CA 4YT2A 1ONPA 3G49A 1U4OA 4DQUA 2GSDA 3EZYA 4XYGA 4BL5A 1ZK2A 3GFBA 3KYCA 5CPBA 2DTEA 4IJWA 3PJGA 1XCBA 5L4NA 2BMAA 3WBFA 1UXKA 2VHVA 5BSHA 1GZ3A 3BHIA 3PJDA 3GHHA 4HBGA 1HE3A 3VAZA 4B3HA 2VUSA 2BRUA 4ZQGA 2X5KO 3WR5A 4CQMB 4E5NA 5CEJA 4NI5A 1A4UA 3QP9A 1PQUA 1U3TA 3FCOA 2GZ1A 3SC6A 2X0IA 9LDTA 1LLDA 1DFIA 4YAIA 5CDYA 4Y6SA 1Y6JA 1KBZA 5F1KA 2QYSA 4A27A 1N7GA 4E5PA 1X7HA 2PZJA 2XAAA 5DNAA 2I66A 3FD8A 3QSGA 2VT3A 1HE5A 3PVZA 1N92A 3BMOB 3P7MA 3C1AA 3KSDO 3MJCA 4CUZA 5KJ1A 3C3XA 5AOVA 3PZBA 3H65A 3INTA 1CEQA 2G17A 2D1YA 2Q2WA 3D4PA 2P9CA 3TFOA 3GNQA 4TROA 1F8FA 2HMTA 2WMDA 1DRUA 4D46A 1DIGA 5TNXA 2C59A 3H9QA 1E1MA 3SJUA 2J5KA 4CR6A 4IXWA 1KYQA 3LF2A 2OOSA 3WSVA 2B4RO 2X86A 3K8ZA 5KJFA 3NX4A 5EN4A 4L76A 5A1TA 4LSWA 1EDZA 1Z75A 2BD0A 2PD6A 4PRKA 2X9VA 3JQ9A 4QFDA 4J9VA 4DLAA 4E2WA 4YT5A 4Z3KA 3TZCA 2PFGA 5DBGA 1XDWA 2PWZA 4ID9A 4Z3DA 2I5PO 2JHFA 2ZB3A 1GV1A 5DOVA 2R00A 1SZJG 1E3WA 2NACA 1CQJA 2EWMA 3NGLA 2X22A 1EQUA 2C7GA 1UZMA 1ULUA 5CDGA 1P77A 1W73A 1MFZA 2QX7A 1T2CA 3AY3A 3MWEB 3W6ZA 1NVGA 1LA2A 1CETA 1YVEI 2BH9A 4JGBA 4UEJA 4JX8A 3ZH2A 4DTIA 3KLPX 3QA9A 1M67A 3D5TA 4LCJA 4R1NA 5T8KC 1P74A 4TKLA 1SEPA 1CQIA 3CMMA 4H16A 4TZKA 1DIRA 5KVSA 3PRJA 3PZRA 2IE0A 4EUHA 3V1UA 2RHCA 4IIVA 3ROPA 3E1KA 4W9NC 2O3RA 3A06A 4P4NA 3EUWA 5B4TA 2NVUA 3DOJA 3FNHA 4JNKA 3LC1O 2RH8A 1DIHA 1P3DA 3QRWA 1LUAA 2Y68A 3L4SO 5DDIP 3IS3A 2EKQA 1PGNA 1F12A 4BB5A 2Y1EA 3F47A 3B70A 4XJSA 1GU7A 1QR6A 1K6JA 4I08A 4M8SA 1O94A 4BNXA 1GUFA 2O3QA 3QVOA 3S2GA 4I5DA 3PPIA 1IZ9A 3ZGYA 3DMTA 3SEFA 4ZQEA 4CMEA 3D1LA 1GL3A 4DVJA 1X1EA 3Q9UA 3HFGA 5IJZA 5JXWA 5FFFA 5JY1A 2P2SA 2QRLA 4MVJG 1NNUA 2VCYA 1B3RA 5CEEA 5A5FA 3TL3A 1PJCA 1ZVMA 5GZ6A 3GLQA 4CLXA 3HUDA 4YJGB 3HG7A 4XWYA 4QXMA 5A3VA 5HA5A 2OP0A 1SBYA 3E9MA 4RQTA 3DOOA 5FWNA 4ZD6A 1Y8QA 3BMNB 4Q3EA 3GHYA 3LSYA 1ZIDA 2DBRA 3OFSA 4MVJP 3H7AA 4CUKA 1SEVA 5F5LA 1MGOA 1P0CA 1WDKA 1B7GO 4KOAA 4CLEA 3KSUA 4MP6A 1ZFNA 4GGPA 1M2WA 4MVJF 3VH1A 1DPGA 4LSMA 3GDGA 3ADPA 3WWZA 5JDCC 4RF4A 3STHA 5DT9A 3RI3A 2ILTA 1B8PA 1N1EA 3H5AA 4XB2A 3D4OA 4GKVA 4NJMA 4FN4A 5EL0A 1LDNA 1Q2XA 3DBLB 1MXFA 4PG7A 2ZB7A 4LRTB 2JFFA 2CD9A 1ZSNA 4N7RA 3X2FA 1U3WA 1BW9B 1FDTA 2AE1A 3NTQA 3OJ0A 4I9HA 3GPDG 3ZHYA 3FNFA 4B4VA 5T67A 3OJOA 3TF5A 1JA9A 3RIHA 2YHUA 1V3TA 3V2HA 5JW6A 2QQ5A 2QW8A 3NUGA 3FF4A 3WTBA 3DFUA 4M86A 5JC8A 5JYEA 4GI2A 2WJPA 2W98A 1NQOA 3GVXA 3AUUA 3LLVA 4B3IA 2JD0A 3JQFC 3WGQA 1SOWA 2AQKA 4BV8A 5I7VA 3L4BC 3ZNNA 4BNVA 4FR5A 4IJUA 2DTXA 2E49A 3AU9A 4G2NA 3PQEA 4R3WA 4E30A 1PJTA 3UGKA 1GPJA 1HXHA 4MVJE 3INRA 1YOVB 1YWGO 3NRCA 2IEDA 4XIJA 2QYTA 4OOEA 2DVMA 2F00A 2JKVA 3K96A 5AXBA 4CM6A 3WDSA 3CH6A 1OC4A 2V6MA 3HADA 2CY0A 3L6EA 4J0FA 4LN1A 4J7UA 5THQA 5K6AC 3HDQA 4JCOA 4QUKA 1E5QA 2I99A 4RORA 1ENYA 1HDYA 2WSBA 2DUWA 2QZ9A 1NR7A 3A9WA 3BZUA 4ND5A 3BIOA 2HO5A 2P5YA 4OAQA 3WYEA 3KYDA 3T7CA 4QO8A 4YWJA 2WE8A 3GPIA 3QIVA 3MOGA 1MLDA 3E8XA 1YB4A 3RC1A 3E5RA 3RUEA 4R51A 4W4TA 2Y0DA 1DOHA 4FFMA 1A7KA 2BFMA 3V1TC 3ZZNA 4ESOA 5L45A 4U6QA 2VRCD 4QQRA 1IULA 3FSRA 5G0TA 1NVTA 5J23A 5G0UA 4PCVA 1GQQA 1GV0A 3BXXA 4L73A 2FR8A 3PJFA 1LDMA 1JWAB 5TGDA 2HLPA 2JHGA 1ZXLA 3WFIA 4BO1A 3S55A 4JJGA 3O9ZA 4AG3A 5DBIA 5IG2A 3SJ7A 2X0JA 2B83A 3H9GA 4ROSA 3ZWMA 1Y9AA 5C37A 1QYWA 2J5QA 4HWKA 4UAGA 4E31A 1S7CA 3EYWA 4DMMA 2JAPA 1MV8A 2X1HA 3IDSA 1ZXBA 4E33A 3FBTA 3FRJA 2AEMA 3QJ5A 4TVBA 1Y7TA 5JE8A 5A03A 2PZKA 3D3EA 5HS4A 2FZWA 4GX2A 4WNIA 1N1GA 1NFFA 3LT1A 1FF9A 4UREA 5TRTA 3UKOA 2Y99A 4OHUA 4E2XA 2VTEA 2YDXA 1DRWA 5CG2A 2YJZA 1YKFA 2FHSA 1VKNA 1J5PA 2GN9A 1U7HA 2A9FA 2AW5A 2BFOA 4J2OA 1ULSA 5G4KB 1BVUA 3JYNA 4BVAA 4XRGA 5ENVA 5EPOA 5I7SA 3JQ7A 2PD4A 1VC2A 2GPTA 4R5MA 4OIMA 5IZ4A 3AI1A 1BXGA 4GLOA 1LDBA 4YT8A 1LBEA 4HNGA 3JD4A 1BGVA 4TWRA 4BGIA 1WZIA 5A9TA 1PZHA 1R4NB 3TPCA 5JO9A 4DPMA 1Q7GA 3WBBA 3B20A 2FSVA 3QWHA 4TKMA 3OQBA 1HWYA 4W99A 1EE9A 5DCUA 5BNTA 3W4IA 3QWIA 4I5FA 3ZWCA 3FN4A 1P31A 1EQ2A 5ILOA 4MPDA 3X2EA 2CDCA 1RJWA 5A3JA 3JYOA 1N9GB 4BNMA 1DEHA 4J1SA 2H6EA 3HHPA 4NQZA 3VDQA 3AJRA 1GPDG 4CM7A 1EVZA 2B4TO 2DQ4A 2VT2A 1EVYA 3GUYA 3P2YA 4RPHA 3D3WB 3E82A 4URFA 4R54A 1LQUA 4FBGA 3RROA 1HDOA 3H3FA 5HS6A 1E3IA 3RUFA 4EGFA 3EHEA 4DC0A 4RF2A 4A7PA 1KEVA 1ENOA 4N5NA 4R9RA 3JYQA 4LK3A 4XQEA 1NQTA 2JJYA 3PDJA 3RUCA 4BO4A 4YAKA 4NHEA 1HTBA 4BNWA 4HFMA 1SPXA 4HX5A 3ETGA 2BGLA 2PTGA 4LGVA 4ILKA 3GEMA 2QRJA 3KB6A 3RCBA 1PGOA 4CM8A 3UF0A 2CZCA 1JAXA 2V65A 3JD3A 2CMDA 3RUAA 1DAOA 3QWFA 3Q2IA 5GY7A 2VNSA 1YQDA 4G65A 1XR3A 1VPDA 3JQAD 5KJ6A 1NPDA 4R68A 5DZSA 3UVEA 3I3OA 4QO7A 4UUPA 1XU9A 2ZYGA 1WZEA 3K31A 1Y81A 5B4UA 4G5HA 4NK4A 4XDZA 4RPKA 3G79A 4BMSA 1XELA 3OA0A 1HDZA 3O03A 2BI8A 1C1XB 2OBYA 3IUSA 4UUOA 1LRKA 3Q6IA 3JQ9C 4MINA 4XRRA 5JPIA 3ZI0A 1O95A 3K9QO 1E1NA 1PJQA 4WKGA 3RC7A 4FCCA 4BV9A 1JWBB 3BMQA 1GD1O 2O2SA 4NR0A 3ZU3A 2HK8A 1ADGA 4E2YA 3V8BA 2UDPA 4NNJA 1T4BA 1YJ8A 1OFGA 2GN4A 4ALJA 4DBZA 2ZB8A 4L75A 1P1FA 3JQGA 1KVQA 4B7XA 2NNLD 3I5MA 3RJ9A 5A4DA 1K6IA 4JJIA 4L0QA 1NTOA 1GQ2A 4O1MA 2C82A 4L8VA 1H0KA 4JXKA 2EJWA 1PGQA 1Q0QA 1UXGA 4M89A 3KZVA 4ZRMA 2VYND 5DOZA 2YV3A 3HE3A 2R2GA 2YUTA 2YQ5A 1ADCA 4ZQFA 4CMJA 2O3JA 4EEZA 1WNTA 4EJMA 4PG4A 3WWYA 4J6FA 5L7WA 1C0IA 1H9AA 5I8WA 1VSUA 3EC7A 4MDHA 3CZRA 4XIYA 3GGPA 1R16A 2D0IA 1BWSA 2HJRA 1R4MB 3BTOA 3U4HA 1NAHA 3Q0EA 4OXYA 4W7HA 1FDSA 4YB8A 1TI7A 3PQFA 1HE4A 4UULA 3L6DA 3RASA 4BOYA 1IYZA 3GT0A 1DBVO 4YTEA 4J91A 4CMEC 3QVXA 3EY4A 3LT0A 4DXHA 1GFSA 2E4AA 2Q2QA 4IGEA 2H1SA 5DP2A 3W6UA 5IF3A 1EUCA 5TIIA 3JQ8B 1T24A 1QSGA 2P4QA 3D7LA 3RBZA 1AHHA 3H9EO 4WCFB 3ZDFA 1AGNA 2P9GA 2QRKA 4KTVE 1VJ0A 1LC3A 3BMCB 4OSPA 4YRAA 3I6IA 1ISGA 1ZCJA 2O7QA 3WOHA 1E7RA 1LLQA 2WDZA 4FJ2A 1C1DA 3WFJA 1PJBA 3MJEA 1UDAA 2AXQA 4CLDA 2UVDA 4A26A 3P2OA 5EQFA 5IXYA 3WXBA 4CV1A 4DUPA 1P33A 5T57A 3IUPA 5JAQA 3SXPA 3WSWA 3QWBA 4BNGA 4D0SA 2ZTUA 4IDFA 3OJEA 1PTJA 3I9JA 4XGIA 3U9LA 3KYBA 5IN4A 2NU9A 3DOCA 3GZNB 1M66A 1OC2A 1MC4A 3UICA 3PI7A 4HADA 3CXRA 1Z6ZA 1V8BA 2ZIZA 4J16A 4MVJD 1PJLA 4DLLA 3QE3A 4GSLA 3F4BA 1Z7EA 4B8ZA 2E6UX 1HSOA 4AJKA 4IXTA 3SX2A 4I5EA 3OP4A 3NTOA 1OAAA 2VHXA 2DBZA 4H15A 1Y8RB 4C4OA 4LVUA 3GNSA 1HKUA 1MFPA 3QV1A 5A06A 2GF2A 4QT0A 1GADO 4UEOA 5TC4A 2JD1A 4A10A 1NASA 4XR9A 2CSUA 4EUFA 1V6AA 3H5RA 2HKIA 4PLYA 3WQSB 2H5LA 3P19A 1T1SA 1H94A 3O8QB 4YJFB 5CFZA 3HNPA 4HV4A 5CDTA 4BGEA 4R1SA 3G3EA 4IPTA 4YRDA 3ONDA 3PLRA 4U6SA 4MIOA 3GA0A 3JCZA 1A9ZA 4HY3A 4BMVA 1UDBA 5KOIA 3FNEA 1ZNQO 4XYMA 3ST7A 5KCZA 3KO8A 2YFQA 4MKXA 3HB4X 1Y5RA 5A04A 4YT4A 2FMUA 3U09A 3HSKA 1PJ4A 3HQ4O 1KC1A 3GVHA 1R4MA 3PK0A 4ZHSA 2LDBA 3WLEA 4PGFA 1ZO8A 2BFAA 2ZB4A 1PWZA 4CM3A 2VWQA 1UR5A 2XF8A 4IMPA 1EK5A 4BNJA 1LSUA 2PGJA 4FGWA 1N5DA 2WWRA 1E3EA 1Q0LA 4AJEA 1NQ5A 4O0LA 5CDSA 3AI3A 2D8AA 4NFSA 1QMGA 4RVSA 1TXGA 2Q1TA 4D3SA 2JD2A 1WMBA 3NT5A 5GZ1A 3CE6A 1KVRA 2Y1GA 1GCOA 3OICA 2CUKA 4XYLA 4EUEA 3VDRA 3TRIA 8LDHA 2HRZA 2IODA 1QLHA 4LMPA 4UVDA 1E3JA 5DCWA 3F46A 4DWVA 1ZSVA 3G1UA 4Z9YA 1IB6A 1EE2A 1PX0A 2X4GA 4E2ZA 3ULKA 4CLOA 4O59O 5KVQA 1DC3A 2B4QA 4JLWA 1JU9A 3Q9NA 2NLOA 2WYVA 3V5NA 1DFGA 1LDGA 3DTTA 5CP8A 2FR0A 5DBFA 3C7CB 3AY6A 1ADFA 5C7OO 2EW8A 2YW9A 4GPD1 1TT5B 4DC1A 2OHXA 5IZCA 1NR1A 2OGUA 4BQRA 3K5PA 5ITWA 4GL4A 3GZNA 5KJCA 1NQAO 2Y1CA 3GG2A 4WGGA 4CQLA 1YH3A 4B7CA 4WLFA 4PZEA 3DZIA 1JKIA 4K28A 1DIBA 2Z1NA 2RH4A 2WD7B 3WGOA 1BXZA 5A02A 1GCUA 1NPYA 3FPCA 2VNAA 4GX1A 4BQPA 3BYZA 1YB1A 2VOJA 3LZ6A 2FSSA 4YQYA 3BTUA 1P1RA 1CIVA 3DAFA 1ZEMA 1SB9A 4NMHA 1MA0A 1ISMA 3U62A 3DZBA 4FDAA 2CFCA 1P1KA 4DPLA 2PV7A 1IPFA 4MP3A 4J4BA 1ISHA 1P45A 2GUGA 1I5RA 1A4IA 4L9RA 4DL9A 4AJHA 4IDDA 4MP8A 1AXEA 1TVEA 5LCXA 2PGDA 1SO8A 4PN3A 3CIFA 3DEYX 1PJ2A 1RWBA 5IDWA 4N18A 1R0LA 1HE2A 3WQQA 1WPQA 3QW2A 1LXCA 1Z82A 4CV0A 2CNBA 3AY7A 4ZQHA 1T2FA 5U9CA 1ADBA 1YB5A 4HXYA 5T5QA 3I4FA 3ZV5A 1YBAA 1HSZA 3R6DA 1NWHA 3CMCO 4IDGA 1VSVA 1YL5A 3W1VA 4ALNA 4YR9A 2VZ0A 2JAHA 2GASA 3JSAA 1X7GA 3GG9A 4XB1A 3GAZA 4GGOA 3UUWA 2GYYA 4RVDA 2F1KA 2X23A 4WE3A 1ONOA 2C0CA 5ILGA 3MJ4A 4TQGA 2NU6A 3E18A 1BVRA 4OYRA 4P4GA 1D4FA 1JN0A 1U4SA 5B12A 4CM4A 4CR8A 3PJEA 1FDWA 2AQIA 2YDYA 3PEFA 1PL8A 1HDRA 1QYCA 3AU8A 2GERA 2W2KB 4WPGA 3CINA 3WGGA 2H63A 4QX6A 4CMGA 4J4HA 3T4XA 3Q1LA 1XA0A 3IL2A 4KQXA 3OHSX 3B6ZA 4PFJA 5A9SA 2A4KA 3F5QA 5BNIA 2Q1WA 2B37A 1RM3A 2HMWA 2YYYA 1JW9B 1S6YA 4NFYA 1PEDA 2O4CA 1YS4A 4S1VA 4GVLA 4RVFA 1DC6A 4MOWA 4DIOA 4XYEA 1YE3A 1PJSA 3E6AA 2HQ1A 2P91A 4JJFA 3GH3A 1YL7A 4UEKA 5T6BA 3GGOA 4KUHA 4WASA 5L7TA 1SMKA 2VN8A 5KVCA 3VH4A 4F46A 1ISIA 3AOEC 4LW8A 3PYMA 1ZEJA 2NU7A 3RU7A 4A2CA 1F14A 4CQMA 3N74A 1VL8A 1LX6A 3SLGA 3NGXA 1IHYA 3GFGA 1PZEA 3ETEA 3R3SA 3DAGA 4J90A 5JY6A 4IM7A 3TNLA 1Q7BA 2I9PA 2QZZA 4Z9XA 2O3UA 2NUAA 4WLEA 4BO5A 3F6YA 3UH1A 3PP8A 1PGPA 4YAJA 4BNTA 3F1KA 3B1KA 5KKAA 4D3DA 2AG5A 4PLVA 2AMFA 4YPOA 2Q4BA 1ZK3A 5TT1A 3WLFA 5EESA 4GLLA 3DZJA 3PTZA 2PZMA 2DUUA 1I32A 2GNAA 4AJIA 1I10A 4YDRA 4ND1A 4BB6A 1KC3A 3BMOA 4XZ3A 2AEJA 4R1UA 3TJRA 4OH1A 2EKPA 3Q2KA 4Y9DA 1BSVA 1GZ6A 5EERA 4UVHA 3F9IA 1YDEA 2O2YA 1I01A 1ENPA 3KM0A 3AW9A 3KVOA 5MDHA 4RVGA 5C7LO 4FJ0A 4IY1A 3PHGA 4DIBA 4NH4A 2I76A 1Q0HA 1RM0A 3ZWVA 5TS3A 3PWKA 2W90A 2I3GA 1EEHA 5TJHA 1TA4A 3O38A 1B14A 2EKLA 1FDUA 2IZ1A 4E4YA 4ALLA 2W8ZA 4BS9A 3NTRA 4IQ8A 1NX6A 3GAFA 2IYPA 4BO3A 3FWZA 3OJLA 5CDUA 1KETA 2DPHA 5COBA 1U9JA 2EGHA 1EVIA 4J7XA 1WWKA 4BKUA 1ZW1A 1UXJA 1E77A 4JBIA 5L95A 3DL2A 3F4LA 1CERA 2Q3EA 5KWEA 1U8FO 4RQUA 4E5KA 3ADOA 2LDXA 4QEDA 3TZKA 1V0JA 1PL6A 2EGGA 4LVCA 3K30A 1KY5A 5C5IA 4FFLA 3HDYA 1JAYA 2CVZA 1UZNA 2FN7A 3GRKA 1R0KA 1YO6A 5EJ2A 3NV9A 4H3VA 3A1NA 5C7IO 1LSSA 4FW8A 4BNIA 2FWMX 3H3JA 3EGOA 5AYVA 4EJ0A 4D44A 3PWZA 3ZHBA 3WJ7A 4CMCA 3NJ4A 3AFMA 4RZHA 1U28A 1B26A 4RF3A 1P9LA 3IP1A 1LNQA 3WQRA 4TRJA 5JLAA 4DPKA 1OOEA 1B8VA 4AJNA 4OSOA 2GRAA 3GUCA 3DR3A 3PIDA 3EMKA 3L9XA 2NV6A 1HF3A 4RGBA 3UHAA 2FR1A 3HJAA 5L4LA 2QG4A 1Q7CA 2GD1O 1O9BA 2O7SA 5ENDA 5COAA 4PZCA 4OXKA 3INGA 3AUAA 1A27A 4FD3A 4GMGA 4NIMA 3COSA 3FHLA 1I8TA 3L07A 3OIFA 4YJGA 5JDIA 1LQTA 5JNLA 1B3BA 2GN8A 3PYLA 4PLFA 2VYVD 1AN9A 1VL0A 4YXFA 3ONFA 1UP4A 2BHLA 1T1RA 2YHIB 3BMNA 3AFNA 4B4OA 2IDZA 1CRWG 1QYVA 3JV7A 5A5EA 2YV2A 3VH2A 2G82A 2G0TA 4IJVA 4FPXA 2AE2A 3A28A 3CKYA 2Y1DA 1MG0A 1P1IA 3U5TA 1I3MA 3KTDA 5CAEA 3RAJA 2HU2A 4WNCA 3RKUA 4IS3A 4ZJUA 2DLDA 1R6DA 1F8GA 3KV3O 4YEDA 5I9NA 4CMAA 4FB5A 4I9UA 1ARZA 4FJ1A 1E1LA 6ADHA 4BNLA 3DBLA 3K2BA 1DC5A 3UFXA 2DTDA 4MVJH 1BW9A 1VRWA 2QIOA 5TSDA 4YRBA 4ZN6A 4IDBA 2UUPA 3PIIA 1D8AA 3ZV6A 2FRDA 1UP6A 1ONNA 5IFLA 3GZ4A 3KEQA 1MC5A 1EUZA 5EINA 3WX0A 1U3VA 2Z5LA 2IZZA 2NADA 2PK3A 1KVTA 3BA1A 1CF2O 3UN1A 4YACA 3NT4A 3OM9A 5HBRA 3U3XA 3ITKA 4OO3A 4I1IA 3MCVA 1QYXA 3JQBC 5ER6A 2X58A 4Q3DA 1B2LA 2W2LA 1PQWA 2IRWA 1UH5A 4BKOA 1VJ1A 1D1SA 3E03A 4KUGA 2NM0A 1F0YA 3JYPA 1YOVA 1MXHA 3R0IA 1ZZEA 3TOXA 1SAYA 3VKVA 1KIFA 2B35A 2HMUA 2P9EA 4CLRB 5IZCC 1DAPA 2YQ4A 2X0RA 8ADHA 3L0DA 3RFVA 4ALIA 4BNYA 4DYVA 3PHHA 3GVIA 4M55A 3VPXA 2VWHA 3KUXA 1GYQA 3IKVA 3MJVA 4RO0A 5DN9A 3GC6A 1LLUA 2HMVA 3AWDA 3BTVA 3LDHA 4MKZA 5L3ZA 3ONEA 1LSJA 3I6QA 1T2AA 1KOLA 1H2BA 1XSEA 3WYCA 3VHRA 4K1LA 1PZFA 4YAEA 3WGHA 4ONEA 1ORRA 5L51A 4JP3A 1GZ4A 1E6EA 3L77A 1D3AA 1WMAA 4W6ZA 1HEUA 1O8CA 5FI3A 3WGYA 1XGKA 4D79A 3DBHB 4U5QA 3AUSA 2A94A 3E5MA 3ORFA 1JQBA 4JBHA 3EW7A 1H5QA 5G0SA 1X13A 2BKAA 4ZU3A 4B79A 4I8XA 1R12A 2YHIA 5HM8A 4U7WA 3U4CA 1K2WA 4ALMA 4W7IA 3WMWA 4EZBA 3UCEA 3ABIA 2V6GA 1N8KA 4W9NA 1PS9A 4XA8A 2J3JA 2O48X 3OJFA 4CMIB 1HRDA 1R15A 4DIFA 3TN7A 3KLMX 4AFNA 2R00C 2VZ8A 4INAA 1GTMA 1O6ZA 3BHMA 3HWRA 1J6UA 4MO2A 5TJ9A 3GMSA 3VTFA 3GGGA 3GK3A 1SCUA 3RFTA 2CDAA 4J4TA 2WYUA 1E5LA 2WTBA 1E1KA 2OL4A 4RF5A 4BHTA 4CM9A 2HUNA 5B4VA 4M1QA 5DP1A 3TZQA 3GMDA 1C0KA 5B37A 3ZWBA 2ZATA 1YQGA 1R0SA 3D5QA 1LLCA 2O23A 4NBRA 5G4KA 4BGVA 1ZBQA 3JQAB 4JP2A 3RSHA 4FS3A 5CPFA 4OL9A 1O5IA 4ND4A 5JCJD 1PL7A 1IUKA 3S1LA 5KKCA 1R4NA 3BAZA 3WS7A 4ZRNA 2SCUA 3NEPX 4AJLA 3FR8A 1DSSG 1W8DA 3PFWO 4TMFA 2YV1A 1X0VA 4M54A 3DMTC 2X6TA 3L6OO 4AJ1A 3VZSA 1JLLA 1XWFA 2BF7A 4GX5A 4NK5A 4JIGA 1P0FA 3W8FA 2OUIA 4DREA 4LCEA 1NHWA 5DCYA 1N9GA 4GMFA 2YZ7A 5JDCA 3A14A 4KZPA 4PLGA 3VPHA 4R3NA 1R66A 3GVPA 3FR7A 3CZMA 2C29D 4PZDA 3R3JA 1NBOA 3D3WA 5LDHA 3B1FA 5G0VA 4IIUA 2HCTA 2OMEA 3QVWA 4RVUA 3SVTA 5JAIA 3ZHXA 6LDHA 1R37A 3KETA 1QV6A 2CDBA 2J5RA 3TFQA 4D42A 2UAGA 2WD8A 4PLHA 4BKQA 2B0JA 3NKLA 5I7EA 4PRLA 1ID1A 4YA6A 4AJOA 4BNZA 3VVCA 2BGKA 4TRRA 4B3JA 2BGMA 1EK6A 1E7YA 5U1PA 1E7MA 3QHAA 3W8EA 1XG5A
chains in the Genus database with same CATH superfamily
4E4TA 1R00A 1DP4A 1K97A 2J1LA 2FFRA 3KWMA 4O4JA 4UBOA 4WDQA 3QF4A 4FGKA 5IARA 3L4BA 2J7PD 1ZOOA 2RIPA 1RRKA 3OUZA 2ZIFA 1IZYA 5JMTA 4Z0HO 1A82A 3ONNA 1ZSYA 3AY0A 4XASA 1U2TA 1D5CA 2Q46A 3OMWA 4TMWA 4CL8A 3CC8A 4WWHA 1MB2A 4EQ6B 4MRRA 3IQDB 1P62B 1XAGA 4FQ5A 2CNKA 3V6LA 4FTWA 3IUQA 3KP1A 2XITA 1SN7A 3L8EA 2IF0A 5CXUA 1UK8A 4IRMA 3U7GA 2FMTA 5BY2A 1GUYA 4IIGA 5JD3A 1DBSA 3ECCA 2Q1YA 3FWNA 4H3SA 4JI1B 3QYJA 3SKYA 4QAQA 3VDMA 3ZDCA 1KVUA 1Z33A 3HZRA 5EKSA 3Q9LA 4BLOA 1WW8A 4MWZA 3T5GA 4HLUC 5GGXA 2GZSA 2G0NA 1YB2A 3OECA 4KYTA 3JRXA 3W3AD 3S2EA 4V0KA 4HDSB 4LNUB 3RRFA 1CYDA 5KU1A 1VYHA 3FYTA 2O8FA 2P9HA 4KP7A 1LEHA 1DEAA 1P2SA 2UVQA 3LYHA 4JLJA 2ZRPA 4D7AA 2J45A 4WKBA 4LG1A 2WM2A 4XUCA 4D4KA 5TGTA 2MOKA 5AUPB 4ERXA 3ITEA 5J2TF 3WTCA 1UKAA 3NHFA 1ISFA 1KJJA 3N76A 1AD2A 4FDLA 4FYWA 2HJWA 2VYFA 2A4MA 2ZI7A 1TTQB 3QEMB 4B5LA 1SC6A 3JVUA 3ILSA 1TZJA 1E6LA 1U8YA 3I01A 3OZXA 1K9SA 4FFBA 4HX9A 1H1TA 5C80A 4RLSA 2HSDA 1G3UA 1IZ0A 4B3RB 5DW3A 4HS9A 4D4IA 4YUZA 1ICIA 1U3UA 4ZCTA 4MPPA 3UJAA 4BNDA 3OD5A 5HW0A 2Z58A 4DMKA 4GZLA 4C29A 1W4LA 3HDGA 2OCYC 1BWPA 3PNKA 4BX8A 2PKEA 5K0SA 5F9MA 1C3VA 1IXKA 3ZZUA 2DWUA 5H1YA 1Z4MA 3SR4A 9GPBA 4NBWA 4DV2B 1JSLA 1P5HA 1ESZA 1RXYA 3KJQA 4J0CA 4C01A 3IYLW 1OLOA 4B7ZA 4NV3A 3OEYA 1T0HB 1V1RB 2PH3A 4CV3A 2JLQA 2UZAA 4KQGA 3PI6A 3A4VA 1P6QA 4BMZA 4RIEA 1N6NA 3HZOA 3LE8A 1YK0A 4BO7A 1W2HA 2J3LA 4QT4A 5I4IA 3HXTA 2NZ8A 4UU0A 5FO1A 1Q92A 5AKHA 5KHOC 1CJBA 2WA1A 3EMDA 2II6A 2PGXA 4I9NA 4QPJC 5I9LA 2FP4A 4GOJA 4AZ0A 3WICA 5JDIC 3IGFA 4OB6A 1YBMA 2HBZA 3CG0A 3OCXA 4KVFA 4OTZA 5JSZA 1MO5A 1U1GA 4P33A 4KX3A 3CGGA 1SC9A 4MV7A 1MO4A 4AJ2A 3HYRA 3D6UA 3NHUA 3PT9A 2ZBFA 3HCDA 2M6LA 2FSHA 1KQGA 2PXAA 3LUPA 3LI2A 5LBUA 5KTPA 3H17A 1KI4A 4ZCMA 2EV9A 2B9EA 3ESAA 2GARA 3GARA 2V1UA 4P58A 4ARIA 2VTBA 5BN3A 4NOMA 2Q6KA 2C4UA 3OT1B 2AMVA 2C3MA 1X6VA 3EIOA 4L7QA 5HTKA 1RYYA 3AL2A 2Z1MA 5SZKB 3LPLA 4FYIA 5CB4B 2J4DA 2R96A 5E9QA 1OB2A 4XYBA 1N2CA 1X38A 1E0DA 1N77A 1FUIA 1GTJ1 3A2KA 1UXIA 2UXBB 1U2DA 1XZJA 3LV8A 3EH2A 2P2CA 4ZO6A 1ACMA 1KI6B 3FTPA 3L1HA 3L7AA 4TRNA 5F7ZA 2XSZA 2OBNA 4BNNA 5FTKA 3CUYA 1XMOB 5IULC 1WMFA 4AZTA 3JVEA 4B47A 1CUZA 4JUBA 3EIEA 2IQ5A 5D01A 4A0SA 1VKHA 4D02A 1NMXA 5FWYA 1A7AA 3ASZA 1BG6A 3LY5A 3IVGA 3NUZA 1YCDA 3P0EA 3N53A 4OQFA 2C20A 4EWLA 3TWOA 3Q5GA 1P0IA 3BWMA 3TLKA 2GVDC 1JT2A 4Q3OA 1WXWA 1ZK1A 2RBGA 1IPEA 1GPNA 5IMSA 3OEED 2Y1FA 1AZLA 2VAMA 3KT3A 2Y9MB 3EF1A 2VBCA 2ZRLA 4A6EA 1MZVA 2O2CA 1MAAA 1QVVA 1OHHA 1QQ6A 2H11A 1KEEB 1NU8A 3PUJA 1GEGA 3NIGB 4X24A 2VP5A 2WU1A 4ZVOA 4O2AA 4E07A 2ZS8A 2CF6A 4EUSA 4RVHA 1WP4A 4M1MA 2IYFA 1DAEA 1U04A 5FTJA 1YE5A 2X5JO 1C7ZA 1FPQA 1CDOA 4QBTA 4YO7A 2XMRA 2BFWA 3LK6A 2YMMA 4F2GA 3O84A 3KQLA 1BMFA 4UARA 1J0CA 3OQJA 2XLBA 1K98A 2FQWA 2R48A 4FE3A 3GLHE 2JGLA 1Z45A 3D8TA 1KQPA 1YL6A 1G5FA 2FJPA 2QN1A 4O4LB 4MCJA 3B12A 4C7KA 5IEJA 2XGJA 2HMSA 2QS9A 4CEJB 4K1XA 4QPPA 4F0JA 3AW8A 3QH4A 5D3MA 3IUJA 2HK7A 3QKSB 2F7SA 1ST3A 3D6MA 1OXKB 3MNFA 2Z43A 2ZB2A 1QDUA 1EBFA 1VJGA 2O8VA 2AN9A 3C3KA 3C3BA 4BFLA 4M1EA 4MVJA 4B2PA 1P9WA 4GWKA 1B6GA 1T4GA 2IHVA 3FVQA 1K89A 3MHPA 1A96A 2MIIA 2JJ2A 1YGYA 5DGDA 1JHQA 2MINA 1NC3A 3C70A 4IDCA 3OLVA 4PYJA 5JVDA 4FFVA 3CY6A 1AF7A 3OEWA 4DCJA 3H2GA 4N49A 3NTXA 4RW0A 4C0HA 5JO0A 1R27A 5GINE 2W6JD 1LZKA 4WZAB 1DEKA 1U0NA 5FUVA 3I9MA 5KYUB 5TQVA 2JI4A 2YKGA 1ZUD1 4Q3BA 5IVKA 3I92A 1IK6A 1F3LA 1T10A 2AF3C 4P7BA 4CEHB 1NJSA 2CF5A 2WE7A 3ZQKA 2HDHA 4AURA 4R6WA 2Y1OA 3V8MA 3VV2A 4I50F 3IP3A 5DMHA 4U63A 3VU9B 4YBRA 3VJLA 3RUDA 1SPBS 1Y6GA 3WGTA 3PDIA 3RYFA 3BRCA 4GPZA 1J70A 3MTIA 1I0ZA 2GPNA 1MVNA 3CM0A 3R3XA 2V45A 5D7NA 4MVXA 1J8VA 1CY2A 2QLLA 2WKRA 1WB4A 1Q1NA 5HQ3B 2FK8A 3GXBA 3ZOZA 5L9AA 2HRDA 3T61A 9LDBA 4OAPA 5ITVA 1G63A 1ZH8A 1R5OA 4AF7A 3FM9A 4CE6A 3G9UA 1UUFA 3MMXA 3T8YA 2QM3A 3K35A 1O95C 4K9MA 3HVIA 2CHVA 3THSA 4DQVA 4JDUA 3R9WA 1RRFA 5L8VA 1AKMA 2GX6A 1J8MF 5LUBA 1PUXA 5A05A 4Y67A 1V7QA 5B3JC 1HT0A 4AAYA 3S2FA 1UAAA 1ZVKA 2IL1A 5EHZA 4MYUA 1E18A 4YYZA 1PDOA 4IUDS 1POWA 2IY7A 2D74A 3EWIA 3KYDB 1KY3A 4ZDWA 3ECSA 4YRJA 4DNFA 3TECE 4UMDA 1JDVA 2BHSA 2BLLA 3AK4A 4Q5IA 4UD6A 1Z12A 3WL4A 4A5OA 3RSGA 3VNBA 2WD7A 1T8TA 4ENPA 3E3NA 3NETA 4GBJA 4HXEB 4EHFA 3DULA 1UDXA 2OUKA 1C3EA 2WOOA 3QMPA 4LTMA 4HB0A 3P9QA 4D8TA 4CCWA 2F55A 2YBEA 2ZXUA 1T6YA 1RKXA 5FOXA 4HQ0A 4HUQB 1XF9A 1V9CA 2A1TR 1VLMA 2TMYA 2ZBDA 4OL0A 4RTQA 5T3YA 1NI5A 3AM4A 5CMLA 1MVOA 5IBQA 4D9IA 4LHVA 1JTVA 4MAAA 1AUPA 1E6UA 1SC3A 2LW7A 1QBKC 1UPBA 3MJSA 4LXYA 4CDRA 5KYNA 2YW2A 1TQ2A 1CVRA 1ITZA 2GEKA 1G2IA 2W2XA 4OQZA 4F5YA 2R4UA 2AN1A 4UUMA 1OKKD 3ABQB 1ZMXA 4V0SA 1XE3A 1L7RA 2XQJA 4M7RA 3TZBA 5HGXA 3D7KA 4URWR 1U0OC 2G5CA 2J3HA 2O8EB 3D31A 5FA6A 5TLSA 2OXIA 4UM7A 1AKVA 2A1IA 4R0VA 1X14A 2IOFA 5AHRA 2AC7A 1EFPA 2NN3C 3B78A 3HBLA 4EIWA 4IQ0A 1X0XA 3FPGA 1J49A 3QVSA 3KVNA 2VA9A 5MN6A 3UXYA 3A6FA 1HDIA 1P72A 4YIHA 3AOGA 5LLSA 4CFZA 5DX8A 5AVJA 5A2QA 2Z95A 3ZWYA 4W1QA 5ER9A 3ZBUA 1DLJA 5BMVA 3DFFA 4R9SA 4P86A 3WVNA 2V7VA 1JHRA 5EVCA 5JWRA 3LPNA 1GGHA 1ZHHA 2P67A 3LS2A 3VNUA 4D74A 4O5OA 1VPWA 4XIGS 1ZGHA 2F1IA 4JI8B 2BMVA 4LMAA 4PLCA 4RIFA 3WV4A 1LPOA 1ZVVA 5JSHA 3OAAD 1FUKA 4XI9A 1GTSA 4HB4A 1K4KA 3CSUA 3H4VA 2DQSA 5F5XA 4XIFA 2HI0A 3VO8A 2RDMA 1S3SA 4NC9A 1F8XA 1Z0KA 5L3SB 3MS4A 4YCJA 2COKA 5LMZA 4AWXA 2P4HX 3K6RA 2XUQA 3IOBA 4JZYA 2GGSA 5CIQA 3L5KA 2XB6A 3EF0A 4QJ4A 3B1XA 1WLYA 4PVCA 2Y2UA 1HLDA 1MB4A 3FUWA 2C94A 2FRXA 2LIPA 2QJOA 2HTEA 3I45A 4W1SA 3RUIA 1CY8A 5E4JA 1PQPA 2ECPA 1QVWA 4JD5A 4PFKA 4DUZB 1W46A 4RK1A 1JPJA 4E2FA 2BGWA 1RQPA 1DBIA 4LYJA 2QM7A 4PLPA 1OI7A 3MIIA 3EFOB 2B5VA 3DL4A 4IDEA 4R8KA 4BO6A 3GY0A 5IF9A 2ZQYA 3N2NA 1E1QA 1JHYA 2WAXA 2GYUA 3RTGA 1KI7A 1GZVA 1UINA 2HQSA 3ON5A 5ITZA 3ZE9A 1K88A 1GUBA 3F7NA 5G02A 4EX7A 3NHYA 1MPTA 4HWRA 5LQAA 2LD4A 2NPIA 1OU0A 2V5UA 3C7AA 2JK1A 2Y05A 4LJSA 2FZEA 1GZSA 3ZYZA 1N33B 1U5BA 1T1EA 1XQYA 5HJ5A 1QFYA 1XKTA 4Q1AA 3IEUA 3K92A 4C4ZA 1JU4A 2QGFA 3KD2A 1CEXA 1O89A 3KFVA 4RJTA 1SOMA 5BV2P 3FNGA 4Y3UA 3TLJA 2GAFA 2WSMA 3A2MA 2HPHA 3BE5A 3C6KA 1X1AA 2AI2A 1FXUA 5I3ZA 4C2BA 2BELA 3EVNA 4Q3NA 1VIYA 2BHRA 4HZUB 1AA9A 1Z6QA 5HKAA 3KZXA 4KAAA 4DIKA 1W1WA 2AKYA 1VOTA 4DAEA 2P62A 1DJNA 3EGIA 2PUEA 2WI8A 3ZNPA 3MMNA 1PWHA 2R1TA 4JT9A 3SY8A 4RZIA 2WY2D 3V2UA 3ZC3A 1F48A 3L7JA 4FNOA 2ANBA 1F7VA 3C7DB 4Y6RA 3N8KA 3E3OA 4CM8B 1H2HA 4NFHA 3EXG2 2AOUA 4WY8A 4S05A 3HGTA 4TM7A 2GDJA 5BQOA 2FQ1A 1ISRA 3I2FA 4EW3A 5COQA 2W2TA 4JI2B 4ENSA 1XRQA 5JPCA 1KTVA 1QYDA 1X74A 4IKOA 1UZLA 4ASUD 3U2QA 1OXMA 4L9WA 4TKUA 5KINB 1G0OA 3AFIA 4PPGA 4Z86A 3A26A 1AB5A 5JNVA 2D5CA 2O0MA 5K0EA 3C3DA 2BMDA 4RSMA 1VLZA 3TTXA 2JIZA 5KU7A 2WM3A 3IOCA 2BM8A 2AOTA 4K81B 5CVVA 3VKFA 3F9CA 3IRUA 3L84A 4DLWA 4PN7A 4II3A 8ABPA 1DUVG 2OO5A 4XUGB 3RH0A 2POCA 4IV5A 3AEQA 5DV9A 4KWHA 4Q93A 3KQPA 4RZSA 4TTRA 4G8JA 4TV9F 3U4DA 1T3ZA 1ZU5A 3DAPA 4WOCA 4WCDA 4JLUA 2O4UX 4BWYA 2FX3A 4KDFA 2JLWA 1M2FA 2FG7C 3AKEA 3P26A 1ISPA 5AXCA 2PRYA 5IKOA 3REQA 1TEVA 5JMWA 2D59A 1JKFA 2QB5A 2OT3B 4K6GA 1X1TA 2NVBA 3OIGA 4C2TA 2I6SA 3L6RA 1A1SA 2AYZA 2QZPA 5K4HA 1UJMA 4ON9A 5EYPA 1PSDA 1C8KA 1QFXA 4XR4A 3TEFA 4CV2A 4HFRA 1IN1A 3PFNA 2YS6A 3PDCA 3ABRB 1EVJA 1PVDA 4QPCA 5BVHA 2ZI3A 1NY5A 1PUIA 3UFBA 5BSFA 3WYBA 1JR6A 3NTLA 3MT7A 4Q9DA 2C5AA 5BRAA 3DWIA 5KQLA 3O4RA 4MV9A 3KQOA 2E85A 3CEAA 3AGPA 5DYGA 4B6QA 5J2TB 4JL6A 1LFDB 3UCXA 3WNVA 3H5NA 1BC5A 1TMKA 4HKTA 5CXSA 3DOEA 2BFNA 4FHEA 3CZQA 5IXSA 5JCXA 2BEJA 4C22A 2K7FA 4DSZA 1HNNA 4NBVA 1Y9DA 5A7FA 3DDOA 2VHZA 1PS8A 1TZKA 2VJMA 3FHCB 1C50A 3HSSA 1E2NA 3K2EA 1TB4A 3P52A 1T9ZA 1TKRA 3CJTA 3F78A 3CTMA 1H6BA 1CJTC 1ZK4A 4L8FA 4RMJA 3OE7A 4LY0A 5DNVA 3G17A 3C24A 3AHGA 1CF9A 1HNWB 5BN4A 3R41A 1BHQ1 3ZEAA 4CODB 1KY4A 5AVYA 2XMBA 4CF4A 4CHTA 2J3EA 3K0SA 1G3QA 3JQ6A 7GPBA 4A73A 1X15A 4PQGA 3CRMA 2I34A 3HN7A 1I80A 3KQWA 3DBIA 4LZLA 1L7MA 4S04A 3W5AA 1CULC 2OZPA 3ZDYB 1NM5C 4H7IA 2C57A 3C1OA 1W94A 3ASYA 3UW3A 3DLAA 4HT3B 1NWCA 2XDQA 4B2IA 4IVQA 1ZYUA 4GKAA 2YUIA 2WWHA 1E6WA 2ZYAA 1JAHA 4ZT4A 3O4HA 3G0OA 1MOQA 4UHBA 1ZINA 2JCVA 2PMCA 3DMYA 5EWJB 5IPFA 2Q28A 5EMKA 4OHYA 1YRLA 4CMHA 1NVFA 2EJVA 5FNVF 4WEOA 4DR2B 2ISCA 4DYDA 2X5NA 5K0TA 4RDCA 1J0BA 1RXCA 2YN4A 4QDZA 3UUFA 1KDYA 2WWVD 1Q21A 3W2HA 1FFEA 1TIBA 1ZD1A 2K5UA 1KY2A 4BBJA 4ZODA 2OQ2A 3CX8A 2VRBA 2XPCA 1CNEA 3NHSA 3L79A 3SZMA 1D1TA 4LY9A 3ZGZA 1DMRA 1P44A 1ZD8A 3AIMA 3KKPA 3S2IA 4ZMRA 1QB7A 2JCYA 3R4VA 5D84A 2G63A 4A2WA 3ZBQA 1KDOA 1Z7BA 3O26A 1Q0UA 2NU9B 1UMCA 2P2NA 3I8OA 221PA 4I4NA 4RNDB 5CVCA 3CVOA 4N6NA 3VTZA 2PCLA 1C7IA 3RREA 2CXUA 2GNOA 3PUXA 2RJNA 1UWLA 3P71T 4E5MA 5IJ0A 5K8IA 3HPQA 4CEIB 3C4JA 4CKZA 3E3LA 1CLUA 3CN9A 3WIDA 2JGDB 3ER9A 2GCPA 3BWBA 3SBOA 4KXUA 5BWBA 5ERXA 1XA3A 1XCOA 4NU5A 4BCCA 1AE1A 2F48A 4HB2A 1PNOA 4MUBA 1DC4A 2G5GX 3STUA 3Q3GE 4ZICA 3IFSA 3QVKA 1Y82A 1Z0UA 3K15A 4U8GA 4PF1A 3AZPA 5FLYA 5FAKA 1F0PA 1GZ5A 4IX1A 4OLAA 1KEPA 2IYZA 1P9NA 4WOJA 3TIVA 3F8WA 4R2LA 3ZX5A 1TEZA 5IN5A 1V8DA 1PWXA 1JQKA 1V9LA 3ISTA 1ODJA 4FFNA 4L5JA 2XVYA 4TRMA 3CZ9A 4YBZA 4B3DA 2R60A 4ARAA 1P1JA 3G7UA 4W5OA 4CKBB 2VP0A 3GP3A 1HDCA 2PLNA 3MJRA 4IF4A 4DJ5X 4DG9A 3MYRA 3KUCA 1RP7A 3NH6A 4OLHA 3SD7A 2EDCA 3F9RA 4UMEA 5FWXA 4DIDA 2WYHA 3BB4A 2YRXA 1IUNA 3K71B 1VKJA 3KKNA 4AP6A 3R3VA 4CL3A 1OUMA 2AD5A 1SCQA 1M73E 1Z74A 1J4AA 3KS9A 1OVGA 2ZWIA 5IAEA 4GBED 3LZCA 4A1OA 4BDSA 3KYJB 2PKQP 5KQSA 3I1IA 1IBKB 1TF7A 1UP7A 3OX2A 4PBTA 3ZV4A 1L5WA 4C7JA 2G9UA 1T0UA 3D6FA 3HJBA 1UJ2A 5LQCA 3RYIB 4X8LA 4JHXA 1Y1LA 4XGKA 2AZXA 1K5GA 4XDYA 4CLRA 3IAUA 4OYLA 5KYYA 4FWTA 2L82A 1LJ8A 3BZBA 3CISA 3H04A 3F5FA 3NORA 1Z22A 4GZ5A 1QE5A 4M0CA 3SIWA 5K05A 4CEHA 1JDZA 1P73A 1RWKA 1XQ6A 2BGNA 4HN2A 3NWJA 4EG1A 1NUPA 2NTNA 4AY6A 5DKFA 2V74B 4B3MB 3NHZA 2A7QA 1A3CA 1DB3A 1FSSA 1I6WA 3C14C 3KQVA 1NJFA 4J1NA 4ZVKA 4A36A 2FRVA 4XCVA 1G4HA 4P3PA 4Y98A 1R88A 3SNHA 3NALA 1XDBA 3ZY2A 4D45A 1H42A 3OLWA 4JI7B 2N0SA 1MJ5A 4LYAA 1VE9A 4OF4A 1J42A 2DU8A 2DR0A 2EP5A 5HFNA 5IDYA 5BN1A 3ZWNA 5MGNA 2WZQA 4P81A 4BE9A 2JFYA 2RB5A 3HU5A 4UJ5A 3TRHA 3MB8A 3N5CA 2ZTMA 1FC0A 2BMWA 2RHOA 3HA2A 2W11A 1GPMA 2Q5JA 4L5YA 4WOKA 4U02A 1ZY2A 1OXSC 2I03A 1AUXA 3HBNA 2V6JA 3WLRA 4BMNA 4DT1B 1E94E 1DFHA 1GAQA 1QZZA 2X6QA 2WPDD 4V0NA 2UXCB 1GEEA 2PSFA 4Q48A 4NBSA 4YWHA 2AEFA 2P7HA 2XOEA 1Z2EA 1M76A 3QTBA 4PCLA 2Z4RA 4L3VA 3SX4A 5JSFA 2VSNA 2X9GA 4X6UA 1JF8A 5CX1B 3NFRA 1KRXA 2FWJA 4DLXA 2XCOA 3MZ0A 4I50B 4FEGA 2FEOA 2WAAA 3ICEA 2DPXA 2VQ6A 4BGUA 1RPTA 1V25A 4EYEA 1XQ1A 1J2EA 2CHEA 2O57A 4GNRA 2O5VA 1FFDA 5G3YA 1T4DA 1TQHA 3RLFA 1AXGA 2AI3A 3LQFA 4L4YA 4M1OA 1K5HA 2H4YA 2C54A 2PSEA 2QUIA 5DX0A 1PDVA 2JANA 4AZSA 3MLEA 1D2GA 1WCIB 3D2BA 3B3GA 4R69A 3OQOA 1FVFA 3B1VA 1I4LD 5G53C 1E1CA 3I34X 4DUGA 1YI0A 1W49A 3C87A 4F6LA 1NUAA 1D09A 1Y48E 2D5IA 1GPBA 1DBQA 2JFPA 2IW3A 3LUDA 1NRIA 1TC2A 4JROA 5H80A 3T1HB 4O2LA 4PQFA 1WHTA 3M5PA 5JQWA 2CUTA 1JZQA 3S1AA 4MW9A 1FDRA 4Q66C 4HGQA 1TA0A 1XNJA 4KK3A 5E8JA 3Q88A 2VSOA 2AJCA 1U9ZA 3BRWA 4G0YA 5C53B 1EM6A 2O0JA 4IMJB 3FOAA 1O9HA 4KDEA 5GONF 4DLSA 1KI2A 2GN0A 3PYXA 2I6TA 3IP5A 4HO1X 4F7WA 1JDUA 3K73O 1M2VB 2ATVA 3GT7A 3R6TA 1J23A 3WMXA 5K8LA 1WNFA 5LXTA 2XB8A 1S0UA 4WXMA 3F4KA 3G9XA 4EKDA 1I30A 3N2YA 1SGWA 5FUBA 1GGJA 1Q3KA 3OPQA 4JZKA 4LDPA 3GQBA 1LTHR 3EN0A 4G81A 2PT7A 1WL8A 1IATA 4LYGA 4QU0A 1N3YA 3D8BA 2OCPA 1ZMRA 1E2KA 1U28C 5FOSA 2V5AA 4LJRA 3FPKA 2IS2A 4QICA 2FQQA 4EECA 2X13A 4KNVA 5E3IA 1HZJA 4L5CA 3DZKA 4P0PB 3GF4A 3RYHB 3TZ6A 1BDMA 3P9SA 3Q7TA 1YK1A 3FBWA 3MWFA 1FYDA 4R8MA 1STOA 1BCRB 3WDMA 4ACBA 3MTQA 3PNYA 2A9QA 4XJTA 2QRQA 1MJHA 3CF4G 5LL6P 1VE5A 3FMFA 3R0JA 4MIEA 3VR4A 2CLCX 3I12A 4ND8B 4WK2B 5DGIA 5C3MA 3FWPA 4BP9A 4OHFA 4GEGA 2BM0A 7REQB 4YJ3A 3OZWA 3JYLA 5KSYA 1Z18A 2K4MA 4I2NA 1MJFA 5CJPA 1COZA 3PHLA 1MTOA 3MGKA 4H08A 4RVCA 3VZSA 1M6YA 1T9GR 3EIHA 3W2EA 4PPQA 1X3LA 1M1YA 4AZWA 4LRWA 4TUYF 2PH5A 5IS2A 2XHEA 2ZTHA 3OE1A 3I4CA 3OLQA 3MW8A 4PTZA 4UHJA 5DBOA 5BYBA 3TTSA 1Z08A 2KLHA 1U7PA 3MRTA 1Q1AA 4LRSB 3QQPA 5UKDA 4BUJA 4EG3A 3GN1A 2W6QA 4WECA 1QLJA 4YGXB 2Z83A 3A4TA 1U9CA 3AZOA 2VT6A 3QFRA 2ZSDA 4MVJI 4O4JF 3M9WA 4LJAA 2BHTA 1J8DA 2XECA 1LSOA 3TKYA 4G8CA 3LYLA 5HXAA 5J4HA 1IOVA 4FFPA 2MHCA 2RHGB 4BB9A 2ZREA 2RKOA 3Q3VA 5LD2B 3LHDA 3VX3A 4PXSA 1E2LA 1N2GA 2DPYA 2JJQA 2XVXA 4BTVA 4DEVA 3T7JA 4RPJA 1W1IA 1IEVA 1VMDA 3DCYA 2C7VA 2Z6UA 1M6WA 1GSHA 2R8OA 3MTAA 1T5DX 1XNHA 2H0AA 2G9QA 2JATA 1GO2A 3DF7A 3Q3CA 4P2GA 2XZDA 4RKRA 2FF7A 4J7CA 4TS9A 4YT2A 4RE5A 3VAYA 2JRLA 3FWKA 3NRJA 4PPFA 4ZOLA 1X7XB 2BGIA 1DI0A 3MFYA 3GFBA 3TBKA 1RE0A 2DTEA 2EF0A 2GOYA 2PVPA 2PZFA 5CPBA 1NNEA 3H0CA 1SA0B 1JIJA 5AVUA 1UXKA 2VHVA 2FDXA 2HDNB 4WJKB 1U7OA 4AXBA 4UPDA 3PJDA 1UBTS 2C1XA 1JG3A 3GHHA 4BN0A 3GB9A 1DU4A 1VJ5A 1KK2A 4B3HA 2QX9A 2NU7B 4H17A 1SVKA 5EXPA 4O29A 3RF6A 2X5KO 5CEJA 1TRHA 4CQMB 3Q8KA 1AS0A 4NI5A 3R9XB 3ZQ4A 4EL5A 4NBNA 2OXRA 3QW4B 2AUNA 2VYCA 4YHBA 4ZVMA 1AHPA 2LGJA 3KQHA 4I55F 1EA5A 1WKBA 3P0FA 1VHJA 1XLTC 4X1IA 5E9WA 1Z56C 4YAIA 5LFAA 5CDYA 4ER0A 3UG7A 4Y6SA 1Y6JA 3AUFA 1U2GC 1KBZA 5F1KA 3JASA 1RVDA 2XAAA 5DNAA 2I66A 2CWWA 3O75A 4OQQA 3NEYA 1NJ8A 1RIFA 3MBKA 2NXNA 1N3BA 3QSGA 3HXKA 2C00A 3TPFA 2VO1A 1V96A 2JH3A 1HE5A 2QN3A 3EIWA 4PBSA 3HWWA 1N92A 3BMOB 5AR1A 4DLVA 1VSQA 2HSEA 3C1AA 4QDKA 3ZBPA 3QOFA 2CNLA 4LZOA 4W5NA 2IEAA 3DT6A 4FXPA 3CH4B 1GTZA 2D1YA 2J7PA 3HU3A 1NATA 4HH4A 4JLOA 2Q4OA 4GXNA 2PFSA 2VTVA 1MMFB 3GNQA 3JWPA 1NOJA 4ENRA 1N3LA 2HMTA 2HIAA 3VAAA 1D9ZA 1DRUA 2RFLA 5HFAA 2ACWA 3NHWA 5TNXA 3JY6A 1I9CA 2B20A 2C59A 3OU6A 3QX7A 2BH2A 1D4OA 4HWTA 2D00A 1UDWA 1KYQA 3LF2A 1IXSB 4PNPA 4CKWB 3ZE6A 2R65A 1SQSA 3GJQA 1CUBA 1E59A 2PXXA 1YMUA 1Z75A 1KDPA 2PD6A 2WT4A 3HJRA 4LSWA 4PRKA 4DLAA 2XMGA 1PR5A 3RVJA 4BFSA 4C7OA 4NV0A 5C8DA 1EGQA 3MTBA 1IAVA 2ZU0C 1GV1A 2BKLA 1MX5A 2R00A 1E3WA 2AOXA 3P8ZA 4CI9A 3ZD6A 1CQJA 2NACA 5FORA 5KTNA 3E2IA 2C7GA 5EZ6B 3MFQA 3P9CA 3BQMB 1E64A 2QX7A 1FSGA 1T2CA 2ZBGA 3MWEB 4TV9B 5K3AA 2B8JA 2OENG 3OCZA 3ZK7A 4TZ0A 4UDYX 2GBCA 4DTIA 4G1FA 4LF4B 2P0AA 4MNTA 4LBYA 3CLRD 5FJJA 5A4MS 4RACA 2R4QA 1C1HA 1CQIA 1XN4A 4H16A 5BWCA 1TA9A 4P4TA 1DIRA 3REGA 5LJIA 3PZRA 2X1MA 1E6MA 1PNQA 3K8QA 2GKSA 2RHCA 4MWEA 1U3DA 3ROPA 4ZI7A 3G2MA 2R1VA 2Z4SA 4EGCB 3ODPA 2NVUA 3DOJA 3R3WA 2RH8A 1DIHA 2RGAA 1S8FA 1LUAA 4Q15A 1XP8A 4Y1FA 2DXIA 1PGNA 2GVZC 4AD8A 4CTKA 1VMIA 2Q1XA 2E4VA 4OHBA 1ZR4A 3KKQA 1K6JA 5KSWB 5HF6A 4IYJA 3PQ7A 2O3QA 2GEVA 1Z2CA 3UMBA 3G8BA 4MW5A 2FFHA 2CNWD 1IZ9A 3ZGYA 1FL9A 1HT1E 5HBGA 2V7UA 1PBTA 3DDUA 1QHGA 4V38A 3TLXA 1T6ZA 2HPAA 3LWBA 3A11A 1TUBA 3D1LA 2OORC 1W5BA 4G63A 3PLAE 3ZDAA 3EGXA 5IJZA 2B1RA 1YB6A 3SMQA 4HEQA 4RADA 4KRGA 4B31A 3IVRA 4MVJG 4M0MA 1PEYA 3LIPA 2I7DA 2R84A 4JJKA 3PFGA 4EVQA 3BREA 5CEEA 1WUTA 2BE9A 2HLHA 4JQYA 1F5NA 2I2AA 2ZYSA 1PJCA 2JFOA 2XT6A 3DO8A 3RSQA 4NBKA 5ALEA 3TOVA 4A6DA 3SSAA 1KQNA 1X8LA 5A3VA 4WNAA 3S5JA 2XADA 4FILA 4HVLA 2J9GA 3Q7IA 1RTKA 5DX1A 2JFUA 3E9MA 2VZLA 1A5BB 1Y8QA 2ADFA 3GI1A 3GJTA 3TCKA 4DWWA 3TLAA 3VBCA 1CE8A 2AOWA 3OFSA 4CUKA 5F5LA 1RQXA 1W25A 3EXHB 1WDKA 4WH0A 2CJWB 4QYSA 1G7CA 4B34A 1TMYA 2ZJOA 4ER6A 3CEPB 1ZFNA 4GGPA 4MVJF 1ULTA 1DPGA 1H5UA 4F4JA 1G16A 3WWZA 5JDCC 4RF4A 2NZUG 5JVDF 3RI3A 4BV9A 2ILTA 3QUQA 1X7ZB 4G97A 1YI1A 4TKVA 3TW8A 4WMLA 5ESDA 4NJMA 4N47A 2FWAA 2VS1A 3RSCA 3VR3A 4EA9A 1M1XB 1TW2A 3Q40A 4PG7A 4AZ3B 3ZVLA 3TCNA 3G2HA 3BC1A 1ZSNA 3RRYA 3OSZA 1BW9B 3NTQA 4I9HA 4M53A 4EK9A 3FNFA 4AY5A 4OJYA 2AFVA 5SV2A 2JIQA 3FLAA 4FMCF 4NYIR 3CN7A 4Z4FA 5FFMA 2YHUA 5AKKA 1IG0A 2NMVA 1SBCA 1YRBA 3OEEA 4B4KA 3FF4A 4ER3A 3DFUA 1A2OA 1DQZA 3B85A 4M86A 5CT4A 4CCYA 2WJPA 3O4IA 3MELA 3HVUA 1NN1A 3IE0A 3RVPA 5JJIA 3WWDA 2QTVA 4MZDA 2BP7A 5CFMA 3H4MA 4AMUA 2Q21A 1SOWA 2AQKA 2FWNA 4M60A 4EFLA 721PA 3UMGA 3L4BC 4B3FX 1MBZA 4BNVA 5I7VA 3DQZA 3T3IA 5BWNA 5J1SB 5KYVA 1TLFA 3G7NA 1ZLXA 2VP6A 4PSAA 4R3WA 3ZOKA 1REQB 3D4BA 4RPIA 1V2GA 3UGKA 1GRNA 1HXHA 1RR6A 3IE2A 3LD9A 3Q8XB 4P35A 4PXAA 4WK4B 1T0BA 1MO6A 5JAOA 4OOEA 1VGRA 4JL8A 4KGDA 2JKVA 4N6GA 3S0JA 3UATA 5IDVA 3ZXYA 5KMGA 3L6EA 1XPJA 2JFNA 4AY3A 4DV6B 4L3WA 4P7FA 1T35A 3HDQA 2QVYX 1E5QA 2I78A 1ENYA 2NUTA 1FW8A 1OPXA 5DWDA 2CUZA 1X1BA 4GE3A 3VZBA 3NCTA 3DOFA 2W2QA 5AKEA 5H16A 2V96A 4ZAWA 4YQFA 2HO5A 3RK1A 5DTEA 4YV7A 2RGCA 1TU4A 3GT3A 1UEXC 1CS0A 2Q27A 4QO8A 4URUR 3KB8A 3GPIA 1XT6A 5J9FA 2PX2A 3O1JC 4POAA 1Z0FA 2IEIA 3E8XA 4YJ2B 4B0OA 2W6JA 3R5TA 4FYMA 3L92A 4NV1A 3RUEA 3OI7A 2UU9B 4PAWA 2Y0DA 1G42A 3RIXA 3SEZA 3BCSA 3KQYA 3FNQA 4MTLA 1HORA 1SUBA 4U6QA 3TW0A 1XQ9A 4ESOA 3WLAA 5KNCD 2VRCD 1PK8A 3IBCA 4Y2RA 3T41A 4DBLE 4UCFA 5KX5A 1IULA 2G25A 3FSRA 3QLVC 3I6MA 4TTSA 4K5QA 3UQZA 1XJQA 3D0QA 2QF7A 5IK2D 2YHSA 3ZIAD 1P0PA 5D3KA 3SYNA 4U7FA 4LE0A 5CFRA 1GV0A 3L41A 4UE6A 1HTTA 1OW3B 2OESA 3IPYA 3MMPA 5BN5B 3S6JA 3SS9X 3X3HA 3PEYA 2YCBA 1K68A 3Q9SA 5EXTA 4L73A 1SXJD 1LDMA 3SR3A 1B2RA 2ATXA 3A3OA 2JHGA 4R9UC 2OCXA 1Z8DA 5IP5A 2A2ZA 4EA6A 4DMUB 2BC9A 4URXR 1GZDA 2YXNA 3S55A 3FPBA 5KNBD 3O9ZA 1WE2A 4K03A 2YC4C 4AG3A 2WB4A 3KBBA 4QNRA 5BMVF 4DF3A 4Z53A 1O0CA 1FZQA 3ZWMA 2JI7A 5ALGA 4HDKB 5C37A 1QYWA 2IQIA 1TZ2A 4M4SA 2V8BA 4GZMA 4QTTB 2GM5A 1WW3A 3A7DA 4HWKA 4UAGA 4CQJA 4E6EA 3EYWA 4EHLA 1PG2A 4DA8A 3CUTA 3UB3A 2FSFA 3KHTA 1RBQA 4BJ3A 3P9PA 2CNNA 5AI9A 2QYOA 3ESBA 3WA6A 2XB9A 4ANFA 4E51A 2CUNA 2P4UA 4XB6B 2WIFA 4E33A 4A91A 4TVBA 2OO3A 2HHAA 1Y7TA 5JE8A 2EX0A 1BCSB 1SCUB 2XNHA 1Q0ZA 1QIIA 3BIJA 3D3EA 3S40A 4NCBA 2B2CA 5ALNA 1N1GA 4L78A 2RMKA 4M0EA 3CVVA 3SF0A 1LBQA 4UREA 5DTRA 3DB1A 4REQA 2VTEA 1V8PA 3KXKA 3MS7A 1RQLA 4W5RA 1QYIA 1UC9A 4B6EA 4P3XA 2UYQA 1KE1A 5EJAA 2FHSA 3V4RA 1K1EA 2BDUA 2XYGA 3QKIA 1N5JA 3HCRA 3BGWA 4N3NA 5AK4A 4KQIA 5F2OA 5G4KB 3GUUA 2ORYA 1Z2DA 2IYNA 5DN6D 4XRGA 5LP1A 1OH5A 1QFSA 1K9VF 1KZ4A 1ZITA 2GPTA 4R5MA 4M99A 5IZ4A 1QGYA 1BXGA 4WESB 1LDBA 2YWBA 5JJCA 1W75A 3JD4A 3E8MA 4TWRA 3ZWKA 1PZHA 4L28A 1R4NB 2PO5A 5FUXA 1OPRA 3LDAA 4LQLA 1Q7GA 1M2KA 4ODIA 3UAWA 1EX6A 1GT91 3QWHA 2ZJ8A 1RPJA 2ODTX 1U2DC 3OQBA 4TKMA 1EE9A 4W99A 1ZGGA 4F9FA 1N6IA 2WHPB 4DCCA 2RAUA 1L4KA 5A0FA 1JLLB 2IPMA 5ILOA 3GWGA 3M4JA 1KHHA 3ACCA 3LDFA 3QI2A 3X2EA 1D9XA 5EHXA 2ERXA 2O8CA 1L7NA 5A3JA 4LGCA 5LPNA 3AVYA 5K8UA 1N9GB 1IFXA 1QIMA 3WNBA 1Y5LA 2B99A 5DEOA 4CTOA 1PNTA 4HAXA 2QTLA 3AJRA 2H5JA 4WZAE 1ZM9A 1EVZA 3CNLA 3PRHA 4RPHA 1EVYA 3EVZA 4G4SO 2C4TA 3B38A 3JQQA 4R54A 3DLBA 4FBGA 3KKEA 5JALA 4FE4A 3BDVA 3RROA 1R0YA 3DEFA 3AJAA 3H3FA 3OAAA 5HS6A 1IJEA 1XD2A 2NPFA 5CDFE 2JLVA 4R9RA 5J3JA 1ORHA 3KR2A 2PRIA 4XDGA 3AUYA 1ABEA 3N0RA 1AKWA 1BZYA 1HTBA 1UK6A 3PNLA 2J0UB 4HFMA 4KBGA 3M49A 1QQ5A 1UKCA 2BGLA 3GIDA 4D4HA 3NBXX 2BCEA 1TYBE 4ILKA 2QRJA 3ANSA 5HKKA 3VR5D 1I7QB 1IVNA 1SHTX 4KEAA 1Z3IX 2WU3A 3UF0A 2B8NA 4INPA 3FGOA 2XXAA 3A1VA 1ELOA 1BS9A 1N4DA 3Q2IA 3QWFA 4HEA1 4XW2A 1G9XA 3AB3A 4JGGA 5GY7A 2FGJA 4GM4A 3PC8C 2CK3A 2X19A 4HGOA 5CVDA 2DLCX 4C0JA 3QF4B 2ST1A 5DZSA 3UVEA 4HAUA 3T15A 2QN7A 2QR3A 3FJOA 4Q1DA 1T8YA 5JHGB 1VG0B 4D96A 4NK4A 1TQ4A 3BK7A 3G9QA 3TLCA 1Y80A 4C3UA 3HCBA 3PA6A 2Y1KA 3WYDA 3O03A 1X1CA 4DJTA 1XRSB 2ID4A 3E22A 4RJ2A 1Z0SA 2G72A 5ADUS 2OBYA 3A6JA 3RRMA 2FI1A 3L6CA 4HAWA 1EXWA 2HXYA 3U3ZA 1CJUC 3R6GA 4MINA 5JPIA 5EKDA 5KTYA 1PAUA 4J0GA 3ZE0B 4CEIA 1S9HA 4OK6A 4YRIA 3TLEA 2J9YB 3RTBA 1QK5A 3ZZMA 1QIKA 1JWBB 5T41A 2O2SA 4NR0A 3K53A 4HWSA 4HH1A 4EQ6A 1XTSA 3LP6A 4KI7A 4RDXA 3X1ZA 3V8BA 1C8VB 2UDPA 1IOZA 3G85A