2EWMA

Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
233
Chain Sequence
TQRLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAPEAEAAIRNLGRRVLTVKCDVSQPGDVEAFGKQVISTFGRCDILVNNAGIYPLIPFDELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLKIEAYTHYISTKAANIGFTRALASDLGKDGITVNAIAPSLVRTATTLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords (S)-1-Phenylethanol dehydrogenase
publication title Crystal Structure and Enzyme kinetics of the (S)-Specific 1-Phenylethanol Dehydrogenase of the denitrifying bacterium Strain EbN1
pubmed doi rcsb
source organism Azoarcus
total genus 78
structure length 233
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.311: (S)-1-phenylethanol dehydrogenase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2ewmA00
2XXBA 1U3TA 3DBLA 4GX2A 4RV9A 2NUAA 3JQDA 2PGLA 1HDCA 1P1FA 3TDKA 5B12A 1BMDA 1Y7TA 2DFVA 1G0OA 2VTDA 2IODA 1DRVA 2YV2A 4YJHB 1YB4A 1ZMTA 2ZB7A 2OORA 2QZZA 3INGA 1YS4A 4FIZA 3E9NA 4IDDA 5ENVA 1NFQA 1ONNA 2HDHA 4K1LA 3AOEC 3CXRA 3M2TA 5JCJA 1DO8A 2O4UX 1TXGA 3FBGA 1FXSA 2B4RO 2FZEA 3QWBA 5KNLA 5L7WA 5KVSA 3C7AA 3WS7A 1ISJA 1OMOA 1RKXA 1X13A 3AFMA 3JD0A 4D7AA 5K6AC 1MX3A 3GVXA 1HXHA 1YXMA 3LYLA 3DFUA 3AUAA 3GN1A 1C1XB 4Q3NA 2PKQO 4R01A 4XJSA 4YDRA 4CUJA 1K6XA 1R4MB 3R1IA 2OBYA 4BNZA 3GVPA 1U8XX 2PH5A 2VHZA 4CODB 3RBVA 4W9NC 2DVMA 3GEDA 3O26A 5A5EA 4AJHA 2P2SA 3OIGA 3D4PA 1D4FA 5I7EA 4PG6A 1I3KA 4J2OA 2C5AA 4F45A 2JHFA 3KYDB 5HTOA 1KY5A 5T64A 1WPQA 3LZ6A 1UR5A 1LQUA 1PJ2A 4IDBA 4EYEA 2B83A 4OH1A 3S55A 1K6JA 5G4LA 4YAIA 3T4EA 3JD4A 5BT9A 2V6FA 1YL7A 2ZJ1A 3SXPA 3PJDA 5AVOA 3PIIA 1UP7A 4K26A 4J1QA 3P2OA 3DBHA 1YQXA 3GGPA 3IIEA 3ZW9A 4JNKA 3HN2A 4GMGA 3WJ7A 4CQLA 4D79A 3EUWA 3INTA 5JNLA 2EKPA 1GUYA 3A14A 1M6WA 4F3YA 1FK8A 4Z3DA 1SAYA 1LLCA 4FFNA 3CMCO 5L4LA 4NPCA 3WGTA 1I33A 4BO3A 2J3HA 1NNUA 1A4IA 3WB9A 3PYMA 1HLDA 3CSDA 2ZB8A 3D4OA 3GEMA 5TJHA 1XA0A 4NFHA 4E12A 4MP3A 2HK9A 3I6IA 1NP3A 3WMWA 3GDOA 1BVUA 2ILTA 3RUCA 1GYRA 2V6GA 1VE9A 1LX6A 1HTBA 3QE3A 3WWYA 5LDGA 4CMEC 4B4UA 4Y9DA 3IKVA 1O9BA 3ZCXA 5B37A 5A04A 2ZATA 4L4RA 4AJIA 1ULUA 5I8ZA 3KLMX 2IYOA 4MVJP 2GDZA 1F8GA 3R3SA 2BGKA 5MGBA 2AEMA 1C0PA 3PJFA 2Q1TA 4KUEA 4D42A 1O6ZA 2E6UX 1TT5B 3GNTA 1JVBA 3DBRB 3H9QA 3QVWA 1NPTO 2H6EA 3JYPA 2WYUA 3ZV6A 2X0IA 4MDHA 1LSSA 2A4KA 4IQ8A 4GX5A 3MCVA 1KEPA 4YTEA 5DN9A 5DT9A 1XCBA 4FS3A 1YOVA 5ER6A 2Z1MA 1SBYA 3EC7A 2FHSA 2D5AA 2C07A 1UP4A 3AOGA 4QT0A 3AM5A 1JWAB 1EEHA 4BNNA 2X9NA 1F17A 3WYEA 2PH3A 3TJRA 3BTSA 4B4OA 3DXFA 1JN0A 5AQ1A 3MEQA 1KETA 4JCOA 4XQCA 3I9OA 2WMDA 4J7XA 4E5YA 3ADPA 3QWFA 1E7QA 2HQ1A 2WD7A 4U6QA 1H0KA 2C29D 1I10A 1WLYA 3F5SA 2OUIA 3I23A 5AOVA 4A0SA 4CM7A 4UUOA 1MGOA 3DMTC 5L3ZA 2GUGA 3ZGYA 3VTFA 1MFPA 4L8VA 3DWFA 4RGBA 1K3TA 4WOJA 3OA0A 5COAA 1PQWA 1P1HA 1N9GA 3GFBA 2HMWA 2EP7A 3OQBA 5CDUA 1E7WA 1DAPA 4A26A 1O5IA 1NFFA 4MKZA 1UXKA 5CG2A 1P45A 2HMSA 1RM3A 3OJFA 3ONFA 4BB6A 4E5PA 4TKLA 2VRCD 5B4UA 5IDXA 4UREA 3ITDA 3N58A 4L4XA 2LDBA 4E21A 4D3FA 4O59O 3LT4A 1PJCA 3CMMA 4FCCA 5DBFA 2IYPA 4GSKA 3OSUA 2QZ9A 3JQGB 3S2EA 2I67A 2YFHA 4ND3A 5JDCC 1DEHA 4BB5A 2PGDA 3DAPA 3F1KA 1SOVA 2E37A 1QYVA 4OQYA 3RSHA 4R5MA 1PS0A 4M8SA 2AG5A 3WLEA 4J6FA 2QG4A 1PJ4A 4OXKA 2Q2VA 3ZNQA 1R4NB 4WOKA 2RHCA 3QA9A 4ALIA 1RJWA 3JD1A 3K8ZA 5TNXA 3ZV4A 1KYQA 5JW6A 1T2AA 4CM9A 3WIEA 3GRPA 4B7CA 4LCEA 5JO0A 2G5CA 4GGPA 5KJEA 2E49A 4YR9A 1B14A 4FFLA 2Q99A 1XGKA 4LW8A 3UKOA 1KEVA 4TMFA 3IAHA 3LC7O 3ZWMA 1P9LA 1HZJA 3PQDA 4OXYA 4CL8A 4DQUA 1U7TA 2FSVA 1MG0A 1AXEA 3ABIA 2BLLA 2ZYGA 4OGWA 4FC7A 4IDFA 2YJZA 5TJ9A 1ZJYA 3IMFA 3TQHA 1Q0QA 3HDQA 1QMGA 4PLTA 1ADBA 1KVQA 2EW8A 3IDSA 4XB2A 1P1JA 1QR6A 4D0RA 3QWIA 3LF1A 3DTTA 2NVBA 1AHIA 1Q1NA 1CDOA 4E32A 3G79A 3QIVA 3TRIA 4EEXA 3WICA 5KTKA 4KMSA 3VPFA 3LLVA 4PLYA 3E18A 4UULA 2XPCA 2PNFA 2YV1A 3I83A 3PK0A 3PZRA 4JLWA 5KKAA 1DOHA 5ENDA 2EG9A 5IXSA 1HZZA 3RU7A 4E33A 1SOWA 1UDCA 1W73A 2DT5A 4OSPA 4CJXA 4BO4A 4MKRA 4FPXA 1WAMA 3RUHA 2Y68A 2Z1NA 3Q3CA 4ZQBA 5G0SA 3KZVA 4EGFA 3KLPX 2X0NA 5GZ1A 1IB6A 1A9ZA 3IQDB 1I24A 1U4SA 3ULKA 4GKBA 3C7CB 1UUFA 4M89A 5JCXA 1WP4A 4MP8A 3WGHA 3CUKA 4KWIA 1PWXA 1U7HA 1YJ8A 5TQVA 2QIOA 1GU7A 1MXFA 3JD3A 1CYDA 5TSDA 1HE4A 3OJOA 2FPIA 4BGEA 1ZMOA 3O03A 2X5KO 3N7UA 3GG9A 4BNWA 1B16A 4IMPA 1VPDA 4CMCA 4C7KA 1EDZA 1ML3A 1MA0A 1UH5A 1Y5RA 4RVFA 3UVEA 4ID9A 3F3SA 4GX1A 3RJ9A 1UXHA 2NM0A 3MOIA 2H63A 2PZMA 1D1SA 3KETA 3WGQA 3F46A 1YBVA 4BKQA 1BHSA 2X1HA 3IC5A 3OECA 4PVDA 4W82A 4W7HA 4NR0A 1U2GA 2FPPA 4CLDA 3WQRA 1EQ2A 1N2SA 4ESOA 3ZV3A 3B1FA 3C8MA 1PL8A 1NQ5A 3Q9UA 2DQ4A 1ZKMA 1BRMA 3NYWA 1AUPA 3AFNA 5ICMA 2VWQA 1H6CA 1M6HA 5KJCA 2DUWA 4BNMA 1U8FO 4J1TA 4AFNA 3FTNA 5L7TA 3GZ4A 3OQ1A 1DC5A 1DIHA 1NPDA 2P5YA 3C1TA 4Y6SA 2CZCA 1YDWA 4IJVA 4TROA 4XKJA 4HFNA 1ADCA 3HDJA 3LT0A 4U5QA 1K6IA 3LU1A 1PGNA 5L53A 4XYEA 4ZQGA 1BVRA 3TPCA 5DP2A 1P0CA 3EAGA 3V2HA 1QV7A 2VQ3A 2Y1DA 3G49A 5EQDA 4GBJA 1FF9A 2PZJA 3UCEA 4YQZA 1EE2A 1OBFO 1ZXBA 2CF6A 5U1PA 3I3OA 2O50A 4YT2A 1SPXA 2UUOA 1BXGA 3L6DA 5COBA 3W4KA 1GEGA 1M75A 1P3DA 1FDWA 3DAGA 4Y6RA 5CDYA 2RIRA 1B26A 3Q2KA 4DGSA 1ZW1A 2FPGA 2QHXA 5F1OA 3L4SO 1ISHA 1BGVA 1OOEA 5F1KA 2IZ0A 4R5HA 5C7LO 3WFJA 3E8XA 1QXSA 2AEFA 4GWGA 4Z0HO 1KIFA 1SB8A 1LU9A 1LXCA 4NBUA 3WBFA 2CF5A 1RPNA 2PKRA 3UOGA 2CDAA 5JFOA 3TSCA 4KP7A 1T26A 3EGOA 2PK3A 4UUPA 5DF1A 1NASA 1XHLA 2W90A 4I5DA 3HG7A 4MJLA 4R41A 3GUYA 1ENYA 1YWGO 3NV9A 3FWNA 4CMJA 3O8QA 5A9SA 3FD8A 5DCWA 5L95A 1WMBA 5AYVA 1VJ1A 3F4BA 3DQPA 4YXFA 4DIBA 3IS3A 2ZTMA 5G0UA 3OHSX 3SJ7A 1PS8A 1PSDA 2D2IA 2W2LD 2W2KA 3A06A 3Q9NA 1GZ3A 1XWFA 4NG5A 5ER9A 5BSHA 5KOIA 1RM5A 3LC1O 3PLRA 4PG8A 5A1TA 2JD0A 2BD0A 1G1AA 3DZHA 5DOVA 3PHJA 1EZ4A 2NLOA 4RDIA 3L4BA 4QO7A 3D3EA 2A94A 4U8GA 3WGZA 2X5OA 1RYDA 3FPLA 4CQLB 4E3ZA 4MPDA 1VSUA 4AJLA 4Z3KA 4CM1A 2ZQZA 3VH4A 3R0IA 4CLOA 2EXXA 3EDMA 4MVJD 1MLDA 5LCXA 2DBQA 4J7UA 4M87A 2AE2A 3NTRA 1I2ZA 4NHEA 3VH3A 4CPDA 3CINA 1GPDG 5C7OO 1P77A 1GZ4A 3OIDA 4OIMA 4AJ4A 1N1GA 1SNYA 2DBZA 3UN1A 1LJ8A 3E5RA 1E1KA 1P1KA 2R6JA 1Y8RA 4EJMA 1X1TA 1U9JA 1SO8A 4E2WA 5GZ6A 3L77A 1NPYA 1LC3A 5THKA 1AN9A 5IZ4A 3RASA 1C3VA 3T7CA 4DPLA 2EF1A 2B4QA 1H93A 4NBRA 3SEFA 2OZPA 2BELA 4PN3A 4KOAA 5A06A 3VZRA 1A71A 3U4IA 3BHJA 5B1YA 1BDBA 3BMOA 4J9UE 3KO8A 2I3GA 4OM8A 4CQMD 1E7YA 5DDIP 1XLTA 4KTVE 1FDTA 2D0IA 4IXTA 5AXAA 2FOIA 2C59A 4OYRA 1PIWA 4RDHA 5KWEA 4N5MA 2ZTLA 4LCJA 4RVSA 4BMNA 2DPHA 3RFTA 5ITVA 2VUSA 3JQ8A 4UAGA 1T2FA 1YOVB 4O0LA 5JMPA 2X5JO 5HS4A 4B3JA 1XELA 3I9JA 1NHWA 3CKYA 1E1NA 3GVIA 3HJAA 4UVIA 1QYCA 2HKIA 3VAZA 1WWKA 3E82A 4S3MA 1KVSA 2PA3A 3QSGA 1Q0HA 2AQHA 2HUNA 4I9UA 3KSUA 4DVJA 3NDJA 5KCZA 3GGOA 4EJ6A 3DAFA 2EGHA 1SC6A 1Z7EA 1EQUA 4S1VA 3UH1A 2VYNA 3DZJA 2GF2A 3W4IA 1EBFA 1CRWG 4UUMA 4I9HA 4KDEA 2QRLA 2J3JA 1QLHA 2HCTA 2PGJA 3ZHXA 2PD4A 4J0EA 1WNTA 3MOGA 1LDEA 1N9GB 4HNGA 3NDIA 4FB5A 3HZZA 4WNCA 4QX6A 4CLXA 1YH3A 4RVHA 3VTZA 1PZGA 2QQ5A 4R4JA 3PWSA 2SCUA 4HFJA 1Y9EA 1ZEMA 2R00C 4DTIA 2X7HA 2I66A 2Y67A 4GQAA 3JV7A 3MWDB 1IE3A 4KQWA 1YBAA 4BNJA 4IMRA 2YDYA 5IJZA 3PVZA 4R54A 3TF5A 1W8DA 3QWAA 4OXNA 1EUDA 4RF2A 4DA9A 3GRKA 5EPOA 4CL3A 5CPBA 3IJRA 2P4QA 1Y5MA 3VVBA 4OHUA 1Q7GA 4TRMA 4OL9A 1DJNA 4WLUA 3PFWO 5T8KA 1V9LA 3RWBA 3JQAB 5EL0A 5FEUA 4XGIA 3VZSA 3TFOA 3ZU5A 3HWRA 1AGNA 3A1NA 3UGKA 2UYYA 5JYDA 1GV1A 2FZWA 5C5IA 4EUFA 3D5TA 1DFIA 5JY1A 4CR7A 1PJTA 1HWYA 1V0JA 2NTJA 2ZCUA 1C14A 3AUSA 3GMSA 3B6ZA 2C7GA 3AI3A 4XX0A 4HKTA 1N5DA 2NACA 2QRJA 1UZMA 3X2FA 5BNIA 3JQ9A 4ZRNA 3ROKA 1P44A 4L9RA 4WJZA 1U4OA 1IULA 4MINA 4XB1A 3WX0A 4DREA 3IOYA 1P1RA 3ADOA 1G6KA 1E3EA 2UV8A 4GVXA 2GN6A 5IN5A 2Y0EA 4JQCA 4BKOA 2AQ8A 4OJNA 3D64A 5TF4A 3BTVA 3F5QA 1GR0A 1J0XO 1UDBA 1Y8QA 4BNIA 3WBBA 4NU6A 4L75A 3AUTA 2DPGA 4KWHA 4YJGA 2JD2A 1KY4A 2CD9A 3OA2A 1U3UA 1QG6A 4QUKA 4D46A 4IGEA 2VYVA 3V2UA 3RUFA 5BSEA 4PLCA 2X9GA 3H9UA 2Q46A 4XIYA 4BO5A 3M1LA 1LLUA 1EMDA 5JAQA 3LT2A 5JE8A 5A9TA 1XQ1A 4GX0A 1T25A 1YONA 3UICA 3C24A 4BV8A 4MIOA 4RORA 3KUXA 2BH9A 1ENOA 3QVXA 5A5FA 1T24A 4WKGA 3FR7A 5JCJD 3S1LA 4W4TA 1HDOA 3MTGA 4OQZA 3PEFA 3EW7A 3FF4A 3VDRA 4P22A 1NWHA 3UXYA 4MVJG 1F8FA 2O7QA 5EMHA 4GLOA 3HDHA 4R1SA 3WGYA 3SBOA 2Q3EA 3AY6A 2LDXA 4TVBA 2BFPA 4B7UA 5C7IO 4U6SA 4E2YA 2P9CA 5G0VA 3TL2A 1R0SA 1YL6A 4Q3AA 3L07A 4II3A 1YRLA 1IOLA 5IDQA 1JWBB 1MC4A 3VKUA 3ZWBA 3BHIA 1DIRA 4BO2A 3D5QA 3AI2A 4BUCA 5BSFA 3NJ8A 3W1VA 2FR8A 2X0JA 3H65A 3K96A 4CV1A 2NU7A 4HY3A 3RC9A 3WGIA 4ND4A 4ZHSA 2BGLA 1V3VA 2YHIA 2Y1EA 4KZPA 4L76A 3WIDA 4CM6A 3BHMA 3QY9A 1T4BA 3JQ7A 1U5AA 1LSOA 1V3TA 3ETEA 4GLLA 4CM4B 4CR6A 1EVYA 3SLGA 1M2WA 1FDSA 4ZA2A 3WYBA 4RPLA 5JBIA 3HN7A 4BIIA 1S7CA 3OBBA 2IEDA 4HFMA 2VTEA 3BMQA 1LDGA 4TRNA 4N5LA 2EJWA 4A27A 4BO7A 2C2XA 3RFXA 1Z82A 5L7YA 4CM8B 2JFHA 3ANNA 4J3FA 4EI2A 1ZK4A 3GDGA 2Y1CA 3M2PA 4AJ2A 5C3MA 4EZBA 5TT0A 4YRAA 4FGSA 2ZYAA 4XYMA 5CDSA 5CEEA 3D3WA 5AXDA 2DUUA 1HDXA 3I5MA 4ZN6A 4EW6A 5KVCA 3C1AA 3JTMA 3U5TA 1E3WA 5KJ6A 3PI7A 4TZKA 4D45A 5COQA 4DLLA 4EJ0A 4MVJM 1E1LA 3EVNA 1Z74A 4Z9XA 2DM6A 2Y05A 3JYOA 4OO3A 3HB4X 3ZWWA 5JO9A 3ZWVA 3GFGA 4CM3A 4NJMB 2Q1WA 1DPGA 2UAGA 1XYGA 5THQA 1BDMA 5JDIA 4A73A 4AG3A 2NTNA 4D43A 3C85A 1DIAA 3F1LA 2Q49A 2O7SA 4WECA 4BNHA 2X86A 5EERA 2VWHA 4GMFA 2D8AA 2BF7A 5DOZA 3RIHA 4WCFA 4YACA 7ADHA 5CEFA 4BOYA 5DBGA 1P1IA 2HAEA 2GZ2A 4FFOA 1B8PA 3ROQA 4EBFA 3K6JA 3PHHA 4J4BA 1U3WA 2AW5A 2YQ4A 4GVLA 4WLNA 3RUEA 4DMLA 3B1JA 4NNJA 1Y6JA 5J23A 1X7GA 5A9SB 3KV3O 3MJEA 5G4KA 4YQYA 1ZK2A 2VWGA 2P91A 4QECA 5IDWA 3GAZA 5F5NA 5BNFA 1PGOA 3G17A 1R0LA 5CDTA 1QV6A 4AJPA 1CERA 3PRJA 5CDGA 1D1TA 2GZ1A 3CTMA 5GZ3A 3WTBA 5A3JA 3DO5A 5H83A 2NTVA 3RKRA 2HSDA 4P38A 4YEDA 5HWSA 1Z45A 2HJRA 2YUTA 1HDRA 1NM5A 4XQEA 4CMIB 4FJ1A 3CH6A 3H7AA 3I4FA 3JQFC 4ND5A 5GMOA 2P4HX 4D44A 3I9KA 2PD3A 1MV8A 1E6UA 3DFZA 4TRRA 4FFRA 1EFLA 3TZHA 3K30A 1H9BA 4HX5A 5EINA 5T67A 1TB4A 1NFRA 2J3IA 3E5MA 2GN9A 3KRTA 4CQMB 1B8UA 3GQVA 3K2EA 4NBWA 3ON5A 3Q2IA 3AI1A 2QYSA 4XGKA 3IP1A 1VL0A 1SEVA 3VZPA 1GY8A 4K6FA 3GT0A 1KVRA 1FJHA 3FNHA 1P74A 4PG7A 4XZ3A 1R6DA 2Q4EA 4X54A 1S6YA 4ZQFA 1ZEJA 3I9MA 1VLLA 3NKLA 2OXIA 3Q6IA 5KVQA 3ZI0A 3JQAD 5GY7A 1U1IA 4F46A 4JJGA 4RZHA 5L4SA 3GG2A 1DHRA 3FSRA 3GMDA 3JQ8B 4TQGA 4CM9D 4LGVA 3OFSA 9LDBA 4WUVA 1HYEA 1IHYA 4NJOA 5CPFA 1OC4A 3MJSA 1YQGA 3L0DA 4J9VA 4XR4A 4DC1A 4NBTA 2WEKA 4RLHA 1R16A 3ICPA 1XEAA 1HRDA 3ETDA 1ZSVA 1WZEA 4YVFA 1HF3A 4Y8VA 2OP1A 2Z5LA 3D0OA 4FOOA 3HHPA 3K5PA 3KYCA 3O38A 3LLSA 2E48A 2C5EA 3V1UA 3MJ4A 2H9IA 3UCXA 3U49A 2A35A 1CQJA 5FF9A 3NT2A 2DTXA 2W98A 4RCVA 4W7IA 4AJOA 2DBVO 4MKXA 2ZTVA 4O5OA 4LVCA 3V2GA 1O8CA 5TT1A 3GZNB 3QHAA 2P9GA 4RPJA 1LEHA 1M67A 2JHGA 2EGGA 2JKVA 1HE3A 1QYDA 4R51A 1LLDA 2VHYA 4J4TA 3JYNA 3ASUA 1LQTA 3LSYA 2Y1OA 4ZICA 4YJHA 1N7GA 4RL6A 1GDHA 1P0FA 2GPTA 1YO6A 1HDGO 3AJRA 4XDYA 3GC6A 2IZZA 1E1MA 1E3LA 4U7WA 2PWZA 2O4CA 1B3RA 2YQ5A 1PS9A 3AU8A 3OEWA 2F1KA 2O2YA 5HBRA 4J1SA 4Z9YA 3K92A 1I2CA 4FGWA 5U4QA 2PTGA 2CVZA 3BMCA 1R4MA 1SEPA 4Q9NA 4IUYA 2IZ1A 4E6PA 4RF3A 3SJUA 5FFFA 1L7EA 3DZGA 3DZFA 1PL6A 1J5PA 5L40A 1GUFA 1UZNA 4Z0TA 4HV4A 4I08A 3RC1A 4TVOA 2G82A 3H8VA 3CZRA 1EBUA 1E3IA 3KYDA 3A28A 2YYYA 2VHVA 2GN4A 1V8BA 4I8XA 5F5LA 3KHUA 3JCZA 4FD3A 2PZLA 3AY7A 4GPD1 1H94A 3FTPA 1J49A 3WFIA 5ICSA 3E9QA 4EUEA 4Q3DA 4MOWA 1NAHA 3RFVA 5JMWA 2I99A 3LT1A 1UXIA 4CLHA 4Z6KA 1E5QA 4IJWA 3I1JA 4IDGA 3ANLA 2HO5A 1P33A 2D3TA 3JQ9C 4OOEA 4Z9FA 3X2EA 1ADFA 3DBLB 3RVDA 3FNGA 1VL6A 4CMBA 5ILGA 3ZV5A 4JK3A 4IGFA 1HYHA 2ZIZA 5JSFA 2HK7A 4L74A 1R12A 3GN2A 4YJGB 3I6QA 5T6BA 2Y99A 4CMEA 3PLNA 5I7SA 4NDNE 2H1SA 5ILOA 4DC0A 1U2DA 3P19A 4R68A 3FHLA 5H82A 4YT5A 4WPGA 1JTVA 2GN8A 3JQCA 4E31A 2RH4A 2GERA 4DPMA 3A9WA 1RM0A 1DXYA 2P5UA 3V1YA 5AXBA 1PU2A 3K2BA 4I5GA 1GZ6A 3TZCA 1CWUA 1U5CA 1GUZA 2EHDA 3P7MA 2OHXA 3KVOA 2OBNA 4HP8A 1NWCA 4YAEA 3MJCA 3AM4A 4RVDA 1IHXA 1JKJA 1PTJA 2BFMA 3TL3A 1PJLA 2VN8A 3PHGA 4O1MA 1BXZA 3DB2A 2CVQA 1E7RA 3DHEA 3F4LA 2O2SA 2V6BA 2O3QA 4WNIA 3OQ6A 4R3NA 3DBRA 4J16A 2UUPA 1BW9A 1PJQA 3IUSA 3PP8A 3DMYA 1I3LA 1X14A 3WR5A 2XF8A 5I7VA 3AUUA 4IINA 1VRWA 2DFDA 4L4SA 4M86A 4NI5A 4QFCA 1C0LA 5DBIA 3PIDA 1ZH8A 1YQDA 3RUDA 2X22A 1J6UA 4BGVA 1A5ZA 3GPIA 5JYEA 5A02A 1K2WA 1LRLA 1QLJA 3NEPX 1KC1A 3WSWA 3KSZO 4NK4A 1ZK1A 2GSDA 5FWNA 1OAAA 4BS9A 3B20A 1QKIA 1CQIA 2W2LA 1GAEO 3GOHA 1PJBA 3DBHB 4P4LA 5I9MA 5JS6A 5JAZA 3AWDA 4TWRA 2E82A 2YHIB 3W6ZA 3BMNA 2ZCVA 1QYWA 4ALNA 2VCYA 3UUWA 4BO9A 4HWKA 4D3SA 3RCBA 1DFGA 4XD2A 4YPOA 1KEWA 5JC8A 1ZNQO 1W0CA 2IXBA 3VPHA 1XQ6A 2JCXA 2VZ9A 3S2IA 3UFXA 3HFSA 1WW8A 4CM5A 5JDCA 2O3TA 4FJ0A 4PLHA 3TZKA 4F6LA 2YZ7A 3TN7A 3OJ0A 3MWEB 1BXKA 4PZCA 1PR3A 3F9IA 3IL2A 2EKLA 3PFFA 4UVDA 2J5KA 2J5QA 4BNXA 1I2BA 4E0BA 1LSJA 3GGGA 4A7PA 1GYPA 2GO1A 1TEHA 2FSSA 3DC2A 4RVGA 4B4WA 4EUHA 5EN4A 1JAXA 4H7PA 5BQFA 2EP5A 3HE3A 4ZGWA 1X1EA 4GGOA 1SB9A 5F3RA 3MJVA 4RF4A 4IQ0A 4YAGA 5TC4A 1EDOA 1IUKA 1Z7BA 1VKNA 4YJFA 1VJTA 4B8ZA 2Y0DA 2YDXA 4RPKA 2C7VA 3GVHA 1LUAA 3DDNA 9LDTA 1H6DA 5HA5A 1ZSNA 2H5LA 2YV3A 2OMEA 3K31A 1HKUA 4N54A 2VT2A 2AXQA 1GYQA 2NU9A 4JN6B 4QQRA 4WCFB 3TOZA 2C54A 1F0YA 4BNUA 4CUKA 3ZU4A 1XU7A 2EEZA 2Y1GA 8ADHA 4GI2A 4H15A 1NR1A 1SMKA 1W4ZA 3D7LA 1MP0A 1YBMA 1CIVA 4W6ZA 4XRRA 2WD7B 4BGUA 5KJFA 2QRKA 2G76A 4N5NA 1HETA 2BGMA 4IJUA 2X8LA 3H9EO 2J8ZA 1UAGA 2YY7A 4WCFC 4J4HA 2E4AA 4RLSA 4LSMA 2WDZA 2WYVA 1DB3A 2WTBA 3BYZA 3H5AA 4FQ8A 4HFRA 2X58A 4LK3A 1TA4A 3GF4A 3DOOA 3PYXA 3FN4A 4WLOA 5L4NA 3LK7A 1PGQA 2ZTUA 3LQFA 1VSVA 2RHRA 3PQEA 1ID1A 4IBOA 4LRSB 4R1NA 5HRUA 1PZEA 2GD1O 3NRCA 5ITWA 2VYND 4DYDA 7MDHA 5L45A 1BSVA 4CV2A 3VPGA 5JPIA 3HUDA 1VM6A 2VUUA 1JQBA 4QO8A 1MFZA 1I01A 2NSDA 3ZHYA 2HMVA 4N18A 3H4VA 4R1UA 1YB1A 4Q3CA 1XKQA 2DLDA 4NQZA 4XRGA 5KIAA 3GNQA 2RH8A 3ENNA 1ADGA 4Y67A 4PLZA 4XGNA 2RAFA 1ONPA 2Y66A 3LF2A 5G2OA 3AM3A 5A3VA 3SLKA 4E5NA 3L9WA 4MVJI 4NU5A 3WSVA 4AJKA 3U09A 3FPCA 2OL4A 3GNSA 1AXGA 1ONOA 1ULSA 3FI9A 1HE5A 1ZJZA 4ND1A 5F21A 1ENZA 2QX7A 3P2YA 3OICA 3HSKA 1PQPA 2QYTA 2WE7A 1PZFA 1FMCA 2I3AA 3H5RA 1BTOA 1LC0A 4FJ2A 4WLFA 2RCYA 4A03A 3H3FA 5C37A 3NTOA 4IIVA 3PWZA 3OMLA 3W8FA 3I9LA 1B0AA 2WYWA 3INRA 3KTDA 3LC2O 4G5HA 3WYCA 4Q3EA 4TRJA 4BO0A 2Y1FA 1EUZA 2JAPA 1E3SA 1DC6A 3IUPA 4Q3BA 3U0BA 1L7DA 3U9LA 3NT4A 4PLWA 5L9AA 3OJEA 3CPSA 3GR6A 4DIOA 8LDHA 1F14A 3BAZA 4KUGA 1J4AA 5FI5A 2YFQA 4J43A 3TNLA 1V3UA 3ORFA 3WNQA 4ZJUA 3KEQA 2Q2WA 4KUHA 2ZK7A 2FY8A 2O3SA 1H6AA 4PRLA 5DNAA 1DC4A 1WXDA 4BNTA 3MZ0A 2R2GA 1UJMA 3WTCA 1E0DA 1X15A 1NXQA 2A92A 2FR0A 3I4CA 2D59A 3ONDA 4D41A 1CETA 4BKRA 1C1DA 3FWZA 1XSEA 4IDCA 1X0XA 4B3HA 1LSUA 1WDLA 5JAIA 2EIHA 3N74A 3U4HA 1IPEA 2Q45A 3KXDA 4B79A 5CG1A 1LLQA 1DBVO 1VKOA 1DRWA 5TRTA 5CEJA 5BR7A 3RBXA 4PG5A 3ZNOA 4PLPA 1Q0LA 1VL8A 1DLIA 2J5RA 4RJTA 2BI7A 5I7FA 2I65A 1AE1A 1LDMA 3QLJA 4A2CA 1WDMA 4B4VA 4M55A 3BIOA 4YRBA 1FDUA 2HK8A 2VYVD 4PRKA 4DRYA 2AQKA 5IAAA 1QP8A 4B8WA 5MDHA 4BNYA 4IY1A 1UXGA 1Y81A 2HLPA 4URFA 2CNBA 3RD5A 3QWHA 1E7SA 1ISMA 2G17A 4AJEA 3QP9A 2BMAA 4PVCA 1TI7A 2ET6A 2O3JA 4BQRA 4EDFA 3OH8A 3E9MA 1IZ9A 2GNAA 4JJIA 1DFHA 4YB8A 2EV9A 4GKVA 6LDHA 4AJJA 1UP6A 1NVTA 5G0TA 4GAEA 5B4TA 3ZHBA 2G0TA 2BKAA 1VC2A 3ST7A 5IZCA 4NMHA 5I9NA 2FRDA 3BMCB 3KB6A 3B1KA 4F6CA 2JCVA 3IP3A 3W6UA 1KC3A 4WEOA 2D1YA 4BMSA 5IXYA 1MB4A 5TGDA 4YRDA 3QRWA 3NUGA 1KVTA 3PWKA 4C7JA 1OC2A 2OO5A 2YW9A 1PWZA 4BL5A 4AJNA 4BNVA 2NVUA 1RWBA 4HNHA 4PLVA 1HDZA 3H3JA 3Q11A 1H2HA 3K9QO 2ZJ0A 2CY0A 2XXJA 4LN1A 1DJQA 3RAJA 1DLJA 3FBTA 1KEUA 2J3KA 2NQTA 4P4NA 1ZCJA 4UEKA 4DLBA 3EMKA 1O0SA 1HYGA 4J1NA 3NDRA 3WWZA 4CMGA 5IDYA 4PLGA 4DPKA 4YJDA 3RUAA 2B5VA 4WK6A 1A72A 4ROSA 4D3DA 3DTYA 3DOJA 1PL7A 5A9RA 2PD6A 4XDZA 2JD1A 4K9DA 2EW2A 5CFZA 3JQBA 4G2NA 2JCYA 5A4DA 4XCVA 4BNFA 3ZN2A 2O3RA 1MC5A 1B15A 4YWJA 3LDHA 2A9FA 2ZQYA 4CV3A 3DBVO 4XQ9A 1I36A 3R6DA 2FN7A 3ZWCA 5I8WA 4M54A 3R3JA 1PGJA 5DP1A 4N7RA 5IG2A 2X4GA 3NX4A 2HJSA 1F12A 3PPIA 4IJKA 4JXKA 3V1TC 4E5MA 1VI2A 3ROMA 1Z6ZA 1N1EA 3RKUA 2BI8A 1X7HA 2Q50A 4CUZA 1N92A 1FDVA 1NR7A 2P68A 4OKIA 4JIGA 1BXGB 3ZNPA 1CJCA 1YGYA 4FSHA 3ZU2A 1NVMB 2F00A 1OI7A 1H5QA 3ZZNA 3TZQA 1PR9A 3S8MA 3L9XA 1XR3A 3NAQA 2VHWA 1GTMA 1OFGA 1HE2A 4Y98A 4CLRA 4JJFA 3STHA 1B8VA 3PHIA 4GH5A 3U3XA 5FI3A 2WSBA 3ETGA 3B70A 4XA8A 4WLVA 4INAA 4ZVVA 1BW9B 3AW9A 2IXAA 3DHYA 4R9SA 4DQVA 2NVWA 3T4XA 1QRRA 4YYZA 4MIYA 1Q2XA 4XYGA 1IYZA 3I9NA 3O8QB 4GL4A 3TFQA 4DIFA 1WDKA 3O4RA 2B69A 1GCUA 1I3MA 1YL5A 2GR9A 2WE8A 3EK2A 4BNKA 3Q1LA 3HFGA 1EVZA 1X7DA 3DOCA 4RQUA 1WVGA 4NK5A 2Q1SA 5CHEA 2W2KB 3BA1A 4H16A 1B7GO 4UEOA 3U4CA 1DHTA 2C0CA 1YB5A 4GSLA 5EIOA 4IS2A 1NX6A 4QXMA 1Z75A 2O23A 4IS3A 1G0NA 5JLAA 3GA0A 3JYLA 4J90A 1ZO8A 3H9GA 4UEJA 1D8AA 2AEJA 2R00A 1ZUD1 2VRCA 1EVIA 1ZXLA 3BMNB 1CF2O 2UDPA 4BV9A 4KDFA 1YJQA 4CLOB 2GGSA 3F47A 4WLEA 5KJ1A 3QV1A 1E77A 3C1OA 3HNPA 2X0RA 3VHRA 3ZWAA 1XIVA 1R0KA 5DCUA 2J6IA 1UAYA 4XR9A 5T57A 3L4BC 4PGFA 3FRJA 4AL4A 5DCYA 2PZKA 1GQQA 4K6CA 2OOSA 3VC7A 5KVVA 4R9RA 3UCFA 3TWOA 2VRBA 3BXXA 1Y8RB 3GEGA 3GY0A 2OP0A 4XYLA 1HL3A 3E6AA 4J0FA 3UHAA 5KKCA 4GWKA 3IJPA 3RC2A 1N8KA 2PFGA 3ANMA 1WMAA 3PGXA 1EK6A 4C4OA 1DRUA 1R15A 1ARZA 3H5NA 1BWSA 3FCOA 4L0QA 4NZ9A 1ZFNA 4E2ZA 2CVOA 3KBOA 3ZWPA 1GQYA 3BMOB 4BQPA 4II2A 2IDZA 2CUKA 2IEBA 3I52A 2CDCA 3VH1A 3V8BA 2Z95A 3PHLA 2BFAA 4TSKA 4J49A 3QQPA 2DC1A 4YJFB 1EK5A 4B3IA 3CZMA 4BMVA 1EFKA 1NVGA 3ASVA 3VOSA 1HSZA 3D4NA 1HSOA 3JQAA 4K28A 1T4DA 4YCAA 4YT8A 2DTDA 5K0ZA 1LDYA 4PIVA 3HDYA 1HEUA 2VOEA 4J7CA 1I5RA 2NV6A 3HB5X 2FMUA 3WJAA 3FR8A 2CDBA 2XOXA 1LRJA 2NWQA 3KYBA 2ZB3A 1K0UA 2VOJA 4HBGA 4HUJA 4QTZA 1QORA 5AXCA 1GADO 4B7XA 3WDSA 1JAYA 4UVEA 4NH4A 3UF0A 2B36A 2Y0CA 1GEEA 2QW8A 4TKMA 4BNLA 3JYQA 4BO8A 5JY6A 4XJTA 1DIGA 1T2EA 3GHHA 3Q0EA 1JKIA 2FWMX 4WCDA 3ROPA 2FP4A 3G0OA 3ZH2A 1LRKA 2DTEA 3RQSA 3GPDG 3ZWXA 2UVDA 3AOEA 4DLAA 1A7AA 3SC4A 3GUCA 3OJLA 3GH3A 5U9CA 1HDYA 2X23A 2D4AA 4NBVA 4Z0PA 4IM7A 5K6AA 4R3WA 1QYXA 4IZHA 3MTJA 4R16A 2P9EA 4FBGA 4MVJH 1C0IA 2OGUA 1ISFA 4OMUA 4MIEA 4CMKA 3TOXA 3PTZA 3E03A 3WGGA 5IN4A 2AG8A 5TLSA 2C2YA 3U62A 4W9NA 2NU6A 1UDAA 1XDWA 2GCGA 5DULA 3SC6A 4L73A 1ORRA 4ZQHA 1C1XA 2Q4BA 2HRBA 1KOLA 5JAMA 3L6OO 4XYBA 2CMDA 1WZIA 4TZTA 5L51A 4OAQA 4I5EA 1HLPA 2HMTA 1GD1O 2VUTA 4FFPA 1ZZEA 4IDEA 3KEOA 2BRUA 2WM3A 4PG4A 5CAEA 2XAAA 2HRZA 5IFLA 3BTUA 2I76A 4RF5A 1NHGA 1GQ2A 1M76A 1PEDA 4RPGA 2VT3A 5DZSA 5T8KC 2PR2A 2EERA 2W8ZA 4FOSA 4XEHA 1IPFA 2ZYDA 1IL0A 2PKQP 4AICA 4MO2A 1A9YA 5ES3A 3NTQA 1V35A 1T2CA 3PYLA 3D1LA 3RJ5A 1E92A 2HMUA 3RI3A 3S2FA 3A4VA 1ENPA 5G0WA 5JXWA 1XG5A 4I9NA 3ENKA 4ALMA 4WE3A 1DC3A 1KBZA 3MJTA 4CM4A 1Y8QB 1I32A 1TT7A 2FR1A 2VZ0A 3W4JA 1C1DB 4YBZA 3VPSA 2AA3A 1I8TA 2B4TO 3WG9A 2DAPA 3EZLA 3VH2A 1H9AA 2B0JA 1DSSG 2GRAA 4HXYA 4E5KA 2B5WA 4UVGA 4JBIA 1OZAA 1RM4A 2EKQA 1O89A 2O3UA 3M1AA 4WEQA 4CM8A 4DBVO 1MUUA 4PLFA 1HT0A 2JFGA 1O94A 1IZ0A 4NFYA 1NTOA 3G1TA 4PZDA 1RYEA 4IQGA 2D5CA 2PY6A 3RU9A 1NQAO 2EWMA 4RVUA 1T2DA 2GASA 4IDAA 2YHUA 2Q1UA 1SZJG 4FFMA 3F6YA 3QVSA 4AVYA 1JDJA 1O95A 1A7KA 1TLTA 1TT5A 3ZWOA 1B2LA 4JROA 3QVOA 3VDQA 3V5NA 3WNVA 3OIFA 2JL1A 1ZK3A 4NJMA 1D7OA 4LRTB 3OETA 2NADA 1E5LA 5A05A 1L1FA 2GLXA 1KERA 3ZDFA 4LMRA 2JJYA 2C82A 4Q39A 3M6IA 3BZUA 3EHEA 3DMTA 1NBOA 3RC7A 3W8DA 1ISGA 4KTTE 4ILKA 2ZB4A 3AK4A 3JQ6A 1KVUA 4XIJA 5EQFA 4ZRMA 3JSAA 4A5OA 3H2SA 2Q2QA 1SCUA 1T1SA 2IRWA 2X9VA 4RPHA 4UVHA 1EVJA 3NGXA 4O6VA 3PJEA 3G3EA 4XWYA 3WLFA 2DBRA 5IZCC 3WQQA 3DZIA 1CEQA 4G65A 1AHHA 4P8RA 2NVUB 1E6WA 1KS9A 3JQ7B 3OEYA 4CMHA 3GHYA 4J91A 2POQX 4IIUA 1ZVMA 3ITKA 3OM9A 1EUCA 5HS6A 4E13A 3JQFA 4A10A 5EESA 3O9ZA 1NQOA 1GPJA 1E3JA 1C0KA 1N7HA 2BHLA 4RZIA 4MVJA 5TX7A 2EJVA 3EZYA 4YAJA 3BMQB 4WASA 4LISA 1UZLA 3DL2A 2NU8A 4YT4A 2B37A 2AMFA 3RBZA 4QFDA 1UXJA 1I30A 4ITUA 4FR5A 4CMIA 5F1PA 4DWVA 2IE0A 4DYVA 1NQTA 4UUNA 1ZK0A 3ONEA 3ZW8A 1NYTA 3JQGA 3VVCA 2B35A 3WGOA 1K5HA 1M66A 4Y6PA 1ZBQA 3DR3A 4JP2A 4RO0A 2I9PA 3D3WB 4FDAA 3ZHZA 4LSWA 3W8EA 5FYDA 2BFOA 3L6EA 1T1RA 1E3WB 4CLEA 3RROA 1PZHA 2VWPA 5LDHA 3BTOA 3JQBC 5B4VA 1GL3A 4CQMA 1D3AA 4ZU3A 3AU9A 3PGJA 4U0JA 2DU8A 4BHTA 4BNGA 1R4NA 3G1UA 1PX0A 3KM0A 1GV0A 1YE3A 4PZEA 3WOHA 2GZ3A 1PGPA 1YKFA 4BO1A 4R69A 2TMGA 3IKTA 2I5PO 3NGLA 1LI4A 2AQIA 4CLRB 1R66A 1X0VA 3OF2A 3S2GA 1YDEA 3DZBA 2I6TA 3OP4A 3HADA 4H3VA 3EVTA 5TIIA 3QVTA 2WD8A 5LC1A 1R37A 5JDIC 3E1KA 2NNLD 1I0ZA 1Q7CA 3GK3A 4LMPA 1JA9A 3WQSB 4JGBA 3GLQA 1TVEA 4MVJE 5TS3A 4JP3A 2CFCA 5G4KB 4DQXA 4WGGA 1Z73A 1EE9A 2PLAA 3KSDO 4HADA 3WMXA 4MVJF 1Y1PA 4KQXA 1MG5A 1B3BA 2V6MA 4LVUA 4BKPA 3DONA 1A4UA 4ZQEA 4E30A 3CEAA 4IXWA 3EYWA 5CP8A 4E4YA 1H2BA 4PCVA 3K73O 5ADHA 1JLLA 2C20A 4OOFA 1ZIDA 4JX8A 4CV0A 1BG6A 1XU9A 4ALLA 1W6UA 3P5SA 3ICCA 3PJGA 2VZ8A 4U0KA 4OSOA 5A03A 5BNTA 1QSGA 3CIFA 3VKVA 3KOUA 4IPTA 1DAOA 3EY4A 1YVEI 1VJ0A 3C7DB 3RUIA 3ZU3A 3SX2A 3GZNA 4D0SA 3PDUA 4NIMA 4R1TA 5IF3A 4PFJA 4AJ1A 1I3NA 4P4GA 1E6EA 2W4QA 3ZWYA 4E2XA 5H81A 3WXBA 3GVCA 4DMMA 3GAFA 3TZ6A 4G81A 2VNAA 4J2HA 1E7MA 1LDNA 1PJ3A 2WJPA 2ZKLA 2RBEA 1JVSA 2Y93A 3H6KA 3UAGA 4BVAA 3COSA 5JC1A 4JBGA 4DXHA 3QW2A 1A27A 3DEYX 1JU9A 3SVTA 1GCOA 1LTHR 3UW3A 4IZIA 3ZWNA 3GDFA 1DIBA 5K9ZA 4QEDA 2AE1A 1ZSYA 2WWRA 2GYYA 4MP6A 2HU2A 1MXHA 4RQTA 1JW9B 4ALKA 3C3XA 2G1UA 4YA6A 5T5QA 6ADHA 4JBHA 5BSGA 4EEZA 3E48A 2V7PA 4FN4A 3FNEA 3PDJA 1F06A 2NQ8A 3FNFA 1NAIA 5I9LA 2V65A 4XQGA 4M1QA 5HM8A 2AHRA 4EITA 2VNSA 3H9JA 4QSMA 3LVFO 3CE6A 3DZKA 4NFSA 4ONEA 3NJ4A 1LA2A 4W99A 3H2ZA 4BGIA 3VPXA 3DHNA 1Q7BA 4FC6A 3U4DA 3NT5A 3PQFA 4O63O 4M49A 1PJSA 2DKNA 3JD2A 4ZD6A 4BO6A 2CSUA 4CR8A 1PQUA 4DBZA 3KYCB 2JAHA 4I5FA 1DDOA 1P31A 1U28A 1Y9AA 3ZNNA 4CMAA 4DL9A 1LBEA 2TMDA 4OKNA 4DUPA 4YAKA 3VZQA 4FW8A 1IY8A 3PXXA 1U3VA 4ND2A 1ISIA 3QJ5A 1JKFA 2X6TA 4ALJA 5EJ2A 2O48X 2OFPA 1K89A 4BKUA 3T7EA 2VHXA 2PV7A 2JFFA 3JQEA 1LNQA 1H6BA 1LDBA 1V6AA 1GFSA 4I1IA 3AY3A 3PZBA 3HQ4O
chains in the Genus database with same CATH superfamily
2VDRB 3DYVA 4PM4A 3EOAI 3IQHX 2PGLA 1P1FA 1R3DA 2DFVA 1G0OA 5FUBA 5INTA 1P75A 1DRVA 3SC3A 1QK5A 3FCEA 4YJHB 1K06A 1ZMTA 2OORA 4D3ZA 4ENQA 1QDUA 1MORA 5DYYA 1KMNA 4IDDA 1A7UA 1AZLA 2ZRHA 3M2TA 3PA8A 4PSAA 5F9MA 5JCJA 1YZ3A 4OQPA 3J80A 1TXGA 2FZEA 1JF8A 2CXXA 4CTOA 4EG6A 1XU4A 5KNLA 5FBHA 3ZZ0A 1I13A 1YZTA 3C7AA 3IEVA 4ER3A 3PHCA 2O8NA 1HQDA 1U7ZA 3C87A 2AOWA 4NYIQ 3SYRA 3VAYA 4D7AA 3NVKI 5BXYA 4JJKA 1CK4A 5EIXA 4YRMA 3AUAA 3WLOA 4OGGA 2PKQO 2IF2A 3AFHA 4CUJA 4A0FA 1KMHB 4EHFA 1R4MB 1IOWA 4TS9A 1Z07A 3CJRA 5CA0F 2C7QA 4K9RA 4BNZA 1GSOA 4W5JA 2YY6A 1XZQA 2W71A 1FQKA 2B2CA 2X5XA 2VHZA 5KZMB 5ESWA 3ITEA 4OHWA 1I3CA 2OUKA 3WI7A 5LQAA 3R5JA 3J7AC 5FWXB 4G5RA 2FLVA 4QICA 4WZAE 3OIGA 2XUHA 2HRQA 4OL0A 1I3KA 2QYHA 1VIDA 1IY1A 2JHFA 4Q93A 5ULLA 4F45A 1JT2A 4FILA 1UMBA 4IDBA 1PJ2A 2CZQA 4QASA 4ZPXA 1SPBS 2FUEA 3LDAA 4EYEA 2B83A 3IBTA 4RHUA 3S55A 1LVGA 2QTVB 5G4LA 4MMZB 2CNWD 2REXB 3CT6A 1G19A 1T8SA 3T4EA 1MEOA 3R20A 1E2BA 3PJDA 1Z0IA 4FHGA 5E3HA 2IXEA 3BZBA 3HZHA 3P0JA 4P6VF 3OCXA 5EIBD 4TMZA 2Q3BA 1JDPA 4HAYA 4C0SA 3GGPA 4ZFNA 3UHPA 2R751 4GMGA 4JT2A 4CQLA 1TAGA 4ZJPA 1EHYA 3EXAA 4MI9A 3EUWA 3S0JA 2ODBA 1W36D 1QIIA 2EKPA 5FPKA 3OFNA 4NCIA 1FK8A 4OBEA 3ED1A 2MMGA 1SAYA 1WU7A 3U7FB 1Y37A 4OXXA 5L4LA 3WGTA 4DEXA 4WZBE 3NTLA 4R8MA 1TDJA 2P75A 3TLEA 3WMEA 1NRJB 4JUBA 1HLDA 1XEXB 2ZYVX 4N7BA 2RHWA 3CSDA 3B38A 3H1FA 1XCOA 4G09A 5HF6A 1U9IA 2H17A 3CLKA 1C4OA 5H4GA 3MAGA 4R81A 5M04A 2X42A 1AQIA 2HK9A 3WC4A 4D98A 2P0AA 1Z08A 1PG0A 1EFVA 4KXLA 4HAWA 2ECPA 4PYKA 5TR9A 2CSXA 3SKYA 3RUCA 4GP7A 4OHRA 1B6TA 1QYIA 1T3HA 3NW9A 3THSA 3QEKA 2V6GA 2NUTB 4EY7A 2XYPA 1L4HA 3BJZA 3E3OA 2QSZA 1ZX1A 3QE3A 3WWYA 3C45A 4TLAA 4B4UA 3DO8A 3FYUC 5TMEA 1JLKA 2C2GA 3KEGA 2E4XA 4L4RA 3PR1A 1AK1A 1HKHA 4HAXA 3BRWA 1PP4A 1Q2UA 2R1VB 5BNZA 1GG5A 3RAFC 1AZSC 4KLAA 2V7TA 1JDTA 3DL4A 3MCWA 4K5QA 3Q9LA 4UTXA 3TLJA 4X7BA 1TCVA 1SR8A 3ZHCA 4GW3A 4B76A 4D42A 1TT5B 2OCLA 1OLOA 1SRRA 3EIFA 4HVLA 3SVLA 3SZGA 1NPTO 2VFAA 3EGDA 4WI1A 3K70C 5BPFA 2NYRA 4MDHA 4XXHA 1LSSA 1TM7E 2ZTHA 4BYMA 4GX5A 4YTEA 5ER6A 3C8HA 4AQDA 4U2KA 1SBYA 1PTJC 2ZJ6A 3MUFA 4GMHA 4WXMA 4ER6A 5AVTA 2D5AA 4DV2B 2JHPA 4WX2B 1P4AA 3FCYA 1JWAB 2XT6A 2IH4A 1EEHA 5BSKA 4B3SB 3AONB 5DX0A 1VFPA 1E9VA 1TKCA 2VP0A 2ZI4A 3WYEA 3HYCA 5EXDA 2WK1A 3EDYA 4BP9A 2JFBA 1VDMA 3H17A 3I37X 2GCOA 2IU6A 1ZIXA 2D8MA 1XRSB 3C70A 3OPYB 3P2MA 4JCOA 5KWVA 4RH3A 1KO1A 4U6NA 4DNXA 5ALSA 2HQ1A 1HM5A 1N6PA 2WD7A 3CLUD 4NYJQ 3L7BA 2MSCB 1WLYA 5EZ5A 2BM8A 1N2CB 2WT4A 3ESCA 4L8YA 5AOVA 3I23A 1HNZB 2AYZA 4UUOA 4AUMA 4DLRA 1OAOA 1HC7A 3CXUA 3DMTC 3QG1A 5L3ZA 2UYHA 2C2HA 3E9RA 3VTFA 4C9BA 1G6Q1 1O4WA 4L8VA 2ID9A 1JXMA 2QBYB 2AN3A 2AEEA 2JGIA 4MV0A 5COAA 2DP4E 4LI3X 5CFQA 1N9GA 3GFBA 5H80A 1ZOOA 4C88A 2VKTA 2RC5A 4A26A 4B34A 1AK2A 4DG9A 1MRNA 1P45A 1RM3A 2PMEA 5EUMA 1D7AA 5I4KA 1H2YA 5IDXA 5B4UA 3X1DA 4KBGA 2OO3A 3UV7A 1KO5A 3OTGA 1D9ZA 3HN6A 4IEIA 1Q0TA 1G20E 4XWAA 3BIXA 3FWHA 1YZKA 3LT4A 4HNVA 1PJCA 1C41A 3CMMA 4FCCA 4R71A 4GSKA 4WKBA 2EJCA 2BKXA 1IVSA 4J76A 2QZ9A 1ULHA 2SHKA 3FUWA 5C8YB 3LKDA 1UMCB 5K1ZA 1RPJA 3MPUA 2I67A 3QFTA 5ESRA 4FYJA 1FS6A 1DEHA 2J7PD 2WKQA 2C9YA 1BO6A 1FFXB 1GGMA 4O2RA 2WJZB 1SOVA 2XWPA 2GK6A 1I4OA 1TKRA 1YCDA 1E3TA 1Z88A 3NONA 5IARA 4M8SA 5EJGA 5FJJA 1U3GA 4N0QA 1IC6A 4PBSA 1ZWLA 2UYOA 1V1JA 2FV8A 4Q1BA 2FMHA 4ZEXA 3UMFA 3TE7A 2OHIA 4A2QA 1WB9A 2OYCA 2J3EA 3GFSA 4HF7A 3MAAC 4Y0VA 1I6WA 5DHTA 4NC9A 1Y7PA 2WU4A 2FDXA 5IYZF 3MM4A 4WOKA 2RHCA 5ICCA 2W6QA 4ALIA 1PZXA 2QVZX 3Q3IA 2F7SA 5TNXA 3A70A 1COZA 3E0XA 4YS6A 2FZKA 1Q3KA 1VE5A 2X19A 4ZXFA 4R1PA 1JP7A 2AOXA 3GRPA 2V96A 4KSBA 4MRPA 2C3UA 3MMNA 3Q3GE 1V4BA 5AIAA 1VGVA 3RSCA 2FWJA 2G5CA 4HDAA 3TW6A 1ESDA 3H5OA 3ML1A 5LZ5A 5HQ3A 1B14A 3GEEA 1L7AA 1WCXA 4WZAA 5D8DA 1PNRA 3NC0C 5JJLA 4D82A 1WMSA 1FTYA 2AJ8A 2WTXA 3UKOA 2XHZA 3OZFA 2P9BA 3FKJA 4TMFA 3NIGB 4B45A 1QFXA 3CFYA 1M0TA 3EAFA 4JASB 3W6PA 1L8LA 1DI0A 5K3CA 2W00A 2VDQB 2K4MA 4CL8A 4FVTA 1S3SA 4B3GA 2O1SA 4TTSA 1MG0A 5DGIA 1VDZA 3B2QA 1H2ZA 1ODIA 2BW0A 3GBSA 3ABIA 2PZEA 2ZJYA 2ZYGA 2CXUA 3OJCA 4NABA 2P2LA 4OGWA 4HN2A 3ZY2A 3COJA 2VDPB 3BGVA 1A1SA 4S24A 5DXAA 1OUMA 2ERYA 1Q0QA 3KALA 2FN4A 4MUKA 1CR2A 3M4ZA 4L2IB 4Y2VA 221PA 3PUHA 2EBHX 1QR6A 3O74A 4TTIA 4L5JA 1UK7A 2AVNA 3B1VA 1CDOA 2DWPA 1FFBA 2UZIR 3UC5A 3QIVA 3TM5A 3P2IA 3D54D 1J22A 2QS9A 1JNXX 4KMSA 2BKVA 4I2NA 4LJYA 4PLYA 2LIVA 1L6IA 3E18A 2HC9A 3I83A 3PK0A 3PZRA 5E1OA 2Q9UA 5KKAA 1KJIA 1AV6A 3NV7A 1LX7A 3NU1A 2XMGA 5D51S 5SZIA 3SIWA 3T94A 3ZVNA 1HZZA 3C3KA 5EHQA 2J5BA 2YJTD 3GELA 2G9QA 5H02A 1UDCA 1W73A 3SHTA 3SJAA 4B44A 1CF4A 4CJXA 1W6RA 4BO4A 3N6RA 2QTBA 4DMUB 3RUHA 4PIMA 1RXEA 4AI6A 3GMIA 1WA5A 4OHCA 5JAUA 3KZVA 3OPQA 4UJ3A 3IRUA 4U3JA 1D0IA 5E3IA 5GZ1A 3NHBA 5B3JA 3IQDB 1A9ZA 2X3FA 4P54A 3RS2A 4GQIA 5DHUA 1LVUA 1W59A 4I7EA 4ZGBA 3AVQA 3C7CB 2CV0A 2O8FB 4B4KA 2J3LA 4FFDA 1FVFA 1MPTA 1I4LD 2J9GA 3EB9A 5D86A 1N2OA 4KWIA 4M37A 1UBRS 2RGNC 1VIMA 5J5CA 1KBQA 1UKYA 1PRYA 3LDGA 1XA3A 4JGGA 1CYDA 1DG1G 1HE4A 5TSDA 1M2JA 2FPIA 2MDTA 5D2CA 5IAEA 1MAWA 3W9BA 4ZVPA 4RWEA 1Z83A 4PY2A 2H06A 2IA5A 3O03A 4EY8A 3KQLA 3QBDA 3GG9A 4MW2A 2YZNA 4KITB 5KWSA 5JJIA 4CKEB 4RFLA 1PFKA 2HBQA 1XDZA 3F0TA 3CEMA 1ML3A 1MA0A 3UVEA 2IQIA 3SSNA 4ID9A 1C5KA 4MZDA 4WKOA 3F3SA 1YVPA 2ZZMA 1Z0SA 4A16A 2PH7A 5ICEA 3AJAA 4DM3A 4TYMA 3KETA 5KS2A 2DRIA 4IH1A 3JATB 3BBLA 3ZU6A 3F46A 2B20A 3GJ0A 1QGUB 2GK4A 2H85A 1KAQA 1W85A 3DG9A 3LE8A 2X1HA 5I3ZA 1SGWA 3SS8A 4QU5A 3THYB 3OECA 3NBKA 3QVUA 3RYFB 4YGXB 4H60A 2RBKA 2XCIA 4CLDA 2MYUA 3D9QX 4ISCA 3WKCA 3WQRA 4MUIA 3DDHA 4F3CA 3IP8A 4RSGA 1LI7A 3ZV3A 4G9EA 2WWFA 4OYHA 1VA5A 4IOMA 4Z7QB 4FZ3A 2IHYA 2BV3A 4AMGA 1KP3A 2PWYA 2GOYA 3CM0A 4IJQA 1VMAA 2GEDA 1BRMA 2H5JA 1AUPA 3ORSA 2I3DA 2QN9A 3AFNA 2CD7A 3GA5A 2XTNA 3QOXA 5HF9A 5KJCA 1XV5A 4BNMA 2O8BA 3AERA 1XBTA 3JR7A 3C6YA 1SCBA 3GLHE 1JHRA 3BL6A 4DKJA 1KH2A 1NULA 1YV9A 3NNNA 1DUIA 3ORQA 4QU0A 5GONF 4B17A 1NPDA 2V3VA 2O8EB 1E1DA 3HYTA 1I94B 1VSTA 2P5YA 3C1TA 4CDGA 1SWWA 1QB7A 1BROA 2AJCA 4XKJA 4Y0NA 4G9GA 9ABPA 4EFDA 1IXKA 4K9KA 4I4TF 1VYUA 2IW3A 5BY2A 1DEAA 1M10A 3TG8A 2NZYA 3PUIA 4XYEA 1VMEA 1VCIA 1ETHA 4HZGA 4DNFA 2UKDA 5H3HA 2VQ3A 2Y1DA 3G49A 4FWTA 1JRLA 1XVLA 1BCRA 2GPAA 4LF6B 1FF9A 2HHLA 5AK0A 3BWYA 2PZJA 2GDJA 1NVDA 1XF9A 5AOAA 4EFNA 1U0BB 4V1CA 1ZXBA 4LOAA 1NJSA 4ARZB 1VYVA 3CF4A 1C7IA 1O94D 3IPXA 3JQQA 4LRWA 3I5UA 3I3OA 1AZWA 5U1PA 2W42A 2AB0A 3ANTA 3LUFA 1SPXA 4G0VA 3ZZMA 3KEMA 4U9IS 2PX2A 3UHOA 5COBA 4FE3A 2Y1XA 4BVGA 4HQ6A 4M0EA 2GBFA 1FDWA 2MHCA 3DAGA 3SHVA 3VYTB 1U4NA 5CDYA 1SUPA 5I45A 2QHXA 2XCQA 1LZLA 3L4SO 2B4KA 4QAJA 3ZDCA 1BGVA 1JH9A 3REFA 4C7OA 1CR1A 2G6BA 3F71A 4MI3A 1M3SA 4FLFA 5C7LO 2EYUA 1IBMB 1AQUA 3QQ5A 4LY6A 2J6CA 1ZNXA 2PXCA 3MBOA 4K81B 4B5KA 4V0KA 4BP3A 1NJGA 2PKRA 2Y1LA 4JL6A 2AXPA 3MAJA 1UEJA 2PK3A 4UUPA 2XNCA 4U7GA 1NASA 1JQAA 1KXZA 4QDOA 3L01A 4PZ0A 4RD4A 5DF1A 1P7CA 1NXPA 2J0EA 3FBWA 3GUYA 4E03A 1LPOA 1YWGO 3ZUPA 2D4HA 2V8OA 2M6SA 4Q9HA 4EG3A 4M7RA 4QQKA 1DADA 4NDZA 5EUBA 4TYPA 1KE2A 4LRYA 1PTKA 2WB4A 3UWDA 2ID8A 3DQPA 3GJ4A 1OZGA 1JQKA 2G63A 3SJ7A 1TTPB 4MQMA 1GKUB 2OVBA 3Q4GA 2P79A 3DJYA 5ER9A 1QFMA 5GQSA 1G2PA 2F8TA 4OK6A 3PFCA 1CJKC 1RM5A 3BC1A 5KKNB 3DFKA 3O3CA 2BD0A 1G1AA 5I6DA 4MCHA 3AVYA 4RZ2A 4YLGA 2A30A 2A5YB 4QO7A 4LZAA 2FPMA 2H18A 2A94A 3I92A 2G9VA 1P7YA 4U8GA 3WGZA 4BFZA 4BVEA 1PJRA 4MPDA 5EE9A 2C83A 3HO8A 3DZ8A 4CM1A 5SY6A 4MPPA 3UNXA 2FYTA 4LY0A 1KP9A 4CLOA 3IVGA 4S1PA 3A0RB 3ND5A 4TMTA 2J3QA 3W7AA 1EG7A 2VXOA 1YR1A 2B7CA 1Z5NA 4UAJA 3EC1A 4F8YA 2YXBA 3PLAE 1ZM3A 2OFXA 1GITA 1ECGA 4N9QA 4KPGA 1N1GA 1BZYA 1Z4OA 3HVRA 2WF9A 5ALKA 3UN1A 3OTQA 3KKOA 3ELYA 1Y8RA 3HGMA 1X1TA 3H04A 4CQJA 5GTDA 4GMKA 2XDWA 5ELMA 4URHA 1NPYA 2GS9A 1LC3A 3KJIA 1AN9A 4A0GA 5AESA 4RTKA 3PCRB 4WTOA 2XVMA 3IEIA 1CQPA 3LUGA 3OZEA 2EBUA 2A1UA 4C4ZA 2OZPA 3ZIAD 2BELA 1E3QA 5IW8A 3IO3A 4D8WA 4EABA 2IS4A 2AOUA 1XA4A 2DLNA 4D8VA 5B1YA 5K8LA 1VPTA 1BDHA 1BDBA 5C1OA 2LCIA 3BMOA 4HJRA 4FNOA 2OD2A 5HPYB 2BSQA 5T4BA 4KI0A 1E1CB 1EJBA 1WUYA 3B1YA 1VL1A 4HG2A 1V6SA 1T36A 2Z9DA 1XLTA 1Y1LA 5DDIP 5GJCA 3BIFA 1G2IA 4FFBA 1SVSA 5D5PA 5HXAA 3O7WA 1GXSB 1CUUA 5AXAA 5JD3A 4OYRA 3FZNA 3R74A 4BZWA 5ITVA 1JTEA 1M2OB 4LCJA 1N5JA 4RVSA 5TMDA 3PUXA 4WZ6A 4I46A 3RFTA 1T2FA 4CKYA 5C1BA 3DDOA 3U16A 1DRJA 1YOVB 4O0LA 5JMPA 4DABA 2BM9A 4B3JA 5LJIA 3GWGA 2IYUA 1SXPA 3CKYA 1ZWKA 2WIKA 3DKIA 3SSAA 2IYNA 1NZJA 1RAEA 2YZ2A 2WHQA 2HKIA 2ZW9A 3FUVA 1CUDA 3GJYA 4TMVA 1SIBE 5EPUA 2RD2A 3TRFA 4PZZA 3CEJA 5JSUA 1V6CA 3II6X 2JW5A 2AQHA 1HFJA 2H51A 1WZCA 3E15A 3L8EA 4IEEA 1AQ6A 4AN1A 1SUEA 2WJWA 3RQIA 4CCWA 5FIUA 1G7RA 2BMDA 3AESA 2HPAA 3KSUA 3MWLA 3D6FA 3AEUA 1R10A 4TYWA 1ZAYA 1K8XB 4EA7A 3M4JA 4QD3A 3W4IA 1Z35A 2PRSA 3QKSB 2VDNB 1CRWG 4UUMA 3E35A 5B6IA 1NDQA 1SHJA 4C87A 2QRLA 4I6JA 5AD1A 3QEAZ 4R9VA 1RRFA 5G1OA 3QK7A 4H7EA 1RC8A 1EINA 3NDIA 1CKEA 1MX1A 2CNLA 4WNCA 3TVTA 4QJ3A 1Q21A 3IQZA 4TUYF 4DNOA 1YH3A 4G1BA 2G9NA 4R4JA 3UB3A 4HFJA 2R00C 1ZEMA 1XZIA 1JA1A 2WP8J 3HVJA 2V0NA 2X7HA 2PT5A 2XMSA 4G26A 3RFCA 3PQ5A 3HXQA 3THWA 3I8XA 3MFQA 3JS5A 1CCWA 4OIFA 5EMKA 2ZBPA 3A05A 3DP9A 4O1HA 1JQDA 3OOWA 4U7TB 5C1DA 2ZYIA 2ZWMA 1SXJE 2PBZA 3D7SA 1JFVA 2Q9CA 3TDMA 2PMBA 1ND6A 3G5TA 1YULA 3KUDA 3IT1A 4UM7A 3VJMA 2PGAA 3FDZB 3PVZA 4PHCA 4C6HA 5IJZA 3U2QA 1OTHA 2A5FA 1KFBB 1Z25A 4LX0A 4OHFA 3BF8A 4OQFA 4L9WA 5AOBA 4DBLC 5EPOA 1RQXA 1X19A 3IALA 5DLEA 4B6JA 1E2FA 2HSZA 1G21E 2P4QA 3UAZA 1H2RS 1KR2A 1XLVA 4OY3A 3EZ2A 4O2BF 3HKEB 2W48A 1P0PA 4JI5B 4MEBA 3G82C 1PR4A 3M7IA 2AI3A 3CA8A 3VNVA 3CBQA 5EJ7A 3DE0X 1V9LA 1QGED 5EL0A 5CT8A 5FEUA 4XGIA 3VZSA 5JBNA 3WIBA 3TFOA 3ZU5A 4CL0A 3HWRA 4Q9KA 3CLRD 3UGKA 2UYYA 5JYDA 4F60A 5IC4A 3KR1A 3HP1A 4PO3X 1BEZA 3TIIA 5FQOA 4EUFA 3GYGA 2XUDA 4MPRA 4NCKA 3SEQA 2HA6A 3EHDA 4CR7A 3AYZB 1ORTA 3PGKA 2FVXA 2NACA 3SBDA 1HFWA 3V1KA 1X1CA 3X2FA 4M3NA 2CJWB 2BEWA 3PDIA 5ALYA 3VRHA 4IDHA 3WRVA 1Q0UA 3JQ9A 4DCPA 5BNIA 3ROKA 4EPYA 2QNBA 2ORYA 5C51B 1JJ7A 3OIUA 1G5HA 1XC7A 1G4AE 4MINA 4PAQA 3UO8B 1GPWB 4YROA 3WX0A 2XUJA 3IOYA 2UV8A 2C7RA 2GN6A 3HK2A 1PG5A 1XDBA 3UOAB 4OJNA 2B6NA 4KQ6A 3D64A 1NXSA 4QNNA 1KSGA 4YLYA 3F5QA 1RKBA 1QHIA 2PX0A 4MW0A 2DZDA 1GR0A 1RQ2A 2NXCA 1UDBA 2XEXA 4Q1DA 2BYTA 2JHCA 3D8UA 1SU8A 1GKKA 1TD9A 4JC8A 1ZRSA 3WYAA 4BPBA 4KWHA 3DKRA 4KKVA 4MUNA 4OGLA 2CD9A 1GNVA 1M2HA 3BF7A 2L69A 2WV9A 3OA2A 4N7MA 3PTLA 2Q07A 3MRVA 4QUKA 3WBKA 3WWPA 2OE2A 5K01A 1J1UA 1J7JA 4JBYA 3I34X 1EFPA 1SHTX 2QMZA 4A0RA 2E55A 3Q3JB 4D3YA 1P1CA 1G3UA 3HHEA 1OILA 4RHTA 2JPDA 2VDUE 1MN6A 1D2MA 2EWVA 4ZDJA 3IQFA 5FLXA 2VJBA 4RDCA 1EMDA 3EEQA 3LT2A 1BFKA 1GNSA 3NDBB 1V5WA 1EAYA 2IPNA 4FWIB 4M1ZA 5C46F 1D6MA 3CKLA 4WV3A 3RF7A 4B83A 2Q3LA 2JLYA 1X1RA 2AOVA 1F2VA 4DLWA 4NZMA 3GV0A 4DG5A 2RK6A 1U63A 1L7PA 4BQSA 5FAKA 4HVTA 4WKGA 5B30A 1T9ZA 3RC8A 2GN0A 3EW7A 4M22A 2Q5IA 5L8VA 4P22A 4FINA 4BFTA 1OYOA 2AF3C 1JKXA 3OUUA 1T2UA 1F8FA 4MVJG 3UXYA 4AYXA 1K5GA 2JFYA 4UBKA 2JRCA 4B7AA 4F85A 5AW0A 2VUIB 4R1SA 4WA7A 3WGYA 3MIIA 1ILEA 3BQNB 5DT2A 2IWRA 4TVBA 4ZHQF 2RE8A 4B7UA 1T0IA 2DY1A 1PW5A 4U2EA 2P9CA 5JECA 2E87A 5G0VA 4XI9A 3SX4A 3FSGA 1JHOA 3CWZA 2WPDD 3ETCA 4Q3AA 4F72A 3VYRB 3BPSA 4KO1S 1MC4A 2Q5HA 3SR4A 3VKUA 2OAQ1 4MYDA 1FU8A 3BHIA 3AVWA 3NC1C 4UAUA 2HSWA 4BO2A 5KNDD 1UC8A 3R7WA 4HDNA 5AVQA 4IMIB 2H4FA 2XZOA 2D0PB 2PDAA 2BRUC 3W1VA 2V5UA 2X0JA 4GRDA 4HS9A 4FS8A 3VISA 4DA4A 2YXLA 3K96A 4M1YA 4BQIA 2PZAA 5ALPA 4CV1A 2IBSA 4KPYA 4ZALA 2NU7A 3SCZA 2YQZA 4HY3A 1KZ6A 3JASA 3PPWA 3RC9A 1NUSA 2WQZA 3OX4A 1VIAA 3K09A 2YVKA 4ZHSA 1A0OA 2ZAOA 4MI6A 1V3VA 4KZPA 4L76A 1PWHA 3WXMA 1X3SA 4N1AA 1T4BA 4GYJA 3AFIA 5D3QA 1R50A 5B7GA 4B40A 3U1VA 4IIDA 3WYGA 1FDSA 4ZYYA 5HW0A 5GP1A 3FY4A 4JBLA 3HDTA 3WYBA 3R9XA 1C8LA 4RPLA 3E9ZA 2GYVA 3QPAA 5M3BA 2PSEA 4FZVA 4HFMA 1MIOB 4L8GA 1YCFA 5DSTA 5SZKB 2VTEA 4ASUA 1UPUA 4DC9A 4DLKA 3C6BA 3FYUB 3P2EA 4ML3A 2QLNA 4RD0A 2NYVA 5DGDA 5KTOA 3HB0A 4QJ4A 3OG9A 2BT4A 4UE2A 2B1IA 3Q5DA 4IVPA 3DZCA 2D2XA 3RUPA 4J3FA 3P71T 1ZK4A 3GDGA 5HQJA 2BFBB 1JFFB 4K6KA 3LQ1A 3WAGA 4Q6WA 3K70B 1CX9B 1JR3A 3KKQA 4FGSA 2ZYAA 5TVKA 4YRAA 5CDSA 5HF8A 1GOTA 1F20A 2DUUA 3DEJA 2ZBFA 4H4DA 1NU6A 1GZ7A 1TEXA 3MK31 1P0MA 2NG1A 2WWWA 4IKPA 4LBVA 3S68A 3UT6A 4EG1A 4TZKA 2QE7D 1YAHA 1L4LA 5COQA 4MVJM 2WM8A 5IUKC 4G41A 3T9DA 2DCMA 1W46A 4OQQA 2Q5FA 5JI2E 2Y4OA 3ZWVA 4D4GA 4C03A 1WDTA 1SBNE 1WKCA 2HU7A 3RF6A 4JXXA 1SULA 1UODA 3H1EA 3A3NA 4MAAA 5BW4A 1UMKA 3PXCX 4QUGA 2J48A 2XE8A 3IERA 3C6XA 5JDIA 2D06A 2NTNA 3WZ2A 3C85A 1R9NA 3F1LA 1GUDA 2O7SA 4IZOA 4WECA 4EKEA 4OHOA 2D8AA 3IBCA 4GD3Q 4WCFA 3BFVA 1KORA 4HDMA 3URMA 4LSZA 3U13A 1ZD4A 3UTDA 2C9BA 3QLEA 1JEYA 3H42B 3ZCRA 2HAEA 1SQ6A 2GZ2A 1QIFA 4EX7A 5HMMA 3QI2A 5B3AA 3R8FA 4IV0A 4NNOA 1BH2A 4YDSA 4BMZA 1MB9A 1Y1TA 4J4BA 2LUOA 3VOBA 5IX8A 4MJ3A 1XEWY 4KQGA 4E08A 13PKA 3EG9A 3PC8C 1L8AA 3ZKWB 1X7GA 3KXKA 3PUJA 4D3XA 5A9SB 3KV3O 4HSGA 2VHQA 1NR5A 2CE7A 3K3PA 4F2WA 4MAFA 1C1YA 2Z0MA 3QVLA 1W5FA 3HBLA 4YQYA 5HCUA 4DUGD 1WCV1 1A3CA 2C9OA 3F8SA 1K4YA 3KQPA 3IOMA 5BNFA 4EATA 1R0BA 3SS9X 3KQNA 1VLHA 2FXVA 2FSIA 2EFGA 2W6MA 3LLCA 3QKRB 4AJPA 3QKWA 1D1TA 4HMQA 3UJ9A 2UYGA 5CT6A 4DMHA 4UE6A 5GZ3A 3WNZA 3DEHA 4Q66C 2Q3HA 4LZNA 1Z9BA 4JNCA 4OQEA 3RKRA 1P6XA 1ODLA 2MR5A 2QTAA 2Z4TA 2JRLA 3LQ4A 3BUSA 1X1DA 1KI8A 3GIDA 3SG0A 4XQEA 3MFYA 3I4FA 3NOVA 4ND5A 1JR4A 2BFCB 1QIGA 1R6TA 2FPOA 2PSJA 4NMWA 1DKLA 1W93A 4U8HA 5CXUA 4QEZA 5IVPA 2LCFA 2FZLA 2Z30A 1UZUA 3ZDEA 1N6NA 2BDUA 5T4FA 2I03A 2ON6A 5H16A 2Z9BA 1R18A 1P4RA 2DH5A 2VBFA 3TZHA 1MZPA 1O96A 2ADOA 4HX5A 4HMPA 2QQEA 2VBGA 1XX6A 3L8MA 2FEAA 4RLQA 2BGUA 3FYTA 1GCIA 3E5MA 5FD8A 5HGJA 4BU0A 5DN6D 4DLZA 4FYWA 5IMSA 4Q4CA 3L84A 1FX0A 3P32A 1M6VB 1Z2OX 4HK4A 2RC6A 1SBIA 4O4HB 1JAIA 1FYFA 1SEVA 4L8LA 2E4VA 2ZEJA 2C5FA 2KSQA 2QLFA 3VU1A 1I9GA 1JUDA 1P0IA 3Q2OA 1FJHA 4DEYA 3CURA 4PG7A 4HQOA 3ICEA 2C4WA 2F43A 4A8JC 1S6YA 1FL9A 1QCDA 4H31A 3I9MA 1VLLA 3GFRA 1B1CA 1TW2A 1Z0JA 2FLWA 3NKLA 2ECQA 1SURA 2OXIA 1EP9A 3Q6IA 3L7MA 1MVNA 4HWPA 5AK4A 1HDIA 3RIYA 1XTJA 4EENA 3R7LA 5GY7A 1SZPA 4GE3A 5IBRA 4BP8A 4F11A 3U3JA 4F46A 2G08A 4JJGA 1Z3CA 8ATCA 5C5CA 1E3DA 5L4SA 1E3MA 2GBLA 1AY0A 5C1IA 1UBFA 3S81A 1GNLA 3H16A 3MXTA 4TQGA 4LGVA 5IM5A 4CM9D 1G5IA 5EEHA 3MOSA 5E6UB 3U26A 1B8OA 1UDWA 3K8OE 4LBYA 4M21A 1V48A 2MSEB 1IBLB 4Z5XA 4O5AA 2O7VA 4J9VA 1SXJC 2X6RA 3PF9A 1SFRA 4M1WA 4E70A 1E2QA 1W94A 4RLHA 4ZCMA 2BZGA 4MO9A 1H0SA 5AI6A 2EGUA 3ETDA 4JZYA 5DI3B 1WZEA 4D57A 1HF3A 5AW8A 2Z5LA 5J4YA 2WNIA 3RGGA 3KYCA 4LE0A 3KZ1E 1G38A 2DPXA 1VECA 3WYNA 4OAPA 4E94A 3CLTC 4XVCA 1I1OA 4LOHA 2V8BA 2DTXA 2W98A 4KREA 4W7IA 4RJLA 1YRYE 1Z6XA 2DBVO 3W9SA 2EF0A 5LQUA 4H6PA 4Q1VA 4U7HA 2VTBA 1IVYA 4GLFA 3RREA 4J8PA 1S2OA 2YNMA 3GZNB 5GONA 1ZA1A 1M67A 3KIPA 2LKCA 1HEIA 5GVRA 4AX4A 4IEFB 2R44A 1KYIA 1QYDA 3B12A 4MWZA 4UKDA 1HFEL 2VHYA 3G6KA 2H52A 4DADA 2Y1OA 4CL2A 3DE3X 1JU4A 1ZGHA 3FFXA 4YJHA 3KC2A 3O4JA 4RJIA 5CX4A 4RL6A 1ZRNA 1EA7A 3A7EA 3PC7A 1E2JA 4Q1CA 5EIWA 1YO6A 3GCGA 5LA6B 4Z2AA 3ZE7A 2V7BA 3TGWA 2FZVA 1L4FA 1OIVA 1FQWA 1OBVA 2A86A 1JPJA 1UK8A 2VK8A 2W93A 1ZMBA 3DKKA 4O4JF 2O4CA 2VEOA 3AU8A 3KUCA 1ZIOA 4B43A 5JS2A 1NJ8A 3S6JA 3ZHSA 3RSSA 3JTEA 4FHCA 4B87A 1QLWA 3UWSA 5LKAA 2I6UA 4XW2A 2P2NA 3M6MD 4JR1A 4JODA 1PHPA 4WUVA 2CVZA 2J08A 3BMCA 4QYIB 1KMHA 1KO8A 1R4MA 2V7GA 3CLVA 1ZVJA 2AGVA 4IUYA 2IZ1A 4M9SA 4GLJA 1RIIA 3AEZA 5BUZA 4EMUA 5DHPA 3DZGA 2ODTX 2Y2UA 4CEJA 1XN4A 3I09A 1GUFA 3K4QA 1AS3A 1QZTA 3LZDA 3PD7A 5FWXA 4E4YA 1JIIA 4A4DA 4HV4A 3T35A 4TVOA 1KK0A 1N6LA 1QIMA 1FLVA 2C8JA 3JWGA 3KE9A 4JZKA 1EBUA 3MCTA 2QPOA 1ZUWA 2ZE5A 4YCSA 1Z6TA 1F4PA 3O31A 5LZ2A 2J45A 1E1YA 3DBOB 2EZ8A 2OVFA 3BFXA 1DEXA 2QTVA 3EXG2 4HPWA 4M1EA 3WFIA 4COKA 4RULA 5CFPA 1IXRC 1WXHA 2BVNA 1HOTA 1ZM2A 3EIHA 2WJHA 3GROA 4JJ7A 3JZIA 5I7WA 4IHQA 4J0JA 3NP9A 5EP3A 5JMWA 1EJ6A 3SZ3A 4IWYA 3RT9A 2HW8A 1D09A 2IK8A 1P3JA 3AJ9A 2EL9A 2O7RA 2PVPA 1ECLA 4Z49A 2WVHA 4GP6A 1TU4A 1Z4JA 2QRZA 3EN0A 1PYOA 2D3TA 1NW9B 2ODPA 3FOAA 3P9QA 5B1DA 3EMDA 4NU0A 3RVDA 5ILGA 1QFJA 4JK3A 4BEBA 1HYHA 2QSUA 1KO7A 4L74A 1BNCA 2CFSA 3GN2A 4JEMA 4DNPA 4YJGB 3I6QA 4B84A 3DL0A 5ISMA 4FHZA 2Y99A 2BFWA 1AQYA 1Q12A 2F17A 3AMVA 2H1SA 1ESMA 1U2DA 3EF0A 4G0XA 2NO0A 3KTAB 4R68A 3T8YA 3W9YA 4KXYA 4CKBB 1CEXA 5I9TA 4WPGA 4G4JA 4KSYA 3UJ8A 3RNLA 2FSFA 4WZBB 4YJ3B 3LXUX 4MV4A 3HVKA 3RVPA 5B36A 1RM0A 1WDWB 4XM0A 5ILQA 1JJAA 1DXYA 3V1YA 5AXBA 2NUTA 3K2BA 3OQPA 4I5GA 4JXZA 3F7MA 3TZCA 3R4VA 3NVDA 5G02A 3IMCA 3REOA 2OBNA 2TSYB 3BWMA 5JSZB 3MJCA 4RVDA 1IHXA 3GCWA 3KKPA 4JBNA 2R1VA 2VN8A 3PHGA 5T7BA 1T2NA 2WMYA 4INJA 621PA 2GD2A 2MYNA 3CF0A 3NOXA 1E7RA 3F4LA 4AT1A 4DFDA 3FCSB 1SD1A 2FPUA 1X3LA 4PXAA 3IXQA 5LU9A 2QMHA 2H16A 5B3LA 3OQ6A 4CIAA 2HHJA 2ZROA 3PP8A 4XGRA 3IUSA 5TPWA 2FFHA 1X6VA 4G86A 2I71A 5HFAA 4RD3A 5KX5B 4FMPA 5A71A 5IBPA 4RA6B 5HNKA 4AUKA 2C5LA 2DFDA 2AJBA 1FLAA 3R4CA 1RP7A 4KE6A 3DTVD 4KE7A 1R64A 3PIDA 5DBIA 4B9AA 1ZD1A 2YJ4A 3GLIA 5K0EA 4NNPA 3WK8A 3L8ZA 5LOVF 1IAQA 3W2EA 5A7HA 1F7UA 2I34A 3OLVA 1KC1A 1A8IA 1ZC3A 4NK4A 5K3DA 1ZK1A 2IS2A 2QRVB 2ES4A 4EMSA 2GCEA 3OPYA 4QUAA 5F2OA 4LXTA 2X8JB 1CJSA 4FEYA 4JAVC 2X4LA 1EVQA 2IEYA 4P4LA 5JAHA 4C01A 5JAZA 1TPYA 2QLJA 3N87A 3AEKA 1W88B 1M7BA 3NJRA 5PNTA 1NDHA 2DR0A 4GZLA 4MWTA 2PFSA 1ORWA 5K09A 4D3SA 3RTGA 4XFKA 1EXVA 1DFGA 2W6ZA 2QU7A 5JH7F 4PXSA 5FDFA 2P40A 1EGQA 2PEZA 3R5SA 1BAPA 1ZNQO 2IXBA 4OI4A 3EVGA 5KYUA 3S2IA 3JRNA 3HFSA 1WW8A 2X1LA 2QMYA 2ZBVA 4FJ0A 5EHXA 1COWD 3KQWA 3TZKA 1XKTA 3UEOA 1I2MA 1GRRA 4U63A 5KO2A 4PZCA 3F9IA 4QJBA 1RDFA 1G3RA 2QR2A 1KDTA 1SKQA 2BBSA 1XDGA 5A2GA 1UADA 2FTKE 3PFFA 2J5KA 4BNXA 1QCCA 3M9XA 5TDHA 1GYPA 1UMCA 3ITNA 4RVGA 3WLKX 5JSQA 4B4WA 1JAXA 1RVDA 2FEPA 5D7NA 4H7PA 5BQFA 1FFXA 1CVRA 2I3ZA 2PUFA 1QDLB 3PXDA 4ZGWA 4A15A 1X1EA 1SB9A 3P1JA 1WW2A 4EG0A 2IHVA 5DM60 4IQ0A 3SEAA 1C81A 5KQRA 1IUKA 1P8JA 1VKNA 1Z7BA 3DE7X 2KYRA 3QF4B 4L6CA 5LBUA 2JLXA 1IBKB 3S70A 4UBNA 2YDXA 4IDQA 5E0KB 1V1RB 4UTVA 5IAJA 1ZGAA 1SVWA 2BMWA 3GVHA 1JHQA 3VSBA 3FOWA 4UEWA 3PC6A 1II9A 1GGFA 3S7TA 2QL7A 5F9HA 3BRCA 3A3KA 1YHZA 3NRBA 4I50F 3RSOA 5JBQA 3T3GA 1XAIA 4UFPA 3CVVA 3NIFB 4QQRA 4OLAA 5DLQC 4AKSA 1F0YA 2EFYA 1E2UA 4M9QA 3AR9A 4AU1A 4ZCLA 1QTIA 2EEZA 4A91A 1ZONA 4ZGGA 2H2HA 2ZUWA 3CONA 3GLKA 1NQVA 4GI2A 3HRKA 4MUAA 1CQWA 1NR1A 3N0WA 3RVMA 1W4ZA 3D7LA 4WGFA 1YBMA 1V8ZA 3B52X 3ILVA 1W44A 2NPIA 3TX6A 4N5NA 1KWKA 1NW3A 2H7XA 1RAHA 3ISJA 1TQ8A 2X8LA 1S3FA 3B3FA 3H9EO 1LBIA 3MINA 5CURA 3WRXC 3KZOA 4DR5B 2WTBA 4V24A 4HFRA 1KFKB 2OPBA 4N9WA 2O20A 4EYQA 4G1CA 3N2LA 4ME6A 2XZLA 3LOPA 4I55B 4LK3A 4RLFA 3T3NA 3DOOA 2GRJA 2PSHA 2H31A 2JDIA 1SA0A 5L4NA 4X63A 2ZE6A 4L2IA 2XSZD 2ZTUA 1M1NB 4KFUA 2QNRA 4PCLA 3M5PA 2RHRA 3G5LA 5EPEA 3F3YA 1XCPA 4OSEA 4R1NA 2WF5A 3NRCA 1Q1GA 2CXQA 2VYND 3GQBB 5CK4A 1RQPA 1NI5A 3G0HA 3VMFA 3BKXA 3HUDA 1KQFA 3D5EA 2O2GA 1MFZA 1I01A 5AVJA 1IY2A 2NSDA 3TR5A 3ZHYA 3BILA 2HT1A 2HMVA 4B6QA 5JS8A 1EFDN 4A3SA 3H4VA 2SICE 3ESBA 2DLDA 4HGQA 2RH8A 3A2MA 4KYVA 5CU7A 5CVVA 2OLKA 4XGNA 3EG5A 3PX3A 1GKLA 2OCXA 1NIPA 2PWPA 3K1TA 4GC9A 1E0SA 5JQGF 2Y66A 4UZEA 1H3FA 3NLLA 2FE1A 3N2KA 2VJOA 1VPEA 2J30A 3A1SA 1NM5C 3E2PA 2YWGA 2OSBA 4PHGA 3FI9A 3ZBTA 2L2QA 5IEBA 1HE5A 1ZJZA 4DEVA 4DV1B 1ENZA 2QX7A 1IWPB 4H17A 1EM6A 4HEJA 3VR3A 2O5CA 3JALB 2XE7A 1O57A 3PT9A 4X65B 1JU3A 2QYTA 2FQ1A 3BWBA 4G1VA 1CLEA